5IZZA

Crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157, triple surface mutant k158a_k223a_k313a) in complex with metahydroxyphenylacetate, thermal exchange of ligand
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
318
structure length
318
Chain Sequence
EVVLKFHSFPPMPANSNAKFVKPWSEKVLAESNGEIKVEIYPAMQLGGKPPQLVDQVRDGVVDIVWTVAGYTPGRFPHLEAFELPFMPASAEATSQALQEYVDTVAASDLKDYKVLAVFCHAPGKIHTKEKVIASAADLNGMKMRGPTRVITKMLEGLGATPVGMPVPAVAGALSKGVIDGMVVPWEIMPSFKLHELTAAHTTVSGSRGLYTTPFLFLMNKAKYESLSDEHKKVIDNNAGLALAKLAGQLWDGFEVPARKLALDAGGTIHSLSGGPLAEMKAAGEGLEADWIKSANDRGLDGAMLVKTAKDLISKYDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP TRANSPORTER SOLUTE BINDING PROTEIN
publication title Crystal structure of a marine metagenome TRAP solute binding protein specific for aromatic acid ligands (Sorcerer II Global Ocean Sampling Expedition, unidentified microbe, locus tag GOS_1523157, Triple Surface Mutant K158A_K223A_K313A) in complex with metahydroxyphenylacetate, thermal exchange of ligand
rcsb
source organism Uncultured bacterium
total genus 121
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2016-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5izzA00
4NAPA 2V4CA 2ZZVA 4PC9A 4OVSA 4NGUA 2VPNA 4PETA 5I7IA 4NN3A 2XWIA 4OVTA 4LN5A 4P8BA 4MAGA 2WX9A 2ZZXA 5LTCA 4N91A 2HZLA 4XEQA 4PE3A 4XF5A 4P47A 4PDDA 3U65A 4YICA 5I5PA 4MCOA 2WYPA 4P56A 4PCDA 2HPGA 4MHFA 4DI3D 4PBHA 2XWOA 2XXKA 5CM6A 4X8RA 2HZKA 4MNPA 4NF0A 4P3LA 4N8YA 4OVRA 4PBQA 4PFBA 4P9KA 4MNIA 4N6DA 3GYYA 4OVQA 2PFZA 4N8GA 4O8MA 5IM2A 4N6KA 4PGNA 2CEXA 4X04A 4P1EA 4PAIA 4PGPA 4OVPA 4YZZA 5IZZA 2CEYA 4PFIA 4MX6A 2XA5A 4NHBA 4N17A 4O94A 4OANA 4PF8A 3B50A 4NQ8A 4DI4B 4MEVA 4NX1A 4N15A 4UABA 4PAFA 2ZZWA 4N4UA 2XWKA 4MIJA 4PF6A 4P1LA 2WYKA 2PFYA 4OA4A 4MMPA 4NG7A 4MNCA 4O7MA 3FXBA 4XFEA 2VPOA 5IGAA 2XWVA 4PFRA 4PAKA 4PDHA
chains in the Genus database with same CATH superfamily
1B3HA 4OVSA 5IAIA 4I3YA 1SBPA 2PBWA 5ITPA 3ROJA 2AIXA 4YB6A 4OVTA 3M3KA 1FPEA 4MAGA 1KWHA 3H7MA 3OO9A 4YMAA 3C31A 3MC2A 5M2VA 1MQIA 3IAZA 3MP8A 2CMOA 2F7CA 2HZKA 1PB9A 2QS2A 5I58A 1R6ZA 4FAJA 1XS5A 5EHSA 5AA2D 3ODBA 5TPAB 1DSNA 1P1WA 1PBQA 2QS3A 3MWBA 1Q1KA 3T96B 3GYYA 1H45A 1NNPA 1FBDA 2DE4A 5IM2A 4X04A 1LAXA 4LZ7A 1UIVA 2OJTA 1Y3QA 3S9NC 4LZ8A 1FPIA 1NUYA 4WXJA 4ECFA 3H6TA 1UTBA 5A5LA 5BUUA 4QSDA 3BKIB 3PD8A 3ECRA 3Q28A 1LAFE 1QJMA 3UIFA 2A5TB 4F19A 2DE2A 2HAUA 1EYJA 5DVFA 2RCBA 3EHSA 1NV3A 3MBPA 4PC9A 3ZKKA 1IMBA 2Y5LA 4NMYA 3L6HA 5EYHA 3RY3A 1AMFA 4LN5A 5FBPA 4G61A 2F34A 4RY1A 1EYKA 2WEFA 5EQ7A 2UVIA 3DLNA 5DEXA 3E9XA 2PT1A 2Q9TA 1B2HA 1QUKA 2I0BA 4Z0IA 1LCFA 3PU5A 1LBYA 4FBPA 3HSTA 2I6EA 1AOVA 5ESYA 4KFQA 3H03A 4KCDA 4TLMB 4NF6B 4RPOA 1PB8A 1JW1A 1Z7NE 3IX1A 1FPKA 2DVZA 3TTNA 3OEMA 3RQTA 2DDKA 3IL1B 2ANJA 5L9OA 4YU0A 4HXVA 4OESA 4R2BA 1G0HA 4GX3A 2M8CA 4ZEDA 4DXUA 1FW0A 3QSLA 4G8HA 1H3DA 1NNFA 4ELQA 4DE8A 1VFEA 4F2OA 5TP9B 3FVOA 2B65A 4RPNA 2F78A 5ITOA 1LFHA 5HPQA 2UVHA 4IB2A 1S9TA 2RC7A 2W7YA 1MXWA 4QFPA 4O7MA 3K00A 2VPOA 4H65A 3LUZA 3T93B 3IO4A 5TPAA 4EF1A 4NGUA 3K0VA 1SI1A 1VR5A 4Z7EA 2P0SA 2XWIA 2P1SA 4GWUA 4PTKA 3VLUA 2V84A 1ZBMA 1JP4A 4XKNA 4AQ4A 1EZOA 3K1PA 4AB5A 4GFRA 4I8CA 3TYHA 1BP5A 2H9BA 4P3LA 2I3VA 1R9LA 1N84A 2AL4A 2LAOA 1MXYA 3LSLA 1MG1A 5TU0A 3S9LC 5CMKA 3HO7A 4F1YA 1SW2A 1JNFA 3KN8A 4O3AA 4IY5A 2NUVA 1YCJA 4YAHX 1A54A 1LAHE 4NWCA 4GBVA 2FBPA 1FJ9A 3IOUA 3VLWA 2XXUA 5K2XA 3PUZE 1H76A 2FA7A 5KCJB 1FBHA 5JEIA 4ISUA 3DELB 1B05A 2YJPA 4H45A 2ONSA 1MH3A 3T9HB 1K9YA 3S9MC 3MJNA 2H5YA 5EQ8A 3C9HA 4YKJA 3LV0A 1T0KA 4OA4A 1JW4A 2QFLA 3C32A 2GH9A 4JWOA 4XFEA 5F1QA 4Q5TA 3LBSA 4ZEFA 4KR5A 3H4ZA 4PFWA 2V4CA 3N6UA 1VDWA 1XOCA 4NF6A 4HTGA 3FVKA 1MY4A 2P2AA 3TZAA 1P1QA 2YPNA 1XVYA 5I57B 3V8XB 4DIGA 2HZLA 3LC8A 1KA1A 3U65A 2NWJA 3MQ9A 2WYPA 4P56A 3N6TA 2IEEA 3G3GA 4F3SA 1QVSA 2XXQA 3A29A 3KGCA 4QSCA 2DVCA 3Q29A 1Y4CA 1SW5A 3IB1A 4IY6A 1N3WA 3A3CA 4OVRA 4PFBA 1M5EA 5TP9A 5H8HB 2GQ1A 1AWBA 3Q25A 2G29A 1OQGA 2CZHA 4OVQA 3MZ9A 4N8GA 3L6GA 3OO8A 4MF3A 1KA0A 2Y5KA 5I59B 5FTHA 1B9JA 4AB6A 2Y7KA 1ELJA 3FJGA 4HE1A 3IORA 4QFKA 3TUSA 4GWSA 2ZYKA 4O94A 3KBZA 4QF9A 2R9JA 2XXTA 5L9MA 2P3NA 1OQHA 1DOTA 3SDFA 4N4UA 4ESWA 4TLLB 3CIJA 1FBGA 1QUIA 1DBZA 2V25A 3QXMA 3LR1A 5J1DA 2VOZA 1UTHB 1FPJA 3RYDA 1WODA 4OETA 4H67A 3K02A 4FIMA 1FTMA 4ELRA 3U94A 5DVIA 2ZMBA 3O97A 1B3EA 5B7DA 2PT2A 2FIEA 1MY0A 1S50A 2E0SA 1XVXA 2F6PA 4U22A 5HM4B 4OERA 2XXVA 2WBBA 4MLQA 3G3IA 2RC9A 2H25A 3ZSFA 4PCDA 1B1HA 4GLIA 4G77A 2UVGA 2XX9A 1FTOA 4M4GA 5KCJA 1EZ9A 3Q27A 3TAJA 2E1SA 4Q30B 2Q2AA 4C1UA 3HHGA 1MM6A 5ET8A 3RNNA 1TT1A 4LQ2A 3UA8A 4N6KA 1F9BA 3KBRA 4KD5A 1Y3NA 1NV0A 4PAIA 3ISPA 1B1XA 2DE3A 2Q88A 3D4CA 1DK4A 1USYE 4GL0A 5L8DA 3TDJA 1P1NA 1QULA 3JYRA 4GWXA 3KSJA 4NEDA 4ZDMA 4G4PA 3CSGA 3U8QA 1ZJLA 1LLSA 5I57A 4BDNA 5ICQA 3OO7A 3U93A 3UGWA 4XKQA 2XXRA 1FQEA 4PFUA 1INPA 1BIYA 3DP6A 3MPKA 4NE4A 2XXWA 2ONRA 3KN7A 3TFLA 1B4ZA 5CMCA 1D9QA 1PC3A 5H8HA 4EQ9A 1RYXA 1LBXA 4X1BA 1IIWA 1IUDA 5H8NB 2QVUA 1ZLQA 5I59A 4PE3A 5AA2A 3HHFA 1R9QA 2Y7RA 2KQZA 4G68C 1H43A 3IB2A 3FVGA 4RA1A 4F29A 1MM7A 3CR9A 3TEPA 4NF0A 1EH3A 1VE4A 1IMCA 1US4A 3MZ1A 3FV2A 2XX7A 1SVXB 4KQPA 3IOVA 4KHZE 1OIBA 1AIVA 1RYOA 3PUYE 2F7BA 3RT8A 3K1NA 5B70A 1UTHA 2QSXA 3O28A 3KZGA 1NI9A 3FBPA 1B3GA 5ET5A 5I3SA 2O51A 1FBFA 1Y9UA 4N81A 2Z8DA 4YB5A 3VXBA 3ZKLA 2DQVA 4MH5A 4N17A 1GVCA 3TTLA 2PVUA 3USDA 4F39A 4NQ8A 1MXVA 1ZU0A 3RN8A 4NX1A 1SYIA 4UABA 1RKMA 1Q9DA 1B0LA 5DW8A 3M8UA 2Q74A 1HSEA 3SERA 1DCUA 2XXHA 1XI6A 5KZTA 3MVYA 3CSBA 1FPLA 2AL5A 4F18A 1PB7A 5ET6A 1XT8A 4GL8A 4QFLA 1MY1A 1R1NA 1NMUA 1HSJA 2XXYA 3C35A 1DMBA 4LQ5A 3HPIA 1NH7A 1FTKA 4KYSA 2XXKA 2ZYMA 3KJTA 2Y7IA 4KPTA 2ZNUA 2F97A 4JVCA 1SYHA 4Q0CA 4BLAA 4DLDA 4OYVA 1B3FA 3S9EA 2PFZA 4YKIA 1FPGA 3RGYA 1GR2A 2R6GE 3SZPA 4JWYA 3MUQA 1TFAA 2PYYA 2O1MA 2XXXA 5H8QB 2DWIA 4GX6A 3TQLA 2REJA 1PDAA 1PEBA 2OBGA 4I1DA 3KG2A 2I58A 4PF8A 3T9XB 4DDDA 5H8NA 3B50A 5DYHA 3RTWB 2MKZA 2FNCA 2XHDA 4DXCA 1FPBA 4N15A 2RINA 3TCFA 3R6UA 4BDLA 2XWKA 2OX3A 4NG7A 3OENA 4WEPA 4IO4A 2XWVA 2IA4A 1SQYA 3QYTA 1B7ZA 4PAKA 4PE5B 2JJKA 5IKBA 2DS9A 1ZIUA 1FQFA 3UN6A 3BFUA 1IZ1A 4EDPA 4AS4A 2V3QA 4MFIA 5DT6A 3W9VA 4BDQA 5LTCA 3KOTA 4XEQA 4XKRA 2ZNSA 4YMBA 1RDXA 1O7TA 3HCQA 3K01A 4GXSB 1NNTA 5EQAA 4ELPA 4ZE9A 4MHFA 3G3FA 2OWZA 4X8RA 3VFJA 1XC1A 3EF7A 3OD7A 1D3KA 5CRYA 3THIA 4P11A 4U23A 2CZLA 2O68A 4P0GA 3IK6B 3CFZA 3SKPA 4P9KA 3BIHA 2I4BA 2VGQA 4FE8A 4N6DA 4U1ZA 4HCWA 4FEDA 5FHNA 2OWSA 1GGGA 4LONB 1MDQA 4WKMA 3KSXA 4BDRA 1BTJA 3MAMA 3VVEA 4OVJA 1ZMGA 2QMWA 1NV4A 2XA5A 3Q26A 5CI5A 1B7HA 2I49A 2GHBA 3WAFA 1N0TA 3C33A 3ONMA 5HBCA 1DTGA 5AA1A 2A5TA 4WEDA 3ILUB 2ONKE 5T3JA 4E0WA 4I9DA 4GD5A 3CI8A 1CB6A 4YB7A 1GTKA 4PF6A 3EN3A 3FATA 4GWWA 3B8BA 3O6IA 2FHYA 2Y7PA 1FQCA 3P7IA 4O3BA 4OMBA 4ZZAA 1EZPA 4NF8B 3FXBA 3E79A 1KZ8A 4PFRA 3KEIA 3SEWA 2UXAA 3TTMA 3CVGA 2ZZVA 5JTYB 2WBDA 1LB8A 1LBZA 2F8DA 1EU8A 4IO3A 2NXOA 2PX1A 2H99A 3PD9A 1FJ6A 1FRPA 2GHAA 2VT5A 1N76A 1A7LA 1Y1MA 5H8QA 1GV8A 1ATGA 3N5LA 5AA4B 1D4NA 3H6UA 4QFNA 1SPIA 1FTLA 2QJEA 4DI3D 1Y1ZA 1FPFA 2RKMA 4I40A 2V3TA 3MW0A 3T9UA 3QAXA 4R6YA 2ZYOA 4NF4B 3D1RA 3IFCA 3GBBA 3EHTA 3N94A 4XXUA 3PMXA 1D9YA 5I84A 4O7IA 1WDNA 4C0RA 3D4GA 3OEKA 4PFIA 5BWJA 1B40A 1VFDA 4U21A 3FXRA 2RC8A 1URDA 2HHMA 2HEUA 3GLBA 3MVXA 1TXFA 3FD3A 3K2DA 3SESA 2B3BA 1IXHA 4TOZA 1LBBA 2DWHA 5ISUA 3TELA 2HXWA 2THIA 3PUWE 4QFOA 2G93A 3MPLA 4OEUA 3K6WA 3QUFA 2PFYA 1UIUA 4GOTA 2Z8EA 3B6QA 2F3BA 2DXYA 2HAVA 3LSFB 3U72A 3SEXA 5CBSA 3LSWA 1BLFA 3I3VA 4L17A 4KI0E 3PPOA 2VPNA 5I2NB 2BJIA 1SDXA 3U92A 1FQBA 1LBWA 3RT6B 4OQOA 2YLNA 3RTFB 1B4HA 2UVJA 1BK4A 2Z8FA 4XIGQ 2QVVA 1ZKBA 4P47A 3VE1B 5I5PA 3K6UA 2HCAA 2XD3A 4KCCA 4JXIA 2R8TA 1YZ0A 4MNPA 5ET7A 4MLVA 4X48A 4R9GA 4X9TA 1B58A 1B7UA 4KYEA 1MQJA 1WVJA 2WKYA 1I6QA 3R7XA 3O6GA 4GQOA 3K1MA 3KC1A 2QS4A 4UACA 1MS7A 3VLVA 2CEXA 1B5HA 1A55A 4NF8A 5LDZA 1FQDA 3IO6A 3TCHA 1A8FA 3FIRA 5JTYA 3HV1A 3E78A 1FBEA 1LB9A 3MP6A 4BDMA 3OELA 5CBRA 4N13A 5CMMA 5J16A 2DOJA 1YAEA 3BFTA 1SI0A 4EUOA 3EPEA 3B6WA 3CFLA 4IO6A 5AA4A 1PBPA 4OWDA 4HE2A 3E13X 2O1LA 4AS5A 2HQ0A 3S2VA 5LOMA 1P1OA 5FHOA 3OO6A 4LZ5A 1II5A 4NF4A 3SEVA 1N3XA 1I6AA 2DSFA 3T0JA 4ZECA 3K6VA 2WX9A 4R74A 2V93A 1LFIA 1SD3A 1B0HA 4YKPA 3RUMA 1IMAA 1YTVA 5F24A 4DCXA 4U1OA 1MQGA 2Y84A 4HS7A 2QVRA 3FGSA 4F3GA 4JWXA 3BBRA 4GXAA 4MNIA 1H44A 4HW8A 1P99A 3KOSA 3IOTA 4PFYA 4FATA 4OXVA 1NUWA 1I69A 3ZS6A 1JVXA 5L9SA 2OLBA 2OCUA 4EXKA 4G68B 3K4UA 3VVDA 4PGPA 4FEBA 1Y3PA 4IGTA 5FTIA 4DCYA 5EHMA 5CC2A 4H8IA 4OTEA 2VD3A 3KFMA 4R2FA 3TTRA 1DPEA 1G0IA 2OK2A 3IFAA 4LVQA 2KR0A 2UYEA 3SETA 5I2NA 3E4RA 3I5OA 3PPNA 1OMPA 1IQ7A 2CZKA 2ZYNA 2O6AA 4R75A 4ZE8A 1I6BA 2QS1A 1B3LA 5DVJA 3S4UA 4DXBA 1Y20A 1POY1 1FCKA 5F7VA 1MRPA 4FORA 4DZ1A 4MIJA 1NV2A 3K6XA 1NL5A 3VDFA 5AA3A 3GXAA 3PGFA 4PP0A 3M3FA 3O2AA 3LSXA 4EQ7A 5FHMA 4GWYA 4QSEA 1IMDA 1A8EA 3HN0A 3TTKA 2F36A 3UK4A 3R26A 4H0WA 3A09A 4JSOA 5H8FB 2QMXA 5ELVA 5CMBA 2ALUA 4ZS9A 4F2QA 1LBCA 2AYSA 4PDDA 4MJOA 1IITA 4F3BA 1J1NA 4MCOA 5EYGA 3IJOB 2P3VA 2B4MA 2HPGA 1DPPA 1MPCA 3EQ1A 1MPDA 3VVFA 4JVDA 2Q8MA 2CZIA 1M5DA 4PBQA 3MVWA 3PMWA 1L5TA 3RLFE 4U4XA 4JSDA 4H6DA 3PPPA 3UP9A 2F35A 3DM0A 3ILTB 1QW0A 2F7AA 1CE2A 3CFXA 3GBAA 1B5IA 3MSTA 5I2KB 2I3WA 1QGXA 1LSTA 2DYXA 3G3HA 1SW4A 3B6TA 3OXNA 3PUXE 3TQWA 1NV6A 3PMVA 4LA9A 3H6VA 2KLFA 3RPLB 1NV5A 1US5A 3MP1A 4DI4B 2GFEA 4MEVA 3OSRA 1RDYA 3C34A 5I56B 1B51A 1S7YA 2DP8A 1POTA 2QRYA 3G7WA 3JZJA 3T9VA 2ZXTA 4R9FA 1MY2A 3SEYA 4C1TA 1YXIA 1LGBC 3C36A 2Q89A 1TWYA 4NAPA 4RK9A 4QHQA 4IGRA 4RK2A 3V5AA 1A99A 4H8JA 4I3EA 3IOWA 2X7PA 1LBVA 3IJXB 3FJ7A 4ONYA 2DWAA 2V3UA 3IR1A 4G68A 3UORA 4GIZA 2I48A 4O3CA 3LUYA 4R6KA 1Q35A 5A5XB 1QKBA 1DTZA 1LEVA 1N7XA 1AL3A 4NF5B 4PBHA 2PMSA 4EXLA 4F1VA 3C4MA 3DP8A 1MXXA 3RPWA 4ESXA 1OVBA 1BKAA 1XHYA 2QPQA 4PFTA 3O29A 1B32A 1B6HA 4XTCQ 4U4SA 1QKAA 3W9WA 4RNSA 4LATA 3B7DA 4O8MA 3H6WA 4PGNA 1NKXA 2I4CA 4X1DA 1OLAA 2FYIA 3F11A 1B5JA 3A3UA 3PTYA 4R6HA 2F5XA 1MH4A 4NHBA 1NFTA 2REGA 1VSOA 1JQFA 4ZEIA 4OANA 4ZEKA 5H8FA 3VXCA 1K9ZA 2O7IA 2XXIA 4POWA 2XXPA 3FUZA 1NNKA 1UQWA 3O9PA 1EYIA 4HE0A 2D3IA 4P1LA 3FASA 4THIA 4ZEBA 4FJPA 3IB0A 4MMPA 1LFGA 4E0XA 4MNCA 3W15C 4JBZA 1NV1A 5IGAA 3AXFA 5AE4A 2A5SA 1OVTA 3PPQA 2Z23A 3VV5A 1IXIA 2RCAA 2VP1A 4GWOA 1MY3A 1ANFA 3O6HA 4PETA 1FTJA 5I7IA 4R73A 4UA8A 2ESNA 4OHNA 4KXPA 4MBPA 4N07A 4P8BA 2D5WA 2ZZXA 4LUBA 4LP2B 4FECA 1JEVA 1Z7ME 4NWDA 5I2KA 3U1OA 4M1VA 2HFBA 4EQBA 1B52A 3MVZA 2RF1A 1IEJA 3NOHA 3RPLA 3OSQA 5I56A 1NUZA 2B3FA 1M5BA 5IZZA 2DWJA 1HSLA 3O66A 4QBAA 5IZ3B 4H5GA 4N6PA 1SW1A 3CG3A 4OFOA 1O64A 1NV7A 1MPBA 4GF8A 1TFDA 3TMGA 5A5XA 2FVZA 4OEVA 4P0IA 1NUXA 1IXCA 5DTBA 4NF5A 4G8NA 1B46A 1NH8A 3FVNA 2Q8JA 4ZZEA 4PDHA 3FZVA 3CRBA 4ND9A 3KN3A 3QMFA 4GBWA 3PPRA 3OOAA 3E3KA 3TKDA 3EHUA 4NN3A 4F1UA 1D9VA 3KC0A 2D21A 4N91A 1A40A 1MQDA 2H98A 5KDTB 4H5FA 2Z22A 4IO7A 3WAEA 1MDP1 4XF5A 4GRKA 4H46A 4HCYA 1URSA 1IMEA 2ZNTA 3H3GA 4I62A 4NTLA 4EF2A 2XWOA 4H1XA 4K3FA 5AA2B 3TCGA 1M5CA 1IMFA 1QUJA 2NVUB 1Y4TA 2H4IA 4BDOA 2F3DA 1URGA 2NOOA 2QL3A 1IXGA 4G8MA 5K2YA 3MYUA 2VD2A 1FSAA 2X7QA 1CNQA 4JDFA 3EKIA 4JB7A 4RYAA 3FXUA 2R71A 5IZ1A 3FXQA 5EYFA 3TPAA 1JVYA 3QK6A 3BIGA 3GZGA 4XKPA 5I58B 4KYDA 3T1BA 3I6VA 4TQUQ 1OLCA 4OZ9A 2ABHA 1MXUA 2ZZWA 3KJ7A 3QUJA 3CG1A 4Q8RA 1JEUA 1AH5A 2WYKA 4RJZA 1MXZA 2XX8A 2L5VA 2O84X 4IO2A 2Y7WA 1FQAA 4OFLA 1YYZA 2F6GA 3T66A 2B4LA 3G3KA 1FBPA 4POXA 2O69A 1N04A 3HFUA 4IO5A 3DP4A 4IR8A 1UTBB 2Q2CA 1YPNA 2GRVA 4OENA 1JW5A 3JV9A 3SEUA 4YKKA 1JETA 4QRZA 4R72A 3MZBA 4YICA 4RXLA 5IZ3A 3N26A 2I0CA 4ELOA 4F3PA 5ICTA 5CM6A 3TODA 3H06B 2XD2A 4GVOA 4OFJA 4F31B 4N8YA 1ZTYA 2X26A 3M3LA 1FTAA 4JVIA 1N7WA 4G2ZA 5H8SA 2O7UA 3V89B 3PUVE 1FBCA 5EQ9A 1M5FA 1LCTA 2PCRA 4P1EA 3QIMA 4OVPA 4YZZA 2CEYA 4U2RA 4MX6A 1RDZA 4PQJA 3CHGA 5DEXB 1LAGE 2UYFA 1FPDA 3FV1A 1P1UA 1O63A 2VHAA 4F22A 2BJJX 5KDTA 3OMBA 4GWZA 5JK4A 2HXRA 2OZZA 1MQHA 4PAFA 3G3JA 2DXRA 3FJMA 3PV0E 2OWTA 2FIXA 4GX4A 1USYH 3T22A 3V83A 4QXDA
chains in the Genus database with same CATH topology
4NAPA 2ZZVA 4OVSA 2WBDA 4I3YA 1LBZA 4I3EA 3ROJA 1LBVA 2FIEA 1FJ6A 4OVTA 1FRPA 1FPEA 2VT5A 4MAGA 1LEVA 2WBBA 4PCDA 1SPIA 4DI3D 4PBHA 1FPFA 4I40A 4F1VA 2HZKA 3D1RA 5ET8A 3IFCA 2QPQA 3GYYA 3W9WA 4O8MA 5IM2A 1FBDA 2DE4A 4N6KA 4PGNA 4X04A 1NV0A 4PAIA 3ISPA 4O7IA 2DE3A 4PFIA 1FPIA 1DK4A 1NUYA 3PTYA 2F5XA 4GWXA 2HHMA 4NHBA 5A5LA 4OANA 1K9ZA 1EYIA 4HE0A 4P1LA 4F19A 2DE2A 1INPA 2PFYA 4MMPA 4MNCA 1EYJA 1NV1A 2F3BA 5IGAA 1NV3A 4PC9A 1D9QA 2VPNA 1IMBA 1LBXA 4PETA 2BJIA 2Y5LA 5I7IA 5EYHA 1LBWA 4KXPA 4LN5A 5FBPA 4G61A 1BK4A 4P8BA 2ZZXA 2QVUA 1EYKA 2WEFA 2QVVA 4PE3A 4P47A 5EQ7A 2KQZA 5I5PA 4M1VA 2Q9TA 2R8TA 1YZ0A 4MNPA 5ET7A 4NF0A 3NOHA 1LBYA 4FBPA 3RPLA 5ESYA 1IMCA 4X9TA 1NUZA 1FPKA 2DVZA 3KC1A 2CEXA 2DDKA 5LDZA 5IZZA 1NI9A 3FBPA 4HXVA 5ET5A 5I3SA 1G0HA 1FBFA 4N81A 4GX3A 3E78A 1FBEA 4QBAA 5IZ3B 5J16A 4N17A 1NV7A 4NQ8A 4NX1A 2FVZA 4UABA 1Q9DA 1NUXA 5DW8A 4HE2A 4O7MA 2Q74A 4AS5A 2VPOA 1DCUA 3LUZA 4PDHA 1XI6A 3QMFA 4GBWA 1FPLA 4NGUA 4F18A 5ET6A 3T0JA 4NN3A 4F1UA 2XWIA 3KC0A 2WX9A 4N91A 4GWUA 4XF5A 4PTKA 4H46A 4HCYA 1JP4A 1IMAA 5F24A 1IMEA 2XWOA 2XXKA 4P3LA 1IMFA 2QVRA 2F3DA 4JVCA 3MYUA 4MNIA 1FSAA 1NUWA 2PFZA 1CNQA 1FPGA 3SZPA 3EKIA 4PGPA 5IZ1A 4GX6A 1G0IA 3IFAA 2KR0A 4GBVA 2FBPA 1FJ9A 3BIGA 2CZKA 4PF8A 1FBHA 3B50A 2MKZA 4H45A 3T1BA 1FPBA 4N15A 1K9YA 2ZZWA 2XWKA 4MIJA 5EQ8A 1NV2A 2OX3A 2WYKA 3LV0A 4OA4A 4NG7A 2QFLA 2L5VA 4XFEA 1YYZA 2XWVA 2B4LA 4PAKA 1FBPA 2JJKA 3HFUA 2V4CA 4GWYA 1IMDA 1VDWA 4IR8A 4AS4A 2V3QA 3W9VA 5LTCA 2HZLA 4XEQA 4PDDA 4MJOA 1KA1A 1RDXA 3U65A 4YICA 4MCOA 2WYPA 4P56A 5EQAA 5EYGA 5IZ3A 2P3VA 2B4MA 2HPGA 4MHFA 3A29A 5CM6A 2OWZA 4X8RA 4JVDA 2Q8MA 4N8YA 2CZIA 4OVRA 4PBQA 4PFBA 4P9KA 3BIHA 2GQ1A 1AWBA 1FTAA 4JVIA 4N6DA 2CZHA 4OVQA 1FBCA 4HCWA 4N8GA 5EQ9A 2PCRA 4P1EA 1KA0A 2Y5KA 4OVPA 4YZZA 2CEYA 4MX6A 1RDZA 2XA5A 1NV4A 3MSTA 1QGXA 3CHGA 4HE1A 1FPDA 4GWSA 4O94A 3KBZA 1NV6A 2P3NA 1NV5A 3RPLB 4DI4B 4GWZA 4MEVA 5T3JA 5JK4A 2HXRA 1RDYA 4PAFA 4N4UA 4PF6A 1FBGA 1DBZA 4GWWA 3B8BA 2FIXA 2FHYA 5J1DA 3FXBA 3E79A 4GX4A 1FPJA 1YXIA 3RYDA 1KZ8A 4PFRA 4QXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAP A;  2V4C A;  2ZZV A;  4PC9 A;  4OVS A;  4NGU A;  2VPN A;  4PET A;  5I7I A;  4NN3 A;  2XWI A;  4OVT A;  4LN5 A;  4P8B A;  4MAG A;  2WX9 A;  2ZZX A;  5LTC A;  4N91 A;  2HZL A;  4XEQ A;  4PE3 A;  4XF5 A;  4P47 A;  4PDD A;  3U65 A;  4YIC A;  5I5P A;  4MCO A;  2WYP A;  4P56 A;  4PCD A;  2HPG A;  4MHF A;  4DI3 D;  4PBH A;  2XWO A;  2XXK A;  5CM6 A;  4X8R A;  2HZK A;  4MNP A;  4NF0 A;  4P3L A;  4N8Y A;  4OVR A;  4PBQ A;  4PFB A;  4P9K A;  4MNI A;  4N6D A;  3GYY A;  4OVQ A;  2PFZ A;  4N8G A;  4O8M A;  5IM2 A;  4N6K A;  4PGN A;  2CEX A;  4X04 A;  4P1E A;  4PAI A;  4PGP A;  4OVP A;  4YZZ A;  5IZZ A;  2CEY A;  4PFI A;  4MX6 A;  2XA5 A;  4NHB A;  4N17 A;  4O94 A;  4OAN A;  4PF8 A;  3B50 A;  4NQ8 A;  4DI4 B;  4MEV A;  4NX1 A;  4N15 A;  4UAB A;  4PAF A;  2ZZW A;  4N4U A;  2XWK A;  4MIJ A;  4PF6 A;  4P1L A;  2WYK A;  2PFY A;  4OA4 A;  4MMP A;  4NG7 A;  4MNC A;  4O7M A;  3FXB A;  4XFE A;  2VPO A;  5IGA A;  2XWV A;  4PFR A;  4PAK A;  4PDH A; 
#chains in the Genus database with same CATH topology
 1B3H A;  4OVS A;  5IAI A;  4I3Y A;  1SBP A;  2PBW A;  5ITP A;  3ROJ A;  2AIX A;  4YB6 A;  4OVT A;  3M3K A;  1FPE A;  4MAG A;  1KWH A;  3H7M A;  3OO9 A;  4YMA A;  3C31 A;  3MC2 A;  5M2V A;  1MQI A;  3IAZ A;  3MP8 A;  2CMO A;  2F7C A;  2HZK A;  1PB9 A;  2QS2 A;  5I58 A;  1R6Z A;  4FAJ A;  1XS5 A;  5EHS A;  5AA2 D;  3ODB A;  5TPA B;  1DSN A;  1P1W A;  1PBQ A;  2QS3 A;  3MWB A;  1Q1K A;  3T96 B;  3GYY A;  1H45 A;  1NNP A;  1FBD A;  2DE4 A;  5IM2 A;  4X04 A;  1LAX A;  4LZ7 A;  1UIV A;  2OJT A;  1Y3Q A;  3S9N C;  4LZ8 A;  1FPI A;  1NUY A;  4WXJ A;  4ECF A;  3H6T A;  1UTB A;  5A5L A;  5BUU A;  4QSD A;  3BKI B;  3PD8 A;  3ECR A;  3Q28 A;  1LAF E;  1QJM A;  3UIF A;  2A5T B;  4F19 A;  2DE2 A;  2HAU A;  1EYJ A;  5DVF A;  2RCB A;  3EHS A;  1NV3 A;  3MBP A;  4PC9 A;  3ZKK A;  1IMB A;  2Y5L A;  4NMY A;  3L6H A;  5EYH A;  3RY3 A;  1AMF A;  4LN5 A;  5FBP A;  4G61 A;  2F34 A;  4RY1 A;  1EYK A;  2WEF A;  5EQ7 A;  2UVI A;  3DLN A;  5DEX A;  3E9X A;  2PT1 A;  2Q9T A;  1B2H A;  1QUK A;  2I0B A;  4Z0I A;  1LCF A;  3PU5 A;  1LBY A;  4FBP A;  3HST A;  2I6E A;  1AOV A;  5ESY A;  4KFQ A;  3H03 A;  4KCD A;  4TLM B;  4NF6 B;  4RPO A;  1PB8 A;  1JW1 A;  1Z7N E;  3IX1 A;  1FPK A;  2DVZ A;  3TTN A;  3OEM A;  3RQT A;  2DDK A;  3IL1 B;  2ANJ A;  5L9O A;  4YU0 A;  4HXV A;  4OES A;  4R2B A;  1G0H A;  4GX3 A;  2M8C A;  4ZED A;  4DXU A;  1FW0 A;  3QSL A;  4G8H A;  1H3D A;  1NNF A;  4ELQ A;  4DE8 A;  1VFE A;  4F2O A;  5TP9 B;  3FVO A;  2B65 A;  4RPN A;  2F78 A;  5ITO A;  1LFH A;  5HPQ A;  2UVH A;  4IB2 A;  1S9T A;  2RC7 A;  2W7Y A;  1MXW A;  4QFP A;  4O7M A;  3K00 A;  2VPO A;  4H65 A;  3LUZ A;  3T93 B;  3IO4 A;  5TPA A;  4EF1 A;  4NGU A;  3K0V A;  1SI1 A;  1VR5 A;  4Z7E A;  2P0S A;  2XWI A;  2P1S A;  4GWU A;  4PTK A;  3VLU A;  2V84 A;  1ZBM A;  1JP4 A;  4XKN A;  4AQ4 A;  1EZO A;  3K1P A;  4AB5 A;  4GFR A;  4I8C A;  3TYH A;  1BP5 A;  2H9B A;  4P3L A;  2I3V A;  1R9L A;  1N84 A;  2AL4 A;  2LAO A;  1MXY A;  3LSL A;  1MG1 A;  5TU0 A;  3S9L C;  5CMK A;  3HO7 A;  4F1Y A;  1SW2 A;  1JNF A;  3KN8 A;  4O3A A;  4IY5 A;  2NUV A;  1YCJ A;  4YAH X;  1A54 A;  1LAH E;  4NWC A;  4GBV A;  2FBP A;  1FJ9 A;  3IOU A;  3VLW A;  2XXU A;  5K2X A;  3PUZ E;  1H76 A;  2FA7 A;  5KCJ B;  1FBH A;  5JEI A;  4ISU A;  3DEL B;  1B05 A;  2YJP A;  4H45 A;  2ONS A;  1MH3 A;  3T9H B;  1K9Y A;  3S9M C;  3MJN A;  2H5Y A;  5EQ8 A;  3C9H A;  4YKJ A;  3LV0 A;  1T0K A;  4OA4 A;  1JW4 A;  2QFL A;  3C32 A;  2GH9 A;  4JWO A;  4XFE A;  5F1Q A;  4Q5T A;  3LBS A;  4ZEF A;  4KR5 A;  3H4Z A;  4PFW A;  2V4C A;  3N6U A;  1VDW A;  1XOC A;  4NF6 A;  4HTG A;  3FVK A;  1MY4 A;  2P2A A;  3TZA A;  1P1Q A;  2YPN A;  1XVY A;  5I57 B;  3V8X B;  4DIG A;  2HZL A;  3LC8 A;  1KA1 A;  3U65 A;  2NWJ A;  3MQ9 A;  2WYP A;  4P56 A;  3N6T A;  2IEE A;  3G3G A;  4F3S A;  1QVS A;  2XXQ A;  3A29 A;  3KGC A;  4QSC A;  2DVC A;  3Q29 A;  1Y4C A;  1SW5 A;  3IB1 A;  4IY6 A;  1N3W A;  3A3C A;  4OVR A;  4PFB A;  1M5E A;  5TP9 A;  5H8H B;  2GQ1 A;  1AWB A;  3Q25 A;  2G29 A;  1OQG A;  2CZH A;  4OVQ A;  3MZ9 A;  4N8G A;  3L6G A;  3OO8 A;  4MF3 A;  1KA0 A;  2Y5K A;  5I59 B;  5FTH A;  1B9J A;  4AB6 A;  2Y7K A;  1ELJ A;  3FJG A;  4HE1 A;  3IOR A;  4QFK A;  3TUS A;  4GWS A;  2ZYK A;  4O94 A;  3KBZ A;  4QF9 A;  2R9J A;  2XXT A;  5L9M A;  2P3N A;  1OQH A;  1DOT A;  3SDF A;  4N4U A;  4ESW A;  4TLL B;  3CIJ A;  1FBG A;  1QUI A;  1DBZ A;  2V25 A;  3QXM A;  3LR1 A;  5J1D A;  2VOZ A;  1UTH B;  1FPJ A;  3RYD A;  1WOD A;  4OET A;  4H67 A;  3K02 A;  4FIM A;  1FTM A;  4ELR A;  3U94 A;  5DVI A;  2ZMB A;  3O97 A;  1B3E A;  5B7D A;  2PT2 A;  2FIE A;  1MY0 A;  1S50 A;  2E0S A;  1XVX A;  2F6P A;  4U22 A;  5HM4 B;  4OER A;  2XXV A;  2WBB A;  4MLQ A;  3G3I A;  2RC9 A;  2H25 A;  3ZSF A;  4PCD A;  1B1H A;  4GLI A;  4G77 A;  2UVG A;  2XX9 A;  1FTO A;  4M4G A;  5KCJ A;  1EZ9 A;  3Q27 A;  3TAJ A;  2E1S A;  4Q30 B;  2Q2A A;  4C1U A;  3HHG A;  1MM6 A;  5ET8 A;  3RNN A;  1TT1 A;  4LQ2 A;  3UA8 A;  4N6K A;  1F9B A;  3KBR A;  4KD5 A;  1Y3N A;  1NV0 A;  4PAI A;  3ISP A;  1B1X A;  2DE3 A;  2Q88 A;  3D4C A;  1DK4 A;  1USY E;  4GL0 A;  5L8D A;  3TDJ A;  1P1N A;  1QUL A;  3JYR A;  4GWX A;  3KSJ A;  4NED A;  4ZDM A;  4G4P A;  3CSG A;  3U8Q A;  1ZJL A;  1LLS A;  5I57 A;  4BDN A;  5ICQ A;  3OO7 A;  3U93 A;  3UGW A;  4XKQ A;  2XXR A;  1FQE A;  4PFU A;  1INP A;  1BIY A;  3DP6 A;  3MPK A;  4NE4 A;  2XXW A;  2ONR A;  3KN7 A;  3TFL A;  1B4Z A;  5CMC A;  1D9Q A;  1PC3 A;  5H8H A;  4EQ9 A;  1RYX A;  1LBX A;  4X1B A;  1IIW A;  1IUD A;  5H8N B;  2QVU A;  1ZLQ A;  5I59 A;  4PE3 A;  5AA2 A;  3HHF A;  1R9Q A;  2Y7R A;  2KQZ A;  4G68 C;  1H43 A;  3IB2 A;  3FVG A;  4RA1 A;  4F29 A;  1MM7 A;  3CR9 A;  3TEP A;  4NF0 A;  1EH3 A;  1VE4 A;  1IMC A;  1US4 A;  3MZ1 A;  3FV2 A;  2XX7 A;  1SVX B;  4KQP A;  3IOV A;  4KHZ E;  1OIB A;  1AIV A;  1RYO A;  3PUY E;  2F7B A;  3RT8 A;  3K1N A;  5B70 A;  1UTH A;  2QSX A;  3O28 A;  3KZG A;  1NI9 A;  3FBP A;  1B3G A;  5ET5 A;  5I3S A;  2O51 A;  1FBF A;  1Y9U A;  4N81 A;  2Z8D A;  4YB5 A;  3VXB A;  3ZKL A;  2DQV A;  4MH5 A;  4N17 A;  1GVC A;  3TTL A;  2PVU A;  3USD A;  4F39 A;  4NQ8 A;  1MXV A;  1ZU0 A;  3RN8 A;  4NX1 A;  1SYI A;  4UAB A;  1RKM A;  1Q9D A;  1B0L A;  5DW8 A;  3M8U A;  2Q74 A;  1HSE A;  3SER A;  1DCU A;  2XXH A;  1XI6 A;  5KZT A;  3MVY A;  3CSB A;  1FPL A;  2AL5 A;  4F18 A;  1PB7 A;  5ET6 A;  1XT8 A;  4GL8 A;  4QFL A;  1MY1 A;  1R1N A;  1NMU A;  1HSJ A;  2XXY A;  3C35 A;  1DMB A;  4LQ5 A;  3HPI A;  1NH7 A;  1FTK A;  4KYS A;  2XXK A;  2ZYM A;  3KJT A;  2Y7I A;  4KPT A;  2ZNU A;  2F97 A;  4JVC A;  1SYH A;  4Q0C A;  4BLA A;  4DLD A;  4OYV A;  1B3F A;  3S9E A;  2PFZ A;  4YKI A;  1FPG A;  3RGY A;  1GR2 A;  2R6G E;  3SZP A;  4JWY A;  3MUQ A;  1TFA A;  2PYY A;  2O1M A;  2XXX A;  5H8Q B;  2DWI A;  4GX6 A;  3TQL A;  2REJ A;  1PDA A;  1PEB A;  2OBG A;  4I1D A;  3KG2 A;  2I58 A;  4PF8 A;  3T9X B;  4DDD A;  5H8N A;  3B50 A;  5DYH A;  3RTW B;  2MKZ A;  2FNC A;  2XHD A;  4DXC A;  1FPB A;  4N15 A;  2RIN A;  3TCF A;  3R6U A;  4BDL A;  2XWK A;  2OX3 A;  4NG7 A;  3OEN A;  4WEP A;  4IO4 A;  2XWV A;  2IA4 A;  1SQY A;  3QYT A;  1B7Z A;  4PAK A;  4PE5 B;  2JJK A;  5IKB A;  2DS9 A;  1ZIU A;  1FQF A;  3UN6 A;  3BFU A;  1IZ1 A;  4EDP A;  4AS4 A;  2V3Q A;  4MFI A;  5DT6 A;  3W9V A;  4BDQ A;  5LTC A;  3KOT A;  4XEQ A;  4XKR A;  2ZNS A;  4YMB A;  1RDX A;  1O7T A;  3HCQ A;  3K01 A;  4GXS B;  1NNT A;  5EQA A;  4ELP A;  4ZE9 A;  4MHF A;  3G3F A;  2OWZ A;  4X8R A;  3VFJ A;  1XC1 A;  3EF7 A;  3OD7 A;  1D3K A;  5CRY A;  3THI A;  4P11 A;  4U23 A;  2CZL A;  2O68 A;  4P0G A;  3IK6 B;  3CFZ A;  3SKP A;  4P9K A;  3BIH A;  2I4B A;  2VGQ A;  4FE8 A;  4N6D A;  4U1Z A;  4HCW A;  4FED A;  5FHN A;  2OWS A;  1GGG A;  4LON B;  1MDQ A;  4WKM A;  3KSX A;  4BDR A;  1BTJ A;  3MAM A;  3VVE A;  4OVJ A;  1ZMG A;  2QMW A;  1NV4 A;  2XA5 A;  3Q26 A;  5CI5 A;  1B7H A;  2I49 A;  2GHB A;  3WAF A;  1N0T A;  3C33 A;  3ONM A;  5HBC A;  1DTG A;  5AA1 A;  2A5T A;  4WED A;  3ILU B;  2ONK E;  5T3J A;  4E0W A;  4I9D A;  4GD5 A;  3CI8 A;  1CB6 A;  4YB7 A;  1GTK A;  4PF6 A;  3EN3 A;  3FAT A;  4GWW A;  3B8B A;  3O6I A;  2FHY A;  2Y7P A;  1FQC A;  3P7I A;  4O3B A;  4OMB A;  4ZZA A;  1EZP A;  4NF8 B;  3FXB A;  3E79 A;  1KZ8 A;  4PFR A;  3KEI A;  3SEW A;  2UXA A;  3TTM A;  3CVG A;  2ZZV A;  5JTY B;  2WBD A;  1LB8 A;  1LBZ A;  2F8D A;  1EU8 A;  4IO3 A;  2NXO A;  2PX1 A;  2H99 A;  3PD9 A;  1FJ6 A;  1FRP A;  2GHA A;  2VT5 A;  1N76 A;  1A7L A;  1Y1M A;  5H8Q A;  1GV8 A;  1ATG A;  3N5L A;  5AA4 B;  1D4N A;  3H6U A;  4QFN A;  1SPI A;  1FTL A;  2QJE A;  4DI3 D;  1Y1Z A;  1FPF A;  2RKM A;  4I40 A;  2V3T A;  3MW0 A;  3T9U A;  3QAX A;  4R6Y A;  2ZYO A;  4NF4 B;  3D1R A;  3IFC A;  3GBB A;  3EHT A;  3N94 A;  4XXU A;  3PMX A;  1D9Y A;  5I84 A;  4O7I A;  1WDN A;  4C0R A;  3D4G A;  3OEK A;  4PFI A;  5BWJ A;  1B40 A;  1VFD A;  4U21 A;  3FXR A;  2RC8 A;  1URD A;  2HHM A;  2HEU A;  3GLB A;  3MVX A;  1TXF A;  3FD3 A;  3K2D A;  3SES A;  2B3B A;  1IXH A;  4TOZ A;  1LBB A;  2DWH A;  5ISU A;  3TEL A;  2HXW A;  2THI A;  3PUW E;  4QFO A;  2G93 A;  3MPL A;  4OEU A;  3K6W A;  3QUF A;  2PFY A;  1UIU A;  4GOT A;  2Z8E A;  3B6Q A;  2F3B A;  2DXY A;  2HAV A;  3LSF B;  3U72 A;  3SEX A;  5CBS A;  3LSW A;  1BLF A;  3I3V A;  4L17 A;  4KI0 E;  3PPO A;  2VPN A;  5I2N B;  2BJI A;  1SDX A;  3U92 A;  1FQB A;  1LBW A;  3RT6 B;  4OQO A;  2YLN A;  3RTF B;  1B4H A;  2UVJ A;  1BK4 A;  2Z8F A;  4XIG Q;  2QVV A;  1ZKB A;  4P47 A;  3VE1 B;  5I5P A;  3K6U A;  2HCA A;  2XD3 A;  4KCC A;  4JXI A;  2R8T A;  1YZ0 A;  4MNP A;  5ET7 A;  4MLV A;  4X48 A;  4R9G A;  4X9T A;  1B58 A;  1B7U A;  4KYE A;  1MQJ A;  1WVJ A;  2WKY A;  1I6Q A;  3R7X A;  3O6G A;  4GQO A;  3K1M A;  3KC1 A;  2QS4 A;  4UAC A;  1MS7 A;  3VLV A;  2CEX A;  1B5H A;  1A55 A;  4NF8 A;  5LDZ A;  1FQD A;  3IO6 A;  3TCH A;  1A8F A;  3FIR A;  5JTY A;  3HV1 A;  3E78 A;  1FBE A;  1LB9 A;  3MP6 A;  4BDM A;  3OEL A;  5CBR A;  4N13 A;  5CMM A;  5J16 A;  2DOJ A;  1YAE A;  3BFT A;  1SI0 A;  4EUO A;  3EPE A;  3B6W A;  3CFL A;  4IO6 A;  5AA4 A;  1PBP A;  4OWD A;  4HE2 A;  3E13 X;  2O1L A;  4AS5 A;  2HQ0 A;  3S2V A;  5LOM A;  1P1O A;  5FHO A;  3OO6 A;  4LZ5 A;  1II5 A;  4NF4 A;  3SEV A;  1N3X A;  1I6A A;  2DSF A;  3T0J A;  4ZEC A;  3K6V A;  2WX9 A;  4R74 A;  2V93 A;  1LFI A;  1SD3 A;  1B0H A;  4YKP A;  3RUM A;  1IMA A;  1YTV A;  5F24 A;  4DCX A;  4U1O A;  1MQG A;  2Y84 A;  4HS7 A;  2QVR A;  3FGS A;  4F3G A;  4JWX A;  3BBR A;  4GXA A;  4MNI A;  1H44 A;  4HW8 A;  1P99 A;  3KOS A;  3IOT A;  4PFY A;  4FAT A;  4OXV A;  1NUW A;  1I69 A;  3ZS6 A;  1JVX A;  5L9S A;  2OLB A;  2OCU A;  4EXK A;  4G68 B;  3K4U A;  3VVD A;  4PGP A;  4FEB A;  1Y3P A;  4IGT A;  5FTI A;  4DCY A;  5EHM A;  5CC2 A;  4H8I A;  4OTE A;  2VD3 A;  3KFM A;  4R2F A;  3TTR A;  1DPE A;  1G0I A;  2OK2 A;  3IFA A;  4LVQ A;  2KR0 A;  2UYE A;  3SET A;  5I2N A;  3E4R A;  3I5O A;  3PPN A;  1OMP A;  1IQ7 A;  2CZK A;  2ZYN A;  2O6A A;  4R75 A;  4ZE8 A;  1I6B A;  2QS1 A;  1B3L A;  5DVJ A;  3S4U A;  4DXB A;  1Y20 A;  1POY 1;  1FCK A;  5F7V A;  1MRP A;  4FOR A;  4DZ1 A;  4MIJ A;  1NV2 A;  3K6X A;  1NL5 A;  3VDF A;  5AA3 A;  3GXA A;  3PGF A;  4PP0 A;  3M3F A;  3O2A A;  3LSX A;  4EQ7 A;  5FHM A;  4GWY A;  4QSE A;  1IMD A;  1A8E A;  3HN0 A;  3TTK A;  2F36 A;  3UK4 A;  3R26 A;  4H0W A;  3A09 A;  4JSO A;  5H8F B;  2QMX A;  5ELV A;  5CMB A;  2ALU A;  4ZS9 A;  4F2Q A;  1LBC A;  2AYS A;  4PDD A;  4MJO A;  1IIT A;  4F3B A;  1J1N A;  4MCO A;  5EYG A;  3IJO B;  2P3V A;  2B4M A;  2HPG A;  1DPP A;  1MPC A;  3EQ1 A;  1MPD A;  3VVF A;  4JVD A;  2Q8M A;  2CZI A;  1M5D A;  4PBQ A;  3MVW A;  3PMW A;  1L5T A;  3RLF E;  4U4X A;  4JSD A;  4H6D A;  3PPP A;  3UP9 A;  2F35 A;  3DM0 A;  3ILT B;  1QW0 A;  2F7A A;  1CE2 A;  3CFX A;  3GBA A;  1B5I A;  3MST A;  5I2K B;  2I3W A;  1QGX A;  1LST A;  2DYX A;  3G3H A;  1SW4 A;  3B6T A;  3OXN A;  3PUX E;  3TQW A;  1NV6 A;  3PMV A;  4LA9 A;  3H6V A;  2KLF A;  3RPL B;  1NV5 A;  1US5 A;  3MP1 A;  4DI4 B;  2GFE A;  4MEV A;  3OSR A;  1RDY A;  3C34 A;  5I56 B;  1B51 A;  1S7Y A;  2DP8 A;  1POT A;  2QRY A;  3G7W A;  3JZJ A;  3T9V A;  2ZXT A;  4R9F A;  1MY2 A;  3SEY A;  4C1T A;  1YXI A;  1LGB C;  3C36 A;  2Q89 A;  1TWY A;  4NAP A;  4RK9 A;  4QHQ A;  4IGR A;  4RK2 A;  3V5A A;  1A99 A;  4H8J A;  4I3E A;  3IOW A;  2X7P A;  1LBV A;  3IJX B;  3FJ7 A;  4ONY A;  2DWA A;  2V3U A;  3IR1 A;  4G68 A;  3UOR A;  4GIZ A;  2I48 A;  4O3C A;  3LUY A;  4R6K A;  1Q35 A;  5A5X B;  1QKB A;  1DTZ A;  1LEV A;  1N7X A;  1AL3 A;  4NF5 B;  4PBH A;  2PMS A;  4EXL A;  4F1V A;  3C4M A;  3DP8 A;  1MXX A;  3RPW A;  4ESX A;  1OVB A;  1BKA A;  1XHY A;  2QPQ A;  4PFT A;  3O29 A;  1B32 A;  1B6H A;  4XTC Q;  4U4S A;  1QKA A;  3W9W A;  4RNS A;  4LAT A;  3B7D A;  4O8M A;  3H6W A;  4PGN A;  1NKX A;  2I4C A;  4X1D A;  1OLA A;  2FYI A;  3F11 A;  1B5J A;  3A3U A;  3PTY A;  4R6H A;  2F5X A;  1MH4 A;  4NHB A;  1NFT A;  2REG A;  1VSO A;  1JQF A;  4ZEI A;  4OAN A;  4ZEK A;  5H8F A;  3VXC A;  1K9Z A;  2O7I A;  2XXI A;  4POW A;  2XXP A;  3FUZ A;  1NNK A;  1UQW A;  3O9P A;  1EYI A;  4HE0 A;  2D3I A;  4P1L A;  3FAS A;  4THI A;  4ZEB A;  4FJP A;  3IB0 A;  4MMP A;  1LFG A;  4E0X A;  4MNC A;  3W15 C;  4JBZ A;  1NV1 A;  5IGA A;  3AXF A;  5AE4 A;  2A5S A;  1OVT A;  3PPQ A;  2Z23 A;  3VV5 A;  1IXI A;  2RCA A;  2VP1 A;  4GWO A;  1MY3 A;  1ANF A;  3O6H A;  4PET A;  1FTJ A;  5I7I A;  4R73 A;  4UA8 A;  2ESN A;  4OHN A;  4KXP A;  4MBP A;  4N07 A;  4P8B A;  2D5W A;  2ZZX A;  4LUB A;  4LP2 B;  4FEC A;  1JEV A;  1Z7M E;  4NWD A;  5I2K A;  3U1O A;  4M1V A;  2HFB A;  4EQB A;  1B52 A;  3MVZ A;  2RF1 A;  1IEJ A;  3NOH A;  3RPL A;  3OSQ A;  5I56 A;  1NUZ A;  2B3F A;  1M5B A;  5IZZ A;  2DWJ A;  1HSL A;  3O66 A;  4QBA A;  5IZ3 B;  4H5G A;  4N6P A;  1SW1 A;  3CG3 A;  4OFO A;  1O64 A;  1NV7 A;  1MPB A;  4GF8 A;  1TFD A;  3TMG A;  5A5X A;  2FVZ A;  4OEV A;  4P0I A;  1NUX A;  1IXC A;  5DTB A;  4NF5 A;  4G8N A;  1B46 A;  1NH8 A;  3FVN A;  2Q8J A;  4ZZE A;  4PDH A;  3FZV A;  3CRB A;  4ND9 A;  3KN3 A;  3QMF A;  4GBW A;  3PPR A;  3OOA A;  3E3K A;  3TKD A;  3EHU A;  4NN3 A;  4F1U A;  1D9V A;  3KC0 A;  2D21 A;  4N91 A;  1A40 A;  1MQD A;  2H98 A;  5KDT B;  4H5F A;  2Z22 A;  4IO7 A;  3WAE A;  1MDP 1;  4XF5 A;  4GRK A;  4H46 A;  4HCY A;  1URS A;  1IME A;  2ZNT A;  3H3G A;  4I62 A;  4NTL A;  4EF2 A;  2XWO A;  4H1X A;  4K3F A;  5AA2 B;  3TCG A;  1M5C A;  1IMF A;  1QUJ A;  2NVU B;  1Y4T A;  2H4I A;  4BDO A;  2F3D A;  1URG A;  2NOO A;  2QL3 A;  1IXG A;  4G8M A;  5K2Y A;  3MYU A;  2VD2 A;  1FSA A;  2X7Q A;  1CNQ A;  4JDF A;  3EKI A;  4JB7 A;  4RYA A;  3FXU A;  2R71 A;  5IZ1 A;  3FXQ A;  5EYF A;  3TPA A;  1JVY A;  3QK6 A;  3BIG A;  3GZG A;  4XKP A;  5I58 B;  4KYD A;  3T1B A;  3I6V A;  4TQU Q;  1OLC A;  4OZ9 A;  2ABH A;  1MXU A;  2ZZW A;  3KJ7 A;  3QUJ A;  3CG1 A;  4Q8R A;  1JEU A;  1AH5 A;  2WYK A;  4RJZ A;  1MXZ A;  2XX8 A;  2L5V A;  2O84 X;  4IO2 A;  2Y7W A;  1FQA A;  4OFL A;  1YYZ A;  2F6G A;  3T66 A;  2B4L A;  3G3K A;  1FBP A;  4POX A;  2O69 A;  1N04 A;  3HFU A;  4IO5 A;  3DP4 A;  4IR8 A;  1UTB B;  2Q2C A;  1YPN A;  2GRV A;  4OEN A;  1JW5 A;  3JV9 A;  3SEU A;  4YKK A;  1JET A;  4QRZ A;  4R72 A;  3MZB A;  4YIC A;  4RXL A;  5IZ3 A;  3N26 A;  2I0C A;  4ELO A;  4F3P A;  5ICT A;  5CM6 A;  3TOD A;  3H06 B;  2XD2 A;  4GVO A;  4OFJ A;  4F31 B;  4N8Y A;  1ZTY A;  2X26 A;  3M3L A;  1FTA A;  4JVI A;  1N7W A;  4G2Z A;  5H8S A;  2O7U A;  3V89 B;  3PUV E;  1FBC A;  5EQ9 A;  1M5F A;  1LCT A;  2PCR A;  4P1E A;  3QIM A;  4OVP A;  4YZZ A;  2CEY A;  4U2R A;  4MX6 A;  1RDZ A;  4PQJ A;  3CHG A;  5DEX B;  1LAG E;  2UYF A;  1FPD A;  3FV1 A;  1P1U A;  1O63 A;  2VHA A;  4F22 A;  2BJJ X;  5KDT A;  3OMB A;  4GWZ A;  5JK4 A;  2HXR A;  2OZZ A;  1MQH A;  4PAF A;  3G3J A;  2DXR A;  3FJM A;  3PV0 E;  2OWT A;  2FIX A;  4GX4 A;  1USY H;  3T22 A;  3V83 A;  4QXD A; 
#chains in the Genus database with same CATH homology
 4NAP A;  2ZZV A;  4OVS A;  2WBD A;  4I3Y A;  1LBZ A;  4I3E A;  3ROJ A;  1LBV A;  2FIE A;  1FJ6 A;  4OVT A;  1FRP A;  1FPE A;  2VT5 A;  4MAG A;  1LEV A;  2WBB A;  4PCD A;  1SPI A;  4DI3 D;  4PBH A;  1FPF A;  4I40 A;  4F1V A;  2HZK A;  3D1R A;  5ET8 A;  3IFC A;  2QPQ A;  3GYY A;  3W9W A;  4O8M A;  5IM2 A;  1FBD A;  2DE4 A;  4N6K A;  4PGN A;  4X04 A;  1NV0 A;  4PAI A;  3ISP A;  4O7I A;  2DE3 A;  4PFI A;  1FPI A;  1DK4 A;  1NUY A;  3PTY A;  2F5X A;  4GWX A;  2HHM A;  4NHB A;  5A5L A;  4OAN A;  1K9Z A;  1EYI A;  4HE0 A;  4P1L A;  4F19 A;  2DE2 A;  1INP A;  2PFY A;  4MMP A;  4MNC A;  1EYJ A;  1NV1 A;  2F3B A;  5IGA A;  1NV3 A;  4PC9 A;  1D9Q A;  2VPN A;  1IMB A;  1LBX A;  4PET A;  2BJI A;  2Y5L A;  5I7I A;  5EYH A;  1LBW A;  4KXP A;  4LN5 A;  5FBP A;  4G61 A;  1BK4 A;  4P8B A;  2ZZX A;  2QVU A;  1EYK A;  2WEF A;  2QVV A;  4PE3 A;  4P47 A;  5EQ7 A;  2KQZ A;  5I5P A;  4M1V A;  2Q9T A;  2R8T A;  1YZ0 A;  4MNP A;  5ET7 A;  4NF0 A;  3NOH A;  1LBY A;  4FBP A;  3RPL A;  5ESY A;  1IMC A;  4X9T A;  1NUZ A;  1FPK A;  2DVZ A;  3KC1 A;  2CEX A;  2DDK A;  5LDZ A;  5IZZ A;  1NI9 A;  3FBP A;  4HXV A;  5ET5 A;  5I3S A;  1G0H A;  1FBF A;  4N81 A;  4GX3 A;  3E78 A;  1FBE A;  4QBA A;  5IZ3 B;  5J16 A;  4N17 A;  1NV7 A;  4NQ8 A;  4NX1 A;  2FVZ A;  4UAB A;  1Q9D A;  1NUX A;  5DW8 A;  4HE2 A;  4O7M A;  2Q74 A;  4AS5 A;  2VPO A;  1DCU A;  3LUZ A;  4PDH A;  1XI6 A;  3QMF A;  4GBW A;  1FPL A;  4NGU A;  4F18 A;  5ET6 A;  3T0J A;  4NN3 A;  4F1U A;  2XWI A;  3KC0 A;  2WX9 A;  4N91 A;  4GWU A;  4XF5 A;  4PTK A;  4H46 A;  4HCY A;  1JP4 A;  1IMA A;  5F24 A;  1IME A;  2XWO A;  2XXK A;  4P3L A;  1IMF A;  2QVR A;  2F3D A;  4JVC A;  3MYU A;  4MNI A;  1FSA A;  1NUW A;  2PFZ A;  1CNQ A;  1FPG A;  3SZP A;  3EKI A;  4PGP A;  5IZ1 A;  4GX6 A;  1G0I A;  3IFA A;  2KR0 A;  4GBV A;  2FBP A;  1FJ9 A;  3BIG A;  2CZK A;  4PF8 A;  1FBH A;  3B50 A;  2MKZ A;  4H45 A;  3T1B A;  1FPB A;  4N15 A;  1K9Y A;  2ZZW A;  2XWK A;  4MIJ A;  5EQ8 A;  1NV2 A;  2OX3 A;  2WYK A;  3LV0 A;  4OA4 A;  4NG7 A;  2QFL A;  2L5V A;  4XFE A;  1YYZ A;  2XWV A;  2B4L A;  4PAK A;  1FBP A;  2JJK A;  3HFU A;  2V4C A;  4GWY A;  1IMD A;  1VDW A;  4IR8 A;  4AS4 A;  2V3Q A;  3W9V A;  5LTC A;  2HZL A;  4XEQ A;  4PDD A;  4MJO A;  1KA1 A;  1RDX A;  3U65 A;  4YIC A;  4MCO A;  2WYP A;  4P56 A;  5EQA A;  5EYG A;  5IZ3 A;  2P3V A;  2B4M A;  2HPG A;  4MHF A;  3A29 A;  5CM6 A;  2OWZ A;  4X8R A;  4JVD A;  2Q8M A;  4N8Y A;  2CZI A;  4OVR A;  4PBQ A;  4PFB A;  4P9K A;  3BIH A;  2GQ1 A;  1AWB A;  1FTA A;  4JVI A;  4N6D A;  2CZH A;  4OVQ A;  1FBC A;  4HCW A;  4N8G A;  5EQ9 A;  2PCR A;  4P1E A;  1KA0 A;  2Y5K A;  4OVP A;  4YZZ A;  2CEY A;  4MX6 A;  1RDZ A;  2XA5 A;  1NV4 A;  3MST A;  1QGX A;  3CHG A;  4HE1 A;  1FPD A;  4GWS A;  4O94 A;  3KBZ A;  1NV6 A;  2P3N A;  1NV5 A;  3RPL B;  4DI4 B;  4GWZ A;  4MEV A;  5T3J A;  5JK4 A;  2HXR A;  1RDY A;  4PAF A;  4N4U A;  4PF6 A;  1FBG A;  1DBZ A;  4GWW A;  3B8B A;  2FIX A;  2FHY A;  5J1D A;  3FXB A;  3E79 A;  4GX4 A;  1FPJ A;  1YXI A;  3RYD A;  1KZ8 A;  4PFR A;  4QXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...