5IZZA

Crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157, triple surface mutant k158a_k223a_k313a) in complex with metahydroxyphenylacetate, thermal exchange of ligand
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
318
structure length
318
Chain Sequence
EVVLKFHSFPPMPANSNAKFVKPWSEKVLAESNGEIKVEIYPAMQLGGKPPQLVDQVRDGVVDIVWTVAGYTPGRFPHLEAFELPFMPASAEATSQALQEYVDTVAASDLKDYKVLAVFCHAPGKIHTKEKVIASAADLNGMKMRGPTRVITKMLEGLGATPVGMPVPAVAGALSKGVIDGMVVPWEIMPSFKLHELTAAHTTVSGSRGLYTTPFLFLMNKAKYESLSDEHKKVIDNNAGLALAKLAGQLWDGFEVPARKLALDAGGTIHSLSGGPLAEMKAAGEGLEADWIKSANDRGLDGAMLVKTAKDLISKYDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP TRANSPORTER SOLUTE BINDING PROTEIN
publication title Crystal structure of a marine metagenome TRAP solute binding protein specific for aromatic acid ligands (Sorcerer II Global Ocean Sampling Expedition, unidentified microbe, locus tag GOS_1523157, Triple Surface Mutant K158A_K223A_K313A) in complex with metahydroxyphenylacetate, thermal exchange of ligand
rcsb
source organism Uncultured bacterium
molecule tags Transport protein
total genus 121
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2016-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5izzA00
4NX1A 4MMPA 4MNCA 4PAIA 2PFZA 4OANA 4OA4A 4N8GA 2V4CA 4PCDA 2XXKA 2VPOA 4PGPA 4DI4B 5I5PA 4PE3A 4N4UA 4PGNA 4OVSA 4NGUA 4NQ8A 3FXBA 4DI3D 4OVTA 4UABA 2XWKA 4X8RA 4P47A 4P1LA 2ZZXA 4XEQA 2CEYA 4NAPA 2XWIA 4PAKA 3GYYA 5CM6A 4N6KA 4OVPA 4MX6A 5IM2A 4PFIA 4XF5A 4NF0A 4MHFA 4NHBA 4PFRA 4MEVA 4NG7A 4PF6A 2WX9A 4MNIA 4YZZA 4MCOA 4PBHA 4LN5A 4P56A 4NN3A 4PAFA 4PF8A 4XFEA 2WYPA 2WYKA 2XA5A 2ZZVA 4PDDA 2CEXA 4N6DA 4O7MA 4PFBA 5IZZA 3B50A 4PETA 4N17A 4N8YA 4PDHA 2HPGA 4MAGA 5IGAA 2ZZWA 4P3LA 4O8MA 4P1EA 2PFYA 2HZLA 2HZKA 3U65A 2VPNA 2XWOA 4X04A 4PC9A 5I7IA 4MIJA 4OVRA 4P8BA 4N15A 4N91A 4O94A 4PBQA 5LTCA 4P9KA 4OVQA 4MNPA 2XWVA 4YICA
chains in the Genus database with same CATH superfamily
2F97A 1O64A 2GH9A 4C1UA 4MMPA 1NUZA 1M5CA 1NV6A 4H5GA 4OANA 5CMBA 3RUMA 1PB7A 3CVGA 3OO9A 2ZNSA 4N07A 2VT5A 3MZ9A 4HCYA 1ZIUA 4G8HA 2I49A 4MLQA 3G3HA 2UYEA 4DI3D 2YJPA 5B7DA 3V89B 2KQZA 4HE1A 1MQGA 3Q26A 4JVIA 2FBPA 2FHYA 1LBBA 1LB8A 3L6GA 4I40A 4M4GA 3ILTB 4OYVA 1PC3A 4R75A 1R1NA 4ONYA 1SQYA 3E78A 3QUFA 2Q9TA 3MP8A 2IA4A 1MPCA 5ET6A 1FTOA 1MPBA 2QJEA 4F3PA 4QHQA 5EHMA 4OFLA 2WYPA 4F3SA 4H65A 1IMAA 5DVJA 3V8XB 1UIVA 1FQBA 1M5FA 4Z7EA 1K9ZA 4KCCA 5KZTA 4UA8A 3I3VA 2ZZWA 5DT6A 1VFEA 3TUSA 4EUOA 4P3LA 4AB6A 1MY3A 4XTCQ 1D4NA 4R72A 2D5WA 3TFLA 4FE8A 4ZZAA 1FPIA 4OVRA 2P3NA 3PU5A 4XXUA 3HCQA 3RTFB 5FHMA 4OWDA 2FYIA 1GR2A 2WBBA 1CNQA 3C9HA 3FVGA 3PD9A 3A29A 3SEUA 3RTWB 4JVCA 3FXRA 2UVHA 1IMDA 1B46A 2AIXA 1IXHA 4IY5A 5I5PA 3U8QA 1AH5A 3C33A 4MLVA 3G7WA 3DLNA 3E13X 1A8FA 4QSEA 2CMOA 3FBPA 4R9GA 2FNCA 4P47A 2QS4A 5IKBA 2FA7A 3Q25A 4FAJA 4L17A 3TAJA 1RDYA 3GXAA 3MPKA 4MHFA 3VXBA 2KR0A 2H9BA 1Y4TA 4MJOA 3FD3A 1BP5A 4G8MA 4NG7A 1GVCA 5H8SA 2Z8EA 2DVZA 2Z8FA 1M5BA 4GX6A 4P56A 1B0LA 2RCAA 1A40A 4N6DA 2ZYOA 1EH3A 3T22A 4EXKA 2Z22A 4NF8A 4G4PA 1AL3A 1AWBA 1Q1KA 4X04A 5HPQA 1B6HA 3TQWA 1SI1A 2ZNUA 1N84A 1QKAA 1QGXA 1VFDA 1FJ6A 3T9UA 4IO4A 1N04A 4YICA 1D9VA 3SDFA 3CG3A 3TCHA 4HE0A 4OENA 3M3FA 1JQFA 1SW4A 2L5VA 4DI4B 5CBRA 5DTBA 2B65A 2QS1A 2Q2CA 4NF5B 4U1OA 1UTBB 4OQOA 2UVIA 2FIXA 3K2DA 3EN3A 2A5SA 3IAZA 2H99A 5FBPA 4FECA 4EDPA 3UK4A 1LGBC 5CM6A 3PTYA 3IB2A 3ISPA 3H3GA 5ET7A 2O69A 3IJOB 4HS7A 5AA1A 4JSOA 3VDFA 3HHFA 2R9JA 1ZTYA 4NF5A 4XKRA 1IZ1A 1UTBA 3KSJA 3Q27A 4BDQA 5CMCA 4G68C 3MJNA 2DWAA 2GHAA 3MW0A 3U1OA 2XXUA 3I6VA 4GRKA 4POWA 4JSDA 1IIWA 1P1OA 1TFDA 1OQGA 5ESYA 4GL0A 3ROJA 2F7BA 4O8MA 2HZLA 2HZKA 2QPQA 2KLFA 3GZGA 1NUWA 3MSTA 2QS2A 1B05A 1NV7A 2XXIA 1A8EA 5CC2A 1Y1ZA 2Q8JA 1SVXB 1B52A 3O6HA 1H44A 3IOVA 3IB0A 3EF7A 2DWIA 1FTMA 1MXVA 3O6IA 4ISUA 2AL5A 3SZPA 3FVKA 5I3SA 1FPLA 2OWZA 5HBCA 5I57B 4PFTA 3TELA 1FPFA 2B3BA 4PGPA 1FBFA 3TPAA 2V84A 3TMGA 3C32A 1LBXA 3TCGA 1ANFA 1QUJA 3N5LA 3ZKLA 4NAPA 1B1XA 1Y3QA 5I57A 3I5OA 3USDA 1I69A 5BUUA 4KD5A 4IGTA 1JVYA 4MNIA 1NI9A 1T0KA 5DW8A 1NH8A 3BFUA 3PMWA 4YAHX 1OVBA 3QXMA 4PAFA 2V93A 4F1VA 1N7XA 5EYHA 1RDXA 1MH4A 4OXVA 2PBWA 1N76A 3B50A 3RT8A 4Q0CA 3TTMA 3HV1A 1LAHE 4WEDA 5ICQA 5IZ1A 2Q89A 2O6AA 3JZJA 3FATA 1ZJLA 2ESNA 4LZ7A 1L5TA 1HSEA 4N15A 2DE3A 4O94A 2UXAA 1F9BA 4KQPA 1FTJA 2NXOA 3PUWE 3CFLA 1GGGA 3KOTA 3MWBA 1R9QA 1EYKA 4YKKA 4PE5B 3LSLA 4IO2A 1A54A 3QYTA 2I48A 1G0IA 3K6XA 4ZS9A 5IAIA 3PPRA 1AMFA 2XX7A 4JXIA 1BIYA 2UVJA 2RKMA 4U4SA 3B6WA 2HXRA 1LCTA 5KCJB 3H6UA 2Y5KA 5DVIA 1QUKA 2RF1A 5B70A 3ONMA 5DVFA 4OEVA 4PTKA 1DMBA 4U22A 4YKJA 4PAKA 1SBPA 3T66A 2RC7A 1FJ9A 2UYFA 4FJPA 4FEBA 1VR5A 2BJIA 1TFAA 1INPA 3U93A 2DE4A 3K1MA 4GWOA 4KHZE 2X26A 4NF4B 4PFRA 5KCJA 2OWSA 3K6UA 1USYH 1IXCA 3PPQA 2G93A 3CFZA 1JP4A 4PDDA 3Q28A 2DOJA 1P99A 4RY1A 4BDOA 1PDAA 1B7UA 3T9XB 2DWJA 4NF4A 4MAGA 5J16A 1JEVA 2DYXA 4GXAA 2REJA 4QF9A 3MBPA 3B7DA 3EQ1A 4JWOA 1BLFA 1HSJA 3IL1B 2QVUA 1XHYA 4F2QA 3E4RA 5TPAB 4P9KA 3H6VA 1SYIA 4N13A 2F6GA 1R9LA 3MZ1A 4MNCA 1DTZA 4QBAA 5EQAA 3DM0A 3MVZA 3ZS6A 4ELQA 2F3DA 1URDA 3KZGA 4PCDA 5EYGA 3CHGA 1B1HA 5I2NB 3MVYA 3A3CA 3OO7A 2NOOA 4ZECA 3PPNA 5TPAA 2G29A 4WKMA 1B9JA 2XWKA 2P2AA 4R6KA 2ZZXA 4XEQA 3IK6B 1UTHB 3DP4A 3SEXA 4FORA 3SEYA 4PFIA 2VD2A 4WEPA 2XXPA 4O7IA 1B3LA 4DCXA 3T93B 3CSBA 3K1PA 4I1DA 4QXDA 5I2NA 3TTNA 4YKIA 4LQ5A 5H8FB 2PT1A 4PBHA 3MP1A 3O2AA 3RYDA 3CG1A 3N6TA 2I58A 1UTHA 1B3GA 2ZZVA 2H98A 4QFLA 4DIGA 4FATA 3OO8A 4RJZA 1XT8A 4H1XA 3M8UA 3TCFA 3DP8A 5H8FA 2PFYA 1B32A 4MH5A 4U23A 1JW4A 4PFUA 2X7QA 3IO6A 1NKXA 1LFIA 4LQ2A 2XWOA 1P1WA 5I7IA 3TTLA 4G2ZA 3P7IA 1B7HA 3B6TA 4M1VA 3M3LA 4ZE9A 5IZ3B 3A09A 2Y7PA 5ITOA 4I9DA 3TKDA 1RDZA 2V4CA 2NVUB 2DVCA 1DSNA 3M3KA 1MXZA 4I3YA 5ICTA 2NWJA 4N4UA 1POY1 2QVVA 4NGUA 1IMCA 4U4XA 2D21A 4DCYA 4PQJA 1QKBA 5IZ3A 1FPBA 4P1LA 3V83A 1FQCA 1US4A 3VLWA 4GX3A 3IOUA 1YPNA 3FV2A 1LBVA 1B5IA 4HTGA 3EKIA 5EYFA 4I8CA 2E1SA 3TTRA 4P0IA 4R73A 4ECFA 1ZKBA 4AB5A 2ZXTA 2F6PA 3KN7A 3TQLA 4QFOA 4NN3A 4PF8A 4H5FA 3IOWA 5A5LA 3WAEA 5CI5A 4PFBA 2HHMA 3K6VA 1HSLA 3IFAA 3LUYA 2V3TA 4THIA 4NF8B 4F18A 4P1EA 5L9OA 2DWHA 3QK6A 2AYSA 5AA3A 2O68A 2ZYMA 2VPNA 4H67A 3LUZA 1PBPA 4OEUA 1BKAA 3HSTA 1FTKA 5L9MA 3PUXE 1Y3NA 2P3VA 1US5A 4F3GA 1IXGA 5BWJA 1A55A 4QRZA 1YTVA 1YAEA 2XXKA 3U72A 4ELOA 3CSGA 3K6WA 1ZU0A 2XD3A 2GRVA 4PFWA 2XXXA 1FBPA 2PCRA 4C1TA 1EZ9A 3T1BA 2V3UA 4XKQA 3KGCA 2OCUA 1LCFA 4YKPA 2X7PA 4GBVA 3LV0A 4Q30B 3TTKA 4KI0E 4OVPA 1IEJA 3KC1A 4ZEBA 4GBWA 1RYXA 4I3EA 5FHOA 1KZ8A 2DDKA 3OOAA 2VP1A 2ZNTA 3MP6A 1KWHA 3UP9A 2WX9A 3B6QA 4F3BA 4PFYA 3U92A 1FPJA 3G3KA 2I3VA 4GLIA 2Q2AA 4ZZEA 2DSFA 2F7CA 4LVQA 4ZE8A 3O28A 4MBPA 2OJTA 4G8NA 2ZYKA 4YU0A 1LB9A 1NUYA 5AE4A 3IO4A 3IR1A 4NWCA 2HAUA 5K2YA 2B4LA 3KOSA 3TODA 4F31B 5CMKA 4FIMA 4MIJA 4P8BA 3HHGA 3KEIA 4H6DA 4EQ7A 3O66A 3FGSA 1SI0A 5EHSA 2JJKA 2XWVA 3W15C 2ONKE 4NX1A 3EHSA 4P0GA 1Q9DA 4PAIA 4RPOA 2DP8A 4POXA 3SESA 3H06B 5H8QB 1MDQA 5AA4B 1P1UA 3GBAA 1QJMA 1K9YA 2HCAA 4MF3A 4UACA 4TLLB 1XVYA 1B58A 4R9FA 2HAVA 1D3KA 4N6KA 4XF5A 1KA0A 3UIFA 5I58B 2I0CA 5H8QA 4RK9A 5AA4A 4KXPA 2ONSA 1IMFA 1I6BA 3BFTA 5TP9B 1Y1MA 5EQ8A 1FTLA 4E0XA 3PMVA 3E79A 4XFEA 1S50A 1Q35A 1MQDA 4F29A 2WYKA 1Y20A 5I58A 1FPEA 2H25A 3QMFA 3K0VA 2BJJX 1FQAA 3LSWA 5TP9A 2Y7RA 4F1YA 1PBQA 3VLUA 2O1LA 1DOTA 4N6PA 3MAMA 3K01A 1SD3A 3KBRA 2F7AA 1G0HA 1MXYA 5FHNA 5TU0A 4Z0IA 1H45A 2R8TA 3OD7A 1OIBA 3FZVA 2WEFA 1N3XA 4RNSA 2REGA 3FASA 2ZMBA 1LSTA 1H43A 2DQVA 4DXUA 1N3WA 3OEKA 4ELRA 2PMSA 1IITA 3H6WA 4K3FA 1QUIA 4PGNA 4XKNA 1NUXA 1NH7A 4NQ8A 3TDJA 1B51A 2Y84A 2HFBA 3LBSA 4YB7A 3HN0A 1ZBMA 3IOTA 3G3FA 4X1DA 1S9TA 5H8NB 2OLBA 1B3HA 3BKIB 4DDDA 4G68B 1N7WA 5IM2A 4ZDMA 5ET8A 3G3JA 4ELPA 2O7UA 1NFTA 4P11A 2WBDA 2DE2A 2CZKA 1VE4A 3SERA 4GWUA 4OHNA 3O29A 3S4UA 2I4CA 5H8NA 4YMAA 3V5AA 5HM4B 1MXUA 1B0HA 3PMXA 1DCUA 4G68A 1NV2A 2QMWA 1MPDA 4KR5A 4ESXA 2Y7KA 3G3IA 3VVFA 5ELVA 3GLBA 1NNFA 2XXTA 3GBBA 1FQFA 3EPEA 2QFLA 2QVRA 1B7ZA 4R6HA 1B3EA 1J1NA 1PB9A 4IB2A 4PC9A 4EQBA 4OVJA 4H45A 3RLFE 3FV1A 3S9EA 3FJGA 4GX4A 4BDNA 4O3BA 5LTCA 2I0BA 3MVWA 1MQJA 1MY2A 4DXCA 2PFZA 2VD3A 4E0WA 4OA4A 3KJTA 1UQWA 1H3DA 4H8JA 3RY3A 3BBRA 4XIGQ 3CFXA 4R2FA 1M5DA 2CZHA 3OXNA 1JW1A 1QULA 1LBYA 4R74A 3SETA 3KSXA 4RPNA 1O7TA 3W9VA 2HXWA 2RINA 4LZ5A 3OELA 1PEBA 4TLMB 1MG1A 2GHBA 2PVUA 2HQ0A 1MQHA 2ALUA 3PUYE 3IB1A 4HE2A 3R26A 2F5XA 3N6UA 3HO7A 1JW5A 4HXVA 4BDLA 4GIZA 1ATGA 1IUDA 1TT1A 4Q8RA 5J1DA 3T0JA 3DELB 3FUZA 3C34A 5I56A 1EZPA 4KYDA 2OZZA 4OFOA 2Z23A 3SEWA 3O6GA 5L8DA 2E0SA 3IFCA 5AA2D 1IXIA 4ZEIA 1B2HA 1B5HA 3QUJA 1MXWA 3MUQA 2PT2A 3ZKKA 2RC9A 2Y5LA 2V25A 1MRPA 3S2VA 3RN8A 1MXXA 3EHTA 4HCWA 1FBEA 1B3FA 1JVXA 5CRYA 1FBDA 3OMBA 2Y7IA 1B40A 1RKMA 1FBCA 1P1NA 2XXVA 2XD2A 2CZLA 5K2XA 1R6ZA 1Z7NE 2XXHA 2VPOA 3JV9A 2AL4A 4PE3A 3IORA 4R2BA 1ZLQA 3FXBA 4OVTA 4UABA 2R6GE 3S9NC 3C4MA 1LFHA 2CZIA 4WXJA 2XWIA 4DLDA 2DS9A 1MY0A 3UA8A 2B3FA 1FSAA 3KFMA 3O97A 4JB7A 2Z8DA 4KCDA 3E9XA 1FW0A 4OETA 4I62A 4IO3A 1MM7A 5AA2B 2F8DA 4YZZA 2O51A 4MCOA 4TOZA 2NUVA 1GV8A 3LSXA 1JETA 3PUZE 1PB8A 4LONB 1B5JA 1NNPA 4GFRA 2CEXA 1QVSA 4GVOA 3KC0A 1XC1A 3C31A 2H4IA 1LEVA 4N8YA 3WAFA 3O9PA 5IGAA 2XXWA 5AA2A 1AOVA 3H4ZA 4AQ4A 3OSRA 1YXIA 3FXUA 5F1QA 3H6TA 2QMXA 4IO7A 1OMPA 1EYIA 2OWTA 4OFJA 1MH3A 3JYRA 2PX1A 1TWYA 2FIEA 2Q8MA 1SW2A 5ITPA 1FBHA 4PBQA 2RC8A 2XXYA 3D4CA 4GWSA 1DPPA 4OVQA 2IEEA 1II5A 1USYE 5M2VA 4G61A 4HW8A 1SDXA 3RPWA 2O7IA 2VHAA 1DPEA 4OVSA 3MVXA 1MS7A 1BTJA 4GD5A 1FTAA 1TXFA 2QSXA 3THIA 3MC2A 1LFGA 2QL3A 2I3WA 4X8RA 1LBWA 2DXYA 1MM6A 4G77A 5I84A 1LBCA 3Q29A 1NNTA 3LR1A 1CE2A 3CRBA 4JWYA 3QIMA 2V3QA 4NF0A 3TZAA 4OZ9A 3S9LC 1LAXA 5CMMA 4OMBA 5I2KB 4MEVA 3RNNA 2YLNA 1I6QA 3K4UA 4FBPA 2R71A 1FCKA 4EF1A 3MYUA 4LN5A 3KJ7A 2I6EA 3RPLB 3ZSFA 3F11A 4GQOA 1M5EA 2P0SA 1O63A 2LAOA 2HEUA 5IZZA 4XKPA 2QS3A 3FJ7A 4N17A 1I6AA 5JTYB 2HPGA 5I2KA 4IR8A 1BK4A 3VFJA 5JEIA 4AS5A 5ISUA 3G3GA 3RPLA 3W9WA 3QSLA 5T3JA 1VSOA 3E3KA 1OVTA 4PP0A 4N91A 4R6YA 1CB6A 4F39A 4TQUQ 4AS4A 1IMBA 5LOMA 1D9QA 2M8CA 4MNPA 5JTYA 4EQ9A 4IY6A 5KDTB 2MKZA 1SPIA 4BDMA 1NL5A 1OLAA 4ZEDA 1RYOA 1ZMGA 1NV5A 3KN8A 3K02A 1SW5A 1DTGA 1XOCA 3ODBA 3AXFA 4NF6B 4Q5TA 4ESWA 4YB5A 3PGFA 1S7YA 2PYYA 1Y3PA 3RGYA 5A5XB 4YMBA 3MPLA 1SYHA 5KDTA 1KA1A 4KYSA 4EF2A 3GYYA 3PD8A 4IO5A 1FPKA 2F34A 1NV3A 3UGWA 4IGRA 4RK2A 4BDRA 1EU8A 3VV5A 1FQDA 2THIA 4NF6A 2B4MA 4U21A 3PUVE 5F7VA 2RCBA 4GWWA 3TEPA 5A5XA 5EQ9A 1B4ZA 1WDNA 1FPDA 5DYHA 3PPOA 1WODA 4MFIA 3UORA 1NMUA 1EYJA 3C36A 3SEVA 3NOHA 4OERA 1OQHA 3T9VA 4OTEA 3IJXB 1JNFA 3KN3A 4JVDA 3TYHA 3T9HB 3KBZA 3MZBA 1LAGE 5DEXB 2OX3A 4KFQA 3RT6B 3QAXA 4FEDA 1LLSA 5FTHA 1AIVA 3BIHA 4NEDA 2O84X 1D9YA 1IMEA 1FQEA 5ET5A 5I59B 4LUBA 2XX9A 3RQTA 3FJMA 1NNKA 1EZOA 1Y9UA 2GQ1A 5DEXA 1Z7ME 5FTIA 4LATA 3FVOA 3KG2A 4O3AA 2XXRA 1A99A 3DP6A 3N94A 3EHUA 3OO6A 2W7YA 1GTKA 3VLVA 1LAFE 1N0TA 2XX8A 2VOZA 4O3CA 1NV1A 1IQ7A 5I59A 5JK4A 3N26A 4GOTA 2F78A 2ANJA 2FVZA 4JBZA 4F22A 2VGQA 4F19A 2Y7WA 1YCJA 4RXLA 4DE8A 4H0WA 4GF8A 3ECRA 2ABHA 3FVNA 3SKPA 4QFNA 3R6UA 5LDZA 1MDP1 1XVXA 4PF6A 5H8HB 3CIJA 3A3UA 1MY4A 1URGA 1JEUA 3MQ9A 1A7LA 1MY1A 4O7MA 2ZYNA 1Y4CA 4BLAA 2WKYA 4PETA 4F1UA 4PDHA 1UIUA 3UN6A 3B8BA 1XS5A 4X48A 1NV0A 5H8HA 2H5YA 3U65A 1LBZA 4U1ZA 1WVJA 2XHDA 3R7XA 5L9SA 4H8IA 3CI8A 2GFEA 1H76A 3S9MC 4OESA 4QFKA 4GWYA 3ILUB 5CBSA 1FPGA 1DBZA 4H46A 2P1SA 2XXQA 4DXBA 1B4HA 3T96B 2QRYA 1P1QA 2Q74A 4GWZA 4QFPA 1VDWA 4N81A 1YZ0A 4LA9A 4N8GA 4ZEKA 2Q88A 1YYZA 2OBGA 1NV4A 2O1MA 4EXLA 4QSCA 3C35A 1URSA 3U94A 3FIRA 4JWXA 2OK2A 3K00A 2CEYA 4C0RA 1ELJA 1POTA 1DK4A 3BIGA 3H03A 2F3BA 3VVEA 4MX6A 1SW1A 3K1NA 3FXQA 2DXRA 4NHBA 4ZEFA 3HFUA 4YB6A 3VXCA 3D4GA 3CR9A 4KPTA 3LSFB 4GL8A 4KYEA 4LZ8A 4NE4A 5F24A 2D3IA 3L6HA 3PV0E 5I56B 3LC8A 4NTLA 2F36A 2ONRA 4RYAA 3VVDA 4X9TA 1MQIA 2A5TB 2XA5A 3OEMA 4GWXA 3OENA 4JDFA 4LP2B 3H7MA 4DZ1A 4ND9A 4QSDA 2I4BA 2YPNA 2UVGA 1QW0A 3HPIA 4X1BA 1OLCA 5EQ7A 3IX1A 4RA1A 3VE1B 4U2RA 3PPPA 2F35A 1XI6A 2A5TA 4GXSB 4IO6A 1FRPA 4NMYA 4F2OA 4NWDA 3OSQA 3D1RA 1FBGA
chains in the Genus database with same CATH topology
4NX1A 4MMPA 1NUZA 1NV6A 1Q9DA 1G0IA 4PAIA 4OANA 4G61A 2VT5A 4OVSA 4HCYA 2HXRA 1FTAA 4DI3D 2Y5KA 4X8RA 1LBWA 1K9YA 2KQZA 4HE1A 4PTKA 4PAKA 1FJ9A 4JVIA 2FBPA 2FHYA 4N6KA 2BJIA 4I40A 4XF5A 1INPA 1KA0A 2V3QA 4NF0A 2DE4A 4PFRA 4KXPA 4MEVA 3E78A 1IMFA 2Q9TA 4FBPA 5EQ8A 3MYUA 4LN5A 3RPLB 3E79A 5ET6A 4XFEA 1JP4A 2WYPA 2WYKA 4PDDA 1IMAA 5IZZA 1K9ZA 1FPEA 4N17A 3QMFA 2HPGA 4MAGA 2ZZWA 5J16A 4IR8A 1BK4A 4P3LA 4AS5A 3RPLA 3W9WA 1FPIA 4OVRA 5T3JA 2P3NA 1G0HA 4N91A 2QVUA 2R8TA 4AS4A 1IMBA 2WBBA 1CNQA 4P9KA 2WEFA 1D9QA 4MNPA 2MKZA 4QBAA 1SPIA 4MNCA 5EQAA 3A29A 4JVCA 2F3DA 1IMDA 4PCDA 5EYGA 3CHGA 5I5PA 1NV5A 4PGNA 1NUXA 4NQ8A 3FBPA 2XWKA 4P47A 2ZZXA 4XEQA 1KA1A 3GYYA 1FPKA 1NV3A 1RDYA 5IM2A 4PFIA 4O7IA 4MHFA 4QXDA 5ET8A 2KR0A 4MJOA 2B4MA 4NG7A 2WBDA 2DE2A 4GWWA 4PBHA 2DVZA 2CZKA 5EQ9A 4GX6A 3RYDA 4GWUA 4P56A 1FPDA 2ZZVA 1DCUA 4N6DA 1NV2A 1EYJA 3NOHA 4JVDA 1AWBA 2PFYA 3KBZA 2QFLA 2QVRA 2OX3A 2XWOA 4X04A 4PC9A 5I7IA 4H45A 4M1VA 3BIHA 1QGXA 4GX4A 5LTCA 1FJ6A 5IZ3B 4YICA 4HE0A 1IMEA 5ET5A 2PFZA 2GQ1A 1RDZA 4OA4A 2V4CA 2L5VA 4I3YA 4DI4B 4N4UA 2QVVA 2CZHA 4NGUA 1IMCA 1LBYA 2FIXA 5IZ3A 3W9VA 1FPBA 4P1LA 1NV1A 5FBPA 5JK4A 4GX3A 5CM6A 2FVZA 3PTYA 3ISPA 4HE2A 5ET7A 2F5XA 4F19A 1LBVA 3EKIA 4HXVA 5LDZA 4PF6A 5J1DA 3T0JA 4NN3A 4PF8A 5A5LA 4O7MA 4PFBA 2HHMA 3IFAA 4PETA 4F1UA 4PDHA 3IFCA 5ESYA 4F18A 3B8BA 3ROJA 4O8MA 1NV0A 4P1EA 2HZLA 2HZKA 3U65A 1LBZA 2Y5LA 2QPQA 1NUWA 3MSTA 1NV7A 2VPNA 3LUZA 4HCWA 1FBEA 4GWYA 1FPGA 1DBZA 4H46A 2P3VA 1FBDA 2Q74A 4GWZA 3SZPA 1VDWA 1FBCA 5I3SA 4N81A 1FPLA 1YZ0A 2OWZA 4N8GA 1FPFA 2XXKA 2VPOA 4PGPA 1YYZA 4PE3A 1NV4A 1FBFA 3FXBA 4OVTA 1LBXA 4UABA 1FBPA 2PCRA 3T1BA 2CZIA 2CEYA 4NAPA 2XWIA 4GBVA 1FSAA 3LV0A 1DK4A 3BIGA 2F3BA 4OVPA 4MX6A 3KC1A 4GBWA 4I3EA 1KZ8A 2DDKA 4NHBA 3HFUA 2WX9A 4MNIA 4YZZA 1NI9A 4MCOA 5DW8A 5F24A 1FPJA 4PAFA 4F1VA 4X9TA 5EYHA 1RDXA 2XA5A 2CEXA 4GWXA 3KC0A 3B50A 1LEVA 4N8YA 5IGAA 5EQ7A 5IZ1A 1NUYA 1YXIA 1EYIA 2B4LA 4MIJA 1XI6A 4P8BA 2FIEA 4N15A 2Q8MA 1FRPA 2DE3A 4O94A 1FBHA 4PBQA 4GWSA 4OVQA 3D1RA 1EYKA 2JJKA 2XWVA 1FBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NX1 A;  4MMP A;  4MNC A;  4PAI A;  2PFZ A;  4OAN A;  4OA4 A;  4N8G A;  2V4C A;  4PCD A;  2XXK A;  2VPO A;  4PGP A;  4DI4 B;  5I5P A;  4PE3 A;  4N4U A;  4PGN A;  4OVS A;  4NGU A;  4NQ8 A;  3FXB A;  4DI3 D;  4OVT A;  4UAB A;  2XWK A;  4X8R A;  4P47 A;  4P1L A;  2ZZX A;  4XEQ A;  2CEY A;  4NAP A;  2XWI A;  4PAK A;  3GYY A;  5CM6 A;  4N6K A;  4OVP A;  4MX6 A;  5IM2 A;  4PFI A;  4XF5 A;  4NF0 A;  4MHF A;  4NHB A;  4PFR A;  4MEV A;  4NG7 A;  4PF6 A;  2WX9 A;  4MNI A;  4YZZ A;  4MCO A;  4PBH A;  4LN5 A;  4P56 A;  4NN3 A;  4PAF A;  4PF8 A;  4XFE A;  2WYP A;  2WYK A;  2XA5 A;  2ZZV A;  4PDD A;  2CEX A;  4N6D A;  4O7M A;  4PFB A;  5IZZ A;  3B50 A;  4PET A;  4N17 A;  4N8Y A;  4PDH A;  2HPG A;  4MAG A;  5IGA A;  2ZZW A;  4P3L A;  4O8M A;  4P1E A;  2PFY A;  2HZL A;  2HZK A;  3U65 A;  2VPN A;  2XWO A;  4X04 A;  4PC9 A;  5I7I A;  4MIJ A;  4OVR A;  4P8B A;  4N15 A;  4N91 A;  4O94 A;  4PBQ A;  5LTC A;  4P9K A;  4OVQ A;  4MNP A;  2XWV A;  4YIC A; 
#chains in the Genus database with same CATH topology
 2F97 A;  1O64 A;  2GH9 A;  4C1U A;  4MMP A;  1NUZ A;  1M5C A;  1NV6 A;  4H5G A;  4OAN A;  5CMB A;  3RUM A;  1PB7 A;  3CVG A;  3OO9 A;  2ZNS A;  4N07 A;  2VT5 A;  3MZ9 A;  4HCY A;  1ZIU A;  4G8H A;  2I49 A;  4MLQ A;  3G3H A;  2UYE A;  4DI3 D;  2YJP A;  5B7D A;  3V89 B;  2KQZ A;  4HE1 A;  1MQG A;  3Q26 A;  4JVI A;  2FBP A;  2FHY A;  1LBB A;  1LB8 A;  3L6G A;  4I40 A;  4M4G A;  3ILT B;  4OYV A;  1PC3 A;  4R75 A;  1R1N A;  4ONY A;  1SQY A;  3E78 A;  3QUF A;  2Q9T A;  3MP8 A;  2IA4 A;  1MPC A;  5ET6 A;  1FTO A;  1MPB A;  2QJE A;  4F3P A;  4QHQ A;  5EHM A;  4OFL A;  2WYP A;  4F3S A;  4H65 A;  1IMA A;  5DVJ A;  3V8X B;  1UIV A;  1FQB A;  1M5F A;  4Z7E A;  1K9Z A;  4KCC A;  5KZT A;  4UA8 A;  3I3V A;  2ZZW A;  5DT6 A;  1VFE A;  3TUS A;  4EUO A;  4P3L A;  4AB6 A;  1MY3 A;  4XTC Q;  1D4N A;  4R72 A;  2D5W A;  3TFL A;  4FE8 A;  4ZZA A;  1FPI A;  4OVR A;  2P3N A;  3PU5 A;  4XXU A;  3HCQ A;  3RTF B;  5FHM A;  4OWD A;  2FYI A;  1GR2 A;  2WBB A;  1CNQ A;  3C9H A;  3FVG A;  3PD9 A;  3A29 A;  3SEU A;  3RTW B;  4JVC A;  3FXR A;  2UVH A;  1IMD A;  1B46 A;  2AIX A;  1IXH A;  4IY5 A;  5I5P A;  3U8Q A;  1AH5 A;  3C33 A;  4MLV A;  3G7W A;  3DLN A;  3E13 X;  1A8F A;  4QSE A;  2CMO A;  3FBP A;  4R9G A;  2FNC A;  4P47 A;  2QS4 A;  5IKB A;  2FA7 A;  3Q25 A;  4FAJ A;  4L17 A;  3TAJ A;  1RDY A;  3GXA A;  3MPK A;  4MHF A;  3VXB A;  2KR0 A;  2H9B A;  1Y4T A;  4MJO A;  3FD3 A;  1BP5 A;  4G8M A;  4NG7 A;  1GVC A;  5H8S A;  2Z8E A;  2DVZ A;  2Z8F A;  1M5B A;  4GX6 A;  4P56 A;  1B0L A;  2RCA A;  1A40 A;  4N6D A;  2ZYO A;  1EH3 A;  3T22 A;  4EXK A;  2Z22 A;  4NF8 A;  4G4P A;  1AL3 A;  1AWB A;  1Q1K A;  4X04 A;  5HPQ A;  1B6H A;  3TQW A;  1SI1 A;  2ZNU A;  1N84 A;  1QKA A;  1QGX A;  1VFD A;  1FJ6 A;  3T9U A;  4IO4 A;  1N04 A;  4YIC A;  1D9V A;  3SDF A;  3CG3 A;  3TCH A;  4HE0 A;  4OEN A;  3M3F A;  1JQF A;  1SW4 A;  2L5V A;  4DI4 B;  5CBR A;  5DTB A;  2B65 A;  2QS1 A;  2Q2C A;  4NF5 B;  4U1O A;  1UTB B;  4OQO A;  2UVI A;  2FIX A;  3K2D A;  3EN3 A;  2A5S A;  3IAZ A;  2H99 A;  5FBP A;  4FEC A;  4EDP A;  3UK4 A;  1LGB C;  5CM6 A;  3PTY A;  3IB2 A;  3ISP A;  3H3G A;  5ET7 A;  2O69 A;  3IJO B;  4HS7 A;  5AA1 A;  4JSO A;  3VDF A;  3HHF A;  2R9J A;  1ZTY A;  4NF5 A;  4XKR A;  1IZ1 A;  1UTB A;  3KSJ A;  3Q27 A;  4BDQ A;  5CMC A;  4G68 C;  3MJN A;  2DWA A;  2GHA A;  3MW0 A;  3U1O A;  2XXU A;  3I6V A;  4GRK A;  4POW A;  4JSD A;  1IIW A;  1P1O A;  1TFD A;  1OQG A;  5ESY A;  4GL0 A;  3ROJ A;  2F7B A;  4O8M A;  2HZL A;  2HZK A;  2QPQ A;  2KLF A;  3GZG A;  1NUW A;  3MST A;  2QS2 A;  1B05 A;  1NV7 A;  2XXI A;  1A8E A;  5CC2 A;  1Y1Z A;  2Q8J A;  1SVX B;  1B52 A;  3O6H A;  1H44 A;  3IOV A;  3IB0 A;  3EF7 A;  2DWI A;  1FTM A;  1MXV A;  3O6I A;  4ISU A;  2AL5 A;  3SZP A;  3FVK A;  5I3S A;  1FPL A;  2OWZ A;  5HBC A;  5I57 B;  4PFT A;  3TEL A;  1FPF A;  2B3B A;  4PGP A;  1FBF A;  3TPA A;  2V84 A;  3TMG A;  3C32 A;  1LBX A;  3TCG A;  1ANF A;  1QUJ A;  3N5L A;  3ZKL A;  4NAP A;  1B1X A;  1Y3Q A;  5I57 A;  3I5O A;  3USD A;  1I69 A;  5BUU A;  4KD5 A;  4IGT A;  1JVY A;  4MNI A;  1NI9 A;  1T0K A;  5DW8 A;  1NH8 A;  3BFU A;  3PMW A;  4YAH X;  1OVB A;  3QXM A;  4PAF A;  2V93 A;  4F1V A;  1N7X A;  5EYH A;  1RDX A;  1MH4 A;  4OXV A;  2PBW A;  1N76 A;  3B50 A;  3RT8 A;  4Q0C A;  3TTM A;  3HV1 A;  1LAH E;  4WED A;  5ICQ A;  5IZ1 A;  2Q89 A;  2O6A A;  3JZJ A;  3FAT A;  1ZJL A;  2ESN A;  4LZ7 A;  1L5T A;  1HSE A;  4N15 A;  2DE3 A;  4O94 A;  2UXA A;  1F9B A;  4KQP A;  1FTJ A;  2NXO A;  3PUW E;  3CFL A;  1GGG A;  3KOT A;  3MWB A;  1R9Q A;  1EYK A;  4YKK A;  4PE5 B;  3LSL A;  4IO2 A;  1A54 A;  3QYT A;  2I48 A;  1G0I A;  3K6X A;  4ZS9 A;  5IAI A;  3PPR A;  1AMF A;  2XX7 A;  4JXI A;  1BIY A;  2UVJ A;  2RKM A;  4U4S A;  3B6W A;  2HXR A;  1LCT A;  5KCJ B;  3H6U A;  2Y5K A;  5DVI A;  1QUK A;  2RF1 A;  5B70 A;  3ONM A;  5DVF A;  4OEV A;  4PTK A;  1DMB A;  4U22 A;  4YKJ A;  4PAK A;  1SBP A;  3T66 A;  2RC7 A;  1FJ9 A;  2UYF A;  4FJP A;  4FEB A;  1VR5 A;  2BJI A;  1TFA A;  1INP A;  3U93 A;  2DE4 A;  3K1M A;  4GWO A;  4KHZ E;  2X26 A;  4NF4 B;  4PFR A;  5KCJ A;  2OWS A;  3K6U A;  1USY H;  1IXC A;  3PPQ A;  2G93 A;  3CFZ A;  1JP4 A;  4PDD A;  3Q28 A;  2DOJ A;  1P99 A;  4RY1 A;  4BDO A;  1PDA A;  1B7U A;  3T9X B;  2DWJ A;  4NF4 A;  4MAG A;  5J16 A;  1JEV A;  2DYX A;  4GXA A;  2REJ A;  4QF9 A;  3MBP A;  3B7D A;  3EQ1 A;  4JWO A;  1BLF A;  1HSJ A;  3IL1 B;  2QVU A;  1XHY A;  4F2Q A;  3E4R A;  5TPA B;  4P9K A;  3H6V A;  1SYI A;  4N13 A;  2F6G A;  1R9L A;  3MZ1 A;  4MNC A;  1DTZ A;  4QBA A;  5EQA A;  3DM0 A;  3MVZ A;  3ZS6 A;  4ELQ A;  2F3D A;  1URD A;  3KZG A;  4PCD A;  5EYG A;  3CHG A;  1B1H A;  5I2N B;  3MVY A;  3A3C A;  3OO7 A;  2NOO A;  4ZEC A;  3PPN A;  5TPA A;  2G29 A;  4WKM A;  1B9J A;  2XWK A;  2P2A A;  4R6K A;  2ZZX A;  4XEQ A;  3IK6 B;  1UTH B;  3DP4 A;  3SEX A;  4FOR A;  3SEY A;  4PFI A;  2VD2 A;  4WEP A;  2XXP A;  4O7I A;  1B3L A;  4DCX A;  3T93 B;  3CSB A;  3K1P A;  4I1D A;  4QXD A;  5I2N A;  3TTN A;  4YKI A;  4LQ5 A;  5H8F B;  2PT1 A;  4PBH A;  3MP1 A;  3O2A A;  3RYD A;  3CG1 A;  3N6T A;  2I58 A;  1UTH A;  1B3G A;  2ZZV A;  2H98 A;  4QFL A;  4DIG A;  4FAT A;  3OO8 A;  4RJZ A;  1XT8 A;  4H1X A;  3M8U A;  3TCF A;  3DP8 A;  5H8F A;  2PFY A;  1B32 A;  4MH5 A;  4U23 A;  1JW4 A;  4PFU A;  2X7Q A;  3IO6 A;  1NKX A;  1LFI A;  4LQ2 A;  2XWO A;  1P1W A;  5I7I A;  3TTL A;  4G2Z A;  3P7I A;  1B7H A;  3B6T A;  4M1V A;  3M3L A;  4ZE9 A;  5IZ3 B;  3A09 A;  2Y7P A;  5ITO A;  4I9D A;  3TKD A;  1RDZ A;  2V4C A;  2NVU B;  2DVC A;  1DSN A;  3M3K A;  1MXZ A;  4I3Y A;  5ICT A;  2NWJ A;  4N4U A;  1POY 1;  2QVV A;  4NGU A;  1IMC A;  4U4X A;  2D21 A;  4DCY A;  4PQJ A;  1QKB A;  5IZ3 A;  1FPB A;  4P1L A;  3V83 A;  1FQC A;  1US4 A;  3VLW A;  4GX3 A;  3IOU A;  1YPN A;  3FV2 A;  1LBV A;  1B5I A;  4HTG A;  3EKI A;  5EYF A;  4I8C A;  2E1S A;  3TTR A;  4P0I A;  4R73 A;  4ECF A;  1ZKB A;  4AB5 A;  2ZXT A;  2F6P A;  3KN7 A;  3TQL A;  4QFO A;  4NN3 A;  4PF8 A;  4H5F A;  3IOW A;  5A5L A;  3WAE A;  5CI5 A;  4PFB A;  2HHM A;  3K6V A;  1HSL A;  3IFA A;  3LUY A;  2V3T A;  4THI A;  4NF8 B;  4F18 A;  4P1E A;  5L9O A;  2DWH A;  3QK6 A;  2AYS A;  5AA3 A;  2O68 A;  2ZYM A;  2VPN A;  4H67 A;  3LUZ A;  1PBP A;  4OEU A;  1BKA A;  3HST A;  1FTK A;  5L9M A;  3PUX E;  1Y3N A;  2P3V A;  1US5 A;  4F3G A;  1IXG A;  5BWJ A;  1A55 A;  4QRZ A;  1YTV A;  1YAE A;  2XXK A;  3U72 A;  4ELO A;  3CSG A;  3K6W A;  1ZU0 A;  2XD3 A;  2GRV A;  4PFW A;  2XXX A;  1FBP A;  2PCR A;  4C1T A;  1EZ9 A;  3T1B A;  2V3U A;  4XKQ A;  3KGC A;  2OCU A;  1LCF A;  4YKP A;  2X7P A;  4GBV A;  3LV0 A;  4Q30 B;  3TTK A;  4KI0 E;  4OVP A;  1IEJ A;  3KC1 A;  4ZEB A;  4GBW A;  1RYX A;  4I3E A;  5FHO A;  1KZ8 A;  2DDK A;  3OOA A;  2VP1 A;  2ZNT A;  3MP6 A;  1KWH A;  3UP9 A;  2WX9 A;  3B6Q A;  4F3B A;  4PFY A;  3U92 A;  1FPJ A;  3G3K A;  2I3V A;  4GLI A;  2Q2A A;  4ZZE A;  2DSF A;  2F7C A;  4LVQ A;  4ZE8 A;  3O28 A;  4MBP A;  2OJT A;  4G8N A;  2ZYK A;  4YU0 A;  1LB9 A;  1NUY A;  5AE4 A;  3IO4 A;  3IR1 A;  4NWC A;  2HAU A;  5K2Y A;  2B4L A;  3KOS A;  3TOD A;  4F31 B;  5CMK A;  4FIM A;  4MIJ A;  4P8B A;  3HHG A;  3KEI A;  4H6D A;  4EQ7 A;  3O66 A;  3FGS A;  1SI0 A;  5EHS A;  2JJK A;  2XWV A;  3W15 C;  2ONK E;  4NX1 A;  3EHS A;  4P0G A;  1Q9D A;  4PAI A;  4RPO A;  2DP8 A;  4POX A;  3SES A;  3H06 B;  5H8Q B;  1MDQ A;  5AA4 B;  1P1U A;  3GBA A;  1QJM A;  1K9Y A;  2HCA A;  4MF3 A;  4UAC A;  4TLL B;  1XVY A;  1B58 A;  4R9F A;  2HAV A;  1D3K A;  4N6K A;  4XF5 A;  1KA0 A;  3UIF A;  5I58 B;  2I0C A;  5H8Q A;  4RK9 A;  5AA4 A;  4KXP A;  2ONS A;  1IMF A;  1I6B A;  3BFT A;  5TP9 B;  1Y1M A;  5EQ8 A;  1FTL A;  4E0X A;  3PMV A;  3E79 A;  4XFE A;  1S50 A;  1Q35 A;  1MQD A;  4F29 A;  2WYK A;  1Y20 A;  5I58 A;  1FPE A;  2H25 A;  3QMF A;  3K0V A;  2BJJ X;  1FQA A;  3LSW A;  5TP9 A;  2Y7R A;  4F1Y A;  1PBQ A;  3VLU A;  2O1L A;  1DOT A;  4N6P A;  3MAM A;  3K01 A;  1SD3 A;  3KBR A;  2F7A A;  1G0H A;  1MXY A;  5FHN A;  5TU0 A;  4Z0I A;  1H45 A;  2R8T A;  3OD7 A;  1OIB A;  3FZV A;  2WEF A;  1N3X A;  4RNS A;  2REG A;  3FAS A;  2ZMB A;  1LST A;  1H43 A;  2DQV A;  4DXU A;  1N3W A;  3OEK A;  4ELR A;  2PMS A;  1IIT A;  3H6W A;  4K3F A;  1QUI A;  4PGN A;  4XKN A;  1NUX A;  1NH7 A;  4NQ8 A;  3TDJ A;  1B51 A;  2Y84 A;  2HFB A;  3LBS A;  4YB7 A;  3HN0 A;  1ZBM A;  3IOT A;  3G3F A;  4X1D A;  1S9T A;  5H8N B;  2OLB A;  1B3H A;  3BKI B;  4DDD A;  4G68 B;  1N7W A;  5IM2 A;  4ZDM A;  5ET8 A;  3G3J A;  4ELP A;  2O7U A;  1NFT A;  4P11 A;  2WBD A;  2DE2 A;  2CZK A;  1VE4 A;  3SER A;  4GWU A;  4OHN A;  3O29 A;  3S4U A;  2I4C A;  5H8N A;  4YMA A;  3V5A A;  5HM4 B;  1MXU A;  1B0H A;  3PMX A;  1DCU A;  4G68 A;  1NV2 A;  2QMW A;  1MPD A;  4KR5 A;  4ESX A;  2Y7K A;  3G3I A;  3VVF A;  5ELV A;  3GLB A;  1NNF A;  2XXT A;  3GBB A;  1FQF A;  3EPE A;  2QFL A;  2QVR A;  1B7Z A;  4R6H A;  1B3E A;  1J1N A;  1PB9 A;  4IB2 A;  4PC9 A;  4EQB A;  4OVJ A;  4H45 A;  3RLF E;  3FV1 A;  3S9E A;  3FJG A;  4GX4 A;  4BDN A;  4O3B A;  5LTC A;  2I0B A;  3MVW A;  1MQJ A;  1MY2 A;  4DXC A;  2PFZ A;  2VD3 A;  4E0W A;  4OA4 A;  3KJT A;  1UQW A;  1H3D A;  4H8J A;  3RY3 A;  3BBR A;  4XIG Q;  3CFX A;  4R2F A;  1M5D A;  2CZH A;  3OXN A;  1JW1 A;  1QUL A;  1LBY A;  4R74 A;  3SET A;  3KSX A;  4RPN A;  1O7T A;  3W9V A;  2HXW A;  2RIN A;  4LZ5 A;  3OEL A;  1PEB A;  4TLM B;  1MG1 A;  2GHB A;  2PVU A;  2HQ0 A;  1MQH A;  2ALU A;  3PUY E;  3IB1 A;  4HE2 A;  3R26 A;  2F5X A;  3N6U A;  3HO7 A;  1JW5 A;  4HXV A;  4BDL A;  4GIZ A;  1ATG A;  1IUD A;  1TT1 A;  4Q8R A;  5J1D A;  3T0J A;  3DEL B;  3FUZ A;  3C34 A;  5I56 A;  1EZP A;  4KYD A;  2OZZ A;  4OFO A;  2Z23 A;  3SEW A;  3O6G A;  5L8D A;  2E0S A;  3IFC A;  5AA2 D;  1IXI A;  4ZEI A;  1B2H A;  1B5H A;  3QUJ A;  1MXW A;  3MUQ A;  2PT2 A;  3ZKK A;  2RC9 A;  2Y5L A;  2V25 A;  1MRP A;  3S2V A;  3RN8 A;  1MXX A;  3EHT A;  4HCW A;  1FBE A;  1B3F A;  1JVX A;  5CRY A;  1FBD A;  3OMB A;  2Y7I A;  1B40 A;  1RKM A;  1FBC A;  1P1N A;  2XXV A;  2XD2 A;  2CZL A;  5K2X A;  1R6Z A;  1Z7N E;  2XXH A;  2VPO A;  3JV9 A;  2AL4 A;  4PE3 A;  3IOR A;  4R2B A;  1ZLQ A;  3FXB A;  4OVT A;  4UAB A;  2R6G E;  3S9N C;  3C4M A;  1LFH A;  2CZI A;  4WXJ A;  2XWI A;  4DLD A;  2DS9 A;  1MY0 A;  3UA8 A;  2B3F A;  1FSA A;  3KFM A;  3O97 A;  4JB7 A;  2Z8D A;  4KCD A;  3E9X A;  1FW0 A;  4OET A;  4I62 A;  4IO3 A;  1MM7 A;  5AA2 B;  2F8D A;  4YZZ A;  2O51 A;  4MCO A;  4TOZ A;  2NUV A;  1GV8 A;  3LSX A;  1JET A;  3PUZ E;  1PB8 A;  4LON B;  1B5J A;  1NNP A;  4GFR A;  2CEX A;  1QVS A;  4GVO A;  3KC0 A;  1XC1 A;  3C31 A;  2H4I A;  1LEV A;  4N8Y A;  3WAF A;  3O9P A;  5IGA A;  2XXW A;  5AA2 A;  1AOV A;  3H4Z A;  4AQ4 A;  3OSR A;  1YXI A;  3FXU A;  5F1Q A;  3H6T A;  2QMX A;  4IO7 A;  1OMP A;  1EYI A;  2OWT A;  4OFJ A;  1MH3 A;  3JYR A;  2PX1 A;  1TWY A;  2FIE A;  2Q8M A;  1SW2 A;  5ITP A;  1FBH A;  4PBQ A;  2RC8 A;  2XXY A;  3D4C A;  4GWS A;  1DPP A;  4OVQ A;  2IEE A;  1II5 A;  1USY E;  5M2V A;  4G61 A;  4HW8 A;  1SDX A;  3RPW A;  2O7I A;  2VHA A;  1DPE A;  4OVS A;  3MVX A;  1MS7 A;  1BTJ A;  4GD5 A;  1FTA A;  1TXF A;  2QSX A;  3THI A;  3MC2 A;  1LFG A;  2QL3 A;  2I3W A;  4X8R A;  1LBW A;  2DXY A;  1MM6 A;  4G77 A;  5I84 A;  1LBC A;  3Q29 A;  1NNT A;  3LR1 A;  1CE2 A;  3CRB A;  4JWY A;  3QIM A;  2V3Q A;  4NF0 A;  3TZA A;  4OZ9 A;  3S9L C;  1LAX A;  5CMM A;  4OMB A;  5I2K B;  4MEV A;  3RNN A;  2YLN A;  1I6Q A;  3K4U A;  4FBP A;  2R71 A;  1FCK A;  4EF1 A;  3MYU A;  4LN5 A;  3KJ7 A;  2I6E A;  3RPL B;  3ZSF A;  3F11 A;  4GQO A;  1M5E A;  2P0S A;  1O63 A;  2LAO A;  2HEU A;  5IZZ A;  4XKP A;  2QS3 A;  3FJ7 A;  4N17 A;  1I6A A;  5JTY B;  2HPG A;  5I2K A;  4IR8 A;  1BK4 A;  3VFJ A;  5JEI A;  4AS5 A;  5ISU A;  3G3G A;  3RPL A;  3W9W A;  3QSL A;  5T3J A;  1VSO A;  3E3K A;  1OVT A;  4PP0 A;  4N91 A;  4R6Y A;  1CB6 A;  4F39 A;  4TQU Q;  4AS4 A;  1IMB A;  5LOM A;  1D9Q A;  2M8C A;  4MNP A;  5JTY A;  4EQ9 A;  4IY6 A;  5KDT B;  2MKZ A;  1SPI A;  4BDM A;  1NL5 A;  1OLA A;  4ZED A;  1RYO A;  1ZMG A;  1NV5 A;  3KN8 A;  3K02 A;  1SW5 A;  1DTG A;  1XOC A;  3ODB A;  3AXF A;  4NF6 B;  4Q5T A;  4ESW A;  4YB5 A;  3PGF A;  1S7Y A;  2PYY A;  1Y3P A;  3RGY A;  5A5X B;  4YMB A;  3MPL A;  1SYH A;  5KDT A;  1KA1 A;  4KYS A;  4EF2 A;  3GYY A;  3PD8 A;  4IO5 A;  1FPK A;  2F34 A;  1NV3 A;  3UGW A;  4IGR A;  4RK2 A;  4BDR A;  1EU8 A;  3VV5 A;  1FQD A;  2THI A;  4NF6 A;  2B4M A;  4U21 A;  3PUV E;  5F7V A;  2RCB A;  4GWW A;  3TEP A;  5A5X A;  5EQ9 A;  1B4Z A;  1WDN A;  1FPD A;  5DYH A;  3PPO A;  1WOD A;  4MFI A;  3UOR A;  1NMU A;  1EYJ A;  3C36 A;  3SEV A;  3NOH A;  4OER A;  1OQH A;  3T9V A;  4OTE A;  3IJX B;  1JNF A;  3KN3 A;  4JVD A;  3TYH A;  3T9H B;  3KBZ A;  3MZB A;  1LAG E;  5DEX B;  2OX3 A;  4KFQ A;  3RT6 B;  3QAX A;  4FED A;  1LLS A;  5FTH A;  1AIV A;  3BIH A;  4NED A;  2O84 X;  1D9Y A;  1IME A;  1FQE A;  5ET5 A;  5I59 B;  4LUB A;  2XX9 A;  3RQT A;  3FJM A;  1NNK A;  1EZO A;  1Y9U A;  2GQ1 A;  5DEX A;  1Z7M E;  5FTI A;  4LAT A;  3FVO A;  3KG2 A;  4O3A A;  2XXR A;  1A99 A;  3DP6 A;  3N94 A;  3EHU A;  3OO6 A;  2W7Y A;  1GTK A;  3VLV A;  1LAF E;  1N0T A;  2XX8 A;  2VOZ A;  4O3C A;  1NV1 A;  1IQ7 A;  5I59 A;  5JK4 A;  3N26 A;  4GOT A;  2F78 A;  2ANJ A;  2FVZ A;  4JBZ A;  4F22 A;  2VGQ A;  4F19 A;  2Y7W A;  1YCJ A;  4RXL A;  4DE8 A;  4H0W A;  4GF8 A;  3ECR A;  2ABH A;  3FVN A;  3SKP A;  4QFN A;  3R6U A;  5LDZ A;  1MDP 1;  1XVX A;  4PF6 A;  5H8H B;  3CIJ A;  3A3U A;  1MY4 A;  1URG A;  1JEU A;  3MQ9 A;  1A7L A;  1MY1 A;  4O7M A;  2ZYN A;  1Y4C A;  4BLA A;  2WKY A;  4PET A;  4F1U A;  4PDH A;  1UIU A;  3UN6 A;  3B8B A;  1XS5 A;  4X48 A;  1NV0 A;  5H8H A;  2H5Y A;  3U65 A;  1LBZ A;  4U1Z A;  1WVJ A;  2XHD A;  3R7X A;  5L9S A;  4H8I A;  3CI8 A;  2GFE A;  1H76 A;  3S9M C;  4OES A;  4QFK A;  4GWY A;  3ILU B;  5CBS A;  1FPG A;  1DBZ A;  4H46 A;  2P1S A;  2XXQ A;  4DXB A;  1B4H A;  3T96 B;  2QRY A;  1P1Q A;  2Q74 A;  4GWZ A;  4QFP A;  1VDW A;  4N81 A;  1YZ0 A;  4LA9 A;  4N8G A;  4ZEK A;  2Q88 A;  1YYZ A;  2OBG A;  1NV4 A;  2O1M A;  4EXL A;  4QSC A;  3C35 A;  1URS A;  3U94 A;  3FIR A;  4JWX A;  2OK2 A;  3K00 A;  2CEY A;  4C0R A;  1ELJ A;  1POT A;  1DK4 A;  3BIG A;  3H03 A;  2F3B A;  3VVE A;  4MX6 A;  1SW1 A;  3K1N A;  3FXQ A;  2DXR A;  4NHB A;  4ZEF A;  3HFU A;  4YB6 A;  3VXC A;  3D4G A;  3CR9 A;  4KPT A;  3LSF B;  4GL8 A;  4KYE A;  4LZ8 A;  4NE4 A;  5F24 A;  2D3I A;  3L6H A;  3PV0 E;  5I56 B;  3LC8 A;  4NTL A;  2F36 A;  2ONR A;  4RYA A;  3VVD A;  4X9T A;  1MQI A;  2A5T B;  2XA5 A;  3OEM A;  4GWX A;  3OEN A;  4JDF A;  4LP2 B;  3H7M A;  4DZ1 A;  4ND9 A;  4QSD A;  2I4B A;  2YPN A;  2UVG A;  1QW0 A;  3HPI A;  4X1B A;  1OLC A;  5EQ7 A;  3IX1 A;  4RA1 A;  3VE1 B;  4U2R A;  3PPP A;  2F35 A;  1XI6 A;  2A5T A;  4GXS B;  4IO6 A;  1FRP A;  4NMY A;  4F2O A;  4NWD A;  3OSQ A;  3D1R A;  1FBG A; 
#chains in the Genus database with same CATH homology
 4NX1 A;  4MMP A;  1NUZ A;  1NV6 A;  1Q9D A;  1G0I A;  4PAI A;  4OAN A;  4G61 A;  2VT5 A;  4OVS A;  4HCY A;  2HXR A;  1FTA A;  4DI3 D;  2Y5K A;  4X8R A;  1LBW A;  1K9Y A;  2KQZ A;  4HE1 A;  4PTK A;  4PAK A;  1FJ9 A;  4JVI A;  2FBP A;  2FHY A;  4N6K A;  2BJI A;  4I40 A;  4XF5 A;  1INP A;  1KA0 A;  2V3Q A;  4NF0 A;  2DE4 A;  4PFR A;  4KXP A;  4MEV A;  3E78 A;  1IMF A;  2Q9T A;  4FBP A;  5EQ8 A;  3MYU A;  4LN5 A;  3RPL B;  3E79 A;  5ET6 A;  4XFE A;  1JP4 A;  2WYP A;  2WYK A;  4PDD A;  1IMA A;  5IZZ A;  1K9Z A;  1FPE A;  4N17 A;  3QMF A;  2HPG A;  4MAG A;  2ZZW A;  5J16 A;  4IR8 A;  1BK4 A;  4P3L A;  4AS5 A;  3RPL A;  3W9W A;  1FPI A;  4OVR A;  5T3J A;  2P3N A;  1G0H A;  4N91 A;  2QVU A;  2R8T A;  4AS4 A;  1IMB A;  2WBB A;  1CNQ A;  4P9K A;  2WEF A;  1D9Q A;  4MNP A;  2MKZ A;  4QBA A;  1SPI A;  4MNC A;  5EQA A;  3A29 A;  4JVC A;  2F3D A;  1IMD A;  4PCD A;  5EYG A;  3CHG A;  5I5P A;  1NV5 A;  4PGN A;  1NUX A;  4NQ8 A;  3FBP A;  2XWK A;  4P47 A;  2ZZX A;  4XEQ A;  1KA1 A;  3GYY A;  1FPK A;  1NV3 A;  1RDY A;  5IM2 A;  4PFI A;  4O7I A;  4MHF A;  4QXD A;  5ET8 A;  2KR0 A;  4MJO A;  2B4M A;  4NG7 A;  2WBD A;  2DE2 A;  4GWW A;  4PBH A;  2DVZ A;  2CZK A;  5EQ9 A;  4GX6 A;  3RYD A;  4GWU A;  4P56 A;  1FPD A;  2ZZV A;  1DCU A;  4N6D A;  1NV2 A;  1EYJ A;  3NOH A;  4JVD A;  1AWB A;  2PFY A;  3KBZ A;  2QFL A;  2QVR A;  2OX3 A;  2XWO A;  4X04 A;  4PC9 A;  5I7I A;  4H45 A;  4M1V A;  3BIH A;  1QGX A;  4GX4 A;  5LTC A;  1FJ6 A;  5IZ3 B;  4YIC A;  4HE0 A;  1IME A;  5ET5 A;  2PFZ A;  2GQ1 A;  1RDZ A;  4OA4 A;  2V4C A;  2L5V A;  4I3Y A;  4DI4 B;  4N4U A;  2QVV A;  2CZH A;  4NGU A;  1IMC A;  1LBY A;  2FIX A;  5IZ3 A;  3W9V A;  1FPB A;  4P1L A;  1NV1 A;  5FBP A;  5JK4 A;  4GX3 A;  5CM6 A;  2FVZ A;  3PTY A;  3ISP A;  4HE2 A;  5ET7 A;  2F5X A;  4F19 A;  1LBV A;  3EKI A;  4HXV A;  5LDZ A;  4PF6 A;  5J1D A;  3T0J A;  4NN3 A;  4PF8 A;  5A5L A;  4O7M A;  4PFB A;  2HHM A;  3IFA A;  4PET A;  4F1U A;  4PDH A;  3IFC A;  5ESY A;  4F18 A;  3B8B A;  3ROJ A;  4O8M A;  1NV0 A;  4P1E A;  2HZL A;  2HZK A;  3U65 A;  1LBZ A;  2Y5L A;  2QPQ A;  1NUW A;  3MST A;  1NV7 A;  2VPN A;  3LUZ A;  4HCW A;  1FBE A;  4GWY A;  1FPG A;  1DBZ A;  4H46 A;  2P3V A;  1FBD A;  2Q74 A;  4GWZ A;  3SZP A;  1VDW A;  1FBC A;  5I3S A;  4N81 A;  1FPL A;  1YZ0 A;  2OWZ A;  4N8G A;  1FPF A;  2XXK A;  2VPO A;  4PGP A;  1YYZ A;  4PE3 A;  1NV4 A;  1FBF A;  3FXB A;  4OVT A;  1LBX A;  4UAB A;  1FBP A;  2PCR A;  3T1B A;  2CZI A;  2CEY A;  4NAP A;  2XWI A;  4GBV A;  1FSA A;  3LV0 A;  1DK4 A;  3BIG A;  2F3B A;  4OVP A;  4MX6 A;  3KC1 A;  4GBW A;  4I3E A;  1KZ8 A;  2DDK A;  4NHB A;  3HFU A;  2WX9 A;  4MNI A;  4YZZ A;  1NI9 A;  4MCO A;  5DW8 A;  5F24 A;  1FPJ A;  4PAF A;  4F1V A;  4X9T A;  5EYH A;  1RDX A;  2XA5 A;  2CEX A;  4GWX A;  3KC0 A;  3B50 A;  1LEV A;  4N8Y A;  5IGA A;  5EQ7 A;  5IZ1 A;  1NUY A;  1YXI A;  1EYI A;  2B4L A;  4MIJ A;  1XI6 A;  4P8B A;  2FIE A;  4N15 A;  2Q8M A;  1FRP A;  2DE3 A;  4O94 A;  1FBH A;  4PBQ A;  4GWS A;  4OVQ A;  3D1R A;  1EYK A;  2JJK A;  2XWV A;  1FBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...