1FQEA

Crystal structures of mutant (k206a) that abolish the dilysine interaction in the n-lobe of human transferrin
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
Knots found
sequence length
329
structure length
329
Chain Sequence
b'DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVAHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures and iron release properties of mutants (K206A and K296A) that abolish the dilysine interaction in the N-lobe of human transferrin.
pubmed doi rcsb
molecule keywords SEROTRANSFERRIN
source organism Homo sapiens
molecule tags Metal transport
total genus 100
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2000-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1fqeA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1fqeA02
2HZLA 2P2AA 2DSFA 2P1SA 4RK2A 3IOTA 4XIGQ 1IIWA 3C9HA 1MQIA 1JNFA 2V3TA 2PMSA 3IB2A 2OJTA 2UYFA 2D5WA 5J1DA 3KN7A 4OESA 3C34A 3EPEA 3C36A 4XKQA 1ZKBA 5KCJB 4F1YA 4EQ9A 3VVDA 3CR9A 5FHNA 2DS9A 3K6VA 4O3AA 4F3BA 4HTGA 4EDPA 2E1SA 1MG1A 3MQ9A 3L6GA 3O9PA 4G4PA 4LUBA 1PEBA 1SQYA 1UQWA 5M2VA 4GL8A 3FVKA 5FTIA 1KWHA 5IKBA 1FQCA 1LFHA 4IY6A 2QS3A 1R1NA 3HN0A 3JYRA 4OYVA 4GD5A 5ICTA 4I8CA 1VE4A 5CBRA 2ZYOA 3LSLA 2O69A 1POTA 3FJMA 1CE2A 3V83A 1Z7NE 2H4IA 4ISUA 2RC7A 3VVEA 4BDQA 4ZEKA 1UIVA 4LP2B 4EQBA 1JEVA 4OQOA 4JXIA 3MVXA 5EHMA 3CG3A 5B70A 1Y4TA 3IB1A 4YKJA 2V3QA 1B40A 3OELA 5I2KA 4H67A 4QFNA 4WEDA 2R9JA 5TP9A 4U2RA 4ELQA 5I84A 3SETA 3RPWA 3RLFE 1OLCA 1M5DA 2XXRA 3FXRA 1JQFA 4WEPA 1JEUA 1ANFA 3ZKLA 3H6TA 1N7WA 2RINA 4G8NA 1PB8A 3CRBA 4Z0IA 1DPPA 2I3WA 4DXBA 5H8QA 4KCCA 4IO7A 1IQ7A 5L9SA 4MLQA 4YB6A 1MPDA 4RA1A 1B58A 1B3GA 4X1DA 3C35A 2NOOA 1DMBA 3OSQA 1AIVA 2Z8EA 1Z7ME 4NF4A 5CMMA 3V89B 1MPBA 3O6GA 1BLFA 5H8HB 3U72A 2A5TA 1O7TA 3TTLA 2UVIA 1SW1A 1MH4A 1NL5A 4Q5TA 1BTJA 1LB9A 1MQJA 3LUYA 3GLBA 1LSTA 5L9OA 3VE1B 1WODA 4PFYA 4NMYA 4JB7A 5K2XA 4JWOA 3RY3A 2ZNUA 2Q88A 1LAXA 4EXLA 5I59A 3O29A 4FATA 1P1NA 3FASA 3CFLA 2VD3A 4DE8A 2A5SA 2Z23A 3KGCA 4OFJA 4ZEBA 1N04A 3VVFA 4ZZAA 2H5YA 1YPNA 3U1OA 3GZGA 4ZECA 2Z8FA 1FTKA 2ZXTA 1QW0A 4U22A 1B3HA 3HPIA 3H03A 3PUVE 3PUXE 2F6GA 5DVJA 1B0HA 4POXA 3KBRA 2F97A 3OXNA 3LBSA 5FTHA 2R71A 2YJPA 5CBSA 1B5HA 3UIFA 4MLVA 2B3FA 5KZTA 2Y7WA 4F3GA 4LZ5A 1DTZA 3TODA 1D9YA 4F19A 2I4BA 1A54A 3E9XA 3QUJA 1MH3A 4PFUA 3MVWA 5I2NA 2XXHA 1NH7A 5JTYB 4NWDA 2ZYMA 1FW0A 1MXUA 2RC9A 1UTBA 1B9JA 2XXWA 4OENA 1Y1ZA 4H0WA 4PP0A 4PFWA 2FYIA 2XXUA 1B0LA 1URDA 1N3WA 2QPQA 2WKYA 3CFXA 3IL1B 2G29A 2QRYA 4QFKA 1L5TA 4DIGA 1B7HA 1JETA 3OO8A 5CMKA 1P1UA 1SYIA 4X9TA 1H45A 5F1QA 3PGFA 3W9VA 2VOZA 2YPNA 5H8SA 4H1XA 1BIYA 5BWJA 4O3BA 2BJJX 5CRYA 3VLWA 3KFMA 4N07A 4O3CA 4E0XA 1I6QA 1QUKA 4GOTA 4F18A 4JSOA 4WXJA 3S9NC 4MBPA 2GFEA 3V8XB 3K6WA 3JV9A 3MP6A 4OZ9A 1I6BA 3TCHA 3C33A 2HAUA 1A55A 4G8MA 4BLAA 4FJPA 3IORA 3PUZE 1GV8A 3RT6B 3EHTA 1Y4CA 4JDFA 1OLAA 5I58B 1FQDA 3KJTA 3OO6A 3TMGA 5ITPA 2HCAA 3FD3A 1ZTYA 2DWIA 2V25A 4PQJA 3O66A 3L6HA 2RC8A 4QSDA 3FIRA 4R72A 3G3IA 5AA2A 3KN8A 2I49A 4LQ5A 4X48A 5AA4A 4GF8A 1IZ1A 2XXIA 4ZEIA 3SDFA 3K4UA 1Q35A 1QJMA 1JVYA 3MZBA 2Y7KA 2UYEA 5HM4B 3RT8A 1R9QA 4YAHX 4NWCA 1IUDA 4WKMA 3CG1A 5A5XA 2V84A 3OO7A 3EHUA 1EZ9A 2HXWA 5CMCA 3GXAA 3CI8A 5CI5A 2B65A 4XTCQ 1OIBA 3TQWA 2ONKE 2I4CA 5FHOA 1CB6A 3M3LA 3RTFB 1PDAA 4ZS9A 1PB9A 3MUQA 4IGTA 5DTBA 5KDTA 3SEWA 2XXVA 1NMUA 4MH5A 4RXLA 3R7XA 3MBPA 4OEUA 4R73A 4R74A 5CM6A 2GH9A 4KHZE 5L9MA 1B32A 4YMBA 5AA1A 3TDJA 1MXWA 3O6IA 4BDLA 3UA8A 1USYH 3TPAA 2LAOA 2V93A 4IO3A 4POWA 1RKMA 1AH5A 2B3BA 3E13X 3IX1A 3TUSA 1GR2A 2G93A 1LB8A 2DE3A 5I56A 1WDNA 3OOAA 1D4NA 1B7UA 1ZIUA 4BDMA 3PMWA 4QSCA 1NNKA 4R9FA 4RPNA 1P1WA 1B51A 1TFDA 1OVTA 4F2OA 1A7LA 1OQHA 4LQ2A 2DXYA 4X1BA 3MP1A 1SW4A 3KG2A 3RTWB 1QULA 2YLNA 2QSXA 1FTOA 2AL5A 1Y3PA 1LFGA 2HEUA 3BFTA 3CSGA 4G2ZA 1POY1 1XC1A 3PU5A 2OWSA 1B3LA 1NFTA 1FQEA 3SEVA 1FQBA 1YCJA 3EN3A 1USYE 3E4RA 1TT1A 1HSJA 2HFBA 2DE4A 4EUOA 2OBGA 3FVNA 1S9TA 3QAXA 1R9LA 3N6UA 2H98A 3IK6B 4KR5A 5ELVA 3IO6A 5TP9B 4H8IA 3GBAA 2PBWA 4IGRA 1N3XA 2O1MA 2REGA 3MVZA 1B3FA 1LCFA 3T22A 4KD5A 1AL3A 3DLNA 4YB5A 2I0CA 5TU0A 3FGSA 4TOZA 4UACA 3IB0A 4YKKA 2Y7IA 2HQ0A 3H4ZA 4U23A 3MPKA 1H76A 2PT1A 4ONYA 1XHYA 1IEJA 5AE4A 3SEYA 3KEIA 1B4HA 5H8QB 3TFLA 2DVCA 2DXRA 2X7QA 4R75A 3TZAA 1NNPA 2GHAA 4G68A 4KYSA 2X26A 4ESXA 1MM7A 2DWJA 4FE8A 4OTEA 4NF4B 2NUVA 4YB7A 4BDOA 1B1XA 3K1NA 4YZZA 3MP8A 4KYEA 4U21A 4KQPA 3MJNA 2A5TB 3KSJA 4H5FA 3VLVA 3USDA 4NF8A 3T9XB 3O6HA 3BKIB 2KLFA 3U92A 1N76A 1B52A 4GRKA 4YICA 2Z8DA 2O7UA 1MY4A 4XKNA 1A8EA 1P1OA 4NF5A 3G3JA 3O28A 4P0IA 3PV0E 4MFIA 1QKAA 4U4SA 5I59B 5DT6A 3T66A 2ZYKA 3K6XA 4U4XA 3FJ7A 3QUFA 3FJGA 4LATA 1JW1A 1BKAA 3PPNA 5H8FA 5ISUA 2CMOA 1MRPA 1LAGE 3DM0A 3TQLA 1MXXA 3RUMA 3G7WA 2H99A 3B6QA 3H6WA 4DCYA 2UVHA 4H5GA 1FQFA 4ZZEA 4K3FA 2O1LA 2XXYA 4QRZA 3TKDA 4FEBA 2DQVA 5BUUA 2XD2A 3TYHA 3O97A 1AOVA 4LONB 3R26A 4GQOA 3DP6A 5I2NB 1MPCA 4F1UA 1Y20A 4R2FA 1TWYA 2DVZA 4F1VA 4BDNA 4JWYA 3N26A 1UTBB 3MC2A 2D3IA 1UTHA 1S7YA 2E0SA 4H65A 1SVXB 4RNSA 4OERA 2QMXA 3A3CA 4R6YA 1J1NA 1SD3A 1S50A 1SI0A 4QHQA 2F35A 4I9DA 2VD2A 4ZEFA 1SI1A 3HCQA 2I3VA 3G3HA 4OHNA 3VDFA 2P0SA 3I3VA 4FECA 4IO6A 4DXCA 1US4A 3TTMA 4GWOA 2HZKA 3Q28A 1Y9UA 3B7DA 1GVCA 4OFLA 1QKBA 3FATA 1IXCA 4HCWA 4M4GA 2NVUB 1H3DA 3C32A 1MXYA 1PC3A 3KSXA 4XKPA 1N0TA 3IOUA 1IXIA 3EF7A 2IA4A 1XVXA 1P99A 4ZE9A 3HV1A 3ONMA 2QL3A 3LSWA 2ONSA 4YMAA 5EHSA 2I6EA 4MF3A 3C31A 3W9WA 3HO7A 4HCYA 3FVGA 3LSFB 5TPAA 2Q8JA 4RYAA 3N6TA 2IEEA 3TEPA 3OSRA 3ILTB 1B2HA 2F7CA 3PPRA 2V3UA 3FZVA 3OMBA 5DEXA 3S4UA 2I0BA 4Q30B 5L8DA 2D21A 3IAZA 1PBPA 3M3FA 2ALUA 3TCFA 3IO4A 1MS7A 4R2BA 4DCXA 3EQ1A 3V5AA 5AA2B 1MQGA 4QF9A 1SW5A 5AA4B 5CMBA 1B05A 1EU8A 4HS7A 4XKRA 1O63A 3HHGA 2VHAA 1ATGA 2ZMBA 4DXUA 1MDQA 1D3KA 5A5XB 2Y84A 3S9LC 4P11A 1AMFA 4ELPA 2THIA 3PD9A 2PVUA 4NF6B 4EF1A 3K00A 2UXAA 3SKPA 1EH3A 5I57A 2QS2A 1WVJA 1M5BA 4F3SA 1SW2A 2ZNSA 3VXBA 4LZ8A 2PYYA 3K2DA 5KDTB 1Y3QA 4EF2A 3MVYA 2ONRA 3QK6A 1QVSA 3U94A 1DSNA 5H8NA 2ZYNA 3THIA 3CSBA 4DLDA 1R6ZA 4R6KA 3Q26A 1FTLA 3IOWA 3EHSA 2OWTA 3TAJA 3K1MA 4GLIA 1JW5A 3PUYE 1B1HA 1D9VA 1NKXA 3ODBA 4YU0A 3H3GA 4OVJA 1ZMGA 1XS5A 2F8DA 1B6HA 5I56B 4LA9A 2GHBA 2ESNA 1RYXA 4NTLA 4C1UA 3OEKA 4RPOA 1P1QA 2XXPA 3T9UA 3S9EA 1QUIA 4ND9A 2F6PA 5AA2D 2XX9A 5FHMA 2AL4A 3QSLA 4YKPA 1OQGA 2RCAA 3PPPA 2ZNTA 4OXVA 1XOCA 3T93B 1DOTA 2XXTA 4I62A 2O6AA 4KFQA 3UGWA 3LSXA 3QIMA 2F5XA 1A40A 4R9GA 4TLMB 2H25A 1LBCA 2QS4A 3TCGA 4L17A 3GBBA 3JZJA 1M5EA 2XD3A 1LAHE 3TTKA 3UK4A 1VSOA 3SERA 5KCJA 4ELOA 1FQAA 3ZKKA 1ZBMA 2F36A 3K0VA 2Y7RA 4KYDA 1HSLA 2CZLA 4QFOA 2O68A 5B7DA 4NE4A 3RQTA 4G68C 3VFJA 1M5FA 1MY1A 3G3FA 3SEXA 4TQUQ 1TFAA 3RN8A 1OMPA 3MZ1A 3BFUA 5I2KB 1IXHA 4KPTA 3PUWE 2DE2A 1VFDA 1XVYA 1IITA 3H06B 1PBQA 3Q29A 1B3EA 3P7IA 1LGBC 1FTMA 3T9HB 3M8UA 4IO2A 3LC8A 4F22A 4GXAA 3PMXA 5K2YA 1GGGA 2O7IA 4G68B 4ZEDA 1MY2A 3Q25A 4OMBA 1F9BA 3ZSFA 2QS1A 1A99A 3FVOA 4FAJA 3DP4A 4OWDA 2OCUA 2Q89A 5F7VA 4I1DA 2F7BA 3K02A 3N5LA 3U8QA 5AA3A 1LBBA 4N6PA 3TELA 1Y3NA 1LCTA 4RY1A 2DYXA 1T0KA 3R6UA 3KN3A 4NF8B 2VP1A 3DELB 3HSTA 3UN6A 2DOJA 3IJOB 3KJ7A 5ITOA 4ELRA 3G3KA 3RNNA 5JK4A 2Y7PA 4R6HA 4BDRA 2OK2A 4IO4A 3T9VA 4NF5B 4PETA 4ESWA 4OFOA 3FUZA 1B5JA 1YAEA 3F11A 1H43A 2DP8A 4LZ7A 2VGQA 2O51A 4P0GA 3H6VA 3A3UA 2OLBA 4GVOA 1DTGA 3I6VA 3FXUA 5H8FB 3PD8A 3KZGA 4AB6A 1VR5A 5HBCA 3LR1A 3IJXB 4PFTA 3H6UA 3PPQA 1A8FA 1I6AA 1ZU0A 3TTNA 2HAVA 2RCBA 1MM6A 5IAIA 4DZ1A 5ICQA 3OO9A 2XXQA 5H8HA 4IY5A 1MQHA 4FORA 2I58A 3S2VA 4F29A 4HW8A 4QFLA 4N13A 1FCKA 3OENA 4XXUA 2I48A 2UVJA 2F7AA 3W15C 1N84A 1MXVA 3M3KA 1H44A 3HHFA 4EXKA 1MY3A 4TLLB 3B6WA 1B46A 2RKMA 3K1PA 1B7ZA 5LOMA 2DWHA 2F34A 2Q2CA 3QYTA 3O2AA 1UTHB 4F31B 3S9MC 1SBPA 2AIXA 3IR1A 1NH8A 2X7PA 4Q8RA 4M1VA 3D4GA 3MZ9A 2H9BA 4EQ7A 4GIZA 4ZDMA 2XX7A 4G8HA 4ZE8A 1ZJLA 4F39A 2GRVA 1XT8A 2XX8A 3MW0A 4QSEA 3PMVA 4Z7EA 3T96B 1US5A 3VXCA 5HPQA 2O84X 1MY0A 4U1OA 1MDP1 2Q2AA 3FV1A 5DYHA 1URGA 3QXMA 1EZPA 2OZZA 1BP5A 2FA7A 1RYOA 3FV2A 1B5IA 5JTYA 1M5CA 1N7XA 5JEIA 1SDXA 4U1ZA 3WAEA 1JVXA 3OEMA 3OD7A 3ILUB 5TPAB 4DDDA 3E3KA 3IOVA 4AB5A 4QFPA 3K6UA 1O64A 3U93A 4ECFA 4LVQA 2PT2A 5DEXB 4H8JA 1HSEA 1Y1MA 3KOTA 3I5OA 1IXGA 3VLUA 1UIUA 1TXFA 1Q1KA 1YTVA 3TTRA 2NXOA 2XHDA 2PX1A 3A09A 1NNFA 4G77A 3B6TA 3H7MA 4IO5A 4UA8A 4RK9A 3UORA 2FNCA 3PPOA 2W7YA 3CFZA 1VFEA 3ZS6A 3UP9A 2QJEA 4F2QA 4GL0A 1NNTA 1B4ZA 1ZLQA 1MXZA 5CC2A 4GFRA 4AQ4A 1MQDA 4JBZA 3SEUA 4KI0E 3RGYA 1LAFE 1LFIA 1II5A 4IB2A 2M8CA 5I57B 1OVBA 4RJZA 3D4CA 1QUJA 4NEDA 3VV5A 1ELJA 4GXSB 5I58A 4KCDA 2R6GE 1I69A 5H8NB 2ANJA 4PE5B 4Q0CA 3BBRA 4H6DA 1URSA 2UVGA 1DPEA 3SESA 2DWAA 1JW4A 2F78A 3CIJA 2ABHA 4JWXA 1FTJA 3MPLA 4JSDA 2RF1A 2AYSA 4F3PA 1SYHA 1GTKA 3K01A 4FIMA 4OETA 4NF6A 4YKIA 4FEDA 5DVFA 3N94A 2Z22A 3MAMA 2NWJA 5DVIA 1PB7A 1LLSA 4THIA 3WAFA 5EYFA 2REJA 2QMWA 4OEVA 2XXXA 3CVGA 3DP8A 3FXQA 3KOSA 4E0WA 4C1TA 1EZOA 3ECRA 3AXFA 3MWBA 2Q9TA 3G3GA 3C4MA 4C0RA 3Q27A
chains in the Genus database with same CATH superfamily
2HZLA 2P2AA 2DSFA 2P1SA 4RK2A 3IOTA 4XIGQ 1IIWA 3C9HA 3PTYA 1MQIA 1JNFA 2V3TA 2PMSA 3IB2A 2OJTA 2UYFA 2D5WA 5J1DA 3KN7A 4OESA 3C34A 3EPEA 3C36A 4XKQA 1ZKBA 5KCJB 4F1YA 4EQ9A 3VVDA 3CR9A 5FHNA 2DS9A 4PAFA 3K6VA 2VT5A 4O3AA 4F3BA 4HTGA 4EDPA 2E1SA 1MG1A 3MQ9A 3L6GA 3O9PA 4G4PA 1FBGA 4LUBA 1PEBA 1SQYA 1UQWA 5M2VA 4GL8A 2ZZVA 3FVKA 5FTIA 1KWHA 5IKBA 1FQCA 1LFHA 4IY6A 2QS3A 1R1NA 3HN0A 4PAIA 3JYRA 4OYVA 3GYYA 4GD5A 5ICTA 4I8CA 1VE4A 4P47A 5CBRA 2ZYOA 3LSLA 4OVRA 1FTAA 2O69A 1POTA 3FJMA 4OVQA 1CE2A 3V83A 1Z7NE 2H4IA 4ISUA 2KQZA 2RC7A 3VVEA 4BDQA 4ZEKA 1UIVA 4LP2B 4EQBA 1JEVA 4OQOA 4JXIA 4KXPA 3MVXA 4NGUA 1LBVA 5EHMA 3CG3A 5B70A 1Y4TA 3IB1A 4YKJA 2V3QA 1B40A 3OELA 5I2KA 4H67A 4QFNA 4WEDA 2R9JA 1FPGA 5TP9A 4PDHA 4U2RA 4ELQA 5I84A 3SETA 3RPWA 3RLFE 3SZPA 1OLCA 1M5DA 2XXRA 3FXRA 1JQFA 4WEPA 2CZHA 1JEUA 1ANFA 2CZIA 5FBPA 3ZKLA 3H6TA 1N7WA 2RINA 1NV5A 4G8NA 1PB8A 2L5VA 3CRBA 4Z0IA 1DPPA 4DI4B 3BIHA 4NHBA 2I3WA 4DXBA 5H8QA 4KCCA 4IO7A 4DI3D 1IQ7A 5L9SA 4MLQA 4YB6A 1MPDA 4RA1A 1B58A 1B3GA 4X1DA 3C35A 2NOOA 1DMBA 3OSQA 4N91A 1AIVA 2Z8EA 1Z7ME 1NUWA 4NF4A 5CMMA 3V89B 2HXRA 1MPBA 3O6GA 4O94A 1BLFA 5H8HB 3U72A 4PTKA 5I7IA 2P3VA 5F24A 2HPGA 2A5TA 4GWUA 2JJKA 5EQ9A 1O7TA 3TTLA 2UVIA 1CNQA 1SW1A 1MH4A 1NL5A 4Q5TA 1BTJA 1LB9A 1MQJA 3LUYA 2Q8MA 3GLBA 1LSTA 5L9OA 3VE1B 4N6KA 1WODA 4PFYA 4NMYA 4JB7A 5K2XA 4JWOA 3RY3A 2ZNUA 2QVRA 2Q88A 1LAXA 4EXLA 5I59A 3O29A 4FATA 1P1NA 3FASA 3CFLA 1NUZA 2Q74A 2VD3A 1VDWA 4DE8A 2A5SA 2Z23A 3KGCA 4OFJA 4ZEBA 1N04A 3VVFA 4ZZAA 4O7IA 2H5YA 1YPNA 3U1OA 3GZGA 4OVTA 4ZECA 4NQ8A 2PFYA 2Z8FA 1FTKA 4GWXA 2ZXTA 4QBAA 1QW0A 4U22A 2WBDA 1NUXA 1B3HA 3HPIA 3H03A 3PUVE 3PUXE 2F6GA 5DVJA 1B0HA 4POXA 3KBRA 2F97A 3OXNA 3LBSA 5FTHA 2R71A 2YJPA 4P1EA 1D9QA 5CBSA 4PF6A 1B5HA 1SPIA 2P3NA 3UIFA 4MLVA 2B3FA 5KZTA 2Y7WA 4F3GA 2B4MA 1DK4A 4LZ5A 1JP4A 1DTZA 3TODA 1D9YA 4F19A 2I4BA 1A54A 3E9XA 3QUJA 1MH3A 4PFUA 3MVWA 5I2NA 2XXHA 1NH7A 5JTYB 4NX1A 4NWDA 2ZYMA 1FW0A 4MCOA 1MXUA 5IGAA 2RC9A 1UTBA 1B9JA 2XXWA 4OENA 1Y1ZA 4H0WA 4PP0A 4PFWA 2FYIA 2XXUA 1B0LA 3NOHA 1URDA 1N3WA 2QPQA 4N8YA 2WKYA 3CFXA 5IZZA 3IL1B 2G29A 2QRYA 4QFKA 1L5TA 3LV0A 4DIGA 1B7HA 1JETA 4P1LA 1KA1A 3OO8A 1P1UA 5CMKA 1SYIA 4GBWA 4X9TA 1H45A 5F1QA 4FBPA 3PGFA 3W9VA 2VOZA 1FBPA 2YPNA 5H8SA 4H1XA 3EKIA 1BIYA 5BWJA 4O3BA 2BJJX 4GWSA 1FPEA 5CRYA 3VLWA 3KFMA 5LDZA 4MEVA 4N07A 4O3CA 4E0XA 1I6QA 1QUKA 4GOTA 4GX6A 2OWZA 4F18A 5J16A 4JSOA 4WXJA 3S9NC 4MBPA 2GFEA 3V8XB 3K6WA 3JV9A 3MP6A 2V4CA 2Y5LA 3T1BA 4OZ9A 1I6BA 3TCHA 3C33A 2HAUA 4I40A 1A55A 4G8MA 4BLAA 4FJPA 1FBEA 3IORA 3PUZE 1GV8A 3RT6B 3EHTA 1Y4CA 4JDFA 1OLAA 5I58B 1FQDA 3KJTA 3OO6A 3TMGA 4GWZA 5ITPA 2HCAA 3FD3A 1FPJA 1ZTYA 4PF8A 2DWIA 2V25A 4PQJA 3O66A 3L6HA 2RC8A 4QSDA 3FIRA 4R72A 3G3IA 5AA2A 3KN8A 2I49A 4LQ5A 4X48A 5AA4A 4GF8A 1IZ1A 2XXIA 4ZEIA 3SDFA 3K4UA 1Q35A 1QJMA 1JVYA 3MZBA 2Y7KA 2UYEA 1EYKA 4P8BA 5HM4B 3RT8A 1R9QA 4YAHX 4NWCA 1IUDA 4HE2A 4WKMA 3U65A 3CG1A 5A5XA 2V84A 3OO7A 3EHUA 1EZ9A 2HXWA 5CMCA 5LTCA 2WX9A 3GXAA 5EQ7A 2WYKA 3CI8A 5CI5A 2B65A 4XTCQ 1OIBA 4PGNA 1FPFA 3TQWA 2ONKE 2I4CA 5FHOA 1CB6A 3M3LA 3RTFB 1PDAA 4ZS9A 2FIXA 2GQ1A 1PB9A 3MUQA 4IGTA 5DTBA 5KDTA 3ISPA 3SEWA 2XXVA 1NMUA 4MH5A 4RXLA 3MSTA 3R7XA 3MBPA 4PGPA 4OEUA 4R73A 4R74A 5IM2A 5CM6A 2GH9A 4KHZE 5L9MA 1B32A 4YMBA 5AA1A 3TDJA 1MXWA 3O6IA 4BDLA 4GX3A 3UA8A 1USYH 3TPAA 2LAOA 2V93A 4IO3A 4MJOA 4POWA 1RKMA 4N8GA 1AH5A 2B3BA 3E13X 3IX1A 4PCDA 3TUSA 1GR2A 2G93A 1LB8A 2DE3A 5I56A 1WDNA 3OOAA 1D4NA 1B7UA 2XA5A 1ZIUA 4BDMA 3PMWA 4QSCA 1NNKA 4R9FA 4QXDA 4RPNA 1P1WA 1B51A 1TFDA 1OVTA 4F2OA 1A7LA 3E78A 1OQHA 4LQ2A 1IMAA 2DXYA 4X1BA 3MP1A 1SW4A 3KG2A 1AWBA 3RTWB 1QULA 2YLNA 2QSXA 1FTOA 2AL5A 5IZ3A 1Y3PA 1LFGA 2HEUA 3BFTA 3CSGA 4G2ZA 4N81A 1POY1 1XC1A 3PU5A 4H45A 2OWSA 1B3LA 1NFTA 3B8BA 5ET8A 1FQEA 3SEVA 1FQBA 1YCJA 3EN3A 1RDYA 1NV6A 1USYE 3E4RA 1TT1A 1HSJA 1G0HA 2HFBA 2DE4A 4EUOA 2OBGA 3FVNA 1S9TA 1YZ0A 3QAXA 1R9LA 3N6UA 4NG7A 2H98A 3IK6B 4KR5A 5ELVA 3IO6A 4G61A 2FBPA 5TP9B 4H8IA 3GBAA 2PBWA 4IGRA 1N3XA 2O1MA 2REGA 3MVZA 3MYUA 1B3FA 1LCFA 3T22A 4KD5A 2XWIA 1AL3A 3DLNA 4YB5A 2I0CA 5TU0A 3FGSA 4TOZA 4UACA 3IB0A 4YKKA 2Y7IA 3B50A 2HQ0A 3H4ZA 4U23A 3MPKA 1H76A 2PT1A 4PBHA 4ONYA 4XEQA 1XHYA 1IEJA 5AE4A 3SEYA 3KEIA 1B4HA 4P9KA 5H8QB 3TFLA 1FSAA 2DVCA 2DXRA 2X7QA 1KZ8A 4R75A 4GBVA 3TZAA 1NNPA 2GHAA 4GX4A 2F3DA 4G68A 4XF5A 4MNCA 4KYSA 2X26A 3KC1A 4ESXA 1MM7A 2DWJA 4FE8A 4OTEA 4NF4B 2NUVA 4YB7A 4BDOA 1B1XA 3K1NA 4YZZA 4P56A 3MP8A 4KYEA 4U21A 4KQPA 3MJNA 1NV7A 2A5TB 5I3SA 3KSJA 4H5FA 3VLVA 3USDA 4NF8A 3T9XB 1EYIA 3O6HA 3BKIB 2KLFA 3U92A 3RPLA 1N76A 1B52A 4PE3A 4GRKA 1NI9A 2Z8DA 4YICA 2O7UA 1MY4A 4XKNA 1A8EA 1P1OA 4NF5A 4H46A 3G3JA 3O28A 4P0IA 3PV0E 4MFIA 1QKAA 4U4SA 5I59B 5DT6A 3T66A 2ZYKA 3K6XA 4U4XA 3FJ7A 3QUFA 4JVCA 3FJGA 4LATA 1JW1A 1BKAA 3PPNA 1BK4A 2B4LA 5H8FA 4GWWA 5ISUA 2CMOA 1MRPA 1LAGE 3DM0A 3TQLA 1MXXA 2BJIA 3RUMA 3G7WA 2H99A 3B6QA 3H6WA 4DCYA 2UVHA 1KA0A 4H5GA 1FQFA 4ZZEA 3FBPA 4K3FA 2O1LA 2XXYA 4QRZA 3TKDA 4FEBA 2DQVA 5BUUA 2XD2A 3TYHA 1FBDA 3O97A 2WYPA 4XFEA 1AOVA 3BIGA 4LONB 4PFBA 3R26A 4GQOA 3DP6A 1FPKA 5I2NB 1MPCA 4F1UA 1Y20A 4R2FA 1TWYA 3FXBA 2DVZA 4F1VA 4BDNA 4JWYA 3N26A 1UTBB 3MC2A 2D3IA 1UTHA 1YXIA 1S7YA 2E0SA 4H65A 3KBZA 1SVXB 4RNSA 4OERA 2QMXA 3A3CA 4R6YA 1J1NA 1SD3A 1S50A 1SI0A 4QHQA 2F35A 4I9DA 2VD2A 4ZEFA 1SI1A 3HCQA 2I3VA 3G3HA 4OHNA 3VDFA 2P0SA 3I3VA 4FECA 4IO6A 4DXCA 1US4A 3TTMA 4GWOA 2HZKA 3Q28A 4PBQA 1Y9UA 3B7DA 1GVCA 4OFLA 1QKBA 4NF0A 3FATA 1IXCA 4HCWA 4M4GA 2MKZA 2NVUB 1H3DA 3C32A 1MXYA 1PC3A 1FBFA 3KSXA 4XKPA 1N0TA 3IOUA 1IXIA 3EF7A 2IA4A 1XVXA 1P99A 4ZE9A 3HV1A 3ONMA 2QL3A 3LSWA 2ONSA 4YMAA 5EHSA 2I6EA 4MF3A 3C31A 4I3EA 3W9WA 3HO7A 2CEYA 4HCYA 2QVUA 1IMCA 3FVGA 3LSFB 5TPAA 2Q8JA 4RYAA 3N6TA 2IEEA 4LN5A 3TEPA 3OSRA 3ILTB 1B2HA 2F7CA 3PPRA 2V3UA 3FZVA 3OMBA 5DEXA 3S4UA 2I0BA 4Q30B 5L8DA 2D21A 3IAZA 1PBPA 4MX6A 1NV2A 3M3FA 2ALUA 3TCFA 3E79A 4MNIA 3IO4A 1MS7A 4N6DA 4R2BA 4DCXA 3EQ1A 3V5AA 5AA2B 4MAGA 1MQGA 4QF9A 1SW5A 5AA4B 5CMBA 1B05A 1EU8A 2F3BA 4HS7A 4XKRA 1O63A 3HHGA 5ET7A 2VHAA 1ATGA 1IMFA 2ZMBA 4NN3A 4DXUA 1MDQA 1D3KA 5A5XB 2Y84A 3S9LC 4P11A 1AMFA 4ELPA 2THIA 3PD9A 2PVUA 3D1RA 4NF6B 4EF1A 3K00A 2UXAA 3SKPA 1EH3A 5I57A 2QS2A 1WVJA 1M5BA 1NV0A 4F3SA 2CEXA 1SW2A 3LUZA 2ZNSA 3VXBA 1EYJA 4LZ8A 2PYYA 3K2DA 4N15A 5KDTB 1Y3QA 4EF2A 3MVYA 2ONRA 3QK6A 1QVSA 3U94A 1DSNA 5H8NA 2ZYNA 3THIA 3CSBA 4PAKA 4DLDA 1R6ZA 4R6KA 3Q26A 1QGXA 1IMDA 2XWKA 1FTLA 3IOWA 2FVZA 3EHSA 5EQAA 2OWTA 3TAJA 3K1MA 4GLIA 1JW5A 3PUYE 1B1HA 1NV4A 1D9VA 1NKXA 3ODBA 1LBWA 4YU0A 4PFRA 3H3GA 4OVJA 1ZMGA 1XS5A 2F8DA 1B6HA 5I56B 4LA9A 4OA4A 2GHBA 2ESNA 1RYXA 4NTLA 4C1UA 3OEKA 4RPOA 1P1QA 4HE1A 2XXPA 3T9UA 3S9EA 1NV1A 1QUIA 1FPBA 4ND9A 2F6PA 5AA2D 2XX9A 5FHMA 2AL4A 1RDZA 2ZZWA 3QSLA 4YKPA 1OQGA 2RCAA 4AS5A 1YYZA 3PPPA 2ZNTA 4OXVA 1XOCA 3T93B 1DOTA 2XXTA 4I62A 2VPNA 2O6AA 4KFQA 3UGWA 3LSXA 3QIMA 4X04A 5IZ3B 2DDKA 2XWOA 1LBYA 2F5XA 1A40A 4R9GA 4TLMB 2H25A 1LBCA 3IFAA 2QS4A 3TCGA 4L17A 3GBBA 3JZJA 1M5EA 1DCUA 2XD3A 1LAHE 4X8RA 3TTKA 3UK4A 4HE0A 1VSOA 3SERA 5KCJA 4ELOA 1FQAA 1FJ6A 3ZKKA 3K0VA 1ZBMA 2F36A 2Y7RA 4KYDA 2CZKA 1HSLA 2CZLA 1IMEA 4QFOA 2O68A 5B7DA 4NE4A 3RQTA 4G68C 2OX3A 4N17A 3VFJA 1M5FA 1MY1A 5ESYA 3G3FA 3SEXA 4TQUQ 1K9ZA 1TFAA 3RN8A 2WEFA 1OMPA 3MZ1A 3BFUA 5I2KB 1IXHA 4KPTA 3PUWE 2DE2A 1VFDA 1XVYA 1IITA 3H06B 1PBQA 3Q29A 1B3EA 3P7IA 1LGBC 1FTMA 3T9HB 3M8UA 4IO2A 3LC8A 4F22A 4GXAA 3PMXA 5K2YA 1GGGA 2O7IA 4G68B 1FRPA 4ZEDA 1DBZA 1MY2A 3Q25A 1G0IA 4OMBA 1F9BA 4I3YA 3ZSFA 4JVDA 2QS1A 1A99A 3FVOA 4FAJA 3DP4A 4OWDA 2OCUA 2Q89A 5F7VA 4I1DA 2F7BA 3K02A 3N5LA 3U8QA 5AA3A 1LBBA 4N6PA 3TELA 1Y3NA 1LCTA 4RY1A 3KC0A 5EYHA 2DYXA 1T0KA 3R6UA 3KN3A 4NF8B 1INPA 2VP1A 3DELB 3HSTA 3UN6A 2DOJA 3IJOB 3KJ7A 5ITOA 4ELRA 3G3KA 3RNNA 5JK4A 3RPLB 2Y7PA 4R6HA 3HFUA 4BDRA 2OK2A 4IO4A 3ROJA 3T9VA 4NF5B 4PETA 4ESWA 4OFOA 3A29A 4HXVA 3FUZA 1B5JA 1NV3A 1YAEA 3F11A 1H43A 2DP8A 4LZ7A 2VGQA 2O51A 4P0GA 3H6VA 3A3UA 2OLBA 4GVOA 1DTGA 2WBBA 4O7MA 3I6VA 3FXUA 5H8FB 3PD8A 3KZGA 2ZZXA 4AB6A 1VR5A 2QVVA 4MMPA 5HBCA 3LR1A 3IJXB 4PFTA 3H6UA 3PPQA 2KR0A 1A8FA 1I6AA 1XI6A 1ZU0A 3TTNA 2HAVA 2RCBA 1MM6A 1FBHA 5IAIA 4DZ1A 5ICQA 2Y5KA 3OO9A 2XXQA 5H8HA 1FPLA 4IY5A 1MQHA 4FORA 3QMFA 2I58A 3S2VA 4F29A 4HW8A 4QFLA 4N13A 5IZ1A 1FCKA 3OENA 4XXUA 2I48A 2UVJA 5ET5A 2F7AA 5DW8A 5A5LA 3W15C 2FHYA 5T3JA 1N84A 1MXVA 1Q9DA 3M3KA 1H44A 3HHFA 4EXKA 1MY3A 4TLLB 3B6WA 4AS4A 5I5PA 1B46A 2RKMA 3K1PA 1B7ZA 5LOMA 2DWHA 2F34A 2Q2CA 3QYTA 3O2AA 1UTHB 4OVSA 4F31B 3S9MC 1SBPA 2AIXA 3IR1A 1NH8A 2X7PA 4Q8RA 4M1VA 3D4GA 3MZ9A 2H9BA 4EQ7A 4GIZA 4ZDMA 2XX7A 4G8HA 4PC9A 1RDXA 3CHGA 2PFZA 4ZE8A 1ZJLA 4F39A 2GRVA 1XT8A 2XX8A 3MW0A 4QSEA 3PMVA 4Z7EA 3T96B 1US5A 4OVPA 3VXCA 5HPQA 2O84X 1MY0A 4U1OA 1MDP1 2Q2AA 4GWYA 3FV1A 5DYHA 1URGA 3QXMA 2XWVA 4O8MA 1EZPA 2OZZA 1BP5A 2FA7A 1RYOA 3FV2A 1B5IA 4NAPA 5JTYA 1M5CA 5EYGA 1N7XA 5JEIA 1SDXA 4U1ZA 3WAEA 1JVXA 3OEMA 2VPOA 3OD7A 2FIEA 5ET6A 3ILUB 5TPAB 4DDDA 3E3KA 3IOVA 4AB5A 4QFPA 3K6UA 1O64A 3U93A 4LVQA 4ECFA 2PT2A 5DEXB 1IMBA 4OANA 4H8JA 2XXKA 1HSEA 1Y1MA 3KOTA 3I5OA 1IXGA 4PFIA 1UIUA 3VLUA 1TXFA 2QFLA 1Q1KA 1YTVA 3TTRA 2NXOA 2XHDA 2PX1A 1LEVA 3A09A 1NNFA 4PDDA 4G77A 3B6TA 3H7MA 4IO5A 4UA8A 4RK9A 3UORA 2FNCA 3PPOA 2W7YA 1NUYA 3CFZA 1VFEA 3ZS6A 3UP9A 2QJEA 4P3LA 4F2QA 4GL0A 1NNTA 1B4ZA 1ZLQA 4UABA 1MXZA 5CC2A 4GFRA 4AQ4A 1MQDA 4JBZA 3SEUA 4KI0E 3RGYA 1LAFE 4MNPA 1LFIA 1II5A 4IB2A 2M8CA 5I57B 1FPIA 1OVBA 4C0RA 2PCRA 5EQ8A 4RJZA 3D4CA 1QUJA 4NEDA 3VV5A 1ELJA 4GXSB 5I58A 1FPDA 3T0JA 4KCDA 2R6GE 1I69A 1LBXA 1LBZA 5H8NB 2ANJA 4PE5B 4Q0CA 2R8TA 3BBRA 4H6DA 1URSA 2UVGA 1FBCA 1DPEA 3SESA 2DWAA 1JW4A 2F78A 3CIJA 2ABHA 4JWXA 1FTJA 3MPLA 4JSDA 2RF1A 3IFCA 2AYSA 4F3PA 1SYHA 2HHMA 1GTKA 3K01A 4FIMA 4MIJA 4OETA 4IR8A 4NF6A 4YKIA 4MHFA 4FEDA 5DVFA 3N94A 2Z22A 3MAMA 2NWJA 5DVIA 1PB7A 1FJ9A 1LLSA 4THIA 3WAFA 5EYFA 2REJA 2QMWA 4OEVA 4JVIA 2XXXA 3CVGA 3DP8A 3FXQA 3KOSA 4E0WA 3RYDA 4C1TA 1EZOA 3ECRA 3AXFA 3MWBA 4N4UA 2Q9TA 3G3GA 3C4MA 1K9YA 3Q27A
chains in the Genus database with same CATH topology
2HZLA 2P2AA 2DSFA 2P1SA 4RK2A 3IOTA 4XIGQ 1IIWA 3C9HA 1MQIA 1JNFA 2V3TA 2PMSA 3IB2A 2OJTA 2UYFA 2D5WA 5J1DA 3KN7A 4OESA 3C34A 3EPEA 3C36A 4XKQA 1ZKBA 5KCJB 4F1YA 4EQ9A 3VVDA 3CR9A 5FHNA 2DS9A 3K6VA 4O3AA 4F3BA 4HTGA 4EDPA 2E1SA 1MG1A 3MQ9A 3L6GA 3O9PA 4G4PA 4LUBA 1PEBA 1SQYA 1UQWA 5M2VA 4GL8A 3FVKA 5FTIA 1KWHA 5IKBA 1FQCA 1LFHA 4IY6A 2QS3A 1R1NA 3HN0A 3JYRA 4OYVA 4GD5A 5ICTA 4I8CA 1VE4A 5CBRA 2ZYOA 3LSLA 2O69A 1POTA 3FJMA 1CE2A 3V83A 1Z7NE 2H4IA 4ISUA 2RC7A 3VVEA 4BDQA 4ZEKA 1UIVA 4LP2B 4EQBA 1JEVA 4OQOA 4JXIA 3MVXA 5EHMA 3CG3A 5B70A 1Y4TA 3IB1A 4YKJA 2V3QA 1B40A 3OELA 5I2KA 4H67A 4QFNA 4WEDA 2R9JA 5TP9A 4U2RA 4ELQA 5I84A 3SETA 3RPWA 3RLFE 1OLCA 1M5DA 2XXRA 3FXRA 1JQFA 4WEPA 1JEUA 1ANFA 3ZKLA 3H6TA 1N7WA 2RINA 4G8NA 1PB8A 3CRBA 4Z0IA 1DPPA 2I3WA 4DXBA 5H8QA 4KCCA 4IO7A 1IQ7A 5L9SA 4MLQA 4YB6A 1MPDA 4RA1A 1B58A 1B3GA 4X1DA 3C35A 2NOOA 1DMBA 3OSQA 1AIVA 2Z8EA 1Z7ME 4NF4A 5CMMA 3V89B 1MPBA 3O6GA 1BLFA 5H8HB 3U72A 2A5TA 1O7TA 3TTLA 2UVIA 1SW1A 1MH4A 1NL5A 4Q5TA 1BTJA 1LB9A 1MQJA 3LUYA 3GLBA 1LSTA 5L9OA 3VE1B 1WODA 4PFYA 4NMYA 4JB7A 5K2XA 4JWOA 3RY3A 2ZNUA 2Q88A 1LAXA 4EXLA 5I59A 3O29A 4FATA 1P1NA 3FASA 3CFLA 2VD3A 4DE8A 2A5SA 2Z23A 3KGCA 4OFJA 4ZEBA 1N04A 3VVFA 4ZZAA 2H5YA 1YPNA 3U1OA 3GZGA 4ZECA 2Z8FA 1FTKA 2ZXTA 1QW0A 4U22A 1B3HA 3HPIA 3H03A 3PUVE 3PUXE 2F6GA 5DVJA 1B0HA 4POXA 3KBRA 2F97A 3OXNA 3LBSA 5FTHA 2R71A 2YJPA 5CBSA 1B5HA 3UIFA 4MLVA 2B3FA 5KZTA 2Y7WA 4F3GA 4LZ5A 1DTZA 3TODA 1D9YA 4F19A 2I4BA 1A54A 3E9XA 3QUJA 1MH3A 4PFUA 3MVWA 5I2NA 2XXHA 1NH7A 5JTYB 4NWDA 2ZYMA 1FW0A 1MXUA 2RC9A 1UTBA 1B9JA 2XXWA 4OENA 1Y1ZA 4H0WA 4PP0A 4PFWA 2FYIA 2XXUA 1B0LA 1URDA 1N3WA 2QPQA 2WKYA 3CFXA 3IL1B 2G29A 2QRYA 4QFKA 1L5TA 4DIGA 1B7HA 1JETA 3OO8A 5CMKA 1P1UA 1SYIA 4X9TA 1H45A 5F1QA 3PGFA 3W9VA 2VOZA 2YPNA 5H8SA 4H1XA 1BIYA 5BWJA 4O3BA 2BJJX 5CRYA 3VLWA 3KFMA 4N07A 4O3CA 4E0XA 1I6QA 1QUKA 4GOTA 4F18A 4JSOA 4WXJA 3S9NC 4MBPA 2GFEA 3V8XB 3K6WA 3JV9A 3MP6A 4OZ9A 1I6BA 3TCHA 3C33A 2HAUA 1A55A 4G8MA 4BLAA 4FJPA 3IORA 3PUZE 1GV8A 3RT6B 3EHTA 1Y4CA 4JDFA 1OLAA 5I58B 1FQDA 3KJTA 3OO6A 3TMGA 5ITPA 2HCAA 3FD3A 1ZTYA 2DWIA 2V25A 4PQJA 3O66A 3L6HA 2RC8A 4QSDA 3FIRA 4R72A 3G3IA 5AA2A 3KN8A 2I49A 4LQ5A 4X48A 5AA4A 4GF8A 1IZ1A 2XXIA 4ZEIA 3SDFA 3K4UA 1Q35A 1QJMA 1JVYA 3MZBA 2Y7KA 2UYEA 5HM4B 3RT8A 1R9QA 4YAHX 4NWCA 1IUDA 4WKMA 3CG1A 5A5XA 2V84A 3OO7A 3EHUA 1EZ9A 2HXWA 5CMCA 3GXAA 3CI8A 5CI5A 2B65A 4XTCQ 1OIBA 3TQWA 2ONKE 2I4CA 5FHOA 1CB6A 3M3LA 3RTFB 1PDAA 4ZS9A 1PB9A 3MUQA 4IGTA 5DTBA 5KDTA 3SEWA 2XXVA 1NMUA 4MH5A 4RXLA 3R7XA 3MBPA 4OEUA 4R73A 4R74A 5CM6A 2GH9A 4KHZE 5L9MA 1B32A 4YMBA 5AA1A 3TDJA 1MXWA 3O6IA 4BDLA 3UA8A 1USYH 3TPAA 2LAOA 2V93A 4IO3A 4POWA 1RKMA 1AH5A 2B3BA 3E13X 3IX1A 3TUSA 1GR2A 2G93A 1LB8A 2DE3A 5I56A 1WDNA 3OOAA 1D4NA 1B7UA 1ZIUA 4BDMA 3PMWA 4QSCA 1NNKA 4R9FA 4RPNA 1P1WA 1B51A 1TFDA 1OVTA 4F2OA 1A7LA 1OQHA 4LQ2A 2DXYA 4X1BA 3MP1A 1SW4A 3KG2A 3RTWB 1QULA 2YLNA 2QSXA 1FTOA 2AL5A 1Y3PA 1LFGA 2HEUA 3BFTA 3CSGA 4G2ZA 1POY1 1XC1A 3PU5A 2OWSA 1B3LA 1NFTA 1FQEA 3SEVA 1FQBA 1YCJA 3EN3A 1USYE 3E4RA 1TT1A 1HSJA 2HFBA 2DE4A 4EUOA 2OBGA 3FVNA 1S9TA 3QAXA 1R9LA 3N6UA 2H98A 3IK6B 4KR5A 5ELVA 3IO6A 5TP9B 4H8IA 3GBAA 2PBWA 4IGRA 1N3XA 2O1MA 2REGA 3MVZA 1B3FA 1LCFA 3T22A 4KD5A 1AL3A 3DLNA 4YB5A 2I0CA 5TU0A 3FGSA 4TOZA 4UACA 3IB0A 4YKKA 2Y7IA 2HQ0A 3H4ZA 4U23A 3MPKA 1H76A 2PT1A 4ONYA 1XHYA 1IEJA 5AE4A 3SEYA 3KEIA 1B4HA 5H8QB 3TFLA 2DVCA 2DXRA 2X7QA 4R75A 3TZAA 1NNPA 2GHAA 4G68A 4KYSA 2X26A 4ESXA 1MM7A 2DWJA 4FE8A 4OTEA 4NF4B 2NUVA 4YB7A 4BDOA 1B1XA 3K1NA 4YZZA 3MP8A 4KYEA 4U21A 4KQPA 3MJNA 2A5TB 3KSJA 4H5FA 3VLVA 3USDA 4NF8A 3T9XB 3O6HA 3BKIB 2KLFA 3U92A 1N76A 1B52A 4GRKA 4YICA 2Z8DA 2O7UA 1MY4A 4XKNA 1A8EA 1P1OA 4NF5A 3G3JA 3O28A 4P0IA 3PV0E 4MFIA 1QKAA 4U4SA 5I59B 5DT6A 3T66A 2ZYKA 3K6XA 4U4XA 3FJ7A 3QUFA 3FJGA 4LATA 1JW1A 1BKAA 3PPNA 5H8FA 5ISUA 2CMOA 1MRPA 1LAGE 3DM0A 3TQLA 1MXXA 3RUMA 3G7WA 2H99A 3B6QA 3H6WA 4DCYA 2UVHA 4H5GA 1FQFA 4ZZEA 4K3FA 2O1LA 2XXYA 4QRZA 3TKDA 4FEBA 2DQVA 5BUUA 2XD2A 3TYHA 3O97A 1AOVA 4LONB 3R26A 4GQOA 3DP6A 5I2NB 1MPCA 4F1UA 1Y20A 4R2FA 1TWYA 2DVZA 4F1VA 4BDNA 4JWYA 3N26A 1UTBB 3MC2A 2D3IA 1UTHA 1S7YA 2E0SA 4H65A 1SVXB 4RNSA 4OERA 2QMXA 3A3CA 4R6YA 1J1NA 1SD3A 1S50A 1SI0A 4QHQA 2F35A 4I9DA 2VD2A 4ZEFA 1SI1A 3HCQA 2I3VA 3G3HA 4OHNA 3VDFA 2P0SA 3I3VA 4FECA 4IO6A 4DXCA 1US4A 3TTMA 4GWOA 2HZKA 3Q28A 1Y9UA 3B7DA 1GVCA 4OFLA 1QKBA 3FATA 1IXCA 4HCWA 4M4GA 2NVUB 1H3DA 3C32A 1MXYA 1PC3A 3KSXA 4XKPA 1N0TA 3IOUA 1IXIA 3EF7A 2IA4A 1XVXA 1P99A 4ZE9A 3HV1A 3ONMA 2QL3A 3LSWA 2ONSA 4YMAA 5EHSA 2I6EA 4MF3A 3C31A 3W9WA 3HO7A 4HCYA 3FVGA 3LSFB 5TPAA 2Q8JA 4RYAA 3N6TA 2IEEA 3TEPA 3OSRA 3ILTB 1B2HA 2F7CA 3PPRA 2V3UA 3FZVA 3OMBA 5DEXA 3S4UA 2I0BA 4Q30B 5L8DA 2D21A 3IAZA 1PBPA 3M3FA 2ALUA 3TCFA 3IO4A 1MS7A 4R2BA 4DCXA 3EQ1A 3V5AA 5AA2B 1MQGA 4QF9A 1SW5A 5AA4B 5CMBA 1B05A 1EU8A 4HS7A 4XKRA 1O63A 3HHGA 2VHAA 1ATGA 2ZMBA 4DXUA 1MDQA 1D3KA 5A5XB 2Y84A 3S9LC 4P11A 1AMFA 4ELPA 2THIA 3PD9A 2PVUA 4NF6B 4EF1A 3K00A 2UXAA 3SKPA 1EH3A 5I57A 2QS2A 1WVJA 1M5BA 4F3SA 1SW2A 2ZNSA 3VXBA 4LZ8A 2PYYA 3K2DA 5KDTB 1Y3QA 4EF2A 3MVYA 2ONRA 3QK6A 1QVSA 3U94A 1DSNA 5H8NA 2ZYNA 3THIA 3CSBA 4DLDA 1R6ZA 4R6KA 3Q26A 1FTLA 3IOWA 3EHSA 2OWTA 3TAJA 3K1MA 4GLIA 1JW5A 3PUYE 1B1HA 1D9VA 1NKXA 3ODBA 4YU0A 3H3GA 4OVJA 1ZMGA 1XS5A 2F8DA 1B6HA 5I56B 4LA9A 2GHBA 2ESNA 1RYXA 4NTLA 4C1UA 3OEKA 4RPOA 1P1QA 2XXPA 3T9UA 3S9EA 1QUIA 4ND9A 2F6PA 5AA2D 2XX9A 5FHMA 2AL4A 3QSLA 4YKPA 1OQGA 2RCAA 3PPPA 2ZNTA 4OXVA 1XOCA 3T93B 1DOTA 2XXTA 4I62A 2O6AA 4KFQA 3UGWA 3LSXA 3QIMA 2F5XA 1A40A 4R9GA 4TLMB 2H25A 1LBCA 2QS4A 3TCGA 4L17A 3GBBA 3JZJA 1M5EA 2XD3A 1LAHE 3TTKA 3UK4A 1VSOA 3SERA 5KCJA 4ELOA 1FQAA 3ZKKA 1ZBMA 2F36A 3K0VA 2Y7RA 4KYDA 1HSLA 2CZLA 4QFOA 2O68A 5B7DA 4NE4A 3RQTA 4G68C 3VFJA 1M5FA 1MY1A 3G3FA 3SEXA 4TQUQ 1TFAA 3RN8A 1OMPA 3MZ1A 3BFUA 5I2KB 1IXHA 4KPTA 3PUWE 2DE2A 1VFDA 1XVYA 1IITA 3H06B 1PBQA 3Q29A 1B3EA 3P7IA 1LGBC 1FTMA 3T9HB 3M8UA 4IO2A 3LC8A 4F22A 4GXAA 3PMXA 5K2YA 1GGGA 2O7IA 4G68B 4ZEDA 1MY2A 3Q25A 4OMBA 1F9BA 3ZSFA 2QS1A 1A99A 3FVOA 4FAJA 3DP4A 4OWDA 2OCUA 2Q89A 5F7VA 4I1DA 2F7BA 3K02A 3N5LA 3U8QA 5AA3A 1LBBA 4N6PA 3TELA 1Y3NA 1LCTA 4RY1A 2DYXA 1T0KA 3R6UA 3KN3A 4NF8B 2VP1A 3DELB 3HSTA 3UN6A 2DOJA 3IJOB 3KJ7A 5ITOA 4ELRA 3G3KA 3RNNA 5JK4A 2Y7PA 4R6HA 4BDRA 2OK2A 4IO4A 3T9VA 4NF5B 4PETA 4ESWA 4OFOA 3FUZA 1B5JA 1YAEA 3F11A 1H43A 2DP8A 4LZ7A 2VGQA 2O51A 4P0GA 3H6VA 3A3UA 2OLBA 4GVOA 1DTGA 3I6VA 3FXUA 5H8FB 3PD8A 3KZGA 4AB6A 1VR5A 5HBCA 3LR1A 3IJXB 4PFTA 3H6UA 3PPQA 1A8FA 1I6AA 1ZU0A 3TTNA 2HAVA 2RCBA 1MM6A 5IAIA 4DZ1A 5ICQA 3OO9A 2XXQA 5H8HA 4IY5A 1MQHA 4FORA 2I58A 3S2VA 4F29A 4HW8A 4QFLA 4N13A 1FCKA 3OENA 4XXUA 2I48A 2UVJA 2F7AA 3W15C 1N84A 1MXVA 3M3KA 1H44A 3HHFA 4EXKA 1MY3A 4TLLB 3B6WA 1B46A 2RKMA 3K1PA 1B7ZA 5LOMA 2DWHA 2F34A 2Q2CA 3QYTA 3O2AA 1UTHB 4F31B 3S9MC 1SBPA 2AIXA 3IR1A 1NH8A 2X7PA 4Q8RA 4M1VA 3D4GA 3MZ9A 2H9BA 4EQ7A 4GIZA 4ZDMA 2XX7A 4G8HA 4ZE8A 1ZJLA 4F39A 2GRVA 1XT8A 2XX8A 3MW0A 4QSEA 3PMVA 4Z7EA 3T96B 1US5A 3VXCA 5HPQA 2O84X 1MY0A 4U1OA 1MDP1 2Q2AA 3FV1A 5DYHA 1URGA 3QXMA 1EZPA 2OZZA 1BP5A 2FA7A 1RYOA 3FV2A 1B5IA 5JTYA 1M5CA 1N7XA 5JEIA 1SDXA 4U1ZA 3WAEA 1JVXA 3OEMA 3OD7A 3ILUB 5TPAB 4DDDA 3E3KA 3IOVA 4AB5A 4QFPA 3K6UA 1O64A 3U93A 4ECFA 4LVQA 2PT2A 5DEXB 4H8JA 1HSEA 1Y1MA 3KOTA 3I5OA 1IXGA 3VLUA 1UIUA 1TXFA 1Q1KA 1YTVA 3TTRA 2NXOA 2XHDA 2PX1A 3A09A 1NNFA 4G77A 3B6TA 3H7MA 4IO5A 4UA8A 4RK9A 3UORA 2FNCA 3PPOA 2W7YA 3CFZA 1VFEA 3ZS6A 3UP9A 2QJEA 4F2QA 4GL0A 1NNTA 1B4ZA 1ZLQA 1MXZA 5CC2A 4GFRA 4AQ4A 1MQDA 4JBZA 3SEUA 4KI0E 3RGYA 1LAFE 1LFIA 1II5A 4IB2A 2M8CA 5I57B 1OVBA 4RJZA 3D4CA 1QUJA 4NEDA 3VV5A 1ELJA 4GXSB 5I58A 4KCDA 2R6GE 1I69A 5H8NB 2ANJA 4PE5B 4Q0CA 3BBRA 4H6DA 1URSA 2UVGA 1DPEA 3SESA 2DWAA 1JW4A 2F78A 3CIJA 2ABHA 4JWXA 1FTJA 3MPLA 4JSDA 2RF1A 2AYSA 4F3PA 1SYHA 1GTKA 3K01A 4FIMA 4OETA 4NF6A 4YKIA 4FEDA 5DVFA 3N94A 2Z22A 3MAMA 2NWJA 5DVIA 1PB7A 1LLSA 4THIA 3WAFA 5EYFA 2REJA 2QMWA 4OEVA 2XXXA 3CVGA 3DP8A 3FXQA 3KOSA 4E0WA 4C1TA 1EZOA 3ECRA 3AXFA 3MWBA 2Q9TA 3G3GA 3C4MA 4C0RA 3Q27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZL A;  2P2A A;  2DSF A;  2P1S A;  4RK2 A;  3IOT A;  4XIG Q;  1IIW A;  3C9H A;  1MQI A;  1JNF A;  2V3T A;  2PMS A;  3IB2 A;  2OJT A;  2UYF A;  2D5W A;  5J1D A;  3KN7 A;  4OES A;  3C34 A;  3EPE A;  3C36 A;  4XKQ A;  1ZKB A;  5KCJ B;  4F1Y A;  4EQ9 A;  3VVD A;  3CR9 A;  5FHN A;  2DS9 A;  3K6V A;  4O3A A;  4F3B A;  4HTG A;  4EDP A;  2E1S A;  1MG1 A;  3MQ9 A;  3L6G A;  3O9P A;  4G4P A;  4LUB A;  1PEB A;  1SQY A;  1UQW A;  5M2V A;  4GL8 A;  3FVK A;  5FTI A;  1KWH A;  5IKB A;  1FQC A;  1LFH A;  4IY6 A;  2QS3 A;  1R1N A;  3HN0 A;  3JYR A;  4OYV A;  4GD5 A;  5ICT A;  4I8C A;  1VE4 A;  5CBR A;  2ZYO A;  3LSL A;  2O69 A;  1POT A;  3FJM A;  1CE2 A;  3V83 A;  1Z7N E;  2H4I A;  4ISU A;  2RC7 A;  3VVE A;  4BDQ A;  4ZEK A;  1UIV A;  4LP2 B;  4EQB A;  1JEV A;  4OQO A;  4JXI A;  3MVX A;  5EHM A;  3CG3 A;  5B70 A;  1Y4T A;  3IB1 A;  4YKJ A;  2V3Q A;  1B40 A;  3OEL A;  5I2K A;  4H67 A;  4QFN A;  4WED A;  2R9J A;  5TP9 A;  4U2R A;  4ELQ A;  5I84 A;  3SET A;  3RPW A;  3RLF E;  1OLC A;  1M5D A;  2XXR A;  3FXR A;  1JQF A;  4WEP A;  1JEU A;  1ANF A;  3ZKL A;  3H6T A;  1N7W A;  2RIN A;  4G8N A;  1PB8 A;  3CRB A;  4Z0I A;  1DPP A;  2I3W A;  4DXB A;  5H8Q A;  4KCC A;  4IO7 A;  1IQ7 A;  5L9S A;  4MLQ A;  4YB6 A;  1MPD A;  4RA1 A;  1B58 A;  1B3G A;  4X1D A;  3C35 A;  2NOO A;  1DMB A;  3OSQ A;  1AIV A;  2Z8E A;  1Z7M E;  4NF4 A;  5CMM A;  3V89 B;  1MPB A;  3O6G A;  1BLF A;  5H8H B;  3U72 A;  2A5T A;  1O7T A;  3TTL A;  2UVI A;  1SW1 A;  1MH4 A;  1NL5 A;  4Q5T A;  1BTJ A;  1LB9 A;  1MQJ A;  3LUY A;  3GLB A;  1LST A;  5L9O A;  3VE1 B;  1WOD A;  4PFY A;  4NMY A;  4JB7 A;  5K2X A;  4JWO A;  3RY3 A;  2ZNU A;  2Q88 A;  1LAX A;  4EXL A;  5I59 A;  3O29 A;  4FAT A;  1P1N A;  3FAS A;  3CFL A;  2VD3 A;  4DE8 A;  2A5S A;  2Z23 A;  3KGC A;  4OFJ A;  4ZEB A;  1N04 A;  3VVF A;  4ZZA A;  2H5Y A;  1YPN A;  3U1O A;  3GZG A;  4ZEC A;  2Z8F A;  1FTK A;  2ZXT A;  1QW0 A;  4U22 A;  1B3H A;  3HPI A;  3H03 A;  3PUV E;  3PUX E;  2F6G A;  5DVJ A;  1B0H A;  4POX A;  3KBR A;  2F97 A;  3OXN A;  3LBS A;  5FTH A;  2R71 A;  2YJP A;  5CBS A;  1B5H A;  3UIF A;  4MLV A;  2B3F A;  5KZT A;  2Y7W A;  4F3G A;  4LZ5 A;  1DTZ A;  3TOD A;  1D9Y A;  4F19 A;  2I4B A;  1A54 A;  3E9X A;  3QUJ A;  1MH3 A;  4PFU A;  3MVW A;  5I2N A;  2XXH A;  1NH7 A;  5JTY B;  4NWD A;  2ZYM A;  1FW0 A;  1MXU A;  2RC9 A;  1UTB A;  1B9J A;  2XXW A;  4OEN A;  1Y1Z A;  4H0W A;  4PP0 A;  4PFW A;  2FYI A;  2XXU A;  1B0L A;  1URD A;  1N3W A;  2QPQ A;  2WKY A;  3CFX A;  3IL1 B;  2G29 A;  2QRY A;  4QFK A;  1L5T A;  4DIG A;  1B7H A;  1JET A;  3OO8 A;  5CMK A;  1P1U A;  1SYI A;  4X9T A;  1H45 A;  5F1Q A;  3PGF A;  3W9V A;  2VOZ A;  2YPN A;  5H8S A;  4H1X A;  1BIY A;  5BWJ A;  4O3B A;  2BJJ X;  5CRY A;  3VLW A;  3KFM A;  4N07 A;  4O3C A;  4E0X A;  1I6Q A;  1QUK A;  4GOT A;  4F18 A;  4JSO A;  4WXJ A;  3S9N C;  4MBP A;  2GFE A;  3V8X B;  3K6W A;  3JV9 A;  3MP6 A;  4OZ9 A;  1I6B A;  3TCH A;  3C33 A;  2HAU A;  1A55 A;  4G8M A;  4BLA A;  4FJP A;  3IOR A;  3PUZ E;  1GV8 A;  3RT6 B;  3EHT A;  1Y4C A;  4JDF A;  1OLA A;  5I58 B;  1FQD A;  3KJT A;  3OO6 A;  3TMG A;  5ITP A;  2HCA A;  3FD3 A;  1ZTY A;  2DWI A;  2V25 A;  4PQJ A;  3O66 A;  3L6H A;  2RC8 A;  4QSD A;  3FIR A;  4R72 A;  3G3I A;  5AA2 A;  3KN8 A;  2I49 A;  4LQ5 A;  4X48 A;  5AA4 A;  4GF8 A;  1IZ1 A;  2XXI A;  4ZEI A;  3SDF A;  3K4U A;  1Q35 A;  1QJM A;  1JVY A;  3MZB A;  2Y7K A;  2UYE A;  5HM4 B;  3RT8 A;  1R9Q A;  4YAH X;  4NWC A;  1IUD A;  4WKM A;  3CG1 A;  5A5X A;  2V84 A;  3OO7 A;  3EHU A;  1EZ9 A;  2HXW A;  5CMC A;  3GXA A;  3CI8 A;  5CI5 A;  2B65 A;  4XTC Q;  1OIB A;  3TQW A;  2ONK E;  2I4C A;  5FHO A;  1CB6 A;  3M3L A;  3RTF B;  1PDA A;  4ZS9 A;  1PB9 A;  3MUQ A;  4IGT A;  5DTB A;  5KDT A;  3SEW A;  2XXV A;  1NMU A;  4MH5 A;  4RXL A;  3R7X A;  3MBP A;  4OEU A;  4R73 A;  4R74 A;  5CM6 A;  2GH9 A;  4KHZ E;  5L9M A;  1B32 A;  4YMB A;  5AA1 A;  3TDJ A;  1MXW A;  3O6I A;  4BDL A;  3UA8 A;  1USY H;  3TPA A;  2LAO A;  2V93 A;  4IO3 A;  4POW A;  1RKM A;  1AH5 A;  2B3B A;  3E13 X;  3IX1 A;  3TUS A;  1GR2 A;  2G93 A;  1LB8 A;  2DE3 A;  5I56 A;  1WDN A;  3OOA A;  1D4N A;  1B7U A;  1ZIU A;  4BDM A;  3PMW A;  4QSC A;  1NNK A;  4R9F A;  4RPN A;  1P1W A;  1B51 A;  1TFD A;  1OVT A;  4F2O A;  1A7L A;  1OQH A;  4LQ2 A;  2DXY A;  4X1B A;  3MP1 A;  1SW4 A;  3KG2 A;  3RTW B;  1QUL A;  2YLN A;  2QSX A;  1FTO A;  2AL5 A;  1Y3P A;  1LFG A;  2HEU A;  3BFT A;  3CSG A;  4G2Z A;  1POY 1;  1XC1 A;  3PU5 A;  2OWS A;  1B3L A;  1NFT A;  1FQE A;  3SEV A;  1FQB A;  1YCJ A;  3EN3 A;  1USY E;  3E4R A;  1TT1 A;  1HSJ A;  2HFB A;  2DE4 A;  4EUO A;  2OBG A;  3FVN A;  1S9T A;  3QAX A;  1R9L A;  3N6U A;  2H98 A;  3IK6 B;  4KR5 A;  5ELV A;  3IO6 A;  5TP9 B;  4H8I A;  3GBA A;  2PBW A;  4IGR A;  1N3X A;  2O1M A;  2REG A;  3MVZ A;  1B3F A;  1LCF A;  3T22 A;  4KD5 A;  1AL3 A;  3DLN A;  4YB5 A;  2I0C A;  5TU0 A;  3FGS A;  4TOZ A;  4UAC A;  3IB0 A;  4YKK A;  2Y7I A;  2HQ0 A;  3H4Z A;  4U23 A;  3MPK A;  1H76 A;  2PT1 A;  4ONY A;  1XHY A;  1IEJ A;  5AE4 A;  3SEY A;  3KEI A;  1B4H A;  5H8Q B;  3TFL A;  2DVC A;  2DXR A;  2X7Q A;  4R75 A;  3TZA A;  1NNP A;  2GHA A;  4G68 A;  4KYS A;  2X26 A;  4ESX A;  1MM7 A;  2DWJ A;  4FE8 A;  4OTE A;  4NF4 B;  2NUV A;  4YB7 A;  4BDO A;  1B1X A;  3K1N A;  4YZZ A;  3MP8 A;  4KYE A;  4U21 A;  4KQP A;  3MJN A;  2A5T B;  3KSJ A;  4H5F A;  3VLV A;  3USD A;  4NF8 A;  3T9X B;  3O6H A;  3BKI B;  2KLF A;  3U92 A;  1N76 A;  1B52 A;  4GRK A;  4YIC A;  2Z8D A;  2O7U A;  1MY4 A;  4XKN A;  1A8E A;  1P1O A;  4NF5 A;  3G3J A;  3O28 A;  4P0I A;  3PV0 E;  4MFI A;  1QKA A;  4U4S A;  5I59 B;  5DT6 A;  3T66 A;  2ZYK A;  3K6X A;  4U4X A;  3FJ7 A;  3QUF A;  3FJG A;  4LAT A;  1JW1 A;  1BKA A;  3PPN A;  5H8F A;  5ISU A;  2CMO A;  1MRP A;  1LAG E;  3DM0 A;  3TQL A;  1MXX A;  3RUM A;  3G7W A;  2H99 A;  3B6Q A;  3H6W A;  4DCY A;  2UVH A;  4H5G A;  1FQF A;  4ZZE A;  4K3F A;  2O1L A;  2XXY A;  4QRZ A;  3TKD A;  4FEB A;  2DQV A;  5BUU A;  2XD2 A;  3TYH A;  3O97 A;  1AOV A;  4LON B;  3R26 A;  4GQO A;  3DP6 A;  5I2N B;  1MPC A;  4F1U A;  1Y20 A;  4R2F A;  1TWY A;  2DVZ A;  4F1V A;  4BDN A;  4JWY A;  3N26 A;  1UTB B;  3MC2 A;  2D3I A;  1UTH A;  1S7Y A;  2E0S A;  4H65 A;  1SVX B;  4RNS A;  4OER A;  2QMX A;  3A3C A;  4R6Y A;  1J1N A;  1SD3 A;  1S50 A;  1SI0 A;  4QHQ A;  2F35 A;  4I9D A;  2VD2 A;  4ZEF A;  1SI1 A;  3HCQ A;  2I3V A;  3G3H A;  4OHN A;  3VDF A;  2P0S A;  3I3V A;  4FEC A;  4IO6 A;  4DXC A;  1US4 A;  3TTM A;  4GWO A;  2HZK A;  3Q28 A;  1Y9U A;  3B7D A;  1GVC A;  4OFL A;  1QKB A;  3FAT A;  1IXC A;  4HCW A;  4M4G A;  2NVU B;  1H3D A;  3C32 A;  1MXY A;  1PC3 A;  3KSX A;  4XKP A;  1N0T A;  3IOU A;  1IXI A;  3EF7 A;  2IA4 A;  1XVX A;  1P99 A;  4ZE9 A;  3HV1 A;  3ONM A;  2QL3 A;  3LSW A;  2ONS A;  4YMA A;  5EHS A;  2I6E A;  4MF3 A;  3C31 A;  3W9W A;  3HO7 A;  4HCY A;  3FVG A;  3LSF B;  5TPA A;  2Q8J A;  4RYA A;  3N6T A;  2IEE A;  3TEP A;  3OSR A;  3ILT B;  1B2H A;  2F7C A;  3PPR A;  2V3U A;  3FZV A;  3OMB A;  5DEX A;  3S4U A;  2I0B A;  4Q30 B;  5L8D A;  2D21 A;  3IAZ A;  1PBP A;  3M3F A;  2ALU A;  3TCF A;  3IO4 A;  1MS7 A;  4R2B A;  4DCX A;  3EQ1 A;  3V5A A;  5AA2 B;  1MQG A;  4QF9 A;  1SW5 A;  5AA4 B;  5CMB A;  1B05 A;  1EU8 A;  4HS7 A;  4XKR A;  1O63 A;  3HHG A;  2VHA A;  1ATG A;  2ZMB A;  4DXU A;  1MDQ A;  1D3K A;  5A5X B;  2Y84 A;  3S9L C;  4P11 A;  1AMF A;  4ELP A;  2THI A;  3PD9 A;  2PVU A;  4NF6 B;  4EF1 A;  3K00 A;  2UXA A;  3SKP A;  1EH3 A;  5I57 A;  2QS2 A;  1WVJ A;  1M5B A;  4F3S A;  1SW2 A;  2ZNS A;  3VXB A;  4LZ8 A;  2PYY A;  3K2D A;  5KDT B;  1Y3Q A;  4EF2 A;  3MVY A;  2ONR A;  3QK6 A;  1QVS A;  3U94 A;  1DSN A;  5H8N A;  2ZYN A;  3THI A;  3CSB A;  4DLD A;  1R6Z A;  4R6K A;  3Q26 A;  1FTL A;  3IOW A;  3EHS A;  2OWT A;  3TAJ A;  3K1M A;  4GLI A;  1JW5 A;  3PUY E;  1B1H A;  1D9V A;  1NKX A;  3ODB A;  4YU0 A;  3H3G A;  4OVJ A;  1ZMG A;  1XS5 A;  2F8D A;  1B6H A;  5I56 B;  4LA9 A;  2GHB A;  2ESN A;  1RYX A;  4NTL A;  4C1U A;  3OEK A;  4RPO A;  1P1Q A;  2XXP A;  3T9U A;  3S9E A;  1QUI A;  4ND9 A;  2F6P A;  5AA2 D;  2XX9 A;  5FHM A;  2AL4 A;  3QSL A;  4YKP A;  1OQG A;  2RCA A;  3PPP A;  2ZNT A;  4OXV A;  1XOC A;  3T93 B;  1DOT A;  2XXT A;  4I62 A;  2O6A A;  4KFQ A;  3UGW A;  3LSX A;  3QIM A;  2F5X A;  1A40 A;  4R9G A;  4TLM B;  2H25 A;  1LBC A;  2QS4 A;  3TCG A;  4L17 A;  3GBB A;  3JZJ A;  1M5E A;  2XD3 A;  1LAH E;  3TTK A;  3UK4 A;  1VSO A;  3SER A;  5KCJ A;  4ELO A;  1FQA A;  3ZKK A;  1ZBM A;  2F36 A;  3K0V A;  2Y7R A;  4KYD A;  1HSL A;  2CZL A;  4QFO A;  2O68 A;  5B7D A;  4NE4 A;  3RQT A;  4G68 C;  3VFJ A;  1M5F A;  1MY1 A;  3G3F A;  3SEX A;  4TQU Q;  1TFA A;  3RN8 A;  1OMP A;  3MZ1 A;  3BFU A;  5I2K B;  1IXH A;  4KPT A;  3PUW E;  2DE2 A;  1VFD A;  1XVY A;  1IIT A;  3H06 B;  1PBQ A;  3Q29 A;  1B3E A;  3P7I A;  1LGB C;  1FTM A;  3T9H B;  3M8U A;  4IO2 A;  3LC8 A;  4F22 A;  4GXA A;  3PMX A;  5K2Y A;  1GGG A;  2O7I A;  4G68 B;  4ZED A;  1MY2 A;  3Q25 A;  4OMB A;  1F9B A;  3ZSF A;  2QS1 A;  1A99 A;  3FVO A;  4FAJ A;  3DP4 A;  4OWD A;  2OCU A;  2Q89 A;  5F7V A;  4I1D A;  2F7B A;  3K02 A;  3N5L A;  3U8Q A;  5AA3 A;  1LBB A;  4N6P A;  3TEL A;  1Y3N A;  1LCT A;  4RY1 A;  2DYX A;  1T0K A;  3R6U A;  3KN3 A;  4NF8 B;  2VP1 A;  3DEL B;  3HST A;  3UN6 A;  2DOJ A;  3IJO B;  3KJ7 A;  5ITO A;  4ELR A;  3G3K A;  3RNN A;  5JK4 A;  2Y7P A;  4R6H A;  4BDR A;  2OK2 A;  4IO4 A;  3T9V A;  4NF5 B;  4PET A;  4ESW A;  4OFO A;  3FUZ A;  1B5J A;  1YAE A;  3F11 A;  1H43 A;  2DP8 A;  4LZ7 A;  2VGQ A;  2O51 A;  4P0G A;  3H6V A;  3A3U A;  2OLB A;  4GVO A;  1DTG A;  3I6V A;  3FXU A;  5H8F B;  3PD8 A;  3KZG A;  4AB6 A;  1VR5 A;  5HBC A;  3LR1 A;  3IJX B;  4PFT A;  3H6U A;  3PPQ A;  1A8F A;  1I6A A;  1ZU0 A;  3TTN A;  2HAV A;  2RCB A;  1MM6 A;  5IAI A;  4DZ1 A;  5ICQ A;  3OO9 A;  2XXQ A;  5H8H A;  4IY5 A;  1MQH A;  4FOR A;  2I58 A;  3S2V A;  4F29 A;  4HW8 A;  4QFL A;  4N13 A;  1FCK A;  3OEN A;  4XXU A;  2I48 A;  2UVJ A;  2F7A A;  3W15 C;  1N84 A;  1MXV A;  3M3K A;  1H44 A;  3HHF A;  4EXK A;  1MY3 A;  4TLL B;  3B6W A;  1B46 A;  2RKM A;  3K1P A;  1B7Z A;  5LOM A;  2DWH A;  2F34 A;  2Q2C A;  3QYT A;  3O2A A;  1UTH B;  4F31 B;  3S9M C;  1SBP A;  2AIX A;  3IR1 A;  1NH8 A;  2X7P A;  4Q8R A;  4M1V A;  3D4G A;  3MZ9 A;  2H9B A;  4EQ7 A;  4GIZ A;  4ZDM A;  2XX7 A;  4G8H A;  4ZE8 A;  1ZJL A;  4F39 A;  2GRV A;  1XT8 A;  2XX8 A;  3MW0 A;  4QSE A;  3PMV A;  4Z7E A;  3T96 B;  1US5 A;  3VXC A;  5HPQ A;  2O84 X;  1MY0 A;  4U1O A;  1MDP 1;  2Q2A A;  3FV1 A;  5DYH A;  1URG A;  3QXM A;  1EZP A;  2OZZ A;  1BP5 A;  2FA7 A;  1RYO A;  3FV2 A;  1B5I A;  5JTY A;  1M5C A;  1N7X A;  5JEI A;  1SDX A;  4U1Z A;  3WAE A;  1JVX A;  3OEM A;  3OD7 A;  3ILU B;  5TPA B;  4DDD A;  3E3K A;  3IOV A;  4AB5 A;  4QFP A;  3K6U A;  1O64 A;  3U93 A;  4ECF A;  4LVQ A;  2PT2 A;  5DEX B;  4H8J A;  1HSE A;  1Y1M A;  3KOT A;  3I5O A;  1IXG A;  3VLU A;  1UIU A;  1TXF A;  1Q1K A;  1YTV A;  3TTR A;  2NXO A;  2XHD A;  2PX1 A;  3A09 A;  1NNF A;  4G77 A;  3B6T A;  3H7M A;  4IO5 A;  4UA8 A;  4RK9 A;  3UOR A;  2FNC A;  3PPO A;  2W7Y A;  3CFZ A;  1VFE A;  3ZS6 A;  3UP9 A;  2QJE A;  4F2Q A;  4GL0 A;  1NNT A;  1B4Z A;  1ZLQ A;  1MXZ A;  5CC2 A;  4GFR A;  4AQ4 A;  1MQD A;  4JBZ A;  3SEU A;  4KI0 E;  3RGY A;  1LAF E;  1LFI A;  1II5 A;  4IB2 A;  2M8C A;  5I57 B;  1OVB A;  4RJZ A;  3D4C A;  1QUJ A;  4NED A;  3VV5 A;  1ELJ A;  4GXS B;  5I58 A;  4KCD A;  2R6G E;  1I69 A;  5H8N B;  2ANJ A;  4PE5 B;  4Q0C A;  3BBR A;  4H6D A;  1URS A;  2UVG A;  1DPE A;  3SES A;  2DWA A;  1JW4 A;  2F78 A;  3CIJ A;  2ABH A;  4JWX A;  1FTJ A;  3MPL A;  4JSD A;  2RF1 A;  2AYS A;  4F3P A;  1SYH A;  1GTK A;  3K01 A;  4FIM A;  4OET A;  4NF6 A;  4YKI A;  4FED A;  5DVF A;  3N94 A;  2Z22 A;  3MAM A;  2NWJ A;  5DVI A;  1PB7 A;  1LLS A;  4THI A;  3WAF A;  5EYF A;  2REJ A;  2QMW A;  4OEV A;  2XXX A;  3CVG A;  3DP8 A;  3FXQ A;  3KOS A;  4E0W A;  4C1T A;  1EZO A;  3ECR A;  3AXF A;  3MWB A;  2Q9T A;  3G3G A;  3C4M A;  4C0R A;  3Q27 A; 
#chains in the Genus database with same CATH topology
 2HZL A;  2P2A A;  2DSF A;  2P1S A;  4RK2 A;  3IOT A;  4XIG Q;  1IIW A;  3C9H A;  3PTY A;  1MQI A;  1JNF A;  2V3T A;  2PMS A;  3IB2 A;  2OJT A;  2UYF A;  2D5W A;  5J1D A;  3KN7 A;  4OES A;  3C34 A;  3EPE A;  3C36 A;  4XKQ A;  1ZKB A;  5KCJ B;  4F1Y A;  4EQ9 A;  3VVD A;  3CR9 A;  5FHN A;  2DS9 A;  4PAF A;  3K6V A;  2VT5 A;  4O3A A;  4F3B A;  4HTG A;  4EDP A;  2E1S A;  1MG1 A;  3MQ9 A;  3L6G A;  3O9P A;  4G4P A;  1FBG A;  4LUB A;  1PEB A;  1SQY A;  1UQW A;  5M2V A;  4GL8 A;  2ZZV A;  3FVK A;  5FTI A;  1KWH A;  5IKB A;  1FQC A;  1LFH A;  4IY6 A;  2QS3 A;  1R1N A;  3HN0 A;  4PAI A;  3JYR A;  4OYV A;  3GYY A;  4GD5 A;  5ICT A;  4I8C A;  1VE4 A;  4P47 A;  5CBR A;  2ZYO A;  3LSL A;  4OVR A;  1FTA A;  2O69 A;  1POT A;  3FJM A;  4OVQ A;  1CE2 A;  3V83 A;  1Z7N E;  2H4I A;  4ISU A;  2KQZ A;  2RC7 A;  3VVE A;  4BDQ A;  4ZEK A;  1UIV A;  4LP2 B;  4EQB A;  1JEV A;  4OQO A;  4JXI A;  4KXP A;  3MVX A;  4NGU A;  1LBV A;  5EHM A;  3CG3 A;  5B70 A;  1Y4T A;  3IB1 A;  4YKJ A;  2V3Q A;  1B40 A;  3OEL A;  5I2K A;  4H67 A;  4QFN A;  4WED A;  2R9J A;  1FPG A;  5TP9 A;  4PDH A;  4U2R A;  4ELQ A;  5I84 A;  3SET A;  3RPW A;  3RLF E;  3SZP A;  1OLC A;  1M5D A;  2XXR A;  3FXR A;  1JQF A;  4WEP A;  2CZH A;  1JEU A;  1ANF A;  2CZI A;  5FBP A;  3ZKL A;  3H6T A;  1N7W A;  2RIN A;  1NV5 A;  4G8N A;  1PB8 A;  2L5V A;  3CRB A;  4Z0I A;  1DPP A;  4DI4 B;  3BIH A;  4NHB A;  2I3W A;  4DXB A;  5H8Q A;  4KCC A;  4IO7 A;  4DI3 D;  1IQ7 A;  5L9S A;  4MLQ A;  4YB6 A;  1MPD A;  4RA1 A;  1B58 A;  1B3G A;  4X1D A;  3C35 A;  2NOO A;  1DMB A;  3OSQ A;  4N91 A;  1AIV A;  2Z8E A;  1Z7M E;  1NUW A;  4NF4 A;  5CMM A;  3V89 B;  2HXR A;  1MPB A;  3O6G A;  4O94 A;  1BLF A;  5H8H B;  3U72 A;  4PTK A;  5I7I A;  2P3V A;  5F24 A;  2HPG A;  2A5T A;  4GWU A;  2JJK A;  5EQ9 A;  1O7T A;  3TTL A;  2UVI A;  1CNQ A;  1SW1 A;  1MH4 A;  1NL5 A;  4Q5T A;  1BTJ A;  1LB9 A;  1MQJ A;  3LUY A;  2Q8M A;  3GLB A;  1LST A;  5L9O A;  3VE1 B;  4N6K A;  1WOD A;  4PFY A;  4NMY A;  4JB7 A;  5K2X A;  4JWO A;  3RY3 A;  2ZNU A;  2QVR A;  2Q88 A;  1LAX A;  4EXL A;  5I59 A;  3O29 A;  4FAT A;  1P1N A;  3FAS A;  3CFL A;  1NUZ A;  2Q74 A;  2VD3 A;  1VDW A;  4DE8 A;  2A5S A;  2Z23 A;  3KGC A;  4OFJ A;  4ZEB A;  1N04 A;  3VVF A;  4ZZA A;  4O7I A;  2H5Y A;  1YPN A;  3U1O A;  3GZG A;  4OVT A;  4ZEC A;  4NQ8 A;  2PFY A;  2Z8F A;  1FTK A;  4GWX A;  2ZXT A;  4QBA A;  1QW0 A;  4U22 A;  2WBD A;  1NUX A;  1B3H A;  3HPI A;  3H03 A;  3PUV E;  3PUX E;  2F6G A;  5DVJ A;  1B0H A;  4POX A;  3KBR A;  2F97 A;  3OXN A;  3LBS A;  5FTH A;  2R71 A;  2YJP A;  4P1E A;  1D9Q A;  5CBS A;  4PF6 A;  1B5H A;  1SPI A;  2P3N A;  3UIF A;  4MLV A;  2B3F A;  5KZT A;  2Y7W A;  4F3G A;  2B4M A;  1DK4 A;  4LZ5 A;  1JP4 A;  1DTZ A;  3TOD A;  1D9Y A;  4F19 A;  2I4B A;  1A54 A;  3E9X A;  3QUJ A;  1MH3 A;  4PFU A;  3MVW A;  5I2N A;  2XXH A;  1NH7 A;  5JTY B;  4NX1 A;  4NWD A;  2ZYM A;  1FW0 A;  4MCO A;  1MXU A;  5IGA A;  2RC9 A;  1UTB A;  1B9J A;  2XXW A;  4OEN A;  1Y1Z A;  4H0W A;  4PP0 A;  4PFW A;  2FYI A;  2XXU A;  1B0L A;  3NOH A;  1URD A;  1N3W A;  2QPQ A;  4N8Y A;  2WKY A;  3CFX A;  5IZZ A;  3IL1 B;  2G29 A;  2QRY A;  4QFK A;  1L5T A;  3LV0 A;  4DIG A;  1B7H A;  1JET A;  4P1L A;  1KA1 A;  3OO8 A;  1P1U A;  5CMK A;  1SYI A;  4GBW A;  4X9T A;  1H45 A;  5F1Q A;  4FBP A;  3PGF A;  3W9V A;  2VOZ A;  1FBP A;  2YPN A;  5H8S A;  4H1X A;  3EKI A;  1BIY A;  5BWJ A;  4O3B A;  2BJJ X;  4GWS A;  1FPE A;  5CRY A;  3VLW A;  3KFM A;  5LDZ A;  4MEV A;  4N07 A;  4O3C A;  4E0X A;  1I6Q A;  1QUK A;  4GOT A;  4GX6 A;  2OWZ A;  4F18 A;  5J16 A;  4JSO A;  4WXJ A;  3S9N C;  4MBP A;  2GFE A;  3V8X B;  3K6W A;  3JV9 A;  3MP6 A;  2V4C A;  2Y5L A;  3T1B A;  4OZ9 A;  1I6B A;  3TCH A;  3C33 A;  2HAU A;  4I40 A;  1A55 A;  4G8M A;  4BLA A;  4FJP A;  1FBE A;  3IOR A;  3PUZ E;  1GV8 A;  3RT6 B;  3EHT A;  1Y4C A;  4JDF A;  1OLA A;  5I58 B;  1FQD A;  3KJT A;  3OO6 A;  3TMG A;  4GWZ A;  5ITP A;  2HCA A;  3FD3 A;  1FPJ A;  1ZTY A;  4PF8 A;  2DWI A;  2V25 A;  4PQJ A;  3O66 A;  3L6H A;  2RC8 A;  4QSD A;  3FIR A;  4R72 A;  3G3I A;  5AA2 A;  3KN8 A;  2I49 A;  4LQ5 A;  4X48 A;  5AA4 A;  4GF8 A;  1IZ1 A;  2XXI A;  4ZEI A;  3SDF A;  3K4U A;  1Q35 A;  1QJM A;  1JVY A;  3MZB A;  2Y7K A;  2UYE A;  1EYK A;  4P8B A;  5HM4 B;  3RT8 A;  1R9Q A;  4YAH X;  4NWC A;  1IUD A;  4HE2 A;  4WKM A;  3U65 A;  3CG1 A;  5A5X A;  2V84 A;  3OO7 A;  3EHU A;  1EZ9 A;  2HXW A;  5CMC A;  5LTC A;  2WX9 A;  3GXA A;  5EQ7 A;  2WYK A;  3CI8 A;  5CI5 A;  2B65 A;  4XTC Q;  1OIB A;  4PGN A;  1FPF A;  3TQW A;  2ONK E;  2I4C A;  5FHO A;  1CB6 A;  3M3L A;  3RTF B;  1PDA A;  4ZS9 A;  2FIX A;  2GQ1 A;  1PB9 A;  3MUQ A;  4IGT A;  5DTB A;  5KDT A;  3ISP A;  3SEW A;  2XXV A;  1NMU A;  4MH5 A;  4RXL A;  3MST A;  3R7X A;  3MBP A;  4PGP A;  4OEU A;  4R73 A;  4R74 A;  5IM2 A;  5CM6 A;  2GH9 A;  4KHZ E;  5L9M A;  1B32 A;  4YMB A;  5AA1 A;  3TDJ A;  1MXW A;  3O6I A;  4BDL A;  4GX3 A;  3UA8 A;  1USY H;  3TPA A;  2LAO A;  2V93 A;  4IO3 A;  4MJO A;  4POW A;  1RKM A;  4N8G A;  1AH5 A;  2B3B A;  3E13 X;  3IX1 A;  4PCD A;  3TUS A;  1GR2 A;  2G93 A;  1LB8 A;  2DE3 A;  5I56 A;  1WDN A;  3OOA A;  1D4N A;  1B7U A;  2XA5 A;  1ZIU A;  4BDM A;  3PMW A;  4QSC A;  1NNK A;  4R9F A;  4QXD A;  4RPN A;  1P1W A;  1B51 A;  1TFD A;  1OVT A;  4F2O A;  1A7L A;  3E78 A;  1OQH A;  4LQ2 A;  1IMA A;  2DXY A;  4X1B A;  3MP1 A;  1SW4 A;  3KG2 A;  1AWB A;  3RTW B;  1QUL A;  2YLN A;  2QSX A;  1FTO A;  2AL5 A;  5IZ3 A;  1Y3P A;  1LFG A;  2HEU A;  3BFT A;  3CSG A;  4G2Z A;  4N81 A;  1POY 1;  1XC1 A;  3PU5 A;  4H45 A;  2OWS A;  1B3L A;  1NFT A;  3B8B A;  5ET8 A;  1FQE A;  3SEV A;  1FQB A;  1YCJ A;  3EN3 A;  1RDY A;  1NV6 A;  1USY E;  3E4R A;  1TT1 A;  1HSJ A;  1G0H A;  2HFB A;  2DE4 A;  4EUO A;  2OBG A;  3FVN A;  1S9T A;  1YZ0 A;  3QAX A;  1R9L A;  3N6U A;  4NG7 A;  2H98 A;  3IK6 B;  4KR5 A;  5ELV A;  3IO6 A;  4G61 A;  2FBP A;  5TP9 B;  4H8I A;  3GBA A;  2PBW A;  4IGR A;  1N3X A;  2O1M A;  2REG A;  3MVZ A;  3MYU A;  1B3F A;  1LCF A;  3T22 A;  4KD5 A;  2XWI A;  1AL3 A;  3DLN A;  4YB5 A;  2I0C A;  5TU0 A;  3FGS A;  4TOZ A;  4UAC A;  3IB0 A;  4YKK A;  2Y7I A;  3B50 A;  2HQ0 A;  3H4Z A;  4U23 A;  3MPK A;  1H76 A;  2PT1 A;  4PBH A;  4ONY A;  4XEQ A;  1XHY A;  1IEJ A;  5AE4 A;  3SEY A;  3KEI A;  1B4H A;  4P9K A;  5H8Q B;  3TFL A;  1FSA A;  2DVC A;  2DXR A;  2X7Q A;  1KZ8 A;  4R75 A;  4GBV A;  3TZA A;  1NNP A;  2GHA A;  4GX4 A;  2F3D A;  4G68 A;  4XF5 A;  4MNC A;  4KYS A;  2X26 A;  3KC1 A;  4ESX A;  1MM7 A;  2DWJ A;  4FE8 A;  4OTE A;  4NF4 B;  2NUV A;  4YB7 A;  4BDO A;  1B1X A;  3K1N A;  4YZZ A;  4P56 A;  3MP8 A;  4KYE A;  4U21 A;  4KQP A;  3MJN A;  1NV7 A;  2A5T B;  5I3S A;  3KSJ A;  4H5F A;  3VLV A;  3USD A;  4NF8 A;  3T9X B;  1EYI A;  3O6H A;  3BKI B;  2KLF A;  3U92 A;  3RPL A;  1N76 A;  1B52 A;  4PE3 A;  4GRK A;  1NI9 A;  2Z8D A;  4YIC A;  2O7U A;  1MY4 A;  4XKN A;  1A8E A;  1P1O A;  4NF5 A;  4H46 A;  3G3J A;  3O28 A;  4P0I A;  3PV0 E;  4MFI A;  1QKA A;  4U4S A;  5I59 B;  5DT6 A;  3T66 A;  2ZYK A;  3K6X A;  4U4X A;  3FJ7 A;  3QUF A;  4JVC A;  3FJG A;  4LAT A;  1JW1 A;  1BKA A;  3PPN A;  1BK4 A;  2B4L A;  5H8F A;  4GWW A;  5ISU A;  2CMO A;  1MRP A;  1LAG E;  3DM0 A;  3TQL A;  1MXX A;  2BJI A;  3RUM A;  3G7W A;  2H99 A;  3B6Q A;  3H6W A;  4DCY A;  2UVH A;  1KA0 A;  4H5G A;  1FQF A;  4ZZE A;  3FBP A;  4K3F A;  2O1L A;  2XXY A;  4QRZ A;  3TKD A;  4FEB A;  2DQV A;  5BUU A;  2XD2 A;  3TYH A;  1FBD A;  3O97 A;  2WYP A;  4XFE A;  1AOV A;  3BIG A;  4LON B;  4PFB A;  3R26 A;  4GQO A;  3DP6 A;  1FPK A;  5I2N B;  1MPC A;  4F1U A;  1Y20 A;  4R2F A;  1TWY A;  3FXB A;  2DVZ A;  4F1V A;  4BDN A;  4JWY A;  3N26 A;  1UTB B;  3MC2 A;  2D3I A;  1UTH A;  1YXI A;  1S7Y A;  2E0S A;  4H65 A;  3KBZ A;  1SVX B;  4RNS A;  4OER A;  2QMX A;  3A3C A;  4R6Y A;  1J1N A;  1SD3 A;  1S50 A;  1SI0 A;  4QHQ A;  2F35 A;  4I9D A;  2VD2 A;  4ZEF A;  1SI1 A;  3HCQ A;  2I3V A;  3G3H A;  4OHN A;  3VDF A;  2P0S A;  3I3V A;  4FEC A;  4IO6 A;  4DXC A;  1US4 A;  3TTM A;  4GWO A;  2HZK A;  3Q28 A;  4PBQ A;  1Y9U A;  3B7D A;  1GVC A;  4OFL A;  1QKB A;  4NF0 A;  3FAT A;  1IXC A;  4HCW A;  4M4G A;  2MKZ A;  2NVU B;  1H3D A;  3C32 A;  1MXY A;  1PC3 A;  1FBF A;  3KSX A;  4XKP A;  1N0T A;  3IOU A;  1IXI A;  3EF7 A;  2IA4 A;  1XVX A;  1P99 A;  4ZE9 A;  3HV1 A;  3ONM A;  2QL3 A;  3LSW A;  2ONS A;  4YMA A;  5EHS A;  2I6E A;  4MF3 A;  3C31 A;  4I3E A;  3W9W A;  3HO7 A;  2CEY A;  4HCY A;  2QVU A;  1IMC A;  3FVG A;  3LSF B;  5TPA A;  2Q8J A;  4RYA A;  3N6T A;  2IEE A;  4LN5 A;  3TEP A;  3OSR A;  3ILT B;  1B2H A;  2F7C A;  3PPR A;  2V3U A;  3FZV A;  3OMB A;  5DEX A;  3S4U A;  2I0B A;  4Q30 B;  5L8D A;  2D21 A;  3IAZ A;  1PBP A;  4MX6 A;  1NV2 A;  3M3F A;  2ALU A;  3TCF A;  3E79 A;  4MNI A;  3IO4 A;  1MS7 A;  4N6D A;  4R2B A;  4DCX A;  3EQ1 A;  3V5A A;  5AA2 B;  4MAG A;  1MQG A;  4QF9 A;  1SW5 A;  5AA4 B;  5CMB A;  1B05 A;  1EU8 A;  2F3B A;  4HS7 A;  4XKR A;  1O63 A;  3HHG A;  5ET7 A;  2VHA A;  1ATG A;  1IMF A;  2ZMB A;  4NN3 A;  4DXU A;  1MDQ A;  1D3K A;  5A5X B;  2Y84 A;  3S9L C;  4P11 A;  1AMF A;  4ELP A;  2THI A;  3PD9 A;  2PVU A;  3D1R A;  4NF6 B;  4EF1 A;  3K00 A;  2UXA A;  3SKP A;  1EH3 A;  5I57 A;  2QS2 A;  1WVJ A;  1M5B A;  1NV0 A;  4F3S A;  2CEX A;  1SW2 A;  3LUZ A;  2ZNS A;  3VXB A;  1EYJ A;  4LZ8 A;  2PYY A;  3K2D A;  4N15 A;  5KDT B;  1Y3Q A;  4EF2 A;  3MVY A;  2ONR A;  3QK6 A;  1QVS A;  3U94 A;  1DSN A;  5H8N A;  2ZYN A;  3THI A;  3CSB A;  4PAK A;  4DLD A;  1R6Z A;  4R6K A;  3Q26 A;  1QGX A;  1IMD A;  2XWK A;  1FTL A;  3IOW A;  2FVZ A;  3EHS A;  5EQA A;  2OWT A;  3TAJ A;  3K1M A;  4GLI A;  1JW5 A;  3PUY E;  1B1H A;  1NV4 A;  1D9V A;  1NKX A;  3ODB A;  1LBW A;  4YU0 A;  4PFR A;  3H3G A;  4OVJ A;  1ZMG A;  1XS5 A;  2F8D A;  1B6H A;  5I56 B;  4LA9 A;  4OA4 A;  2GHB A;  2ESN A;  1RYX A;  4NTL A;  4C1U A;  3OEK A;  4RPO A;  1P1Q A;  4HE1 A;  2XXP A;  3T9U A;  3S9E A;  1NV1 A;  1QUI A;  1FPB A;  4ND9 A;  2F6P A;  5AA2 D;  2XX9 A;  5FHM A;  2AL4 A;  1RDZ A;  2ZZW A;  3QSL A;  4YKP A;  1OQG A;  2RCA A;  4AS5 A;  1YYZ A;  3PPP A;  2ZNT A;  4OXV A;  1XOC A;  3T93 B;  1DOT A;  2XXT A;  4I62 A;  2VPN A;  2O6A A;  4KFQ A;  3UGW A;  3LSX A;  3QIM A;  4X04 A;  5IZ3 B;  2DDK A;  2XWO A;  1LBY A;  2F5X A;  1A40 A;  4R9G A;  4TLM B;  2H25 A;  1LBC A;  3IFA A;  2QS4 A;  3TCG A;  4L17 A;  3GBB A;  3JZJ A;  1M5E A;  1DCU A;  2XD3 A;  1LAH E;  4X8R A;  3TTK A;  3UK4 A;  4HE0 A;  1VSO A;  3SER A;  5KCJ A;  4ELO A;  1FQA A;  1FJ6 A;  3ZKK A;  3K0V A;  1ZBM A;  2F36 A;  2Y7R A;  4KYD A;  2CZK A;  1HSL A;  2CZL A;  1IME A;  4QFO A;  2O68 A;  5B7D A;  4NE4 A;  3RQT A;  4G68 C;  2OX3 A;  4N17 A;  3VFJ A;  1M5F A;  1MY1 A;  5ESY A;  3G3F A;  3SEX A;  4TQU Q;  1K9Z A;  1TFA A;  3RN8 A;  2WEF A;  1OMP A;  3MZ1 A;  3BFU A;  5I2K B;  1IXH A;  4KPT A;  3PUW E;  2DE2 A;  1VFD A;  1XVY A;  1IIT A;  3H06 B;  1PBQ A;  3Q29 A;  1B3E A;  3P7I A;  1LGB C;  1FTM A;  3T9H B;  3M8U A;  4IO2 A;  3LC8 A;  4F22 A;  4GXA A;  3PMX A;  5K2Y A;  1GGG A;  2O7I A;  4G68 B;  1FRP A;  4ZED A;  1DBZ A;  1MY2 A;  3Q25 A;  1G0I A;  4OMB A;  1F9B A;  4I3Y A;  3ZSF A;  4JVD A;  2QS1 A;  1A99 A;  3FVO A;  4FAJ A;  3DP4 A;  4OWD A;  2OCU A;  2Q89 A;  5F7V A;  4I1D A;  2F7B A;  3K02 A;  3N5L A;  3U8Q A;  5AA3 A;  1LBB A;  4N6P A;  3TEL A;  1Y3N A;  1LCT A;  4RY1 A;  3KC0 A;  5EYH A;  2DYX A;  1T0K A;  3R6U A;  3KN3 A;  4NF8 B;  1INP A;  2VP1 A;  3DEL B;  3HST A;  3UN6 A;  2DOJ A;  3IJO B;  3KJ7 A;  5ITO A;  4ELR A;  3G3K A;  3RNN A;  5JK4 A;  3RPL B;  2Y7P A;  4R6H A;  3HFU A;  4BDR A;  2OK2 A;  4IO4 A;  3ROJ A;  3T9V A;  4NF5 B;  4PET A;  4ESW A;  4OFO A;  3A29 A;  4HXV A;  3FUZ A;  1B5J A;  1NV3 A;  1YAE A;  3F11 A;  1H43 A;  2DP8 A;  4LZ7 A;  2VGQ A;  2O51 A;  4P0G A;  3H6V A;  3A3U A;  2OLB A;  4GVO A;  1DTG A;  2WBB A;  4O7M A;  3I6V A;  3FXU A;  5H8F B;  3PD8 A;  3KZG A;  2ZZX A;  4AB6 A;  1VR5 A;  2QVV A;  4MMP A;  5HBC A;  3LR1 A;  3IJX B;  4PFT A;  3H6U A;  3PPQ A;  2KR0 A;  1A8F A;  1I6A A;  1XI6 A;  1ZU0 A;  3TTN A;  2HAV A;  2RCB A;  1MM6 A;  1FBH A;  5IAI A;  4DZ1 A;  5ICQ A;  2Y5K A;  3OO9 A;  2XXQ A;  5H8H A;  1FPL A;  4IY5 A;  1MQH A;  4FOR A;  3QMF A;  2I58 A;  3S2V A;  4F29 A;  4HW8 A;  4QFL A;  4N13 A;  5IZ1 A;  1FCK A;  3OEN A;  4XXU A;  2I48 A;  2UVJ A;  5ET5 A;  2F7A A;  5DW8 A;  5A5L A;  3W15 C;  2FHY A;  5T3J A;  1N84 A;  1MXV A;  1Q9D A;  3M3K A;  1H44 A;  3HHF A;  4EXK A;  1MY3 A;  4TLL B;  3B6W A;  4AS4 A;  5I5P A;  1B46 A;  2RKM A;  3K1P A;  1B7Z A;  5LOM A;  2DWH A;  2F34 A;  2Q2C A;  3QYT A;  3O2A A;  1UTH B;  4OVS A;  4F31 B;  3S9M C;  1SBP A;  2AIX A;  3IR1 A;  1NH8 A;  2X7P A;  4Q8R A;  4M1V A;  3D4G A;  3MZ9 A;  2H9B A;  4EQ7 A;  4GIZ A;  4ZDM A;  2XX7 A;  4G8H A;  4PC9 A;  1RDX A;  3CHG A;  2PFZ A;  4ZE8 A;  1ZJL A;  4F39 A;  2GRV A;  1XT8 A;  2XX8 A;  3MW0 A;  4QSE A;  3PMV A;  4Z7E A;  3T96 B;  1US5 A;  4OVP A;  3VXC A;  5HPQ A;  2O84 X;  1MY0 A;  4U1O A;  1MDP 1;  2Q2A A;  4GWY A;  3FV1 A;  5DYH A;  1URG A;  3QXM A;  2XWV A;  4O8M A;  1EZP A;  2OZZ A;  1BP5 A;  2FA7 A;  1RYO A;  3FV2 A;  1B5I A;  4NAP A;  5JTY A;  1M5C A;  5EYG A;  1N7X A;  5JEI A;  1SDX A;  4U1Z A;  3WAE A;  1JVX A;  3OEM A;  2VPO A;  3OD7 A;  2FIE A;  5ET6 A;  3ILU B;  5TPA B;  4DDD A;  3E3K A;  3IOV A;  4AB5 A;  4QFP A;  3K6U A;  1O64 A;  3U93 A;  4LVQ A;  4ECF A;  2PT2 A;  5DEX B;  1IMB A;  4OAN A;  4H8J A;  2XXK A;  1HSE A;  1Y1M A;  3KOT A;  3I5O A;  1IXG A;  4PFI A;  1UIU A;  3VLU A;  1TXF A;  2QFL A;  1Q1K A;  1YTV A;  3TTR A;  2NXO A;  2XHD A;  2PX1 A;  1LEV A;  3A09 A;  1NNF A;  4PDD A;  4G77 A;  3B6T A;  3H7M A;  4IO5 A;  4UA8 A;  4RK9 A;  3UOR A;  2FNC A;  3PPO A;  2W7Y A;  1NUY A;  3CFZ A;  1VFE A;  3ZS6 A;  3UP9 A;  2QJE A;  4P3L A;  4F2Q A;  4GL0 A;  1NNT A;  1B4Z A;  1ZLQ A;  4UAB A;  1MXZ A;  5CC2 A;  4GFR A;  4AQ4 A;  1MQD A;  4JBZ A;  3SEU A;  4KI0 E;  3RGY A;  1LAF E;  4MNP A;  1LFI A;  1II5 A;  4IB2 A;  2M8C A;  5I57 B;  1FPI A;  1OVB A;  4C0R A;  2PCR A;  5EQ8 A;  4RJZ A;  3D4C A;  1QUJ A;  4NED A;  3VV5 A;  1ELJ A;  4GXS B;  5I58 A;  1FPD A;  3T0J A;  4KCD A;  2R6G E;  1I69 A;  1LBX A;  1LBZ A;  5H8N B;  2ANJ A;  4PE5 B;  4Q0C A;  2R8T A;  3BBR A;  4H6D A;  1URS A;  2UVG A;  1FBC A;  1DPE A;  3SES A;  2DWA A;  1JW4 A;  2F78 A;  3CIJ A;  2ABH A;  4JWX A;  1FTJ A;  3MPL A;  4JSD A;  2RF1 A;  3IFC A;  2AYS A;  4F3P A;  1SYH A;  2HHM A;  1GTK A;  3K01 A;  4FIM A;  4MIJ A;  4OET A;  4IR8 A;  4NF6 A;  4YKI A;  4MHF A;  4FED A;  5DVF A;  3N94 A;  2Z22 A;  3MAM A;  2NWJ A;  5DVI A;  1PB7 A;  1FJ9 A;  1LLS A;  4THI A;  3WAF A;  5EYF A;  2REJ A;  2QMW A;  4OEV A;  4JVI A;  2XXX A;  3CVG A;  3DP8 A;  3FXQ A;  3KOS A;  4E0W A;  3RYD A;  4C1T A;  1EZO A;  3ECR A;  3AXF A;  3MWB A;  4N4U A;  2Q9T A;  3G3G A;  3C4M A;  1K9Y A;  3Q27 A; 
#chains in the Genus database with same CATH homology
 2HZL A;  2P2A A;  2DSF A;  2P1S A;  4RK2 A;  3IOT A;  4XIG Q;  1IIW A;  3C9H A;  1MQI A;  1JNF A;  2V3T A;  2PMS A;  3IB2 A;  2OJT A;  2UYF A;  2D5W A;  5J1D A;  3KN7 A;  4OES A;  3C34 A;  3EPE A;  3C36 A;  4XKQ A;  1ZKB A;  5KCJ B;  4F1Y A;  4EQ9 A;  3VVD A;  3CR9 A;  5FHN A;  2DS9 A;  3K6V A;  4O3A A;  4F3B A;  4HTG A;  4EDP A;  2E1S A;  1MG1 A;  3MQ9 A;  3L6G A;  3O9P A;  4G4P A;  4LUB A;  1PEB A;  1SQY A;  1UQW A;  5M2V A;  4GL8 A;  3FVK A;  5FTI A;  1KWH A;  5IKB A;  1FQC A;  1LFH A;  4IY6 A;  2QS3 A;  1R1N A;  3HN0 A;  3JYR A;  4OYV A;  4GD5 A;  5ICT A;  4I8C A;  1VE4 A;  5CBR A;  2ZYO A;  3LSL A;  2O69 A;  1POT A;  3FJM A;  1CE2 A;  3V83 A;  1Z7N E;  2H4I A;  4ISU A;  2RC7 A;  3VVE A;  4BDQ A;  4ZEK A;  1UIV A;  4LP2 B;  4EQB A;  1JEV A;  4OQO A;  4JXI A;  3MVX A;  5EHM A;  3CG3 A;  5B70 A;  1Y4T A;  3IB1 A;  4YKJ A;  2V3Q A;  1B40 A;  3OEL A;  5I2K A;  4H67 A;  4QFN A;  4WED A;  2R9J A;  5TP9 A;  4U2R A;  4ELQ A;  5I84 A;  3SET A;  3RPW A;  3RLF E;  1OLC A;  1M5D A;  2XXR A;  3FXR A;  1JQF A;  4WEP A;  1JEU A;  1ANF A;  3ZKL A;  3H6T A;  1N7W A;  2RIN A;  4G8N A;  1PB8 A;  3CRB A;  4Z0I A;  1DPP A;  2I3W A;  4DXB A;  5H8Q A;  4KCC A;  4IO7 A;  1IQ7 A;  5L9S A;  4MLQ A;  4YB6 A;  1MPD A;  4RA1 A;  1B58 A;  1B3G A;  4X1D A;  3C35 A;  2NOO A;  1DMB A;  3OSQ A;  1AIV A;  2Z8E A;  1Z7M E;  4NF4 A;  5CMM A;  3V89 B;  1MPB A;  3O6G A;  1BLF A;  5H8H B;  3U72 A;  2A5T A;  1O7T A;  3TTL A;  2UVI A;  1SW1 A;  1MH4 A;  1NL5 A;  4Q5T A;  1BTJ A;  1LB9 A;  1MQJ A;  3LUY A;  3GLB A;  1LST A;  5L9O A;  3VE1 B;  1WOD A;  4PFY A;  4NMY A;  4JB7 A;  5K2X A;  4JWO A;  3RY3 A;  2ZNU A;  2Q88 A;  1LAX A;  4EXL A;  5I59 A;  3O29 A;  4FAT A;  1P1N A;  3FAS A;  3CFL A;  2VD3 A;  4DE8 A;  2A5S A;  2Z23 A;  3KGC A;  4OFJ A;  4ZEB A;  1N04 A;  3VVF A;  4ZZA A;  2H5Y A;  1YPN A;  3U1O A;  3GZG A;  4ZEC A;  2Z8F A;  1FTK A;  2ZXT A;  1QW0 A;  4U22 A;  1B3H A;  3HPI A;  3H03 A;  3PUV E;  3PUX E;  2F6G A;  5DVJ A;  1B0H A;  4POX A;  3KBR A;  2F97 A;  3OXN A;  3LBS A;  5FTH A;  2R71 A;  2YJP A;  5CBS A;  1B5H A;  3UIF A;  4MLV A;  2B3F A;  5KZT A;  2Y7W A;  4F3G A;  4LZ5 A;  1DTZ A;  3TOD A;  1D9Y A;  4F19 A;  2I4B A;  1A54 A;  3E9X A;  3QUJ A;  1MH3 A;  4PFU A;  3MVW A;  5I2N A;  2XXH A;  1NH7 A;  5JTY B;  4NWD A;  2ZYM A;  1FW0 A;  1MXU A;  2RC9 A;  1UTB A;  1B9J A;  2XXW A;  4OEN A;  1Y1Z A;  4H0W A;  4PP0 A;  4PFW A;  2FYI A;  2XXU A;  1B0L A;  1URD A;  1N3W A;  2QPQ A;  2WKY A;  3CFX A;  3IL1 B;  2G29 A;  2QRY A;  4QFK A;  1L5T A;  4DIG A;  1B7H A;  1JET A;  3OO8 A;  5CMK A;  1P1U A;  1SYI A;  4X9T A;  1H45 A;  5F1Q A;  3PGF A;  3W9V A;  2VOZ A;  2YPN A;  5H8S A;  4H1X A;  1BIY A;  5BWJ A;  4O3B A;  2BJJ X;  5CRY A;  3VLW A;  3KFM A;  4N07 A;  4O3C A;  4E0X A;  1I6Q A;  1QUK A;  4GOT A;  4F18 A;  4JSO A;  4WXJ A;  3S9N C;  4MBP A;  2GFE A;  3V8X B;  3K6W A;  3JV9 A;  3MP6 A;  4OZ9 A;  1I6B A;  3TCH A;  3C33 A;  2HAU A;  1A55 A;  4G8M A;  4BLA A;  4FJP A;  3IOR A;  3PUZ E;  1GV8 A;  3RT6 B;  3EHT A;  1Y4C A;  4JDF A;  1OLA A;  5I58 B;  1FQD A;  3KJT A;  3OO6 A;  3TMG A;  5ITP A;  2HCA A;  3FD3 A;  1ZTY A;  2DWI A;  2V25 A;  4PQJ A;  3O66 A;  3L6H A;  2RC8 A;  4QSD A;  3FIR A;  4R72 A;  3G3I A;  5AA2 A;  3KN8 A;  2I49 A;  4LQ5 A;  4X48 A;  5AA4 A;  4GF8 A;  1IZ1 A;  2XXI A;  4ZEI A;  3SDF A;  3K4U A;  1Q35 A;  1QJM A;  1JVY A;  3MZB A;  2Y7K A;  2UYE A;  5HM4 B;  3RT8 A;  1R9Q A;  4YAH X;  4NWC A;  1IUD A;  4WKM A;  3CG1 A;  5A5X A;  2V84 A;  3OO7 A;  3EHU A;  1EZ9 A;  2HXW A;  5CMC A;  3GXA A;  3CI8 A;  5CI5 A;  2B65 A;  4XTC Q;  1OIB A;  3TQW A;  2ONK E;  2I4C A;  5FHO A;  1CB6 A;  3M3L A;  3RTF B;  1PDA A;  4ZS9 A;  1PB9 A;  3MUQ A;  4IGT A;  5DTB A;  5KDT A;  3SEW A;  2XXV A;  1NMU A;  4MH5 A;  4RXL A;  3R7X A;  3MBP A;  4OEU A;  4R73 A;  4R74 A;  5CM6 A;  2GH9 A;  4KHZ E;  5L9M A;  1B32 A;  4YMB A;  5AA1 A;  3TDJ A;  1MXW A;  3O6I A;  4BDL A;  3UA8 A;  1USY H;  3TPA A;  2LAO A;  2V93 A;  4IO3 A;  4POW A;  1RKM A;  1AH5 A;  2B3B A;  3E13 X;  3IX1 A;  3TUS A;  1GR2 A;  2G93 A;  1LB8 A;  2DE3 A;  5I56 A;  1WDN A;  3OOA A;  1D4N A;  1B7U A;  1ZIU A;  4BDM A;  3PMW A;  4QSC A;  1NNK A;  4R9F A;  4RPN A;  1P1W A;  1B51 A;  1TFD A;  1OVT A;  4F2O A;  1A7L A;  1OQH A;  4LQ2 A;  2DXY A;  4X1B A;  3MP1 A;  1SW4 A;  3KG2 A;  3RTW B;  1QUL A;  2YLN A;  2QSX A;  1FTO A;  2AL5 A;  1Y3P A;  1LFG A;  2HEU A;  3BFT A;  3CSG A;  4G2Z A;  1POY 1;  1XC1 A;  3PU5 A;  2OWS A;  1B3L A;  1NFT A;  1FQE A;  3SEV A;  1FQB A;  1YCJ A;  3EN3 A;  1USY E;  3E4R A;  1TT1 A;  1HSJ A;  2HFB A;  2DE4 A;  4EUO A;  2OBG A;  3FVN A;  1S9T A;  3QAX A;  1R9L A;  3N6U A;  2H98 A;  3IK6 B;  4KR5 A;  5ELV A;  3IO6 A;  5TP9 B;  4H8I A;  3GBA A;  2PBW A;  4IGR A;  1N3X A;  2O1M A;  2REG A;  3MVZ A;  1B3F A;  1LCF A;  3T22 A;  4KD5 A;  1AL3 A;  3DLN A;  4YB5 A;  2I0C A;  5TU0 A;  3FGS A;  4TOZ A;  4UAC A;  3IB0 A;  4YKK A;  2Y7I A;  2HQ0 A;  3H4Z A;  4U23 A;  3MPK A;  1H76 A;  2PT1 A;  4ONY A;  1XHY A;  1IEJ A;  5AE4 A;  3SEY A;  3KEI A;  1B4H A;  5H8Q B;  3TFL A;  2DVC A;  2DXR A;  2X7Q A;  4R75 A;  3TZA A;  1NNP A;  2GHA A;  4G68 A;  4KYS A;  2X26 A;  4ESX A;  1MM7 A;  2DWJ A;  4FE8 A;  4OTE A;  4NF4 B;  2NUV A;  4YB7 A;  4BDO A;  1B1X A;  3K1N A;  4YZZ A;  3MP8 A;  4KYE A;  4U21 A;  4KQP A;  3MJN A;  2A5T B;  3KSJ A;  4H5F A;  3VLV A;  3USD A;  4NF8 A;  3T9X B;  3O6H A;  3BKI B;  2KLF A;  3U92 A;  1N76 A;  1B52 A;  4GRK A;  4YIC A;  2Z8D A;  2O7U A;  1MY4 A;  4XKN A;  1A8E A;  1P1O A;  4NF5 A;  3G3J A;  3O28 A;  4P0I A;  3PV0 E;  4MFI A;  1QKA A;  4U4S A;  5I59 B;  5DT6 A;  3T66 A;  2ZYK A;  3K6X A;  4U4X A;  3FJ7 A;  3QUF A;  3FJG A;  4LAT A;  1JW1 A;  1BKA A;  3PPN A;  5H8F A;  5ISU A;  2CMO A;  1MRP A;  1LAG E;  3DM0 A;  3TQL A;  1MXX A;  3RUM A;  3G7W A;  2H99 A;  3B6Q A;  3H6W A;  4DCY A;  2UVH A;  4H5G A;  1FQF A;  4ZZE A;  4K3F A;  2O1L A;  2XXY A;  4QRZ A;  3TKD A;  4FEB A;  2DQV A;  5BUU A;  2XD2 A;  3TYH A;  3O97 A;  1AOV A;  4LON B;  3R26 A;  4GQO A;  3DP6 A;  5I2N B;  1MPC A;  4F1U A;  1Y20 A;  4R2F A;  1TWY A;  2DVZ A;  4F1V A;  4BDN A;  4JWY A;  3N26 A;  1UTB B;  3MC2 A;  2D3I A;  1UTH A;  1S7Y A;  2E0S A;  4H65 A;  1SVX B;  4RNS A;  4OER A;  2QMX A;  3A3C A;  4R6Y A;  1J1N A;  1SD3 A;  1S50 A;  1SI0 A;  4QHQ A;  2F35 A;  4I9D A;  2VD2 A;  4ZEF A;  1SI1 A;  3HCQ A;  2I3V A;  3G3H A;  4OHN A;  3VDF A;  2P0S A;  3I3V A;  4FEC A;  4IO6 A;  4DXC A;  1US4 A;  3TTM A;  4GWO A;  2HZK A;  3Q28 A;  1Y9U A;  3B7D A;  1GVC A;  4OFL A;  1QKB A;  3FAT A;  1IXC A;  4HCW A;  4M4G A;  2NVU B;  1H3D A;  3C32 A;  1MXY A;  1PC3 A;  3KSX A;  4XKP A;  1N0T A;  3IOU A;  1IXI A;  3EF7 A;  2IA4 A;  1XVX A;  1P99 A;  4ZE9 A;  3HV1 A;  3ONM A;  2QL3 A;  3LSW A;  2ONS A;  4YMA A;  5EHS A;  2I6E A;  4MF3 A;  3C31 A;  3W9W A;  3HO7 A;  4HCY A;  3FVG A;  3LSF B;  5TPA A;  2Q8J A;  4RYA A;  3N6T A;  2IEE A;  3TEP A;  3OSR A;  3ILT B;  1B2H A;  2F7C A;  3PPR A;  2V3U A;  3FZV A;  3OMB A;  5DEX A;  3S4U A;  2I0B A;  4Q30 B;  5L8D A;  2D21 A;  3IAZ A;  1PBP A;  3M3F A;  2ALU A;  3TCF A;  3IO4 A;  1MS7 A;  4R2B A;  4DCX A;  3EQ1 A;  3V5A A;  5AA2 B;  1MQG A;  4QF9 A;  1SW5 A;  5AA4 B;  5CMB A;  1B05 A;  1EU8 A;  4HS7 A;  4XKR A;  1O63 A;  3HHG A;  2VHA A;  1ATG A;  2ZMB A;  4DXU A;  1MDQ A;  1D3K A;  5A5X B;  2Y84 A;  3S9L C;  4P11 A;  1AMF A;  4ELP A;  2THI A;  3PD9 A;  2PVU A;  4NF6 B;  4EF1 A;  3K00 A;  2UXA A;  3SKP A;  1EH3 A;  5I57 A;  2QS2 A;  1WVJ A;  1M5B A;  4F3S A;  1SW2 A;  2ZNS A;  3VXB A;  4LZ8 A;  2PYY A;  3K2D A;  5KDT B;  1Y3Q A;  4EF2 A;  3MVY A;  2ONR A;  3QK6 A;  1QVS A;  3U94 A;  1DSN A;  5H8N A;  2ZYN A;  3THI A;  3CSB A;  4DLD A;  1R6Z A;  4R6K A;  3Q26 A;  1FTL A;  3IOW A;  3EHS A;  2OWT A;  3TAJ A;  3K1M A;  4GLI A;  1JW5 A;  3PUY E;  1B1H A;  1D9V A;  1NKX A;  3ODB A;  4YU0 A;  3H3G A;  4OVJ A;  1ZMG A;  1XS5 A;  2F8D A;  1B6H A;  5I56 B;  4LA9 A;  2GHB A;  2ESN A;  1RYX A;  4NTL A;  4C1U A;  3OEK A;  4RPO A;  1P1Q A;  2XXP A;  3T9U A;  3S9E A;  1QUI A;  4ND9 A;  2F6P A;  5AA2 D;  2XX9 A;  5FHM A;  2AL4 A;  3QSL A;  4YKP A;  1OQG A;  2RCA A;  3PPP A;  2ZNT A;  4OXV A;  1XOC A;  3T93 B;  1DOT A;  2XXT A;  4I62 A;  2O6A A;  4KFQ A;  3UGW A;  3LSX A;  3QIM A;  2F5X A;  1A40 A;  4R9G A;  4TLM B;  2H25 A;  1LBC A;  2QS4 A;  3TCG A;  4L17 A;  3GBB A;  3JZJ A;  1M5E A;  2XD3 A;  1LAH E;  3TTK A;  3UK4 A;  1VSO A;  3SER A;  5KCJ A;  4ELO A;  1FQA A;  3ZKK A;  1ZBM A;  2F36 A;  3K0V A;  2Y7R A;  4KYD A;  1HSL A;  2CZL A;  4QFO A;  2O68 A;  5B7D A;  4NE4 A;  3RQT A;  4G68 C;  3VFJ A;  1M5F A;  1MY1 A;  3G3F A;  3SEX A;  4TQU Q;  1TFA A;  3RN8 A;  1OMP A;  3MZ1 A;  3BFU A;  5I2K B;  1IXH A;  4KPT A;  3PUW E;  2DE2 A;  1VFD A;  1XVY A;  1IIT A;  3H06 B;  1PBQ A;  3Q29 A;  1B3E A;  3P7I A;  1LGB C;  1FTM A;  3T9H B;  3M8U A;  4IO2 A;  3LC8 A;  4F22 A;  4GXA A;  3PMX A;  5K2Y A;  1GGG A;  2O7I A;  4G68 B;  4ZED A;  1MY2 A;  3Q25 A;  4OMB A;  1F9B A;  3ZSF A;  2QS1 A;  1A99 A;  3FVO A;  4FAJ A;  3DP4 A;  4OWD A;  2OCU A;  2Q89 A;  5F7V A;  4I1D A;  2F7B A;  3K02 A;  3N5L A;  3U8Q A;  5AA3 A;  1LBB A;  4N6P A;  3TEL A;  1Y3N A;  1LCT A;  4RY1 A;  2DYX A;  1T0K A;  3R6U A;  3KN3 A;  4NF8 B;  2VP1 A;  3DEL B;  3HST A;  3UN6 A;  2DOJ A;  3IJO B;  3KJ7 A;  5ITO A;  4ELR A;  3G3K A;  3RNN A;  5JK4 A;  2Y7P A;  4R6H A;  4BDR A;  2OK2 A;  4IO4 A;  3T9V A;  4NF5 B;  4PET A;  4ESW A;  4OFO A;  3FUZ A;  1B5J A;  1YAE A;  3F11 A;  1H43 A;  2DP8 A;  4LZ7 A;  2VGQ A;  2O51 A;  4P0G A;  3H6V A;  3A3U A;  2OLB A;  4GVO A;  1DTG A;  3I6V A;  3FXU A;  5H8F B;  3PD8 A;  3KZG A;  4AB6 A;  1VR5 A;  5HBC A;  3LR1 A;  3IJX B;  4PFT A;  3H6U A;  3PPQ A;  1A8F A;  1I6A A;  1ZU0 A;  3TTN A;  2HAV A;  2RCB A;  1MM6 A;  5IAI A;  4DZ1 A;  5ICQ A;  3OO9 A;  2XXQ A;  5H8H A;  4IY5 A;  1MQH A;  4FOR A;  2I58 A;  3S2V A;  4F29 A;  4HW8 A;  4QFL A;  4N13 A;  1FCK A;  3OEN A;  4XXU A;  2I48 A;  2UVJ A;  2F7A A;  3W15 C;  1N84 A;  1MXV A;  3M3K A;  1H44 A;  3HHF A;  4EXK A;  1MY3 A;  4TLL B;  3B6W A;  1B46 A;  2RKM A;  3K1P A;  1B7Z A;  5LOM A;  2DWH A;  2F34 A;  2Q2C A;  3QYT A;  3O2A A;  1UTH B;  4F31 B;  3S9M C;  1SBP A;  2AIX A;  3IR1 A;  1NH8 A;  2X7P A;  4Q8R A;  4M1V A;  3D4G A;  3MZ9 A;  2H9B A;  4EQ7 A;  4GIZ A;  4ZDM A;  2XX7 A;  4G8H A;  4ZE8 A;  1ZJL A;  4F39 A;  2GRV A;  1XT8 A;  2XX8 A;  3MW0 A;  4QSE A;  3PMV A;  4Z7E A;  3T96 B;  1US5 A;  3VXC A;  5HPQ A;  2O84 X;  1MY0 A;  4U1O A;  1MDP 1;  2Q2A A;  3FV1 A;  5DYH A;  1URG A;  3QXM A;  1EZP A;  2OZZ A;  1BP5 A;  2FA7 A;  1RYO A;  3FV2 A;  1B5I A;  5JTY A;  1M5C A;  1N7X A;  5JEI A;  1SDX A;  4U1Z A;  3WAE A;  1JVX A;  3OEM A;  3OD7 A;  3ILU B;  5TPA B;  4DDD A;  3E3K A;  3IOV A;  4AB5 A;  4QFP A;  3K6U A;  1O64 A;  3U93 A;  4ECF A;  4LVQ A;  2PT2 A;  5DEX B;  4H8J A;  1HSE A;  1Y1M A;  3KOT A;  3I5O A;  1IXG A;  3VLU A;  1UIU A;  1TXF A;  1Q1K A;  1YTV A;  3TTR A;  2NXO A;  2XHD A;  2PX1 A;  3A09 A;  1NNF A;  4G77 A;  3B6T A;  3H7M A;  4IO5 A;  4UA8 A;  4RK9 A;  3UOR A;  2FNC A;  3PPO A;  2W7Y A;  3CFZ A;  1VFE A;  3ZS6 A;  3UP9 A;  2QJE A;  4F2Q A;  4GL0 A;  1NNT A;  1B4Z A;  1ZLQ A;  1MXZ A;  5CC2 A;  4GFR A;  4AQ4 A;  1MQD A;  4JBZ A;  3SEU A;  4KI0 E;  3RGY A;  1LAF E;  1LFI A;  1II5 A;  4IB2 A;  2M8C A;  5I57 B;  1OVB A;  4RJZ A;  3D4C A;  1QUJ A;  4NED A;  3VV5 A;  1ELJ A;  4GXS B;  5I58 A;  4KCD A;  2R6G E;  1I69 A;  5H8N B;  2ANJ A;  4PE5 B;  4Q0C A;  3BBR A;  4H6D A;  1URS A;  2UVG A;  1DPE A;  3SES A;  2DWA A;  1JW4 A;  2F78 A;  3CIJ A;  2ABH A;  4JWX A;  1FTJ A;  3MPL A;  4JSD A;  2RF1 A;  2AYS A;  4F3P A;  1SYH A;  1GTK A;  3K01 A;  4FIM A;  4OET A;  4NF6 A;  4YKI A;  4FED A;  5DVF A;  3N94 A;  2Z22 A;  3MAM A;  2NWJ A;  5DVI A;  1PB7 A;  1LLS A;  4THI A;  3WAF A;  5EYF A;  2REJ A;  2QMW A;  4OEV A;  2XXX A;  3CVG A;  3DP8 A;  3FXQ A;  3KOS A;  4E0W A;  4C1T A;  1EZO A;  3ECR A;  3AXF A;  3MWB A;  2Q9T A;  3G3G A;  3C4M A;  4C0R A;  3Q27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...