1FQEA

Crystal structures of mutant (k206a) that abolish the dilysine interaction in the n-lobe of human transferrin
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVAHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures and iron release properties of mutants (K206A and K296A) that abolish the dilysine interaction in the N-lobe of human transferrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords SEROTRANSFERRIN
total genus 100
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2000-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1fqeA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1fqeA02
1AL3A 1IXHA 5I2NA 1N7XA 1MXVA 2PBWA 3C4MA 2GRVA 4MBPA 4OVJA 3E9XA 5DVFA 5AE4A 2DWAA 2X7PA 4EXKA 2XXQA 4XXUA 3A3CA 1IUDA 1URDA 4YKJA 3VXCA 5AA4B 2VHAA 5CMMA 1I6QA 2M8CA 4F1UA 1OLAA 1FQBA 1Y1ZA 4PETA 4X9TA 5I57B 3FJGA 2OZZA 3RNNA 1B5JA 3HSTA 1LCFA 3EPEA 4MLQA 2PYYA 2O68A 5EHSA 2X7QA 4LVQA 1PDAA 5DVJA 2F7BA 1FQFA 1DTGA 1EH3A 1MY2A 4QFOA 2H25A 2Q88A 3E3KA 4TOZA 2PMSA 4ZE9A 3UA8A 1B2HA 1POTA 2UVGA 2ZNTA 4NTLA 4XIGQ 4ESXA 3IL1B 3K6WA 1TWYA 3CG3A 3RGYA 2F6GA 3G3GA 2Z8DA 1DTZA 2HFBA 3G3HA 4LQ5A 3IO4A 4FEBA 4Z0IA 1AMFA 5ISUA 2UYEA 1Y3PA 2D5WA 4NF6B 1L5TA 2XD3A 3VLWA 3W9WA 1UTHB 3DP4A 2O1MA 3KOSA 4BLAA 3CSGA 1ANFA 1B5IA 1BP5A 1D9YA 4ELQA 3MPKA 4NWDA 5H8SA 4DCYA 1Y3QA 3MQ9A 3TQLA 4RXLA 4ZECA 4JXIA 4M4GA 4GVOA 3SESA 3I6VA 3FXQA 5DTBA 5JTYA 3OOAA 4WEDA 4MF3A 3VVDA 5DYHA 4KYDA 1N7WA 2DE2A 3BFTA 4G68B 3SEYA 1B4ZA 2VD3A 4F1VA 1USYE 2QS2A 2VOZA 3GBAA 1JEUA 3G3KA 3MBPA 4JWXA 1FCKA 5BWJA 4KCDA 3OSQA 1B6HA 2AYSA 4F22A 4NF4A 1S9TA 1XHYA 4IY6A 4KFQA 4ELOA 1ZIUA 1JW1A 3IR1A 3M8UA 1PB8A 3OO8A 4H67A 4OETA 3RUMA 1N76A 2RCBA 2XXYA 4KYSA 5L8DA 2ANJA 5DEXB 2PVUA 1M5CA 4RJZA 3R7XA 1GV8A 4F3GA 3FJMA 2GHAA 1TXFA 2CMOA 3K6UA 3CFXA 4GIZA 3MZ9A 4DLDA 4NEDA 1MM7A 1N3WA 2DE4A 5CI5A 2O69A 2Z8FA 3SEVA 3O66A 1A8FA 3FVGA 4L17A 1MM6A 1GTKA 2Y7RA 1ZTYA 3MP6A 4ZS9A 3VDFA 1A55A 2RF1A 2V3TA 4G8HA 3N26A 1UTBB 4XKQA 1NFTA 1FTMA 3HPIA 3K01A 3M3FA 4KPTA 3WAFA 4EXLA 1B7ZA 1MQDA 5I56A 3QAXA 1JQFA 3CFZA 4F19A 2O7IA 2UYFA 1P1UA 4BDRA 4FECA 2ZYMA 5H8NA 4Q8RA 1KWHA 1FQCA 2QMWA 3TODA 1XVXA 1ZBMA 2GH9A 4H0WA 5I56B 3EHSA 2DXRA 2Y7KA 1B3HA 1A99A 4O3CA 3TEPA 1FQEA 3H6VA 3KOTA 1HSLA 1LCTA 1SQYA 2DE3A 1OQHA 2DXYA 3I3VA 3JYRA 4GLIA 5AA2D 3ZKKA 4Q5TA 3JZJA 4RY1A 4KYEA 2I4BA 4YMAA 5A5XB 4GL0A 3TCHA 1B3FA 1P1NA 5TPAB 3IOUA 1M5FA 4LP2B 4U21A 4ELRA 3PUXE 4YKKA 4F2QA 3C31A 3KEIA 1O63A 3UORA 1GR2A 3DP6A 1MY0A 3PPOA 1CE2A 3VXBA 4IGTA 2F5XA 4BDMA 3O28A 4H8JA 4C1TA 1SW4A 4R2FA 3IO6A 4KI0E 2UVJA 2H9BA 2I3WA 5CMKA 4H8IA 2QJEA 3PUVE 3RT8A 4FIMA 2ESNA 1LFIA 1PB7A 2XXIA 3MP1A 2QMXA 1Y9UA 1SI0A 2O51A 2AL5A 1MG1A 1P1WA 3QXMA 4MLVA 4R6HA 4Q0CA 3FUZA 1MXWA 4LZ7A 2RINA 3IOWA 3IB0A 3N6TA 3PPPA 2D21A 3USDA 4QRZA 1USYH 1O64A 5CBSA 4U4XA 2F7AA 3MJNA 3D4GA 1SW5A 2HAVA 4LQ2A 3T9XB 2DWHA 3E4RA 1YPNA 2XX7A 3PD9A 4IO2A 4EF2A 1PBQA 3IJOB 1JW5A 1B40A 1B0HA 4U1ZA 2WKYA 3VLUA 1H43A 5FTIA 3ILUB 4U1OA 2V93A 4UACA 3RLFE 1QULA 3B6TA 4HTGA 3RY3A 1J1NA 4EF1A 1US5A 1IQ7A 4GQOA 3IOTA 4NF6A 4OEVA 2OCUA 5A5XA 3Q28A 2DQVA 3FVKA 5I84A 1OIBA 1H76A 2XXUA 4RA1A 4BDNA 5HM4B 1LAGE 2I6EA 3TTNA 1Z7NE 1M5EA 2ONRA 2Y7IA 3C32A 3FV1A 3KJ7A 1QVSA 4F3BA 4GD5A 4KHZE 3QK6A 5TU0A 5B70A 3TQWA 4H6DA 3KG2A 1QW0A 3M3KA 4F29A 1ZJLA 5CRYA 1NNKA 3V5AA 3SETA 4M1VA 2Q89A 3V89B 3FIRA 2PT2A 3OD7A 4ELPA 1UTBA 5CM6A 3OMBA 3L6GA 1IXIA 3PMVA 4GF8A 4QSEA 3FXRA 4I1DA 1RKMA 2PX1A 4TLMB 2O84X 3U93A 3KSXA 4U22A 3CRBA 4FEDA 3U94A 3RTFB 4BDQA 5ICQA 1Q35A 4IO3A 1LSTA 2B3BA 2ONKE 2Q2AA 4PQJA 4ESWA 5I57A 3OO7A 5K2XA 3KN3A 3SEWA 3TCFA 5H8QB 4U4SA 4JWYA 3KN8A 3RPWA 2ZMBA 3PMWA 3TCGA 1MH3A 1MQJA 3UIFA 2F78A 3ZKLA 5L9SA 5J1DA 3H4ZA 1QKBA 1EU8A 3MVWA 1MY4A 2DWIA 4OHNA 3TMGA 1F9BA 2G93A 1SVXB 4QFKA 3AXFA 4NF4B 5I2KB 3H06B 5AA2A 2XXTA 1YCJA 1ZLQA 2UXAA 3B6QA 3K4UA 3SERA 1LB8A 3U72A 3Q29A 3A09A 3C9HA 3CG1A 2IA4A 3EF7A 2XXHA 3P7IA 4QFLA 4OENA 5DT6A 5L9MA 3THIA 4P0IA 3ZS6A 4C1UA 1YTVA 4K3FA 1JVYA 1FTKA 1Q1KA 2OJTA 3GBBA 1LBBA 4YKIA 1QKAA 4ZDMA 2DS9A 3LSFB 3A3UA 3Q25A 2V84A 2NVUB 1D9VA 3PUWE 2OWTA 1LAFE 1B3GA 2Z22A 3ONMA 2I3VA 3C35A 4F2OA 5ICTA 5KCJB 1SYIA 1MXZA 3OEMA 2PT1A 1URGA 4DXUA 4X1BA 1Z7ME 4NF8A 5M2VA 1H3DA 2ZNUA 4R9GA 1DSNA 4OXVA 4R72A 2R9JA 2A5SA 1I69A 3T66A 3MUQA 3TTLA 3PU5A 4FATA 5H8NB 3VLVA 2FYIA 3O9PA 3OEKA 5CMCA 3UP9A 4G2ZA 1IXCA 4YMBA 4FJPA 5AA1A 4FORA 2QS1A 4LATA 3KZGA 3PD8A 1OVBA 4I8CA 4WXJA 5KDTA 3G3FA 1M5DA 3O2AA 2BJJX 4YB5A 2ZNSA 1NH7A 3LR1A 2I49A 1QUIA 1MPBA 4LZ5A 3MZBA 3DELB 1BTJA 2KLFA 5L9OA 3K02A 4JSDA 4IO4A 4OESA 4NWCA 3C34A 3TFLA 1FTLA 1A40A 3QUFA 2R71A 2XXVA 3DP8A 5AA3A 1JNFA 1OVTA 2QL3A 2UVHA 3K6XA 2E1SA 3B6WA 4G8NA 4JSOA 4ZZEA 2QRYA 5CC2A 5JEIA 1B32A 3QYTA 4PFTA 3PGFA 1N3XA 3TTRA 3W15C 4IB2A 4IY5A 1NNPA 2VP1A 2F6PA 3K1PA 4I62A 2O7UA 3O97A 4JB7A 4PE5B 5JK4A 5F1QA 2RC9A 3MVZA 3H6UA 3OSRA 5H8HA 1IEJA 1SYHA 2P0SA 5K2YA 4H5GA 2LAOA 3C33A 1O7TA 2I48A 1FW0A 3HN0A 3PPQA 2HAUA 2Q8JA 3GZGA 3TKDA 4G68A 5FHMA 2I0BA 3PUZE 4OWDA 4GWOA 1B7HA 1PEBA 2G29A 2I0CA 2R6GE 2RKMA 1DPEA 3HHGA 1R1NA 3PMXA 4IGRA 4IO6A 3VFJA 1NKXA 4LUBA 4DDDA 1TFAA 4DXBA 3S9MC 3MW0A 2P1SA 3RT6B 3FV2A 4QSCA 4THIA 1B46A 3T9UA 4H65A 5KCJA 1AOVA 3PPNA 1XOCA 3RTWB 4F1YA 2F35A 3TDJA 3ILTB 1H45A 4MH5A 5LOMA 1B0LA 3LBSA 4KCCA 2QPQA 3FVOA 4OMBA 1P1QA 1UIUA 3TZAA 1EZOA 1SW1A 4PFYA 1MDQA 1D3KA 1I6BA 1UQWA 1ATGA 2RCAA 3HV1A 3LSWA 3LUYA 3PPRA 3VE1B 1TFDA 1R6ZA 2QS4A 4DE8A 3RN8A 4RYAA 2H5YA 4OFJA 4AB5A 3IX1A 4E0WA 3UN6A 1LAXA 1MQHA 3OELA 3S2VA 4EUOA 4EQ7A 1AH5A 1SI1A 4JDFA 2OK2A 3K1NA 3H6WA 4P11A 1FTJA 1B9JA 3K2DA 3U92A 3SEXA 1ZKBA 2I4CA 3BFUA 5CMBA 1PBPA 3LC8A 3MZ1A 4R73A 5H8QA 4F39A 2F97A 3SKPA 3FJ7A 2F7CA 1MY3A 3TUSA 4F18A 2QS3A 3CSBA 2ZYKA 4GL8A 3OO9A 4OTEA 5IAIA 1QJMA 1B1XA 1ZMGA 2GHBA 5FHNA 2OLBA 4R75A 1II5A 2I58A 4U23A 5FHOA 5AA2B 1B7UA 1R9QA 4FAJA 1LGBC 4C0RA 1A7LA 3G3JA 1B51A 2Y84A 4XKPA 2UVIA 2YLNA 3FXUA 3QIMA 4R2BA 4YB6A 3ECRA 3LSXA 2DVZA 4XKRA 1Y3NA 2XX8A 1MRPA 2REJA 1IZ1A 2VD2A 3K6VA 4Q30B 1JVXA 3TTMA 4DZ1A 2XXPA 3U1OA 1FQDA 2XXRA 2CZLA 4HS7A 4F31B 1NNTA 3FD3A 4IO5A 4R6YA 3DLNA 5HPQA 3MVXA 4BDOA 1H44A 5I58B 4OYVA 4ZEDA 2Y7WA 2IEEA 4HW8A 3MPLA 3CI8A 4DCXA 4OEUA 2HQ0A 1ZU0A 4RK9A 1DMBA 4HCWA 4F3SA 4ECFA 2REGA 1MS7A 2ABHA 3L6HA 4BDLA 4YKPA 1N84A 2D3IA 3HHFA 4NF5B 4EQBA 1N0TA 4GXSB 3K00A 3O29A 3T22A 3W9VA 3C36A 1I6AA 4G77A 3TYHA 1LFGA 3B7DA 4QF9A 1OLCA 3V83A 1VFEA 2ZYNA 1SBPA 3FGSA 4HCYA 4R6KA 4WEPA 2O1LA 3H7MA 4E0XA 3MP8A 4O3BA 2O6AA 2ZYOA 4P0GA 4RPNA 3T93B 3H3GA 4GRKA 5DEXA 3QUJA 4EDPA 2AIXA 1B3EA 2AL4A 5IKBA 3H03A 4NE4A 1PB9A 4NMYA 3WAEA 1US4A 1NNFA 3IB1A 1JEVA 1S7YA 2FA7A 3VVEA 2W7YA 4G68C 3ZSFA 4F3PA 1NMUA 4QHQA 3IORA 2H98A 4MFIA 1AIVA 2HZLA 5ITPA 5I2KA 1SD3A 4IO7A 1B5HA 1FTOA 4ISUA 4PFWA 1RYOA 4R9FA 3CIJA 2NOOA 5TPAA 2ALUA 3QSLA 5ELVA 4DXCA 3T96B 5JTYB 1VR5A 1NL5A 2DYXA 1IIWA 4ZEIA 5ITOA 1B1HA 1FQAA 1HSEA 2YJPA 4RPOA 3TELA 4AB6A 4Z7EA 4XTCQ 5I59A 3S9EA 2RC8A 3D4CA 2OBGA 1B4HA 1POY1 2F36A 3RQTA 3H6TA 1A8EA 1MH4A 1IXGA 1WVJA 4OQOA 3N6UA 2XXWA 2H99A 3BKIB 3PUYE 3OXNA 3FVNA 1B58A 5FTHA 4N13A 3O6IA 5HBCA 1T0KA 2F8DA 1OMPA 2Q2CA 1DPPA 2DP8A 3IB2A 3IOVA 4GXAA 4OFLA 4RNSA 4UA8A 4JBZA 1B3LA 3IAZA 2HXWA 1R9LA 5TP9B 1Y20A 3MAMA 3Q27A 1VFDA 4O3AA 1HSJA 4POWA 2V3QA 1Y4TA 3E13X 1WODA 3K1MA 4KR5A 4PP0A 1XS5A 2HEUA 2XXXA 3OO6A 4TLLB 4YU0A 1UTHA 1SW2A 1YAEA 5F7VA 2V3UA 2Z23A 2Y7PA 4QFNA 4N6PA 3CR9A 4WKMA 2V25A 1MPDA 1XT8A 4LZ8A 4ZZAA 2XD2A 4X1DA 1P1OA 4PFUA 3S4UA 4G4PA 4EQ9A 5I58A 5KZTA 3VV5A 1BIYA 3LSLA 3JV9A 3TAJA 3G3IA 3M3LA 2Z8EA 3U8QA 5KDTB 1GGGA 3IJXB 4LONB 3SEUA 4TQUQ 4OFOA 3S9NC 3KFMA 2DWJA 1LBCA 3TTKA 1JETA 4ZE8A 5I59B 1LAHE 3V8XB 2THIA 3F11A 3UGWA 3OENA 3KJTA 1S50A 2A5TB 3CFLA 3HCQA 1LFHA 3DM0A 1URSA 2XHDA 3KN7A 4POXA 3SDFA 3VVFA 5DVIA 1SDXA 3FATA 4R74A 2RC7A 2HCAA 2OWSA 1DOTA 1LLSA 2H4IA 5EHMA 1RYXA 1PC3A 3T9HB 1MXUA 3TPAA 3CVGA 1MQIA 2B65A 3G7WA 1BKAA 1QUKA 3N5LA 1WDNA 3K0VA 4ZEFA 2FNCA 1TT1A 4GFRA 1MY1A 1XC1A 2HZKA 1MXYA 1GVCA 2QSXA 3KSJA 4YAHX 5H8FA 4DIGA 2F34A 3UK4A 2DSFA 3KGCA 4GOTA 4YICA 4H5FA 1MQGA 4XKNA 1MXXA 4X48A 4ND9A 4NF8B 1D4NA 4H1XA 4U2RA 2YPNA 2P2AA 1M5BA 1XVYA 2ONSA 3BBRA 5TP9A 2GFEA 3GLBA 3O6GA 1BLFA 4OERA 2ZXTA 4N07A 4NF5A 3FASA 4ZEBA 3HO7A 1QUJA 4QSDA 1B05A 3GXAA 5CBRA 3EN3A 3PV0E 1B52A 2NXOA 1CB6A 2NWJA 1VE4A 2NUVA 3KBRA 3N94A 1P99A 5BUUA 1Y1MA 5H8FB 3IK6B 4I9DA 4G8MA 3EHTA 3R26A 1EZPA 1NH8A 3O6HA 3EQ1A 3Q26A 1EZ9A 4KD5A 2Q9TA 1MDP1 4OZ9A 4QFPA 4ZEKA 3FZVA 2A5TA 2DOJA 4ONYA 1N04A 2DVCA 5B7DA 5AA4A 3MWBA 2E0SA 3EHUA 1OQGA 3MC2A 3I5OA 4FE8A 1VSOA 3T9VA 4AQ4A 4YZZA 3ODBA 1LB9A 4LA9A 4KQPA 2VGQA 5EYFA 2X26A 5I2NB 5H8HB 3S9LC 1ELJA 2B3FA 1JW4A 1Y4CA 1UIVA 3MVYA 1A54A 1MPCA 4JWOA 3R6UA 4RK2A 2XX9A 1IITA 4YB7A
chains in the Genus database with same CATH superfamily
1AL3A 1N7XA 4MBPA 4AS4A 5AA4B 5CMMA 2M8CA 4F1UA 4PETA 4X9TA 1Y1ZA 3EPEA 2PYYA 5EHSA 2X7QA 1EH3A 3E78A 3UA8A 1POTA 1DTZA 4PDHA 1Y3PA 2XD3A 3DP4A 4BLAA 3CSGA 1B5IA 1BP5A 2HHMA 5H8SA 4RXLA 4G61A 3SESA 5JTYA 3OOAA 4MF3A 3VVDA 5DYHA 4KYDA 1N7WA 2DE2A 3BFTA 1FJ9A 1JEUA 3RPLA 3OSQA 4F22A 1S9TA 5EQ9A 4ELOA 1ZIUA 3OO8A 3M8UA 4OETA 1G0IA 1M5CA 3R7XA 1RDZA 4F3GA 3CFXA 5CI5A 2O69A 4L17A 4XKQA 1FTMA 3M3FA 5IZ3B 4GWSA 5I56A 1JQFA 2UYFA 5ESYA 4H0WA 1FPDA 2DXRA 4O3CA 2KR0A 1HSLA 3D1RA 1FBHA 2BJIA 5IGAA 4KYEA 4YKKA 3KEIA 1XI6A 1GR2A 4C1TA 5IZ1A 3IO6A 2UVJA 5CMKA 4H8IA 2QJEA 3PUVE 3RT8A 1RDYA 1SI0A 4MLVA 2CEYA 2CZHA 1MXWA 2RINA 2D21A 3MJNA 3E4RA 3PD9A 4EF2A 3IJOB 1JW5A 2WKYA 1H43A 3ILUB 3RLFE 1FPIA 2V93A 1US5A 3TTNA 4KHZE 3TQWA 4H6DA 2Q89A 3FIRA 2PT2A 3OD7A 1UTBA 3OMBA 3L6GA 3FXRA 4U22A 3CRBA 3U94A 1FPBA 4IO3A 2B3BA 2ONKE 2XWKA 4ESWA 5I57A 3SEWA 4MJOA 4U4SA 5CBRA 3KN8A 3PMWA 3TCGA 1MH3A 1MQJA 2F78A 5L9SA 1QKBA 4OHNA 5I2KB 2XXTA 3CG1A 3EF7A 3THIA 4P0IA 1JVYA 4QXDA 1LBBA 1D9VA 2Z22A 3C35A 5ICTA 1NUXA 1URGA 1Z7ME 5M2VA 4R9GA 4OXVA 2A5SA 3MUQA 5H8NB 3O9PA 3UP9A 4G2ZA 4FJPA 4LATA 3KZGA 1OVBA 1KA0A 1MPBA 4LZ5A 3B50A 4NWCA 2R71A 3DP8A 1OVTA 3K6XA 4ZZEA 4G8NA 1B32A 5EQ8A 3K1PA 3O97A 4KXPA 3MVZA 5K2YA 2P0SA 2LAOA 2I48A 1FW0A 2HAUA 5FHMA 2HXRA 3KC1A 3PMXA 3FXBA 3MW0A 1B46A 1NUYA 1IMEA 1FBDA 1D3KA 4N15A 4DE8A 2DDKA 4RYAA 4P1EA 4AB5A 3IX1A 3OELA 2OK2A 4OVRA 3H6WA 2WBBA 3K2DA 3U92A 5EYHA 4F39A 4PBHA 3CSBA 2GHBA 2OLBA 2I58A 4FAJA 4C0RA 3G3JA 1B51A 2PFZA 3LSXA 1MRPA 2REJA 1IZ1A 4DZ1A 2XXRA 4GX3A 4HS7A 4IO5A 4R6YA 4ZEDA 3MPLA 3CI8A 1LBYA 4OEUA 2HQ0A 4RK9A 4F3SA 1FBFA 3L6HA 4YKPA 3K00A 3E79A 1LFGA 4QF9A 1VFEA 2ZYNA 3MP8A 4I3EA 3H3GA 2AL4A 3IFAA 1US4A 3IB1A 4G68C 3ZSFA 1NMUA 2H98A 1SD3A 2V4CA 4X8RA 3LV0A 4R9FA 3CIJA 4DXCA 3T96B 5JTYB 1NL5A 2DYXA 1FQAA 3TELA 2RC8A 3BIHA 4P3LA 3RQTA 1MH4A 1WVJA 4OQOA 2H99A 3BKIB 3PUYE 4N13A 5HBCA 1NI9A 2Q2CA 4UA8A 4GXAA 4RNSA 1FBPA 4JBZA 1T0KA 1VFDA 4POWA 2XXXA 3OO6A 1YAEA 4N4UA 2Q8MA 2Y7PA 4QFNA 4LZ8A 2XD2A 4X1DA 5I58A 4PFUA 4G4PA 4DI4B 3VV5A 4LONB 3SEUA 1NV7A 3TTKA 4MX6A 2THIA 3CFLA 4POXA 1URSA 2H4IA 3CVGA 2B65A 1BKAA 1QUKA 3N5LA 2KQZA 2QSXA 3KSJA 3RYDA 3UK4A 1KZ8A 4XKNA 4NX1A 4H1XA 2YPNA 2P2AA 2ONSA 5TP9A 1FBCA 4ZEBA 4I3YA 4FBPA 3PV0E 2NWJA 2ZZVA 2NUVA 4I9DA 4MHFA 1NH8A 1EZ9A 3FBPA 4OZ9A 2A5TA 5B7DA 3MWBA 2E0SA 3EHUA 1OQGA 3ODBA 1LB9A 4LA9A 5EYFA 3S9LC 1ELJA 1Y4CA 1UIVA 2XX9A 1IITA 4I40A 3C4MA 2GRVA 2X7PA 4XXUA 4YKJA 1URDA 3VXCA 1I6QA 1OLAA 5I57B 4MCOA 1FPLA 3RNNA 1LCFA 2O68A 4LVQA 1DTGA 1MY2A 2UVGA 2ZNTA 4XIGQ 2F6GA 2Z8DA 2HFBA 5ISUA 4LQ5A 3IO4A 3W9WA 1L5TA 1UTHB 4NWDA 2F3DA 4ZECA 2XXKA 2B4LA 4PBQA 3I6VA 2VPNA 5DTBA 3HFUA 1USYE 2VOZA 3GBAA 5BWJA 4KCDA 4IY6A 4JVDA 4H67A 1PB8A 2XXYA 4JVIA 4P47A 5DEXB 2GHAA 2CMOA 3KBZA 3MZ9A 4NEDA 1N3WA 2DE4A 1Q9DA 2FBPA 1MM6A 2Y7RA 4GX4A 4HXVA 3MP6A 4ZS9A 2RF1A 1UTBB 1NFTA 1B7ZA 4F19A 2F3BA 5H8NA 2QMWA 1IMDA 2GH9A 3EHSA 4OVSA 1A99A 2DXYA 5J16A 4Q5TA 4RY1A 3TCHA 3IOUA 1M5FA 4GWUA 4ELRA 3PUXE 3C31A 1O63A 3UORA 2F5XA 3O28A 4N8GA 4KI0E 2I3WA 4PF8A 1FPGA 4FIMA 2ESNA 2XXIA 3KC0A 2QMXA 1MG1A 1QGXA 1P1WA 3N6TA 3IB0A 4XEQA 1CNQA 1SW5A 2HAVA 4X04A 4MAGA 4IO2A 1PBQA 4U1ZA 1QULA 1J1NA 4NF6A 3IOTA 3Q28A 2DQVA 5I84A 4BDNA 2Y7IA 3KJ7A 4NG7A 1QW0A 1NNKA 1LBZA 3SETA 4M1VA 3V89B 1K9ZA 4I1DA 3RTFB 5ICQA 3KN3A 4MEVA 4JWYA 2ZMBA 3ZKLA 3MVWA 1MY4A 3TMGA 4NF4B 3H06B 5AA2A 3B6QA 3SERA 2UXAA 3Q29A 3C9HA 2IA4A 5DT6A 3IFCA 3ZS6A 2OJTA 4YKIA 3LSFB 2NVUB 2V84A 3ONMA 2PT1A 2ZNUA 4R72A 1I69A 3T66A 3TTLA 3PU5A 5FBPA 4I8CA 3PD8A 4WXJA 2PFYA 1NH7A 3MZBA 1BTJA 3K02A 2XXVA 1JNFA 2E1SA 5CC2A 2QRYA 2JJKA 4PFTA 3TTRA 3W15C 4IB2A 4O7IA 2VP1A 2F6PA 4PE5B 5F1QA 4NQ8A 1IEJA 1SYHA 4H5GA 3HN0A 3TKDA 3GZGA 1B7HA 1PEBA 2G29A 2I0CA 1R1NA 4IO6A 4DXBA 1TFAA 2P1SA 3RT6B 4H65A 1FBGA 3RTWB 3TDJA 5LOMA 2XWIA 3TZAA 4OMBA 1UIUA 1UQWA 2RCAA 1ATGA 1R6ZA 3B8BA 4OFJA 1LBWA 1NV4A 1LAXA 4EUOA 4NF0A 1AH5A 4P11A 1FTJA 5CMBA 3MZ1A 4PAIA 3SZPA 3FJ7A 3TUSA 5IAIA 2ZYKA 5FHNA 1B1XA 4R75A 5AA2B 1R9QA 1LGBC 4OANA 4PFBA 2Y84A 3QIMA 3FXUA 4XKRA 1Y3NA 4N17A 5ET5A 4F31B 1NNTA 3DLNA 3MVXA 4BDOA 1H44A 4PDDA 4OYVA 2Y7WA 1DK4A 4DCXA 1VDWA 1ZU0A 4ECFA 1MS7A 2Y5LA 1N84A 3HHFA 1N0TA 4GXSB 3T22A 3C36A 1I6AA 4G77A 3B7DA 1OLCA 3V83A 4HCYA 2CEXA 4EDPA 1B3EA 4O7MA 4PGNA 5IKBA 3WAEA 1NNFA 1AWBA 1S7YA 2FA7A 3LUZA 2HZLA 4IO7A 1B5HA 1FTOA 4PFWA 1RYOA 5ELVA 5ITOA 3S9EA 4P56A 3D4CA 1POY1 3H6TA 1FJ6A 2QVRA 5FTHA 3O6IA 2DP8A 3IOVA 3Q27A 4WEDA 2HEUA 4YU0A 2Z23A 3CR9A 4ZZAA 4O94A 5KZTA 3TAJA 4P8BA 1GGGA 3IJXB 4TQUQ 2DWJA 1JETA 1LAHE 1S50A 2A5TB 2MKZA 3KN7A 2XHDA 4R74A 2HCAA 3TPAA 1LLSA 1RYXA 3G7WA 1WDNA 3K0VA 4QBAA 4OVPA 1XC1A 1MXYA 4DIGA 4YICA 1MXXA 4ND9A 3CHGA 2GFEA 3O6GA 1BLFA 4OERA 3FASA 4QSDA 2NXOA 1CB6A 1VE4A 3A29A 3N94A 5BUUA 3U65A 5H8FB 3IK6B 3EHTA 2XWOA 4KD5A 4QFPA 4ZEKA 1KA1A 1N04A 2DVCA 5AA4A 4AQ4A 1EYKA 5I2NB 1A54A 3R6UA 4YB7A 5I2NA 1MXVA 5DVFA 3E9XA 2DWAA 3A3CA 2VHAA 4OVTA 1B5JA 4QFOA 4ZE9A 2PMSA 5I58B 1B2HA 4NTLA 3IL1B 1TWYA 3G3HA 4FEBA 1AMFA 3VLWA 4NF6B 3KOSA 2O1MA 1ANFA 4ELQA 1D9YA 3MPKA 1Y3QA 4JXIA 3FXQA 4PE3A 4F1VA 2VD3A 3ISPA 4MNIA 2QS2A 2Q74A 3MBPA 4JWXA 4NAPA 4PTKA 2AYSA 4NF4A 1XHYA 1IMFA 4KFQA 4N6KA 3RUMA 3IR1A 1FSAA 2RCBA 5L8DA 4KYSA 2ANJA 2PVUA 4DLDA 1MM7A 2Z8FA 1A8FA 4LN5A 3FVGA 1ZTYA 1A55A 2V3TA 3K01A 4EXLA 1MQDA 3CFZA 4MNCA 1D9QA 2O7IA 1P1UA 4FECA 1KWHA 1FQCA 3TODA 1XVXA 1ZBMA 1NV2A 2Y7KA 1NUZA 3TEPA 1FQEA 3H6VA 1LCTA 2DE3A 1OQHA 2WX9A 5AA2D 1DBZA 3ZKKA 5IZZA 4YMAA 4GL0A 5TPAB 4LP2B 4U21A 3DP6A 1MY0A 3VXBA 4BDMA 1FPEA 4H8JA 1SW4A 2H9BA 4PC9A 1LFIA 3MP1A 1Y9UA 2O51A 4R6HA 2AL5A 1LBVA 4Q0CA 3PPPA 1O64A 2F7AA 3D4GA 2DWHA 1YPNA 1INPA 1B40A 5FTIA 4UACA 3B6TA 4HTGA 3RY3A 1IQ7A 4OEVA 1OIBA 4RA1A 5HM4B 4P9KA 1M5EA 2ONRA 3C32A 3FV1A 4F3BA 1QVSA 5TU0A 3QK6A 3V5AA 4ELPA 5CM6A 1IXIA 4TLMB 2O84X 2FIEA 4FEDA 4BDQA 1Q35A 1LSTA 3PTYA 5K2XA 5H8QB 3EKIA 3GYYA 5J1DA 1EU8A 2DWIA 2CZIA 4QFKA 1YCJA 1ZLQA 3K4UA 2Y5KA 3A09A 2B4MA 3P7IA 4OENA 4C1UA 1FTKA 3GBBA 1QKAA 2DS9A 2OWTA 5KCJB 1MXZA 3OEMA 4X1BA 1H3DA 1DSNA 2R9JA 3VLVA 3OEKA 2HPGA 5CMCA 1DCUA 4YMBA 2QS1A 4YB5A 2P3VA 2ZNSA 1QUIA 1FPFA 3DELB 2KLFA 4JSDA 4IO4A 1FTLA 4PFIA 5AA3A 4JSOA 3QYTA 1N3XA 1NNPA 5I7IA 4I62A 4JB7A 2O7UA 1BK4A 2XWVA 4GBWA 3H6UA 5H8HA 1NV6A 2Q8JA 3C33A 3MYUA 4G68A 3PUZE 4OWDA 4GWOA 2RKMA 4IGRA 1DPEA 3VFJA 1NKXA 4DDDA 3T9UA 4THIA 5F24A 1AOVA 3PPNA 1XOCA 2F35A 3LBSA 4KCCA 2QPQA 2R8TA 4PFYA 1I6BA 3HV1A 3LSWA 3VE1B 3LUYA 3RN8A 2H5YA 2WEFA 1MQHA 1SI1A 4JDFA 3K1NA 3SEXA 3ROJA 4F18A 2QS3A 4OTEA 1II5A 4N91A 1YZ0A 1LBXA 4R2BA 2FHYA 3ECRA 2DVZA 2XX8A 3K6VA 4Q30B 2XXPA 2WYPA 2L5VA 2IEEA 4HW8A 2ZZXA 1DMBA 4BDLA 3O29A 3W9VA 4O8MA 3TYHA 5T3JA 3FGSA 2O1LA 4E0XA 2O6AA 2ZYOA 4P0GA 3QUJA 2AIXA 3H03A 4NE4A 1PB9A 1FRPA 2W7YA 4F3PA 4PCDA 4MFIA 5I2KA 1K9YA 2NOOA 1B1HA 1HSEA 4AB6A 2YJPA 4RPOA 4Z7EA 4XTCQ 5I59A 1B4HA 1IXGA 3N6UA 3OXNA 3FVNA 2F8DA 1OMPA 1DPPA 3IAZA 1R9LA 5TP9B 3MAMA 2V3QA 4KR5A 5AE4A 1XS5A 4TLLB 4PAFA 2V3UA 4UABA 4WKMA 4EQ9A 1BIYA 3LSLA 3JV9A 3G3IA 3U8QA 5KDTB 3S9NC 4OFOA 3KFMA 2CZKA 1YYZA 5I59B 3V8XB 3F11A 3UGWA 3OENA 3KJTA 3DM0A 3VVFA 3SDFA 5DVIA 1SDXA 1SPIA 3FATA 2RC7A 2OWSA 1DOTA 3T9HB 1MQIA 4H46A 4ZEFA 4NN3A 2FNCA 4YAHX 3T1BA 2OX3A 4H5FA 4X48A 4NF8B 1D4NA 1XVYA 3BBRA 3GLBA 3HO7A 1QUJA 2ZZWA 1B05A 3GXAA 1B52A 2QFLA 1FBEA 1Y1MA 5IZ3A 4G8MA 1EZPA 3EQ1A 4MIJA 3MSTA 2Q9TA 3FZVA 2DOJA 4ONYA 4GWWA 3MC2A 3I5OA 4FE8A 1VSOA 2VGQA 1JW4A 3MVYA 1MPCA 1IXHA 2PBWA 4OVJA 5EQ7A 4EXKA 3RPLB 4N6DA 2XXQA 1IMAA 1IUDA 5I3SA 1FQBA 3FJGA 2OZZA 3HSTA 4MLQA 4DI3D 1YXIA 1PDAA 5DVJA 2F7BA 1FQFA 2H25A 2Q88A 3E3KA 4TOZA 4ESXA 3K6WA 3CG3A 3RGYA 3G3GA 4Z0IA 2UYEA 2D5WA 4GWZA 4MMPA 4DCYA 5I5PA 3MQ9A 3NOHA 3TQLA 4M4GA 4GVOA 4OVQA 4GWYA 5EQAA 4G68B 3SEYA 1B4ZA 2GQ1A 3G3KA 1FCKA 1B6HA 5A5LA 1JW1A 1JP4A 1N76A 5IM2A 4RJZA 1GV8A 3FJMA 3K6UA 1TXFA 4GIZA 4GWXA 3SEVA 3O66A 1GTKA 3VDFA 4G8HA 3N26A 4NHBA 3HPIA 3WAFA 4KPTA 3QAXA 2FIXA 4BDRA 4Q8RA 2ZYMA 5I56B 1B3HA 4GBVA 1NV3A 3KOTA 1SQYA 3I3VA 3JYRA 4GLIA 3JZJA 2I4BA 5A5XB 1B3FA 1P1NA 4F2QA 3PPOA 1CE2A 4IGTA 4R2FA 4JVCA 1PB7A 2QVUA 3QXMA 1G0HA 3FUZA 4LZ7A 3IOWA 4P1LA 4QRZA 1USYH 4U4XA 4OA4A 4LQ2A 3T9XB 2XX7A 1B0HA 3VLUA 5CBSA 4U1OA 4EF1A 4GQOA 2OCUA 5A5XA 3FVKA 1H76A 2XXUA 4N81A 1LAGE 2I6EA 1Z7NE 5B70A 4GD5A 3KG2A 3M3KA 4F29A 1ZJLA 5CRYA 3PMVA 4GF8A 4QSEA 1RKMA 2PX1A 3U93A 3KSXA 2PCRA 2Q2AA 4PQJA 3OO7A 3TCFA 3RPWA 3UIFA 3H4ZA 2VPOA 1F9BA 2G93A 1SVXB 3AXFA 4PF6A 3U72A 1LB8A 4QFLA 1FPKA 2XXHA 5LTCA 5L9MA 1YTVA 4K3FA 4ZDMA 1Q1KA 3Q25A 3A3UA 3PUWE 1LAFE 1B3GA 4F2OA 4HE1A 2I3VA 1SYIA 4DXUA 4NF8A 5EYGA 4H45A 2FYIA 1IXCA 5AA1A 4FORA 4N8YA 3G3FA 1M5DA 3O2AA 2BJJX 3LR1A 2I49A 5L9OA 4OESA 4MNPA 3C34A 4NGUA 3TFLA 1A40A 1FTAA 3QUFA 2UVHA 2QL3A 3B6WA 5JEIA 3PGFA 1IMBA 4IY5A 2RC9A 3OSRA 4FATA 1O7TA 4PAKA 4XF5A 3PPQA 2I0BA 3HHGA 2R6GE 1IMCA 4LUBA 3S9MC 2OWZA 3FV2A 4QSCA 5KCJA 3QMFA 4F1YA 3ILTB 1H45A 4MH5A 1B0LA 3FVOA 1LEVA 1P1QA 1EZOA 1SW1A 1MDQA 3PPRA 1TFDA 2QS4A 4E0WA 3UN6A 3S2VA 4EQ7A 1B9JA 1EYIA 1ZKBA 2I4CA 3BFUA 1PBPA 3LC8A 4R73A 5H8QA 2F97A 3SKPA 2F7CA 1MY3A 4GL8A 3OO9A 1QJMA 5KDTA 1ZMGA 5FHOA 4U23A 1B7UA 2FVZA 2VT5A 1A7LA 4XKPA 5ET6A 2UVIA 2YLNA 4YB6A 2P3NA 2VD2A 3TTMA 1JVXA 3U1OA 1FQDA 2CZLA 3FD3A 5HPQA 4PFRA 4HCWA 2REGA 2ABHA 2D3IA 4NF5B 4EQBA 5DW8A 2QVVA 1NV1A 4IR8A 4WEPA 4R6KA 1SBPA 4PGPA 3H7MA 4GX6A 4O3BA 4RPNA 3T0JA 3T93B 5DEXA 4GRKA 4NMYA 3VVEA 1JEVA 2XA5A 4QHQA 3IORA 1AIVA 5ITPA 1NV0A 4ISUA 5TPAA 2ALUA 3QSLA 1VR5A 1IIWA 4ZEIA 2OBGA 2F36A 1A8EA 2XXWA 5ET8A 1B58A 3IB2A 4OFLA 1NV5A 1B3LA 2HXWA 5JK4A 1Y20A 4O3AA 1HSJA 1Y4TA 3E13X 1WODA 3K1MA 4PP0A 1RDXA 1UTHA 1SW2A 5F7VA 4N6PA 1FPJA 2V25A 1MPDA 1XT8A 3S4UA 1P1OA 4XFEA 3M3LA 2Z8EA 1LBCA 4ZE8A 3HCQA 1LFHA 4AS5A 2WBDA 5EHMA 3USDA 1PC3A 1MXUA 4GFRA 1TT1A 4HE2A 1MY1A 1GVCA 2HZKA 1NUWA 5H8FA 2F34A 2DSFA 3KGCA 4GOTA 1MQGA 1EYJA 5ET7A 4U2RA 1M5BA 4HE0A 2ZXTA 2WYKA 4N07A 4NF5A 3EN3A 3BIGA 3KBRA 1P99A 3R26A 3O6HA 3Q26A 5LDZA 1MDP1 3T9VA 4YZZA 4KQPA 2X26A 5H8HB 2B3FA 4JWOA 4RK2A
chains in the Genus database with same CATH topology
1AL3A 1IXHA 5I2NA 1N7XA 1MXVA 2PBWA 3C4MA 2GRVA 4MBPA 4OVJA 3E9XA 5DVFA 5AE4A 2DWAA 2X7PA 4EXKA 2XXQA 4XXUA 3A3CA 1IUDA 1URDA 4YKJA 3VXCA 5AA4B 2VHAA 5CMMA 1I6QA 2M8CA 4F1UA 1OLAA 1FQBA 1Y1ZA 4PETA 4X9TA 5I57B 3FJGA 2OZZA 3RNNA 1B5JA 3HSTA 1LCFA 3EPEA 4MLQA 2PYYA 2O68A 5EHSA 2X7QA 4LVQA 1PDAA 5DVJA 2F7BA 1FQFA 1DTGA 1EH3A 1MY2A 4QFOA 2H25A 2Q88A 3E3KA 4TOZA 2PMSA 4ZE9A 3UA8A 1B2HA 1POTA 2UVGA 2ZNTA 4NTLA 4XIGQ 4ESXA 3IL1B 3K6WA 1TWYA 3CG3A 3RGYA 2F6GA 3G3GA 2Z8DA 1DTZA 2HFBA 3G3HA 4LQ5A 3IO4A 4FEBA 4Z0IA 1AMFA 5ISUA 2UYEA 1Y3PA 2D5WA 4NF6B 1L5TA 2XD3A 3VLWA 3W9WA 1UTHB 3DP4A 2O1MA 3KOSA 4BLAA 3CSGA 1ANFA 1B5IA 1BP5A 1D9YA 4ELQA 3MPKA 4NWDA 5H8SA 4DCYA 1Y3QA 3MQ9A 3TQLA 4RXLA 4ZECA 4JXIA 4M4GA 4GVOA 3SESA 3I6VA 3FXQA 5DTBA 5JTYA 3OOAA 4WEDA 4MF3A 3VVDA 5DYHA 4KYDA 1N7WA 2DE2A 3BFTA 4G68B 3SEYA 1B4ZA 2VD3A 4F1VA 1USYE 2QS2A 2VOZA 3GBAA 1JEUA 3G3KA 3MBPA 4JWXA 1FCKA 5BWJA 4KCDA 3OSQA 1B6HA 2AYSA 4F22A 4NF4A 1S9TA 1XHYA 4IY6A 4KFQA 4ELOA 1ZIUA 1JW1A 3IR1A 3M8UA 1PB8A 3OO8A 4H67A 4OETA 3RUMA 1N76A 2RCBA 2XXYA 4KYSA 5L8DA 2ANJA 5DEXB 2PVUA 1M5CA 4RJZA 3R7XA 1GV8A 4F3GA 3FJMA 2GHAA 1TXFA 2CMOA 3K6UA 3CFXA 4GIZA 3MZ9A 4DLDA 4NEDA 1MM7A 1N3WA 2DE4A 5CI5A 2O69A 2Z8FA 3SEVA 3O66A 1A8FA 3FVGA 4L17A 1MM6A 1GTKA 2Y7RA 1ZTYA 3MP6A 4ZS9A 3VDFA 1A55A 2RF1A 2V3TA 4G8HA 3N26A 1UTBB 4XKQA 1NFTA 1FTMA 3HPIA 3K01A 3M3FA 4KPTA 3WAFA 4EXLA 1B7ZA 1MQDA 5I56A 3QAXA 1JQFA 3CFZA 4F19A 2O7IA 2UYFA 1P1UA 4BDRA 4FECA 2ZYMA 5H8NA 4Q8RA 1KWHA 1FQCA 2QMWA 3TODA 1XVXA 1ZBMA 2GH9A 4H0WA 5I56B 3EHSA 2DXRA 2Y7KA 1B3HA 1A99A 4O3CA 3TEPA 1FQEA 3H6VA 3KOTA 1HSLA 1LCTA 1SQYA 2DE3A 1OQHA 2DXYA 3I3VA 3JYRA 4GLIA 5AA2D 3ZKKA 4Q5TA 3JZJA 4RY1A 4KYEA 2I4BA 4YMAA 5A5XB 4GL0A 3TCHA 1B3FA 1P1NA 5TPAB 3IOUA 1M5FA 4LP2B 4U21A 4ELRA 3PUXE 4YKKA 4F2QA 3C31A 3KEIA 1O63A 3UORA 1GR2A 3DP6A 1MY0A 3PPOA 1CE2A 3VXBA 4IGTA 2F5XA 4BDMA 3O28A 4H8JA 4C1TA 1SW4A 4R2FA 3IO6A 4KI0E 2UVJA 2H9BA 2I3WA 5CMKA 4H8IA 2QJEA 3PUVE 3RT8A 4FIMA 2ESNA 1LFIA 1PB7A 2XXIA 3MP1A 2QMXA 1Y9UA 1SI0A 2O51A 2AL5A 1MG1A 1P1WA 3QXMA 4MLVA 4R6HA 4Q0CA 3FUZA 1MXWA 4LZ7A 2RINA 3IOWA 3IB0A 3N6TA 3PPPA 2D21A 3USDA 4QRZA 1USYH 1O64A 5CBSA 4U4XA 2F7AA 3MJNA 3D4GA 1SW5A 2HAVA 4LQ2A 3T9XB 2DWHA 3E4RA 1YPNA 2XX7A 3PD9A 4IO2A 4EF2A 1PBQA 3IJOB 1JW5A 1B40A 1B0HA 4U1ZA 2WKYA 3VLUA 1H43A 5FTIA 3ILUB 4U1OA 2V93A 4UACA 3RLFE 1QULA 3B6TA 4HTGA 3RY3A 1J1NA 4EF1A 1US5A 1IQ7A 4GQOA 3IOTA 4NF6A 4OEVA 2OCUA 5A5XA 3Q28A 2DQVA 3FVKA 5I84A 1OIBA 1H76A 2XXUA 4RA1A 4BDNA 5HM4B 1LAGE 2I6EA 3TTNA 1Z7NE 1M5EA 2ONRA 2Y7IA 3C32A 3FV1A 3KJ7A 1QVSA 4F3BA 4GD5A 4KHZE 3QK6A 5TU0A 5B70A 3TQWA 4H6DA 3KG2A 1QW0A 3M3KA 4F29A 1ZJLA 5CRYA 1NNKA 3V5AA 3SETA 4M1VA 2Q89A 3V89B 3FIRA 2PT2A 3OD7A 4ELPA 1UTBA 5CM6A 3OMBA 3L6GA 1IXIA 3PMVA 4GF8A 4QSEA 3FXRA 4I1DA 1RKMA 2PX1A 4TLMB 2O84X 3U93A 3KSXA 4U22A 3CRBA 4FEDA 3U94A 3RTFB 4BDQA 5ICQA 1Q35A 4IO3A 1LSTA 2B3BA 2ONKE 2Q2AA 4PQJA 4ESWA 5I57A 3OO7A 5K2XA 3KN3A 3SEWA 3TCFA 5H8QB 4U4SA 4JWYA 3KN8A 3RPWA 2ZMBA 3PMWA 3TCGA 1MH3A 1MQJA 3UIFA 2F78A 3ZKLA 5L9SA 5J1DA 3H4ZA 1QKBA 1EU8A 3MVWA 1MY4A 2DWIA 4OHNA 3TMGA 1F9BA 2G93A 1SVXB 4QFKA 3AXFA 4NF4B 5I2KB 3H06B 5AA2A 2XXTA 1YCJA 1ZLQA 2UXAA 3B6QA 3K4UA 3SERA 1LB8A 3U72A 3Q29A 3A09A 3C9HA 3CG1A 2IA4A 3EF7A 2XXHA 3P7IA 4QFLA 4OENA 5DT6A 5L9MA 3THIA 4P0IA 3ZS6A 4C1UA 1YTVA 4K3FA 1JVYA 1FTKA 1Q1KA 2OJTA 3GBBA 1LBBA 4YKIA 1QKAA 4ZDMA 2DS9A 3LSFB 3A3UA 3Q25A 2V84A 2NVUB 1D9VA 3PUWE 2OWTA 1LAFE 1B3GA 2Z22A 3ONMA 2I3VA 3C35A 4F2OA 5ICTA 5KCJB 1SYIA 1MXZA 3OEMA 2PT1A 1URGA 4DXUA 4X1BA 1Z7ME 4NF8A 5M2VA 1H3DA 2ZNUA 4R9GA 1DSNA 4OXVA 4R72A 2R9JA 2A5SA 1I69A 3T66A 3MUQA 3TTLA 3PU5A 4FATA 5H8NB 3VLVA 2FYIA 3O9PA 3OEKA 5CMCA 3UP9A 4G2ZA 1IXCA 4YMBA 4FJPA 5AA1A 4FORA 2QS1A 4LATA 3KZGA 3PD8A 1OVBA 4I8CA 4WXJA 5KDTA 3G3FA 1M5DA 3O2AA 2BJJX 4YB5A 2ZNSA 1NH7A 3LR1A 2I49A 1QUIA 1MPBA 4LZ5A 3MZBA 3DELB 1BTJA 2KLFA 5L9OA 3K02A 4JSDA 4IO4A 4OESA 4NWCA 3C34A 3TFLA 1FTLA 1A40A 3QUFA 2R71A 2XXVA 3DP8A 5AA3A 1JNFA 1OVTA 2QL3A 2UVHA 3K6XA 2E1SA 3B6WA 4G8NA 4JSOA 4ZZEA 2QRYA 5CC2A 5JEIA 1B32A 3QYTA 4PFTA 3PGFA 1N3XA 3TTRA 3W15C 4IB2A 4IY5A 1NNPA 2VP1A 2F6PA 3K1PA 4I62A 2O7UA 3O97A 4JB7A 4PE5B 5JK4A 5F1QA 2RC9A 3MVZA 3H6UA 3OSRA 5H8HA 1IEJA 1SYHA 2P0SA 5K2YA 4H5GA 2LAOA 3C33A 1O7TA 2I48A 1FW0A 3HN0A 3PPQA 2HAUA 2Q8JA 3GZGA 3TKDA 4G68A 5FHMA 2I0BA 3PUZE 4OWDA 4GWOA 1B7HA 1PEBA 2G29A 2I0CA 2R6GE 2RKMA 1DPEA 3HHGA 1R1NA 3PMXA 4IGRA 4IO6A 3VFJA 1NKXA 4LUBA 4DDDA 1TFAA 4DXBA 3S9MC 3MW0A 2P1SA 3RT6B 3FV2A 4QSCA 4THIA 1B46A 3T9UA 4H65A 5KCJA 1AOVA 3PPNA 1XOCA 3RTWB 4F1YA 2F35A 3TDJA 3ILTB 1H45A 4MH5A 5LOMA 1B0LA 3LBSA 4KCCA 2QPQA 3FVOA 4OMBA 1P1QA 1UIUA 3TZAA 1EZOA 1SW1A 4PFYA 1MDQA 1D3KA 1I6BA 1UQWA 1ATGA 2RCAA 3HV1A 3LSWA 3LUYA 3PPRA 3VE1B 1TFDA 1R6ZA 2QS4A 4DE8A 3RN8A 4RYAA 2H5YA 4OFJA 4AB5A 3IX1A 4E0WA 3UN6A 1LAXA 1MQHA 3OELA 3S2VA 4EUOA 4EQ7A 1AH5A 1SI1A 4JDFA 2OK2A 3K1NA 3H6WA 4P11A 1FTJA 1B9JA 3K2DA 3U92A 3SEXA 1ZKBA 2I4CA 3BFUA 5CMBA 1PBPA 3LC8A 3MZ1A 4R73A 5H8QA 4F39A 2F97A 3SKPA 3FJ7A 2F7CA 1MY3A 3TUSA 4F18A 2QS3A 3CSBA 2ZYKA 4GL8A 3OO9A 4OTEA 5IAIA 1QJMA 1B1XA 1ZMGA 2GHBA 5FHNA 2OLBA 4R75A 1II5A 2I58A 4U23A 5FHOA 5AA2B 1B7UA 1R9QA 4FAJA 1LGBC 4C0RA 1A7LA 3G3JA 1B51A 2Y84A 4XKPA 2UVIA 2YLNA 3FXUA 3QIMA 4R2BA 4YB6A 3ECRA 3LSXA 2DVZA 4XKRA 1Y3NA 2XX8A 1MRPA 2REJA 1IZ1A 2VD2A 3K6VA 4Q30B 1JVXA 3TTMA 4DZ1A 2XXPA 3U1OA 1FQDA 2XXRA 2CZLA 4HS7A 4F31B 1NNTA 3FD3A 4IO5A 4R6YA 3DLNA 5HPQA 3MVXA 4BDOA 1H44A 5I58B 4OYVA 4ZEDA 2Y7WA 2IEEA 4HW8A 3MPLA 3CI8A 4DCXA 4OEUA 2HQ0A 1ZU0A 4RK9A 1DMBA 4HCWA 4F3SA 4ECFA 2REGA 1MS7A 2ABHA 3L6HA 4BDLA 4YKPA 1N84A 2D3IA 3HHFA 4NF5B 4EQBA 1N0TA 4GXSB 3K00A 3O29A 3T22A 3W9VA 3C36A 1I6AA 4G77A 3TYHA 1LFGA 3B7DA 4QF9A 1OLCA 3V83A 1VFEA 2ZYNA 1SBPA 3FGSA 4HCYA 4R6KA 4WEPA 2O1LA 3H7MA 4E0XA 3MP8A 4O3BA 2O6AA 2ZYOA 4P0GA 4RPNA 3T93B 3H3GA 4GRKA 5DEXA 3QUJA 4EDPA 2AIXA 1B3EA 2AL4A 5IKBA 3H03A 4NE4A 1PB9A 4NMYA 3WAEA 1US4A 1NNFA 3IB1A 1JEVA 1S7YA 2FA7A 3VVEA 2W7YA 4G68C 3ZSFA 4F3PA 1NMUA 4QHQA 3IORA 2H98A 4MFIA 1AIVA 2HZLA 5ITPA 5I2KA 1SD3A 4IO7A 1B5HA 1FTOA 4ISUA 4PFWA 1RYOA 4R9FA 3CIJA 2NOOA 5TPAA 2ALUA 3QSLA 5ELVA 4DXCA 3T96B 5JTYB 1VR5A 1NL5A 2DYXA 1IIWA 4ZEIA 5ITOA 1B1HA 1FQAA 1HSEA 2YJPA 4RPOA 3TELA 4AB6A 4Z7EA 4XTCQ 5I59A 3S9EA 2RC8A 3D4CA 2OBGA 1B4HA 1POY1 2F36A 3RQTA 3H6TA 1A8EA 1MH4A 1IXGA 1WVJA 4OQOA 3N6UA 2XXWA 2H99A 3BKIB 3PUYE 3OXNA 3FVNA 1B58A 5FTHA 4N13A 3O6IA 5HBCA 1T0KA 2F8DA 1OMPA 2Q2CA 1DPPA 2DP8A 3IB2A 3IOVA 4GXAA 4OFLA 4RNSA 4UA8A 4JBZA 1B3LA 3IAZA 2HXWA 1R9LA 5TP9B 1Y20A 3MAMA 3Q27A 1VFDA 4O3AA 1HSJA 4POWA 2V3QA 1Y4TA 3E13X 1WODA 3K1MA 4KR5A 4PP0A 1XS5A 2HEUA 2XXXA 3OO6A 4TLLB 4YU0A 1UTHA 1SW2A 1YAEA 5F7VA 2V3UA 2Z23A 2Y7PA 4QFNA 4N6PA 3CR9A 4WKMA 2V25A 1MPDA 1XT8A 4LZ8A 4ZZAA 2XD2A 4X1DA 1P1OA 4PFUA 3S4UA 4G4PA 4EQ9A 5I58A 5KZTA 3VV5A 1BIYA 3LSLA 3JV9A 3TAJA 3G3IA 3M3LA 2Z8EA 3U8QA 5KDTB 1GGGA 3IJXB 4LONB 3SEUA 4TQUQ 4OFOA 3S9NC 3KFMA 2DWJA 1LBCA 3TTKA 1JETA 4ZE8A 5I59B 1LAHE 3V8XB 2THIA 3F11A 3UGWA 3OENA 3KJTA 1S50A 2A5TB 3CFLA 3HCQA 1LFHA 3DM0A 1URSA 2XHDA 3KN7A 4POXA 3SDFA 3VVFA 5DVIA 1SDXA 3FATA 4R74A 2RC7A 2HCAA 2OWSA 1DOTA 1LLSA 2H4IA 5EHMA 1RYXA 1PC3A 3T9HB 1MXUA 3TPAA 3CVGA 1MQIA 2B65A 3G7WA 1BKAA 1QUKA 3N5LA 1WDNA 3K0VA 4ZEFA 2FNCA 1TT1A 4GFRA 1MY1A 1XC1A 2HZKA 1MXYA 1GVCA 2QSXA 3KSJA 4YAHX 5H8FA 4DIGA 2F34A 3UK4A 2DSFA 3KGCA 4GOTA 4YICA 4H5FA 1MQGA 4XKNA 1MXXA 4X48A 4ND9A 4NF8B 1D4NA 4H1XA 4U2RA 2YPNA 2P2AA 1M5BA 1XVYA 2ONSA 3BBRA 5TP9A 2GFEA 3GLBA 3O6GA 1BLFA 4OERA 2ZXTA 4N07A 4NF5A 3FASA 4ZEBA 3HO7A 1QUJA 4QSDA 1B05A 3GXAA 5CBRA 3EN3A 3PV0E 1B52A 2NXOA 1CB6A 2NWJA 1VE4A 2NUVA 3KBRA 3N94A 1P99A 5BUUA 1Y1MA 5H8FB 3IK6B 4I9DA 4G8MA 3EHTA 3R26A 1EZPA 1NH8A 3O6HA 3EQ1A 3Q26A 1EZ9A 4KD5A 2Q9TA 1MDP1 4OZ9A 4QFPA 4ZEKA 3FZVA 2A5TA 2DOJA 4ONYA 1N04A 2DVCA 5B7DA 5AA4A 3MWBA 2E0SA 3EHUA 1OQGA 3MC2A 3I5OA 4FE8A 1VSOA 3T9VA 4AQ4A 4YZZA 3ODBA 1LB9A 4LA9A 4KQPA 2VGQA 5EYFA 2X26A 5I2NB 5H8HB 3S9LC 1ELJA 2B3FA 1JW4A 1Y4CA 1UIVA 3MVYA 1A54A 1MPCA 4JWOA 3R6UA 4RK2A 2XX9A 1IITA 4YB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AL3 A;  1IXH A;  5I2N A;  1N7X A;  1MXV A;  2PBW A;  3C4M A;  2GRV A;  4MBP A;  4OVJ A;  3E9X A;  5DVF A;  5AE4 A;  2DWA A;  2X7P A;  4EXK A;  2XXQ A;  4XXU A;  3A3C A;  1IUD A;  1URD A;  4YKJ A;  3VXC A;  5AA4 B;  2VHA A;  5CMM A;  1I6Q A;  2M8C A;  4F1U A;  1OLA A;  1FQB A;  1Y1Z A;  4PET A;  4X9T A;  5I57 B;  3FJG A;  2OZZ A;  3RNN A;  1B5J A;  3HST A;  1LCF A;  3EPE A;  4MLQ A;  2PYY A;  2O68 A;  5EHS A;  2X7Q A;  4LVQ A;  1PDA A;  5DVJ A;  2F7B A;  1FQF A;  1DTG A;  1EH3 A;  1MY2 A;  4QFO A;  2H25 A;  2Q88 A;  3E3K A;  4TOZ A;  2PMS A;  4ZE9 A;  3UA8 A;  1B2H A;  1POT A;  2UVG A;  2ZNT A;  4NTL A;  4XIG Q;  4ESX A;  3IL1 B;  3K6W A;  1TWY A;  3CG3 A;  3RGY A;  2F6G A;  3G3G A;  2Z8D A;  1DTZ A;  2HFB A;  3G3H A;  4LQ5 A;  3IO4 A;  4FEB A;  4Z0I A;  1AMF A;  5ISU A;  2UYE A;  1Y3P A;  2D5W A;  4NF6 B;  1L5T A;  2XD3 A;  3VLW A;  3W9W A;  1UTH B;  3DP4 A;  2O1M A;  3KOS A;  4BLA A;  3CSG A;  1ANF A;  1B5I A;  1BP5 A;  1D9Y A;  4ELQ A;  3MPK A;  4NWD A;  5H8S A;  4DCY A;  1Y3Q A;  3MQ9 A;  3TQL A;  4RXL A;  4ZEC A;  4JXI A;  4M4G A;  4GVO A;  3SES A;  3I6V A;  3FXQ A;  5DTB A;  5JTY A;  3OOA A;  4WED A;  4MF3 A;  3VVD A;  5DYH A;  4KYD A;  1N7W A;  2DE2 A;  3BFT A;  4G68 B;  3SEY A;  1B4Z A;  2VD3 A;  4F1V A;  1USY E;  2QS2 A;  2VOZ A;  3GBA A;  1JEU A;  3G3K A;  3MBP A;  4JWX A;  1FCK A;  5BWJ A;  4KCD A;  3OSQ A;  1B6H A;  2AYS A;  4F22 A;  4NF4 A;  1S9T A;  1XHY A;  4IY6 A;  4KFQ A;  4ELO A;  1ZIU A;  1JW1 A;  3IR1 A;  3M8U A;  1PB8 A;  3OO8 A;  4H67 A;  4OET A;  3RUM A;  1N76 A;  2RCB A;  2XXY A;  4KYS A;  5L8D A;  2ANJ A;  5DEX B;  2PVU A;  1M5C A;  4RJZ A;  3R7X A;  1GV8 A;  4F3G A;  3FJM A;  2GHA A;  1TXF A;  2CMO A;  3K6U A;  3CFX A;  4GIZ A;  3MZ9 A;  4DLD A;  4NED A;  1MM7 A;  1N3W A;  2DE4 A;  5CI5 A;  2O69 A;  2Z8F A;  3SEV A;  3O66 A;  1A8F A;  3FVG A;  4L17 A;  1MM6 A;  1GTK A;  2Y7R A;  1ZTY A;  3MP6 A;  4ZS9 A;  3VDF A;  1A55 A;  2RF1 A;  2V3T A;  4G8H A;  3N26 A;  1UTB B;  4XKQ A;  1NFT A;  1FTM A;  3HPI A;  3K01 A;  3M3F A;  4KPT A;  3WAF A;  4EXL A;  1B7Z A;  1MQD A;  5I56 A;  3QAX A;  1JQF A;  3CFZ A;  4F19 A;  2O7I A;  2UYF A;  1P1U A;  4BDR A;  4FEC A;  2ZYM A;  5H8N A;  4Q8R A;  1KWH A;  1FQC A;  2QMW A;  3TOD A;  1XVX A;  1ZBM A;  2GH9 A;  4H0W A;  5I56 B;  3EHS A;  2DXR A;  2Y7K A;  1B3H A;  1A99 A;  4O3C A;  3TEP A;  1FQE A;  3H6V A;  3KOT A;  1HSL A;  1LCT A;  1SQY A;  2DE3 A;  1OQH A;  2DXY A;  3I3V A;  3JYR A;  4GLI A;  5AA2 D;  3ZKK A;  4Q5T A;  3JZJ A;  4RY1 A;  4KYE A;  2I4B A;  4YMA A;  5A5X B;  4GL0 A;  3TCH A;  1B3F A;  1P1N A;  5TPA B;  3IOU A;  1M5F A;  4LP2 B;  4U21 A;  4ELR A;  3PUX E;  4YKK A;  4F2Q A;  3C31 A;  3KEI A;  1O63 A;  3UOR A;  1GR2 A;  3DP6 A;  1MY0 A;  3PPO A;  1CE2 A;  3VXB A;  4IGT A;  2F5X A;  4BDM A;  3O28 A;  4H8J A;  4C1T A;  1SW4 A;  4R2F A;  3IO6 A;  4KI0 E;  2UVJ A;  2H9B A;  2I3W A;  5CMK A;  4H8I A;  2QJE A;  3PUV E;  3RT8 A;  4FIM A;  2ESN A;  1LFI A;  1PB7 A;  2XXI A;  3MP1 A;  2QMX A;  1Y9U A;  1SI0 A;  2O51 A;  2AL5 A;  1MG1 A;  1P1W A;  3QXM A;  4MLV A;  4R6H A;  4Q0C A;  3FUZ A;  1MXW A;  4LZ7 A;  2RIN A;  3IOW A;  3IB0 A;  3N6T A;  3PPP A;  2D21 A;  3USD A;  4QRZ A;  1USY H;  1O64 A;  5CBS A;  4U4X A;  2F7A A;  3MJN A;  3D4G A;  1SW5 A;  2HAV A;  4LQ2 A;  3T9X B;  2DWH A;  3E4R A;  1YPN A;  2XX7 A;  3PD9 A;  4IO2 A;  4EF2 A;  1PBQ A;  3IJO B;  1JW5 A;  1B40 A;  1B0H A;  4U1Z A;  2WKY A;  3VLU A;  1H43 A;  5FTI A;  3ILU B;  4U1O A;  2V93 A;  4UAC A;  3RLF E;  1QUL A;  3B6T A;  4HTG A;  3RY3 A;  1J1N A;  4EF1 A;  1US5 A;  1IQ7 A;  4GQO A;  3IOT A;  4NF6 A;  4OEV A;  2OCU A;  5A5X A;  3Q28 A;  2DQV A;  3FVK A;  5I84 A;  1OIB A;  1H76 A;  2XXU A;  4RA1 A;  4BDN A;  5HM4 B;  1LAG E;  2I6E A;  3TTN A;  1Z7N E;  1M5E A;  2ONR A;  2Y7I A;  3C32 A;  3FV1 A;  3KJ7 A;  1QVS A;  4F3B A;  4GD5 A;  4KHZ E;  3QK6 A;  5TU0 A;  5B70 A;  3TQW A;  4H6D A;  3KG2 A;  1QW0 A;  3M3K A;  4F29 A;  1ZJL A;  5CRY A;  1NNK A;  3V5A A;  3SET A;  4M1V A;  2Q89 A;  3V89 B;  3FIR A;  2PT2 A;  3OD7 A;  4ELP A;  1UTB A;  5CM6 A;  3OMB A;  3L6G A;  1IXI A;  3PMV A;  4GF8 A;  4QSE A;  3FXR A;  4I1D A;  1RKM A;  2PX1 A;  4TLM B;  2O84 X;  3U93 A;  3KSX A;  4U22 A;  3CRB A;  4FED A;  3U94 A;  3RTF B;  4BDQ A;  5ICQ A;  1Q35 A;  4IO3 A;  1LST A;  2B3B A;  2ONK E;  2Q2A A;  4PQJ A;  4ESW A;  5I57 A;  3OO7 A;  5K2X A;  3KN3 A;  3SEW A;  3TCF A;  5H8Q B;  4U4S A;  4JWY A;  3KN8 A;  3RPW A;  2ZMB A;  3PMW A;  3TCG A;  1MH3 A;  1MQJ A;  3UIF A;  2F78 A;  3ZKL A;  5L9S A;  5J1D A;  3H4Z A;  1QKB A;  1EU8 A;  3MVW A;  1MY4 A;  2DWI A;  4OHN A;  3TMG A;  1F9B A;  2G93 A;  1SVX B;  4QFK A;  3AXF A;  4NF4 B;  5I2K B;  3H06 B;  5AA2 A;  2XXT A;  1YCJ A;  1ZLQ A;  2UXA A;  3B6Q A;  3K4U A;  3SER A;  1LB8 A;  3U72 A;  3Q29 A;  3A09 A;  3C9H A;  3CG1 A;  2IA4 A;  3EF7 A;  2XXH A;  3P7I A;  4QFL A;  4OEN A;  5DT6 A;  5L9M A;  3THI A;  4P0I A;  3ZS6 A;  4C1U A;  1YTV A;  4K3F A;  1JVY A;  1FTK A;  1Q1K A;  2OJT A;  3GBB A;  1LBB A;  4YKI A;  1QKA A;  4ZDM A;  2DS9 A;  3LSF B;  3A3U A;  3Q25 A;  2V84 A;  2NVU B;  1D9V A;  3PUW E;  2OWT A;  1LAF E;  1B3G A;  2Z22 A;  3ONM A;  2I3V A;  3C35 A;  4F2O A;  5ICT A;  5KCJ B;  1SYI A;  1MXZ A;  3OEM A;  2PT1 A;  1URG A;  4DXU A;  4X1B A;  1Z7M E;  4NF8 A;  5M2V A;  1H3D A;  2ZNU A;  4R9G A;  1DSN A;  4OXV A;  4R72 A;  2R9J A;  2A5S A;  1I69 A;  3T66 A;  3MUQ A;  3TTL A;  3PU5 A;  4FAT A;  5H8N B;  3VLV A;  2FYI A;  3O9P A;  3OEK A;  5CMC A;  3UP9 A;  4G2Z A;  1IXC A;  4YMB A;  4FJP A;  5AA1 A;  4FOR A;  2QS1 A;  4LAT A;  3KZG A;  3PD8 A;  1OVB A;  4I8C A;  4WXJ A;  5KDT A;  3G3F A;  1M5D A;  3O2A A;  2BJJ X;  4YB5 A;  2ZNS A;  1NH7 A;  3LR1 A;  2I49 A;  1QUI A;  1MPB A;  4LZ5 A;  3MZB A;  3DEL B;  1BTJ A;  2KLF A;  5L9O A;  3K02 A;  4JSD A;  4IO4 A;  4OES A;  4NWC A;  3C34 A;  3TFL A;  1FTL A;  1A40 A;  3QUF A;  2R71 A;  2XXV A;  3DP8 A;  5AA3 A;  1JNF A;  1OVT A;  2QL3 A;  2UVH A;  3K6X A;  2E1S A;  3B6W A;  4G8N A;  4JSO A;  4ZZE A;  2QRY A;  5CC2 A;  5JEI A;  1B32 A;  3QYT A;  4PFT A;  3PGF A;  1N3X A;  3TTR A;  3W15 C;  4IB2 A;  4IY5 A;  1NNP A;  2VP1 A;  2F6P A;  3K1P A;  4I62 A;  2O7U A;  3O97 A;  4JB7 A;  4PE5 B;  5JK4 A;  5F1Q A;  2RC9 A;  3MVZ A;  3H6U A;  3OSR A;  5H8H A;  1IEJ A;  1SYH A;  2P0S A;  5K2Y A;  4H5G A;  2LAO A;  3C33 A;  1O7T A;  2I48 A;  1FW0 A;  3HN0 A;  3PPQ A;  2HAU A;  2Q8J A;  3GZG A;  3TKD A;  4G68 A;  5FHM A;  2I0B A;  3PUZ E;  4OWD A;  4GWO A;  1B7H A;  1PEB A;  2G29 A;  2I0C A;  2R6G E;  2RKM A;  1DPE A;  3HHG A;  1R1N A;  3PMX A;  4IGR A;  4IO6 A;  3VFJ A;  1NKX A;  4LUB A;  4DDD A;  1TFA A;  4DXB A;  3S9M C;  3MW0 A;  2P1S A;  3RT6 B;  3FV2 A;  4QSC A;  4THI A;  1B46 A;  3T9U A;  4H65 A;  5KCJ A;  1AOV A;  3PPN A;  1XOC A;  3RTW B;  4F1Y A;  2F35 A;  3TDJ A;  3ILT B;  1H45 A;  4MH5 A;  5LOM A;  1B0L A;  3LBS A;  4KCC A;  2QPQ A;  3FVO A;  4OMB A;  1P1Q A;  1UIU A;  3TZA A;  1EZO A;  1SW1 A;  4PFY A;  1MDQ A;  1D3K A;  1I6B A;  1UQW A;  1ATG A;  2RCA A;  3HV1 A;  3LSW A;  3LUY A;  3PPR A;  3VE1 B;  1TFD A;  1R6Z A;  2QS4 A;  4DE8 A;  3RN8 A;  4RYA A;  2H5Y A;  4OFJ A;  4AB5 A;  3IX1 A;  4E0W A;  3UN6 A;  1LAX A;  1MQH A;  3OEL A;  3S2V A;  4EUO A;  4EQ7 A;  1AH5 A;  1SI1 A;  4JDF A;  2OK2 A;  3K1N A;  3H6W A;  4P11 A;  1FTJ A;  1B9J A;  3K2D A;  3U92 A;  3SEX A;  1ZKB A;  2I4C A;  3BFU A;  5CMB A;  1PBP A;  3LC8 A;  3MZ1 A;  4R73 A;  5H8Q A;  4F39 A;  2F97 A;  3SKP A;  3FJ7 A;  2F7C A;  1MY3 A;  3TUS A;  4F18 A;  2QS3 A;  3CSB A;  2ZYK A;  4GL8 A;  3OO9 A;  4OTE A;  5IAI A;  1QJM A;  1B1X A;  1ZMG A;  2GHB A;  5FHN A;  2OLB A;  4R75 A;  1II5 A;  2I58 A;  4U23 A;  5FHO A;  5AA2 B;  1B7U A;  1R9Q A;  4FAJ A;  1LGB C;  4C0R A;  1A7L A;  3G3J A;  1B51 A;  2Y84 A;  4XKP A;  2UVI A;  2YLN A;  3FXU A;  3QIM A;  4R2B A;  4YB6 A;  3ECR A;  3LSX A;  2DVZ A;  4XKR A;  1Y3N A;  2XX8 A;  1MRP A;  2REJ A;  1IZ1 A;  2VD2 A;  3K6V A;  4Q30 B;  1JVX A;  3TTM A;  4DZ1 A;  2XXP A;  3U1O A;  1FQD A;  2XXR A;  2CZL A;  4HS7 A;  4F31 B;  1NNT A;  3FD3 A;  4IO5 A;  4R6Y A;  3DLN A;  5HPQ A;  3MVX A;  4BDO A;  1H44 A;  5I58 B;  4OYV A;  4ZED A;  2Y7W A;  2IEE A;  4HW8 A;  3MPL A;  3CI8 A;  4DCX A;  4OEU A;  2HQ0 A;  1ZU0 A;  4RK9 A;  1DMB A;  4HCW A;  4F3S A;  4ECF A;  2REG A;  1MS7 A;  2ABH A;  3L6H A;  4BDL A;  4YKP A;  1N84 A;  2D3I A;  3HHF A;  4NF5 B;  4EQB A;  1N0T A;  4GXS B;  3K00 A;  3O29 A;  3T22 A;  3W9V A;  3C36 A;  1I6A A;  4G77 A;  3TYH A;  1LFG A;  3B7D A;  4QF9 A;  1OLC A;  3V83 A;  1VFE A;  2ZYN A;  1SBP A;  3FGS A;  4HCY A;  4R6K A;  4WEP A;  2O1L A;  3H7M A;  4E0X A;  3MP8 A;  4O3B A;  2O6A A;  2ZYO A;  4P0G A;  4RPN A;  3T93 B;  3H3G A;  4GRK A;  5DEX A;  3QUJ A;  4EDP A;  2AIX A;  1B3E A;  2AL4 A;  5IKB A;  3H03 A;  4NE4 A;  1PB9 A;  4NMY A;  3WAE A;  1US4 A;  1NNF A;  3IB1 A;  1JEV A;  1S7Y A;  2FA7 A;  3VVE A;  2W7Y A;  4G68 C;  3ZSF A;  4F3P A;  1NMU A;  4QHQ A;  3IOR A;  2H98 A;  4MFI A;  1AIV A;  2HZL A;  5ITP A;  5I2K A;  1SD3 A;  4IO7 A;  1B5H A;  1FTO A;  4ISU A;  4PFW A;  1RYO A;  4R9F A;  3CIJ A;  2NOO A;  5TPA A;  2ALU A;  3QSL A;  5ELV A;  4DXC A;  3T96 B;  5JTY B;  1VR5 A;  1NL5 A;  2DYX A;  1IIW A;  4ZEI A;  5ITO A;  1B1H A;  1FQA A;  1HSE A;  2YJP A;  4RPO A;  3TEL A;  4AB6 A;  4Z7E A;  4XTC Q;  5I59 A;  3S9E A;  2RC8 A;  3D4C A;  2OBG A;  1B4H A;  1POY 1;  2F36 A;  3RQT A;  3H6T A;  1A8E A;  1MH4 A;  1IXG A;  1WVJ A;  4OQO A;  3N6U A;  2XXW A;  2H99 A;  3BKI B;  3PUY E;  3OXN A;  3FVN A;  1B58 A;  5FTH A;  4N13 A;  3O6I A;  5HBC A;  1T0K A;  2F8D A;  1OMP A;  2Q2C A;  1DPP A;  2DP8 A;  3IB2 A;  3IOV A;  4GXA A;  4OFL A;  4RNS A;  4UA8 A;  4JBZ A;  1B3L A;  3IAZ A;  2HXW A;  1R9L A;  5TP9 B;  1Y20 A;  3MAM A;  3Q27 A;  1VFD A;  4O3A A;  1HSJ A;  4POW A;  2V3Q A;  1Y4T A;  3E13 X;  1WOD A;  3K1M A;  4KR5 A;  4PP0 A;  1XS5 A;  2HEU A;  2XXX A;  3OO6 A;  4TLL B;  4YU0 A;  1UTH A;  1SW2 A;  1YAE A;  5F7V A;  2V3U A;  2Z23 A;  2Y7P A;  4QFN A;  4N6P A;  3CR9 A;  4WKM A;  2V25 A;  1MPD A;  1XT8 A;  4LZ8 A;  4ZZA A;  2XD2 A;  4X1D A;  1P1O A;  4PFU A;  3S4U A;  4G4P A;  4EQ9 A;  5I58 A;  5KZT A;  3VV5 A;  1BIY A;  3LSL A;  3JV9 A;  3TAJ A;  3G3I A;  3M3L A;  2Z8E A;  3U8Q A;  5KDT B;  1GGG A;  3IJX B;  4LON B;  3SEU A;  4TQU Q;  4OFO A;  3S9N C;  3KFM A;  2DWJ A;  1LBC A;  3TTK A;  1JET A;  4ZE8 A;  5I59 B;  1LAH E;  3V8X B;  2THI A;  3F11 A;  3UGW A;  3OEN A;  3KJT A;  1S50 A;  2A5T B;  3CFL A;  3HCQ A;  1LFH A;  3DM0 A;  1URS A;  2XHD A;  3KN7 A;  4POX A;  3SDF A;  3VVF A;  5DVI A;  1SDX A;  3FAT A;  4R74 A;  2RC7 A;  2HCA A;  2OWS A;  1DOT A;  1LLS A;  2H4I A;  5EHM A;  1RYX A;  1PC3 A;  3T9H B;  1MXU A;  3TPA A;  3CVG A;  1MQI A;  2B65 A;  3G7W A;  1BKA A;  1QUK A;  3N5L A;  1WDN A;  3K0V A;  4ZEF A;  2FNC A;  1TT1 A;  4GFR A;  1MY1 A;  1XC1 A;  2HZK A;  1MXY A;  1GVC A;  2QSX A;  3KSJ A;  4YAH X;  5H8F A;  4DIG A;  2F34 A;  3UK4 A;  2DSF A;  3KGC A;  4GOT A;  4YIC A;  4H5F A;  1MQG A;  4XKN A;  1MXX A;  4X48 A;  4ND9 A;  4NF8 B;  1D4N A;  4H1X A;  4U2R A;  2YPN A;  2P2A A;  1M5B A;  1XVY A;  2ONS A;  3BBR A;  5TP9 A;  2GFE A;  3GLB A;  3O6G A;  1BLF A;  4OER A;  2ZXT A;  4N07 A;  4NF5 A;  3FAS A;  4ZEB A;  3HO7 A;  1QUJ A;  4QSD A;  1B05 A;  3GXA A;  5CBR A;  3EN3 A;  3PV0 E;  1B52 A;  2NXO A;  1CB6 A;  2NWJ A;  1VE4 A;  2NUV A;  3KBR A;  3N94 A;  1P99 A;  5BUU A;  1Y1M A;  5H8F B;  3IK6 B;  4I9D A;  4G8M A;  3EHT A;  3R26 A;  1EZP A;  1NH8 A;  3O6H A;  3EQ1 A;  3Q26 A;  1EZ9 A;  4KD5 A;  2Q9T A;  1MDP 1;  4OZ9 A;  4QFP A;  4ZEK A;  3FZV A;  2A5T A;  2DOJ A;  4ONY A;  1N04 A;  2DVC A;  5B7D A;  5AA4 A;  3MWB A;  2E0S A;  3EHU A;  1OQG A;  3MC2 A;  3I5O A;  4FE8 A;  1VSO A;  3T9V A;  4AQ4 A;  4YZZ A;  3ODB A;  1LB9 A;  4LA9 A;  4KQP A;  2VGQ A;  5EYF A;  2X26 A;  5I2N B;  5H8H B;  3S9L C;  1ELJ A;  2B3F A;  1JW4 A;  1Y4C A;  1UIV A;  3MVY A;  1A54 A;  1MPC A;  4JWO A;  3R6U A;  4RK2 A;  2XX9 A;  1IIT A;  4YB7 A; 
#chains in the Genus database with same CATH topology
 1AL3 A;  1N7X A;  4MBP A;  4AS4 A;  5AA4 B;  5CMM A;  2M8C A;  4F1U A;  4PET A;  4X9T A;  1Y1Z A;  3EPE A;  2PYY A;  5EHS A;  2X7Q A;  1EH3 A;  3E78 A;  3UA8 A;  1POT A;  1DTZ A;  4PDH A;  1Y3P A;  2XD3 A;  3DP4 A;  4BLA A;  3CSG A;  1B5I A;  1BP5 A;  2HHM A;  5H8S A;  4RXL A;  4G61 A;  3SES A;  5JTY A;  3OOA A;  4MF3 A;  3VVD A;  5DYH A;  4KYD A;  1N7W A;  2DE2 A;  3BFT A;  1FJ9 A;  1JEU A;  3RPL A;  3OSQ A;  4F22 A;  1S9T A;  5EQ9 A;  4ELO A;  1ZIU A;  3OO8 A;  3M8U A;  4OET A;  1G0I A;  1M5C A;  3R7X A;  1RDZ A;  4F3G A;  3CFX A;  5CI5 A;  2O69 A;  4L17 A;  4XKQ A;  1FTM A;  3M3F A;  5IZ3 B;  4GWS A;  5I56 A;  1JQF A;  2UYF A;  5ESY A;  4H0W A;  1FPD A;  2DXR A;  4O3C A;  2KR0 A;  1HSL A;  3D1R A;  1FBH A;  2BJI A;  5IGA A;  4KYE A;  4YKK A;  3KEI A;  1XI6 A;  1GR2 A;  4C1T A;  5IZ1 A;  3IO6 A;  2UVJ A;  5CMK A;  4H8I A;  2QJE A;  3PUV E;  3RT8 A;  1RDY A;  1SI0 A;  4MLV A;  2CEY A;  2CZH A;  1MXW A;  2RIN A;  2D21 A;  3MJN A;  3E4R A;  3PD9 A;  4EF2 A;  3IJO B;  1JW5 A;  2WKY A;  1H43 A;  3ILU B;  3RLF E;  1FPI A;  2V93 A;  1US5 A;  3TTN A;  4KHZ E;  3TQW A;  4H6D A;  2Q89 A;  3FIR A;  2PT2 A;  3OD7 A;  1UTB A;  3OMB A;  3L6G A;  3FXR A;  4U22 A;  3CRB A;  3U94 A;  1FPB A;  4IO3 A;  2B3B A;  2ONK E;  2XWK A;  4ESW A;  5I57 A;  3SEW A;  4MJO A;  4U4S A;  5CBR A;  3KN8 A;  3PMW A;  3TCG A;  1MH3 A;  1MQJ A;  2F78 A;  5L9S A;  1QKB A;  4OHN A;  5I2K B;  2XXT A;  3CG1 A;  3EF7 A;  3THI A;  4P0I A;  1JVY A;  4QXD A;  1LBB A;  1D9V A;  2Z22 A;  3C35 A;  5ICT A;  1NUX A;  1URG A;  1Z7M E;  5M2V A;  4R9G A;  4OXV A;  2A5S A;  3MUQ A;  5H8N B;  3O9P A;  3UP9 A;  4G2Z A;  4FJP A;  4LAT A;  3KZG A;  1OVB A;  1KA0 A;  1MPB A;  4LZ5 A;  3B50 A;  4NWC A;  2R71 A;  3DP8 A;  1OVT A;  3K6X A;  4ZZE A;  4G8N A;  1B32 A;  5EQ8 A;  3K1P A;  3O97 A;  4KXP A;  3MVZ A;  5K2Y A;  2P0S A;  2LAO A;  2I48 A;  1FW0 A;  2HAU A;  5FHM A;  2HXR A;  3KC1 A;  3PMX A;  3FXB A;  3MW0 A;  1B46 A;  1NUY A;  1IME A;  1FBD A;  1D3K A;  4N15 A;  4DE8 A;  2DDK A;  4RYA A;  4P1E A;  4AB5 A;  3IX1 A;  3OEL A;  2OK2 A;  4OVR A;  3H6W A;  2WBB A;  3K2D A;  3U92 A;  5EYH A;  4F39 A;  4PBH A;  3CSB A;  2GHB A;  2OLB A;  2I58 A;  4FAJ A;  4C0R A;  3G3J A;  1B51 A;  2PFZ A;  3LSX A;  1MRP A;  2REJ A;  1IZ1 A;  4DZ1 A;  2XXR A;  4GX3 A;  4HS7 A;  4IO5 A;  4R6Y A;  4ZED A;  3MPL A;  3CI8 A;  1LBY A;  4OEU A;  2HQ0 A;  4RK9 A;  4F3S A;  1FBF A;  3L6H A;  4YKP A;  3K00 A;  3E79 A;  1LFG A;  4QF9 A;  1VFE A;  2ZYN A;  3MP8 A;  4I3E A;  3H3G A;  2AL4 A;  3IFA A;  1US4 A;  3IB1 A;  4G68 C;  3ZSF A;  1NMU A;  2H98 A;  1SD3 A;  2V4C A;  4X8R A;  3LV0 A;  4R9F A;  3CIJ A;  4DXC A;  3T96 B;  5JTY B;  1NL5 A;  2DYX A;  1FQA A;  3TEL A;  2RC8 A;  3BIH A;  4P3L A;  3RQT A;  1MH4 A;  1WVJ A;  4OQO A;  2H99 A;  3BKI B;  3PUY E;  4N13 A;  5HBC A;  1NI9 A;  2Q2C A;  4UA8 A;  4GXA A;  4RNS A;  1FBP A;  4JBZ A;  1T0K A;  1VFD A;  4POW A;  2XXX A;  3OO6 A;  1YAE A;  4N4U A;  2Q8M A;  2Y7P A;  4QFN A;  4LZ8 A;  2XD2 A;  4X1D A;  5I58 A;  4PFU A;  4G4P A;  4DI4 B;  3VV5 A;  4LON B;  3SEU A;  1NV7 A;  3TTK A;  4MX6 A;  2THI A;  3CFL A;  4POX A;  1URS A;  2H4I A;  3CVG A;  2B65 A;  1BKA A;  1QUK A;  3N5L A;  2KQZ A;  2QSX A;  3KSJ A;  3RYD A;  3UK4 A;  1KZ8 A;  4XKN A;  4NX1 A;  4H1X A;  2YPN A;  2P2A A;  2ONS A;  5TP9 A;  1FBC A;  4ZEB A;  4I3Y A;  4FBP A;  3PV0 E;  2NWJ A;  2ZZV A;  2NUV A;  4I9D A;  4MHF A;  1NH8 A;  1EZ9 A;  3FBP A;  4OZ9 A;  2A5T A;  5B7D A;  3MWB A;  2E0S A;  3EHU A;  1OQG A;  3ODB A;  1LB9 A;  4LA9 A;  5EYF A;  3S9L C;  1ELJ A;  1Y4C A;  1UIV A;  2XX9 A;  1IIT A;  4I40 A;  3C4M A;  2GRV A;  2X7P A;  4XXU A;  4YKJ A;  1URD A;  3VXC A;  1I6Q A;  1OLA A;  5I57 B;  4MCO A;  1FPL A;  3RNN A;  1LCF A;  2O68 A;  4LVQ A;  1DTG A;  1MY2 A;  2UVG A;  2ZNT A;  4XIG Q;  2F6G A;  2Z8D A;  2HFB A;  5ISU A;  4LQ5 A;  3IO4 A;  3W9W A;  1L5T A;  1UTH B;  4NWD A;  2F3D A;  4ZEC A;  2XXK A;  2B4L A;  4PBQ A;  3I6V A;  2VPN A;  5DTB A;  3HFU A;  1USY E;  2VOZ A;  3GBA A;  5BWJ A;  4KCD A;  4IY6 A;  4JVD A;  4H67 A;  1PB8 A;  2XXY A;  4JVI A;  4P47 A;  5DEX B;  2GHA A;  2CMO A;  3KBZ A;  3MZ9 A;  4NED A;  1N3W A;  2DE4 A;  1Q9D A;  2FBP A;  1MM6 A;  2Y7R A;  4GX4 A;  4HXV A;  3MP6 A;  4ZS9 A;  2RF1 A;  1UTB B;  1NFT A;  1B7Z A;  4F19 A;  2F3B A;  5H8N A;  2QMW A;  1IMD A;  2GH9 A;  3EHS A;  4OVS A;  1A99 A;  2DXY A;  5J16 A;  4Q5T A;  4RY1 A;  3TCH A;  3IOU A;  1M5F A;  4GWU A;  4ELR A;  3PUX E;  3C31 A;  1O63 A;  3UOR A;  2F5X A;  3O28 A;  4N8G A;  4KI0 E;  2I3W A;  4PF8 A;  1FPG A;  4FIM A;  2ESN A;  2XXI A;  3KC0 A;  2QMX A;  1MG1 A;  1QGX A;  1P1W A;  3N6T A;  3IB0 A;  4XEQ A;  1CNQ A;  1SW5 A;  2HAV A;  4X04 A;  4MAG A;  4IO2 A;  1PBQ A;  4U1Z A;  1QUL A;  1J1N A;  4NF6 A;  3IOT A;  3Q28 A;  2DQV A;  5I84 A;  4BDN A;  2Y7I A;  3KJ7 A;  4NG7 A;  1QW0 A;  1NNK A;  1LBZ A;  3SET A;  4M1V A;  3V89 B;  1K9Z A;  4I1D A;  3RTF B;  5ICQ A;  3KN3 A;  4MEV A;  4JWY A;  2ZMB A;  3ZKL A;  3MVW A;  1MY4 A;  3TMG A;  4NF4 B;  3H06 B;  5AA2 A;  3B6Q A;  3SER A;  2UXA A;  3Q29 A;  3C9H A;  2IA4 A;  5DT6 A;  3IFC A;  3ZS6 A;  2OJT A;  4YKI A;  3LSF B;  2NVU B;  2V84 A;  3ONM A;  2PT1 A;  2ZNU A;  4R72 A;  1I69 A;  3T66 A;  3TTL A;  3PU5 A;  5FBP A;  4I8C A;  3PD8 A;  4WXJ A;  2PFY A;  1NH7 A;  3MZB A;  1BTJ A;  3K02 A;  2XXV A;  1JNF A;  2E1S A;  5CC2 A;  2QRY A;  2JJK A;  4PFT A;  3TTR A;  3W15 C;  4IB2 A;  4O7I A;  2VP1 A;  2F6P A;  4PE5 B;  5F1Q A;  4NQ8 A;  1IEJ A;  1SYH A;  4H5G A;  3HN0 A;  3TKD A;  3GZG A;  1B7H A;  1PEB A;  2G29 A;  2I0C A;  1R1N A;  4IO6 A;  4DXB A;  1TFA A;  2P1S A;  3RT6 B;  4H65 A;  1FBG A;  3RTW B;  3TDJ A;  5LOM A;  2XWI A;  3TZA A;  4OMB A;  1UIU A;  1UQW A;  2RCA A;  1ATG A;  1R6Z A;  3B8B A;  4OFJ A;  1LBW A;  1NV4 A;  1LAX A;  4EUO A;  4NF0 A;  1AH5 A;  4P11 A;  1FTJ A;  5CMB A;  3MZ1 A;  4PAI A;  3SZP A;  3FJ7 A;  3TUS A;  5IAI A;  2ZYK A;  5FHN A;  1B1X A;  4R75 A;  5AA2 B;  1R9Q A;  1LGB C;  4OAN A;  4PFB A;  2Y84 A;  3QIM A;  3FXU A;  4XKR A;  1Y3N A;  4N17 A;  5ET5 A;  4F31 B;  1NNT A;  3DLN A;  3MVX A;  4BDO A;  1H44 A;  4PDD A;  4OYV A;  2Y7W A;  1DK4 A;  4DCX A;  1VDW A;  1ZU0 A;  4ECF A;  1MS7 A;  2Y5L A;  1N84 A;  3HHF A;  1N0T A;  4GXS B;  3T22 A;  3C36 A;  1I6A A;  4G77 A;  3B7D A;  1OLC A;  3V83 A;  4HCY A;  2CEX A;  4EDP A;  1B3E A;  4O7M A;  4PGN A;  5IKB A;  3WAE A;  1NNF A;  1AWB A;  1S7Y A;  2FA7 A;  3LUZ A;  2HZL A;  4IO7 A;  1B5H A;  1FTO A;  4PFW A;  1RYO A;  5ELV A;  5ITO A;  3S9E A;  4P56 A;  3D4C A;  1POY 1;  3H6T A;  1FJ6 A;  2QVR A;  5FTH A;  3O6I A;  2DP8 A;  3IOV A;  3Q27 A;  4WED A;  2HEU A;  4YU0 A;  2Z23 A;  3CR9 A;  4ZZA A;  4O94 A;  5KZT A;  3TAJ A;  4P8B A;  1GGG A;  3IJX B;  4TQU Q;  2DWJ A;  1JET A;  1LAH E;  1S50 A;  2A5T B;  2MKZ A;  3KN7 A;  2XHD A;  4R74 A;  2HCA A;  3TPA A;  1LLS A;  1RYX A;  3G7W A;  1WDN A;  3K0V A;  4QBA A;  4OVP A;  1XC1 A;  1MXY A;  4DIG A;  4YIC A;  1MXX A;  4ND9 A;  3CHG A;  2GFE A;  3O6G A;  1BLF A;  4OER A;  3FAS A;  4QSD A;  2NXO A;  1CB6 A;  1VE4 A;  3A29 A;  3N94 A;  5BUU A;  3U65 A;  5H8F B;  3IK6 B;  3EHT A;  2XWO A;  4KD5 A;  4QFP A;  4ZEK A;  1KA1 A;  1N04 A;  2DVC A;  5AA4 A;  4AQ4 A;  1EYK A;  5I2N B;  1A54 A;  3R6U A;  4YB7 A;  5I2N A;  1MXV A;  5DVF A;  3E9X A;  2DWA A;  3A3C A;  2VHA A;  4OVT A;  1B5J A;  4QFO A;  4ZE9 A;  2PMS A;  5I58 B;  1B2H A;  4NTL A;  3IL1 B;  1TWY A;  3G3H A;  4FEB A;  1AMF A;  3VLW A;  4NF6 B;  3KOS A;  2O1M A;  1ANF A;  4ELQ A;  1D9Y A;  3MPK A;  1Y3Q A;  4JXI A;  3FXQ A;  4PE3 A;  4F1V A;  2VD3 A;  3ISP A;  4MNI A;  2QS2 A;  2Q74 A;  3MBP A;  4JWX A;  4NAP A;  4PTK A;  2AYS A;  4NF4 A;  1XHY A;  1IMF A;  4KFQ A;  4N6K A;  3RUM A;  3IR1 A;  1FSA A;  2RCB A;  5L8D A;  4KYS A;  2ANJ A;  2PVU A;  4DLD A;  1MM7 A;  2Z8F A;  1A8F A;  4LN5 A;  3FVG A;  1ZTY A;  1A55 A;  2V3T A;  3K01 A;  4EXL A;  1MQD A;  3CFZ A;  4MNC A;  1D9Q A;  2O7I A;  1P1U A;  4FEC A;  1KWH A;  1FQC A;  3TOD A;  1XVX A;  1ZBM A;  1NV2 A;  2Y7K A;  1NUZ A;  3TEP A;  1FQE A;  3H6V A;  1LCT A;  2DE3 A;  1OQH A;  2WX9 A;  5AA2 D;  1DBZ A;  3ZKK A;  5IZZ A;  4YMA A;  4GL0 A;  5TPA B;  4LP2 B;  4U21 A;  3DP6 A;  1MY0 A;  3VXB A;  4BDM A;  1FPE A;  4H8J A;  1SW4 A;  2H9B A;  4PC9 A;  1LFI A;  3MP1 A;  1Y9U A;  2O51 A;  4R6H A;  2AL5 A;  1LBV A;  4Q0C A;  3PPP A;  1O64 A;  2F7A A;  3D4G A;  2DWH A;  1YPN A;  1INP A;  1B40 A;  5FTI A;  4UAC A;  3B6T A;  4HTG A;  3RY3 A;  1IQ7 A;  4OEV A;  1OIB A;  4RA1 A;  5HM4 B;  4P9K A;  1M5E A;  2ONR A;  3C32 A;  3FV1 A;  4F3B A;  1QVS A;  5TU0 A;  3QK6 A;  3V5A A;  4ELP A;  5CM6 A;  1IXI A;  4TLM B;  2O84 X;  2FIE A;  4FED A;  4BDQ A;  1Q35 A;  1LST A;  3PTY A;  5K2X A;  5H8Q B;  3EKI A;  3GYY A;  5J1D A;  1EU8 A;  2DWI A;  2CZI A;  4QFK A;  1YCJ A;  1ZLQ A;  3K4U A;  2Y5K A;  3A09 A;  2B4M A;  3P7I A;  4OEN A;  4C1U A;  1FTK A;  3GBB A;  1QKA A;  2DS9 A;  2OWT A;  5KCJ B;  1MXZ A;  3OEM A;  4X1B A;  1H3D A;  1DSN A;  2R9J A;  3VLV A;  3OEK A;  2HPG A;  5CMC A;  1DCU A;  4YMB A;  2QS1 A;  4YB5 A;  2P3V A;  2ZNS A;  1QUI A;  1FPF A;  3DEL B;  2KLF A;  4JSD A;  4IO4 A;  1FTL A;  4PFI A;  5AA3 A;  4JSO A;  3QYT A;  1N3X A;  1NNP A;  5I7I A;  4I62 A;  4JB7 A;  2O7U A;  1BK4 A;  2XWV A;  4GBW A;  3H6U A;  5H8H A;  1NV6 A;  2Q8J A;  3C33 A;  3MYU A;  4G68 A;  3PUZ E;  4OWD A;  4GWO A;  2RKM A;  4IGR A;  1DPE A;  3VFJ A;  1NKX A;  4DDD A;  3T9U A;  4THI A;  5F24 A;  1AOV A;  3PPN A;  1XOC A;  2F35 A;  3LBS A;  4KCC A;  2QPQ A;  2R8T A;  4PFY A;  1I6B A;  3HV1 A;  3LSW A;  3VE1 B;  3LUY A;  3RN8 A;  2H5Y A;  2WEF A;  1MQH A;  1SI1 A;  4JDF A;  3K1N A;  3SEX A;  3ROJ A;  4F18 A;  2QS3 A;  4OTE A;  1II5 A;  4N91 A;  1YZ0 A;  1LBX A;  4R2B A;  2FHY A;  3ECR A;  2DVZ A;  2XX8 A;  3K6V A;  4Q30 B;  2XXP A;  2WYP A;  2L5V A;  2IEE A;  4HW8 A;  2ZZX A;  1DMB A;  4BDL A;  3O29 A;  3W9V A;  4O8M A;  3TYH A;  5T3J A;  3FGS A;  2O1L A;  4E0X A;  2O6A A;  2ZYO A;  4P0G A;  3QUJ A;  2AIX A;  3H03 A;  4NE4 A;  1PB9 A;  1FRP A;  2W7Y A;  4F3P A;  4PCD A;  4MFI A;  5I2K A;  1K9Y A;  2NOO A;  1B1H A;  1HSE A;  4AB6 A;  2YJP A;  4RPO A;  4Z7E A;  4XTC Q;  5I59 A;  1B4H A;  1IXG A;  3N6U A;  3OXN A;  3FVN A;  2F8D A;  1OMP A;  1DPP A;  3IAZ A;  1R9L A;  5TP9 B;  3MAM A;  2V3Q A;  4KR5 A;  5AE4 A;  1XS5 A;  4TLL B;  4PAF A;  2V3U A;  4UAB A;  4WKM A;  4EQ9 A;  1BIY A;  3LSL A;  3JV9 A;  3G3I A;  3U8Q A;  5KDT B;  3S9N C;  4OFO A;  3KFM A;  2CZK A;  1YYZ A;  5I59 B;  3V8X B;  3F11 A;  3UGW A;  3OEN A;  3KJT A;  3DM0 A;  3VVF A;  3SDF A;  5DVI A;  1SDX A;  1SPI A;  3FAT A;  2RC7 A;  2OWS A;  1DOT A;  3T9H B;  1MQI A;  4H46 A;  4ZEF A;  4NN3 A;  2FNC A;  4YAH X;  3T1B A;  2OX3 A;  4H5F A;  4X48 A;  4NF8 B;  1D4N A;  1XVY A;  3BBR A;  3GLB A;  3HO7 A;  1QUJ A;  2ZZW A;  1B05 A;  3GXA A;  1B52 A;  2QFL A;  1FBE A;  1Y1M A;  5IZ3 A;  4G8M A;  1EZP A;  3EQ1 A;  4MIJ A;  3MST A;  2Q9T A;  3FZV A;  2DOJ A;  4ONY A;  4GWW A;  3MC2 A;  3I5O A;  4FE8 A;  1VSO A;  2VGQ A;  1JW4 A;  3MVY A;  1MPC A;  1IXH A;  2PBW A;  4OVJ A;  5EQ7 A;  4EXK A;  3RPL B;  4N6D A;  2XXQ A;  1IMA A;  1IUD A;  5I3S A;  1FQB A;  3FJG A;  2OZZ A;  3HST A;  4MLQ A;  4DI3 D;  1YXI A;  1PDA A;  5DVJ A;  2F7B A;  1FQF A;  2H25 A;  2Q88 A;  3E3K A;  4TOZ A;  4ESX A;  3K6W A;  3CG3 A;  3RGY A;  3G3G A;  4Z0I A;  2UYE A;  2D5W A;  4GWZ A;  4MMP A;  4DCY A;  5I5P A;  3MQ9 A;  3NOH A;  3TQL A;  4M4G A;  4GVO A;  4OVQ A;  4GWY A;  5EQA A;  4G68 B;  3SEY A;  1B4Z A;  2GQ1 A;  3G3K A;  1FCK A;  1B6H A;  5A5L A;  1JW1 A;  1JP4 A;  1N76 A;  5IM2 A;  4RJZ A;  1GV8 A;  3FJM A;  3K6U A;  1TXF A;  4GIZ A;  4GWX A;  3SEV A;  3O66 A;  1GTK A;  3VDF A;  4G8H A;  3N26 A;  4NHB A;  3HPI A;  3WAF A;  4KPT A;  3QAX A;  2FIX A;  4BDR A;  4Q8R A;  2ZYM A;  5I56 B;  1B3H A;  4GBV A;  1NV3 A;  3KOT A;  1SQY A;  3I3V A;  3JYR A;  4GLI A;  3JZJ A;  2I4B A;  5A5X B;  1B3F A;  1P1N A;  4F2Q A;  3PPO A;  1CE2 A;  4IGT A;  4R2F A;  4JVC A;  1PB7 A;  2QVU A;  3QXM A;  1G0H A;  3FUZ A;  4LZ7 A;  3IOW A;  4P1L A;  4QRZ A;  1USY H;  4U4X A;  4OA4 A;  4LQ2 A;  3T9X B;  2XX7 A;  1B0H A;  3VLU A;  5CBS A;  4U1O A;  4EF1 A;  4GQO A;  2OCU A;  5A5X A;  3FVK A;  1H76 A;  2XXU A;  4N81 A;  1LAG E;  2I6E A;  1Z7N E;  5B70 A;  4GD5 A;  3KG2 A;  3M3K A;  4F29 A;  1ZJL A;  5CRY A;  3PMV A;  4GF8 A;  4QSE A;  1RKM A;  2PX1 A;  3U93 A;  3KSX A;  2PCR A;  2Q2A A;  4PQJ A;  3OO7 A;  3TCF A;  3RPW A;  3UIF A;  3H4Z A;  2VPO A;  1F9B A;  2G93 A;  1SVX B;  3AXF A;  4PF6 A;  3U72 A;  1LB8 A;  4QFL A;  1FPK A;  2XXH A;  5LTC A;  5L9M A;  1YTV A;  4K3F A;  4ZDM A;  1Q1K A;  3Q25 A;  3A3U A;  3PUW E;  1LAF E;  1B3G A;  4F2O A;  4HE1 A;  2I3V A;  1SYI A;  4DXU A;  4NF8 A;  5EYG A;  4H45 A;  2FYI A;  1IXC A;  5AA1 A;  4FOR A;  4N8Y A;  3G3F A;  1M5D A;  3O2A A;  2BJJ X;  3LR1 A;  2I49 A;  5L9O A;  4OES A;  4MNP A;  3C34 A;  4NGU A;  3TFL A;  1A40 A;  1FTA A;  3QUF A;  2UVH A;  2QL3 A;  3B6W A;  5JEI A;  3PGF A;  1IMB A;  4IY5 A;  2RC9 A;  3OSR A;  4FAT A;  1O7T A;  4PAK A;  4XF5 A;  3PPQ A;  2I0B A;  3HHG A;  2R6G E;  1IMC A;  4LUB A;  3S9M C;  2OWZ A;  3FV2 A;  4QSC A;  5KCJ A;  3QMF A;  4F1Y A;  3ILT B;  1H45 A;  4MH5 A;  1B0L A;  3FVO A;  1LEV A;  1P1Q A;  1EZO A;  1SW1 A;  1MDQ A;  3PPR A;  1TFD A;  2QS4 A;  4E0W A;  3UN6 A;  3S2V A;  4EQ7 A;  1B9J A;  1EYI A;  1ZKB A;  2I4C A;  3BFU A;  1PBP A;  3LC8 A;  4R73 A;  5H8Q A;  2F97 A;  3SKP A;  2F7C A;  1MY3 A;  4GL8 A;  3OO9 A;  1QJM A;  5KDT A;  1ZMG A;  5FHO A;  4U23 A;  1B7U A;  2FVZ A;  2VT5 A;  1A7L A;  4XKP A;  5ET6 A;  2UVI A;  2YLN A;  4YB6 A;  2P3N A;  2VD2 A;  3TTM A;  1JVX A;  3U1O A;  1FQD A;  2CZL A;  3FD3 A;  5HPQ A;  4PFR A;  4HCW A;  2REG A;  2ABH A;  2D3I A;  4NF5 B;  4EQB A;  5DW8 A;  2QVV A;  1NV1 A;  4IR8 A;  4WEP A;  4R6K A;  1SBP A;  4PGP A;  3H7M A;  4GX6 A;  4O3B A;  4RPN A;  3T0J A;  3T93 B;  5DEX A;  4GRK A;  4NMY A;  3VVE A;  1JEV A;  2XA5 A;  4QHQ A;  3IOR A;  1AIV A;  5ITP A;  1NV0 A;  4ISU A;  5TPA A;  2ALU A;  3QSL A;  1VR5 A;  1IIW A;  4ZEI A;  2OBG A;  2F36 A;  1A8E A;  2XXW A;  5ET8 A;  1B58 A;  3IB2 A;  4OFL A;  1NV5 A;  1B3L A;  2HXW A;  5JK4 A;  1Y20 A;  4O3A A;  1HSJ A;  1Y4T A;  3E13 X;  1WOD A;  3K1M A;  4PP0 A;  1RDX A;  1UTH A;  1SW2 A;  5F7V A;  4N6P A;  1FPJ A;  2V25 A;  1MPD A;  1XT8 A;  3S4U A;  1P1O A;  4XFE A;  3M3L A;  2Z8E A;  1LBC A;  4ZE8 A;  3HCQ A;  1LFH A;  4AS5 A;  2WBD A;  5EHM A;  3USD A;  1PC3 A;  1MXU A;  4GFR A;  1TT1 A;  4HE2 A;  1MY1 A;  1GVC A;  2HZK A;  1NUW A;  5H8F A;  2F34 A;  2DSF A;  3KGC A;  4GOT A;  1MQG A;  1EYJ A;  5ET7 A;  4U2R A;  1M5B A;  4HE0 A;  2ZXT A;  2WYK A;  4N07 A;  4NF5 A;  3EN3 A;  3BIG A;  3KBR A;  1P99 A;  3R26 A;  3O6H A;  3Q26 A;  5LDZ A;  1MDP 1;  3T9V A;  4YZZ A;  4KQP A;  2X26 A;  5H8H B;  2B3F A;  4JWO A;  4RK2 A; 
#chains in the Genus database with same CATH homology
 1AL3 A;  1IXH A;  5I2N A;  1N7X A;  1MXV A;  2PBW A;  3C4M A;  2GRV A;  4MBP A;  4OVJ A;  3E9X A;  5DVF A;  5AE4 A;  2DWA A;  2X7P A;  4EXK A;  2XXQ A;  4XXU A;  3A3C A;  1IUD A;  1URD A;  4YKJ A;  3VXC A;  5AA4 B;  2VHA A;  5CMM A;  1I6Q A;  2M8C A;  4F1U A;  1OLA A;  1FQB A;  1Y1Z A;  4PET A;  4X9T A;  5I57 B;  3FJG A;  2OZZ A;  3RNN A;  1B5J A;  3HST A;  1LCF A;  3EPE A;  4MLQ A;  2PYY A;  2O68 A;  5EHS A;  2X7Q A;  4LVQ A;  1PDA A;  5DVJ A;  2F7B A;  1FQF A;  1DTG A;  1EH3 A;  1MY2 A;  4QFO A;  2H25 A;  2Q88 A;  3E3K A;  4TOZ A;  2PMS A;  4ZE9 A;  3UA8 A;  1B2H A;  1POT A;  2UVG A;  2ZNT A;  4NTL A;  4XIG Q;  4ESX A;  3IL1 B;  3K6W A;  1TWY A;  3CG3 A;  3RGY A;  2F6G A;  3G3G A;  2Z8D A;  1DTZ A;  2HFB A;  3G3H A;  4LQ5 A;  3IO4 A;  4FEB A;  4Z0I A;  1AMF A;  5ISU A;  2UYE A;  1Y3P A;  2D5W A;  4NF6 B;  1L5T A;  2XD3 A;  3VLW A;  3W9W A;  1UTH B;  3DP4 A;  2O1M A;  3KOS A;  4BLA A;  3CSG A;  1ANF A;  1B5I A;  1BP5 A;  1D9Y A;  4ELQ A;  3MPK A;  4NWD A;  5H8S A;  4DCY A;  1Y3Q A;  3MQ9 A;  3TQL A;  4RXL A;  4ZEC A;  4JXI A;  4M4G A;  4GVO A;  3SES A;  3I6V A;  3FXQ A;  5DTB A;  5JTY A;  3OOA A;  4WED A;  4MF3 A;  3VVD A;  5DYH A;  4KYD A;  1N7W A;  2DE2 A;  3BFT A;  4G68 B;  3SEY A;  1B4Z A;  2VD3 A;  4F1V A;  1USY E;  2QS2 A;  2VOZ A;  3GBA A;  1JEU A;  3G3K A;  3MBP A;  4JWX A;  1FCK A;  5BWJ A;  4KCD A;  3OSQ A;  1B6H A;  2AYS A;  4F22 A;  4NF4 A;  1S9T A;  1XHY A;  4IY6 A;  4KFQ A;  4ELO A;  1ZIU A;  1JW1 A;  3IR1 A;  3M8U A;  1PB8 A;  3OO8 A;  4H67 A;  4OET A;  3RUM A;  1N76 A;  2RCB A;  2XXY A;  4KYS A;  5L8D A;  2ANJ A;  5DEX B;  2PVU A;  1M5C A;  4RJZ A;  3R7X A;  1GV8 A;  4F3G A;  3FJM A;  2GHA A;  1TXF A;  2CMO A;  3K6U A;  3CFX A;  4GIZ A;  3MZ9 A;  4DLD A;  4NED A;  1MM7 A;  1N3W A;  2DE4 A;  5CI5 A;  2O69 A;  2Z8F A;  3SEV A;  3O66 A;  1A8F A;  3FVG A;  4L17 A;  1MM6 A;  1GTK A;  2Y7R A;  1ZTY A;  3MP6 A;  4ZS9 A;  3VDF A;  1A55 A;  2RF1 A;  2V3T A;  4G8H A;  3N26 A;  1UTB B;  4XKQ A;  1NFT A;  1FTM A;  3HPI A;  3K01 A;  3M3F A;  4KPT A;  3WAF A;  4EXL A;  1B7Z A;  1MQD A;  5I56 A;  3QAX A;  1JQF A;  3CFZ A;  4F19 A;  2O7I A;  2UYF A;  1P1U A;  4BDR A;  4FEC A;  2ZYM A;  5H8N A;  4Q8R A;  1KWH A;  1FQC A;  2QMW A;  3TOD A;  1XVX A;  1ZBM A;  2GH9 A;  4H0W A;  5I56 B;  3EHS A;  2DXR A;  2Y7K A;  1B3H A;  1A99 A;  4O3C A;  3TEP A;  1FQE A;  3H6V A;  3KOT A;  1HSL A;  1LCT A;  1SQY A;  2DE3 A;  1OQH A;  2DXY A;  3I3V A;  3JYR A;  4GLI A;  5AA2 D;  3ZKK A;  4Q5T A;  3JZJ A;  4RY1 A;  4KYE A;  2I4B A;  4YMA A;  5A5X B;  4GL0 A;  3TCH A;  1B3F A;  1P1N A;  5TPA B;  3IOU A;  1M5F A;  4LP2 B;  4U21 A;  4ELR A;  3PUX E;  4YKK A;  4F2Q A;  3C31 A;  3KEI A;  1O63 A;  3UOR A;  1GR2 A;  3DP6 A;  1MY0 A;  3PPO A;  1CE2 A;  3VXB A;  4IGT A;  2F5X A;  4BDM A;  3O28 A;  4H8J A;  4C1T A;  1SW4 A;  4R2F A;  3IO6 A;  4KI0 E;  2UVJ A;  2H9B A;  2I3W A;  5CMK A;  4H8I A;  2QJE A;  3PUV E;  3RT8 A;  4FIM A;  2ESN A;  1LFI A;  1PB7 A;  2XXI A;  3MP1 A;  2QMX A;  1Y9U A;  1SI0 A;  2O51 A;  2AL5 A;  1MG1 A;  1P1W A;  3QXM A;  4MLV A;  4R6H A;  4Q0C A;  3FUZ A;  1MXW A;  4LZ7 A;  2RIN A;  3IOW A;  3IB0 A;  3N6T A;  3PPP A;  2D21 A;  3USD A;  4QRZ A;  1USY H;  1O64 A;  5CBS A;  4U4X A;  2F7A A;  3MJN A;  3D4G A;  1SW5 A;  2HAV A;  4LQ2 A;  3T9X B;  2DWH A;  3E4R A;  1YPN A;  2XX7 A;  3PD9 A;  4IO2 A;  4EF2 A;  1PBQ A;  3IJO B;  1JW5 A;  1B40 A;  1B0H A;  4U1Z A;  2WKY A;  3VLU A;  1H43 A;  5FTI A;  3ILU B;  4U1O A;  2V93 A;  4UAC A;  3RLF E;  1QUL A;  3B6T A;  4HTG A;  3RY3 A;  1J1N A;  4EF1 A;  1US5 A;  1IQ7 A;  4GQO A;  3IOT A;  4NF6 A;  4OEV A;  2OCU A;  5A5X A;  3Q28 A;  2DQV A;  3FVK A;  5I84 A;  1OIB A;  1H76 A;  2XXU A;  4RA1 A;  4BDN A;  5HM4 B;  1LAG E;  2I6E A;  3TTN A;  1Z7N E;  1M5E A;  2ONR A;  2Y7I A;  3C32 A;  3FV1 A;  3KJ7 A;  1QVS A;  4F3B A;  4GD5 A;  4KHZ E;  3QK6 A;  5TU0 A;  5B70 A;  3TQW A;  4H6D A;  3KG2 A;  1QW0 A;  3M3K A;  4F29 A;  1ZJL A;  5CRY A;  1NNK A;  3V5A A;  3SET A;  4M1V A;  2Q89 A;  3V89 B;  3FIR A;  2PT2 A;  3OD7 A;  4ELP A;  1UTB A;  5CM6 A;  3OMB A;  3L6G A;  1IXI A;  3PMV A;  4GF8 A;  4QSE A;  3FXR A;  4I1D A;  1RKM A;  2PX1 A;  4TLM B;  2O84 X;  3U93 A;  3KSX A;  4U22 A;  3CRB A;  4FED A;  3U94 A;  3RTF B;  4BDQ A;  5ICQ A;  1Q35 A;  4IO3 A;  1LST A;  2B3B A;  2ONK E;  2Q2A A;  4PQJ A;  4ESW A;  5I57 A;  3OO7 A;  5K2X A;  3KN3 A;  3SEW A;  3TCF A;  5H8Q B;  4U4S A;  4JWY A;  3KN8 A;  3RPW A;  2ZMB A;  3PMW A;  3TCG A;  1MH3 A;  1MQJ A;  3UIF A;  2F78 A;  3ZKL A;  5L9S A;  5J1D A;  3H4Z A;  1QKB A;  1EU8 A;  3MVW A;  1MY4 A;  2DWI A;  4OHN A;  3TMG A;  1F9B A;  2G93 A;  1SVX B;  4QFK A;  3AXF A;  4NF4 B;  5I2K B;  3H06 B;  5AA2 A;  2XXT A;  1YCJ A;  1ZLQ A;  2UXA A;  3B6Q A;  3K4U A;  3SER A;  1LB8 A;  3U72 A;  3Q29 A;  3A09 A;  3C9H A;  3CG1 A;  2IA4 A;  3EF7 A;  2XXH A;  3P7I A;  4QFL A;  4OEN A;  5DT6 A;  5L9M A;  3THI A;  4P0I A;  3ZS6 A;  4C1U A;  1YTV A;  4K3F A;  1JVY A;  1FTK A;  1Q1K A;  2OJT A;  3GBB A;  1LBB A;  4YKI A;  1QKA A;  4ZDM A;  2DS9 A;  3LSF B;  3A3U A;  3Q25 A;  2V84 A;  2NVU B;  1D9V A;  3PUW E;  2OWT A;  1LAF E;  1B3G A;  2Z22 A;  3ONM A;  2I3V A;  3C35 A;  4F2O A;  5ICT A;  5KCJ B;  1SYI A;  1MXZ A;  3OEM A;  2PT1 A;  1URG A;  4DXU A;  4X1B A;  1Z7M E;  4NF8 A;  5M2V A;  1H3D A;  2ZNU A;  4R9G A;  1DSN A;  4OXV A;  4R72 A;  2R9J A;  2A5S A;  1I69 A;  3T66 A;  3MUQ A;  3TTL A;  3PU5 A;  4FAT A;  5H8N B;  3VLV A;  2FYI A;  3O9P A;  3OEK A;  5CMC A;  3UP9 A;  4G2Z A;  1IXC A;  4YMB A;  4FJP A;  5AA1 A;  4FOR A;  2QS1 A;  4LAT A;  3KZG A;  3PD8 A;  1OVB A;  4I8C A;  4WXJ A;  5KDT A;  3G3F A;  1M5D A;  3O2A A;  2BJJ X;  4YB5 A;  2ZNS A;  1NH7 A;  3LR1 A;  2I49 A;  1QUI A;  1MPB A;  4LZ5 A;  3MZB A;  3DEL B;  1BTJ A;  2KLF A;  5L9O A;  3K02 A;  4JSD A;  4IO4 A;  4OES A;  4NWC A;  3C34 A;  3TFL A;  1FTL A;  1A40 A;  3QUF A;  2R71 A;  2XXV A;  3DP8 A;  5AA3 A;  1JNF A;  1OVT A;  2QL3 A;  2UVH A;  3K6X A;  2E1S A;  3B6W A;  4G8N A;  4JSO A;  4ZZE A;  2QRY A;  5CC2 A;  5JEI A;  1B32 A;  3QYT A;  4PFT A;  3PGF A;  1N3X A;  3TTR A;  3W15 C;  4IB2 A;  4IY5 A;  1NNP A;  2VP1 A;  2F6P A;  3K1P A;  4I62 A;  2O7U A;  3O97 A;  4JB7 A;  4PE5 B;  5JK4 A;  5F1Q A;  2RC9 A;  3MVZ A;  3H6U A;  3OSR A;  5H8H A;  1IEJ A;  1SYH A;  2P0S A;  5K2Y A;  4H5G A;  2LAO A;  3C33 A;  1O7T A;  2I48 A;  1FW0 A;  3HN0 A;  3PPQ A;  2HAU A;  2Q8J A;  3GZG A;  3TKD A;  4G68 A;  5FHM A;  2I0B A;  3PUZ E;  4OWD A;  4GWO A;  1B7H A;  1PEB A;  2G29 A;  2I0C A;  2R6G E;  2RKM A;  1DPE A;  3HHG A;  1R1N A;  3PMX A;  4IGR A;  4IO6 A;  3VFJ A;  1NKX A;  4LUB A;  4DDD A;  1TFA A;  4DXB A;  3S9M C;  3MW0 A;  2P1S A;  3RT6 B;  3FV2 A;  4QSC A;  4THI A;  1B46 A;  3T9U A;  4H65 A;  5KCJ A;  1AOV A;  3PPN A;  1XOC A;  3RTW B;  4F1Y A;  2F35 A;  3TDJ A;  3ILT B;  1H45 A;  4MH5 A;  5LOM A;  1B0L A;  3LBS A;  4KCC A;  2QPQ A;  3FVO A;  4OMB A;  1P1Q A;  1UIU A;  3TZA A;  1EZO A;  1SW1 A;  4PFY A;  1MDQ A;  1D3K A;  1I6B A;  1UQW A;  1ATG A;  2RCA A;  3HV1 A;  3LSW A;  3LUY A;  3PPR A;  3VE1 B;  1TFD A;  1R6Z A;  2QS4 A;  4DE8 A;  3RN8 A;  4RYA A;  2H5Y A;  4OFJ A;  4AB5 A;  3IX1 A;  4E0W A;  3UN6 A;  1LAX A;  1MQH A;  3OEL A;  3S2V A;  4EUO A;  4EQ7 A;  1AH5 A;  1SI1 A;  4JDF A;  2OK2 A;  3K1N A;  3H6W A;  4P11 A;  1FTJ A;  1B9J A;  3K2D A;  3U92 A;  3SEX A;  1ZKB A;  2I4C A;  3BFU A;  5CMB A;  1PBP A;  3LC8 A;  3MZ1 A;  4R73 A;  5H8Q A;  4F39 A;  2F97 A;  3SKP A;  3FJ7 A;  2F7C A;  1MY3 A;  3TUS A;  4F18 A;  2QS3 A;  3CSB A;  2ZYK A;  4GL8 A;  3OO9 A;  4OTE A;  5IAI A;  1QJM A;  1B1X A;  1ZMG A;  2GHB A;  5FHN A;  2OLB A;  4R75 A;  1II5 A;  2I58 A;  4U23 A;  5FHO A;  5AA2 B;  1B7U A;  1R9Q A;  4FAJ A;  1LGB C;  4C0R A;  1A7L A;  3G3J A;  1B51 A;  2Y84 A;  4XKP A;  2UVI A;  2YLN A;  3FXU A;  3QIM A;  4R2B A;  4YB6 A;  3ECR A;  3LSX A;  2DVZ A;  4XKR A;  1Y3N A;  2XX8 A;  1MRP A;  2REJ A;  1IZ1 A;  2VD2 A;  3K6V A;  4Q30 B;  1JVX A;  3TTM A;  4DZ1 A;  2XXP A;  3U1O A;  1FQD A;  2XXR A;  2CZL A;  4HS7 A;  4F31 B;  1NNT A;  3FD3 A;  4IO5 A;  4R6Y A;  3DLN A;  5HPQ A;  3MVX A;  4BDO A;  1H44 A;  5I58 B;  4OYV A;  4ZED A;  2Y7W A;  2IEE A;  4HW8 A;  3MPL A;  3CI8 A;  4DCX A;  4OEU A;  2HQ0 A;  1ZU0 A;  4RK9 A;  1DMB A;  4HCW A;  4F3S A;  4ECF A;  2REG A;  1MS7 A;  2ABH A;  3L6H A;  4BDL A;  4YKP A;  1N84 A;  2D3I A;  3HHF A;  4NF5 B;  4EQB A;  1N0T A;  4GXS B;  3K00 A;  3O29 A;  3T22 A;  3W9V A;  3C36 A;  1I6A A;  4G77 A;  3TYH A;  1LFG A;  3B7D A;  4QF9 A;  1OLC A;  3V83 A;  1VFE A;  2ZYN A;  1SBP A;  3FGS A;  4HCY A;  4R6K A;  4WEP A;  2O1L A;  3H7M A;  4E0X A;  3MP8 A;  4O3B A;  2O6A A;  2ZYO A;  4P0G A;  4RPN A;  3T93 B;  3H3G A;  4GRK A;  5DEX A;  3QUJ A;  4EDP A;  2AIX A;  1B3E A;  2AL4 A;  5IKB A;  3H03 A;  4NE4 A;  1PB9 A;  4NMY A;  3WAE A;  1US4 A;  1NNF A;  3IB1 A;  1JEV A;  1S7Y A;  2FA7 A;  3VVE A;  2W7Y A;  4G68 C;  3ZSF A;  4F3P A;  1NMU A;  4QHQ A;  3IOR A;  2H98 A;  4MFI A;  1AIV A;  2HZL A;  5ITP A;  5I2K A;  1SD3 A;  4IO7 A;  1B5H A;  1FTO A;  4ISU A;  4PFW A;  1RYO A;  4R9F A;  3CIJ A;  2NOO A;  5TPA A;  2ALU A;  3QSL A;  5ELV A;  4DXC A;  3T96 B;  5JTY B;  1VR5 A;  1NL5 A;  2DYX A;  1IIW A;  4ZEI A;  5ITO A;  1B1H A;  1FQA A;  1HSE A;  2YJP A;  4RPO A;  3TEL A;  4AB6 A;  4Z7E A;  4XTC Q;  5I59 A;  3S9E A;  2RC8 A;  3D4C A;  2OBG A;  1B4H A;  1POY 1;  2F36 A;  3RQT A;  3H6T A;  1A8E A;  1MH4 A;  1IXG A;  1WVJ A;  4OQO A;  3N6U A;  2XXW A;  2H99 A;  3BKI B;  3PUY E;  3OXN A;  3FVN A;  1B58 A;  5FTH A;  4N13 A;  3O6I A;  5HBC A;  1T0K A;  2F8D A;  1OMP A;  2Q2C A;  1DPP A;  2DP8 A;  3IB2 A;  3IOV A;  4GXA A;  4OFL A;  4RNS A;  4UA8 A;  4JBZ A;  1B3L A;  3IAZ A;  2HXW A;  1R9L A;  5TP9 B;  1Y20 A;  3MAM A;  3Q27 A;  1VFD A;  4O3A A;  1HSJ A;  4POW A;  2V3Q A;  1Y4T A;  3E13 X;  1WOD A;  3K1M A;  4KR5 A;  4PP0 A;  1XS5 A;  2HEU A;  2XXX A;  3OO6 A;  4TLL B;  4YU0 A;  1UTH A;  1SW2 A;  1YAE A;  5F7V A;  2V3U A;  2Z23 A;  2Y7P A;  4QFN A;  4N6P A;  3CR9 A;  4WKM A;  2V25 A;  1MPD A;  1XT8 A;  4LZ8 A;  4ZZA A;  2XD2 A;  4X1D A;  1P1O A;  4PFU A;  3S4U A;  4G4P A;  4EQ9 A;  5I58 A;  5KZT A;  3VV5 A;  1BIY A;  3LSL A;  3JV9 A;  3TAJ A;  3G3I A;  3M3L A;  2Z8E A;  3U8Q A;  5KDT B;  1GGG A;  3IJX B;  4LON B;  3SEU A;  4TQU Q;  4OFO A;  3S9N C;  3KFM A;  2DWJ A;  1LBC A;  3TTK A;  1JET A;  4ZE8 A;  5I59 B;  1LAH E;  3V8X B;  2THI A;  3F11 A;  3UGW A;  3OEN A;  3KJT A;  1S50 A;  2A5T B;  3CFL A;  3HCQ A;  1LFH A;  3DM0 A;  1URS A;  2XHD A;  3KN7 A;  4POX A;  3SDF A;  3VVF A;  5DVI A;  1SDX A;  3FAT A;  4R74 A;  2RC7 A;  2HCA A;  2OWS A;  1DOT A;  1LLS A;  2H4I A;  5EHM A;  1RYX A;  1PC3 A;  3T9H B;  1MXU A;  3TPA A;  3CVG A;  1MQI A;  2B65 A;  3G7W A;  1BKA A;  1QUK A;  3N5L A;  1WDN A;  3K0V A;  4ZEF A;  2FNC A;  1TT1 A;  4GFR A;  1MY1 A;  1XC1 A;  2HZK A;  1MXY A;  1GVC A;  2QSX A;  3KSJ A;  4YAH X;  5H8F A;  4DIG A;  2F34 A;  3UK4 A;  2DSF A;  3KGC A;  4GOT A;  4YIC A;  4H5F A;  1MQG A;  4XKN A;  1MXX A;  4X48 A;  4ND9 A;  4NF8 B;  1D4N A;  4H1X A;  4U2R A;  2YPN A;  2P2A A;  1M5B A;  1XVY A;  2ONS A;  3BBR A;  5TP9 A;  2GFE A;  3GLB A;  3O6G A;  1BLF A;  4OER A;  2ZXT A;  4N07 A;  4NF5 A;  3FAS A;  4ZEB A;  3HO7 A;  1QUJ A;  4QSD A;  1B05 A;  3GXA A;  5CBR A;  3EN3 A;  3PV0 E;  1B52 A;  2NXO A;  1CB6 A;  2NWJ A;  1VE4 A;  2NUV A;  3KBR A;  3N94 A;  1P99 A;  5BUU A;  1Y1M A;  5H8F B;  3IK6 B;  4I9D A;  4G8M A;  3EHT A;  3R26 A;  1EZP A;  1NH8 A;  3O6H A;  3EQ1 A;  3Q26 A;  1EZ9 A;  4KD5 A;  2Q9T A;  1MDP 1;  4OZ9 A;  4QFP A;  4ZEK A;  3FZV A;  2A5T A;  2DOJ A;  4ONY A;  1N04 A;  2DVC A;  5B7D A;  5AA4 A;  3MWB A;  2E0S A;  3EHU A;  1OQG A;  3MC2 A;  3I5O A;  4FE8 A;  1VSO A;  3T9V A;  4AQ4 A;  4YZZ A;  3ODB A;  1LB9 A;  4LA9 A;  4KQP A;  2VGQ A;  5EYF A;  2X26 A;  5I2N B;  5H8H B;  3S9L C;  1ELJ A;  2B3F A;  1JW4 A;  1Y4C A;  1UIV A;  3MVY A;  1A54 A;  1MPC A;  4JWO A;  3R6U A;  4RK2 A;  2XX9 A;  1IIT A;  4YB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...