1FQEA

Crystal structures of mutant (k206a) that abolish the dilysine interaction in the n-lobe of human transferrin
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVAHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords SEROTRANSFERRIN
publication title Crystal structures and iron release properties of mutants (K206A and K296A) that abolish the dilysine interaction in the N-lobe of human transferrin.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2000-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1fqeA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1fqeA02
4IO3A 3E4RA 3TTRA 3ODBA 3H6UA 2FYIA 1SQYA 3U92A 3GBBA 2O84X 5EYFA 3MP8A 1MQIA 3FASA 4ELPA 4H8IA 1MPDA 1A99A 3M3LA 2REGA 1MS7A 5FTIA 4I62A 1AOVA 4PE5B 1GR2A 4X1BA 1SI1A 4G8HA 2I0CA 4GXSB 4R9FA 1IZ1A 2G93A 4ZS9A 1S9TA 4EDPA 1N84A 4YICA 1GGGA 1N3WA 4ISUA 4FATA 4WEDA 4IO2A 1FW0A 4KYDA 1FQBA 2OK2A 3C34A 1DPEA 3TEPA 5CMCA 4LATA 4RXLA 2DS9A 3UP9A 1OVTA 4MBPA 1NNPA 1R9LA 2R71A 3B7DA 2O68A 3LSWA 2RF1A 1O63A 2XHDA 3BKIB 3VVEA 2XX7A 3PPNA 2B3FA 3DM0A 4R6HA 4GRKA 3TAJA 2XXTA 1ZBMA 3UGWA 4ELOA 1CE2A 1Y1MA 2NXOA 3C33A 3UN6A 3RN8A 4M4GA 3RTFB 4FAJA 4GWOA 2H5YA 4HS7A 3OSRA 2H9BA 1N04A 5B70A 2Z8DA 4JBZA 3MZBA 5ELVA 4YMAA 3N6TA 2D21A 3SESA 3MPKA 3IOUA 5H8HB 5I84A 4O3BA 4RPOA 1DTZA 3FV1A 4P11A 2PYYA 3N26A 4YB6A 3VFJA 3D4CA 2O1MA 3UA8A 2ZYNA 1LB8A 1Y1ZA 3CVGA 1MY1A 3C31A 3HHFA 3TTMA 4GD5A 3VXCA 1MM6A 4HCYA 5KCJB 1FTLA 2O69A 5DTBA 4RPNA 3RPWA 3G3FA 1JQFA 2ZNUA 2DWIA 3TCHA 3SEYA 4LONB 3Q25A 3EHSA 3L6GA 3FVOA 5I59B 1LFGA 4JDFA 3SEUA 3PMXA 3SKPA 2F7BA 3N6UA 1VSOA 3T66A 1H76A 5H8HA 2DE3A 1MRPA 4EF2A 4F1UA 3VVDA 1B4ZA 3TFLA 4FEBA 4Q8RA 4ZEKA 3TELA 2VP1A 1B9JA 3FUZA 3QXMA 5CBRA 3HO7A 3EPEA 1XOCA 1XVXA 3RT8A 2P1SA 1AIVA 1QUIA 1DPPA 2PMSA 4JWYA 3GLBA 5KCJA 5HBCA 4X48A 3VLVA 5I56B 2IA4A 3OENA 2P2AA 2OJTA 2QL3A 5CI5A 4IO6A 3TZAA 3K1NA 3OEMA 5I59A 4JXIA 1YAEA 4JSOA 3FD3A 2F7AA 1N3XA 3WAFA 4OFJA 4U4XA 2I4BA 4UACA 3FZVA 3MP6A 4E0WA 2R9JA 5I2KB 4F3GA 5J1DA 3PGFA 4IO5A 3KFMA 3CG3A 3IORA 4F3SA 1VE4A 4GIZA 3FXQA 3QSLA 1IXGA 1A8EA 1B1HA 1GVCA 5I56A 1ZKBA 4EF1A 1B40A 3GBAA 3KSXA 2ZXTA 1OMPA 3KN8A 1P1UA 4Z7EA 4YMBA 5CBSA 1B6HA 3IJXB 4LUBA 1JNFA 2A5TA 1B58A 1POTA 1LLSA 3RTWB 1MH4A 3PD9A 3KN7A 4HTGA 1II5A 5I2KA 1JVYA 2H25A 5ITPA 2F8DA 2GHBA 3ECRA 1LBBA 4KQPA 1Q1KA 5H8FB 2I49A 4OENA 1MXYA 2VD2A 2DWHA 4GXAA 3A3UA 1B0LA 2I58A 1SD3A 1ZTYA 1QULA 4POXA 4OZ9A 3DELB 1B52A 3OO7A 3QUJA 4JWXA 4U23A 2F34A 1P1OA 2LAOA 1N7XA 4H8JA 4OVJA 3K2DA 2I48A 4PFTA 1IXHA 5FTHA 5A5XB 4H67A 1MXWA 1D4NA 4OEVA 5KZTA 5DEXB 4KD5A 3SEVA 1PEBA 4OESA 4POWA 1LGBC 5HM4B 3OXNA 4G8MA 5H8FA 2V3UA 4U2RA 4LP2B 4GOTA 3VE1B 4AB6A 2YPNA 1MDQA 1MQJA 3EF7A 4U1ZA 3SEXA 4THIA 1LAHE 3U1OA 1B32A 2QRYA 3I3VA 1NKXA 1JW1A 2PBWA 3FJGA 1MQDA 1POY1 1FQEA 3HSTA 4C1UA 3T9VA 2QPQA 5A5XA 4ZEIA 3O29A 3JV9A 2UVGA 1B3HA 4DE8A 5JTYB 3O2AA 3W15C 4LQ5A 5DEXA 4EXLA 3FXUA 2HXWA 3H6VA 5K2YA 4H1XA 3MZ1A 4F2OA 3PMWA 1PB7A 1TFAA 3V8XB 2DYXA 3TDJA 1B3FA 1PC3A 4F3BA 4NMYA 4GF8A 4JWOA 4NF5B 4F1YA 5HPQA 2W7YA 3A09A 1QW0A 3MP1A 4GVOA 1MXVA 3IJOB 3M3KA 4YKKA 1D9VA 1FTMA 4PFWA 4GQOA 4XIGQ 1JEVA 3A3CA 1MY4A 3RY3A 5JTYA 1SVXB 4ONYA 4RA1A 3F11A 4OTEA 1IQ7A 3IX1A 4TLLB 2H4IA 2E0SA 4KCDA 1ATGA 2XXHA 2O7IA 3R7XA 3K00A 1YTVA 2XXPA 1B2HA 3LR1A 1H3DA 3O28A 3FJ7A 4I9DA 4NF5A 4H6DA 3O6HA 3MWBA 4P0IA 4R74A 2HQ0A 2B3BA 1S50A 2ZYKA 2H99A 1LCTA 3VLWA 4NF8B 1LAGE 4ZEDA 4U22A 4ELQA 3CSBA 5M2VA 3O6GA 4EXKA 4ZEBA 3TQLA 5EHSA 2PX1A 1B7HA 3T22A 2X7PA 4UA8A 1MPBA 2HZLA 3USDA 4GL8A 2HAUA 1NFTA 2F6PA 3HCQA 4OFLA 4FIMA 2NOOA 3OO6A 2RCAA 4PFYA 4TOZA 3TCGA 1Y9UA 1P1QA 4G68C 1D9YA 1GV8A 3PPQA 5K2XA 1ZU0A 1SW4A 2HZKA 4MFIA 1B3EA 2NUVA 4OWDA 2DWJA 4EQ7A 3U94A 4IO7A 4QFNA 2OWSA 4OHNA 4NF8A 1JVXA 4N13A 3GXAA 1RYOA 1BP5A 5H8NB 3CSGA 1Z7NE 1MQGA 1LAXA 4F29A 1QKAA 1URDA 1DMBA 2ONSA 3VV5A 3LSLA 4KYSA 3TTLA 1Y3PA 2UVJA 2ZNSA 2QSXA 2UYEA 5AE4A 1SW5A 4OMBA 4LA9A 5ITOA 3S9EA 4G68B 4DXUA 1IUDA 3K4UA 4DLDA 1RYXA 4QFOA 2Z23A 3S9MC 1US4A 4DDDA 3G3GA 1F9BA 3HHGA 3PMVA 3LSXA 2GFEA 2GH9A 5TP9B 3U8QA 3DLNA 3IR1A 2F78A 2VHAA 1B7ZA 1NH7A 3MZ9A 1GTKA 1Y20A 3K02A 5H8NA 3K6VA 3OMBA 3PUYE 4QHQA 4RK2A 4NF4B 4OFOA 1URGA 1R1NA 1A54A 1AH5A 5I57B 3E13X 3KZGA 3B6WA 2V3QA 4X1DA 3E3KA 4YZZA 4H5FA 3O97A 2I3VA 3K1MA 3OD7A 1DSNA 3LBSA 1Y3QA 3CFZA 3V83A 4XTCQ 1PBQA 3QK6A 4G68A 1I6BA 3FIRA 4HW8A 2Q88A 4F2QA 4WEPA 1M5FA 3PD8A 4AB5A 2R6GE 4XKPA 3MVZA 3TQWA 1BLFA 2ALUA 2DP8A 4K3FA 1M5CA 3T9XB 4QFLA 5TP9A 4Z0IA 4F3PA 2DXYA 3RLFE 2RKMA 5AA2D 5ICTA 4NF4A 4C1TA 2A5SA 4ZE8A 4BDMA 2ANJA 5I57A 1OVBA 3HPIA 1LSTA 2Q2CA 1TWYA 4XXUA 5L9MA 4RNSA 2XXRA 3RUMA 1P1NA 4BDLA 3MAMA 3FV2A 1IXIA 4U1OA 1HSLA 3CI8A 2O1LA 3ZS6A 1UQWA 3G3IA 2A5TB 3WAEA 3FVKA 1T0KA 4FE8A 4FECA 1B3GA 2Z8EA 3Q28A 3DP6A 2HCAA 4OYVA 4IY6A 3Q26A 3GZGA 2I3WA 3C36A 4F18A 1NNFA 2XXXA 3PUWE 1MM7A 1XVYA 4E0XA 5I58B 1CB6A 3TTNA 1EH3A 5F7VA 4EQ9A 4NF6B 1OQGA 4AQ4A 3MC2A 3PUVE 3FXRA 5H8SA 3VVFA 3O6IA 1NMUA 3LC8A 1MDP1 1IXCA 2D5WA 1DOTA 4QFKA 1NNTA 1R6ZA 3S2VA 4LZ7A 1NNKA 1UIUA 3OEKA 1B5HA 3SERA 2XXQA 3G3JA 1FCKA 2UVIA 5CMMA 2CZLA 5DVJA 1ZLQA 5KDTB 3VLUA 2FA7A 4X9TA 3IOTA 4KI0E 4YB7A 3P7IA 2VOZA 3RQTA 2F36A 2GRVA 1FQFA 5I58A 4IB2A 2ONKE 3K1PA 4H5GA 4NF6A 5DYHA 1US5A 3V89B 4U21A 4ZEFA 1I6QA 4L17A 1N76A 1FQAA 4ESXA 1P99A 4Q0CA 2G29A 3FGSA 4NWDA 1H45A 3Q29A 2P0SA 3IOWA 1I69A 3K01A 4FEDA 1BTJA 2XXIA 5CC2A 4NWCA 4R2FA 1MH3A 4RJZA 5KDTA 3CG1A 4YKPA 5I2NB 3FVGA 3W9VA 1VFDA 4NE4A 2AL4A 2Z8FA 3W9WA 4G2ZA 2Q8JA 1TXFA 3PPOA 4OETA 1WDNA 1AMFA 1A55A 1MXZA 4F1VA 2D3IA 1M5EA 1FQCA 2E1SA 2Y7WA 2GHAA 3TODA 1IEJA 4U4SA 4RYAA 3CRBA 2Q9TA 3K6UA 2QJEA 3OELA 4R2BA 1JEUA 4O3CA 5TU0A 4R75A 2Y7PA 1N0TA 4OQOA 5I2NA 2UVHA 4TQUQ 1XT8A 4WXJA 1B5JA 2XD2A 3IB1A 1BKAA 4NTLA 1SDXA 4BDQA 2VD3A 4BLAA 1HSEA 3RGYA 2V84A 2FNCA 2XX9A 1XHYA 3HV1A 3T93B 1OLCA 2I4CA 3TPAA 3UORA 3ZSFA 4KR5A 4YKIA 3IAZA 3S9NC 3KJTA 2XX8A 1SBPA 3SDFA 3G3HA 2OCUA 2Z22A 5L9OA 3Q27A 5CMKA 1WVJA 3H06B 5FHOA 2XXYA 1D3KA 5CMBA 3TTKA 5BUUA 3D4GA 4Q30B 4H65A 3V5AA 1B46A 3PPRA 4QSEA 3MVWA 3FJMA 5BWJA 3EHUA 3H4ZA 4R6KA 1JETA 2QS3A 2ONRA 4LZ8A 4ZZAA 3HN0A 3RT6B 5CRYA 1R9QA 4DZ1A 2F5XA 2F97A 3PUZE 1UTHB 4GLIA 3TMGA 1MG1A 2RC7A 2OLBA 2DXRA 4PETA 1UTBB 1QVSA 1FTJA 4IGTA 4WKMA 1QJMA 4DIGA 1PDAA 3S4UA 2DVCA 4MLVA 2Y7KA 1B7UA 5B7DA 3PPPA 4F31B 4NEDA 5TPAB 1OLAA 4LQ2A 1MY3A 3CIJA 1PBPA 3IB2A 4EQBA 4N6PA 2Q89A 5JK4A 2DOJA 3ILUB 3TKDA 2IEEA 2HFBA 1UIVA 1LFIA 2X26A 3CR9A 2ESNA 3MQ9A 3BFUA 4IGRA 4G4PA 1UTHA 1J1NA 2DVZA 1LAFE 1L5TA 4PP0A 5AA2B 1UTBA 3G7WA 2RINA 3K6WA 3IL1B 1HSJA 2DSFA 3I5OA 3IB0A 1PB9A 1O7TA 4YKJA 1BIYA 2OZZA 3ONMA 1RKMA 3K6XA 4FORA 5TPAA 1B3LA 5DVIA 3MBPA 3MVYA 3MJNA 2BJJX 2Y7RA 5FHMA 4DCXA 4BDNA 2DE4A 1AL3A 1XC1A 4I8CA 3H6WA 3C32A 4P0GA 4QF9A 3TCFA 2REJA 3ZKKA 1A7LA 2THIA 5L9SA 1M5DA 2YLNA 2DWAA 3U72A 2QMXA 2I0BA 3AXFA 4JSDA 4KPTA 3TUSA 5AA2A 2DE2A 1B05A 1SYHA 1MY2A 1A40A 1B51A 3LUYA 5AA4B 2AL5A 3CFXA 3PUXE 1Y4CA 3R6UA 1MY0A 3KJ7A 4OXVA 5CM6A 2ZYMA 4H0WA 2AIXA 1OIBA 1Q35A 4ESWA 3BFTA 4ZZEA 3H03A 5EHMA 1MPCA 4G8NA 3QYTA 1I6AA 4ECFA 4QSDA 1A8FA 3U93A 3SEWA 3THIA 4KYEA 3B6QA 3EN3A 1QKBA 3FATA 4GL0A 2O51A 3K0VA 4F22A 3IOVA 1LB9A 2X7QA 4OERA 1DTGA 4IO4A 3C35A 3L6HA 3MVXA 1S7YA 4R73A 3DP8A 3QIMA 5AA4A 4PQJA 4YB5A 1ZMGA 1JW4A 1FTOA 2OWTA 2RC8A 2Q2AA 2H98A 2VGQA 3OSQA 5FHNA 2F7CA 1IIWA 3QAXA 1VFEA 4XKRA 3T9HB 1WODA 4QSCA 1ELJA 4F39A 3MW0A 2HEUA 2UXAA 4KCCA 2DQVA 3T9UA 4Q5TA 1B4HA 4MF3A 1OQHA 1O64A 2O7UA 4I1DA 3KEIA 3KN3A 3KSJA 4ZDMA 2ABHA 3H6TA 5IAIA 3TYHA 1EU8A 2F35A 2AYSA 2XXVA 2PT1A 1LBCA 4HCWA 1M5BA 3H3GA 4EUOA 1EZPA 1MQHA 3EHTA 3SETA 1B5IA 3CFLA 1SI0A 4N07A 3IO4A 3BBRA 4R9GA 4QFPA 1QUKA 5IKBA 4GFRA 3UK4A 1YCJA 2V93A 3ILTB 3VXBA 2O6AA 3VDFA 3KBRA 2I6EA 2V3TA 1H43A 1NH8A 2RCBA 3LSFB 3UIFA 2RC9A 4LZ5A 4JB7A 1MXXA 1SW2A 4BDOA 1JW5A 4O3AA 2Y84A 3JZJA 3PU5A 3OO9A 3O9PA 3KOSA 3ZKLA 4OEUA 3N94A 1SYIA 1FQDA 1EZ9A 4YU0A 2V25A 2YJPA 3T96B 3B6TA 1MXUA 3OO8A 4KFQA 1EZOA 4XKNA 3IK6B 1ZIUA 2XXUA 1KWHA 5L8DA 3JYRA 2ZMBA 2CMOA 4XKQA 4C0RA 1TT1A 1ANFA 5DVFA 2M8CA 3C4MA 4M1VA 1IITA 2PVUA 2Y7IA 1Y4TA 3OOAA 5AA3A 3DP4A 2NWJA 3S9LC 1SW1A 5DT6A 1B1XA 1Y3NA 4MLQA 1TFDA 2QS4A 5AA1A 4LVQA 5F1QA 3FVNA 2QS1A 4KHZE 4BDRA 1N7WA 4ELRA 4ND9A 4IY5A 4PFUA 3H7MA 1XS5A 3KOTA 1VR5A 1B0HA 2B65A 4RK9A 5H8QB 4ZE9A 5ICQA 4MH5A 1Z7ME 4DXCA 4YAHX 2XXWA 1FTKA 1PB8A 3EQ1A 1LFHA 2NVUB 4R72A 3MUQA 3M8UA 3I6VA 1P1WA 3RNNA 3G3KA 2XD3A 5LOMA 3C9HA 5ISUA 3N5LA 3R26A 2WKYA 1H44A 4ZECA 3PV0E 4RY1A 1QUJA 2ZNTA 2ZYOA 2F6GA 4QRZA 1YPNA 4G77A 1USYE 4TLMB 2KLFA 3QUFA 2HAVA 2PT2A 1LCFA 2QMWA 3MPLA 5H8QA 2QS2A 1NL5A 4DCYA 1ZJLA 5JEIA 3O66A 4DXBA 2OBGA 1URSA 3E9XA 3KG2A 3IO6A 3M3FA 1USYH 2UYFA 4F19A 4FJPA 3KGCA 4R6YA
chains in the Genus database with same CATH superfamily
4IO3A 3E4RA 3TTRA 3ODBA 3H6UA 2FYIA 1SQYA 3U92A 4PBHA 3GBBA 2O84X 5EYFA 4OVTA 1Q9DA 3MP8A 4PDDA 1MQIA 3FASA 1FSAA 4ELPA 4H8IA 2VT5A 1MPDA 1A99A 4GX3A 3M3LA 2REGA 1MS7A 5FTIA 4I62A 1AOVA 4PE5B 1GR2A 3RPLB 4X1BA 1SI1A 4G8HA 2I0CA 4GXSB 4P3LA 4R9FA 5FBPA 1IZ1A 2G93A 4ZS9A 1S9TA 4EDPA 1N84A 2CZHA 4YICA 1GGGA 1N3WA 1D9QA 4ISUA 4FATA 4WEDA 2GQ1A 4IO2A 2ZZVA 4GWSA 1FBCA 1FW0A 4KYDA 1LEVA 4GX6A 1FQBA 2OK2A 3C34A 1DPEA 4PF8A 3TEPA 1FPBA 5CMCA 4LATA 4RXLA 2DS9A 3UP9A 3ISPA 1OVTA 4MBPA 1NNPA 3RPLA 1R9LA 2R71A 4NX1A 3B7DA 2O68A 3LSWA 2RF1A 1O63A 2XHDA 3BKIB 3VVEA 2XX7A 3PPNA 5ESYA 2B3FA 3DM0A 4R6HA 4GRKA 3TAJA 2XXTA 1ZBMA 3UGWA 4ELOA 4PAFA 1CE2A 1Y1MA 5IM2A 2NXOA 3C33A 3UN6A 4PFBA 3RN8A 5I7IA 4M4GA 3RTFB 4FAJA 1INPA 4GWOA 2H5YA 4HS7A 3OSRA 2H9BA 1N04A 5B70A 2CZIA 5EQ8A 2Z8DA 4JBZA 4PAIA 3MZBA 2B4LA 5ELVA 4YMAA 4XFEA 3N6TA 2D21A 3SESA 3MPKA 3IOUA 5H8HB 4HXVA 5I84A 4O3BA 4RPOA 1DTZA 3FV1A 4P11A 2PYYA 3N26A 4YB6A 3VFJA 4N91A 4MIJA 3D4CA 2O1MA 3UA8A 2ZYNA 1LB8A 1Y1ZA 3CVGA 1MY1A 3C31A 3HHFA 1NV7A 5J16A 3TTMA 4GD5A 3VXCA 1MM6A 4HCYA 4NAPA 1LBVA 5KCJB 4P1LA 1FTLA 2O69A 5DTBA 4RPNA 3RPWA 3G3FA 1JQFA 2ZNUA 2DWIA 3TCHA 3SEYA 4LONB 3Q25A 3EHSA 3L6GA 3FVOA 5I59B 1LFGA 4JDFA 3SEUA 3PMXA 2FBPA 3SKPA 2F7BA 3N6UA 1VSOA 3T66A 1H76A 2QVVA 5H8HA 2DE3A 1MRPA 1SPIA 1FBHA 4EF2A 4F1UA 4N15A 3VVDA 1B4ZA 3TFLA 4FEBA 4Q8RA 4ZEKA 3TELA 2VP1A 4N6DA 1B9JA 3FUZA 3QXMA 5CBRA 3HO7A 1FPIA 1BK4A 3EPEA 1XOCA 1XVXA 3RT8A 2P1SA 1AIVA 1QUIA 2WBBA 1DPPA 2PMSA 4JWYA 3GLBA 5KCJA 5HBCA 4X48A 3VLVA 5I56B 2IA4A 3OENA 2P2AA 2OJTA 2QL3A 5CI5A 4IO6A 3TZAA 3K1NA 4P9KA 3OEMA 5I59A 4JXIA 1YAEA 4JSOA 3FD3A 2F7AA 1N3XA 3WAFA 4OFJA 4U4XA 2I4BA 4GWWA 4UACA 3FZVA 3MP6A 4E0WA 2R9JA 5I2KB 4F3GA 5J1DA 3PGFA 4IO5A 3KFMA 3CG3A 3IORA 4F3SA 1VE4A 4GIZA 3FXQA 3QSLA 1IXGA 3U65A 1A8EA 2XWVA 2WYKA 1B1HA 1GVCA 4OVRA 5I56A 1ZKBA 4EF1A 4OVSA 1B40A 3GBAA 3KSXA 2ZXTA 1OMPA 3KN8A 1P1UA 4Z7EA 4YMBA 1FBPA 5CBSA 1B6HA 3IJXB 4LUBA 1JNFA 2A5TA 1B58A 1POTA 1LLSA 3RTWB 1MH4A 3PD9A 3KN7A 3E78A 4GWZA 4HTGA 1II5A 5I2KA 1JVYA 4N81A 2H25A 5ITPA 2F8DA 2GHBA 3ECRA 1LBBA 4KQPA 2FHYA 1Q1KA 5H8FB 3BIGA 2I49A 4OENA 1MXYA 2VD2A 5ET6A 2DWHA 4GXAA 3A3UA 1B0LA 2I58A 4MX6A 1SD3A 1ZTYA 1QULA 3D1RA 4POXA 4OZ9A 3BIHA 3DELB 1B52A 3OO7A 3QUJA 4JWXA 4U23A 2F34A 1P1OA 2LAOA 1N7XA 4H8JA 4OVJA 3K2DA 2I48A 1IMFA 4PFTA 1IXHA 5FTHA 5A5XB 4H67A 1MXWA 1D4NA 4OEVA 1NV6A 5KZTA 5DEXB 4KD5A 3SEVA 1PEBA 4OESA 4POWA 1LGBC 5HM4B 3OXNA 4G8MA 4JVIA 5H8FA 4KXPA 2V3UA 4U2RA 4LP2B 4GOTA 3VE1B 4AB6A 2YPNA 1MDQA 1MQJA 3EF7A 4U1ZA 3SEXA 4THIA 1LAHE 3U1OA 1B32A 2BJIA 2QRYA 3I3VA 4PGPA 4UABA 1NKXA 1JW1A 1LBWA 2PBWA 3FJGA 1MQDA 1POY1 1FQEA 3HSTA 4MMPA 4C1UA 3T9VA 2QPQA 1RDXA 5A5XA 4GWXA 4NGUA 4ZEIA 3O29A 3JV9A 1NV2A 2UVGA 1B3HA 4FBPA 4DE8A 4NQ8A 5JTYB 3O2AA 3W15C 4LQ5A 5DEXA 4EXLA 3FXUA 2HXWA 3H6VA 5K2YA 3B50A 4H1XA 3MZ1A 4F2OA 3PMWA 4JVDA 1PB7A 1TFAA 3V8XB 2DYXA 3TDJA 1B3FA 1PC3A 4F3BA 4NMYA 1RDYA 1K9YA 3KC0A 4GF8A 2XXKA 4JWOA 4NF5B 4F1YA 5HPQA 2W7YA 3A09A 1QW0A 3MP1A 4GVOA 1MXVA 3IJOB 3M3KA 4YKKA 1D9VA 1FTMA 4PFWA 4GQOA 4XIGQ 4HE2A 1JEVA 3A3CA 1MY4A 3RY3A 5JTYA 1SVXB 4ONYA 4RA1A 3F11A 1YZ0A 4OTEA 1IQ7A 3IX1A 4TLLB 3MYUA 2H4IA 2E0SA 4KCDA 1ATGA 2XXHA 2O7IA 3R7XA 3K00A 1YTVA 2XXPA 1B2HA 3LR1A 1H3DA 3O28A 3FJ7A 4I9DA 4NF5A 4H6DA 3O6HA 3MWBA 4P0IA 4R74A 4O94A 2HQ0A 2B3BA 1S50A 1G0IA 2ZYKA 2H99A 1LCTA 3VLWA 4NF8B 3RYDA 1LAGE 4ZEDA 4U22A 4ELQA 3CSBA 5M2VA 3O6GA 4EXKA 4ZEBA 3TQLA 5EHSA 2PX1A 4NHBA 1B7HA 3T22A 2ZZXA 1FPEA 2X7PA 2OWZA 4UA8A 1MPBA 2HZLA 3USDA 3PTYA 4GL8A 2HAUA 1NFTA 1NV1A 2F6PA 3HCQA 4OFLA 4IR8A 4FIMA 1KA0A 1XI6A 2NOOA 3OO6A 2RCAA 1FRPA 4PFYA 4TOZA 3TCGA 1Y9UA 4GWYA 1P1QA 4G68C 1D9YA 1GV8A 3PPQA 5K2XA 1ZU0A 1SW4A 2HZKA 2OX3A 4MFIA 1B3EA 5EQAA 3SZPA 2NUVA 4OWDA 2DWJA 4EQ7A 3U94A 4IO7A 4QFNA 2OWSA 4OHNA 4NF8A 1JVXA 1FPGA 4N13A 2CEYA 3GXAA 1RYOA 1BP5A 5H8NB 1FPDA 3CSGA 1Z7NE 1MQGA 4NN3A 1LAXA 5EQ9A 4F29A 1G0HA 2P3VA 1QKAA 1URDA 1JP4A 1DMBA 2ONSA 3VV5A 3LSLA 4KYSA 3TTLA 1Y3PA 2UVJA 1FTAA 2ZNSA 2QSXA 2UYEA 5AE4A 1SW5A 4OMBA 4LA9A 5ITOA 3S9EA 4G68B 4DI3D 4DXUA 1IUDA 3K4UA 4DLDA 1RYXA 4QFOA 2Z23A 3S9MC 1US4A 4DDDA 3G3GA 1F9BA 1FPLA 3HHGA 2FVZA 3PMVA 2CEXA 3LSXA 2GFEA 2GH9A 5TP9B 3DLNA 3IR1A 3U8QA 2F78A 2VHAA 1B7ZA 1NH7A 3MZ9A 1GTKA 4NF0A 1Y20A 3K02A 5IGAA 5H8NA 3K6VA 3OMBA 3PUYE 4QHQA 2L5VA 4RK2A 2WBDA 4NF4B 3QMFA 1NV3A 1EYJA 4OFOA 1URGA 5ET8A 1R1NA 1A54A 1AH5A 5I57B 3E13X 3KZGA 3B6WA 2V3QA 2P3NA 4I40A 4X1DA 3E3KA 4YZZA 4H5FA 3O97A 2I3VA 3K1MA 3OD7A 1DSNA 4XF5A 3LBSA 1Y3QA 3CFZA 3V83A 4XTCQ 1PBQA 3QK6A 4G68A 1I6BA 3FIRA 4HW8A 2Q88A 4F2QA 4WEPA 1M5FA 4GBWA 3PD8A 4AB5A 2R6GE 2QFLA 3MVZA 4XKPA 3TQWA 1BLFA 2ALUA 2DP8A 4K3FA 1M5CA 1DCUA 3T9XB 4QFLA 5TP9A 1NUWA 4Z0IA 4F3PA 2DXYA 3RLFE 2RKMA 5AA2D 5ICTA 4PTKA 1FBGA 4NF4A 4C1TA 2QVUA 2A5SA 4ZE8A 4BDMA 2ANJA 5I57A 1OVBA 3HPIA 1LSTA 2Q2CA 1TWYA 4XXUA 5L9MA 4HE1A 4JVCA 4RNSA 2XXRA 3RUMA 1P1NA 5IZ1A 4BDLA 3MAMA 3FV2A 1IXIA 4U1OA 1HSLA 3CI8A 1FBEA 3MSTA 2O1LA 3ZS6A 1NUZA 1UQWA 3GYYA 3G3IA 2A5TB 3WAEA 3FVKA 1T0KA 4FE8A 4FECA 5EYHA 1B3GA 2Z8EA 3Q28A 1IMCA 3DP6A 2HCAA 4OYVA 4IY6A 3Q26A 3GZGA 2I3WA 3C36A 4F18A 1NNFA 4GBVA 2XXXA 3PUWE 1MM7A 1XVYA 4MJOA 4E0XA 5I58B 1CB6A 3TTNA 1EH3A 5F7VA 4EQ9A 4NF6B 1OQGA 2F3BA 4AQ4A 3MC2A 3PUVE 3FXRA 5H8SA 3VVFA 3O6IA 1NMUA 3LC8A 1MDP1 1IXCA 3E79A 2D5WA 1DOTA 4QFKA 1NNTA 4PDHA 1R6ZA 4MNIA 3S2VA 4O7MA 3HFUA 4LZ7A 2KR0A 1NNKA 1UIUA 3OEKA 1IMEA 1B5HA 3SERA 2XXQA 3G3JA 1FCKA 4PBQA 2UVIA 2V4CA 5CMMA 2CZLA 5DVJA 1ZLQA 4MEVA 2Q74A 5KDTB 3VLUA 2FA7A 4X9TA 4PFIA 3IOTA 4KI0E 4YB7A 3P7IA 2VOZA 3RQTA 2F36A 2GRVA 1FQFA 5I58A 4IB2A 4PGNA 2ONKE 3K1PA 4H5GA 4NF6A 5DYHA 5I5PA 1US5A 3V89B 4X8RA 4U21A 4ZEFA 1I6QA 4L17A 1N76A 1FQAA 4ESXA 1P99A 4OVQA 4Q0CA 2G29A 3FGSA 2FIXA 4NWDA 1H45A 3Q29A 2P0SA 3IOWA 1I69A 3K01A 4FEDA 1BTJA 2XXIA 5CC2A 4NWCA 4R2FA 1MH3A 4RJZA 4H46A 5KDTA 3CG1A 4YKPA 5I2NB 4PAKA 3FVGA 3W9VA 1VFDA 1FBFA 4I3EA 4NE4A 2AL4A 2Z8FA 1AWBA 3W9WA 4QXDA 4MCOA 4G2ZA 2Q8JA 2PFYA 1TXFA 3PPOA 4OETA 1WDNA 1AMFA 1A55A 1MXZA 4F1VA 2D3IA 1M5EA 1FQCA 2E1SA 2Y7WA 5ET7A 1FJ6A 2GHAA 3TODA 1IEJA 4U4SA 4RYAA 3CRBA 4HE0A 4XEQA 2Q9TA 3K6UA 2QJEA 3OELA 4R2BA 1JEUA 4O3CA 5IZ3A 5TU0A 4R75A 2Y7PA 1N0TA 1NI9A 4OQOA 5I2NA 4PC9A 2UVHA 4TQUQ 1XT8A 4WXJA 1B5JA 2XD2A 3IB1A 1IMAA 1BKAA 2MKZA 4NTLA 1SDXA 2WYPA 4BDQA 2VD3A 4BLAA 2HPGA 1HSEA 3RGYA 2V84A 4PF6A 2FNCA 2XX9A 1XHYA 3HV1A 1YYZA 3T93B 1OLCA 2I4CA 3TPAA 3UORA 3ZSFA 1VDWA 1FBDA 4KR5A 4YKIA 3IAZA 3S9NC 3KJTA 2XX8A 1SBPA 4N8YA 3SDFA 3G3HA 2OCUA 2Z22A 5L9OA 3Q27A 2XWIA 5CMKA 1WVJA 2VPNA 3H06B 5FHOA 2XXYA 1D3KA 5CMBA 3TTKA 5BUUA 3D4GA 4Q30B 4H65A 3V5AA 2WEFA 1B46A 3PPRA 4QSEA 1NUXA 3MVWA 3FJMA 5BWJA 4P56A 4O7IA 3EHUA 3H4ZA 4R6KA 1JETA 5IZZA 2QS3A 2ONRA 1LBXA 4LZ8A 4ZZAA 3HN0A 3RT6B 5CRYA 3IFCA 1R9QA 4DZ1A 2F5XA 2F97A 3PUZE 1NV0A 1UTHB 4GLIA 3TMGA 1MG1A 2RC7A 2OLBA 2DXRA 1IMDA 4PETA 1UTBB 2KQZA 1QVSA 1FTJA 4IGTA 4WKMA 1QJMA 4DIGA 1PDAA 3S4UA 2DVCA 4MLVA 2Y7KA 1B7UA 5B7DA 3PPPA 4F31B 4NEDA 5TPAB 1OLAA 3LV0A 4LQ2A 4MNCA 1MY3A 3CIJA 1PBPA 3IB2A 4EQBA 4N6PA 2Q89A 5JK4A 2DOJA 3ILUB 3TKDA 2IEEA 2HFBA 1UIVA 1LFIA 5EYGA 2X26A 1NV4A 3CR9A 2ESNA 3MQ9A 3BFUA 4IGRA 2HXRA 4G4PA 1UTHA 1J1NA 2DVZA 1LAFE 4P47A 1L5TA 4PP0A 5AA2B 1UTBA 3G7WA 2RINA 3K6WA 3IL1B 1HSJA 2DSFA 3I5OA 3IB0A 1PB9A 1O7TA 4YKJA 1BIYA 4DI4B 2OZZA 3ONMA 2HHMA 1RKMA 3K6XA 4FORA 5TPAA 1B3LA 1FPJA 5DVIA 1LBYA 3MBPA 3MVYA 3KC1A 3MJNA 2BJJX 2Y7RA 5FHMA 2Y5KA 4DCXA 4BDNA 2DE4A 4OVPA 1AL3A 1XC1A 4I8CA 3H6WA 3C32A 4P0GA 4QF9A 3TCFA 2REJA 3ZKKA 1A7LA 2THIA 5L9SA 1M5DA 2YLNA 2DWAA 3U72A 2QMXA 2I0BA 2XWOA 4X04A 3AXFA 2WX9A 1EYKA 4JSDA 3KBZA 4KPTA 3TUSA 5AA2A 2DE2A 1B05A 2Y5LA 1SYHA 4AS4A 1MY2A 1A40A 5ET5A 1B51A 3LUYA 5AA4B 2AL5A 3CFXA 3PUXE 1Y4CA 3R6UA 1MY0A 3KJ7A 4OXVA 5CM6A 2ZYMA 4H0WA 1FPFA 2AIXA 1OIBA 1YXIA 1Q35A 1KA1A 4ESWA 3BFTA 2R8TA 4ZZEA 3H03A 5EHMA 1MPCA 4H45A 4G8NA 3QYTA 1I6AA 4ECFA 4QSDA 1FJ9A 1A8FA 3U93A 3SEWA 3LUZA 3THIA 4KYEA 3B6QA 3EN3A 1QKBA 3FATA 5T3JA 4I3YA 4N17A 1LBZA 4GL0A 5EQ7A 2O51A 3K0VA 4F22A 3IOVA 1LB9A 2X7QA 4MNPA 4OERA 1DTGA 4IO4A 3C35A 3L6HA 3MVXA 5LDZA 1S7YA 4R73A 4QBAA 1K9ZA 3DP8A 3QIMA 5A5LA 1EYIA 5AA4A 4PQJA 4YB5A 5DW8A 1ZMGA 1JW4A 2VPOA 1FTOA 2OWTA 4MAGA 2RC8A 2Q2AA 2H98A 2VGQA 3OSQA 4N6KA 3T0JA 5FHNA 2F7CA 2ZZWA 1QGXA 1IIWA 4LN5A 3QAXA 1VFEA 4XKRA 4NG7A 3T9HB 1WODA 4QSCA 1ELJA 1KZ8A 4G61A 2JJKA 4F39A 3MW0A 2HEUA 3EKIA 2UXAA 4KCCA 2DQVA 3T9UA 4Q5TA 1B4HA 4MF3A 1OQHA 1O64A 2O7UA 4I1DA 3KEIA 3KN3A 3KSJA 4ZDMA 4AS5A 5I3SA 4P1EA 2ABHA 4OA4A 3H6TA 5IAIA 3TYHA 1EU8A 2F35A 4PCDA 2AYSA 2XXVA 2PT1A 1LBCA 4HCWA 1M5BA 3H3GA 4EUOA 1EZPA 1MQHA 3EHTA 4PFRA 3SETA 1B5IA 3CFLA 1SI0A 4N07A 3IO4A 3A29A 1RDZA 3BBRA 4R9GA 4QFPA 1QUKA 5IKBA 2FIEA 4GFRA 3UK4A 1DBZA 1YCJA 2V93A 3ILTB 3VXBA 2O6AA 3VDFA 2DDKA 2I6EA 3KBRA 2V3TA 1H43A 1NH8A 2RCBA 3LSFB 3UIFA 2RC9A 4LZ5A 4JB7A 1MXXA 1SW2A 4BDOA 1JW5A 4O3AA 2Y84A 3JZJA 3PU5A 3OO9A 3O9PA 3KOSA 3ZKLA 4OEUA 3N94A 1SYIA 1FQDA 1EZ9A 4YU0A 2V25A 2YJPA 3T96B 3B6TA 4GWUA 1MXUA 3OO8A 4KFQA 1EZOA 5F24A 4XKNA 3IK6B 2CZKA 2XA5A 4P8BA 1ZIUA 2XXUA 1KWHA 5L8DA 3JYRA 2ZMBA 2CMOA 4XKQA 4C0RA 1TT1A 1ANFA 5DVFA 1CNQA 4N4UA 2M8CA 3C4MA 5IZ3B 4M1VA 1IITA 2Q8MA 2PVUA 3B8BA 2Y7IA 1Y4TA 3OOAA 3FBPA 5AA3A 2PCRA 3DP4A 2NWJA 3S9LC 1SW1A 4O8MA 5DT6A 1B1XA 1Y3NA 4MLQA 1TFDA 4OANA 2QS4A 5AA1A 4LVQA 5F1QA 3FVNA 1NUYA 2QS1A 4KHZE 4BDRA 1N7WA 1DK4A 3NOHA 4ELRA 4ND9A 2XWKA 4IY5A 4PFUA 3H7MA 1XS5A 3KOTA 1VR5A 1B0HA 2B65A 4RK9A 5H8QB 4ZE9A 5ICQA 4MH5A 1Z7ME 1IMBA 2QVRA 4DXCA 4YAHX 2XXWA 1FTKA 1PB8A 3EQ1A 2F3DA 1LFHA 2NVUB 4R72A 3MUQA 3M8UA 4GX4A 3I6VA 1P1WA 4N8GA 3RNNA 3FXBA 3ROJA 3G3KA 2XD3A 5LOMA 4PE3A 3C9HA 5ISUA 2B4MA 3N5LA 3R26A 5LTCA 2WKYA 1H44A 4ZECA 3PV0E 4RY1A 1QUJA 2ZNTA 2ZYOA 2F6GA 4QRZA 1YPNA 4G77A 3T1BA 1USYE 4TLMB 2KLFA 3QUFA 3IFAA 2HAVA 2PT2A 3CHGA 1LCFA 2QMWA 3MPLA 5H8QA 2QS2A 2PFZA 1NL5A 4DCYA 1ZJLA 5JEIA 3O66A 4DXBA 2OBGA 1FPKA 1URSA 4MHFA 3E9XA 3KG2A 1NV5A 3IO6A 3M3FA 1USYH 2UYFA 4F19A 4FJPA 3KGCA 4R6YA
chains in the Genus database with same CATH topology
4IO3A 3E4RA 3TTRA 3ODBA 3H6UA 2FYIA 1SQYA 3U92A 3GBBA 2O84X 5EYFA 3MP8A 1MQIA 3FASA 4ELPA 4H8IA 1MPDA 1A99A 3M3LA 2REGA 1MS7A 5FTIA 4I62A 1AOVA 4PE5B 1GR2A 4X1BA 1SI1A 4G8HA 2I0CA 4GXSB 4R9FA 1IZ1A 2G93A 4ZS9A 1S9TA 4EDPA 1N84A 4YICA 1GGGA 1N3WA 4ISUA 4FATA 4WEDA 4IO2A 1FW0A 4KYDA 1FQBA 2OK2A 3C34A 1DPEA 3TEPA 5CMCA 4LATA 4RXLA 2DS9A 3UP9A 1OVTA 4MBPA 1NNPA 1R9LA 2R71A 3B7DA 2O68A 3LSWA 2RF1A 1O63A 2XHDA 3BKIB 3VVEA 2XX7A 3PPNA 2B3FA 3DM0A 4R6HA 4GRKA 3TAJA 2XXTA 1ZBMA 3UGWA 4ELOA 1CE2A 1Y1MA 2NXOA 3C33A 3UN6A 3RN8A 4M4GA 3RTFB 4FAJA 4GWOA 2H5YA 4HS7A 3OSRA 2H9BA 1N04A 5B70A 2Z8DA 4JBZA 3MZBA 5ELVA 4YMAA 3N6TA 2D21A 3SESA 3MPKA 3IOUA 5H8HB 5I84A 4O3BA 4RPOA 1DTZA 3FV1A 4P11A 2PYYA 3N26A 4YB6A 3VFJA 3D4CA 2O1MA 3UA8A 2ZYNA 1LB8A 1Y1ZA 3CVGA 1MY1A 3C31A 3HHFA 3TTMA 4GD5A 3VXCA 1MM6A 4HCYA 5KCJB 1FTLA 2O69A 5DTBA 4RPNA 3RPWA 3G3FA 1JQFA 2ZNUA 2DWIA 3TCHA 3SEYA 4LONB 3Q25A 3EHSA 3L6GA 3FVOA 5I59B 1LFGA 4JDFA 3SEUA 3PMXA 3SKPA 2F7BA 3N6UA 1VSOA 3T66A 1H76A 5H8HA 2DE3A 1MRPA 4EF2A 4F1UA 3VVDA 1B4ZA 3TFLA 4FEBA 4Q8RA 4ZEKA 3TELA 2VP1A 1B9JA 3FUZA 3QXMA 5CBRA 3HO7A 3EPEA 1XOCA 1XVXA 3RT8A 2P1SA 1AIVA 1QUIA 1DPPA 2PMSA 4JWYA 3GLBA 5KCJA 5HBCA 4X48A 3VLVA 5I56B 2IA4A 3OENA 2P2AA 2OJTA 2QL3A 5CI5A 4IO6A 3TZAA 3K1NA 3OEMA 5I59A 4JXIA 1YAEA 4JSOA 3FD3A 2F7AA 1N3XA 3WAFA 4OFJA 4U4XA 2I4BA 4UACA 3FZVA 3MP6A 4E0WA 2R9JA 5I2KB 4F3GA 5J1DA 3PGFA 4IO5A 3KFMA 3CG3A 3IORA 4F3SA 1VE4A 4GIZA 3FXQA 3QSLA 1IXGA 1A8EA 1B1HA 1GVCA 5I56A 1ZKBA 4EF1A 1B40A 3GBAA 3KSXA 2ZXTA 1OMPA 3KN8A 1P1UA 4Z7EA 4YMBA 5CBSA 1B6HA 3IJXB 4LUBA 1JNFA 2A5TA 1B58A 1POTA 1LLSA 3RTWB 1MH4A 3PD9A 3KN7A 4HTGA 1II5A 5I2KA 1JVYA 2H25A 5ITPA 2F8DA 2GHBA 3ECRA 1LBBA 4KQPA 1Q1KA 5H8FB 2I49A 4OENA 1MXYA 2VD2A 2DWHA 4GXAA 3A3UA 1B0LA 2I58A 1SD3A 1ZTYA 1QULA 4POXA 4OZ9A 3DELB 1B52A 3OO7A 3QUJA 4JWXA 4U23A 2F34A 1P1OA 2LAOA 1N7XA 4H8JA 4OVJA 3K2DA 2I48A 4PFTA 1IXHA 5FTHA 5A5XB 4H67A 1MXWA 1D4NA 4OEVA 5KZTA 5DEXB 4KD5A 3SEVA 1PEBA 4OESA 4POWA 1LGBC 5HM4B 3OXNA 4G8MA 5H8FA 2V3UA 4U2RA 4LP2B 4GOTA 3VE1B 4AB6A 2YPNA 1MDQA 1MQJA 3EF7A 4U1ZA 3SEXA 4THIA 1LAHE 3U1OA 1B32A 2QRYA 3I3VA 1NKXA 1JW1A 2PBWA 3FJGA 1MQDA 1POY1 1FQEA 3HSTA 4C1UA 3T9VA 2QPQA 5A5XA 4ZEIA 3O29A 3JV9A 2UVGA 1B3HA 4DE8A 5JTYB 3O2AA 3W15C 4LQ5A 5DEXA 4EXLA 3FXUA 2HXWA 3H6VA 5K2YA 4H1XA 3MZ1A 4F2OA 3PMWA 1PB7A 1TFAA 3V8XB 2DYXA 3TDJA 1B3FA 1PC3A 4F3BA 4NMYA 4GF8A 4JWOA 4NF5B 4F1YA 5HPQA 2W7YA 3A09A 1QW0A 3MP1A 4GVOA 1MXVA 3IJOB 3M3KA 4YKKA 1D9VA 1FTMA 4PFWA 4GQOA 4XIGQ 1JEVA 3A3CA 1MY4A 3RY3A 5JTYA 1SVXB 4ONYA 4RA1A 3F11A 4OTEA 1IQ7A 3IX1A 4TLLB 2H4IA 2E0SA 4KCDA 1ATGA 2XXHA 2O7IA 3R7XA 3K00A 1YTVA 2XXPA 1B2HA 3LR1A 1H3DA 3O28A 3FJ7A 4I9DA 4NF5A 4H6DA 3O6HA 3MWBA 4P0IA 4R74A 2HQ0A 2B3BA 1S50A 2ZYKA 2H99A 1LCTA 3VLWA 4NF8B 1LAGE 4ZEDA 4U22A 4ELQA 3CSBA 5M2VA 3O6GA 4EXKA 4ZEBA 3TQLA 5EHSA 2PX1A 1B7HA 3T22A 2X7PA 4UA8A 1MPBA 2HZLA 3USDA 4GL8A 2HAUA 1NFTA 2F6PA 3HCQA 4OFLA 4FIMA 2NOOA 3OO6A 2RCAA 4PFYA 4TOZA 3TCGA 1Y9UA 1P1QA 4G68C 1D9YA 1GV8A 3PPQA 5K2XA 1ZU0A 1SW4A 2HZKA 4MFIA 1B3EA 2NUVA 4OWDA 2DWJA 4EQ7A 3U94A 4IO7A 4QFNA 2OWSA 4OHNA 4NF8A 1JVXA 4N13A 3GXAA 1RYOA 1BP5A 5H8NB 3CSGA 1Z7NE 1MQGA 1LAXA 4F29A 1QKAA 1URDA 1DMBA 2ONSA 3VV5A 3LSLA 4KYSA 3TTLA 1Y3PA 2UVJA 2ZNSA 2QSXA 2UYEA 5AE4A 1SW5A 4OMBA 4LA9A 5ITOA 3S9EA 4G68B 4DXUA 1IUDA 3K4UA 4DLDA 1RYXA 4QFOA 2Z23A 3S9MC 1US4A 4DDDA 3G3GA 1F9BA 3HHGA 3PMVA 3LSXA 2GFEA 2GH9A 5TP9B 3U8QA 3DLNA 3IR1A 2F78A 2VHAA 1B7ZA 1NH7A 3MZ9A 1GTKA 1Y20A 3K02A 5H8NA 3K6VA 3OMBA 3PUYE 4QHQA 4RK2A 4NF4B 4OFOA 1URGA 1R1NA 1A54A 1AH5A 5I57B 3E13X 3KZGA 3B6WA 2V3QA 4X1DA 3E3KA 4YZZA 4H5FA 3O97A 2I3VA 3K1MA 3OD7A 1DSNA 3LBSA 1Y3QA 3CFZA 3V83A 4XTCQ 1PBQA 3QK6A 4G68A 1I6BA 3FIRA 4HW8A 2Q88A 4F2QA 4WEPA 1M5FA 3PD8A 4AB5A 2R6GE 4XKPA 3MVZA 3TQWA 1BLFA 2ALUA 2DP8A 4K3FA 1M5CA 3T9XB 4QFLA 5TP9A 4Z0IA 4F3PA 2DXYA 3RLFE 2RKMA 5AA2D 5ICTA 4NF4A 4C1TA 2A5SA 4ZE8A 4BDMA 2ANJA 5I57A 1OVBA 3HPIA 1LSTA 2Q2CA 1TWYA 4XXUA 5L9MA 4RNSA 2XXRA 3RUMA 1P1NA 4BDLA 3MAMA 3FV2A 1IXIA 4U1OA 1HSLA 3CI8A 2O1LA 3ZS6A 1UQWA 3G3IA 2A5TB 3WAEA 3FVKA 1T0KA 4FE8A 4FECA 1B3GA 2Z8EA 3Q28A 3DP6A 2HCAA 4OYVA 4IY6A 3Q26A 3GZGA 2I3WA 3C36A 4F18A 1NNFA 2XXXA 3PUWE 1MM7A 1XVYA 4E0XA 5I58B 1CB6A 3TTNA 1EH3A 5F7VA 4EQ9A 4NF6B 1OQGA 4AQ4A 3MC2A 3PUVE 3FXRA 5H8SA 3VVFA 3O6IA 1NMUA 3LC8A 1MDP1 1IXCA 2D5WA 1DOTA 4QFKA 1NNTA 1R6ZA 3S2VA 4LZ7A 1NNKA 1UIUA 3OEKA 1B5HA 3SERA 2XXQA 3G3JA 1FCKA 2UVIA 5CMMA 2CZLA 5DVJA 1ZLQA 5KDTB 3VLUA 2FA7A 4X9TA 3IOTA 4KI0E 4YB7A 3P7IA 2VOZA 3RQTA 2F36A 2GRVA 1FQFA 5I58A 4IB2A 2ONKE 3K1PA 4H5GA 4NF6A 5DYHA 1US5A 3V89B 4U21A 4ZEFA 1I6QA 4L17A 1N76A 1FQAA 4ESXA 1P99A 4Q0CA 2G29A 3FGSA 4NWDA 1H45A 3Q29A 2P0SA 3IOWA 1I69A 3K01A 4FEDA 1BTJA 2XXIA 5CC2A 4NWCA 4R2FA 1MH3A 4RJZA 5KDTA 3CG1A 4YKPA 5I2NB 3FVGA 3W9VA 1VFDA 4NE4A 2AL4A 2Z8FA 3W9WA 4G2ZA 2Q8JA 1TXFA 3PPOA 4OETA 1WDNA 1AMFA 1A55A 1MXZA 4F1VA 2D3IA 1M5EA 1FQCA 2E1SA 2Y7WA 2GHAA 3TODA 1IEJA 4U4SA 4RYAA 3CRBA 2Q9TA 3K6UA 2QJEA 3OELA 4R2BA 1JEUA 4O3CA 5TU0A 4R75A 2Y7PA 1N0TA 4OQOA 5I2NA 2UVHA 4TQUQ 1XT8A 4WXJA 1B5JA 2XD2A 3IB1A 1BKAA 4NTLA 1SDXA 4BDQA 2VD3A 4BLAA 1HSEA 3RGYA 2V84A 2FNCA 2XX9A 1XHYA 3HV1A 3T93B 1OLCA 2I4CA 3TPAA 3UORA 3ZSFA 4KR5A 4YKIA 3IAZA 3S9NC 3KJTA 2XX8A 1SBPA 3SDFA 3G3HA 2OCUA 2Z22A 5L9OA 3Q27A 5CMKA 1WVJA 3H06B 5FHOA 2XXYA 1D3KA 5CMBA 3TTKA 5BUUA 3D4GA 4Q30B 4H65A 3V5AA 1B46A 3PPRA 4QSEA 3MVWA 3FJMA 5BWJA 3EHUA 3H4ZA 4R6KA 1JETA 2QS3A 2ONRA 4LZ8A 4ZZAA 3HN0A 3RT6B 5CRYA 1R9QA 4DZ1A 2F5XA 2F97A 3PUZE 1UTHB 4GLIA 3TMGA 1MG1A 2RC7A 2OLBA 2DXRA 4PETA 1UTBB 1QVSA 1FTJA 4IGTA 4WKMA 1QJMA 4DIGA 1PDAA 3S4UA 2DVCA 4MLVA 2Y7KA 1B7UA 5B7DA 3PPPA 4F31B 4NEDA 5TPAB 1OLAA 4LQ2A 1MY3A 3CIJA 1PBPA 3IB2A 4EQBA 4N6PA 2Q89A 5JK4A 2DOJA 3ILUB 3TKDA 2IEEA 2HFBA 1UIVA 1LFIA 2X26A 3CR9A 2ESNA 3MQ9A 3BFUA 4IGRA 4G4PA 1UTHA 1J1NA 2DVZA 1LAFE 1L5TA 4PP0A 5AA2B 1UTBA 3G7WA 2RINA 3K6WA 3IL1B 1HSJA 2DSFA 3I5OA 3IB0A 1PB9A 1O7TA 4YKJA 1BIYA 2OZZA 3ONMA 1RKMA 3K6XA 4FORA 5TPAA 1B3LA 5DVIA 3MBPA 3MVYA 3MJNA 2BJJX 2Y7RA 5FHMA 4DCXA 4BDNA 2DE4A 1AL3A 1XC1A 4I8CA 3H6WA 3C32A 4P0GA 4QF9A 3TCFA 2REJA 3ZKKA 1A7LA 2THIA 5L9SA 1M5DA 2YLNA 2DWAA 3U72A 2QMXA 2I0BA 3AXFA 4JSDA 4KPTA 3TUSA 5AA2A 2DE2A 1B05A 1SYHA 1MY2A 1A40A 1B51A 3LUYA 5AA4B 2AL5A 3CFXA 3PUXE 1Y4CA 3R6UA 1MY0A 3KJ7A 4OXVA 5CM6A 2ZYMA 4H0WA 2AIXA 1OIBA 1Q35A 4ESWA 3BFTA 4ZZEA 3H03A 5EHMA 1MPCA 4G8NA 3QYTA 1I6AA 4ECFA 4QSDA 1A8FA 3U93A 3SEWA 3THIA 4KYEA 3B6QA 3EN3A 1QKBA 3FATA 4GL0A 2O51A 3K0VA 4F22A 3IOVA 1LB9A 2X7QA 4OERA 1DTGA 4IO4A 3C35A 3L6HA 3MVXA 1S7YA 4R73A 3DP8A 3QIMA 5AA4A 4PQJA 4YB5A 1ZMGA 1JW4A 1FTOA 2OWTA 2RC8A 2Q2AA 2H98A 2VGQA 3OSQA 5FHNA 2F7CA 1IIWA 3QAXA 1VFEA 4XKRA 3T9HB 1WODA 4QSCA 1ELJA 4F39A 3MW0A 2HEUA 2UXAA 4KCCA 2DQVA 3T9UA 4Q5TA 1B4HA 4MF3A 1OQHA 1O64A 2O7UA 4I1DA 3KEIA 3KN3A 3KSJA 4ZDMA 2ABHA 3H6TA 5IAIA 3TYHA 1EU8A 2F35A 2AYSA 2XXVA 2PT1A 1LBCA 4HCWA 1M5BA 3H3GA 4EUOA 1EZPA 1MQHA 3EHTA 3SETA 1B5IA 3CFLA 1SI0A 4N07A 3IO4A 3BBRA 4R9GA 4QFPA 1QUKA 5IKBA 4GFRA 3UK4A 1YCJA 2V93A 3ILTB 3VXBA 2O6AA 3VDFA 3KBRA 2I6EA 2V3TA 1H43A 1NH8A 2RCBA 3LSFB 3UIFA 2RC9A 4LZ5A 4JB7A 1MXXA 1SW2A 4BDOA 1JW5A 4O3AA 2Y84A 3JZJA 3PU5A 3OO9A 3O9PA 3KOSA 3ZKLA 4OEUA 3N94A 1SYIA 1FQDA 1EZ9A 4YU0A 2V25A 2YJPA 3T96B 3B6TA 1MXUA 3OO8A 4KFQA 1EZOA 4XKNA 3IK6B 1ZIUA 2XXUA 1KWHA 5L8DA 3JYRA 2ZMBA 2CMOA 4XKQA 4C0RA 1TT1A 1ANFA 5DVFA 2M8CA 3C4MA 4M1VA 1IITA 2PVUA 2Y7IA 1Y4TA 3OOAA 5AA3A 3DP4A 2NWJA 3S9LC 1SW1A 5DT6A 1B1XA 1Y3NA 4MLQA 1TFDA 2QS4A 5AA1A 4LVQA 5F1QA 3FVNA 2QS1A 4KHZE 4BDRA 1N7WA 4ELRA 4ND9A 4IY5A 4PFUA 3H7MA 1XS5A 3KOTA 1VR5A 1B0HA 2B65A 4RK9A 5H8QB 4ZE9A 5ICQA 4MH5A 1Z7ME 4DXCA 4YAHX 2XXWA 1FTKA 1PB8A 3EQ1A 1LFHA 2NVUB 4R72A 3MUQA 3M8UA 3I6VA 1P1WA 3RNNA 3G3KA 2XD3A 5LOMA 3C9HA 5ISUA 3N5LA 3R26A 2WKYA 1H44A 4ZECA 3PV0E 4RY1A 1QUJA 2ZNTA 2ZYOA 2F6GA 4QRZA 1YPNA 4G77A 1USYE 4TLMB 2KLFA 3QUFA 2HAVA 2PT2A 1LCFA 2QMWA 3MPLA 5H8QA 2QS2A 1NL5A 4DCYA 1ZJLA 5JEIA 3O66A 4DXBA 2OBGA 1URSA 3E9XA 3KG2A 3IO6A 3M3FA 1USYH 2UYFA 4F19A 4FJPA 3KGCA 4R6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IO3 A;  3E4R A;  3TTR A;  3ODB A;  3H6U A;  2FYI A;  1SQY A;  3U92 A;  3GBB A;  2O84 X;  5EYF A;  3MP8 A;  1MQI A;  3FAS A;  4ELP A;  4H8I A;  1MPD A;  1A99 A;  3M3L A;  2REG A;  1MS7 A;  5FTI A;  4I62 A;  1AOV A;  4PE5 B;  1GR2 A;  4X1B A;  1SI1 A;  4G8H A;  2I0C A;  4GXS B;  4R9F A;  1IZ1 A;  2G93 A;  4ZS9 A;  1S9T A;  4EDP A;  1N84 A;  4YIC A;  1GGG A;  1N3W A;  4ISU A;  4FAT A;  4WED A;  4IO2 A;  1FW0 A;  4KYD A;  1FQB A;  2OK2 A;  3C34 A;  1DPE A;  3TEP A;  5CMC A;  4LAT A;  4RXL A;  2DS9 A;  3UP9 A;  1OVT A;  4MBP A;  1NNP A;  1R9L A;  2R71 A;  3B7D A;  2O68 A;  3LSW A;  2RF1 A;  1O63 A;  2XHD A;  3BKI B;  3VVE A;  2XX7 A;  3PPN A;  2B3F A;  3DM0 A;  4R6H A;  4GRK A;  3TAJ A;  2XXT A;  1ZBM A;  3UGW A;  4ELO A;  1CE2 A;  1Y1M A;  2NXO A;  3C33 A;  3UN6 A;  3RN8 A;  4M4G A;  3RTF B;  4FAJ A;  4GWO A;  2H5Y A;  4HS7 A;  3OSR A;  2H9B A;  1N04 A;  5B70 A;  2Z8D A;  4JBZ A;  3MZB A;  5ELV A;  4YMA A;  3N6T A;  2D21 A;  3SES A;  3MPK A;  3IOU A;  5H8H B;  5I84 A;  4O3B A;  4RPO A;  1DTZ A;  3FV1 A;  4P11 A;  2PYY A;  3N26 A;  4YB6 A;  3VFJ A;  3D4C A;  2O1M A;  3UA8 A;  2ZYN A;  1LB8 A;  1Y1Z A;  3CVG A;  1MY1 A;  3C31 A;  3HHF A;  3TTM A;  4GD5 A;  3VXC A;  1MM6 A;  4HCY A;  5KCJ B;  1FTL A;  2O69 A;  5DTB A;  4RPN A;  3RPW A;  3G3F A;  1JQF A;  2ZNU A;  2DWI A;  3TCH A;  3SEY A;  4LON B;  3Q25 A;  3EHS A;  3L6G A;  3FVO A;  5I59 B;  1LFG A;  4JDF A;  3SEU A;  3PMX A;  3SKP A;  2F7B A;  3N6U A;  1VSO A;  3T66 A;  1H76 A;  5H8H A;  2DE3 A;  1MRP A;  4EF2 A;  4F1U A;  3VVD A;  1B4Z A;  3TFL A;  4FEB A;  4Q8R A;  4ZEK A;  3TEL A;  2VP1 A;  1B9J A;  3FUZ A;  3QXM A;  5CBR A;  3HO7 A;  3EPE A;  1XOC A;  1XVX A;  3RT8 A;  2P1S A;  1AIV A;  1QUI A;  1DPP A;  2PMS A;  4JWY A;  3GLB A;  5KCJ A;  5HBC A;  4X48 A;  3VLV A;  5I56 B;  2IA4 A;  3OEN A;  2P2A A;  2OJT A;  2QL3 A;  5CI5 A;  4IO6 A;  3TZA A;  3K1N A;  3OEM A;  5I59 A;  4JXI A;  1YAE A;  4JSO A;  3FD3 A;  2F7A A;  1N3X A;  3WAF A;  4OFJ A;  4U4X A;  2I4B A;  4UAC A;  3FZV A;  3MP6 A;  4E0W A;  2R9J A;  5I2K B;  4F3G A;  5J1D A;  3PGF A;  4IO5 A;  3KFM A;  3CG3 A;  3IOR A;  4F3S A;  1VE4 A;  4GIZ A;  3FXQ A;  3QSL A;  1IXG A;  1A8E A;  1B1H A;  1GVC A;  5I56 A;  1ZKB A;  4EF1 A;  1B40 A;  3GBA A;  3KSX A;  2ZXT A;  1OMP A;  3KN8 A;  1P1U A;  4Z7E A;  4YMB A;  5CBS A;  1B6H A;  3IJX B;  4LUB A;  1JNF A;  2A5T A;  1B58 A;  1POT A;  1LLS A;  3RTW B;  1MH4 A;  3PD9 A;  3KN7 A;  4HTG A;  1II5 A;  5I2K A;  1JVY A;  2H25 A;  5ITP A;  2F8D A;  2GHB A;  3ECR A;  1LBB A;  4KQP A;  1Q1K A;  5H8F B;  2I49 A;  4OEN A;  1MXY A;  2VD2 A;  2DWH A;  4GXA A;  3A3U A;  1B0L A;  2I58 A;  1SD3 A;  1ZTY A;  1QUL A;  4POX A;  4OZ9 A;  3DEL B;  1B52 A;  3OO7 A;  3QUJ A;  4JWX A;  4U23 A;  2F34 A;  1P1O A;  2LAO A;  1N7X A;  4H8J A;  4OVJ A;  3K2D A;  2I48 A;  4PFT A;  1IXH A;  5FTH A;  5A5X B;  4H67 A;  1MXW A;  1D4N A;  4OEV A;  5KZT A;  5DEX B;  4KD5 A;  3SEV A;  1PEB A;  4OES A;  4POW A;  1LGB C;  5HM4 B;  3OXN A;  4G8M A;  5H8F A;  2V3U A;  4U2R A;  4LP2 B;  4GOT A;  3VE1 B;  4AB6 A;  2YPN A;  1MDQ A;  1MQJ A;  3EF7 A;  4U1Z A;  3SEX A;  4THI A;  1LAH E;  3U1O A;  1B32 A;  2QRY A;  3I3V A;  1NKX A;  1JW1 A;  2PBW A;  3FJG A;  1MQD A;  1POY 1;  1FQE A;  3HST A;  4C1U A;  3T9V A;  2QPQ A;  5A5X A;  4ZEI A;  3O29 A;  3JV9 A;  2UVG A;  1B3H A;  4DE8 A;  5JTY B;  3O2A A;  3W15 C;  4LQ5 A;  5DEX A;  4EXL A;  3FXU A;  2HXW A;  3H6V A;  5K2Y A;  4H1X A;  3MZ1 A;  4F2O A;  3PMW A;  1PB7 A;  1TFA A;  3V8X B;  2DYX A;  3TDJ A;  1B3F A;  1PC3 A;  4F3B A;  4NMY A;  4GF8 A;  4JWO A;  4NF5 B;  4F1Y A;  5HPQ A;  2W7Y A;  3A09 A;  1QW0 A;  3MP1 A;  4GVO A;  1MXV A;  3IJO B;  3M3K A;  4YKK A;  1D9V A;  1FTM A;  4PFW A;  4GQO A;  4XIG Q;  1JEV A;  3A3C A;  1MY4 A;  3RY3 A;  5JTY A;  1SVX B;  4ONY A;  4RA1 A;  3F11 A;  4OTE A;  1IQ7 A;  3IX1 A;  4TLL B;  2H4I A;  2E0S A;  4KCD A;  1ATG A;  2XXH A;  2O7I A;  3R7X A;  3K00 A;  1YTV A;  2XXP A;  1B2H A;  3LR1 A;  1H3D A;  3O28 A;  3FJ7 A;  4I9D A;  4NF5 A;  4H6D A;  3O6H A;  3MWB A;  4P0I A;  4R74 A;  2HQ0 A;  2B3B A;  1S50 A;  2ZYK A;  2H99 A;  1LCT A;  3VLW A;  4NF8 B;  1LAG E;  4ZED A;  4U22 A;  4ELQ A;  3CSB A;  5M2V A;  3O6G A;  4EXK A;  4ZEB A;  3TQL A;  5EHS A;  2PX1 A;  1B7H A;  3T22 A;  2X7P A;  4UA8 A;  1MPB A;  2HZL A;  3USD A;  4GL8 A;  2HAU A;  1NFT A;  2F6P A;  3HCQ A;  4OFL A;  4FIM A;  2NOO A;  3OO6 A;  2RCA A;  4PFY A;  4TOZ A;  3TCG A;  1Y9U A;  1P1Q A;  4G68 C;  1D9Y A;  1GV8 A;  3PPQ A;  5K2X A;  1ZU0 A;  1SW4 A;  2HZK A;  4MFI A;  1B3E A;  2NUV A;  4OWD A;  2DWJ A;  4EQ7 A;  3U94 A;  4IO7 A;  4QFN A;  2OWS A;  4OHN A;  4NF8 A;  1JVX A;  4N13 A;  3GXA A;  1RYO A;  1BP5 A;  5H8N B;  3CSG A;  1Z7N E;  1MQG A;  1LAX A;  4F29 A;  1QKA A;  1URD A;  1DMB A;  2ONS A;  3VV5 A;  3LSL A;  4KYS A;  3TTL A;  1Y3P A;  2UVJ A;  2ZNS A;  2QSX A;  2UYE A;  5AE4 A;  1SW5 A;  4OMB A;  4LA9 A;  5ITO A;  3S9E A;  4G68 B;  4DXU A;  1IUD A;  3K4U A;  4DLD A;  1RYX A;  4QFO A;  2Z23 A;  3S9M C;  1US4 A;  4DDD A;  3G3G A;  1F9B A;  3HHG A;  3PMV A;  3LSX A;  2GFE A;  2GH9 A;  5TP9 B;  3U8Q A;  3DLN A;  3IR1 A;  2F78 A;  2VHA A;  1B7Z A;  1NH7 A;  3MZ9 A;  1GTK A;  1Y20 A;  3K02 A;  5H8N A;  3K6V A;  3OMB A;  3PUY E;  4QHQ A;  4RK2 A;  4NF4 B;  4OFO A;  1URG A;  1R1N A;  1A54 A;  1AH5 A;  5I57 B;  3E13 X;  3KZG A;  3B6W A;  2V3Q A;  4X1D A;  3E3K A;  4YZZ A;  4H5F A;  3O97 A;  2I3V A;  3K1M A;  3OD7 A;  1DSN A;  3LBS A;  1Y3Q A;  3CFZ A;  3V83 A;  4XTC Q;  1PBQ A;  3QK6 A;  4G68 A;  1I6B A;  3FIR A;  4HW8 A;  2Q88 A;  4F2Q A;  4WEP A;  1M5F A;  3PD8 A;  4AB5 A;  2R6G E;  4XKP A;  3MVZ A;  3TQW A;  1BLF A;  2ALU A;  2DP8 A;  4K3F A;  1M5C A;  3T9X B;  4QFL A;  5TP9 A;  4Z0I A;  4F3P A;  2DXY A;  3RLF E;  2RKM A;  5AA2 D;  5ICT A;  4NF4 A;  4C1T A;  2A5S A;  4ZE8 A;  4BDM A;  2ANJ A;  5I57 A;  1OVB A;  3HPI A;  1LST A;  2Q2C A;  1TWY A;  4XXU A;  5L9M A;  4RNS A;  2XXR A;  3RUM A;  1P1N A;  4BDL A;  3MAM A;  3FV2 A;  1IXI A;  4U1O A;  1HSL A;  3CI8 A;  2O1L A;  3ZS6 A;  1UQW A;  3G3I A;  2A5T B;  3WAE A;  3FVK A;  1T0K A;  4FE8 A;  4FEC A;  1B3G A;  2Z8E A;  3Q28 A;  3DP6 A;  2HCA A;  4OYV A;  4IY6 A;  3Q26 A;  3GZG A;  2I3W A;  3C36 A;  4F18 A;  1NNF A;  2XXX A;  3PUW E;  1MM7 A;  1XVY A;  4E0X A;  5I58 B;  1CB6 A;  3TTN A;  1EH3 A;  5F7V A;  4EQ9 A;  4NF6 B;  1OQG A;  4AQ4 A;  3MC2 A;  3PUV E;  3FXR A;  5H8S A;  3VVF A;  3O6I A;  1NMU A;  3LC8 A;  1MDP 1;  1IXC A;  2D5W A;  1DOT A;  4QFK A;  1NNT A;  1R6Z A;  3S2V A;  4LZ7 A;  1NNK A;  1UIU A;  3OEK A;  1B5H A;  3SER A;  2XXQ A;  3G3J A;  1FCK A;  2UVI A;  5CMM A;  2CZL A;  5DVJ A;  1ZLQ A;  5KDT B;  3VLU A;  2FA7 A;  4X9T A;  3IOT A;  4KI0 E;  4YB7 A;  3P7I A;  2VOZ A;  3RQT A;  2F36 A;  2GRV A;  1FQF A;  5I58 A;  4IB2 A;  2ONK E;  3K1P A;  4H5G A;  4NF6 A;  5DYH A;  1US5 A;  3V89 B;  4U21 A;  4ZEF A;  1I6Q A;  4L17 A;  1N76 A;  1FQA A;  4ESX A;  1P99 A;  4Q0C A;  2G29 A;  3FGS A;  4NWD A;  1H45 A;  3Q29 A;  2P0S A;  3IOW A;  1I69 A;  3K01 A;  4FED A;  1BTJ A;  2XXI A;  5CC2 A;  4NWC A;  4R2F A;  1MH3 A;  4RJZ A;  5KDT A;  3CG1 A;  4YKP A;  5I2N B;  3FVG A;  3W9V A;  1VFD A;  4NE4 A;  2AL4 A;  2Z8F A;  3W9W A;  4G2Z A;  2Q8J A;  1TXF A;  3PPO A;  4OET A;  1WDN A;  1AMF A;  1A55 A;  1MXZ A;  4F1V A;  2D3I A;  1M5E A;  1FQC A;  2E1S A;  2Y7W A;  2GHA A;  3TOD A;  1IEJ A;  4U4S A;  4RYA A;  3CRB A;  2Q9T A;  3K6U A;  2QJE A;  3OEL A;  4R2B A;  1JEU A;  4O3C A;  5TU0 A;  4R75 A;  2Y7P A;  1N0T A;  4OQO A;  5I2N A;  2UVH A;  4TQU Q;  1XT8 A;  4WXJ A;  1B5J A;  2XD2 A;  3IB1 A;  1BKA A;  4NTL A;  1SDX A;  4BDQ A;  2VD3 A;  4BLA A;  1HSE A;  3RGY A;  2V84 A;  2FNC A;  2XX9 A;  1XHY A;  3HV1 A;  3T93 B;  1OLC A;  2I4C A;  3TPA A;  3UOR A;  3ZSF A;  4KR5 A;  4YKI A;  3IAZ A;  3S9N C;  3KJT A;  2XX8 A;  1SBP A;  3SDF A;  3G3H A;  2OCU A;  2Z22 A;  5L9O A;  3Q27 A;  5CMK A;  1WVJ A;  3H06 B;  5FHO A;  2XXY A;  1D3K A;  5CMB A;  3TTK A;  5BUU A;  3D4G A;  4Q30 B;  4H65 A;  3V5A A;  1B46 A;  3PPR A;  4QSE A;  3MVW A;  3FJM A;  5BWJ A;  3EHU A;  3H4Z A;  4R6K A;  1JET A;  2QS3 A;  2ONR A;  4LZ8 A;  4ZZA A;  3HN0 A;  3RT6 B;  5CRY A;  1R9Q A;  4DZ1 A;  2F5X A;  2F97 A;  3PUZ E;  1UTH B;  4GLI A;  3TMG A;  1MG1 A;  2RC7 A;  2OLB A;  2DXR A;  4PET A;  1UTB B;  1QVS A;  1FTJ A;  4IGT A;  4WKM A;  1QJM A;  4DIG A;  1PDA A;  3S4U A;  2DVC A;  4MLV A;  2Y7K A;  1B7U A;  5B7D A;  3PPP A;  4F31 B;  4NED A;  5TPA B;  1OLA A;  4LQ2 A;  1MY3 A;  3CIJ A;  1PBP A;  3IB2 A;  4EQB A;  4N6P A;  2Q89 A;  5JK4 A;  2DOJ A;  3ILU B;  3TKD A;  2IEE A;  2HFB A;  1UIV A;  1LFI A;  2X26 A;  3CR9 A;  2ESN A;  3MQ9 A;  3BFU A;  4IGR A;  4G4P A;  1UTH A;  1J1N A;  2DVZ A;  1LAF E;  1L5T A;  4PP0 A;  5AA2 B;  1UTB A;  3G7W A;  2RIN A;  3K6W A;  3IL1 B;  1HSJ A;  2DSF A;  3I5O A;  3IB0 A;  1PB9 A;  1O7T A;  4YKJ A;  1BIY A;  2OZZ A;  3ONM A;  1RKM A;  3K6X A;  4FOR A;  5TPA A;  1B3L A;  5DVI A;  3MBP A;  3MVY A;  3MJN A;  2BJJ X;  2Y7R A;  5FHM A;  4DCX A;  4BDN A;  2DE4 A;  1AL3 A;  1XC1 A;  4I8C A;  3H6W A;  3C32 A;  4P0G A;  4QF9 A;  3TCF A;  2REJ A;  3ZKK A;  1A7L A;  2THI A;  5L9S A;  1M5D A;  2YLN A;  2DWA A;  3U72 A;  2QMX A;  2I0B A;  3AXF A;  4JSD A;  4KPT A;  3TUS A;  5AA2 A;  2DE2 A;  1B05 A;  1SYH A;  1MY2 A;  1A40 A;  1B51 A;  3LUY A;  5AA4 B;  2AL5 A;  3CFX A;  3PUX E;  1Y4C A;  3R6U A;  1MY0 A;  3KJ7 A;  4OXV A;  5CM6 A;  2ZYM A;  4H0W A;  2AIX A;  1OIB A;  1Q35 A;  4ESW A;  3BFT A;  4ZZE A;  3H03 A;  5EHM A;  1MPC A;  4G8N A;  3QYT A;  1I6A A;  4ECF A;  4QSD A;  1A8F A;  3U93 A;  3SEW A;  3THI A;  4KYE A;  3B6Q A;  3EN3 A;  1QKB A;  3FAT A;  4GL0 A;  2O51 A;  3K0V A;  4F22 A;  3IOV A;  1LB9 A;  2X7Q A;  4OER A;  1DTG A;  4IO4 A;  3C35 A;  3L6H A;  3MVX A;  1S7Y A;  4R73 A;  3DP8 A;  3QIM A;  5AA4 A;  4PQJ A;  4YB5 A;  1ZMG A;  1JW4 A;  1FTO A;  2OWT A;  2RC8 A;  2Q2A A;  2H98 A;  2VGQ A;  3OSQ A;  5FHN A;  2F7C A;  1IIW A;  3QAX A;  1VFE A;  4XKR A;  3T9H B;  1WOD A;  4QSC A;  1ELJ A;  4F39 A;  3MW0 A;  2HEU A;  2UXA A;  4KCC A;  2DQV A;  3T9U A;  4Q5T A;  1B4H A;  4MF3 A;  1OQH A;  1O64 A;  2O7U A;  4I1D A;  3KEI A;  3KN3 A;  3KSJ A;  4ZDM A;  2ABH A;  3H6T A;  5IAI A;  3TYH A;  1EU8 A;  2F35 A;  2AYS A;  2XXV A;  2PT1 A;  1LBC A;  4HCW A;  1M5B A;  3H3G A;  4EUO A;  1EZP A;  1MQH A;  3EHT A;  3SET A;  1B5I A;  3CFL A;  1SI0 A;  4N07 A;  3IO4 A;  3BBR A;  4R9G A;  4QFP A;  1QUK A;  5IKB A;  4GFR A;  3UK4 A;  1YCJ A;  2V93 A;  3ILT B;  3VXB A;  2O6A A;  3VDF A;  3KBR A;  2I6E A;  2V3T A;  1H43 A;  1NH8 A;  2RCB A;  3LSF B;  3UIF A;  2RC9 A;  4LZ5 A;  4JB7 A;  1MXX A;  1SW2 A;  4BDO A;  1JW5 A;  4O3A A;  2Y84 A;  3JZJ A;  3PU5 A;  3OO9 A;  3O9P A;  3KOS A;  3ZKL A;  4OEU A;  3N94 A;  1SYI A;  1FQD A;  1EZ9 A;  4YU0 A;  2V25 A;  2YJP A;  3T96 B;  3B6T A;  1MXU A;  3OO8 A;  4KFQ A;  1EZO A;  4XKN A;  3IK6 B;  1ZIU A;  2XXU A;  1KWH A;  5L8D A;  3JYR A;  2ZMB A;  2CMO A;  4XKQ A;  4C0R A;  1TT1 A;  1ANF A;  5DVF A;  2M8C A;  3C4M A;  4M1V A;  1IIT A;  2PVU A;  2Y7I A;  1Y4T A;  3OOA A;  5AA3 A;  3DP4 A;  2NWJ A;  3S9L C;  1SW1 A;  5DT6 A;  1B1X A;  1Y3N A;  4MLQ A;  1TFD A;  2QS4 A;  5AA1 A;  4LVQ A;  5F1Q A;  3FVN A;  2QS1 A;  4KHZ E;  4BDR A;  1N7W A;  4ELR A;  4ND9 A;  4IY5 A;  4PFU A;  3H7M A;  1XS5 A;  3KOT A;  1VR5 A;  1B0H A;  2B65 A;  4RK9 A;  5H8Q B;  4ZE9 A;  5ICQ A;  4MH5 A;  1Z7M E;  4DXC A;  4YAH X;  2XXW A;  1FTK A;  1PB8 A;  3EQ1 A;  1LFH A;  2NVU B;  4R72 A;  3MUQ A;  3M8U A;  3I6V A;  1P1W A;  3RNN A;  3G3K A;  2XD3 A;  5LOM A;  3C9H A;  5ISU A;  3N5L A;  3R26 A;  2WKY A;  1H44 A;  4ZEC A;  3PV0 E;  4RY1 A;  1QUJ A;  2ZNT A;  2ZYO A;  2F6G A;  4QRZ A;  1YPN A;  4G77 A;  1USY E;  4TLM B;  2KLF A;  3QUF A;  2HAV A;  2PT2 A;  1LCF A;  2QMW A;  3MPL A;  5H8Q A;  2QS2 A;  1NL5 A;  4DCY A;  1ZJL A;  5JEI A;  3O66 A;  4DXB A;  2OBG A;  1URS A;  3E9X A;  3KG2 A;  3IO6 A;  3M3F A;  1USY H;  2UYF A;  4F19 A;  4FJP A;  3KGC A;  4R6Y A; 
#chains in the Genus database with same CATH topology
 4IO3 A;  3E4R A;  3TTR A;  3ODB A;  3H6U A;  2FYI A;  1SQY A;  3U92 A;  4PBH A;  3GBB A;  2O84 X;  5EYF A;  4OVT A;  1Q9D A;  3MP8 A;  4PDD A;  1MQI A;  3FAS A;  1FSA A;  4ELP A;  4H8I A;  2VT5 A;  1MPD A;  1A99 A;  4GX3 A;  3M3L A;  2REG A;  1MS7 A;  5FTI A;  4I62 A;  1AOV A;  4PE5 B;  1GR2 A;  3RPL B;  4X1B A;  1SI1 A;  4G8H A;  2I0C A;  4GXS B;  4P3L A;  4R9F A;  5FBP A;  1IZ1 A;  2G93 A;  4ZS9 A;  1S9T A;  4EDP A;  1N84 A;  2CZH A;  4YIC A;  1GGG A;  1N3W A;  1D9Q A;  4ISU A;  4FAT A;  4WED A;  2GQ1 A;  4IO2 A;  2ZZV A;  4GWS A;  1FBC A;  1FW0 A;  4KYD A;  1LEV A;  4GX6 A;  1FQB A;  2OK2 A;  3C34 A;  1DPE A;  4PF8 A;  3TEP A;  1FPB A;  5CMC A;  4LAT A;  4RXL A;  2DS9 A;  3UP9 A;  3ISP A;  1OVT A;  4MBP A;  1NNP A;  3RPL A;  1R9L A;  2R71 A;  4NX1 A;  3B7D A;  2O68 A;  3LSW A;  2RF1 A;  1O63 A;  2XHD A;  3BKI B;  3VVE A;  2XX7 A;  3PPN A;  5ESY A;  2B3F A;  3DM0 A;  4R6H A;  4GRK A;  3TAJ A;  2XXT A;  1ZBM A;  3UGW A;  4ELO A;  4PAF A;  1CE2 A;  1Y1M A;  5IM2 A;  2NXO A;  3C33 A;  3UN6 A;  4PFB A;  3RN8 A;  5I7I A;  4M4G A;  3RTF B;  4FAJ A;  1INP A;  4GWO A;  2H5Y A;  4HS7 A;  3OSR A;  2H9B A;  1N04 A;  5B70 A;  2CZI A;  5EQ8 A;  2Z8D A;  4JBZ A;  4PAI A;  3MZB A;  2B4L A;  5ELV A;  4YMA A;  4XFE A;  3N6T A;  2D21 A;  3SES A;  3MPK A;  3IOU A;  5H8H B;  4HXV A;  5I84 A;  4O3B A;  4RPO A;  1DTZ A;  3FV1 A;  4P11 A;  2PYY A;  3N26 A;  4YB6 A;  3VFJ A;  4N91 A;  4MIJ A;  3D4C A;  2O1M A;  3UA8 A;  2ZYN A;  1LB8 A;  1Y1Z A;  3CVG A;  1MY1 A;  3C31 A;  3HHF A;  1NV7 A;  5J16 A;  3TTM A;  4GD5 A;  3VXC A;  1MM6 A;  4HCY A;  4NAP A;  1LBV A;  5KCJ B;  4P1L A;  1FTL A;  2O69 A;  5DTB A;  4RPN A;  3RPW A;  3G3F A;  1JQF A;  2ZNU A;  2DWI A;  3TCH A;  3SEY A;  4LON B;  3Q25 A;  3EHS A;  3L6G A;  3FVO A;  5I59 B;  1LFG A;  4JDF A;  3SEU A;  3PMX A;  2FBP A;  3SKP A;  2F7B A;  3N6U A;  1VSO A;  3T66 A;  1H76 A;  2QVV A;  5H8H A;  2DE3 A;  1MRP A;  1SPI A;  1FBH A;  4EF2 A;  4F1U A;  4N15 A;  3VVD A;  1B4Z A;  3TFL A;  4FEB A;  4Q8R A;  4ZEK A;  3TEL A;  2VP1 A;  4N6D A;  1B9J A;  3FUZ A;  3QXM A;  5CBR A;  3HO7 A;  1FPI A;  1BK4 A;  3EPE A;  1XOC A;  1XVX A;  3RT8 A;  2P1S A;  1AIV A;  1QUI A;  2WBB A;  1DPP A;  2PMS A;  4JWY A;  3GLB A;  5KCJ A;  5HBC A;  4X48 A;  3VLV A;  5I56 B;  2IA4 A;  3OEN A;  2P2A A;  2OJT A;  2QL3 A;  5CI5 A;  4IO6 A;  3TZA A;  3K1N A;  4P9K A;  3OEM A;  5I59 A;  4JXI A;  1YAE A;  4JSO A;  3FD3 A;  2F7A A;  1N3X A;  3WAF A;  4OFJ A;  4U4X A;  2I4B A;  4GWW A;  4UAC A;  3FZV A;  3MP6 A;  4E0W A;  2R9J A;  5I2K B;  4F3G A;  5J1D A;  3PGF A;  4IO5 A;  3KFM A;  3CG3 A;  3IOR A;  4F3S A;  1VE4 A;  4GIZ A;  3FXQ A;  3QSL A;  1IXG A;  3U65 A;  1A8E A;  2XWV A;  2WYK A;  1B1H A;  1GVC A;  4OVR A;  5I56 A;  1ZKB A;  4EF1 A;  4OVS A;  1B40 A;  3GBA A;  3KSX A;  2ZXT A;  1OMP A;  3KN8 A;  1P1U A;  4Z7E A;  4YMB A;  1FBP A;  5CBS A;  1B6H A;  3IJX B;  4LUB A;  1JNF A;  2A5T A;  1B58 A;  1POT A;  1LLS A;  3RTW B;  1MH4 A;  3PD9 A;  3KN7 A;  3E78 A;  4GWZ A;  4HTG A;  1II5 A;  5I2K A;  1JVY A;  4N81 A;  2H25 A;  5ITP A;  2F8D A;  2GHB A;  3ECR A;  1LBB A;  4KQP A;  2FHY A;  1Q1K A;  5H8F B;  3BIG A;  2I49 A;  4OEN A;  1MXY A;  2VD2 A;  5ET6 A;  2DWH A;  4GXA A;  3A3U A;  1B0L A;  2I58 A;  4MX6 A;  1SD3 A;  1ZTY A;  1QUL A;  3D1R A;  4POX A;  4OZ9 A;  3BIH A;  3DEL B;  1B52 A;  3OO7 A;  3QUJ A;  4JWX A;  4U23 A;  2F34 A;  1P1O A;  2LAO A;  1N7X A;  4H8J A;  4OVJ A;  3K2D A;  2I48 A;  1IMF A;  4PFT A;  1IXH A;  5FTH A;  5A5X B;  4H67 A;  1MXW A;  1D4N A;  4OEV A;  1NV6 A;  5KZT A;  5DEX B;  4KD5 A;  3SEV A;  1PEB A;  4OES A;  4POW A;  1LGB C;  5HM4 B;  3OXN A;  4G8M A;  4JVI A;  5H8F A;  4KXP A;  2V3U A;  4U2R A;  4LP2 B;  4GOT A;  3VE1 B;  4AB6 A;  2YPN A;  1MDQ A;  1MQJ A;  3EF7 A;  4U1Z A;  3SEX A;  4THI A;  1LAH E;  3U1O A;  1B32 A;  2BJI A;  2QRY A;  3I3V A;  4PGP A;  4UAB A;  1NKX A;  1JW1 A;  1LBW A;  2PBW A;  3FJG A;  1MQD A;  1POY 1;  1FQE A;  3HST A;  4MMP A;  4C1U A;  3T9V A;  2QPQ A;  1RDX A;  5A5X A;  4GWX A;  4NGU A;  4ZEI A;  3O29 A;  3JV9 A;  1NV2 A;  2UVG A;  1B3H A;  4FBP A;  4DE8 A;  4NQ8 A;  5JTY B;  3O2A A;  3W15 C;  4LQ5 A;  5DEX A;  4EXL A;  3FXU A;  2HXW A;  3H6V A;  5K2Y A;  3B50 A;  4H1X A;  3MZ1 A;  4F2O A;  3PMW A;  4JVD A;  1PB7 A;  1TFA A;  3V8X B;  2DYX A;  3TDJ A;  1B3F A;  1PC3 A;  4F3B A;  4NMY A;  1RDY A;  1K9Y A;  3KC0 A;  4GF8 A;  2XXK A;  4JWO A;  4NF5 B;  4F1Y A;  5HPQ A;  2W7Y A;  3A09 A;  1QW0 A;  3MP1 A;  4GVO A;  1MXV A;  3IJO B;  3M3K A;  4YKK A;  1D9V A;  1FTM A;  4PFW A;  4GQO A;  4XIG Q;  4HE2 A;  1JEV A;  3A3C A;  1MY4 A;  3RY3 A;  5JTY A;  1SVX B;  4ONY A;  4RA1 A;  3F11 A;  1YZ0 A;  4OTE A;  1IQ7 A;  3IX1 A;  4TLL B;  3MYU A;  2H4I A;  2E0S A;  4KCD A;  1ATG A;  2XXH A;  2O7I A;  3R7X A;  3K00 A;  1YTV A;  2XXP A;  1B2H A;  3LR1 A;  1H3D A;  3O28 A;  3FJ7 A;  4I9D A;  4NF5 A;  4H6D A;  3O6H A;  3MWB A;  4P0I A;  4R74 A;  4O94 A;  2HQ0 A;  2B3B A;  1S50 A;  1G0I A;  2ZYK A;  2H99 A;  1LCT A;  3VLW A;  4NF8 B;  3RYD A;  1LAG E;  4ZED A;  4U22 A;  4ELQ A;  3CSB A;  5M2V A;  3O6G A;  4EXK A;  4ZEB A;  3TQL A;  5EHS A;  2PX1 A;  4NHB A;  1B7H A;  3T22 A;  2ZZX A;  1FPE A;  2X7P A;  2OWZ A;  4UA8 A;  1MPB A;  2HZL A;  3USD A;  3PTY A;  4GL8 A;  2HAU A;  1NFT A;  1NV1 A;  2F6P A;  3HCQ A;  4OFL A;  4IR8 A;  4FIM A;  1KA0 A;  1XI6 A;  2NOO A;  3OO6 A;  2RCA A;  1FRP A;  4PFY A;  4TOZ A;  3TCG A;  1Y9U A;  4GWY A;  1P1Q A;  4G68 C;  1D9Y A;  1GV8 A;  3PPQ A;  5K2X A;  1ZU0 A;  1SW4 A;  2HZK A;  2OX3 A;  4MFI A;  1B3E A;  5EQA A;  3SZP A;  2NUV A;  4OWD A;  2DWJ A;  4EQ7 A;  3U94 A;  4IO7 A;  4QFN A;  2OWS A;  4OHN A;  4NF8 A;  1JVX A;  1FPG A;  4N13 A;  2CEY A;  3GXA A;  1RYO A;  1BP5 A;  5H8N B;  1FPD A;  3CSG A;  1Z7N E;  1MQG A;  4NN3 A;  1LAX A;  5EQ9 A;  4F29 A;  1G0H A;  2P3V A;  1QKA A;  1URD A;  1JP4 A;  1DMB A;  2ONS A;  3VV5 A;  3LSL A;  4KYS A;  3TTL A;  1Y3P A;  2UVJ A;  1FTA A;  2ZNS A;  2QSX A;  2UYE A;  5AE4 A;  1SW5 A;  4OMB A;  4LA9 A;  5ITO A;  3S9E A;  4G68 B;  4DI3 D;  4DXU A;  1IUD A;  3K4U A;  4DLD A;  1RYX A;  4QFO A;  2Z23 A;  3S9M C;  1US4 A;  4DDD A;  3G3G A;  1F9B A;  1FPL A;  3HHG A;  2FVZ A;  3PMV A;  2CEX A;  3LSX A;  2GFE A;  2GH9 A;  5TP9 B;  3DLN A;  3IR1 A;  3U8Q A;  2F78 A;  2VHA A;  1B7Z A;  1NH7 A;  3MZ9 A;  1GTK A;  4NF0 A;  1Y20 A;  3K02 A;  5IGA A;  5H8N A;  3K6V A;  3OMB A;  3PUY E;  4QHQ A;  2L5V A;  4RK2 A;  2WBD A;  4NF4 B;  3QMF A;  1NV3 A;  1EYJ A;  4OFO A;  1URG A;  5ET8 A;  1R1N A;  1A54 A;  1AH5 A;  5I57 B;  3E13 X;  3KZG A;  3B6W A;  2V3Q A;  2P3N A;  4I40 A;  4X1D A;  3E3K A;  4YZZ A;  4H5F A;  3O97 A;  2I3V A;  3K1M A;  3OD7 A;  1DSN A;  4XF5 A;  3LBS A;  1Y3Q A;  3CFZ A;  3V83 A;  4XTC Q;  1PBQ A;  3QK6 A;  4G68 A;  1I6B A;  3FIR A;  4HW8 A;  2Q88 A;  4F2Q A;  4WEP A;  1M5F A;  4GBW A;  3PD8 A;  4AB5 A;  2R6G E;  2QFL A;  3MVZ A;  4XKP A;  3TQW A;  1BLF A;  2ALU A;  2DP8 A;  4K3F A;  1M5C A;  1DCU A;  3T9X B;  4QFL A;  5TP9 A;  1NUW A;  4Z0I A;  4F3P A;  2DXY A;  3RLF E;  2RKM A;  5AA2 D;  5ICT A;  4PTK A;  1FBG A;  4NF4 A;  4C1T A;  2QVU A;  2A5S A;  4ZE8 A;  4BDM A;  2ANJ A;  5I57 A;  1OVB A;  3HPI A;  1LST A;  2Q2C A;  1TWY A;  4XXU A;  5L9M A;  4HE1 A;  4JVC A;  4RNS A;  2XXR A;  3RUM A;  1P1N A;  5IZ1 A;  4BDL A;  3MAM A;  3FV2 A;  1IXI A;  4U1O A;  1HSL A;  3CI8 A;  1FBE A;  3MST A;  2O1L A;  3ZS6 A;  1NUZ A;  1UQW A;  3GYY A;  3G3I A;  2A5T B;  3WAE A;  3FVK A;  1T0K A;  4FE8 A;  4FEC A;  5EYH A;  1B3G A;  2Z8E A;  3Q28 A;  1IMC A;  3DP6 A;  2HCA A;  4OYV A;  4IY6 A;  3Q26 A;  3GZG A;  2I3W A;  3C36 A;  4F18 A;  1NNF A;  4GBV A;  2XXX A;  3PUW E;  1MM7 A;  1XVY A;  4MJO A;  4E0X A;  5I58 B;  1CB6 A;  3TTN A;  1EH3 A;  5F7V A;  4EQ9 A;  4NF6 B;  1OQG A;  2F3B A;  4AQ4 A;  3MC2 A;  3PUV E;  3FXR A;  5H8S A;  3VVF A;  3O6I A;  1NMU A;  3LC8 A;  1MDP 1;  1IXC A;  3E79 A;  2D5W A;  1DOT A;  4QFK A;  1NNT A;  4PDH A;  1R6Z A;  4MNI A;  3S2V A;  4O7M A;  3HFU A;  4LZ7 A;  2KR0 A;  1NNK A;  1UIU A;  3OEK A;  1IME A;  1B5H A;  3SER A;  2XXQ A;  3G3J A;  1FCK A;  4PBQ A;  2UVI A;  2V4C A;  5CMM A;  2CZL A;  5DVJ A;  1ZLQ A;  4MEV A;  2Q74 A;  5KDT B;  3VLU A;  2FA7 A;  4X9T A;  4PFI A;  3IOT A;  4KI0 E;  4YB7 A;  3P7I A;  2VOZ A;  3RQT A;  2F36 A;  2GRV A;  1FQF A;  5I58 A;  4IB2 A;  4PGN A;  2ONK E;  3K1P A;  4H5G A;  4NF6 A;  5DYH A;  5I5P A;  1US5 A;  3V89 B;  4X8R A;  4U21 A;  4ZEF A;  1I6Q A;  4L17 A;  1N76 A;  1FQA A;  4ESX A;  1P99 A;  4OVQ A;  4Q0C A;  2G29 A;  3FGS A;  2FIX A;  4NWD A;  1H45 A;  3Q29 A;  2P0S A;  3IOW A;  1I69 A;  3K01 A;  4FED A;  1BTJ A;  2XXI A;  5CC2 A;  4NWC A;  4R2F A;  1MH3 A;  4RJZ A;  4H46 A;  5KDT A;  3CG1 A;  4YKP A;  5I2N B;  4PAK A;  3FVG A;  3W9V A;  1VFD A;  1FBF A;  4I3E A;  4NE4 A;  2AL4 A;  2Z8F A;  1AWB A;  3W9W A;  4QXD A;  4MCO A;  4G2Z A;  2Q8J A;  2PFY A;  1TXF A;  3PPO A;  4OET A;  1WDN A;  1AMF A;  1A55 A;  1MXZ A;  4F1V A;  2D3I A;  1M5E A;  1FQC A;  2E1S A;  2Y7W A;  5ET7 A;  1FJ6 A;  2GHA A;  3TOD A;  1IEJ A;  4U4S A;  4RYA A;  3CRB A;  4HE0 A;  4XEQ A;  2Q9T A;  3K6U A;  2QJE A;  3OEL A;  4R2B A;  1JEU A;  4O3C A;  5IZ3 A;  5TU0 A;  4R75 A;  2Y7P A;  1N0T A;  1NI9 A;  4OQO A;  5I2N A;  4PC9 A;  2UVH A;  4TQU Q;  1XT8 A;  4WXJ A;  1B5J A;  2XD2 A;  3IB1 A;  1IMA A;  1BKA A;  2MKZ A;  4NTL A;  1SDX A;  2WYP A;  4BDQ A;  2VD3 A;  4BLA A;  2HPG A;  1HSE A;  3RGY A;  2V84 A;  4PF6 A;  2FNC A;  2XX9 A;  1XHY A;  3HV1 A;  1YYZ A;  3T93 B;  1OLC A;  2I4C A;  3TPA A;  3UOR A;  3ZSF A;  1VDW A;  1FBD A;  4KR5 A;  4YKI A;  3IAZ A;  3S9N C;  3KJT A;  2XX8 A;  1SBP A;  4N8Y A;  3SDF A;  3G3H A;  2OCU A;  2Z22 A;  5L9O A;  3Q27 A;  2XWI A;  5CMK A;  1WVJ A;  2VPN A;  3H06 B;  5FHO A;  2XXY A;  1D3K A;  5CMB A;  3TTK A;  5BUU A;  3D4G A;  4Q30 B;  4H65 A;  3V5A A;  2WEF A;  1B46 A;  3PPR A;  4QSE A;  1NUX A;  3MVW A;  3FJM A;  5BWJ A;  4P56 A;  4O7I A;  3EHU A;  3H4Z A;  4R6K A;  1JET A;  5IZZ A;  2QS3 A;  2ONR A;  1LBX A;  4LZ8 A;  4ZZA A;  3HN0 A;  3RT6 B;  5CRY A;  3IFC A;  1R9Q A;  4DZ1 A;  2F5X A;  2F97 A;  3PUZ E;  1NV0 A;  1UTH B;  4GLI A;  3TMG A;  1MG1 A;  2RC7 A;  2OLB A;  2DXR A;  1IMD A;  4PET A;  1UTB B;  2KQZ A;  1QVS A;  1FTJ A;  4IGT A;  4WKM A;  1QJM A;  4DIG A;  1PDA A;  3S4U A;  2DVC A;  4MLV A;  2Y7K A;  1B7U A;  5B7D A;  3PPP A;  4F31 B;  4NED A;  5TPA B;  1OLA A;  3LV0 A;  4LQ2 A;  4MNC A;  1MY3 A;  3CIJ A;  1PBP A;  3IB2 A;  4EQB A;  4N6P A;  2Q89 A;  5JK4 A;  2DOJ A;  3ILU B;  3TKD A;  2IEE A;  2HFB A;  1UIV A;  1LFI A;  5EYG A;  2X26 A;  1NV4 A;  3CR9 A;  2ESN A;  3MQ9 A;  3BFU A;  4IGR A;  2HXR A;  4G4P A;  1UTH A;  1J1N A;  2DVZ A;  1LAF E;  4P47 A;  1L5T A;  4PP0 A;  5AA2 B;  1UTB A;  3G7W A;  2RIN A;  3K6W A;  3IL1 B;  1HSJ A;  2DSF A;  3I5O A;  3IB0 A;  1PB9 A;  1O7T A;  4YKJ A;  1BIY A;  4DI4 B;  2OZZ A;  3ONM A;  2HHM A;  1RKM A;  3K6X A;  4FOR A;  5TPA A;  1B3L A;  1FPJ A;  5DVI A;  1LBY A;  3MBP A;  3MVY A;  3KC1 A;  3MJN A;  2BJJ X;  2Y7R A;  5FHM A;  2Y5K A;  4DCX A;  4BDN A;  2DE4 A;  4OVP A;  1AL3 A;  1XC1 A;  4I8C A;  3H6W A;  3C32 A;  4P0G A;  4QF9 A;  3TCF A;  2REJ A;  3ZKK A;  1A7L A;  2THI A;  5L9S A;  1M5D A;  2YLN A;  2DWA A;  3U72 A;  2QMX A;  2I0B A;  2XWO A;  4X04 A;  3AXF A;  2WX9 A;  1EYK A;  4JSD A;  3KBZ A;  4KPT A;  3TUS A;  5AA2 A;  2DE2 A;  1B05 A;  2Y5L A;  1SYH A;  4AS4 A;  1MY2 A;  1A40 A;  5ET5 A;  1B51 A;  3LUY A;  5AA4 B;  2AL5 A;  3CFX A;  3PUX E;  1Y4C A;  3R6U A;  1MY0 A;  3KJ7 A;  4OXV A;  5CM6 A;  2ZYM A;  4H0W A;  1FPF A;  2AIX A;  1OIB A;  1YXI A;  1Q35 A;  1KA1 A;  4ESW A;  3BFT A;  2R8T A;  4ZZE A;  3H03 A;  5EHM A;  1MPC A;  4H45 A;  4G8N A;  3QYT A;  1I6A A;  4ECF A;  4QSD A;  1FJ9 A;  1A8F A;  3U93 A;  3SEW A;  3LUZ A;  3THI A;  4KYE A;  3B6Q A;  3EN3 A;  1QKB A;  3FAT A;  5T3J A;  4I3Y A;  4N17 A;  1LBZ A;  4GL0 A;  5EQ7 A;  2O51 A;  3K0V A;  4F22 A;  3IOV A;  1LB9 A;  2X7Q A;  4MNP A;  4OER A;  1DTG A;  4IO4 A;  3C35 A;  3L6H A;  3MVX A;  5LDZ A;  1S7Y A;  4R73 A;  4QBA A;  1K9Z A;  3DP8 A;  3QIM A;  5A5L A;  1EYI A;  5AA4 A;  4PQJ A;  4YB5 A;  5DW8 A;  1ZMG A;  1JW4 A;  2VPO A;  1FTO A;  2OWT A;  4MAG A;  2RC8 A;  2Q2A A;  2H98 A;  2VGQ A;  3OSQ A;  4N6K A;  3T0J A;  5FHN A;  2F7C A;  2ZZW A;  1QGX A;  1IIW A;  4LN5 A;  3QAX A;  1VFE A;  4XKR A;  4NG7 A;  3T9H B;  1WOD A;  4QSC A;  1ELJ A;  1KZ8 A;  4G61 A;  2JJK A;  4F39 A;  3MW0 A;  2HEU A;  3EKI A;  2UXA A;  4KCC A;  2DQV A;  3T9U A;  4Q5T A;  1B4H A;  4MF3 A;  1OQH A;  1O64 A;  2O7U A;  4I1D A;  3KEI A;  3KN3 A;  3KSJ A;  4ZDM A;  4AS5 A;  5I3S A;  4P1E A;  2ABH A;  4OA4 A;  3H6T A;  5IAI A;  3TYH A;  1EU8 A;  2F35 A;  4PCD A;  2AYS A;  2XXV A;  2PT1 A;  1LBC A;  4HCW A;  1M5B A;  3H3G A;  4EUO A;  1EZP A;  1MQH A;  3EHT A;  4PFR A;  3SET A;  1B5I A;  3CFL A;  1SI0 A;  4N07 A;  3IO4 A;  3A29 A;  1RDZ A;  3BBR A;  4R9G A;  4QFP A;  1QUK A;  5IKB A;  2FIE A;  4GFR A;  3UK4 A;  1DBZ A;  1YCJ A;  2V93 A;  3ILT B;  3VXB A;  2O6A A;  3VDF A;  2DDK A;  2I6E A;  3KBR A;  2V3T A;  1H43 A;  1NH8 A;  2RCB A;  3LSF B;  3UIF A;  2RC9 A;  4LZ5 A;  4JB7 A;  1MXX A;  1SW2 A;  4BDO A;  1JW5 A;  4O3A A;  2Y84 A;  3JZJ A;  3PU5 A;  3OO9 A;  3O9P A;  3KOS A;  3ZKL A;  4OEU A;  3N94 A;  1SYI A;  1FQD A;  1EZ9 A;  4YU0 A;  2V25 A;  2YJP A;  3T96 B;  3B6T A;  4GWU A;  1MXU A;  3OO8 A;  4KFQ A;  1EZO A;  5F24 A;  4XKN A;  3IK6 B;  2CZK A;  2XA5 A;  4P8B A;  1ZIU A;  2XXU A;  1KWH A;  5L8D A;  3JYR A;  2ZMB A;  2CMO A;  4XKQ A;  4C0R A;  1TT1 A;  1ANF A;  5DVF A;  1CNQ A;  4N4U A;  2M8C A;  3C4M A;  5IZ3 B;  4M1V A;  1IIT A;  2Q8M A;  2PVU A;  3B8B A;  2Y7I A;  1Y4T A;  3OOA A;  3FBP A;  5AA3 A;  2PCR A;  3DP4 A;  2NWJ A;  3S9L C;  1SW1 A;  4O8M A;  5DT6 A;  1B1X A;  1Y3N A;  4MLQ A;  1TFD A;  4OAN A;  2QS4 A;  5AA1 A;  4LVQ A;  5F1Q A;  3FVN A;  1NUY A;  2QS1 A;  4KHZ E;  4BDR A;  1N7W A;  1DK4 A;  3NOH A;  4ELR A;  4ND9 A;  2XWK A;  4IY5 A;  4PFU A;  3H7M A;  1XS5 A;  3KOT A;  1VR5 A;  1B0H A;  2B65 A;  4RK9 A;  5H8Q B;  4ZE9 A;  5ICQ A;  4MH5 A;  1Z7M E;  1IMB A;  2QVR A;  4DXC A;  4YAH X;  2XXW A;  1FTK A;  1PB8 A;  3EQ1 A;  2F3D A;  1LFH A;  2NVU B;  4R72 A;  3MUQ A;  3M8U A;  4GX4 A;  3I6V A;  1P1W A;  4N8G A;  3RNN A;  3FXB A;  3ROJ A;  3G3K A;  2XD3 A;  5LOM A;  4PE3 A;  3C9H A;  5ISU A;  2B4M A;  3N5L A;  3R26 A;  5LTC A;  2WKY A;  1H44 A;  4ZEC A;  3PV0 E;  4RY1 A;  1QUJ A;  2ZNT A;  2ZYO A;  2F6G A;  4QRZ A;  1YPN A;  4G77 A;  3T1B A;  1USY E;  4TLM B;  2KLF A;  3QUF A;  3IFA A;  2HAV A;  2PT2 A;  3CHG A;  1LCF A;  2QMW A;  3MPL A;  5H8Q A;  2QS2 A;  2PFZ A;  1NL5 A;  4DCY A;  1ZJL A;  5JEI A;  3O66 A;  4DXB A;  2OBG A;  1FPK A;  1URS A;  4MHF A;  3E9X A;  3KG2 A;  1NV5 A;  3IO6 A;  3M3F A;  1USY H;  2UYF A;  4F19 A;  4FJP A;  3KGC A;  4R6Y A; 
#chains in the Genus database with same CATH homology
 4IO3 A;  3E4R A;  3TTR A;  3ODB A;  3H6U A;  2FYI A;  1SQY A;  3U92 A;  3GBB A;  2O84 X;  5EYF A;  3MP8 A;  1MQI A;  3FAS A;  4ELP A;  4H8I A;  1MPD A;  1A99 A;  3M3L A;  2REG A;  1MS7 A;  5FTI A;  4I62 A;  1AOV A;  4PE5 B;  1GR2 A;  4X1B A;  1SI1 A;  4G8H A;  2I0C A;  4GXS B;  4R9F A;  1IZ1 A;  2G93 A;  4ZS9 A;  1S9T A;  4EDP A;  1N84 A;  4YIC A;  1GGG A;  1N3W A;  4ISU A;  4FAT A;  4WED A;  4IO2 A;  1FW0 A;  4KYD A;  1FQB A;  2OK2 A;  3C34 A;  1DPE A;  3TEP A;  5CMC A;  4LAT A;  4RXL A;  2DS9 A;  3UP9 A;  1OVT A;  4MBP A;  1NNP A;  1R9L A;  2R71 A;  3B7D A;  2O68 A;  3LSW A;  2RF1 A;  1O63 A;  2XHD A;  3BKI B;  3VVE A;  2XX7 A;  3PPN A;  2B3F A;  3DM0 A;  4R6H A;  4GRK A;  3TAJ A;  2XXT A;  1ZBM A;  3UGW A;  4ELO A;  1CE2 A;  1Y1M A;  2NXO A;  3C33 A;  3UN6 A;  3RN8 A;  4M4G A;  3RTF B;  4FAJ A;  4GWO A;  2H5Y A;  4HS7 A;  3OSR A;  2H9B A;  1N04 A;  5B70 A;  2Z8D A;  4JBZ A;  3MZB A;  5ELV A;  4YMA A;  3N6T A;  2D21 A;  3SES A;  3MPK A;  3IOU A;  5H8H B;  5I84 A;  4O3B A;  4RPO A;  1DTZ A;  3FV1 A;  4P11 A;  2PYY A;  3N26 A;  4YB6 A;  3VFJ A;  3D4C A;  2O1M A;  3UA8 A;  2ZYN A;  1LB8 A;  1Y1Z A;  3CVG A;  1MY1 A;  3C31 A;  3HHF A;  3TTM A;  4GD5 A;  3VXC A;  1MM6 A;  4HCY A;  5KCJ B;  1FTL A;  2O69 A;  5DTB A;  4RPN A;  3RPW A;  3G3F A;  1JQF A;  2ZNU A;  2DWI A;  3TCH A;  3SEY A;  4LON B;  3Q25 A;  3EHS A;  3L6G A;  3FVO A;  5I59 B;  1LFG A;  4JDF A;  3SEU A;  3PMX A;  3SKP A;  2F7B A;  3N6U A;  1VSO A;  3T66 A;  1H76 A;  5H8H A;  2DE3 A;  1MRP A;  4EF2 A;  4F1U A;  3VVD A;  1B4Z A;  3TFL A;  4FEB A;  4Q8R A;  4ZEK A;  3TEL A;  2VP1 A;  1B9J A;  3FUZ A;  3QXM A;  5CBR A;  3HO7 A;  3EPE A;  1XOC A;  1XVX A;  3RT8 A;  2P1S A;  1AIV A;  1QUI A;  1DPP A;  2PMS A;  4JWY A;  3GLB A;  5KCJ A;  5HBC A;  4X48 A;  3VLV A;  5I56 B;  2IA4 A;  3OEN A;  2P2A A;  2OJT A;  2QL3 A;  5CI5 A;  4IO6 A;  3TZA A;  3K1N A;  3OEM A;  5I59 A;  4JXI A;  1YAE A;  4JSO A;  3FD3 A;  2F7A A;  1N3X A;  3WAF A;  4OFJ A;  4U4X A;  2I4B A;  4UAC A;  3FZV A;  3MP6 A;  4E0W A;  2R9J A;  5I2K B;  4F3G A;  5J1D A;  3PGF A;  4IO5 A;  3KFM A;  3CG3 A;  3IOR A;  4F3S A;  1VE4 A;  4GIZ A;  3FXQ A;  3QSL A;  1IXG A;  1A8E A;  1B1H A;  1GVC A;  5I56 A;  1ZKB A;  4EF1 A;  1B40 A;  3GBA A;  3KSX A;  2ZXT A;  1OMP A;  3KN8 A;  1P1U A;  4Z7E A;  4YMB A;  5CBS A;  1B6H A;  3IJX B;  4LUB A;  1JNF A;  2A5T A;  1B58 A;  1POT A;  1LLS A;  3RTW B;  1MH4 A;  3PD9 A;  3KN7 A;  4HTG A;  1II5 A;  5I2K A;  1JVY A;  2H25 A;  5ITP A;  2F8D A;  2GHB A;  3ECR A;  1LBB A;  4KQP A;  1Q1K A;  5H8F B;  2I49 A;  4OEN A;  1MXY A;  2VD2 A;  2DWH A;  4GXA A;  3A3U A;  1B0L A;  2I58 A;  1SD3 A;  1ZTY A;  1QUL A;  4POX A;  4OZ9 A;  3DEL B;  1B52 A;  3OO7 A;  3QUJ A;  4JWX A;  4U23 A;  2F34 A;  1P1O A;  2LAO A;  1N7X A;  4H8J A;  4OVJ A;  3K2D A;  2I48 A;  4PFT A;  1IXH A;  5FTH A;  5A5X B;  4H67 A;  1MXW A;  1D4N A;  4OEV A;  5KZT A;  5DEX B;  4KD5 A;  3SEV A;  1PEB A;  4OES A;  4POW A;  1LGB C;  5HM4 B;  3OXN A;  4G8M A;  5H8F A;  2V3U A;  4U2R A;  4LP2 B;  4GOT A;  3VE1 B;  4AB6 A;  2YPN A;  1MDQ A;  1MQJ A;  3EF7 A;  4U1Z A;  3SEX A;  4THI A;  1LAH E;  3U1O A;  1B32 A;  2QRY A;  3I3V A;  1NKX A;  1JW1 A;  2PBW A;  3FJG A;  1MQD A;  1POY 1;  1FQE A;  3HST A;  4C1U A;  3T9V A;  2QPQ A;  5A5X A;  4ZEI A;  3O29 A;  3JV9 A;  2UVG A;  1B3H A;  4DE8 A;  5JTY B;  3O2A A;  3W15 C;  4LQ5 A;  5DEX A;  4EXL A;  3FXU A;  2HXW A;  3H6V A;  5K2Y A;  4H1X A;  3MZ1 A;  4F2O A;  3PMW A;  1PB7 A;  1TFA A;  3V8X B;  2DYX A;  3TDJ A;  1B3F A;  1PC3 A;  4F3B A;  4NMY A;  4GF8 A;  4JWO A;  4NF5 B;  4F1Y A;  5HPQ A;  2W7Y A;  3A09 A;  1QW0 A;  3MP1 A;  4GVO A;  1MXV A;  3IJO B;  3M3K A;  4YKK A;  1D9V A;  1FTM A;  4PFW A;  4GQO A;  4XIG Q;  1JEV A;  3A3C A;  1MY4 A;  3RY3 A;  5JTY A;  1SVX B;  4ONY A;  4RA1 A;  3F11 A;  4OTE A;  1IQ7 A;  3IX1 A;  4TLL B;  2H4I A;  2E0S A;  4KCD A;  1ATG A;  2XXH A;  2O7I A;  3R7X A;  3K00 A;  1YTV A;  2XXP A;  1B2H A;  3LR1 A;  1H3D A;  3O28 A;  3FJ7 A;  4I9D A;  4NF5 A;  4H6D A;  3O6H A;  3MWB A;  4P0I A;  4R74 A;  2HQ0 A;  2B3B A;  1S50 A;  2ZYK A;  2H99 A;  1LCT A;  3VLW A;  4NF8 B;  1LAG E;  4ZED A;  4U22 A;  4ELQ A;  3CSB A;  5M2V A;  3O6G A;  4EXK A;  4ZEB A;  3TQL A;  5EHS A;  2PX1 A;  1B7H A;  3T22 A;  2X7P A;  4UA8 A;  1MPB A;  2HZL A;  3USD A;  4GL8 A;  2HAU A;  1NFT A;  2F6P A;  3HCQ A;  4OFL A;  4FIM A;  2NOO A;  3OO6 A;  2RCA A;  4PFY A;  4TOZ A;  3TCG A;  1Y9U A;  1P1Q A;  4G68 C;  1D9Y A;  1GV8 A;  3PPQ A;  5K2X A;  1ZU0 A;  1SW4 A;  2HZK A;  4MFI A;  1B3E A;  2NUV A;  4OWD A;  2DWJ A;  4EQ7 A;  3U94 A;  4IO7 A;  4QFN A;  2OWS A;  4OHN A;  4NF8 A;  1JVX A;  4N13 A;  3GXA A;  1RYO A;  1BP5 A;  5H8N B;  3CSG A;  1Z7N E;  1MQG A;  1LAX A;  4F29 A;  1QKA A;  1URD A;  1DMB A;  2ONS A;  3VV5 A;  3LSL A;  4KYS A;  3TTL A;  1Y3P A;  2UVJ A;  2ZNS A;  2QSX A;  2UYE A;  5AE4 A;  1SW5 A;  4OMB A;  4LA9 A;  5ITO A;  3S9E A;  4G68 B;  4DXU A;  1IUD A;  3K4U A;  4DLD A;  1RYX A;  4QFO A;  2Z23 A;  3S9M C;  1US4 A;  4DDD A;  3G3G A;  1F9B A;  3HHG A;  3PMV A;  3LSX A;  2GFE A;  2GH9 A;  5TP9 B;  3U8Q A;  3DLN A;  3IR1 A;  2F78 A;  2VHA A;  1B7Z A;  1NH7 A;  3MZ9 A;  1GTK A;  1Y20 A;  3K02 A;  5H8N A;  3K6V A;  3OMB A;  3PUY E;  4QHQ A;  4RK2 A;  4NF4 B;  4OFO A;  1URG A;  1R1N A;  1A54 A;  1AH5 A;  5I57 B;  3E13 X;  3KZG A;  3B6W A;  2V3Q A;  4X1D A;  3E3K A;  4YZZ A;  4H5F A;  3O97 A;  2I3V A;  3K1M A;  3OD7 A;  1DSN A;  3LBS A;  1Y3Q A;  3CFZ A;  3V83 A;  4XTC Q;  1PBQ A;  3QK6 A;  4G68 A;  1I6B A;  3FIR A;  4HW8 A;  2Q88 A;  4F2Q A;  4WEP A;  1M5F A;  3PD8 A;  4AB5 A;  2R6G E;  4XKP A;  3MVZ A;  3TQW A;  1BLF A;  2ALU A;  2DP8 A;  4K3F A;  1M5C A;  3T9X B;  4QFL A;  5TP9 A;  4Z0I A;  4F3P A;  2DXY A;  3RLF E;  2RKM A;  5AA2 D;  5ICT A;  4NF4 A;  4C1T A;  2A5S A;  4ZE8 A;  4BDM A;  2ANJ A;  5I57 A;  1OVB A;  3HPI A;  1LST A;  2Q2C A;  1TWY A;  4XXU A;  5L9M A;  4RNS A;  2XXR A;  3RUM A;  1P1N A;  4BDL A;  3MAM A;  3FV2 A;  1IXI A;  4U1O A;  1HSL A;  3CI8 A;  2O1L A;  3ZS6 A;  1UQW A;  3G3I A;  2A5T B;  3WAE A;  3FVK A;  1T0K A;  4FE8 A;  4FEC A;  1B3G A;  2Z8E A;  3Q28 A;  3DP6 A;  2HCA A;  4OYV A;  4IY6 A;  3Q26 A;  3GZG A;  2I3W A;  3C36 A;  4F18 A;  1NNF A;  2XXX A;  3PUW E;  1MM7 A;  1XVY A;  4E0X A;  5I58 B;  1CB6 A;  3TTN A;  1EH3 A;  5F7V A;  4EQ9 A;  4NF6 B;  1OQG A;  4AQ4 A;  3MC2 A;  3PUV E;  3FXR A;  5H8S A;  3VVF A;  3O6I A;  1NMU A;  3LC8 A;  1MDP 1;  1IXC A;  2D5W A;  1DOT A;  4QFK A;  1NNT A;  1R6Z A;  3S2V A;  4LZ7 A;  1NNK A;  1UIU A;  3OEK A;  1B5H A;  3SER A;  2XXQ A;  3G3J A;  1FCK A;  2UVI A;  5CMM A;  2CZL A;  5DVJ A;  1ZLQ A;  5KDT B;  3VLU A;  2FA7 A;  4X9T A;  3IOT A;  4KI0 E;  4YB7 A;  3P7I A;  2VOZ A;  3RQT A;  2F36 A;  2GRV A;  1FQF A;  5I58 A;  4IB2 A;  2ONK E;  3K1P A;  4H5G A;  4NF6 A;  5DYH A;  1US5 A;  3V89 B;  4U21 A;  4ZEF A;  1I6Q A;  4L17 A;  1N76 A;  1FQA A;  4ESX A;  1P99 A;  4Q0C A;  2G29 A;  3FGS A;  4NWD A;  1H45 A;  3Q29 A;  2P0S A;  3IOW A;  1I69 A;  3K01 A;  4FED A;  1BTJ A;  2XXI A;  5CC2 A;  4NWC A;  4R2F A;  1MH3 A;  4RJZ A;  5KDT A;  3CG1 A;  4YKP A;  5I2N B;  3FVG A;  3W9V A;  1VFD A;  4NE4 A;  2AL4 A;  2Z8F A;  3W9W A;  4G2Z A;  2Q8J A;  1TXF A;  3PPO A;  4OET A;  1WDN A;  1AMF A;  1A55 A;  1MXZ A;  4F1V A;  2D3I A;  1M5E A;  1FQC A;  2E1S A;  2Y7W A;  2GHA A;  3TOD A;  1IEJ A;  4U4S A;  4RYA A;  3CRB A;  2Q9T A;  3K6U A;  2QJE A;  3OEL A;  4R2B A;  1JEU A;  4O3C A;  5TU0 A;  4R75 A;  2Y7P A;  1N0T A;  4OQO A;  5I2N A;  2UVH A;  4TQU Q;  1XT8 A;  4WXJ A;  1B5J A;  2XD2 A;  3IB1 A;  1BKA A;  4NTL A;  1SDX A;  4BDQ A;  2VD3 A;  4BLA A;  1HSE A;  3RGY A;  2V84 A;  2FNC A;  2XX9 A;  1XHY A;  3HV1 A;  3T93 B;  1OLC A;  2I4C A;  3TPA A;  3UOR A;  3ZSF A;  4KR5 A;  4YKI A;  3IAZ A;  3S9N C;  3KJT A;  2XX8 A;  1SBP A;  3SDF A;  3G3H A;  2OCU A;  2Z22 A;  5L9O A;  3Q27 A;  5CMK A;  1WVJ A;  3H06 B;  5FHO A;  2XXY A;  1D3K A;  5CMB A;  3TTK A;  5BUU A;  3D4G A;  4Q30 B;  4H65 A;  3V5A A;  1B46 A;  3PPR A;  4QSE A;  3MVW A;  3FJM A;  5BWJ A;  3EHU A;  3H4Z A;  4R6K A;  1JET A;  2QS3 A;  2ONR A;  4LZ8 A;  4ZZA A;  3HN0 A;  3RT6 B;  5CRY A;  1R9Q A;  4DZ1 A;  2F5X A;  2F97 A;  3PUZ E;  1UTH B;  4GLI A;  3TMG A;  1MG1 A;  2RC7 A;  2OLB A;  2DXR A;  4PET A;  1UTB B;  1QVS A;  1FTJ A;  4IGT A;  4WKM A;  1QJM A;  4DIG A;  1PDA A;  3S4U A;  2DVC A;  4MLV A;  2Y7K A;  1B7U A;  5B7D A;  3PPP A;  4F31 B;  4NED A;  5TPA B;  1OLA A;  4LQ2 A;  1MY3 A;  3CIJ A;  1PBP A;  3IB2 A;  4EQB A;  4N6P A;  2Q89 A;  5JK4 A;  2DOJ A;  3ILU B;  3TKD A;  2IEE A;  2HFB A;  1UIV A;  1LFI A;  2X26 A;  3CR9 A;  2ESN A;  3MQ9 A;  3BFU A;  4IGR A;  4G4P A;  1UTH A;  1J1N A;  2DVZ A;  1LAF E;  1L5T A;  4PP0 A;  5AA2 B;  1UTB A;  3G7W A;  2RIN A;  3K6W A;  3IL1 B;  1HSJ A;  2DSF A;  3I5O A;  3IB0 A;  1PB9 A;  1O7T A;  4YKJ A;  1BIY A;  2OZZ A;  3ONM A;  1RKM A;  3K6X A;  4FOR A;  5TPA A;  1B3L A;  5DVI A;  3MBP A;  3MVY A;  3MJN A;  2BJJ X;  2Y7R A;  5FHM A;  4DCX A;  4BDN A;  2DE4 A;  1AL3 A;  1XC1 A;  4I8C A;  3H6W A;  3C32 A;  4P0G A;  4QF9 A;  3TCF A;  2REJ A;  3ZKK A;  1A7L A;  2THI A;  5L9S A;  1M5D A;  2YLN A;  2DWA A;  3U72 A;  2QMX A;  2I0B A;  3AXF A;  4JSD A;  4KPT A;  3TUS A;  5AA2 A;  2DE2 A;  1B05 A;  1SYH A;  1MY2 A;  1A40 A;  1B51 A;  3LUY A;  5AA4 B;  2AL5 A;  3CFX A;  3PUX E;  1Y4C A;  3R6U A;  1MY0 A;  3KJ7 A;  4OXV A;  5CM6 A;  2ZYM A;  4H0W A;  2AIX A;  1OIB A;  1Q35 A;  4ESW A;  3BFT A;  4ZZE A;  3H03 A;  5EHM A;  1MPC A;  4G8N A;  3QYT A;  1I6A A;  4ECF A;  4QSD A;  1A8F A;  3U93 A;  3SEW A;  3THI A;  4KYE A;  3B6Q A;  3EN3 A;  1QKB A;  3FAT A;  4GL0 A;  2O51 A;  3K0V A;  4F22 A;  3IOV A;  1LB9 A;  2X7Q A;  4OER A;  1DTG A;  4IO4 A;  3C35 A;  3L6H A;  3MVX A;  1S7Y A;  4R73 A;  3DP8 A;  3QIM A;  5AA4 A;  4PQJ A;  4YB5 A;  1ZMG A;  1JW4 A;  1FTO A;  2OWT A;  2RC8 A;  2Q2A A;  2H98 A;  2VGQ A;  3OSQ A;  5FHN A;  2F7C A;  1IIW A;  3QAX A;  1VFE A;  4XKR A;  3T9H B;  1WOD A;  4QSC A;  1ELJ A;  4F39 A;  3MW0 A;  2HEU A;  2UXA A;  4KCC A;  2DQV A;  3T9U A;  4Q5T A;  1B4H A;  4MF3 A;  1OQH A;  1O64 A;  2O7U A;  4I1D A;  3KEI A;  3KN3 A;  3KSJ A;  4ZDM A;  2ABH A;  3H6T A;  5IAI A;  3TYH A;  1EU8 A;  2F35 A;  2AYS A;  2XXV A;  2PT1 A;  1LBC A;  4HCW A;  1M5B A;  3H3G A;  4EUO A;  1EZP A;  1MQH A;  3EHT A;  3SET A;  1B5I A;  3CFL A;  1SI0 A;  4N07 A;  3IO4 A;  3BBR A;  4R9G A;  4QFP A;  1QUK A;  5IKB A;  4GFR A;  3UK4 A;  1YCJ A;  2V93 A;  3ILT B;  3VXB A;  2O6A A;  3VDF A;  3KBR A;  2I6E A;  2V3T A;  1H43 A;  1NH8 A;  2RCB A;  3LSF B;  3UIF A;  2RC9 A;  4LZ5 A;  4JB7 A;  1MXX A;  1SW2 A;  4BDO A;  1JW5 A;  4O3A A;  2Y84 A;  3JZJ A;  3PU5 A;  3OO9 A;  3O9P A;  3KOS A;  3ZKL A;  4OEU A;  3N94 A;  1SYI A;  1FQD A;  1EZ9 A;  4YU0 A;  2V25 A;  2YJP A;  3T96 B;  3B6T A;  1MXU A;  3OO8 A;  4KFQ A;  1EZO A;  4XKN A;  3IK6 B;  1ZIU A;  2XXU A;  1KWH A;  5L8D A;  3JYR A;  2ZMB A;  2CMO A;  4XKQ A;  4C0R A;  1TT1 A;  1ANF A;  5DVF A;  2M8C A;  3C4M A;  4M1V A;  1IIT A;  2PVU A;  2Y7I A;  1Y4T A;  3OOA A;  5AA3 A;  3DP4 A;  2NWJ A;  3S9L C;  1SW1 A;  5DT6 A;  1B1X A;  1Y3N A;  4MLQ A;  1TFD A;  2QS4 A;  5AA1 A;  4LVQ A;  5F1Q A;  3FVN A;  2QS1 A;  4KHZ E;  4BDR A;  1N7W A;  4ELR A;  4ND9 A;  4IY5 A;  4PFU A;  3H7M A;  1XS5 A;  3KOT A;  1VR5 A;  1B0H A;  2B65 A;  4RK9 A;  5H8Q B;  4ZE9 A;  5ICQ A;  4MH5 A;  1Z7M E;  4DXC A;  4YAH X;  2XXW A;  1FTK A;  1PB8 A;  3EQ1 A;  1LFH A;  2NVU B;  4R72 A;  3MUQ A;  3M8U A;  3I6V A;  1P1W A;  3RNN A;  3G3K A;  2XD3 A;  5LOM A;  3C9H A;  5ISU A;  3N5L A;  3R26 A;  2WKY A;  1H44 A;  4ZEC A;  3PV0 E;  4RY1 A;  1QUJ A;  2ZNT A;  2ZYO A;  2F6G A;  4QRZ A;  1YPN A;  4G77 A;  1USY E;  4TLM B;  2KLF A;  3QUF A;  2HAV A;  2PT2 A;  1LCF A;  2QMW A;  3MPL A;  5H8Q A;  2QS2 A;  1NL5 A;  4DCY A;  1ZJL A;  5JEI A;  3O66 A;  4DXB A;  2OBG A;  1URS A;  3E9X A;  3KG2 A;  3IO6 A;  3M3F A;  1USY H;  2UYF A;  4F19 A;  4FJP A;  3KGC A;  4R6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...