1FQEA

Crystal structures of mutant (k206a) that abolish the dilysine interaction in the n-lobe of human transferrin
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVAHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEROTRANSFERRIN
publication title Crystal structures and iron release properties of mutants (K206A and K296A) that abolish the dilysine interaction in the N-lobe of human transferrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 100
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2000-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1fqeA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1fqeA02
4EQBA 5FTHA 3C4MA 2DP8A 4NWDA 3QSLA 3KN3A 3DELB 1QVSA 5CMCA 4M1VA 4ZECA 2UVIA 1MM6A 1R9LA 4O3CA 2D5WA 3LSWA 2XHDA 1S9TA 4OERA 1JETA 1SDXA 2AL5A 3K6WA 5DVJA 1USYE 4F1UA 2I58A 4BDLA 1B5JA 1DSNA 3FV1A 3O6GA 3TTMA 1MQDA 1YAEA 1XVYA 3KN8A 1D9VA 4XKQA 3N6TA 3THIA 3OEKA 3W9VA 1PBPA 4X1BA 5I56A 1B46A 3TDJA 1OLCA 3G3FA 5KDTB 3TQWA 1XC1A 1I6AA 3QIMA 1MY3A 3S9LC 1P1QA 4QSCA 4XIGQ 3R7XA 4DDDA 3QAXA 2BJJX 4U4XA 1EU8A 3OENA 3B6QA 1QUIA 1AIVA 2ZNTA 3K1MA 5ITOA 3VFJA 3SEYA 1DMBA 1SD3A 1IXIA 1MH4A 3ZS6A 1UTBB 1MY0A 2Q8JA 2DS9A 2FYIA 3A09A 4E0WA 3MVZA 5BWJA 2XXTA 4N13A 3C35A 4OYVA 3RQTA 5H8NA 4BDRA 2XXQA 2F6PA 4GQOA 1N76A 1R1NA 3GZGA 2P2AA 3IR1A 5FHMA 4QFNA 3K6VA 1TT1A 3ECRA 4NMYA 2V84A 4QRZA 1MQGA 4KCCA 4U4SA 3PMVA 4NF5B 4KD5A 1B9JA 5I2KB 1II5A 4F29A 3FVNA 3P7IA 2F7CA 2Z8EA 1VE4A 4L17A 2HEUA 4H65A 3TTRA 1US5A 1FQCA 4TQUQ 4G8HA 4GD5A 1OIBA 1RYXA 4ZZAA 1URSA 2G29A 2Y7RA 4JXIA 3OXNA 4GF8A 4Q8RA 3RNNA 4FORA 5A5XA 1NH8A 3O6IA 5H8QB 2QPQA 3UP9A 1FTMA 4RPNA 3T66A 4LP2B 3N26A 2GFEA 3BFTA 1QKAA 1LFHA 4G4PA 3N5LA 1JNFA 1MDP1 3QXMA 3LUYA 2QS4A 1P99A 1QJMA 1I69A 1NNFA 1I6BA 4ELQA 1USYH 3MVWA 3C34A 1LAXA 4F1VA 4R6KA 2IEEA 4GLIA 3T9VA 3AXFA 1N3XA 4MBPA 1QW0A 5F1QA 5ISUA 4G8MA 3USDA 3VLWA 3Q26A 1ZBMA 2YLNA 1Y3NA 4ELOA 4R9FA 1HSLA 1B40A 3LBSA 4F3PA 1DPEA 4R6HA 1FQAA 4KCDA 5AA1A 2PYYA 2RCBA 2I0BA 3A3UA 2A5TB 1M5BA 2Z23A 4YICA 3PUYE 4NF8A 2RF1A 4KYEA 5H8NB 3V89B 3Q28A 4OFLA 1PEBA 2HAUA 1NL5A 4QFOA 2ZYKA 4RYAA 1US4A 3PUZE 4FIMA 2H4IA 2XXUA 1B4HA 3FV2A 5CBSA 1TXFA 2M8CA 2VD2A 3ODBA 4NEDA 3TMGA 4FEBA 1LCFA 4OETA 4XKNA 1B4ZA 1MXWA 3GLBA 2XXPA 2XD2A 2Z8DA 4GL8A 3MVXA 4I1DA 3FXQA 2I0CA 1BKAA 2O7IA 4Q0CA 3VXBA 1XHYA 1Y4TA 3O29A 2Z8FA 2O84X 4R72A 3HPIA 3MUQA 1ZJLA 3A3CA 5A5XB 4C0RA 2F36A 3T22A 3V5AA 1MXYA 3OO8A 1Y4CA 1BIYA 1MPDA 1B0HA 3IOWA 4R75A 4H8IA 1FTKA 4YKJA 3B6WA 5TP9B 2DE2A 2DE3A 1MH3A 5HM4B 4FJPA 1FQDA 3T9XB 3I5OA 1EZPA 3SEWA 2O69A 2ONRA 2NUVA 1SW5A 2HAVA 3FD3A 4ELRA 2I3WA 3GBBA 4BDMA 4TLLB 2O1LA 5I59A 2XXWA 1LFIA 3QUFA 4G2ZA 4DCYA 4PP0A 4U22A 5DVIA 3DP4A 1IXHA 3WAEA 3SESA 3PU5A 2XXIA 2F8DA 3FJGA 2ZNSA 3DLNA 2FA7A 5KDTA 4F18A 1N0TA 1LLSA 4DXCA 4TLMB 5CRYA 1QUJA 3O97A 2OK2A 1N84A 3Q29A 1YPNA 4DZ1A 3PPOA 4YMAA 3MQ9A 5K2YA 1LCTA 3K00A 3EHUA 1ZIUA 1B52A 4NF8B 1NH7A 5DT6A 3O66A 4BDQA 1UTBA 3I3VA 4THIA 1TWYA 1NNTA 4YZZA 2H9BA 3PUXE 1XT8A 4PETA 1MPBA 2O6AA 3PD8A 4F39A 1SW4A 3ONMA 1WODA 4LZ8A 5LOMA 3H7MA 3MW0A 1MXXA 1LAGE 5L8DA 1MQIA 3R26A 5JTYA 1Y9UA 4KI0E 3U72A 1L5TA 2B3FA 4YKPA 5L9OA 1RYOA 5CMKA 3HHGA 4Q30B 1Y20A 4JSOA 4H6DA 3U8QA 4QFLA 4IO5A 4NF5A 4XTCQ 4UACA 2NWJA 3PPNA 3H6WA 3MZ9A 4DXUA 3OSRA 3OMBA 4EUOA 3KOSA 2ESNA 1A54A 4H5FA 2XXYA 5B70A 5I58B 1URGA 4KHZE 3O6HA 5J1DA 3OSQA 2XX9A 1XOCA 2GHAA 5H8QA 4ZEDA 4YKKA 4EQ9A 3N6UA 3CRBA 2H25A 3FUZA 3IX1A 3JYRA 1XVXA 3MP6A 1IZ1A 4DCXA 4IY6A 3IK6B 5I59B 1FQBA 3CVGA 2OWSA 4BDOA 1N7WA 1N3WA 2ABHA 3F11A 3UGWA 3FXRA 1OVBA 2OBGA 3RTWB 3PGFA 3T93B 1FQFA 3DP6A 1LGBC 4JWYA 2XXHA 3RN8A 4HCWA 1MS7A 1B3EA 5ITPA 4GWOA 3IB0A 3FVOA 2W7YA 3OELA 1MY4A 2VHAA 1HSJA 4HCYA 1FW0A 2V25A 1SW1A 5CMMA 5HBCA 1N04A 1PBQA 1BLFA 5ICTA 1J1NA 4LQ2A 3K6XA 3MBPA 5FHNA 5DTBA 3PD9A 4ZE8A 3OO7A 2A5TA 3MPKA 2DWHA 4P11A 1JW1A 1IXCA 3TUSA 4H8JA 3LSFB 5DYHA 1VR5A 4F31B 4R74A 1MXZA 4UA8A 4OFOA 3FJ7A 5HPQA 3EPEA 3UN6A 2DWAA 2Y7IA 5JTYB 1WVJA 3OO9A 3HN0A 3TTLA 4ZEBA 1URDA 3G3KA 2XX8A 1OLAA 3HO7A 3CSGA 4ONYA 2WKYA 2HCAA 5ICQA 4IO6A 4OZ9A 4QFKA 3E3KA 3M3FA 4KYDA 2I3VA 1H76A 3Q25A 1CE2A 3W15C 3TCHA 2AIXA 2ONKE 3VDFA 1QULA 3UORA 1Z7ME 2HZKA 3C31A 1JEUA 4GXAA 3C9HA 4HW8A 5AA3A 3TPAA 1QKBA 2VD3A 1H43A 5TP9A 4AB6A 1FQEA 3M3KA 1D3KA 2PVUA 2UYEA 1PDAA 3TTNA 5FTIA 5H8FA 3IO4A 2VGQA 3PMXA 1NNKA 5I57A 3U92A 3V8XB 1DTZA 2RINA 4OWDA 5TU0A 3IB2A 4DIGA 2OZZA 5AA2D 1FTLA 3K0VA 3T9UA 3TQLA 3V83A 3D4GA 1YTVA 2ZYNA 2O51A 4OQOA 4MFIA 5AA2B 2UVJA 2DYXA 3PPRA 2ONSA 4U1OA 1A8FA 2DXYA 1EH3A 3EHTA 4RXLA 4NE4A 1MXUA 4YB6A 2NOOA 5AA4A 3FASA 1GTKA 1A8EA 3RY3A 2B3BA 1YCJA 4JDFA 2H98A 2F7AA 3S2VA 3CG3A 3HHFA 1DPPA 2ZYMA 3CFZA 2PT2A 1IITA 1UQWA 4OEUA 2F35A 4RNSA 1ZMGA 1POTA 4NF4A 1B3GA 3CG1A 1LSTA 3SETA 4PFTA 3TYHA 3KEIA 2QS2A 4LA9A 5B7DA 3SKPA 1FTJA 4YAHX 2V3TA 1MY1A 1FTOA 4BDNA 4LZ5A 2DQVA 3CFXA 3PMWA 3VE1B 1M5FA 3H6UA 3MP1A 3MJNA 1B1HA 2R6GE 1OVTA 4U21A 3TFLA 1QUKA 3O9PA 3K01A 2QL3A 4P0GA 1Y3PA 3JV9A 2R71A 4IO4A 3PUVE 5L9MA 1JVXA 1NNPA 3CR9A 2QSXA 4OFJA 2Q2AA 3VXCA 2D21A 1M5DA 4WEPA 1H44A 1Y1ZA 1DTGA 3ZKLA 5I58A 4LQ5A 1PB8A 2OLBA 3IOTA 1A40A 5CC2A 2ALUA 3SEUA 4DXBA 4GVOA 1NKXA 2RKMA 4O3BA 1AMFA 1UIUA 4MLQA 5DVFA 3OO6A 1IUDA 1EZ9A 2IA4A 3O2AA 3FVKA 3HV1A 3QK6A 5H8FB 3CI8A 4OENA 3KN7A 5I57B 2Q9TA 4JWOA 4GFRA 3K2DA 4I9DA 4AQ4A 3K1PA 1M5EA 4XXUA 3C33A 4MF3A 4JBZA 3RGYA 1FCKA 2I49A 3SEVA 3U93A 2REGA 3KGCA 1Q1KA 3K4UA 3OD7A 4O3AA 2OCUA 5AA4B 1ZLQA 3IOVA 3PPPA 1PB9A 3FXUA 2OJTA 2RC7A 2F7BA 4F2OA 1O63A 4PQJA 4G68C 1R6ZA 2RC8A 4MLVA 1SYHA 1A7LA 3H06B 3H03A 4H1XA 3LR1A 4EF1A 1P1WA 3RLFE 3GXAA 4DLDA 4NWCA 1H3DA 4F3GA 4NF6A 2B65A 2YPNA 3FIRA 3BKIB 4NF4B 2V93A 2I48A 5TPAA 4WXJA 2D3IA 1KWHA 3VVEA 4GXSB 1JW4A 4F19A 3OOAA 3B7DA 3KG2A 2O1MA 2XXRA 3M3LA 2DVCA 4F22A 2V3QA 3R6UA 4G8NA 4FATA 2GRVA 1POY1 4R6YA 1B6HA 3ZSFA 3TCFA 1NMUA 4U1ZA 3W9WA 2XXXA 2Z22A 2YJPA 1AH5A 3FJMA 1A99A 3G3IA 4OHNA 4ZDMA 3QUJA 4G68A 1F9BA 4C1UA 1SI0A 1B7HA 3L6HA 1IEJA 3BFUA 4KQPA 3HSTA 3S9EA 1N7XA 1IXGA 3FATA 4POWA 2DWJA 2QRYA 1GR2A 2HFBA 4FEDA 4LATA 3T96B 3VLVA 3E4RA 3Q27A 4HTGA 2V3UA 3TEPA 2H99A 2Y7PA 4R73A 2PBWA 3G3GA 3KZGA 1VSOA 1JW5A 3LC8A 1P1UA 5H8SA 1AOVA 1SQYA 2E0SA 4POXA 2QJEA 2P1SA 4ELPA 4YKIA 3D4CA 1B3HA 3TELA 2AYSA 2KLFA 1LAHE 4PFWA 4ESWA 2ANJA 3E9XA 4H0WA 3MZ1A 4R2BA 1ANFA 1Z7NE 4KR5A 2ZYOA 3H6TA 4DE8A 2FNCA 4ESXA 1LB8A 1UIVA 1Y3QA 5AA2A 2O7UA 1LBBA 2Y7KA 4JB7A 3TCGA 4EXLA 5KZTA 3KJTA 4OTEA 2E1SA 2DWIA 5KCJA 2THIA 1ZKBA 1D9YA 3IJOB 3FZVA 4GRKA 2I6EA 5I2NA 4IGRA 1SW2A 1RKMA 4FECA 4NF6B 4ZZEA 5TPAB 3EF7A 2F78A 2F34A 1IIWA 4LONB 1ZU0A 4OVJA 1MQHA 4PFUA 4KFQA 1O64A 4MH5A 5K2XA 4AB5A 4PFYA 1P1NA 4XKRA 1D4NA 4IGTA 2PMSA 2NXOA 4OESA 3N94A 3ZKKA 4LUBA 3S9NC 4RPOA 3TZAA 1MDQA 4X1DA 5L9SA 4PE5B 4N6PA 4QFPA 1IQ7A 2HXWA 3KBRA 4G68B 2H5YA 2DXRA 4JSDA 3EQ1A 2XXVA 4U23A 2CMOA 4BLAA 1UTHB 1GGGA 3FGSA 1LFGA 2HZLA 1VFDA 3MWBA 1A55A 2NVUB 4OMBA 3VVDA 1HSEA 1DOTA 3JZJA 3K02A 4IB2A 2VP1A 3ILUB 4Z0IA 5EYFA 1ZTYA 1B7UA 1MXVA 3HCQA 4I62A 4TOZA 5CMBA 3G3HA 1MQJA 4GOTA 1T0KA 1P1OA 4Z7EA 3SERA 4C1TA 1S50A 3M8UA 4ECFA 4N07A 3H3GA 2I4BA 5DEXA 2XX7A 1Q35A 3MAMA 3U1OA 1JVYA 3TKDA 3TTKA 3LSLA 3VV5A 3IORA 5CBRA 4IO7A 2UVGA 4RJZA 4R9GA 3MZBA 3PPQA 4EDPA 3IJXB 4ZE9A 4YB7A 5I56B 4FE8A 4RK9A 3CSBA 4P0IA 4EQ7A 5KCJB 3MVYA 4FAJA 3BBRA 3H4ZA 1B0LA 2X26A 3DP8A 5I2NB 1MPCA 1Y1MA 1BP5A 1SBPA 2RC9A 1WDNA 3TAJA 4IY5A 3LSXA 2DVZA 5JEIA 4ZEKA 2HQ0A 2G93A 2RCAA 5CM6A 5M2VA 2Y7WA 3CFLA 3VLUA 3KSXA 1B05A 3KFMA 5F7VA 1TFDA 1I6QA 2O68A 2ZNUA 1S7YA 3U94A 3GBAA 2REJA 3PUWE 4QSDA 3C32A 1O7TA 1PB7A 2P0SA 3RTFB 3KJ7A 2QMXA 3E13X 4GIZA 4G77A 4LZ7A 1B5IA 1BTJA 4ND9A 2DE4A 4F2QA 2UYFA 4KYSA 3SDFA 3VVFA 2Q88A 3MPLA 5IKBA 1MRPA 4E0XA 2F97A 2QS1A 4R2FA 1SYIA 2Q2CA 3IAZA 3RT6B 5JK4A 5H8HA 3UIFA 5IAIA 3S9MC 1B7ZA 1LAFE 2OWTA 1OQHA 2CZLA 3G3JA 4ZS9A 1LB9A 3SEXA 3QYTA 4X9TA 4YB5A 4GL0A 3TODA 1MG1A 3PV0E 5ELVA 1JQFA 4K3FA 1B58A 3IL1B 3S4UA 5DEXB 3OEMA 4EF2A 1SI1A 4RY1A 2QMWA 3KSJA 4ZEIA 4F3BA 3K6UA 2F6GA 3MC2A 4IO2A 3DM0A 1OQGA 3CIJA 1B3FA 4NTLA 3RUMA 3T9HB 2X7PA 5I84A 3B6TA 4JWXA 3K1NA 3IO6A 2GHBA 3IOUA 1JEVA 2GH9A 2PT1A 2QS3A 4I8CA 4OEVA 4H5GA 4U2RA 2ZMBA 4YMBA 1GVCA 2F5XA 1B3LA 1R9QA 1GV8A 4M4GA 1B32A 2AL4A 1EZOA 2ZXTA 3RPWA 2X7QA 5EHSA 2XD3A 4ZEFA 3I6VA 3EHSA 2LAOA 4ISUA 5CI5A 2DSFA 3IB1A 4F3SA 2PX1A 3G7WA 5AE4A 1NFTA 4KPTA 4YU0A 4QF9A 2UXAA 1MM7A 3H6VA 3UA8A 4F1YA 4WKMA 3L6GA 1M5CA 4WEDA 3RT8A 1MY2A 1H45A 1B51A 3KOTA 2I4CA 1SVXB 1B1XA 1AL3A 2VOZA 3WAFA 4QHQA 4EXKA 3FVGA 4IO3A 1OMPA 1B2HA 2R9JA 4RK2A 4Q5TA 1CB6A 4H67A 5H8HB 3C36A 2DOJA 1LBCA 4LVQA 1B5HA 1PC3A 1TFAA 3UK4A 1UTHA 5I2KA 4XKPA 2UVHA 1XS5A 5BUUA 3ILTB 1ATGA 4HS7A 5FHOA 1VFEA 1ELJA 3O28A 4X48A 4OXVA 2Y84A 2A5SA 3MP8A 4RA1A 5EHMA 4QSEA 3EN3A 2Q89A
chains in the Genus database with same CATH superfamily
4EQBA 5FTHA 3C4MA 1QGXA 1FBEA 1JP4A 2DP8A 4NWDA 3QSLA 3KN3A 3DELB 3T0JA 1QVSA 4I3YA 5CMCA 4M1VA 4ZECA 2UVIA 1MM6A 1R9LA 4O3CA 2D5WA 3LSWA 2FBPA 2XHDA 1S9TA 4OERA 1JETA 1SDXA 2AL5A 3K6WA 5DVJA 1USYE 5EQ7A 4F1UA 2I58A 4BDLA 1B5JA 1DSNA 3FV1A 3O6GA 3D1RA 3TTMA 1FBFA 1MQDA 1YAEA 1XVYA 3KN8A 1D9VA 4XKQA 3N6TA 3THIA 3OEKA 3W9VA 1PBPA 4X1BA 5I56A 1B46A 3TDJA 4PCDA 1OLCA 3G3FA 5KDTB 4G61A 3TQWA 2VPNA 1XC1A 2MKZA 2V4CA 1I6AA 3QIMA 1MY3A 4N8YA 3S9LC 1P1QA 4QSCA 4XIGQ 3R7XA 1FPDA 4DDDA 3QAXA 2BJJX 4U4XA 2QVVA 1EU8A 3OENA 4O7MA 3B6QA 1QUIA 1AIVA 2ZNTA 3K1MA 5ITOA 2P3VA 3VFJA 1BK4A 3SEYA 1DMBA 4GWXA 1SD3A 1IXIA 1MH4A 2B4MA 1UTBB 1FJ9A 4XFEA 3ZS6A 1MY0A 2Q8JA 2DS9A 2FYIA 3A09A 4E0WA 3MVZA 5BWJA 2XXTA 4N13A 3C35A 4OYVA 3RQTA 5H8NA 4BDRA 2XXQA 2F6PA 4GQOA 1N76A 1KA1A 1R1NA 3GZGA 4AS5A 2P2AA 3IR1A 5FHMA 5DW8A 4QFNA 1NV5A 3K6VA 1TT1A 3ECRA 4NMYA 4H46A 4OANA 1NV3A 2V84A 4QRZA 5EYHA 1MQGA 4KCCA 4U4SA 3PMVA 4NF5B 4KD5A 1B9JA 5I2KB 1II5A 4F29A 3FVNA 3P7IA 4P1LA 2F7CA 2Z8EA 1VE4A 4L17A 2HEUA 4H65A 3TTRA 1US5A 1FQCA 4TQUQ 4G8HA 4GD5A 1OIBA 4O8MA 1RDXA 1RYXA 4ZZAA 1URSA 3IFCA 2G29A 2Y7RA 4JXIA 3OXNA 4GF8A 4Q8RA 3RNNA 4FORA 5A5XA 1NH8A 3O6IA 5H8QB 2QPQA 3UP9A 1FTMA 4GWYA 5IGAA 4RPNA 4P9KA 3T66A 4LP2B 3N26A 3IFAA 4PBQA 2GFEA 3BFTA 1QKAA 4AS4A 4G4PA 1LFHA 3N5LA 2VPOA 1JNFA 1MDP1 3QXMA 3LUYA 1FPLA 2QS4A 1P99A 1QJMA 1I69A 1NNFA 1I6BA 4ELQA 1USYH 1LBWA 3MVWA 2CZKA 1FPKA 4PBHA 3C34A 1LAXA 4F1VA 4R6KA 2IEEA 4GLIA 3T9VA 3AXFA 2Q8MA 1N3XA 3FBPA 4MBPA 1QW0A 5F1QA 5ISUA 4PDDA 4G8MA 3USDA 3VLWA 3Q26A 1ZBMA 2YLNA 2CZIA 1Y3NA 1NUYA 4MX6A 3ISPA 4ELOA 4R9FA 1HSLA 1B40A 3LBSA 4F3PA 1DPEA 4R6HA 4KXPA 4PFIA 1FQAA 4KCDA 4O7IA 5AA1A 1LBYA 2PYYA 2RCBA 2I0BA 3A3UA 2A5TB 1M5BA 2Z23A 1FPFA 1FPIA 4YICA 3PUYE 4NF8A 2RF1A 4H45A 4KYEA 5H8NB 3V89B 3Q28A 4OFLA 1PEBA 1LEVA 1NL5A 2HAUA 4QFOA 4PFBA 5IZ3A 2ZYKA 4RYAA 1US4A 3PUZE 4FIMA 2H4IA 2XXUA 1B4HA 3FV2A 5CBSA 4DI3D 1TXFA 2M8CA 2VD2A 3ODBA 4NEDA 4MAGA 1EYKA 3TMGA 4XF5A 4FEBA 1LCFA 4OETA 4XKNA 1B4ZA 1MXWA 3GLBA 2XXPA 2XD2A 2Z8DA 1EYIA 4GL8A 3MVXA 4I1DA 3FXQA 2I0CA 1BKAA 2O7IA 4Q0CA 3VXBA 1XHYA 1Y4TA 5F24A 1NV0A 3O29A 2Z8FA 2ZZXA 4OVQA 2O84X 4R72A 3HPIA 3MUQA 1ZJLA 3A3CA 5A5XB 4C0RA 2F36A 3T22A 1NV1A 3V5AA 1MXYA 1NV2A 3OO8A 1Y4CA 1BIYA 1MPDA 1B0HA 3IOWA 4R75A 4H8IA 3KBZA 1FTKA 4YKJA 3B6WA 2FVZA 5TP9B 2DE2A 2DE3A 1MH3A 3SZPA 5HM4B 1IMDA 4FJPA 1FQDA 3HFUA 3T9XB 3I5OA 1EZPA 3SEWA 2O69A 2ONRA 2NUVA 1SW5A 2HAVA 3FD3A 4ELRA 1Q9DA 2I3WA 3GBBA 4BDMA 1NV4A 4TLLB 2O1LA 5I59A 2XXWA 1LFIA 3QUFA 4G2ZA 4DCYA 4MJOA 4PP0A 4U22A 5DVIA 3DP4A 1IXHA 4PAKA 3SESA 3WAEA 3PU5A 2XXIA 2F8DA 1EYJA 3FJGA 2ZNSA 3DLNA 2FA7A 5KDTA 4F18A 1N0TA 2XWVA 1LLSA 4DXCA 4TLMB 3E78A 5CRYA 1QUJA 3O97A 2OK2A 1N84A 4PTKA 3Q29A 1YPNA 4DZ1A 3PPOA 4YMAA 4QXDA 3MQ9A 3MYUA 5K2YA 3MSTA 4NQ8A 1LCTA 3K00A 3EHUA 1ZIUA 1NV7A 1B52A 4NF8B 3BIHA 1NH7A 5DT6A 3O66A 2Q74A 1DK4A 4BDQA 1UTBA 3I3VA 4THIA 5IZ3B 1TWYA 1NNTA 4YZZA 2H9BA 4OVTA 4FBPA 3LUZA 3PUXE 1XT8A 2PCRA 4PETA 1MPBA 2O6AA 3PD8A 4F39A 1SW4A 3ONMA 1WODA 4LZ8A 5LOMA 3H7MA 3MW0A 1MXXA 1LAGE 5L8DA 1MQIA 3R26A 1FRPA 5JTYA 1Y9UA 4KI0E 3U72A 1L5TA 2WYKA 2B3FA 4YKPA 2WX9A 5L9OA 1RYOA 5CMKA 3HHGA 4Q30B 1Y20A 4JSOA 4H6DA 4GWZA 4QFLA 3U8QA 4IO5A 4NF5A 4XTCQ 4UACA 2NWJA 3PPNA 2L5VA 3H6WA 3MZ9A 4DXUA 3OSRA 3OMBA 4EUOA 3KOSA 5I7IA 2ESNA 1A54A 4H5FA 2XXYA 5B70A 5I58B 1URGA 4KHZE 2FHYA 1YYZA 4DI4B 3O6HA 5J1DA 3OSQA 2XX9A 1XOCA 2GHAA 5H8QA 4ZEDA 4YKKA 3KC1A 2CZHA 4EQ9A 3N6UA 4JVIA 3CRBA 2H25A 3FUZA 3IX1A 3JYRA 1XVXA 4P8BA 4IR8A 3MP6A 1IZ1A 4DCXA 4IY6A 3IK6B 5EYGA 5I59B 1FQBA 4PAIA 3CVGA 2OWSA 4BDOA 1N7WA 1N3WA 2ABHA 3F11A 3UGWA 3FXRA 1OVBA 2OBGA 4NN3A 3RTWB 3PGFA 3EKIA 3T93B 1FQFA 3DP6A 3FXBA 1LGBC 4JWYA 2XXHA 3RN8A 4HCWA 1MS7A 1B3EA 5ITPA 4GWOA 2WBBA 3IB0A 3FVOA 2W7YA 1AWBA 3OELA 1MY4A 2VHAA 1HSJA 4HCYA 1FW0A 2FIXA 2V25A 1SW1A 4X8RA 5CMMA 5HBCA 4UABA 1N04A 1PBQA 1BLFA 5ICTA 2PFZA 1J1NA 2QFLA 4LQ2A 3K6XA 3MBPA 5FHNA 5DTBA 3PD9A 4ZE8A 4PFRA 3OO7A 5IZ1A 2XA5A 2A5TA 3MPKA 2DWHA 4P11A 1JW1A 1IXCA 3TUSA 4H8JA 3LSFB 5DYHA 1VR5A 3E79A 4F31B 4R74A 2R8TA 1MXZA 4UA8A 4OFOA 3FJ7A 5HPQA 3EPEA 3UN6A 3ROJA 2DWAA 2Y7IA 5JTYB 1WVJA 3OO9A 3HN0A 3TTLA 4ZEBA 1URDA 3G3KA 2XX8A 1OLAA 3HO7A 3CSGA 4ONYA 2WKYA 1DBZA 2HCAA 5ICQA 4IO6A 4OZ9A 4QFKA 1FTAA 4GX4A 3E3KA 3M3FA 4KYDA 2I3VA 2B4LA 4XEQA 1H76A 3Q25A 1CE2A 3W15C 3TCHA 2AIXA 2HXRA 2ONKE 3VDFA 1QULA 3UORA 1Z7ME 2HZKA 3C31A 1JEUA 1CNQA 4GXAA 3C9HA 4GBVA 4HW8A 3U65A 5AA3A 3TPAA 2OWZA 1QKBA 2ZZVA 2VD3A 1H43A 5TP9A 4AB6A 4GX6A 1FQEA 3M3KA 1D3KA 4MEVA 2PVUA 2UYEA 1PDAA 3TTNA 5FTIA 5H8FA 3IO4A 2VGQA 3PMXA 1NNKA 5I57A 3U92A 3V8XB 1DTZA 4JVCA 2RINA 4OWDA 5TU0A 3IB2A 4DIGA 2OZZA 5AA2D 1FTLA 3KC0A 3K0VA 3T9UA 3TQLA 3V83A 3D4GA 1YTVA 2ZYNA 2O51A 4OQOA 4MFIA 5AA2B 1VDWA 2UVJA 2DYXA 4PC9A 3PPRA 2ONSA 4U1OA 1A8FA 2DXYA 1EH3A 4RXLA 3EHTA 4NE4A 1MXUA 4YB6A 2NOOA 5AA4A 3FASA 1GTKA 1A8EA 3RY3A 1FBGA 4GX3A 2B3BA 1YCJA 4JDFA 4PGPA 2H98A 2F7AA 3S2VA 1INPA 3CG3A 3HHFA 1DPPA 2Y5LA 2ZYMA 3CFZA 4GWWA 2PT2A 1IITA 4N91A 1UQWA 4OEUA 2F35A 4RNSA 1ZMGA 3CHGA 1POTA 4NF4A 1B3GA 3CG1A 1LSTA 3SETA 4PFTA 3TYHA 3KEIA 4MNPA 2QS2A 4LA9A 5B7DA 3SKPA 1FTJA 4YAHX 2V3TA 1MY1A 4PF8A 1FTOA 4BDNA 2XXKA 4LZ5A 2DQVA 3CFXA 3PMWA 3VE1B 1M5FA 3H6UA 3MP1A 1G0IA 3MJNA 1B1HA 2R6GE 1DCUA 3GYYA 1OVTA 4U21A 1K9ZA 1FPJA 1YZ0A 3TFLA 1QUKA 5ET5A 3O9PA 3K01A 2QL3A 4MCOA 4P0GA 1Y3PA 3JV9A 1RDYA 2R71A 5ET8A 4IO4A 3PUVE 5L9MA 1JVXA 1NNPA 3CR9A 2QSXA 4OFJA 2Q2AA 3VXCA 2D21A 1M5DA 4WEPA 1H44A 1Y1ZA 1DTGA 3ZKLA 5I58A 1IMCA 4LQ5A 1PB8A 2OLBA 3IOTA 1A40A 1LBXA 5CC2A 2ALUA 1KZ8A 3SEUA 4DXBA 4GVOA 1NKXA 2RKMA 4O3BA 5I5PA 1AMFA 1FBCA 1UIUA 4MLQA 5DVFA 3OO6A 1IUDA 1EZ9A 2IA4A 3O2AA 1FBHA 3FVKA 3HV1A 3QK6A 5H8FB 3CI8A 4OENA 3KN7A 5I57B 2Q9TA 4JWOA 2KQZA 4GFRA 3K2DA 4I9DA 4AQ4A 3K1PA 1M5EA 4XXUA 1RDZA 3C33A 4MF3A 5ET7A 4JBZA 3RGYA 1FCKA 2I49A 3SEVA 2VT5A 3U93A 2REGA 4GWUA 1FPBA 3KGCA 1Q1KA 3K4UA 4NG7A 3OD7A 4O3AA 2OCUA 5AA4B 1FBDA 1ZLQA 3IOVA 3PPPA 1PB9A 3FXUA 2OJTA 2RC7A 4NF0A 2F7BA 4F2OA 1O63A 1IMFA 4PQJA 4G68C 1R6ZA 2RC8A 4MLVA 1SYHA 1A7LA 3H06B 3H03A 4H1XA 3LR1A 3A29A 4EF1A 1P1WA 2XWOA 4N6KA 3RLFE 3GXAA 4DLDA 4NWCA 4N17A 1H3DA 4F3GA 4NF6A 2B65A 2YPNA 3FIRA 3BKIB 4NF4B 2WYPA 2V93A 2I48A 5TPAA 4WXJA 2D3IA 1KWHA 3VVEA 4MIJA 4GXSB 1JW4A 3PTYA 4F19A 4N15A 4NGUA 3OOAA 4N4UA 3B7DA 3KG2A 2O1MA 2XXRA 3M3LA 4PDHA 2DVCA 4F22A 4NX1A 2V3QA 3R6UA 3RYDA 4P47A 4G8NA 4FATA 2GRVA 1POY1 1K9YA 4R6YA 2PFYA 1B6HA 3ZSFA 3TCFA 1NMUA 4U1ZA 3W9WA 2XXXA 2Z22A 5J16A 2YJPA 3RPLA 1AH5A 3FJMA 1A99A 1G0HA 3G3IA 4OHNA 4ZDMA 3QUJA 4G68A 4HXVA 1F9BA 4C1UA 1SI0A 1B7HA 3L6HA 1IEJA 3BFUA 4KQPA 3HSTA 3S9EA 1N7XA 1IXGA 3FATA 4POWA 2DWJA 2QRYA 1D9QA 1GR2A 2HFBA 4FEDA 4LATA 5IM2A 2XWIA 3T96B 2JJKA 2QVRA 3VLVA 3E4RA 1YXIA 3Q27A 4HTGA 2V3UA 3TEPA 2H99A 2Y7PA 4R73A 1LBZA 2PBWA 4MNIA 3G3GA 3KZGA 1VSOA 1JW5A 3LC8A 1P1UA 5H8SA 1AOVA 1SQYA 2E0SA 4POXA 2QJEA 2P1SA 4ELPA 4YKIA 3D4CA 1B3HA 3TELA 2AYSA 2KLFA 1LAHE 4PFWA 4ESWA 4OVRA 2ANJA 3E9XA 4H0WA 3MZ1A 4R2BA 1ANFA 1Z7NE 3QMFA 5LTCA 4KR5A 2ZYOA 3H6TA 4DE8A 2FNCA 4ESXA 1LB8A 1UIVA 1Y3QA 5AA2A 2O7UA 1LBBA 2Y7KA 4JB7A 3TCGA 4EXLA 5KZTA 5A5LA 3KJTA 4GWSA 4OTEA 2E1SA 2DWIA 5KCJA 2THIA 1ZKBA 1D9YA 2WEFA 3IJOB 3FZVA 4GRKA 2I6EA 2F3DA 5I2NA 4IGRA 1SW2A 1RKMA 4FECA 4NF6B 4ZZEA 5TPAB 2GQ1A 3EF7A 2BJIA 2F78A 2F34A 1IIWA 4LONB 1ZU0A 4OVJA 1MQHA 4PFUA 4KFQA 1O64A 4MH5A 5K2XA 2DDKA 4P1EA 1FJ6A 4AB5A 4PFYA 1P1NA 4XKRA 1D4NA 4IGTA 2PMSA 2NXOA 4OESA 3N94A 3ZKKA 4N6DA 4LUBA 3T1BA 4I40A 3S9NC 3NOHA 4RPOA 3TZAA 1MDQA 4X1DA 3RPLB 4QBAA 5L9SA 4PE5B 4N6PA 3B50A 4QFPA 1IQ7A 2HXWA 3KBRA 4G68B 1NV6A 1IMAA 2H5YA 2DXRA 4JSDA 3EQ1A 2XXVA 4P3LA 4U23A 2CMOA 4BLAA 2HHMA 1UTHB 1GGGA 3FGSA 1LFGA 2HZLA 2FIEA 1VFDA 1IMEA 3MWBA 1A55A 2NVUB 4OMBA 3VVDA 1HSEA 4PF6A 1DOTA 3JZJA 3K02A 4IB2A 2VP1A 3ILUB 4HE0A 4Z0IA 5EYFA 1ZTYA 1B7UA 1MXVA 3HCQA 4I62A 4TOZA 4MNCA 5CMBA 3G3HA 1MQJA 4MHFA 4GOTA 1T0KA 1P1OA 4Z7EA 1IMBA 3SERA 4C1TA 1S50A 3M8UA 4PAFA 4ECFA 5LDZA 4N07A 3H3GA 2I4BA 5DEXA 2XX7A 1NUZA 1Q35A 3MAMA 3U1OA 1JVYA 3TKDA 3TTKA 3LSLA 3VV5A 3IORA 5CBRA 4IO7A 2UVGA 4RJZA 4NHBA 4R9GA 4GBWA 4OA4A 3MZBA 3PPQA 1NUWA 4EDPA 3IJXB 4ZE9A 4YB7A 5I56B 4FE8A 4RK9A 3CSBA 4P0IA 4EQ7A 5FBPA 5KCJB 3MVYA 4NAPA 4FAJA 3BBRA 3H4ZA 4PGNA 1B0LA 2X26A 3DP8A 5I2NB 1KA0A 2P3NA 1MPCA 1Y1MA 1BP5A 1SBPA 2RC9A 1WDNA 4JVDA 5I3SA 3TAJA 4IY5A 1NI9A 3LSXA 2DVZA 5JEIA 4ZEKA 2HQ0A 1FSAA 2G93A 2RCAA 5CM6A 5M2VA 2CEXA 2CEYA 2Y7WA 3CFLA 5EQ9A 3VLUA 3KSXA 1B05A 3KFMA 5F7VA 1TFDA 2OX3A 2F3BA 1I6QA 2O68A 5ET6A 2ZNUA 1S7YA 3U94A 3GBAA 2REJA 3PUWE 2ZZWA 4QSDA 3C32A 1O7TA 4PE3A 1PB7A 2P0SA 3RTFB 3KJ7A 2QMXA 3E13X 4GIZA 4G77A 4LZ7A 1B5IA 1BTJA 4ND9A 3LV0A 2DE4A 4F2QA 2UYFA 4KYSA 3SDFA 3VVFA 2Q88A 4I3EA 3MPLA 5IKBA 1MRPA 4X04A 4E0XA 2F97A 2QS1A 4R2FA 1SYIA 2Q2CA 3IAZA 3RT6B 5JK4A 5H8HA 3UIFA 5IAIA 3S9MC 2XWKA 1B7ZA 1LAFE 2OWTA 1OQHA 2CZLA 3G3JA 4ZS9A 1LB9A 5ESYA 3SEXA 1XI6A 3QYTA 4X9TA 4YB5A 4GL0A 3TODA 4MMPA 4HE2A 1MG1A 3PV0E 5ELVA 1JQFA 4K3FA 4HE1A 1B58A 3IL1B 3S4UA 5DEXB 3OEMA 4EF2A 1FBPA 1SI1A 4RY1A 2QMWA 3KSJA 4ZEIA 4F3BA 3K6UA 2F6GA 3MC2A 4IO2A 3DM0A 1OQGA 3CIJA 1B3FA 4LN5A 4NTLA 3RUMA 4OVPA 4N81A 3T9HB 2X7PA 5I84A 3B6TA 2HPGA 4JWXA 3K1NA 3IO6A 2GHBA 3IOUA 1JEVA 2GH9A 2PT1A 2KR0A 2QS3A 4I8CA 4OEVA 4H5GA 4U2RA 5EQAA 2ZMBA 4YMBA 1GVCA 2F5XA 1B3LA 1R9QA 1GV8A 2Y5KA 4M4GA 1B32A 2AL4A 1EZOA 2ZXTA 3RPWA 2X7QA 5EHSA 2XD3A 4ZEFA 3I6VA 5T3JA 3EHSA 2LAOA 4ISUA 5CI5A 2DSFA 1FPGA 3IB1A 4F3SA 5EQ8A 2QVUA 2PX1A 3G7WA 5AE4A 1NFTA 4KPTA 1LBVA 4YU0A 1NUXA 1FPEA 4QF9A 2UXAA 3B8BA 1MM7A 3H6VA 3UA8A 4F1YA 4WKMA 3L6GA 4N8GA 1M5CA 4WEDA 3RT8A 1MY2A 1H45A 1B51A 3KOTA 2I4CA 1SVXB 1B1XA 1AL3A 2VOZA 3WAFA 4QHQA 4EXKA 3FVGA 4IO3A 1OMPA 1B2HA 2R9JA 4RK2A 4Q5TA 1CB6A 4H67A 5H8HB 3C36A 2DOJA 1LBCA 4LVQA 1B5HA 3BIGA 5IZZA 4OVSA 1PC3A 1TFAA 3UK4A 1UTHA 1SPIA 2UVHA 4XKPA 1XS5A 5I2KA 5BUUA 3ILTB 1ATGA 4P56A 4HS7A 5FHOA 1VFEA 1ELJA 3O28A 4X48A 4OXVA 4O94A 2Y84A 2WBDA 2A5SA 3MP8A 4RA1A 5EHMA 4QSEA 3EN3A 2Q89A
chains in the Genus database with same CATH topology
4EQBA 5FTHA 3C4MA 2DP8A 4NWDA 3QSLA 3KN3A 3DELB 1QVSA 5CMCA 4M1VA 4ZECA 2UVIA 1MM6A 1R9LA 4O3CA 2D5WA 3LSWA 2XHDA 1S9TA 4OERA 1JETA 1SDXA 2AL5A 3K6WA 5DVJA 1USYE 4F1UA 2I58A 4BDLA 1B5JA 1DSNA 3FV1A 3O6GA 3TTMA 1MQDA 1YAEA 1XVYA 3KN8A 1D9VA 4XKQA 3N6TA 3THIA 3OEKA 3W9VA 1PBPA 4X1BA 5I56A 1B46A 3TDJA 1OLCA 3G3FA 5KDTB 3TQWA 1XC1A 1I6AA 3QIMA 1MY3A 3S9LC 1P1QA 4QSCA 4XIGQ 3R7XA 4DDDA 3QAXA 2BJJX 4U4XA 1EU8A 3OENA 3B6QA 1QUIA 1AIVA 2ZNTA 3K1MA 5ITOA 3VFJA 3SEYA 1DMBA 1SD3A 1IXIA 1MH4A 3ZS6A 1UTBB 1MY0A 2Q8JA 2DS9A 2FYIA 3A09A 4E0WA 3MVZA 5BWJA 2XXTA 4N13A 3C35A 4OYVA 3RQTA 5H8NA 4BDRA 2XXQA 2F6PA 4GQOA 1N76A 1R1NA 3GZGA 2P2AA 3IR1A 5FHMA 4QFNA 3K6VA 1TT1A 3ECRA 4NMYA 2V84A 4QRZA 1MQGA 4KCCA 4U4SA 3PMVA 4NF5B 4KD5A 1B9JA 5I2KB 1II5A 4F29A 3FVNA 3P7IA 2F7CA 2Z8EA 1VE4A 4L17A 2HEUA 4H65A 3TTRA 1US5A 1FQCA 4TQUQ 4G8HA 4GD5A 1OIBA 1RYXA 4ZZAA 1URSA 2G29A 2Y7RA 4JXIA 3OXNA 4GF8A 4Q8RA 3RNNA 4FORA 5A5XA 1NH8A 3O6IA 5H8QB 2QPQA 3UP9A 1FTMA 4RPNA 3T66A 4LP2B 3N26A 2GFEA 3BFTA 1QKAA 1LFHA 4G4PA 3N5LA 1JNFA 1MDP1 3QXMA 3LUYA 2QS4A 1P99A 1QJMA 1I69A 1NNFA 1I6BA 4ELQA 1USYH 3MVWA 3C34A 1LAXA 4F1VA 4R6KA 2IEEA 4GLIA 3T9VA 3AXFA 1N3XA 4MBPA 1QW0A 5F1QA 5ISUA 4G8MA 3USDA 3VLWA 3Q26A 1ZBMA 2YLNA 1Y3NA 4ELOA 4R9FA 1HSLA 1B40A 3LBSA 4F3PA 1DPEA 4R6HA 1FQAA 4KCDA 5AA1A 2PYYA 2RCBA 2I0BA 3A3UA 2A5TB 1M5BA 2Z23A 4YICA 3PUYE 4NF8A 2RF1A 4KYEA 5H8NB 3V89B 3Q28A 4OFLA 1PEBA 2HAUA 1NL5A 4QFOA 2ZYKA 4RYAA 1US4A 3PUZE 4FIMA 2H4IA 2XXUA 1B4HA 3FV2A 5CBSA 1TXFA 2M8CA 2VD2A 3ODBA 4NEDA 3TMGA 4FEBA 1LCFA 4OETA 4XKNA 1B4ZA 1MXWA 3GLBA 2XXPA 2XD2A 2Z8DA 4GL8A 3MVXA 4I1DA 3FXQA 2I0CA 1BKAA 2O7IA 4Q0CA 3VXBA 1XHYA 1Y4TA 3O29A 2Z8FA 2O84X 4R72A 3HPIA 3MUQA 1ZJLA 3A3CA 5A5XB 4C0RA 2F36A 3T22A 3V5AA 1MXYA 3OO8A 1Y4CA 1BIYA 1MPDA 1B0HA 3IOWA 4R75A 4H8IA 1FTKA 4YKJA 3B6WA 5TP9B 2DE2A 2DE3A 1MH3A 5HM4B 4FJPA 1FQDA 3T9XB 3I5OA 1EZPA 3SEWA 2O69A 2ONRA 2NUVA 1SW5A 2HAVA 3FD3A 4ELRA 2I3WA 3GBBA 4BDMA 4TLLB 2O1LA 5I59A 2XXWA 1LFIA 3QUFA 4G2ZA 4DCYA 4PP0A 4U22A 5DVIA 3DP4A 1IXHA 3WAEA 3SESA 3PU5A 2XXIA 2F8DA 3FJGA 2ZNSA 3DLNA 2FA7A 5KDTA 4F18A 1N0TA 1LLSA 4DXCA 4TLMB 5CRYA 1QUJA 3O97A 2OK2A 1N84A 3Q29A 1YPNA 4DZ1A 3PPOA 4YMAA 3MQ9A 5K2YA 1LCTA 3K00A 3EHUA 1ZIUA 1B52A 4NF8B 1NH7A 5DT6A 3O66A 4BDQA 1UTBA 3I3VA 4THIA 1TWYA 1NNTA 4YZZA 2H9BA 3PUXE 1XT8A 4PETA 1MPBA 2O6AA 3PD8A 4F39A 1SW4A 3ONMA 1WODA 4LZ8A 5LOMA 3H7MA 3MW0A 1MXXA 1LAGE 5L8DA 1MQIA 3R26A 5JTYA 1Y9UA 4KI0E 3U72A 1L5TA 2B3FA 4YKPA 5L9OA 1RYOA 5CMKA 3HHGA 4Q30B 1Y20A 4JSOA 4H6DA 3U8QA 4QFLA 4IO5A 4NF5A 4XTCQ 4UACA 2NWJA 3PPNA 3H6WA 3MZ9A 4DXUA 3OSRA 3OMBA 4EUOA 3KOSA 2ESNA 1A54A 4H5FA 2XXYA 5B70A 5I58B 1URGA 4KHZE 3O6HA 5J1DA 3OSQA 2XX9A 1XOCA 2GHAA 5H8QA 4ZEDA 4YKKA 4EQ9A 3N6UA 3CRBA 2H25A 3FUZA 3IX1A 3JYRA 1XVXA 3MP6A 1IZ1A 4DCXA 4IY6A 3IK6B 5I59B 1FQBA 3CVGA 2OWSA 4BDOA 1N7WA 1N3WA 2ABHA 3F11A 3UGWA 3FXRA 1OVBA 2OBGA 3RTWB 3PGFA 3T93B 1FQFA 3DP6A 1LGBC 4JWYA 2XXHA 3RN8A 4HCWA 1MS7A 1B3EA 5ITPA 4GWOA 3IB0A 3FVOA 2W7YA 3OELA 1MY4A 2VHAA 1HSJA 4HCYA 1FW0A 2V25A 1SW1A 5CMMA 5HBCA 1N04A 1PBQA 1BLFA 5ICTA 1J1NA 4LQ2A 3K6XA 3MBPA 5FHNA 5DTBA 3PD9A 4ZE8A 3OO7A 2A5TA 3MPKA 2DWHA 4P11A 1JW1A 1IXCA 3TUSA 4H8JA 3LSFB 5DYHA 1VR5A 4F31B 4R74A 1MXZA 4UA8A 4OFOA 3FJ7A 5HPQA 3EPEA 3UN6A 2DWAA 2Y7IA 5JTYB 1WVJA 3OO9A 3HN0A 3TTLA 4ZEBA 1URDA 3G3KA 2XX8A 1OLAA 3HO7A 3CSGA 4ONYA 2WKYA 2HCAA 5ICQA 4IO6A 4OZ9A 4QFKA 3E3KA 3M3FA 4KYDA 2I3VA 1H76A 3Q25A 1CE2A 3W15C 3TCHA 2AIXA 2ONKE 3VDFA 1QULA 3UORA 1Z7ME 2HZKA 3C31A 1JEUA 4GXAA 3C9HA 4HW8A 5AA3A 3TPAA 1QKBA 2VD3A 1H43A 5TP9A 4AB6A 1FQEA 3M3KA 1D3KA 2PVUA 2UYEA 1PDAA 3TTNA 5FTIA 5H8FA 3IO4A 2VGQA 3PMXA 1NNKA 5I57A 3U92A 3V8XB 1DTZA 2RINA 4OWDA 5TU0A 3IB2A 4DIGA 2OZZA 5AA2D 1FTLA 3K0VA 3T9UA 3TQLA 3V83A 3D4GA 1YTVA 2ZYNA 2O51A 4OQOA 4MFIA 5AA2B 2UVJA 2DYXA 3PPRA 2ONSA 4U1OA 1A8FA 2DXYA 1EH3A 3EHTA 4RXLA 4NE4A 1MXUA 4YB6A 2NOOA 5AA4A 3FASA 1GTKA 1A8EA 3RY3A 2B3BA 1YCJA 4JDFA 2H98A 2F7AA 3S2VA 3CG3A 3HHFA 1DPPA 2ZYMA 3CFZA 2PT2A 1IITA 1UQWA 4OEUA 2F35A 4RNSA 1ZMGA 1POTA 4NF4A 1B3GA 3CG1A 1LSTA 3SETA 4PFTA 3TYHA 3KEIA 2QS2A 4LA9A 5B7DA 3SKPA 1FTJA 4YAHX 2V3TA 1MY1A 1FTOA 4BDNA 4LZ5A 2DQVA 3CFXA 3PMWA 3VE1B 1M5FA 3H6UA 3MP1A 3MJNA 1B1HA 2R6GE 1OVTA 4U21A 3TFLA 1QUKA 3O9PA 3K01A 2QL3A 4P0GA 1Y3PA 3JV9A 2R71A 4IO4A 3PUVE 5L9MA 1JVXA 1NNPA 3CR9A 2QSXA 4OFJA 2Q2AA 3VXCA 2D21A 1M5DA 4WEPA 1H44A 1Y1ZA 1DTGA 3ZKLA 5I58A 4LQ5A 1PB8A 2OLBA 3IOTA 1A40A 5CC2A 2ALUA 3SEUA 4DXBA 4GVOA 1NKXA 2RKMA 4O3BA 1AMFA 1UIUA 4MLQA 5DVFA 3OO6A 1IUDA 1EZ9A 2IA4A 3O2AA 3FVKA 3HV1A 3QK6A 5H8FB 3CI8A 4OENA 3KN7A 5I57B 2Q9TA 4JWOA 4GFRA 3K2DA 4I9DA 4AQ4A 3K1PA 1M5EA 4XXUA 3C33A 4MF3A 4JBZA 3RGYA 1FCKA 2I49A 3SEVA 3U93A 2REGA 3KGCA 1Q1KA 3K4UA 3OD7A 4O3AA 2OCUA 5AA4B 1ZLQA 3IOVA 3PPPA 1PB9A 3FXUA 2OJTA 2RC7A 2F7BA 4F2OA 1O63A 4PQJA 4G68C 1R6ZA 2RC8A 4MLVA 1SYHA 1A7LA 3H06B 3H03A 4H1XA 3LR1A 4EF1A 1P1WA 3RLFE 3GXAA 4DLDA 4NWCA 1H3DA 4F3GA 4NF6A 2B65A 2YPNA 3FIRA 3BKIB 4NF4B 2V93A 2I48A 5TPAA 4WXJA 2D3IA 1KWHA 3VVEA 4GXSB 1JW4A 4F19A 3OOAA 3B7DA 3KG2A 2O1MA 2XXRA 3M3LA 2DVCA 4F22A 2V3QA 3R6UA 4G8NA 4FATA 2GRVA 1POY1 4R6YA 1B6HA 3ZSFA 3TCFA 1NMUA 4U1ZA 3W9WA 2XXXA 2Z22A 2YJPA 1AH5A 3FJMA 1A99A 3G3IA 4OHNA 4ZDMA 3QUJA 4G68A 1F9BA 4C1UA 1SI0A 1B7HA 3L6HA 1IEJA 3BFUA 4KQPA 3HSTA 3S9EA 1N7XA 1IXGA 3FATA 4POWA 2DWJA 2QRYA 1GR2A 2HFBA 4FEDA 4LATA 3T96B 3VLVA 3E4RA 3Q27A 4HTGA 2V3UA 3TEPA 2H99A 2Y7PA 4R73A 2PBWA 3G3GA 3KZGA 1VSOA 1JW5A 3LC8A 1P1UA 5H8SA 1AOVA 1SQYA 2E0SA 4POXA 2QJEA 2P1SA 4ELPA 4YKIA 3D4CA 1B3HA 3TELA 2AYSA 2KLFA 1LAHE 4PFWA 4ESWA 2ANJA 3E9XA 4H0WA 3MZ1A 4R2BA 1ANFA 1Z7NE 4KR5A 2ZYOA 3H6TA 4DE8A 2FNCA 4ESXA 1LB8A 1UIVA 1Y3QA 5AA2A 2O7UA 1LBBA 2Y7KA 4JB7A 3TCGA 4EXLA 5KZTA 3KJTA 4OTEA 2E1SA 2DWIA 5KCJA 2THIA 1ZKBA 1D9YA 3IJOB 3FZVA 4GRKA 2I6EA 5I2NA 4IGRA 1SW2A 1RKMA 4FECA 4NF6B 4ZZEA 5TPAB 3EF7A 2F78A 2F34A 1IIWA 4LONB 1ZU0A 4OVJA 1MQHA 4PFUA 4KFQA 1O64A 4MH5A 5K2XA 4AB5A 4PFYA 1P1NA 4XKRA 1D4NA 4IGTA 2PMSA 2NXOA 4OESA 3N94A 3ZKKA 4LUBA 3S9NC 4RPOA 3TZAA 1MDQA 4X1DA 5L9SA 4PE5B 4N6PA 4QFPA 1IQ7A 2HXWA 3KBRA 4G68B 2H5YA 2DXRA 4JSDA 3EQ1A 2XXVA 4U23A 2CMOA 4BLAA 1UTHB 1GGGA 3FGSA 1LFGA 2HZLA 1VFDA 3MWBA 1A55A 2NVUB 4OMBA 3VVDA 1HSEA 1DOTA 3JZJA 3K02A 4IB2A 2VP1A 3ILUB 4Z0IA 5EYFA 1ZTYA 1B7UA 1MXVA 3HCQA 4I62A 4TOZA 5CMBA 3G3HA 1MQJA 4GOTA 1T0KA 1P1OA 4Z7EA 3SERA 4C1TA 1S50A 3M8UA 4ECFA 4N07A 3H3GA 2I4BA 5DEXA 2XX7A 1Q35A 3MAMA 3U1OA 1JVYA 3TKDA 3TTKA 3LSLA 3VV5A 3IORA 5CBRA 4IO7A 2UVGA 4RJZA 4R9GA 3MZBA 3PPQA 4EDPA 3IJXB 4ZE9A 4YB7A 5I56B 4FE8A 4RK9A 3CSBA 4P0IA 4EQ7A 5KCJB 3MVYA 4FAJA 3BBRA 3H4ZA 1B0LA 2X26A 3DP8A 5I2NB 1MPCA 1Y1MA 1BP5A 1SBPA 2RC9A 1WDNA 3TAJA 4IY5A 3LSXA 2DVZA 5JEIA 4ZEKA 2HQ0A 2G93A 2RCAA 5CM6A 5M2VA 2Y7WA 3CFLA 3VLUA 3KSXA 1B05A 3KFMA 5F7VA 1TFDA 1I6QA 2O68A 2ZNUA 1S7YA 3U94A 3GBAA 2REJA 3PUWE 4QSDA 3C32A 1O7TA 1PB7A 2P0SA 3RTFB 3KJ7A 2QMXA 3E13X 4GIZA 4G77A 4LZ7A 1B5IA 1BTJA 4ND9A 2DE4A 4F2QA 2UYFA 4KYSA 3SDFA 3VVFA 2Q88A 3MPLA 5IKBA 1MRPA 4E0XA 2F97A 2QS1A 4R2FA 1SYIA 2Q2CA 3IAZA 3RT6B 5JK4A 5H8HA 3UIFA 5IAIA 3S9MC 1B7ZA 1LAFE 2OWTA 1OQHA 2CZLA 3G3JA 4ZS9A 1LB9A 3SEXA 3QYTA 4X9TA 4YB5A 4GL0A 3TODA 1MG1A 3PV0E 5ELVA 1JQFA 4K3FA 1B58A 3IL1B 3S4UA 5DEXB 3OEMA 4EF2A 1SI1A 4RY1A 2QMWA 3KSJA 4ZEIA 4F3BA 3K6UA 2F6GA 3MC2A 4IO2A 3DM0A 1OQGA 3CIJA 1B3FA 4NTLA 3RUMA 3T9HB 2X7PA 5I84A 3B6TA 4JWXA 3K1NA 3IO6A 2GHBA 3IOUA 1JEVA 2GH9A 2PT1A 2QS3A 4I8CA 4OEVA 4H5GA 4U2RA 2ZMBA 4YMBA 1GVCA 2F5XA 1B3LA 1R9QA 1GV8A 4M4GA 1B32A 2AL4A 1EZOA 2ZXTA 3RPWA 2X7QA 5EHSA 2XD3A 4ZEFA 3I6VA 3EHSA 2LAOA 4ISUA 5CI5A 2DSFA 3IB1A 4F3SA 2PX1A 3G7WA 5AE4A 1NFTA 4KPTA 4YU0A 4QF9A 2UXAA 1MM7A 3H6VA 3UA8A 4F1YA 4WKMA 3L6GA 1M5CA 4WEDA 3RT8A 1MY2A 1H45A 1B51A 3KOTA 2I4CA 1SVXB 1B1XA 1AL3A 2VOZA 3WAFA 4QHQA 4EXKA 3FVGA 4IO3A 1OMPA 1B2HA 2R9JA 4RK2A 4Q5TA 1CB6A 4H67A 5H8HB 3C36A 2DOJA 1LBCA 4LVQA 1B5HA 1PC3A 1TFAA 3UK4A 1UTHA 5I2KA 4XKPA 2UVHA 1XS5A 5BUUA 3ILTB 1ATGA 4HS7A 5FHOA 1VFEA 1ELJA 3O28A 4X48A 4OXVA 2Y84A 2A5SA 3MP8A 4RA1A 5EHMA 4QSEA 3EN3A 2Q89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQB A;  5FTH A;  3C4M A;  2DP8 A;  4NWD A;  3QSL A;  3KN3 A;  3DEL B;  1QVS A;  5CMC A;  4M1V A;  4ZEC A;  2UVI A;  1MM6 A;  1R9L A;  4O3C A;  2D5W A;  3LSW A;  2XHD A;  1S9T A;  4OER A;  1JET A;  1SDX A;  2AL5 A;  3K6W A;  5DVJ A;  1USY E;  4F1U A;  2I58 A;  4BDL A;  1B5J A;  1DSN A;  3FV1 A;  3O6G A;  3TTM A;  1MQD A;  1YAE A;  1XVY A;  3KN8 A;  1D9V A;  4XKQ A;  3N6T A;  3THI A;  3OEK A;  3W9V A;  1PBP A;  4X1B A;  5I56 A;  1B46 A;  3TDJ A;  1OLC A;  3G3F A;  5KDT B;  3TQW A;  1XC1 A;  1I6A A;  3QIM A;  1MY3 A;  3S9L C;  1P1Q A;  4QSC A;  4XIG Q;  3R7X A;  4DDD A;  3QAX A;  2BJJ X;  4U4X A;  1EU8 A;  3OEN A;  3B6Q A;  1QUI A;  1AIV A;  2ZNT A;  3K1M A;  5ITO A;  3VFJ A;  3SEY A;  1DMB A;  1SD3 A;  1IXI A;  1MH4 A;  3ZS6 A;  1UTB B;  1MY0 A;  2Q8J A;  2DS9 A;  2FYI A;  3A09 A;  4E0W A;  3MVZ A;  5BWJ A;  2XXT A;  4N13 A;  3C35 A;  4OYV A;  3RQT A;  5H8N A;  4BDR A;  2XXQ A;  2F6P A;  4GQO A;  1N76 A;  1R1N A;  3GZG A;  2P2A A;  3IR1 A;  5FHM A;  4QFN A;  3K6V A;  1TT1 A;  3ECR A;  4NMY A;  2V84 A;  4QRZ A;  1MQG A;  4KCC A;  4U4S A;  3PMV A;  4NF5 B;  4KD5 A;  1B9J A;  5I2K B;  1II5 A;  4F29 A;  3FVN A;  3P7I A;  2F7C A;  2Z8E A;  1VE4 A;  4L17 A;  2HEU A;  4H65 A;  3TTR A;  1US5 A;  1FQC A;  4TQU Q;  4G8H A;  4GD5 A;  1OIB A;  1RYX A;  4ZZA A;  1URS A;  2G29 A;  2Y7R A;  4JXI A;  3OXN A;  4GF8 A;  4Q8R A;  3RNN A;  4FOR A;  5A5X A;  1NH8 A;  3O6I A;  5H8Q B;  2QPQ A;  3UP9 A;  1FTM A;  4RPN A;  3T66 A;  4LP2 B;  3N26 A;  2GFE A;  3BFT A;  1QKA A;  1LFH A;  4G4P A;  3N5L A;  1JNF A;  1MDP 1;  3QXM A;  3LUY A;  2QS4 A;  1P99 A;  1QJM A;  1I69 A;  1NNF A;  1I6B A;  4ELQ A;  1USY H;  3MVW A;  3C34 A;  1LAX A;  4F1V A;  4R6K A;  2IEE A;  4GLI A;  3T9V A;  3AXF A;  1N3X A;  4MBP A;  1QW0 A;  5F1Q A;  5ISU A;  4G8M A;  3USD A;  3VLW A;  3Q26 A;  1ZBM A;  2YLN A;  1Y3N A;  4ELO A;  4R9F A;  1HSL A;  1B40 A;  3LBS A;  4F3P A;  1DPE A;  4R6H A;  1FQA A;  4KCD A;  5AA1 A;  2PYY A;  2RCB A;  2I0B A;  3A3U A;  2A5T B;  1M5B A;  2Z23 A;  4YIC A;  3PUY E;  4NF8 A;  2RF1 A;  4KYE A;  5H8N B;  3V89 B;  3Q28 A;  4OFL A;  1PEB A;  2HAU A;  1NL5 A;  4QFO A;  2ZYK A;  4RYA A;  1US4 A;  3PUZ E;  4FIM A;  2H4I A;  2XXU A;  1B4H A;  3FV2 A;  5CBS A;  1TXF A;  2M8C A;  2VD2 A;  3ODB A;  4NED A;  3TMG A;  4FEB A;  1LCF A;  4OET A;  4XKN A;  1B4Z A;  1MXW A;  3GLB A;  2XXP A;  2XD2 A;  2Z8D A;  4GL8 A;  3MVX A;  4I1D A;  3FXQ A;  2I0C A;  1BKA A;  2O7I A;  4Q0C A;  3VXB A;  1XHY A;  1Y4T A;  3O29 A;  2Z8F A;  2O84 X;  4R72 A;  3HPI A;  3MUQ A;  1ZJL A;  3A3C A;  5A5X B;  4C0R A;  2F36 A;  3T22 A;  3V5A A;  1MXY A;  3OO8 A;  1Y4C A;  1BIY A;  1MPD A;  1B0H A;  3IOW A;  4R75 A;  4H8I A;  1FTK A;  4YKJ A;  3B6W A;  5TP9 B;  2DE2 A;  2DE3 A;  1MH3 A;  5HM4 B;  4FJP A;  1FQD A;  3T9X B;  3I5O A;  1EZP A;  3SEW A;  2O69 A;  2ONR A;  2NUV A;  1SW5 A;  2HAV A;  3FD3 A;  4ELR A;  2I3W A;  3GBB A;  4BDM A;  4TLL B;  2O1L A;  5I59 A;  2XXW A;  1LFI A;  3QUF A;  4G2Z A;  4DCY A;  4PP0 A;  4U22 A;  5DVI A;  3DP4 A;  1IXH A;  3WAE A;  3SES A;  3PU5 A;  2XXI A;  2F8D A;  3FJG A;  2ZNS A;  3DLN A;  2FA7 A;  5KDT A;  4F18 A;  1N0T A;  1LLS A;  4DXC A;  4TLM B;  5CRY A;  1QUJ A;  3O97 A;  2OK2 A;  1N84 A;  3Q29 A;  1YPN A;  4DZ1 A;  3PPO A;  4YMA A;  3MQ9 A;  5K2Y A;  1LCT A;  3K00 A;  3EHU A;  1ZIU A;  1B52 A;  4NF8 B;  1NH7 A;  5DT6 A;  3O66 A;  4BDQ A;  1UTB A;  3I3V A;  4THI A;  1TWY A;  1NNT A;  4YZZ A;  2H9B A;  3PUX E;  1XT8 A;  4PET A;  1MPB A;  2O6A A;  3PD8 A;  4F39 A;  1SW4 A;  3ONM A;  1WOD A;  4LZ8 A;  5LOM A;  3H7M A;  3MW0 A;  1MXX A;  1LAG E;  5L8D A;  1MQI A;  3R26 A;  5JTY A;  1Y9U A;  4KI0 E;  3U72 A;  1L5T A;  2B3F A;  4YKP A;  5L9O A;  1RYO A;  5CMK A;  3HHG A;  4Q30 B;  1Y20 A;  4JSO A;  4H6D A;  3U8Q A;  4QFL A;  4IO5 A;  4NF5 A;  4XTC Q;  4UAC A;  2NWJ A;  3PPN A;  3H6W A;  3MZ9 A;  4DXU A;  3OSR A;  3OMB A;  4EUO A;  3KOS A;  2ESN A;  1A54 A;  4H5F A;  2XXY A;  5B70 A;  5I58 B;  1URG A;  4KHZ E;  3O6H A;  5J1D A;  3OSQ A;  2XX9 A;  1XOC A;  2GHA A;  5H8Q A;  4ZED A;  4YKK A;  4EQ9 A;  3N6U A;  3CRB A;  2H25 A;  3FUZ A;  3IX1 A;  3JYR A;  1XVX A;  3MP6 A;  1IZ1 A;  4DCX A;  4IY6 A;  3IK6 B;  5I59 B;  1FQB A;  3CVG A;  2OWS A;  4BDO A;  1N7W A;  1N3W A;  2ABH A;  3F11 A;  3UGW A;  3FXR A;  1OVB A;  2OBG A;  3RTW B;  3PGF A;  3T93 B;  1FQF A;  3DP6 A;  1LGB C;  4JWY A;  2XXH A;  3RN8 A;  4HCW A;  1MS7 A;  1B3E A;  5ITP A;  4GWO A;  3IB0 A;  3FVO A;  2W7Y A;  3OEL A;  1MY4 A;  2VHA A;  1HSJ A;  4HCY A;  1FW0 A;  2V25 A;  1SW1 A;  5CMM A;  5HBC A;  1N04 A;  1PBQ A;  1BLF A;  5ICT A;  1J1N A;  4LQ2 A;  3K6X A;  3MBP A;  5FHN A;  5DTB A;  3PD9 A;  4ZE8 A;  3OO7 A;  2A5T A;  3MPK A;  2DWH A;  4P11 A;  1JW1 A;  1IXC A;  3TUS A;  4H8J A;  3LSF B;  5DYH A;  1VR5 A;  4F31 B;  4R74 A;  1MXZ A;  4UA8 A;  4OFO A;  3FJ7 A;  5HPQ A;  3EPE A;  3UN6 A;  2DWA A;  2Y7I A;  5JTY B;  1WVJ A;  3OO9 A;  3HN0 A;  3TTL A;  4ZEB A;  1URD A;  3G3K A;  2XX8 A;  1OLA A;  3HO7 A;  3CSG A;  4ONY A;  2WKY A;  2HCA A;  5ICQ A;  4IO6 A;  4OZ9 A;  4QFK A;  3E3K A;  3M3F A;  4KYD A;  2I3V A;  1H76 A;  3Q25 A;  1CE2 A;  3W15 C;  3TCH A;  2AIX A;  2ONK E;  3VDF A;  1QUL A;  3UOR A;  1Z7M E;  2HZK A;  3C31 A;  1JEU A;  4GXA A;  3C9H A;  4HW8 A;  5AA3 A;  3TPA A;  1QKB A;  2VD3 A;  1H43 A;  5TP9 A;  4AB6 A;  1FQE A;  3M3K A;  1D3K A;  2PVU A;  2UYE A;  1PDA A;  3TTN A;  5FTI A;  5H8F A;  3IO4 A;  2VGQ A;  3PMX A;  1NNK A;  5I57 A;  3U92 A;  3V8X B;  1DTZ A;  2RIN A;  4OWD A;  5TU0 A;  3IB2 A;  4DIG A;  2OZZ A;  5AA2 D;  1FTL A;  3K0V A;  3T9U A;  3TQL A;  3V83 A;  3D4G A;  1YTV A;  2ZYN A;  2O51 A;  4OQO A;  4MFI A;  5AA2 B;  2UVJ A;  2DYX A;  3PPR A;  2ONS A;  4U1O A;  1A8F A;  2DXY A;  1EH3 A;  3EHT A;  4RXL A;  4NE4 A;  1MXU A;  4YB6 A;  2NOO A;  5AA4 A;  3FAS A;  1GTK A;  1A8E A;  3RY3 A;  2B3B A;  1YCJ A;  4JDF A;  2H98 A;  2F7A A;  3S2V A;  3CG3 A;  3HHF A;  1DPP A;  2ZYM A;  3CFZ A;  2PT2 A;  1IIT A;  1UQW A;  4OEU A;  2F35 A;  4RNS A;  1ZMG A;  1POT A;  4NF4 A;  1B3G A;  3CG1 A;  1LST A;  3SET A;  4PFT A;  3TYH A;  3KEI A;  2QS2 A;  4LA9 A;  5B7D A;  3SKP A;  1FTJ A;  4YAH X;  2V3T A;  1MY1 A;  1FTO A;  4BDN A;  4LZ5 A;  2DQV A;  3CFX A;  3PMW A;  3VE1 B;  1M5F A;  3H6U A;  3MP1 A;  3MJN A;  1B1H A;  2R6G E;  1OVT A;  4U21 A;  3TFL A;  1QUK A;  3O9P A;  3K01 A;  2QL3 A;  4P0G A;  1Y3P A;  3JV9 A;  2R71 A;  4IO4 A;  3PUV E;  5L9M A;  1JVX A;  1NNP A;  3CR9 A;  2QSX A;  4OFJ A;  2Q2A A;  3VXC A;  2D21 A;  1M5D A;  4WEP A;  1H44 A;  1Y1Z A;  1DTG A;  3ZKL A;  5I58 A;  4LQ5 A;  1PB8 A;  2OLB A;  3IOT A;  1A40 A;  5CC2 A;  2ALU A;  3SEU A;  4DXB A;  4GVO A;  1NKX A;  2RKM A;  4O3B A;  1AMF A;  1UIU A;  4MLQ A;  5DVF A;  3OO6 A;  1IUD A;  1EZ9 A;  2IA4 A;  3O2A A;  3FVK A;  3HV1 A;  3QK6 A;  5H8F B;  3CI8 A;  4OEN A;  3KN7 A;  5I57 B;  2Q9T A;  4JWO A;  4GFR A;  3K2D A;  4I9D A;  4AQ4 A;  3K1P A;  1M5E A;  4XXU A;  3C33 A;  4MF3 A;  4JBZ A;  3RGY A;  1FCK A;  2I49 A;  3SEV A;  3U93 A;  2REG A;  3KGC A;  1Q1K A;  3K4U A;  3OD7 A;  4O3A A;  2OCU A;  5AA4 B;  1ZLQ A;  3IOV A;  3PPP A;  1PB9 A;  3FXU A;  2OJT A;  2RC7 A;  2F7B A;  4F2O A;  1O63 A;  4PQJ A;  4G68 C;  1R6Z A;  2RC8 A;  4MLV A;  1SYH A;  1A7L A;  3H06 B;  3H03 A;  4H1X A;  3LR1 A;  4EF1 A;  1P1W A;  3RLF E;  3GXA A;  4DLD A;  4NWC A;  1H3D A;  4F3G A;  4NF6 A;  2B65 A;  2YPN A;  3FIR A;  3BKI B;  4NF4 B;  2V93 A;  2I48 A;  5TPA A;  4WXJ A;  2D3I A;  1KWH A;  3VVE A;  4GXS B;  1JW4 A;  4F19 A;  3OOA A;  3B7D A;  3KG2 A;  2O1M A;  2XXR A;  3M3L A;  2DVC A;  4F22 A;  2V3Q A;  3R6U A;  4G8N A;  4FAT A;  2GRV A;  1POY 1;  4R6Y A;  1B6H A;  3ZSF A;  3TCF A;  1NMU A;  4U1Z A;  3W9W A;  2XXX A;  2Z22 A;  2YJP A;  1AH5 A;  3FJM A;  1A99 A;  3G3I A;  4OHN A;  4ZDM A;  3QUJ A;  4G68 A;  1F9B A;  4C1U A;  1SI0 A;  1B7H A;  3L6H A;  1IEJ A;  3BFU A;  4KQP A;  3HST A;  3S9E A;  1N7X A;  1IXG A;  3FAT A;  4POW A;  2DWJ A;  2QRY A;  1GR2 A;  2HFB A;  4FED A;  4LAT A;  3T96 B;  3VLV A;  3E4R A;  3Q27 A;  4HTG A;  2V3U A;  3TEP A;  2H99 A;  2Y7P A;  4R73 A;  2PBW A;  3G3G A;  3KZG A;  1VSO A;  1JW5 A;  3LC8 A;  1P1U A;  5H8S A;  1AOV A;  1SQY A;  2E0S A;  4POX A;  2QJE A;  2P1S A;  4ELP A;  4YKI A;  3D4C A;  1B3H A;  3TEL A;  2AYS A;  2KLF A;  1LAH E;  4PFW A;  4ESW A;  2ANJ A;  3E9X A;  4H0W A;  3MZ1 A;  4R2B A;  1ANF A;  1Z7N E;  4KR5 A;  2ZYO A;  3H6T A;  4DE8 A;  2FNC A;  4ESX A;  1LB8 A;  1UIV A;  1Y3Q A;  5AA2 A;  2O7U A;  1LBB A;  2Y7K A;  4JB7 A;  3TCG A;  4EXL A;  5KZT A;  3KJT A;  4OTE A;  2E1S A;  2DWI A;  5KCJ A;  2THI A;  1ZKB A;  1D9Y A;  3IJO B;  3FZV A;  4GRK A;  2I6E A;  5I2N A;  4IGR A;  1SW2 A;  1RKM A;  4FEC A;  4NF6 B;  4ZZE A;  5TPA B;  3EF7 A;  2F78 A;  2F34 A;  1IIW A;  4LON B;  1ZU0 A;  4OVJ A;  1MQH A;  4PFU A;  4KFQ A;  1O64 A;  4MH5 A;  5K2X A;  4AB5 A;  4PFY A;  1P1N A;  4XKR A;  1D4N A;  4IGT A;  2PMS A;  2NXO A;  4OES A;  3N94 A;  3ZKK A;  4LUB A;  3S9N C;  4RPO A;  3TZA A;  1MDQ A;  4X1D A;  5L9S A;  4PE5 B;  4N6P A;  4QFP A;  1IQ7 A;  2HXW A;  3KBR A;  4G68 B;  2H5Y A;  2DXR A;  4JSD A;  3EQ1 A;  2XXV A;  4U23 A;  2CMO A;  4BLA A;  1UTH B;  1GGG A;  3FGS A;  1LFG A;  2HZL A;  1VFD A;  3MWB A;  1A55 A;  2NVU B;  4OMB A;  3VVD A;  1HSE A;  1DOT A;  3JZJ A;  3K02 A;  4IB2 A;  2VP1 A;  3ILU B;  4Z0I A;  5EYF A;  1ZTY A;  1B7U A;  1MXV A;  3HCQ A;  4I62 A;  4TOZ A;  5CMB A;  3G3H A;  1MQJ A;  4GOT A;  1T0K A;  1P1O A;  4Z7E A;  3SER A;  4C1T A;  1S50 A;  3M8U A;  4ECF A;  4N07 A;  3H3G A;  2I4B A;  5DEX A;  2XX7 A;  1Q35 A;  3MAM A;  3U1O A;  1JVY A;  3TKD A;  3TTK A;  3LSL A;  3VV5 A;  3IOR A;  5CBR A;  4IO7 A;  2UVG A;  4RJZ A;  4R9G A;  3MZB A;  3PPQ A;  4EDP A;  3IJX B;  4ZE9 A;  4YB7 A;  5I56 B;  4FE8 A;  4RK9 A;  3CSB A;  4P0I A;  4EQ7 A;  5KCJ B;  3MVY A;  4FAJ A;  3BBR A;  3H4Z A;  1B0L A;  2X26 A;  3DP8 A;  5I2N B;  1MPC A;  1Y1M A;  1BP5 A;  1SBP A;  2RC9 A;  1WDN A;  3TAJ A;  4IY5 A;  3LSX A;  2DVZ A;  5JEI A;  4ZEK A;  2HQ0 A;  2G93 A;  2RCA A;  5CM6 A;  5M2V A;  2Y7W A;  3CFL A;  3VLU A;  3KSX A;  1B05 A;  3KFM A;  5F7V A;  1TFD A;  1I6Q A;  2O68 A;  2ZNU A;  1S7Y A;  3U94 A;  3GBA A;  2REJ A;  3PUW E;  4QSD A;  3C32 A;  1O7T A;  1PB7 A;  2P0S A;  3RTF B;  3KJ7 A;  2QMX A;  3E13 X;  4GIZ A;  4G77 A;  4LZ7 A;  1B5I A;  1BTJ A;  4ND9 A;  2DE4 A;  4F2Q A;  2UYF A;  4KYS A;  3SDF A;  3VVF A;  2Q88 A;  3MPL A;  5IKB A;  1MRP A;  4E0X A;  2F97 A;  2QS1 A;  4R2F A;  1SYI A;  2Q2C A;  3IAZ A;  3RT6 B;  5JK4 A;  5H8H A;  3UIF A;  5IAI A;  3S9M C;  1B7Z A;  1LAF E;  2OWT A;  1OQH A;  2CZL A;  3G3J A;  4ZS9 A;  1LB9 A;  3SEX A;  3QYT A;  4X9T A;  4YB5 A;  4GL0 A;  3TOD A;  1MG1 A;  3PV0 E;  5ELV A;  1JQF A;  4K3F A;  1B58 A;  3IL1 B;  3S4U A;  5DEX B;  3OEM A;  4EF2 A;  1SI1 A;  4RY1 A;  2QMW A;  3KSJ A;  4ZEI A;  4F3B A;  3K6U A;  2F6G A;  3MC2 A;  4IO2 A;  3DM0 A;  1OQG A;  3CIJ A;  1B3F A;  4NTL A;  3RUM A;  3T9H B;  2X7P A;  5I84 A;  3B6T A;  4JWX A;  3K1N A;  3IO6 A;  2GHB A;  3IOU A;  1JEV A;  2GH9 A;  2PT1 A;  2QS3 A;  4I8C A;  4OEV A;  4H5G A;  4U2R A;  2ZMB A;  4YMB A;  1GVC A;  2F5X A;  1B3L A;  1R9Q A;  1GV8 A;  4M4G A;  1B32 A;  2AL4 A;  1EZO A;  2ZXT A;  3RPW A;  2X7Q A;  5EHS A;  2XD3 A;  4ZEF A;  3I6V A;  3EHS A;  2LAO A;  4ISU A;  5CI5 A;  2DSF A;  3IB1 A;  4F3S A;  2PX1 A;  3G7W A;  5AE4 A;  1NFT A;  4KPT A;  4YU0 A;  4QF9 A;  2UXA A;  1MM7 A;  3H6V A;  3UA8 A;  4F1Y A;  4WKM A;  3L6G A;  1M5C A;  4WED A;  3RT8 A;  1MY2 A;  1H45 A;  1B51 A;  3KOT A;  2I4C A;  1SVX B;  1B1X A;  1AL3 A;  2VOZ A;  3WAF A;  4QHQ A;  4EXK A;  3FVG A;  4IO3 A;  1OMP A;  1B2H A;  2R9J A;  4RK2 A;  4Q5T A;  1CB6 A;  4H67 A;  5H8H B;  3C36 A;  2DOJ A;  1LBC A;  4LVQ A;  1B5H A;  1PC3 A;  1TFA A;  3UK4 A;  1UTH A;  5I2K A;  4XKP A;  2UVH A;  1XS5 A;  5BUU A;  3ILT B;  1ATG A;  4HS7 A;  5FHO A;  1VFE A;  1ELJ A;  3O28 A;  4X48 A;  4OXV A;  2Y84 A;  2A5S A;  3MP8 A;  4RA1 A;  5EHM A;  4QSE A;  3EN3 A;  2Q89 A; 
#chains in the Genus database with same CATH topology
 4EQB A;  5FTH A;  3C4M A;  1QGX A;  1FBE A;  1JP4 A;  2DP8 A;  4NWD A;  3QSL A;  3KN3 A;  3DEL B;  3T0J A;  1QVS A;  4I3Y A;  5CMC A;  4M1V A;  4ZEC A;  2UVI A;  1MM6 A;  1R9L A;  4O3C A;  2D5W A;  3LSW A;  2FBP A;  2XHD A;  1S9T A;  4OER A;  1JET A;  1SDX A;  2AL5 A;  3K6W A;  5DVJ A;  1USY E;  5EQ7 A;  4F1U A;  2I58 A;  4BDL A;  1B5J A;  1DSN A;  3FV1 A;  3O6G A;  3D1R A;  3TTM A;  1FBF A;  1MQD A;  1YAE A;  1XVY A;  3KN8 A;  1D9V A;  4XKQ A;  3N6T A;  3THI A;  3OEK A;  3W9V A;  1PBP A;  4X1B A;  5I56 A;  1B46 A;  3TDJ A;  4PCD A;  1OLC A;  3G3F A;  5KDT B;  4G61 A;  3TQW A;  2VPN A;  1XC1 A;  2MKZ A;  2V4C A;  1I6A A;  3QIM A;  1MY3 A;  4N8Y A;  3S9L C;  1P1Q A;  4QSC A;  4XIG Q;  3R7X A;  1FPD A;  4DDD A;  3QAX A;  2BJJ X;  4U4X A;  2QVV A;  1EU8 A;  3OEN A;  4O7M A;  3B6Q A;  1QUI A;  1AIV A;  2ZNT A;  3K1M A;  5ITO A;  2P3V A;  3VFJ A;  1BK4 A;  3SEY A;  1DMB A;  4GWX A;  1SD3 A;  1IXI A;  1MH4 A;  2B4M A;  1UTB B;  1FJ9 A;  4XFE A;  3ZS6 A;  1MY0 A;  2Q8J A;  2DS9 A;  2FYI A;  3A09 A;  4E0W A;  3MVZ A;  5BWJ A;  2XXT A;  4N13 A;  3C35 A;  4OYV A;  3RQT A;  5H8N A;  4BDR A;  2XXQ A;  2F6P A;  4GQO A;  1N76 A;  1KA1 A;  1R1N A;  3GZG A;  4AS5 A;  2P2A A;  3IR1 A;  5FHM A;  5DW8 A;  4QFN A;  1NV5 A;  3K6V A;  1TT1 A;  3ECR A;  4NMY A;  4H46 A;  4OAN A;  1NV3 A;  2V84 A;  4QRZ A;  5EYH A;  1MQG A;  4KCC A;  4U4S A;  3PMV A;  4NF5 B;  4KD5 A;  1B9J A;  5I2K B;  1II5 A;  4F29 A;  3FVN A;  3P7I A;  4P1L A;  2F7C A;  2Z8E A;  1VE4 A;  4L17 A;  2HEU A;  4H65 A;  3TTR A;  1US5 A;  1FQC A;  4TQU Q;  4G8H A;  4GD5 A;  1OIB A;  4O8M A;  1RDX A;  1RYX A;  4ZZA A;  1URS A;  3IFC A;  2G29 A;  2Y7R A;  4JXI A;  3OXN A;  4GF8 A;  4Q8R A;  3RNN A;  4FOR A;  5A5X A;  1NH8 A;  3O6I A;  5H8Q B;  2QPQ A;  3UP9 A;  1FTM A;  4GWY A;  5IGA A;  4RPN A;  4P9K A;  3T66 A;  4LP2 B;  3N26 A;  3IFA A;  4PBQ A;  2GFE A;  3BFT A;  1QKA A;  4AS4 A;  4G4P A;  1LFH A;  3N5L A;  2VPO A;  1JNF A;  1MDP 1;  3QXM A;  3LUY A;  1FPL A;  2QS4 A;  1P99 A;  1QJM A;  1I69 A;  1NNF A;  1I6B A;  4ELQ A;  1USY H;  1LBW A;  3MVW A;  2CZK A;  1FPK A;  4PBH A;  3C34 A;  1LAX A;  4F1V A;  4R6K A;  2IEE A;  4GLI A;  3T9V A;  3AXF A;  2Q8M A;  1N3X A;  3FBP A;  4MBP A;  1QW0 A;  5F1Q A;  5ISU A;  4PDD A;  4G8M A;  3USD A;  3VLW A;  3Q26 A;  1ZBM A;  2YLN A;  2CZI A;  1Y3N A;  1NUY A;  4MX6 A;  3ISP A;  4ELO A;  4R9F A;  1HSL A;  1B40 A;  3LBS A;  4F3P A;  1DPE A;  4R6H A;  4KXP A;  4PFI A;  1FQA A;  4KCD A;  4O7I A;  5AA1 A;  1LBY A;  2PYY A;  2RCB A;  2I0B A;  3A3U A;  2A5T B;  1M5B A;  2Z23 A;  1FPF A;  1FPI A;  4YIC A;  3PUY E;  4NF8 A;  2RF1 A;  4H45 A;  4KYE A;  5H8N B;  3V89 B;  3Q28 A;  4OFL A;  1PEB A;  1LEV A;  1NL5 A;  2HAU A;  4QFO A;  4PFB A;  5IZ3 A;  2ZYK A;  4RYA A;  1US4 A;  3PUZ E;  4FIM A;  2H4I A;  2XXU A;  1B4H A;  3FV2 A;  5CBS A;  4DI3 D;  1TXF A;  2M8C A;  2VD2 A;  3ODB A;  4NED A;  4MAG A;  1EYK A;  3TMG A;  4XF5 A;  4FEB A;  1LCF A;  4OET A;  4XKN A;  1B4Z A;  1MXW A;  3GLB A;  2XXP A;  2XD2 A;  2Z8D A;  1EYI A;  4GL8 A;  3MVX A;  4I1D A;  3FXQ A;  2I0C A;  1BKA A;  2O7I A;  4Q0C A;  3VXB A;  1XHY A;  1Y4T A;  5F24 A;  1NV0 A;  3O29 A;  2Z8F A;  2ZZX A;  4OVQ A;  2O84 X;  4R72 A;  3HPI A;  3MUQ A;  1ZJL A;  3A3C A;  5A5X B;  4C0R A;  2F36 A;  3T22 A;  1NV1 A;  3V5A A;  1MXY A;  1NV2 A;  3OO8 A;  1Y4C A;  1BIY A;  1MPD A;  1B0H A;  3IOW A;  4R75 A;  4H8I A;  3KBZ A;  1FTK A;  4YKJ A;  3B6W A;  2FVZ A;  5TP9 B;  2DE2 A;  2DE3 A;  1MH3 A;  3SZP A;  5HM4 B;  1IMD A;  4FJP A;  1FQD A;  3HFU A;  3T9X B;  3I5O A;  1EZP A;  3SEW A;  2O69 A;  2ONR A;  2NUV A;  1SW5 A;  2HAV A;  3FD3 A;  4ELR A;  1Q9D A;  2I3W A;  3GBB A;  4BDM A;  1NV4 A;  4TLL B;  2O1L A;  5I59 A;  2XXW A;  1LFI A;  3QUF A;  4G2Z A;  4DCY A;  4MJO A;  4PP0 A;  4U22 A;  5DVI A;  3DP4 A;  1IXH A;  4PAK A;  3SES A;  3WAE A;  3PU5 A;  2XXI A;  2F8D A;  1EYJ A;  3FJG A;  2ZNS A;  3DLN A;  2FA7 A;  5KDT A;  4F18 A;  1N0T A;  2XWV A;  1LLS A;  4DXC A;  4TLM B;  3E78 A;  5CRY A;  1QUJ A;  3O97 A;  2OK2 A;  1N84 A;  4PTK A;  3Q29 A;  1YPN A;  4DZ1 A;  3PPO A;  4YMA A;  4QXD A;  3MQ9 A;  3MYU A;  5K2Y A;  3MST A;  4NQ8 A;  1LCT A;  3K00 A;  3EHU A;  1ZIU A;  1NV7 A;  1B52 A;  4NF8 B;  3BIH A;  1NH7 A;  5DT6 A;  3O66 A;  2Q74 A;  1DK4 A;  4BDQ A;  1UTB A;  3I3V A;  4THI A;  5IZ3 B;  1TWY A;  1NNT A;  4YZZ A;  2H9B A;  4OVT A;  4FBP A;  3LUZ A;  3PUX E;  1XT8 A;  2PCR A;  4PET A;  1MPB A;  2O6A A;  3PD8 A;  4F39 A;  1SW4 A;  3ONM A;  1WOD A;  4LZ8 A;  5LOM A;  3H7M A;  3MW0 A;  1MXX A;  1LAG E;  5L8D A;  1MQI A;  3R26 A;  1FRP A;  5JTY A;  1Y9U A;  4KI0 E;  3U72 A;  1L5T A;  2WYK A;  2B3F A;  4YKP A;  2WX9 A;  5L9O A;  1RYO A;  5CMK A;  3HHG A;  4Q30 B;  1Y20 A;  4JSO A;  4H6D A;  4GWZ A;  4QFL A;  3U8Q A;  4IO5 A;  4NF5 A;  4XTC Q;  4UAC A;  2NWJ A;  3PPN A;  2L5V A;  3H6W A;  3MZ9 A;  4DXU A;  3OSR A;  3OMB A;  4EUO A;  3KOS A;  5I7I A;  2ESN A;  1A54 A;  4H5F A;  2XXY A;  5B70 A;  5I58 B;  1URG A;  4KHZ E;  2FHY A;  1YYZ A;  4DI4 B;  3O6H A;  5J1D A;  3OSQ A;  2XX9 A;  1XOC A;  2GHA A;  5H8Q A;  4ZED A;  4YKK A;  3KC1 A;  2CZH A;  4EQ9 A;  3N6U A;  4JVI A;  3CRB A;  2H25 A;  3FUZ A;  3IX1 A;  3JYR A;  1XVX A;  4P8B A;  4IR8 A;  3MP6 A;  1IZ1 A;  4DCX A;  4IY6 A;  3IK6 B;  5EYG A;  5I59 B;  1FQB A;  4PAI A;  3CVG A;  2OWS A;  4BDO A;  1N7W A;  1N3W A;  2ABH A;  3F11 A;  3UGW A;  3FXR A;  1OVB A;  2OBG A;  4NN3 A;  3RTW B;  3PGF A;  3EKI A;  3T93 B;  1FQF A;  3DP6 A;  3FXB A;  1LGB C;  4JWY A;  2XXH A;  3RN8 A;  4HCW A;  1MS7 A;  1B3E A;  5ITP A;  4GWO A;  2WBB A;  3IB0 A;  3FVO A;  2W7Y A;  1AWB A;  3OEL A;  1MY4 A;  2VHA A;  1HSJ A;  4HCY A;  1FW0 A;  2FIX A;  2V25 A;  1SW1 A;  4X8R A;  5CMM A;  5HBC A;  4UAB A;  1N04 A;  1PBQ A;  1BLF A;  5ICT A;  2PFZ A;  1J1N A;  2QFL A;  4LQ2 A;  3K6X A;  3MBP A;  5FHN A;  5DTB A;  3PD9 A;  4ZE8 A;  4PFR A;  3OO7 A;  5IZ1 A;  2XA5 A;  2A5T A;  3MPK A;  2DWH A;  4P11 A;  1JW1 A;  1IXC A;  3TUS A;  4H8J A;  3LSF B;  5DYH A;  1VR5 A;  3E79 A;  4F31 B;  4R74 A;  2R8T A;  1MXZ A;  4UA8 A;  4OFO A;  3FJ7 A;  5HPQ A;  3EPE A;  3UN6 A;  3ROJ A;  2DWA A;  2Y7I A;  5JTY B;  1WVJ A;  3OO9 A;  3HN0 A;  3TTL A;  4ZEB A;  1URD A;  3G3K A;  2XX8 A;  1OLA A;  3HO7 A;  3CSG A;  4ONY A;  2WKY A;  1DBZ A;  2HCA A;  5ICQ A;  4IO6 A;  4OZ9 A;  4QFK A;  1FTA A;  4GX4 A;  3E3K A;  3M3F A;  4KYD A;  2I3V A;  2B4L A;  4XEQ A;  1H76 A;  3Q25 A;  1CE2 A;  3W15 C;  3TCH A;  2AIX A;  2HXR A;  2ONK E;  3VDF A;  1QUL A;  3UOR A;  1Z7M E;  2HZK A;  3C31 A;  1JEU A;  1CNQ A;  4GXA A;  3C9H A;  4GBV A;  4HW8 A;  3U65 A;  5AA3 A;  3TPA A;  2OWZ A;  1QKB A;  2ZZV A;  2VD3 A;  1H43 A;  5TP9 A;  4AB6 A;  4GX6 A;  1FQE A;  3M3K A;  1D3K A;  4MEV A;  2PVU A;  2UYE A;  1PDA A;  3TTN A;  5FTI A;  5H8F A;  3IO4 A;  2VGQ A;  3PMX A;  1NNK A;  5I57 A;  3U92 A;  3V8X B;  1DTZ A;  4JVC A;  2RIN A;  4OWD A;  5TU0 A;  3IB2 A;  4DIG A;  2OZZ A;  5AA2 D;  1FTL A;  3KC0 A;  3K0V A;  3T9U A;  3TQL A;  3V83 A;  3D4G A;  1YTV A;  2ZYN A;  2O51 A;  4OQO A;  4MFI A;  5AA2 B;  1VDW A;  2UVJ A;  2DYX A;  4PC9 A;  3PPR A;  2ONS A;  4U1O A;  1A8F A;  2DXY A;  1EH3 A;  4RXL A;  3EHT A;  4NE4 A;  1MXU A;  4YB6 A;  2NOO A;  5AA4 A;  3FAS A;  1GTK A;  1A8E A;  3RY3 A;  1FBG A;  4GX3 A;  2B3B A;  1YCJ A;  4JDF A;  4PGP A;  2H98 A;  2F7A A;  3S2V A;  1INP A;  3CG3 A;  3HHF A;  1DPP A;  2Y5L A;  2ZYM A;  3CFZ A;  4GWW A;  2PT2 A;  1IIT A;  4N91 A;  1UQW A;  4OEU A;  2F35 A;  4RNS A;  1ZMG A;  3CHG A;  1POT A;  4NF4 A;  1B3G A;  3CG1 A;  1LST A;  3SET A;  4PFT A;  3TYH A;  3KEI A;  4MNP A;  2QS2 A;  4LA9 A;  5B7D A;  3SKP A;  1FTJ A;  4YAH X;  2V3T A;  1MY1 A;  4PF8 A;  1FTO A;  4BDN A;  2XXK A;  4LZ5 A;  2DQV A;  3CFX A;  3PMW A;  3VE1 B;  1M5F A;  3H6U A;  3MP1 A;  1G0I A;  3MJN A;  1B1H A;  2R6G E;  1DCU A;  3GYY A;  1OVT A;  4U21 A;  1K9Z A;  1FPJ A;  1YZ0 A;  3TFL A;  1QUK A;  5ET5 A;  3O9P A;  3K01 A;  2QL3 A;  4MCO A;  4P0G A;  1Y3P A;  3JV9 A;  1RDY A;  2R71 A;  5ET8 A;  4IO4 A;  3PUV E;  5L9M A;  1JVX A;  1NNP A;  3CR9 A;  2QSX A;  4OFJ A;  2Q2A A;  3VXC A;  2D21 A;  1M5D A;  4WEP A;  1H44 A;  1Y1Z A;  1DTG A;  3ZKL A;  5I58 A;  1IMC A;  4LQ5 A;  1PB8 A;  2OLB A;  3IOT A;  1A40 A;  1LBX A;  5CC2 A;  2ALU A;  1KZ8 A;  3SEU A;  4DXB A;  4GVO A;  1NKX A;  2RKM A;  4O3B A;  5I5P A;  1AMF A;  1FBC A;  1UIU A;  4MLQ A;  5DVF A;  3OO6 A;  1IUD A;  1EZ9 A;  2IA4 A;  3O2A A;  1FBH A;  3FVK A;  3HV1 A;  3QK6 A;  5H8F B;  3CI8 A;  4OEN A;  3KN7 A;  5I57 B;  2Q9T A;  4JWO A;  2KQZ A;  4GFR A;  3K2D A;  4I9D A;  4AQ4 A;  3K1P A;  1M5E A;  4XXU A;  1RDZ A;  3C33 A;  4MF3 A;  5ET7 A;  4JBZ A;  3RGY A;  1FCK A;  2I49 A;  3SEV A;  2VT5 A;  3U93 A;  2REG A;  4GWU A;  1FPB A;  3KGC A;  1Q1K A;  3K4U A;  4NG7 A;  3OD7 A;  4O3A A;  2OCU A;  5AA4 B;  1FBD A;  1ZLQ A;  3IOV A;  3PPP A;  1PB9 A;  3FXU A;  2OJT A;  2RC7 A;  4NF0 A;  2F7B A;  4F2O A;  1O63 A;  1IMF A;  4PQJ A;  4G68 C;  1R6Z A;  2RC8 A;  4MLV A;  1SYH A;  1A7L A;  3H06 B;  3H03 A;  4H1X A;  3LR1 A;  3A29 A;  4EF1 A;  1P1W A;  2XWO A;  4N6K A;  3RLF E;  3GXA A;  4DLD A;  4NWC A;  4N17 A;  1H3D A;  4F3G A;  4NF6 A;  2B65 A;  2YPN A;  3FIR A;  3BKI B;  4NF4 B;  2WYP A;  2V93 A;  2I48 A;  5TPA A;  4WXJ A;  2D3I A;  1KWH A;  3VVE A;  4MIJ A;  4GXS B;  1JW4 A;  3PTY A;  4F19 A;  4N15 A;  4NGU A;  3OOA A;  4N4U A;  3B7D A;  3KG2 A;  2O1M A;  2XXR A;  3M3L A;  4PDH A;  2DVC A;  4F22 A;  4NX1 A;  2V3Q A;  3R6U A;  3RYD A;  4P47 A;  4G8N A;  4FAT A;  2GRV A;  1POY 1;  1K9Y A;  4R6Y A;  2PFY A;  1B6H A;  3ZSF A;  3TCF A;  1NMU A;  4U1Z A;  3W9W A;  2XXX A;  2Z22 A;  5J16 A;  2YJP A;  3RPL A;  1AH5 A;  3FJM A;  1A99 A;  1G0H A;  3G3I A;  4OHN A;  4ZDM A;  3QUJ A;  4G68 A;  4HXV A;  1F9B A;  4C1U A;  1SI0 A;  1B7H A;  3L6H A;  1IEJ A;  3BFU A;  4KQP A;  3HST A;  3S9E A;  1N7X A;  1IXG A;  3FAT A;  4POW A;  2DWJ A;  2QRY A;  1D9Q A;  1GR2 A;  2HFB A;  4FED A;  4LAT A;  5IM2 A;  2XWI A;  3T96 B;  2JJK A;  2QVR A;  3VLV A;  3E4R A;  1YXI A;  3Q27 A;  4HTG A;  2V3U A;  3TEP A;  2H99 A;  2Y7P A;  4R73 A;  1LBZ A;  2PBW A;  4MNI A;  3G3G A;  3KZG A;  1VSO A;  1JW5 A;  3LC8 A;  1P1U A;  5H8S A;  1AOV A;  1SQY A;  2E0S A;  4POX A;  2QJE A;  2P1S A;  4ELP A;  4YKI A;  3D4C A;  1B3H A;  3TEL A;  2AYS A;  2KLF A;  1LAH E;  4PFW A;  4ESW A;  4OVR A;  2ANJ A;  3E9X A;  4H0W A;  3MZ1 A;  4R2B A;  1ANF A;  1Z7N E;  3QMF A;  5LTC A;  4KR5 A;  2ZYO A;  3H6T A;  4DE8 A;  2FNC A;  4ESX A;  1LB8 A;  1UIV A;  1Y3Q A;  5AA2 A;  2O7U A;  1LBB A;  2Y7K A;  4JB7 A;  3TCG A;  4EXL A;  5KZT A;  5A5L A;  3KJT A;  4GWS A;  4OTE A;  2E1S A;  2DWI A;  5KCJ A;  2THI A;  1ZKB A;  1D9Y A;  2WEF A;  3IJO B;  3FZV A;  4GRK A;  2I6E A;  2F3D A;  5I2N A;  4IGR A;  1SW2 A;  1RKM A;  4FEC A;  4NF6 B;  4ZZE A;  5TPA B;  2GQ1 A;  3EF7 A;  2BJI A;  2F78 A;  2F34 A;  1IIW A;  4LON B;  1ZU0 A;  4OVJ A;  1MQH A;  4PFU A;  4KFQ A;  1O64 A;  4MH5 A;  5K2X A;  2DDK A;  4P1E A;  1FJ6 A;  4AB5 A;  4PFY A;  1P1N A;  4XKR A;  1D4N A;  4IGT A;  2PMS A;  2NXO A;  4OES A;  3N94 A;  3ZKK A;  4N6D A;  4LUB A;  3T1B A;  4I40 A;  3S9N C;  3NOH A;  4RPO A;  3TZA A;  1MDQ A;  4X1D A;  3RPL B;  4QBA A;  5L9S A;  4PE5 B;  4N6P A;  3B50 A;  4QFP A;  1IQ7 A;  2HXW A;  3KBR A;  4G68 B;  1NV6 A;  1IMA A;  2H5Y A;  2DXR A;  4JSD A;  3EQ1 A;  2XXV A;  4P3L A;  4U23 A;  2CMO A;  4BLA A;  2HHM A;  1UTH B;  1GGG A;  3FGS A;  1LFG A;  2HZL A;  2FIE A;  1VFD A;  1IME A;  3MWB A;  1A55 A;  2NVU B;  4OMB A;  3VVD A;  1HSE A;  4PF6 A;  1DOT A;  3JZJ A;  3K02 A;  4IB2 A;  2VP1 A;  3ILU B;  4HE0 A;  4Z0I A;  5EYF A;  1ZTY A;  1B7U A;  1MXV A;  3HCQ A;  4I62 A;  4TOZ A;  4MNC A;  5CMB A;  3G3H A;  1MQJ A;  4MHF A;  4GOT A;  1T0K A;  1P1O A;  4Z7E A;  1IMB A;  3SER A;  4C1T A;  1S50 A;  3M8U A;  4PAF A;  4ECF A;  5LDZ A;  4N07 A;  3H3G A;  2I4B A;  5DEX A;  2XX7 A;  1NUZ A;  1Q35 A;  3MAM A;  3U1O A;  1JVY A;  3TKD A;  3TTK A;  3LSL A;  3VV5 A;  3IOR A;  5CBR A;  4IO7 A;  2UVG A;  4RJZ A;  4NHB A;  4R9G A;  4GBW A;  4OA4 A;  3MZB A;  3PPQ A;  1NUW A;  4EDP A;  3IJX B;  4ZE9 A;  4YB7 A;  5I56 B;  4FE8 A;  4RK9 A;  3CSB A;  4P0I A;  4EQ7 A;  5FBP A;  5KCJ B;  3MVY A;  4NAP A;  4FAJ A;  3BBR A;  3H4Z A;  4PGN A;  1B0L A;  2X26 A;  3DP8 A;  5I2N B;  1KA0 A;  2P3N A;  1MPC A;  1Y1M A;  1BP5 A;  1SBP A;  2RC9 A;  1WDN A;  4JVD A;  5I3S A;  3TAJ A;  4IY5 A;  1NI9 A;  3LSX A;  2DVZ A;  5JEI A;  4ZEK A;  2HQ0 A;  1FSA A;  2G93 A;  2RCA A;  5CM6 A;  5M2V A;  2CEX A;  2CEY A;  2Y7W A;  3CFL A;  5EQ9 A;  3VLU A;  3KSX A;  1B05 A;  3KFM A;  5F7V A;  1TFD A;  2OX3 A;  2F3B A;  1I6Q A;  2O68 A;  5ET6 A;  2ZNU A;  1S7Y A;  3U94 A;  3GBA A;  2REJ A;  3PUW E;  2ZZW A;  4QSD A;  3C32 A;  1O7T A;  4PE3 A;  1PB7 A;  2P0S A;  3RTF B;  3KJ7 A;  2QMX A;  3E13 X;  4GIZ A;  4G77 A;  4LZ7 A;  1B5I A;  1BTJ A;  4ND9 A;  3LV0 A;  2DE4 A;  4F2Q A;  2UYF A;  4KYS A;  3SDF A;  3VVF A;  2Q88 A;  4I3E A;  3MPL A;  5IKB A;  1MRP A;  4X04 A;  4E0X A;  2F97 A;  2QS1 A;  4R2F A;  1SYI A;  2Q2C A;  3IAZ A;  3RT6 B;  5JK4 A;  5H8H A;  3UIF A;  5IAI A;  3S9M C;  2XWK A;  1B7Z A;  1LAF E;  2OWT A;  1OQH A;  2CZL A;  3G3J A;  4ZS9 A;  1LB9 A;  5ESY A;  3SEX A;  1XI6 A;  3QYT A;  4X9T A;  4YB5 A;  4GL0 A;  3TOD A;  4MMP A;  4HE2 A;  1MG1 A;  3PV0 E;  5ELV A;  1JQF A;  4K3F A;  4HE1 A;  1B58 A;  3IL1 B;  3S4U A;  5DEX B;  3OEM A;  4EF2 A;  1FBP A;  1SI1 A;  4RY1 A;  2QMW A;  3KSJ A;  4ZEI A;  4F3B A;  3K6U A;  2F6G A;  3MC2 A;  4IO2 A;  3DM0 A;  1OQG A;  3CIJ A;  1B3F A;  4LN5 A;  4NTL A;  3RUM A;  4OVP A;  4N81 A;  3T9H B;  2X7P A;  5I84 A;  3B6T A;  2HPG A;  4JWX A;  3K1N A;  3IO6 A;  2GHB A;  3IOU A;  1JEV A;  2GH9 A;  2PT1 A;  2KR0 A;  2QS3 A;  4I8C A;  4OEV A;  4H5G A;  4U2R A;  5EQA A;  2ZMB A;  4YMB A;  1GVC A;  2F5X A;  1B3L A;  1R9Q A;  1GV8 A;  2Y5K A;  4M4G A;  1B32 A;  2AL4 A;  1EZO A;  2ZXT A;  3RPW A;  2X7Q A;  5EHS A;  2XD3 A;  4ZEF A;  3I6V A;  5T3J A;  3EHS A;  2LAO A;  4ISU A;  5CI5 A;  2DSF A;  1FPG A;  3IB1 A;  4F3S A;  5EQ8 A;  2QVU A;  2PX1 A;  3G7W A;  5AE4 A;  1NFT A;  4KPT A;  1LBV A;  4YU0 A;  1NUX A;  1FPE A;  4QF9 A;  2UXA A;  3B8B A;  1MM7 A;  3H6V A;  3UA8 A;  4F1Y A;  4WKM A;  3L6G A;  4N8G A;  1M5C A;  4WED A;  3RT8 A;  1MY2 A;  1H45 A;  1B51 A;  3KOT A;  2I4C A;  1SVX B;  1B1X A;  1AL3 A;  2VOZ A;  3WAF A;  4QHQ A;  4EXK A;  3FVG A;  4IO3 A;  1OMP A;  1B2H A;  2R9J A;  4RK2 A;  4Q5T A;  1CB6 A;  4H67 A;  5H8H B;  3C36 A;  2DOJ A;  1LBC A;  4LVQ A;  1B5H A;  3BIG A;  5IZZ A;  4OVS A;  1PC3 A;  1TFA A;  3UK4 A;  1UTH A;  1SPI A;  2UVH A;  4XKP A;  1XS5 A;  5I2K A;  5BUU A;  3ILT B;  1ATG A;  4P56 A;  4HS7 A;  5FHO A;  1VFE A;  1ELJ A;  3O28 A;  4X48 A;  4OXV A;  4O94 A;  2Y84 A;  2WBD A;  2A5S A;  3MP8 A;  4RA1 A;  5EHM A;  4QSE A;  3EN3 A;  2Q89 A; 
#chains in the Genus database with same CATH homology
 4EQB A;  5FTH A;  3C4M A;  2DP8 A;  4NWD A;  3QSL A;  3KN3 A;  3DEL B;  1QVS A;  5CMC A;  4M1V A;  4ZEC A;  2UVI A;  1MM6 A;  1R9L A;  4O3C A;  2D5W A;  3LSW A;  2XHD A;  1S9T A;  4OER A;  1JET A;  1SDX A;  2AL5 A;  3K6W A;  5DVJ A;  1USY E;  4F1U A;  2I58 A;  4BDL A;  1B5J A;  1DSN A;  3FV1 A;  3O6G A;  3TTM A;  1MQD A;  1YAE A;  1XVY A;  3KN8 A;  1D9V A;  4XKQ A;  3N6T A;  3THI A;  3OEK A;  3W9V A;  1PBP A;  4X1B A;  5I56 A;  1B46 A;  3TDJ A;  1OLC A;  3G3F A;  5KDT B;  3TQW A;  1XC1 A;  1I6A A;  3QIM A;  1MY3 A;  3S9L C;  1P1Q A;  4QSC A;  4XIG Q;  3R7X A;  4DDD A;  3QAX A;  2BJJ X;  4U4X A;  1EU8 A;  3OEN A;  3B6Q A;  1QUI A;  1AIV A;  2ZNT A;  3K1M A;  5ITO A;  3VFJ A;  3SEY A;  1DMB A;  1SD3 A;  1IXI A;  1MH4 A;  3ZS6 A;  1UTB B;  1MY0 A;  2Q8J A;  2DS9 A;  2FYI A;  3A09 A;  4E0W A;  3MVZ A;  5BWJ A;  2XXT A;  4N13 A;  3C35 A;  4OYV A;  3RQT A;  5H8N A;  4BDR A;  2XXQ A;  2F6P A;  4GQO A;  1N76 A;  1R1N A;  3GZG A;  2P2A A;  3IR1 A;  5FHM A;  4QFN A;  3K6V A;  1TT1 A;  3ECR A;  4NMY A;  2V84 A;  4QRZ A;  1MQG A;  4KCC A;  4U4S A;  3PMV A;  4NF5 B;  4KD5 A;  1B9J A;  5I2K B;  1II5 A;  4F29 A;  3FVN A;  3P7I A;  2F7C A;  2Z8E A;  1VE4 A;  4L17 A;  2HEU A;  4H65 A;  3TTR A;  1US5 A;  1FQC A;  4TQU Q;  4G8H A;  4GD5 A;  1OIB A;  1RYX A;  4ZZA A;  1URS A;  2G29 A;  2Y7R A;  4JXI A;  3OXN A;  4GF8 A;  4Q8R A;  3RNN A;  4FOR A;  5A5X A;  1NH8 A;  3O6I A;  5H8Q B;  2QPQ A;  3UP9 A;  1FTM A;  4RPN A;  3T66 A;  4LP2 B;  3N26 A;  2GFE A;  3BFT A;  1QKA A;  1LFH A;  4G4P A;  3N5L A;  1JNF A;  1MDP 1;  3QXM A;  3LUY A;  2QS4 A;  1P99 A;  1QJM A;  1I69 A;  1NNF A;  1I6B A;  4ELQ A;  1USY H;  3MVW A;  3C34 A;  1LAX A;  4F1V A;  4R6K A;  2IEE A;  4GLI A;  3T9V A;  3AXF A;  1N3X A;  4MBP A;  1QW0 A;  5F1Q A;  5ISU A;  4G8M A;  3USD A;  3VLW A;  3Q26 A;  1ZBM A;  2YLN A;  1Y3N A;  4ELO A;  4R9F A;  1HSL A;  1B40 A;  3LBS A;  4F3P A;  1DPE A;  4R6H A;  1FQA A;  4KCD A;  5AA1 A;  2PYY A;  2RCB A;  2I0B A;  3A3U A;  2A5T B;  1M5B A;  2Z23 A;  4YIC A;  3PUY E;  4NF8 A;  2RF1 A;  4KYE A;  5H8N B;  3V89 B;  3Q28 A;  4OFL A;  1PEB A;  2HAU A;  1NL5 A;  4QFO A;  2ZYK A;  4RYA A;  1US4 A;  3PUZ E;  4FIM A;  2H4I A;  2XXU A;  1B4H A;  3FV2 A;  5CBS A;  1TXF A;  2M8C A;  2VD2 A;  3ODB A;  4NED A;  3TMG A;  4FEB A;  1LCF A;  4OET A;  4XKN A;  1B4Z A;  1MXW A;  3GLB A;  2XXP A;  2XD2 A;  2Z8D A;  4GL8 A;  3MVX A;  4I1D A;  3FXQ A;  2I0C A;  1BKA A;  2O7I A;  4Q0C A;  3VXB A;  1XHY A;  1Y4T A;  3O29 A;  2Z8F A;  2O84 X;  4R72 A;  3HPI A;  3MUQ A;  1ZJL A;  3A3C A;  5A5X B;  4C0R A;  2F36 A;  3T22 A;  3V5A A;  1MXY A;  3OO8 A;  1Y4C A;  1BIY A;  1MPD A;  1B0H A;  3IOW A;  4R75 A;  4H8I A;  1FTK A;  4YKJ A;  3B6W A;  5TP9 B;  2DE2 A;  2DE3 A;  1MH3 A;  5HM4 B;  4FJP A;  1FQD A;  3T9X B;  3I5O A;  1EZP A;  3SEW A;  2O69 A;  2ONR A;  2NUV A;  1SW5 A;  2HAV A;  3FD3 A;  4ELR A;  2I3W A;  3GBB A;  4BDM A;  4TLL B;  2O1L A;  5I59 A;  2XXW A;  1LFI A;  3QUF A;  4G2Z A;  4DCY A;  4PP0 A;  4U22 A;  5DVI A;  3DP4 A;  1IXH A;  3WAE A;  3SES A;  3PU5 A;  2XXI A;  2F8D A;  3FJG A;  2ZNS A;  3DLN A;  2FA7 A;  5KDT A;  4F18 A;  1N0T A;  1LLS A;  4DXC A;  4TLM B;  5CRY A;  1QUJ A;  3O97 A;  2OK2 A;  1N84 A;  3Q29 A;  1YPN A;  4DZ1 A;  3PPO A;  4YMA A;  3MQ9 A;  5K2Y A;  1LCT A;  3K00 A;  3EHU A;  1ZIU A;  1B52 A;  4NF8 B;  1NH7 A;  5DT6 A;  3O66 A;  4BDQ A;  1UTB A;  3I3V A;  4THI A;  1TWY A;  1NNT A;  4YZZ A;  2H9B A;  3PUX E;  1XT8 A;  4PET A;  1MPB A;  2O6A A;  3PD8 A;  4F39 A;  1SW4 A;  3ONM A;  1WOD A;  4LZ8 A;  5LOM A;  3H7M A;  3MW0 A;  1MXX A;  1LAG E;  5L8D A;  1MQI A;  3R26 A;  5JTY A;  1Y9U A;  4KI0 E;  3U72 A;  1L5T A;  2B3F A;  4YKP A;  5L9O A;  1RYO A;  5CMK A;  3HHG A;  4Q30 B;  1Y20 A;  4JSO A;  4H6D A;  3U8Q A;  4QFL A;  4IO5 A;  4NF5 A;  4XTC Q;  4UAC A;  2NWJ A;  3PPN A;  3H6W A;  3MZ9 A;  4DXU A;  3OSR A;  3OMB A;  4EUO A;  3KOS A;  2ESN A;  1A54 A;  4H5F A;  2XXY A;  5B70 A;  5I58 B;  1URG A;  4KHZ E;  3O6H A;  5J1D A;  3OSQ A;  2XX9 A;  1XOC A;  2GHA A;  5H8Q A;  4ZED A;  4YKK A;  4EQ9 A;  3N6U A;  3CRB A;  2H25 A;  3FUZ A;  3IX1 A;  3JYR A;  1XVX A;  3MP6 A;  1IZ1 A;  4DCX A;  4IY6 A;  3IK6 B;  5I59 B;  1FQB A;  3CVG A;  2OWS A;  4BDO A;  1N7W A;  1N3W A;  2ABH A;  3F11 A;  3UGW A;  3FXR A;  1OVB A;  2OBG A;  3RTW B;  3PGF A;  3T93 B;  1FQF A;  3DP6 A;  1LGB C;  4JWY A;  2XXH A;  3RN8 A;  4HCW A;  1MS7 A;  1B3E A;  5ITP A;  4GWO A;  3IB0 A;  3FVO A;  2W7Y A;  3OEL A;  1MY4 A;  2VHA A;  1HSJ A;  4HCY A;  1FW0 A;  2V25 A;  1SW1 A;  5CMM A;  5HBC A;  1N04 A;  1PBQ A;  1BLF A;  5ICT A;  1J1N A;  4LQ2 A;  3K6X A;  3MBP A;  5FHN A;  5DTB A;  3PD9 A;  4ZE8 A;  3OO7 A;  2A5T A;  3MPK A;  2DWH A;  4P11 A;  1JW1 A;  1IXC A;  3TUS A;  4H8J A;  3LSF B;  5DYH A;  1VR5 A;  4F31 B;  4R74 A;  1MXZ A;  4UA8 A;  4OFO A;  3FJ7 A;  5HPQ A;  3EPE A;  3UN6 A;  2DWA A;  2Y7I A;  5JTY B;  1WVJ A;  3OO9 A;  3HN0 A;  3TTL A;  4ZEB A;  1URD A;  3G3K A;  2XX8 A;  1OLA A;  3HO7 A;  3CSG A;  4ONY A;  2WKY A;  2HCA A;  5ICQ A;  4IO6 A;  4OZ9 A;  4QFK A;  3E3K A;  3M3F A;  4KYD A;  2I3V A;  1H76 A;  3Q25 A;  1CE2 A;  3W15 C;  3TCH A;  2AIX A;  2ONK E;  3VDF A;  1QUL A;  3UOR A;  1Z7M E;  2HZK A;  3C31 A;  1JEU A;  4GXA A;  3C9H A;  4HW8 A;  5AA3 A;  3TPA A;  1QKB A;  2VD3 A;  1H43 A;  5TP9 A;  4AB6 A;  1FQE A;  3M3K A;  1D3K A;  2PVU A;  2UYE A;  1PDA A;  3TTN A;  5FTI A;  5H8F A;  3IO4 A;  2VGQ A;  3PMX A;  1NNK A;  5I57 A;  3U92 A;  3V8X B;  1DTZ A;  2RIN A;  4OWD A;  5TU0 A;  3IB2 A;  4DIG A;  2OZZ A;  5AA2 D;  1FTL A;  3K0V A;  3T9U A;  3TQL A;  3V83 A;  3D4G A;  1YTV A;  2ZYN A;  2O51 A;  4OQO A;  4MFI A;  5AA2 B;  2UVJ A;  2DYX A;  3PPR A;  2ONS A;  4U1O A;  1A8F A;  2DXY A;  1EH3 A;  3EHT A;  4RXL A;  4NE4 A;  1MXU A;  4YB6 A;  2NOO A;  5AA4 A;  3FAS A;  1GTK A;  1A8E A;  3RY3 A;  2B3B A;  1YCJ A;  4JDF A;  2H98 A;  2F7A A;  3S2V A;  3CG3 A;  3HHF A;  1DPP A;  2ZYM A;  3CFZ A;  2PT2 A;  1IIT A;  1UQW A;  4OEU A;  2F35 A;  4RNS A;  1ZMG A;  1POT A;  4NF4 A;  1B3G A;  3CG1 A;  1LST A;  3SET A;  4PFT A;  3TYH A;  3KEI A;  2QS2 A;  4LA9 A;  5B7D A;  3SKP A;  1FTJ A;  4YAH X;  2V3T A;  1MY1 A;  1FTO A;  4BDN A;  4LZ5 A;  2DQV A;  3CFX A;  3PMW A;  3VE1 B;  1M5F A;  3H6U A;  3MP1 A;  3MJN A;  1B1H A;  2R6G E;  1OVT A;  4U21 A;  3TFL A;  1QUK A;  3O9P A;  3K01 A;  2QL3 A;  4P0G A;  1Y3P A;  3JV9 A;  2R71 A;  4IO4 A;  3PUV E;  5L9M A;  1JVX A;  1NNP A;  3CR9 A;  2QSX A;  4OFJ A;  2Q2A A;  3VXC A;  2D21 A;  1M5D A;  4WEP A;  1H44 A;  1Y1Z A;  1DTG A;  3ZKL A;  5I58 A;  4LQ5 A;  1PB8 A;  2OLB A;  3IOT A;  1A40 A;  5CC2 A;  2ALU A;  3SEU A;  4DXB A;  4GVO A;  1NKX A;  2RKM A;  4O3B A;  1AMF A;  1UIU A;  4MLQ A;  5DVF A;  3OO6 A;  1IUD A;  1EZ9 A;  2IA4 A;  3O2A A;  3FVK A;  3HV1 A;  3QK6 A;  5H8F B;  3CI8 A;  4OEN A;  3KN7 A;  5I57 B;  2Q9T A;  4JWO A;  4GFR A;  3K2D A;  4I9D A;  4AQ4 A;  3K1P A;  1M5E A;  4XXU A;  3C33 A;  4MF3 A;  4JBZ A;  3RGY A;  1FCK A;  2I49 A;  3SEV A;  3U93 A;  2REG A;  3KGC A;  1Q1K A;  3K4U A;  3OD7 A;  4O3A A;  2OCU A;  5AA4 B;  1ZLQ A;  3IOV A;  3PPP A;  1PB9 A;  3FXU A;  2OJT A;  2RC7 A;  2F7B A;  4F2O A;  1O63 A;  4PQJ A;  4G68 C;  1R6Z A;  2RC8 A;  4MLV A;  1SYH A;  1A7L A;  3H06 B;  3H03 A;  4H1X A;  3LR1 A;  4EF1 A;  1P1W A;  3RLF E;  3GXA A;  4DLD A;  4NWC A;  1H3D A;  4F3G A;  4NF6 A;  2B65 A;  2YPN A;  3FIR A;  3BKI B;  4NF4 B;  2V93 A;  2I48 A;  5TPA A;  4WXJ A;  2D3I A;  1KWH A;  3VVE A;  4GXS B;  1JW4 A;  4F19 A;  3OOA A;  3B7D A;  3KG2 A;  2O1M A;  2XXR A;  3M3L A;  2DVC A;  4F22 A;  2V3Q A;  3R6U A;  4G8N A;  4FAT A;  2GRV A;  1POY 1;  4R6Y A;  1B6H A;  3ZSF A;  3TCF A;  1NMU A;  4U1Z A;  3W9W A;  2XXX A;  2Z22 A;  2YJP A;  1AH5 A;  3FJM A;  1A99 A;  3G3I A;  4OHN A;  4ZDM A;  3QUJ A;  4G68 A;  1F9B A;  4C1U A;  1SI0 A;  1B7H A;  3L6H A;  1IEJ A;  3BFU A;  4KQP A;  3HST A;  3S9E A;  1N7X A;  1IXG A;  3FAT A;  4POW A;  2DWJ A;  2QRY A;  1GR2 A;  2HFB A;  4FED A;  4LAT A;  3T96 B;  3VLV A;  3E4R A;  3Q27 A;  4HTG A;  2V3U A;  3TEP A;  2H99 A;  2Y7P A;  4R73 A;  2PBW A;  3G3G A;  3KZG A;  1VSO A;  1JW5 A;  3LC8 A;  1P1U A;  5H8S A;  1AOV A;  1SQY A;  2E0S A;  4POX A;  2QJE A;  2P1S A;  4ELP A;  4YKI A;  3D4C A;  1B3H A;  3TEL A;  2AYS A;  2KLF A;  1LAH E;  4PFW A;  4ESW A;  2ANJ A;  3E9X A;  4H0W A;  3MZ1 A;  4R2B A;  1ANF A;  1Z7N E;  4KR5 A;  2ZYO A;  3H6T A;  4DE8 A;  2FNC A;  4ESX A;  1LB8 A;  1UIV A;  1Y3Q A;  5AA2 A;  2O7U A;  1LBB A;  2Y7K A;  4JB7 A;  3TCG A;  4EXL A;  5KZT A;  3KJT A;  4OTE A;  2E1S A;  2DWI A;  5KCJ A;  2THI A;  1ZKB A;  1D9Y A;  3IJO B;  3FZV A;  4GRK A;  2I6E A;  5I2N A;  4IGR A;  1SW2 A;  1RKM A;  4FEC A;  4NF6 B;  4ZZE A;  5TPA B;  3EF7 A;  2F78 A;  2F34 A;  1IIW A;  4LON B;  1ZU0 A;  4OVJ A;  1MQH A;  4PFU A;  4KFQ A;  1O64 A;  4MH5 A;  5K2X A;  4AB5 A;  4PFY A;  1P1N A;  4XKR A;  1D4N A;  4IGT A;  2PMS A;  2NXO A;  4OES A;  3N94 A;  3ZKK A;  4LUB A;  3S9N C;  4RPO A;  3TZA A;  1MDQ A;  4X1D A;  5L9S A;  4PE5 B;  4N6P A;  4QFP A;  1IQ7 A;  2HXW A;  3KBR A;  4G68 B;  2H5Y A;  2DXR A;  4JSD A;  3EQ1 A;  2XXV A;  4U23 A;  2CMO A;  4BLA A;  1UTH B;  1GGG A;  3FGS A;  1LFG A;  2HZL A;  1VFD A;  3MWB A;  1A55 A;  2NVU B;  4OMB A;  3VVD A;  1HSE A;  1DOT A;  3JZJ A;  3K02 A;  4IB2 A;  2VP1 A;  3ILU B;  4Z0I A;  5EYF A;  1ZTY A;  1B7U A;  1MXV A;  3HCQ A;  4I62 A;  4TOZ A;  5CMB A;  3G3H A;  1MQJ A;  4GOT A;  1T0K A;  1P1O A;  4Z7E A;  3SER A;  4C1T A;  1S50 A;  3M8U A;  4ECF A;  4N07 A;  3H3G A;  2I4B A;  5DEX A;  2XX7 A;  1Q35 A;  3MAM A;  3U1O A;  1JVY A;  3TKD A;  3TTK A;  3LSL A;  3VV5 A;  3IOR A;  5CBR A;  4IO7 A;  2UVG A;  4RJZ A;  4R9G A;  3MZB A;  3PPQ A;  4EDP A;  3IJX B;  4ZE9 A;  4YB7 A;  5I56 B;  4FE8 A;  4RK9 A;  3CSB A;  4P0I A;  4EQ7 A;  5KCJ B;  3MVY A;  4FAJ A;  3BBR A;  3H4Z A;  1B0L A;  2X26 A;  3DP8 A;  5I2N B;  1MPC A;  1Y1M A;  1BP5 A;  1SBP A;  2RC9 A;  1WDN A;  3TAJ A;  4IY5 A;  3LSX A;  2DVZ A;  5JEI A;  4ZEK A;  2HQ0 A;  2G93 A;  2RCA A;  5CM6 A;  5M2V A;  2Y7W A;  3CFL A;  3VLU A;  3KSX A;  1B05 A;  3KFM A;  5F7V A;  1TFD A;  1I6Q A;  2O68 A;  2ZNU A;  1S7Y A;  3U94 A;  3GBA A;  2REJ A;  3PUW E;  4QSD A;  3C32 A;  1O7T A;  1PB7 A;  2P0S A;  3RTF B;  3KJ7 A;  2QMX A;  3E13 X;  4GIZ A;  4G77 A;  4LZ7 A;  1B5I A;  1BTJ A;  4ND9 A;  2DE4 A;  4F2Q A;  2UYF A;  4KYS A;  3SDF A;  3VVF A;  2Q88 A;  3MPL A;  5IKB A;  1MRP A;  4E0X A;  2F97 A;  2QS1 A;  4R2F A;  1SYI A;  2Q2C A;  3IAZ A;  3RT6 B;  5JK4 A;  5H8H A;  3UIF A;  5IAI A;  3S9M C;  1B7Z A;  1LAF E;  2OWT A;  1OQH A;  2CZL A;  3G3J A;  4ZS9 A;  1LB9 A;  3SEX A;  3QYT A;  4X9T A;  4YB5 A;  4GL0 A;  3TOD A;  1MG1 A;  3PV0 E;  5ELV A;  1JQF A;  4K3F A;  1B58 A;  3IL1 B;  3S4U A;  5DEX B;  3OEM A;  4EF2 A;  1SI1 A;  4RY1 A;  2QMW A;  3KSJ A;  4ZEI A;  4F3B A;  3K6U A;  2F6G A;  3MC2 A;  4IO2 A;  3DM0 A;  1OQG A;  3CIJ A;  1B3F A;  4NTL A;  3RUM A;  3T9H B;  2X7P A;  5I84 A;  3B6T A;  4JWX A;  3K1N A;  3IO6 A;  2GHB A;  3IOU A;  1JEV A;  2GH9 A;  2PT1 A;  2QS3 A;  4I8C A;  4OEV A;  4H5G A;  4U2R A;  2ZMB A;  4YMB A;  1GVC A;  2F5X A;  1B3L A;  1R9Q A;  1GV8 A;  4M4G A;  1B32 A;  2AL4 A;  1EZO A;  2ZXT A;  3RPW A;  2X7Q A;  5EHS A;  2XD3 A;  4ZEF A;  3I6V A;  3EHS A;  2LAO A;  4ISU A;  5CI5 A;  2DSF A;  3IB1 A;  4F3S A;  2PX1 A;  3G7W A;  5AE4 A;  1NFT A;  4KPT A;  4YU0 A;  4QF9 A;  2UXA A;  1MM7 A;  3H6V A;  3UA8 A;  4F1Y A;  4WKM A;  3L6G A;  1M5C A;  4WED A;  3RT8 A;  1MY2 A;  1H45 A;  1B51 A;  3KOT A;  2I4C A;  1SVX B;  1B1X A;  1AL3 A;  2VOZ A;  3WAF A;  4QHQ A;  4EXK A;  3FVG A;  4IO3 A;  1OMP A;  1B2H A;  2R9J A;  4RK2 A;  4Q5T A;  1CB6 A;  4H67 A;  5H8H B;  3C36 A;  2DOJ A;  1LBC A;  4LVQ A;  1B5H A;  1PC3 A;  1TFA A;  3UK4 A;  1UTH A;  5I2K A;  4XKP A;  2UVH A;  1XS5 A;  5BUU A;  3ILT B;  1ATG A;  4HS7 A;  5FHO A;  1VFE A;  1ELJ A;  3O28 A;  4X48 A;  4OXV A;  2Y84 A;  2A5S A;  3MP8 A;  4RA1 A;  5EHM A;  4QSE A;  3EN3 A;  2Q89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...