3RPWA

The crystal structure of an abc transporter from rhodopseudomonas palustris cga009
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
333
structure length
333
Chain Sequence
QSNVVIMQDPGGGYGDALRKVMYDPFEKETGIKVVTVQEARSGPRIKAQAEAGKAQWDLTFIFDQETKLLGDCCLADIDYSKLSESAHKTLAAMPDNLKRKKGVALQVIGVGLVYNKDKFKGDKAPQTWADFWDVKKFPGRRCMPAWPRFTFEAALMADGVTKDKLYPIDMDRALKKLKEIKPHVVKWWTTAAQPPQLILDGEADMCLAYTGSMSKLALEGAPIDLTFNQGFVYYDFFSIPKGAPNYDNALKLLSWRLDPKRAAQLTSTFPVALPSKVVFDAATDKNIARYWANNPENVAKAIEWSPDFWGAPSPAGNSTNEEYGQEKLNAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter
publication title Structural and functional characterization of solute binding proteins for aromatic compounds derived from lignin: p-Coumaric acid and related aromatic acids.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
total genus 108
structure length 333
sequence length 333
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3rpwA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3rpwA01
4RA1A 3DP6A 1PBQA 2O7IA 1D9VA 2RCAA 3CR9A 5ISUA 2Q2AA 2DWIA 3OELA 4X1BA 1JW4A 4OESA 3K00A 5K2YA 2WKYA 1LFIA 3TZAA 1PEBA 3C36A 5I2NA 3UORA 4GF8A 4F3SA 4OETA 2UVGA 1MXZA 5L9SA 2D3IA 4HTGA 5J1DA 4ZZAA 4HCYA 3W9WA 3SETA 5CMMA 3IORA 1EH3A 4WEDA 4FJPA 4OVJA 4N07A 3VLVA 1ZMGA 4F31B 5CM6A 2DOJA 1AL3A 1Y3PA 5DVJA 3IO4A 4POXA 4R9FA 1OVTA 3TKDA 1USYE 3SEYA 2UXAA 3MWBA 3RTFB 5AA4B 4NF8B 3GZGA 2XXIA 1ZBMA 3VLWA 2CMOA 5CBRA 4FATA 1Y9UA 5F7VA 3U72A 3DP4A 3PGFA 4X1DA 3M3KA 1UTHB 4F19A 3VVDA 3I3VA 4RJZA 2M8CA 5I2KA 3GBBA 1M5FA 4NWCA 4FIMA 4YZZA 3KN3A 2Y7WA 4QRZA 2OWSA 3PPRA 1PBPA 2NVUB 2NXOA 3IK6B 3Q25A 3OXNA 1A54A 4Q5TA 3TTLA 4DXCA 3MVXA 4C1UA 3RT6B 4BDOA 3R6UA 2H9BA 2ALUA 2XXPA 4WKMA 1B7ZA 1DPEA 1JVYA 3U1OA 3FGSA 3HN0A 3TTKA 1MQGA 2R6GE 4YKKA 3O6HA 1YPNA 3MVYA 4EXKA 2H4IA 4QHQA 1NH7A 1LAGE 1XHYA 5FTIA 4ZEBA 1B3HA 1MY3A 2AL5A 4POWA 3V5AA 3T9XB 2GHBA 2NOOA 3FUZA 1GR2A 4GQOA 5A5XB 3K6UA 2VGQA 3MP1A 3IAZA 4AQ4A 4F2QA 2Z8FA 4OFLA 3FATA 1I6AA 1VE4A 2VHAA 2QPQA 2I6EA 3CIJA 1HSJA 2ZMBA 4U4SA 1AOVA 4H1XA 2F36A 2LAOA 4OXVA 4RPOA 1LFGA 2ANJA 4ZEKA 4OENA 4JDFA 1PB8A 3TYHA 1I6BA 2UVJA 3RT8A 4ND9A 4R6YA 3MZ9A 5ICTA 4QSCA 1HSLA 2H25A 1BP5A 2Y7RA 3S4UA 2DE2A 5I57B 5FHOA 1IZ1A 3VXCA 3MUQA 1B3LA 2F6PA 2I49A 2ZXTA 4H0WA 3FVGA 1B0HA 1BTJA 2XX9A 1B05A 2Z8DA 3SDFA 3H06B 4NF4A 2RF1A 3CG1A 5AA4A 5ELVA 4Q30B 4BDLA 2UYFA 5CBSA 3KOSA 4EUOA 3N94A 4LVQA 2R71A 2DQVA 4BDMA 4QFPA 3PUWE 4PFUA 4H8JA 4GVOA 4KQPA 4FEBA 2QRYA 3G3HA 2PVUA 4RK2A 2PBWA 1M5CA 2BJJX 5BWJA 4KFQA 3K6VA 4ELRA 1PDAA 3PD9A 4G8MA 4ESWA 1IQ7A 3PV0E 4YKPA 4EF2A 1OQHA 4O3AA 1LLSA 1FW0A 1LAFE 4GIZA 4LQ5A 1FQCA 2QJEA 4GL0A 4F2OA 1B5JA 3TCHA 1Q1KA 3RPWA 2D5WA 3HHGA 3IJXB 3A3CA 3JV9A 4WXJA 3T9VA 5I59B 2I48A 4MF3A 1MM6A 4QSDA 2PMSA 3ODBA 1JW1A 4KYEA 2VP1A 1MS7A 4IY6A 4IO4A 5CRYA 1N76A 1QUIA 4DDDA 4EQ9A 3PUZE 4X9TA 3V83A 1NL5A 3HO7A 4M1VA 1Z7ME 4YB5A 3IB2A 3PMWA 1EZPA 3ILUB 1B5IA 4IY5A 5BUUA 3MBPA 1DOTA 5HBCA 4H5FA 2HCAA 1A55A 5TP9B 4KR5A 3PPNA 1VFEA 2F7AA 4KYDA 1SI1A 4F3BA 4F29A 5A5XA 2DXYA 2GH9A 5M2VA 2O51A 3RLFE 3TCGA 4ELOA 2B3BA 1URDA 1ZIUA 1JETA 1A8EA 2H98A 2A5SA 1URGA 2RCBA 1YAEA 4R2BA 3W9VA 1TFAA 1HSEA 1SW5A 3C32A 4KYSA 3MP8A 2Q89A 5JTYB 2V3UA 3PUVE 3IX1A 3H03A 3OO9A 5FTHA 1I69A 1CE2A 5I57A 4G2ZA 2F7BA 4ZDMA 4OEUA 3OO8A 1FTJA 2O1LA 5H8NA 4RY1A 3PD8A 4KPTA 3TAJA 4FE8A 2F8DA 1RYOA 4QFLA 4BLAA 3I6VA 1IXIA 1S7YA 3LSLA 3CFZA 3PMXA 1VSOA 4KCDA 3BFTA 4R2FA 1JVXA 1T0KA 3AXFA 1MY1A 1RYXA 1I6QA 3O97A 2DVCA 1CB6A 3SKPA 4R6HA 3VVEA 4NWDA 4QFOA 2Z22A 1ZJLA 3TQWA 4IO6A 1D4NA 5L9MA 1NH8A 2CZLA 5H8QB 3RN8A 2PT1A 1B58A 1Y3NA 4QFKA 2I0BA 3O6GA 1H44A 3V89B 2V84A 3FIRA 1N04A 3SEVA 5AA2A 4R74A 4LZ7A 1TFDA 1ATGA 4RNSA 3OOAA 4G68C 4NF5B 1WODA 4JSDA 4EDPA 1SD3A 3EF7A 4H65A 3IB0A 4OFJA 1H3DA 5I59A 5TPAB 4MFIA 3MPKA 1UIUA 2AIXA 2F7CA 3K2DA 1SVXB 2QSXA 3Q29A 2RC7A 4M4GA 1TWYA 4AB5A 5EYFA 5JEIA 2XXHA 1FCKA 1DTGA 4GXSB 1B51A 3EPEA 1B46A 2VD2A 4ECFA 2F78A 3Q27A 5H8FB 3KFMA 1MM7A 3C4MA 4G68A 4ONYA 2Z23A 4XTCQ 3KN8A 5DVIA 2V3QA 3MW0A 3S9EA 2P1SA 2OBGA 2RC9A 2X7PA 2P0SA 3B7DA 4OQOA 2XX7A 4EQ7A 1USYH 3TODA 4YB7A 5AE4A 1JEVA 3ZS6A 3FV1A 4ISUA 1H76A 2VOZA 5HM4B 4TOZA 1OLCA 2XD3A 3OO7A 3PPPA 3FVNA 4FECA 1NMUA 2XXYA 2O6AA 2H5YA 4YMBA 5F1QA 5EHSA 4IGRA 4F1UA 3OO6A 2UYEA 5KDTB 4OYVA 3T9HB 1LBBA 3TTNA 4BDNA 2DS9A 4C0RA 3T9UA 3G3KA 3TPAA 3B6TA 3H4ZA 1ZU0A 4DCYA 1SW4A 4IO5A 4XKNA 1D9YA 2YJPA 3LUYA 1MQIA 2HEUA 3MAMA 4H6DA 4KI0E 1MDP1 4FAJA 1N3WA 2I3WA 3M8UA 1JNFA 2QS1A 4U1OA 3N26A 1OQGA 1GV8A 1B4ZA 1US4A 3IL1B 4PE5B 1S9TA 4I8CA 3SESA 3ZKKA 4OZ9A 2I4BA 4LUBA 1QUKA 3IB1A 1B3GA 3EHTA 3IOUA 3C9HA 4OERA 3ILTB 3G3GA 3TTRA 3VLUA 3GBAA 2A5TA 3K1MA 3E9XA 3UA8A 4PETA 4OMBA 1QW0A 2F97A 3CFLA 4R72A 1FTKA 1UQWA 2W7YA 5LOMA 4JWOA 4JB7A 3Q28A 1UTBB 3F11A 3C31A 3EQ1A 4N13A 2GRVA 4NF5A 4R6KA 4AB6A 2FA7A 3FXRA 3FD3A 1B32A 1LCFA 1MXVA 5TPAA 1B3EA 1BIYA 4JSOA 1Y1MA 2ONSA 1FQAA 2DXRA 3QUFA 4ZECA 4X48A 2DWHA 3B6WA 3M3LA 2RC8A 4K3FA 1FQBA 5I58B 2OLBA 2Y7PA 4N6PA 3C35A 4P0IA 2ZYKA 2Q8JA 4MBPA 4NF8A 5JK4A 4O3BA 3S9MC 2FYIA 1FTOA 2XXWA 3OSRA 4IGTA 2DYXA 2O68A 1M5DA 1XC1A 4F39A 4NF6B 5CMKA 1LGBC 2ZNSA 2GFEA 1UTHA 4OTEA 3RNNA 2HZKA 3CG3A 4ZEDA 2Q9TA 1M5EA 1ZLQA 3UK4A 4ZS9A 3C33A 3SEXA 1SW1A 3O2AA 3IOWA 4ZE9A 3ONMA 1P1OA 4YB6A 3SEUA 1B9JA 2HFBA 2DWJA 4UACA 1IUDA 2F5XA 5B7DA 4GFRA 1MH3A 3QK6A 2OZZA 1S50A 4JXIA 3G3JA 3HCQA 1WDNA 5I2NB 2IEEA 1MXUA 2V93A 4F1VA 1MQJA 1P1WA 1WVJA 1NFTA 5AA1A 1Q35A 3VE1B 5K2XA 1DTZA 4LA9A 3KOTA 3S2VA 1QUJA 4YAHX 1FQFA 4GL8A 3CRBA 4XKRA 4LONB 2PYYA 4OFOA 3PPOA 3EHUA 1Y3QA 4OHNA 1B52A 4H67A 1B40A 2Q88A 1MPBA 1BKAA 1MDQA 1MPCA 2IA4A 4NEDA 2HQ0A 3U92A 4G4PA 1MXYA 1UTBA 3TQLA 2Y84A 1BLFA 1D3KA 2XHDA 3KZGA 1LAXA 3CSGA 1O63A 4DE8A 1MQHA 1ELJA 3MPLA 4I1DA 4DZ1A 2XXVA 4G8HA 3CVGA 4YU0A 4OWDA 1JQFA 5I2KB 1FQDA 3MZBA 2OWTA 3ECRA 3BBRA 3K1NA 3ZSFA 1LSTA 3FXQA 1TXFA 4O3CA 4ESXA 2B3FA 1MG1A 1P1QA 3IJOB 5I58A 3TELA 1SI0A 1SYIA 4U22A 4Q0CA 3L6HA 3MVZA 3KJ7A 3R26A 3WAEA 1US5A 4HS7A 3A09A 1QVSA 5ICQA 1EZ9A 3H3GA 3GXAA 4IO3A 1O64A 3O9PA 3LSWA 4QF9A 3M3FA 4THIA 3FVKA 4PFWA 5TU0A 4WEPA 4BDRA 1NNKA 1URSA 1NNPA 2XXXA 1FQEA 3H7MA 2X26A 3A3UA 2THIA 3T66A 4U4XA 4U21A 3U94A 4YMAA 1R9LA 4G8NA 3EN3A 3D4CA 3BFUA 3H6TA 1GVCA 4P0GA 2O1MA 4UA8A 3PUYE 4XKPA 1MH4A 4LP2B 3FJ7A 4I9DA 3OMBA 3HPIA 2REJA 1OMPA 4XKQA 1LFHA 2HXWA 4ZEFA 1OLAA 1N84A 3LSFB 2G93A 1SYHA 3THIA 1QJMA 3N6UA 1DPPA 1N0TA 3KSXA 4IO2A 3H6UA 3KG2A 1DSNA 1O7TA 1TT1A 1NNTA 1LCTA 3KJTA 1B1XA 3DM0A 3H6WA 3G3FA 4F3GA 3PUXE 3O29A 3FJGA 1MXXA 3LR1A 2FNCA 3OENA 4ZE8A 5B70A 1XS5A 4U2RA 3T93B 1H43A 3LC8A 1POY1 5TP9A 3P7IA 3KSJA 1QKAA 1PB9A 4E0XA 3RGYA 3UP9A 2I4CA 2NUVA 3FVOA 1IXHA 3EHSA 3R7XA 4NMYA 4DXBA 2ZNTA 3TDJA 4NF4B 1NKXA 4OEVA 1PC3A 3OEMA 4R75A 5DT6A 1QKBA 1B3FA 3Q26A 3TFLA 1SBPA 2XX8A 3DLNA 4IB2A 4EQBA 3G7WA 2F35A 2YPNA 3DELB 4QSEA 5JTYA 2DE3A 3K4UA 2OJTA 2V25A 3QAXA 3WAFA 2ONRA 3S9LC 3GLBA 2D21A 3U8QA 1OIBA 2O7UA 1POTA 4GWOA 1Y1ZA 5DVFA 1MQDA 3C34A 4GD5A 4EXLA 5I56B 3TMGA 3DP8A 2REGA 1B4HA 1AH5A 5I84A 1MY0A 2Z8EA 3KN7A 5AA2D 3E13X 2ZYNA 1XVYA 4LZ8A 1XOCA 4E0WA 1N3XA 3TCFA 4H5GA 1Y4TA 2NWJA 2O69A 1F9BA 4DCXA 1B1HA 3HHFA 3H6VA 5AA3A 3TEPA 3JYRA 1Y20A 1P99A 2ZYMA 5ITOA 4GRKA 4I62A 2V3TA 4JBZA 3V8XB 2QS4A 3O66A 4QFNA 3G3IA 5H8QA 1R1NA 3CI8A 1DMBA 1LBCA 2XXUA 5EHMA 5CMBA 2XXQA 3MP6A 3VV5A 3T22A 2P2AA 1B2HA 1VR5A 2E0SA 1A7LA 1P1NA 3JZJA 1MXWA 3K01A 3SEWA 1A99A 1J1NA 3N6TA 2Y7KA 1Z7NE 2B65A 3IR1A 5IAIA 4DLDA 3RQTA 2Y7IA 4RK9A 1II5A 4H8IA 2QS3A 3UIFA 4R73A 3FASA 5KCJB 3MZ1A 3K1PA 3E3KA 4C1TA 3TTMA 5ITPA 1LB8A 4BDQA 2QL3A 1YCJA 3IOTA 2AYSA 5H8FA 1QULA 3FJMA 1AMFA 1XT8A 1NNFA 3IOVA 4EF1A 4GLIA 4YICA 3SERA 3RUMA 5H8HB 2DP8A 2XXTA 3PPQA 4F3PA 4U1ZA 4L17A 3I5OA 3USDA 3RTWB 3VDFA 1IIWA 4JWXA 3LSXA 4GOTA 1MY4A 5H8NB 2ESNA 2ONKE 2RINA 2DSFA 5KZTA 3E4RA 3L6GA 2E1SA 5DEXB 4ELQA 4F22A 2DWAA 1SQYA 3QSLA 1B0LA 2HAUA 5DYHA 4YKIA 2YLNA 2ZNUA 3W15C 5KDTA 1R9QA 3MVWA 4PFTA 3K6WA 2UVIA 3K02A 4LQ2A 1IEJA 3O6IA 3U93A 4U23A 3QUJA 4MH5A 1RKMA 2QMXA 4HCWA 1Y4CA 3MJNA 2AL4A 3OEKA 1PB7A 1FTMA 3FV2A 4P11A 4LZ5A 1SDXA 4Z0IA 5AA2B 5I56A 1P1UA 1N7WA 1MPDA 1A40A 4DIGA 2UVHA 2ZYOA 3HSTA 2H99A 3PMVA 3TUSA 1EZOA 1IXGA 2I58A 1M5BA 4KD5A 1GTKA 3T96B 1IITA 4FORA 1FTLA 2OK2A 3K0VA 4HW8A 2GHAA 1OVBA 1IXCA 1XVXA 5L9OA 1GGGA 2HZLA 3CSBA 5H8SA 5CC2A 1SW2A 4Q8RA 4G68B 2Q2CA 2RKMA 2R9JA 4RYAA 4F1YA 4NE4A 5L8DA 5FHNA 1YTVA 3VVFA 2ABHA 3ZKLA 3RY3A 3IO6A 3MQ9A 2HAVA 4IO7A 3FXUA 4ZEIA 5IKBA 1KWHA 2XD2A 3S9NC 2F6GA 5HPQA 4G77A 4KCCA 3UN6A 2KLFA 4RPNA 1B7UA 1B5HA 4TQUQ 2I3VA 1A8FA 2G29A 4F18A 3UGWA 3D4GA 2X7QA 1ZTYA 1L5TA 5KCJA 3OSQA 1ANFA 5CI5A 3QIMA 4Z7EA 1B6HA 2VD3A 2OCUA 2O84X 3O28A 3CFXA 5FHMA 2QMWA 1B7HA 4PP0A 3KGCA 4PFYA 1LAHE 2PT2A 3KBRA 3N5LA 3BKIB 5H8HA 4KHZE 3MC2A 3KEIA 4ELPA 3B6QA 4NTLA 1N7XA 4PQJA 3OD7A 3LBSA 3VXBA 4MLQA 4ZZEA 4YKJA 1MRPA 1EU8A 4TLMB 4DXUA 4RXLA 1MY2A 2DE4A 4NF6A 2DVZA 4R9GA 1AIVA 1JEUA 1R6ZA 1ZKBA 4JWYA 3QXMA 5CMCA 1LB9A 3K6XA 1UIVA 3FZVA 2I0CA 4XIGQ 2QS2A 4MLVA 5DEXA 3VFJA 1JW5A 4XXUA 4FEDA 1VFDA 3HV1A 2PX1A 5DTBA 4LATA 3QYTA 2F34A 3PU5A 1H45A 2XXRA 4TLLB 2A5TB 4GXAA
chains in the Genus database with same CATH superfamily
4RA1A 3DP6A 4FBPA 1PBQA 2V4CA 2O7IA 1XI6A 4GBWA 1D9VA 2RCAA 3CR9A 5ISUA 2Q2AA 2DWIA 3OELA 4X1BA 1JW4A 4OESA 3K00A 5K2YA 2WKYA 1IMAA 1VDWA 1LFIA 3TZAA 1PEBA 3C36A 5I2NA 3UORA 4GF8A 4F3SA 4OETA 2UVGA 4LN5A 1MXZA 5L9SA 2D3IA 4HTGA 5J1DA 4ZZAA 4HCYA 3W9WA 3SETA 5CMMA 3IORA 1EH3A 3MSTA 4WEDA 4FJPA 4OVJA 4N07A 3VLVA 1ZMGA 2ZZVA 1K9YA 4OVPA 4F31B 4P56A 5CM6A 2DOJA 1AL3A 5F24A 1Y3PA 5DVJA 3IO4A 4POXA 4R9FA 1OVTA 3TKDA 1USYE 3SEYA 2UXAA 3MWBA 4XFEA 3RTFB 5AA4B 4NF8B 2CZKA 3GZGA 2XXIA 5ET5A 1ZBMA 4GWWA 3VLWA 2CMOA 2QFLA 5CBRA 4PTKA 4FATA 1Y9UA 5F7VA 3U72A 3DP4A 3PGFA 4X1DA 3M3KA 1UTHB 3LV0A 4F19A 3VVDA 3I3VA 5FBPA 1FBHA 4RJZA 2M8CA 3GYYA 5I2KA 3GBBA 1M5FA 4NWCA 4FIMA 4YZZA 3KN3A 2Y7WA 4QRZA 2OWSA 3PPRA 1PBPA 2NVUB 2NXOA 3IK6B 1K9ZA 3Q25A 1RDYA 3OXNA 1A54A 4Q5TA 3TTLA 4DXCA 3MVXA 4JVDA 4C1UA 3RT6B 4BDOA 1IMBA 3R6UA 2H9BA 2ALUA 2XXPA 4WKMA 1B7ZA 1DPEA 4GWZA 1NV1A 1JVYA 3U1OA 3FGSA 3HN0A 3TTKA 1MQGA 1JP4A 2R6GE 4YKKA 3O6HA 1YPNA 3MVYA 1LBVA 4QXDA 3FBPA 4EXKA 2H4IA 4QHQA 1NH7A 1LAGE 1XHYA 5FTIA 4ZEBA 1B3HA 1MY3A 2AL5A 4POWA 3V5AA 3T9XB 2GHBA 2NOOA 2OX3A 3FUZA 4MAGA 1GR2A 4GQOA 5A5XB 3K6UA 2VGQA 3MP1A 3IAZA 4AQ4A 4F2QA 2Z8FA 4OFLA 3FATA 4PBQA 1I6AA 1VE4A 2VPOA 2VHAA 2QPQA 4NAPA 2I6EA 2ZZWA 4O7IA 5T3JA 3CIJA 1HSJA 1RDZA 2ZMBA 4U4SA 1AOVA 4DI3D 4H1XA 2F36A 2LAOA 4OXVA 4RPOA 1LFGA 4O94A 2ANJA 4ZEKA 4OENA 3MYUA 5EYGA 4JDFA 1PB8A 3TYHA 1LBXA 1I6BA 1AWBA 2UVJA 4X8RA 3RT8A 4ND9A 4R6YA 3MZ9A 5ICTA 4QSCA 2PFZA 1HSLA 2H25A 1BP5A 2Y7RA 3S4UA 2DE2A 5I57B 5FHOA 1IZ1A 4IR8A 3VXCA 3MUQA 1B3LA 2F6PA 2I49A 2ZXTA 4H0WA 4PAIA 3FVGA 1B0HA 2HPGA 1IMDA 1BTJA 2XX9A 4H45A 1B05A 2Z8DA 3SDFA 3H06B 4NF4A 2RF1A 3CG1A 5AA4A 5ELVA 3KC1A 4Q30B 2Q8MA 4BDLA 2UYFA 5CBSA 4P1LA 4MIJA 4PC9A 3KOSA 4EUOA 1DK4A 3LUZA 3N94A 4LVQA 2R71A 4P47A 2DQVA 4BDMA 4QFPA 3PUWE 4N8YA 4PFUA 1NUXA 4H8JA 1G0HA 4GVOA 4KQPA 4FEBA 2QRYA 3G3HA 2PVUA 4RK2A 2PBWA 1M5CA 2BJJX 5BWJA 2CZIA 4MX6A 4KFQA 3K6VA 4ELRA 1PDAA 3PD9A 4G8MA 4ESWA 1IQ7A 3PV0E 4N6DA 4YKPA 4EF2A 1OQHA 4O3AA 1LLSA 1FW0A 1LAFE 2Q74A 4GIZA 4LQ5A 1FQCA 2QJEA 2PCRA 4GL0A 4F2OA 5ESYA 1B5JA 3TCHA 1FBEA 1Q1KA 3RPWA 3QMFA 2D5WA 3HHGA 3IJXB 3A3CA 1RDXA 2CZHA 3JV9A 4WXJA 3T9VA 4NQ8A 5I59B 2I48A 4MF3A 1MM6A 4QSDA 2PMSA 3ODBA 1JW1A 4KYEA 2VP1A 1MS7A 4IY6A 4IO4A 5CRYA 1N76A 1QUIA 4DDDA 4EQ9A 3PUZE 4X9TA 5ET8A 3V83A 1NL5A 3HO7A 4M1VA 1Z7ME 4YB5A 3IB2A 4PBHA 3PMWA 1EZPA 3ILUB 1B5IA 4IY5A 5BUUA 1KA1A 3MBPA 1DOTA 5HBCA 2KQZA 4H5FA 2HCAA 1A55A 3ISPA 5TP9B 4KR5A 3PPNA 1VFEA 3E78A 2F7AA 4KYDA 1SI1A 4F3BA 4F29A 5A5XA 4GWSA 2DXYA 2GH9A 5M2VA 3RPLB 2O51A 3RLFE 3TCGA 4ELOA 4PGNA 2B3BA 1URDA 1ZIUA 1JETA 2B4LA 1CNQA 1A8EA 2H98A 2A5SA 1URGA 2RCBA 1YAEA 4R2BA 3W9VA 1TFAA 1HSEA 4OANA 1SW5A 3C32A 4KYSA 3MP8A 2Q89A 5JTYB 2V3UA 3PUVE 3IX1A 3H03A 1NUYA 4HXVA 2WBDA 3OO9A 5FTHA 1I69A 1CE2A 5I57A 4G2ZA 2F7BA 4ZDMA 4OEUA 4JVCA 1LBWA 4AS4A 4XEQA 3OO8A 1FTJA 2O1LA 5H8NA 4RY1A 2FIEA 3PD8A 4KPTA 2XA5A 3TAJA 4FE8A 2F8DA 1RYOA 4QFLA 2ZZXA 4GX3A 5LDZA 4BLAA 3I6VA 1IXIA 1S7YA 3LSLA 3CFZA 3SZPA 3T0JA 3PMXA 1VSOA 4HE1A 4KCDA 3BFTA 4R2FA 1NUWA 1JVXA 1T0KA 3AXFA 1MY1A 1RYXA 1I6QA 3O97A 2XWOA 2DVCA 1CB6A 4NGUA 3SKPA 4R6HA 2WX9A 3VVEA 1LBZA 4NWDA 4QFOA 2Z22A 1ZJLA 3TQWA 4IO6A 2XWVA 1D4NA 5L9MA 5IGAA 4AS5A 1NH8A 2CZLA 2QVRA 5H8QB 3RN8A 2PT1A 1B58A 1Y3NA 1SPIA 4QFKA 2I0BA 3O6GA 1H44A 5I7IA 4N8GA 3V89B 2V84A 3FIRA 1N04A 3SEVA 5AA2A 4R74A 4LZ7A 1TFDA 1ATGA 4RNSA 3OOAA 4G68C 4NF5B 1WODA 4JSDA 4EDPA 1SD3A 3EF7A 4H65A 3IB0A 4OFJA 1H3DA 3CHGA 5I59A 5TPAB 4MFIA 3MPKA 1UIUA 2AIXA 2F7CA 3K2DA 1SVXB 1FPGA 2QSXA 3Q29A 2RC7A 4M4GA 1TWYA 5DW8A 4AB5A 5EYFA 5JEIA 2XXHA 1FCKA 1DTGA 4GXSB 1IMEA 2B4MA 1B51A 1KZ8A 3EPEA 3T1BA 1B46A 2VD2A 4ECFA 2F78A 3Q27A 5H8FB 3KFMA 1MM7A 3C4MA 4G68A 4ONYA 2Z23A 1FBGA 1FPIA 4XTCQ 3KN8A 5DVIA 2V3QA 3MW0A 3S9EA 2WBBA 2P1SA 2OBGA 2RC9A 4PAFA 2L5VA 5IZ3B 2X7PA 2P0SA 3B7DA 2QVUA 4NN3A 4OQOA 5I3SA 2XX7A 4EQ7A 1USYH 3TODA 4YB7A 5AE4A 2HXRA 2OWZA 3B8BA 1JEVA 3ZS6A 3FV1A 4ISUA 1H76A 2VOZA 5HM4B 4TOZA 1OLCA 4X04A 2XD3A 3OO7A 3PPPA 3FVNA 4FECA 1NMUA 2XXYA 2O6AA 2H5YA 4YMBA 5F1QA 5EHSA 4IGRA 4F1UA 3OO6A 2UYEA 5KDTB 4OYVA 3T9HB 1LBBA 3TTNA 4BDNA 2DS9A 4MEVA 4C0RA 1DBZA 3T9UA 3G3KA 4G61A 3TPAA 3B6TA 3H4ZA 1ZU0A 4DCYA 1FBDA 1SW4A 1FBCA 4IO5A 4XKNA 1D9YA 2YJPA 3LUYA 4GWUA 4H46A 1MQIA 2HEUA 4GWXA 3MAMA 4H6DA 1FPDA 4KI0E 3ROJA 1MDP1 4FAJA 1N3WA 2I3WA 3M8UA 1JNFA 4N6KA 2QS1A 4U1OA 3N26A 1OQGA 1NV0A 1GV8A 1B4ZA 1US4A 3IL1B 4PE5B 4OVQA 1S9TA 4I8CA 3SESA 3ZKKA 4OZ9A 2I4BA 4LUBA 1QUKA 3IB1A 1B3GA 3EHTA 3IOUA 3C9HA 4OERA 4PDHA 3ILTB 3G3GA 4HE0A 3TTRA 3GBAA 3VLUA 5IZZA 2A5TA 3K1MA 3E9XA 3UA8A 4PETA 4OMBA 1QW0A 2F97A 3CFLA 4R72A 1FTKA 1UQWA 2W7YA 5LOMA 4JWOA 4JB7A 3Q28A 1UTBB 3F11A 3C31A 1NV3A 3EQ1A 4N13A 2GRVA 4NF5A 4R6KA 4AB6A 2FA7A 1INPA 3FXRA 3FD3A 2BJIA 1B32A 1LCFA 1MXVA 5TPAA 1FPBA 1B3EA 1BIYA 4JSOA 1Y1MA 2ONSA 1FQAA 2DXRA 3QUFA 4ZECA 4X48A 2DWHA 3B6WA 3M3LA 4K3FA 2RC8A 1FQBA 5I58B 2OLBA 2Y7PA 4N6PA 3C35A 4P0IA 2ZYKA 3HFUA 4I3YA 2Q8JA 4MBPA 2CEXA 4NF8A 5JK4A 4O3BA 3S9MC 2FYIA 1FTOA 2XXWA 2PFYA 3OSRA 4IGTA 2DYXA 2O68A 1M5DA 4P9KA 1XC1A 2Y5KA 4NF6B 4F39A 5CMKA 1LGBC 2ZNSA 2GFEA 1UTHA 4OTEA 2P3VA 3RNNA 2HZKA 3CG3A 4ZEDA 4OVRA 4I3EA 2Q9TA 1M5EA 1ZLQA 3UK4A 4ZS9A 3C33A 3SEXA 1D9QA 1SW1A 3O2AA 3IOWA 4ZE9A 3ONMA 2R8TA 1P1OA 4YB6A 3SEUA 1FBFA 1B9JA 2HFBA 3RYDA 4DI4B 2DWJA 4OA4A 4UACA 1IUDA 2F5XA 5B7DA 4GFRA 1MH3A 3QK6A 2OZZA 1S50A 4JXIA 3G3JA 3HCQA 1WDNA 5I2NB 2IEEA 1MXUA 2V93A 4N17A 4F1VA 1MQJA 4OVTA 1P1WA 1WVJA 1NFTA 3EKIA 5AA1A 1Q35A 4O8MA 3VE1B 4PAKA 5K2XA 1DTZA 1FPFA 4LA9A 3KOTA 3S2VA 2VPNA 1QUJA 4YAHX 1FQFA 4GL8A 3CRBA 4XKRA 4LONB 2PYYA 4OFOA 3PPOA 3EHUA 1Y3QA 3BIHA 4NG7A 4OHNA 1B52A 4H67A 5EQAA 1B40A 4MJOA 2Q88A 1MPBA 1BKAA 1MDQA 3IFCA 1MPCA 2IA4A 4NEDA 2HQ0A 4PE3A 3U92A 4G4PA 1MXYA 5EYHA 1UTBA 3TQLA 2Y84A 1BLFA 1D3KA 2XHDA 3KZGA 2WEFA 1LAXA 3CSGA 1O63A 4DE8A 1MQHA 1ELJA 3MPLA 1LEVA 4I1DA 4DZ1A 4QBAA 5LTCA 4PDDA 2XXVA 4G8HA 3CVGA 4YU0A 2Y5LA 4OWDA 5EQ9A 1JQFA 5I2KB 4N81A 1FQDA 3MZBA 2OWTA 3ECRA 3BBRA 4GX6A 4NF0A 3K1NA 3ZSFA 1LSTA 3FXQA 1TXFA 3KC0A 2CEYA 4O3CA 2XWIA 1QGXA 4ESXA 2B3FA 1MG1A 1P1QA 3IJOB 5I58A 3TELA 1SI0A 1SYIA 4U22A 4P3LA 4Q0CA 3L6HA 3MVZA 3KJ7A 1YZ0A 3R26A 3WAEA 1US5A 4HS7A 3A09A 1QVSA 5ICQA 1EZ9A 3H3GA 3GXAA 4IO3A 5EQ7A 1O64A 3O9PA 3LSWA 4QF9A 3M3FA 1FPLA 4THIA 3FVKA 4PFWA 5TU0A 4WEPA 4BDRA 1NNKA 1URSA 1NNPA 2XXXA 1FQEA 3H7MA 2X26A 3A3UA 2THIA 4PFRA 3T66A 4U4XA 4U21A 1FPJA 3U94A 4YMAA 1R9LA 2F3BA 4G8NA 3EN3A 3D4CA 3BFUA 3H6TA 1GVCA 4P0GA 4UA8A 2O1MA 1EYIA 3D1RA 3PUYE 4XKPA 4P8BA 1MH4A 4LP2B 3FJ7A 4I9DA 4PFBA 1FJ6A 3OMBA 3HPIA 2REJA 1OMPA 4XKQA 1LFHA 2HXWA 4ZEFA 1OLAA 1N84A 5IZ1A 3LSFB 2G93A 1SYHA 3THIA 1FPEA 1QJMA 3N6UA 1YYZA 1DPPA 1N0TA 3KSXA 1BK4A 4IO2A 3H6UA 3KG2A 1DSNA 1O7TA 1TT1A 1NNTA 1LCTA 3KJTA 1B1XA 3DM0A 3H6WA 3G3FA 4F3GA 3PUXE 3O29A 3FJGA 4GBVA 3NOHA 1MXXA 3LR1A 2FNCA 3OENA 4ZE8A 5B70A 1XS5A 4PF8A 4U2RA 3T93B 1H43A 3LC8A 1POY1 5TP9A 3P7IA 3KSJA 1QKAA 1PB9A 4E0XA 3RGYA 3UP9A 2WYPA 4MHFA 2I4CA 2NUVA 3FVOA 1IXHA 3EHSA 3RPLA 3R7XA 4NMYA 4DXBA 2ZNTA 3TDJA 4NF4B 5J16A 1NKXA 4OEVA 1PC3A 3OEMA 3E79A 4R75A 5DT6A 2XWKA 4JVIA 1QKBA 1KA0A 2WYKA 1B3FA 4MNCA 3Q26A 5EQ8A 3TFLA 1SBPA 2XX8A 1IMCA 3DLNA 4IB2A 4EQBA 3G7WA 2F35A 2YPNA 4NX1A 3DELB 4QSEA 5JTYA 2DE3A 3K4UA 2OJTA 1G0IA 2V25A 3QAXA 1NV6A 3WAFA 2ONRA 3S9LC 3GLBA 2D21A 3U8QA 1OIBA 2O7UA 1POTA 1FBPA 4GWOA 1Y1ZA 5DVFA 1MQDA 3C34A 4GD5A 4XF5A 4EXLA 5I56B 3TMGA 3DP8A 2REGA 1B4HA 1AH5A 5I84A 1MY0A 2Z8EA 3KN7A 5AA2D 3E13X 2ZYNA 1XVYA 4LZ8A 2P3NA 1XOCA 4E0WA 1N3XA 3TCFA 4H5GA 1Y4TA 2HHMA 2NWJA 2O69A 1F9BA 1FSAA 4DCXA 1B1HA 3HHFA 3H6VA 4MNPA 5AA3A 3TEPA 3JYRA 1Y20A 4N91A 1P99A 2ZYMA 5ITOA 4GRKA 4I62A 2V3TA 1IMFA 4JBZA 3V8XB 2QS4A 3O66A 2KR0A 4QFNA 3G3IA 5H8QA 1R1NA 3CI8A 4MMPA 1DMBA 1LBCA 2XXUA 5EHMA 5CMBA 2XXQA 4I40A 3MP6A 3VV5A 1YXIA 2QVVA 4P1EA 3U65A 3T22A 2P2AA 1B2HA 1VR5A 2E0SA 1A7LA 1FJ9A 1P1NA 3JZJA 1MXWA 3K01A 3SEWA 1A99A 4PF6A 1J1NA 3N6TA 2Y7KA 2XXKA 1Z7NE 2B65A 3IR1A 5IAIA 4DLDA 3RQTA 1NV2A 2Y7IA 4RK9A 1II5A 4H8IA 2QS3A 3UIFA 4R73A 3FASA 5KCJB 3MZ1A 3K1PA 3E3KA 4C1TA 3TTMA 5ITPA 1LB8A 4BDQA 2QL3A 1YCJA 3IOTA 2AYSA 5ET6A 5H8FA 1QULA 3FJMA 1AMFA 4HE2A 1XT8A 1NNFA 3IOVA 4EF1A 4GLIA 4YICA 3SERA 3RUMA 5H8HB 2MKZA 2DP8A 5IZ3A 2XXTA 3PPQA 4F3PA 4U1ZA 4L17A 3I5OA 1EYJA 3USDA 3RTWB 3VDFA 1IIWA 4JWXA 4N4UA 3LSXA 4GOTA 1MY4A 5H8NB 2ESNA 2ONKE 2RINA 2DSFA 4GX4A 5KZTA 3E4RA 3L6GA 2E1SA 5DEXB 4ELQA 2DWAA 4F22A 1SQYA 3QSLA 1B0LA 2HAUA 5DYHA 5ET7A 4YKIA 2YLNA 2ZNUA 3W15C 5KDTA 1R9QA 1DCUA 3FXBA 4PCDA 3MVWA 4UABA 4PFTA 3K6WA 4MCOA 2UVIA 3K02A 4LQ2A 1IEJA 3O6IA 3U93A 4U23A 3QUJA 4MH5A 2F3DA 1RKMA 2QMXA 4O7MA 4HCWA 1NUZA 1Y4CA 3MJNA 2AL4A 3OEKA 1PB7A 1FTMA 3FV2A 4P11A 4LZ5A 1SDXA 4Z0IA 5AA2B 5I56A 3PTYA 3KBZA 1P1UA 1N7WA 1MPDA 1A40A 4DIGA 2UVHA 3A29A 2ZYOA 3HSTA 2H99A 3PMVA 3TUSA 1EZOA 1IXGA 2I58A 1M5BA 2JJKA 4KD5A 1GTKA 3T96B 1IITA 4FORA 1FTLA 2OK2A 3K0VA 4HW8A 2FVZA 2GHAA 1OVBA 1IXCA 1XVXA 5L9OA 1GGGA 2HZLA 3CSBA 5H8SA 5CC2A 5IM2A 1SW2A 1FRPA 4G68B 4Q8RA 1NV7A 2Q2CA 2RKMA 2R9JA 5I5PA 2VT5A 4RYAA 4F1YA 4NE4A 5FHNA 5L8DA 1YTVA 3VVFA 2ABHA 3ZKLA 3RY3A 3IO6A 1Q9DA 3MQ9A 2HAVA 4IO7A 3FXUA 4ZEIA 5IKBA 1KWHA 2XD2A 3S9NC 4N15A 4NHBA 2F6GA 5HPQA 4G77A 4KCCA 3UN6A 2KLFA 4RPNA 5A5LA 1B7UA 1B5HA 4TQUQ 2I3VA 1A8FA 2G29A 2FIXA 4F18A 3UGWA 2FHYA 3D4GA 2X7QA 1ZTYA 1L5TA 5KCJA 3OSQA 1ANFA 5CI5A 3QIMA 4Z7EA 1B6HA 2VD3A 4MNIA 2OCUA 1EYKA 2O84X 3O28A 3CFXA 5FHMA 2QMWA 1B7HA 4PP0A 4PFIA 3IFAA 3KGCA 4PFYA 1LAHE 2PT2A 3KBRA 3N5LA 3BKIB 5H8HA 4KHZE 1LBYA 3MC2A 3KEIA 4ELPA 3B6QA 4KXPA 4NTLA 1N7XA 4PQJA 3OD7A 3LBSA 3VXBA 4MLQA 2GQ1A 4ZZEA 4YKJA 4PGPA 1MRPA 1EU8A 4TLMB 4DXUA 4RXLA 1MY2A 2DE4A 4NF6A 2DVZA 4R9GA 1AIVA 4OVSA 1JEUA 1FPKA 1R6ZA 1ZKBA 4JWYA 3QXMA 5CMCA 2DDKA 1LB9A 3K6XA 1UIVA 1FTAA 3FZVA 2I0CA 4XIGQ 2QS2A 4MLVA 5DEXA 3VFJA 1JW5A 4XXUA 4FEDA 1VFDA 2FBPA 3HV1A 2PX1A 4GWYA 1NV4A 5DTBA 4LATA 1NV5A 3B50A 3QYTA 1NI9A 2F34A 3PU5A 1H45A 2XXRA 4TLLB 3BIGA 2A5TB 4GXAA
chains in the Genus database with same CATH topology
4RA1A 3DP6A 1PBQA 2O7IA 1D9VA 2RCAA 3CR9A 5ISUA 2Q2AA 2DWIA 3OELA 4X1BA 1JW4A 4OESA 3K00A 5K2YA 2WKYA 1LFIA 3TZAA 1PEBA 3C36A 5I2NA 3UORA 4GF8A 4F3SA 4OETA 2UVGA 1MXZA 5L9SA 2D3IA 4HTGA 5J1DA 4ZZAA 4HCYA 3W9WA 3SETA 5CMMA 3IORA 1EH3A 4WEDA 4FJPA 4OVJA 4N07A 3VLVA 1ZMGA 4F31B 5CM6A 2DOJA 1AL3A 1Y3PA 5DVJA 3IO4A 4POXA 4R9FA 1OVTA 3TKDA 1USYE 3SEYA 2UXAA 3MWBA 3RTFB 5AA4B 4NF8B 3GZGA 2XXIA 1ZBMA 3VLWA 2CMOA 5CBRA 4FATA 1Y9UA 5F7VA 3U72A 3DP4A 3PGFA 4X1DA 3M3KA 1UTHB 4F19A 3VVDA 3I3VA 4RJZA 2M8CA 5I2KA 3GBBA 1M5FA 4NWCA 4FIMA 4YZZA 3KN3A 2Y7WA 4QRZA 2OWSA 3PPRA 1PBPA 2NVUB 2NXOA 3IK6B 3Q25A 3OXNA 1A54A 4Q5TA 3TTLA 4DXCA 3MVXA 4C1UA 3RT6B 4BDOA 3R6UA 2H9BA 2ALUA 2XXPA 4WKMA 1B7ZA 1DPEA 1JVYA 3U1OA 3FGSA 3HN0A 3TTKA 1MQGA 2R6GE 4YKKA 3O6HA 1YPNA 3MVYA 4EXKA 2H4IA 4QHQA 1NH7A 1LAGE 1XHYA 5FTIA 4ZEBA 1B3HA 1MY3A 2AL5A 4POWA 3V5AA 3T9XB 2GHBA 2NOOA 3FUZA 1GR2A 4GQOA 5A5XB 3K6UA 2VGQA 3MP1A 3IAZA 4AQ4A 4F2QA 2Z8FA 4OFLA 3FATA 1I6AA 1VE4A 2VHAA 2QPQA 2I6EA 3CIJA 1HSJA 2ZMBA 4U4SA 1AOVA 4H1XA 2F36A 2LAOA 4OXVA 4RPOA 1LFGA 2ANJA 4ZEKA 4OENA 4JDFA 1PB8A 3TYHA 1I6BA 2UVJA 3RT8A 4ND9A 4R6YA 3MZ9A 5ICTA 4QSCA 1HSLA 2H25A 1BP5A 2Y7RA 3S4UA 2DE2A 5I57B 5FHOA 1IZ1A 3VXCA 3MUQA 1B3LA 2F6PA 2I49A 2ZXTA 4H0WA 3FVGA 1B0HA 1BTJA 2XX9A 1B05A 2Z8DA 3SDFA 3H06B 4NF4A 2RF1A 3CG1A 5AA4A 5ELVA 4Q30B 4BDLA 2UYFA 5CBSA 3KOSA 4EUOA 3N94A 4LVQA 2R71A 2DQVA 4BDMA 4QFPA 3PUWE 4PFUA 4H8JA 4GVOA 4KQPA 4FEBA 2QRYA 3G3HA 2PVUA 4RK2A 2PBWA 1M5CA 2BJJX 5BWJA 4KFQA 3K6VA 4ELRA 1PDAA 3PD9A 4G8MA 4ESWA 1IQ7A 3PV0E 4YKPA 4EF2A 1OQHA 4O3AA 1LLSA 1FW0A 1LAFE 4GIZA 4LQ5A 1FQCA 2QJEA 4GL0A 4F2OA 1B5JA 3TCHA 1Q1KA 3RPWA 2D5WA 3HHGA 3IJXB 3A3CA 3JV9A 4WXJA 3T9VA 5I59B 2I48A 4MF3A 1MM6A 4QSDA 2PMSA 3ODBA 1JW1A 4KYEA 2VP1A 1MS7A 4IY6A 4IO4A 5CRYA 1N76A 1QUIA 4DDDA 4EQ9A 3PUZE 4X9TA 3V83A 1NL5A 3HO7A 4M1VA 1Z7ME 4YB5A 3IB2A 3PMWA 1EZPA 3ILUB 1B5IA 4IY5A 5BUUA 3MBPA 1DOTA 5HBCA 4H5FA 2HCAA 1A55A 5TP9B 4KR5A 3PPNA 1VFEA 2F7AA 4KYDA 1SI1A 4F3BA 4F29A 5A5XA 2DXYA 2GH9A 5M2VA 2O51A 3RLFE 3TCGA 4ELOA 2B3BA 1URDA 1ZIUA 1JETA 1A8EA 2H98A 2A5SA 1URGA 2RCBA 1YAEA 4R2BA 3W9VA 1TFAA 1HSEA 1SW5A 3C32A 4KYSA 3MP8A 2Q89A 5JTYB 2V3UA 3PUVE 3IX1A 3H03A 3OO9A 5FTHA 1I69A 1CE2A 5I57A 4G2ZA 2F7BA 4ZDMA 4OEUA 3OO8A 1FTJA 2O1LA 5H8NA 4RY1A 3PD8A 4KPTA 3TAJA 4FE8A 2F8DA 1RYOA 4QFLA 4BLAA 3I6VA 1IXIA 1S7YA 3LSLA 3CFZA 3PMXA 1VSOA 4KCDA 3BFTA 4R2FA 1JVXA 1T0KA 3AXFA 1MY1A 1RYXA 1I6QA 3O97A 2DVCA 1CB6A 3SKPA 4R6HA 3VVEA 4NWDA 4QFOA 2Z22A 1ZJLA 3TQWA 4IO6A 1D4NA 5L9MA 1NH8A 2CZLA 5H8QB 3RN8A 2PT1A 1B58A 1Y3NA 4QFKA 2I0BA 3O6GA 1H44A 3V89B 2V84A 3FIRA 1N04A 3SEVA 5AA2A 4R74A 4LZ7A 1TFDA 1ATGA 4RNSA 3OOAA 4G68C 4NF5B 1WODA 4JSDA 4EDPA 1SD3A 3EF7A 4H65A 3IB0A 4OFJA 1H3DA 5I59A 5TPAB 4MFIA 3MPKA 1UIUA 2AIXA 2F7CA 3K2DA 1SVXB 2QSXA 3Q29A 2RC7A 4M4GA 1TWYA 4AB5A 5EYFA 5JEIA 2XXHA 1FCKA 1DTGA 4GXSB 1B51A 3EPEA 1B46A 2VD2A 4ECFA 2F78A 3Q27A 5H8FB 3KFMA 1MM7A 3C4MA 4G68A 4ONYA 2Z23A 4XTCQ 3KN8A 5DVIA 2V3QA 3MW0A 3S9EA 2P1SA 2OBGA 2RC9A 2X7PA 2P0SA 3B7DA 4OQOA 2XX7A 4EQ7A 1USYH 3TODA 4YB7A 5AE4A 1JEVA 3ZS6A 3FV1A 4ISUA 1H76A 2VOZA 5HM4B 4TOZA 1OLCA 2XD3A 3OO7A 3PPPA 3FVNA 4FECA 1NMUA 2XXYA 2O6AA 2H5YA 4YMBA 5F1QA 5EHSA 4IGRA 4F1UA 3OO6A 2UYEA 5KDTB 4OYVA 3T9HB 1LBBA 3TTNA 4BDNA 2DS9A 4C0RA 3T9UA 3G3KA 3TPAA 3B6TA 3H4ZA 1ZU0A 4DCYA 1SW4A 4IO5A 4XKNA 1D9YA 2YJPA 3LUYA 1MQIA 2HEUA 3MAMA 4H6DA 4KI0E 1MDP1 4FAJA 1N3WA 2I3WA 3M8UA 1JNFA 2QS1A 4U1OA 3N26A 1OQGA 1GV8A 1B4ZA 1US4A 3IL1B 4PE5B 1S9TA 4I8CA 3SESA 3ZKKA 4OZ9A 2I4BA 4LUBA 1QUKA 3IB1A 1B3GA 3EHTA 3IOUA 3C9HA 4OERA 3ILTB 3G3GA 3TTRA 3VLUA 3GBAA 2A5TA 3K1MA 3E9XA 3UA8A 4PETA 4OMBA 1QW0A 2F97A 3CFLA 4R72A 1FTKA 1UQWA 2W7YA 5LOMA 4JWOA 4JB7A 3Q28A 1UTBB 3F11A 3C31A 3EQ1A 4N13A 2GRVA 4NF5A 4R6KA 4AB6A 2FA7A 3FXRA 3FD3A 1B32A 1LCFA 1MXVA 5TPAA 1B3EA 1BIYA 4JSOA 1Y1MA 2ONSA 1FQAA 2DXRA 3QUFA 4ZECA 4X48A 2DWHA 3B6WA 3M3LA 2RC8A 4K3FA 1FQBA 5I58B 2OLBA 2Y7PA 4N6PA 3C35A 4P0IA 2ZYKA 2Q8JA 4MBPA 4NF8A 5JK4A 4O3BA 3S9MC 2FYIA 1FTOA 2XXWA 3OSRA 4IGTA 2DYXA 2O68A 1M5DA 1XC1A 4F39A 4NF6B 5CMKA 1LGBC 2ZNSA 2GFEA 1UTHA 4OTEA 3RNNA 2HZKA 3CG3A 4ZEDA 2Q9TA 1M5EA 1ZLQA 3UK4A 4ZS9A 3C33A 3SEXA 1SW1A 3O2AA 3IOWA 4ZE9A 3ONMA 1P1OA 4YB6A 3SEUA 1B9JA 2HFBA 2DWJA 4UACA 1IUDA 2F5XA 5B7DA 4GFRA 1MH3A 3QK6A 2OZZA 1S50A 4JXIA 3G3JA 3HCQA 1WDNA 5I2NB 2IEEA 1MXUA 2V93A 4F1VA 1MQJA 1P1WA 1WVJA 1NFTA 5AA1A 1Q35A 3VE1B 5K2XA 1DTZA 4LA9A 3KOTA 3S2VA 1QUJA 4YAHX 1FQFA 4GL8A 3CRBA 4XKRA 4LONB 2PYYA 4OFOA 3PPOA 3EHUA 1Y3QA 4OHNA 1B52A 4H67A 1B40A 2Q88A 1MPBA 1BKAA 1MDQA 1MPCA 2IA4A 4NEDA 2HQ0A 3U92A 4G4PA 1MXYA 1UTBA 3TQLA 2Y84A 1BLFA 1D3KA 2XHDA 3KZGA 1LAXA 3CSGA 1O63A 4DE8A 1MQHA 1ELJA 3MPLA 4I1DA 4DZ1A 2XXVA 4G8HA 3CVGA 4YU0A 4OWDA 1JQFA 5I2KB 1FQDA 3MZBA 2OWTA 3ECRA 3BBRA 3K1NA 3ZSFA 1LSTA 3FXQA 1TXFA 4O3CA 4ESXA 2B3FA 1MG1A 1P1QA 3IJOB 5I58A 3TELA 1SI0A 1SYIA 4U22A 4Q0CA 3L6HA 3MVZA 3KJ7A 3R26A 3WAEA 1US5A 4HS7A 3A09A 1QVSA 5ICQA 1EZ9A 3H3GA 3GXAA 4IO3A 1O64A 3O9PA 3LSWA 4QF9A 3M3FA 4THIA 3FVKA 4PFWA 5TU0A 4WEPA 4BDRA 1NNKA 1URSA 1NNPA 2XXXA 1FQEA 3H7MA 2X26A 3A3UA 2THIA 3T66A 4U4XA 4U21A 3U94A 4YMAA 1R9LA 4G8NA 3EN3A 3D4CA 3BFUA 3H6TA 1GVCA 4P0GA 2O1MA 4UA8A 3PUYE 4XKPA 1MH4A 4LP2B 3FJ7A 4I9DA 3OMBA 3HPIA 2REJA 1OMPA 4XKQA 1LFHA 2HXWA 4ZEFA 1OLAA 1N84A 3LSFB 2G93A 1SYHA 3THIA 1QJMA 3N6UA 1DPPA 1N0TA 3KSXA 4IO2A 3H6UA 3KG2A 1DSNA 1O7TA 1TT1A 1NNTA 1LCTA 3KJTA 1B1XA 3DM0A 3H6WA 3G3FA 4F3GA 3PUXE 3O29A 3FJGA 1MXXA 3LR1A 2FNCA 3OENA 4ZE8A 5B70A 1XS5A 4U2RA 3T93B 1H43A 3LC8A 1POY1 5TP9A 3P7IA 3KSJA 1QKAA 1PB9A 4E0XA 3RGYA 3UP9A 2I4CA 2NUVA 3FVOA 1IXHA 3EHSA 3R7XA 4NMYA 4DXBA 2ZNTA 3TDJA 4NF4B 1NKXA 4OEVA 1PC3A 3OEMA 4R75A 5DT6A 1QKBA 1B3FA 3Q26A 3TFLA 1SBPA 2XX8A 3DLNA 4IB2A 4EQBA 3G7WA 2F35A 2YPNA 3DELB 4QSEA 5JTYA 2DE3A 3K4UA 2OJTA 2V25A 3QAXA 3WAFA 2ONRA 3S9LC 3GLBA 2D21A 3U8QA 1OIBA 2O7UA 1POTA 4GWOA 1Y1ZA 5DVFA 1MQDA 3C34A 4GD5A 4EXLA 5I56B 3TMGA 3DP8A 2REGA 1B4HA 1AH5A 5I84A 1MY0A 2Z8EA 3KN7A 5AA2D 3E13X 2ZYNA 1XVYA 4LZ8A 1XOCA 4E0WA 1N3XA 3TCFA 4H5GA 1Y4TA 2NWJA 2O69A 1F9BA 4DCXA 1B1HA 3HHFA 3H6VA 5AA3A 3TEPA 3JYRA 1Y20A 1P99A 2ZYMA 5ITOA 4GRKA 4I62A 2V3TA 4JBZA 3V8XB 2QS4A 3O66A 4QFNA 3G3IA 5H8QA 1R1NA 3CI8A 1DMBA 1LBCA 2XXUA 5EHMA 5CMBA 2XXQA 3MP6A 3VV5A 3T22A 2P2AA 1B2HA 1VR5A 2E0SA 1A7LA 1P1NA 3JZJA 1MXWA 3K01A 3SEWA 1A99A 1J1NA 3N6TA 2Y7KA 1Z7NE 2B65A 3IR1A 5IAIA 4DLDA 3RQTA 2Y7IA 4RK9A 1II5A 4H8IA 2QS3A 3UIFA 4R73A 3FASA 5KCJB 3MZ1A 3K1PA 3E3KA 4C1TA 3TTMA 5ITPA 1LB8A 4BDQA 2QL3A 1YCJA 3IOTA 2AYSA 5H8FA 1QULA 3FJMA 1AMFA 1XT8A 1NNFA 3IOVA 4EF1A 4GLIA 4YICA 3SERA 3RUMA 5H8HB 2DP8A 2XXTA 3PPQA 4F3PA 4U1ZA 4L17A 3I5OA 3USDA 3RTWB 3VDFA 1IIWA 4JWXA 3LSXA 4GOTA 1MY4A 5H8NB 2ESNA 2ONKE 2RINA 2DSFA 5KZTA 3E4RA 3L6GA 2E1SA 5DEXB 4ELQA 4F22A 2DWAA 1SQYA 3QSLA 1B0LA 2HAUA 5DYHA 4YKIA 2YLNA 2ZNUA 3W15C 5KDTA 1R9QA 3MVWA 4PFTA 3K6WA 2UVIA 3K02A 4LQ2A 1IEJA 3O6IA 3U93A 4U23A 3QUJA 4MH5A 1RKMA 2QMXA 4HCWA 1Y4CA 3MJNA 2AL4A 3OEKA 1PB7A 1FTMA 3FV2A 4P11A 4LZ5A 1SDXA 4Z0IA 5AA2B 5I56A 1P1UA 1N7WA 1MPDA 1A40A 4DIGA 2UVHA 2ZYOA 3HSTA 2H99A 3PMVA 3TUSA 1EZOA 1IXGA 2I58A 1M5BA 4KD5A 1GTKA 3T96B 1IITA 4FORA 1FTLA 2OK2A 3K0VA 4HW8A 2GHAA 1OVBA 1IXCA 1XVXA 5L9OA 1GGGA 2HZLA 3CSBA 5H8SA 5CC2A 1SW2A 4Q8RA 4G68B 2Q2CA 2RKMA 2R9JA 4RYAA 4F1YA 4NE4A 5L8DA 5FHNA 1YTVA 3VVFA 2ABHA 3ZKLA 3RY3A 3IO6A 3MQ9A 2HAVA 4IO7A 3FXUA 4ZEIA 5IKBA 1KWHA 2XD2A 3S9NC 2F6GA 5HPQA 4G77A 4KCCA 3UN6A 2KLFA 4RPNA 1B7UA 1B5HA 4TQUQ 2I3VA 1A8FA 2G29A 4F18A 3UGWA 3D4GA 2X7QA 1ZTYA 1L5TA 5KCJA 3OSQA 1ANFA 5CI5A 3QIMA 4Z7EA 1B6HA 2VD3A 2OCUA 2O84X 3O28A 3CFXA 5FHMA 2QMWA 1B7HA 4PP0A 3KGCA 4PFYA 1LAHE 2PT2A 3KBRA 3N5LA 3BKIB 5H8HA 4KHZE 3MC2A 3KEIA 4ELPA 3B6QA 4NTLA 1N7XA 4PQJA 3OD7A 3LBSA 3VXBA 4MLQA 4ZZEA 4YKJA 1MRPA 1EU8A 4TLMB 4DXUA 4RXLA 1MY2A 2DE4A 4NF6A 2DVZA 4R9GA 1AIVA 1JEUA 1R6ZA 1ZKBA 4JWYA 3QXMA 5CMCA 1LB9A 3K6XA 1UIVA 3FZVA 2I0CA 4XIGQ 2QS2A 4MLVA 5DEXA 3VFJA 1JW5A 4XXUA 4FEDA 1VFDA 3HV1A 2PX1A 5DTBA 4LATA 3QYTA 2F34A 3PU5A 1H45A 2XXRA 4TLLB 2A5TB 4GXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RA1 A;  3DP6 A;  1PBQ A;  2O7I A;  1D9V A;  2RCA A;  3CR9 A;  5ISU A;  2Q2A A;  2DWI A;  3OEL A;  4X1B A;  1JW4 A;  4OES A;  3K00 A;  5K2Y A;  2WKY A;  1LFI A;  3TZA A;  1PEB A;  3C36 A;  5I2N A;  3UOR A;  4GF8 A;  4F3S A;  4OET A;  2UVG A;  1MXZ A;  5L9S A;  2D3I A;  4HTG A;  5J1D A;  4ZZA A;  4HCY A;  3W9W A;  3SET A;  5CMM A;  3IOR A;  1EH3 A;  4WED A;  4FJP A;  4OVJ A;  4N07 A;  3VLV A;  1ZMG A;  4F31 B;  5CM6 A;  2DOJ A;  1AL3 A;  1Y3P A;  5DVJ A;  3IO4 A;  4POX A;  4R9F A;  1OVT A;  3TKD A;  1USY E;  3SEY A;  2UXA A;  3MWB A;  3RTF B;  5AA4 B;  4NF8 B;  3GZG A;  2XXI A;  1ZBM A;  3VLW A;  2CMO A;  5CBR A;  4FAT A;  1Y9U A;  5F7V A;  3U72 A;  3DP4 A;  3PGF A;  4X1D A;  3M3K A;  1UTH B;  4F19 A;  3VVD A;  3I3V A;  4RJZ A;  2M8C A;  5I2K A;  3GBB A;  1M5F A;  4NWC A;  4FIM A;  4YZZ A;  3KN3 A;  2Y7W A;  4QRZ A;  2OWS A;  3PPR A;  1PBP A;  2NVU B;  2NXO A;  3IK6 B;  3Q25 A;  3OXN A;  1A54 A;  4Q5T A;  3TTL A;  4DXC A;  3MVX A;  4C1U A;  3RT6 B;  4BDO A;  3R6U A;  2H9B A;  2ALU A;  2XXP A;  4WKM A;  1B7Z A;  1DPE A;  1JVY A;  3U1O A;  3FGS A;  3HN0 A;  3TTK A;  1MQG A;  2R6G E;  4YKK A;  3O6H A;  1YPN A;  3MVY A;  4EXK A;  2H4I A;  4QHQ A;  1NH7 A;  1LAG E;  1XHY A;  5FTI A;  4ZEB A;  1B3H A;  1MY3 A;  2AL5 A;  4POW A;  3V5A A;  3T9X B;  2GHB A;  2NOO A;  3FUZ A;  1GR2 A;  4GQO A;  5A5X B;  3K6U A;  2VGQ A;  3MP1 A;  3IAZ A;  4AQ4 A;  4F2Q A;  2Z8F A;  4OFL A;  3FAT A;  1I6A A;  1VE4 A;  2VHA A;  2QPQ A;  2I6E A;  3CIJ A;  1HSJ A;  2ZMB A;  4U4S A;  1AOV A;  4H1X A;  2F36 A;  2LAO A;  4OXV A;  4RPO A;  1LFG A;  2ANJ A;  4ZEK A;  4OEN A;  4JDF A;  1PB8 A;  3TYH A;  1I6B A;  2UVJ A;  3RT8 A;  4ND9 A;  4R6Y A;  3MZ9 A;  5ICT A;  4QSC A;  1HSL A;  2H25 A;  1BP5 A;  2Y7R A;  3S4U A;  2DE2 A;  5I57 B;  5FHO A;  1IZ1 A;  3VXC A;  3MUQ A;  1B3L A;  2F6P A;  2I49 A;  2ZXT A;  4H0W A;  3FVG A;  1B0H A;  1BTJ A;  2XX9 A;  1B05 A;  2Z8D A;  3SDF A;  3H06 B;  4NF4 A;  2RF1 A;  3CG1 A;  5AA4 A;  5ELV A;  4Q30 B;  4BDL A;  2UYF A;  5CBS A;  3KOS A;  4EUO A;  3N94 A;  4LVQ A;  2R71 A;  2DQV A;  4BDM A;  4QFP A;  3PUW E;  4PFU A;  4H8J A;  4GVO A;  4KQP A;  4FEB A;  2QRY A;  3G3H A;  2PVU A;  4RK2 A;  2PBW A;  1M5C A;  2BJJ X;  5BWJ A;  4KFQ A;  3K6V A;  4ELR A;  1PDA A;  3PD9 A;  4G8M A;  4ESW A;  1IQ7 A;  3PV0 E;  4YKP A;  4EF2 A;  1OQH A;  4O3A A;  1LLS A;  1FW0 A;  1LAF E;  4GIZ A;  4LQ5 A;  1FQC A;  2QJE A;  4GL0 A;  4F2O A;  1B5J A;  3TCH A;  1Q1K A;  3RPW A;  2D5W A;  3HHG A;  3IJX B;  3A3C A;  3JV9 A;  4WXJ A;  3T9V A;  5I59 B;  2I48 A;  4MF3 A;  1MM6 A;  4QSD A;  2PMS A;  3ODB A;  1JW1 A;  4KYE A;  2VP1 A;  1MS7 A;  4IY6 A;  4IO4 A;  5CRY A;  1N76 A;  1QUI A;  4DDD A;  4EQ9 A;  3PUZ E;  4X9T A;  3V83 A;  1NL5 A;  3HO7 A;  4M1V A;  1Z7M E;  4YB5 A;  3IB2 A;  3PMW A;  1EZP A;  3ILU B;  1B5I A;  4IY5 A;  5BUU A;  3MBP A;  1DOT A;  5HBC A;  4H5F A;  2HCA A;  1A55 A;  5TP9 B;  4KR5 A;  3PPN A;  1VFE A;  2F7A A;  4KYD A;  1SI1 A;  4F3B A;  4F29 A;  5A5X A;  2DXY A;  2GH9 A;  5M2V A;  2O51 A;  3RLF E;  3TCG A;  4ELO A;  2B3B A;  1URD A;  1ZIU A;  1JET A;  1A8E A;  2H98 A;  2A5S A;  1URG A;  2RCB A;  1YAE A;  4R2B A;  3W9V A;  1TFA A;  1HSE A;  1SW5 A;  3C32 A;  4KYS A;  3MP8 A;  2Q89 A;  5JTY B;  2V3U A;  3PUV E;  3IX1 A;  3H03 A;  3OO9 A;  5FTH A;  1I69 A;  1CE2 A;  5I57 A;  4G2Z A;  2F7B A;  4ZDM A;  4OEU A;  3OO8 A;  1FTJ A;  2O1L A;  5H8N A;  4RY1 A;  3PD8 A;  4KPT A;  3TAJ A;  4FE8 A;  2F8D A;  1RYO A;  4QFL A;  4BLA A;  3I6V A;  1IXI A;  1S7Y A;  3LSL A;  3CFZ A;  3PMX A;  1VSO A;  4KCD A;  3BFT A;  4R2F A;  1JVX A;  1T0K A;  3AXF A;  1MY1 A;  1RYX A;  1I6Q A;  3O97 A;  2DVC A;  1CB6 A;  3SKP A;  4R6H A;  3VVE A;  4NWD A;  4QFO A;  2Z22 A;  1ZJL A;  3TQW A;  4IO6 A;  1D4N A;  5L9M A;  1NH8 A;  2CZL A;  5H8Q B;  3RN8 A;  2PT1 A;  1B58 A;  1Y3N A;  4QFK A;  2I0B A;  3O6G A;  1H44 A;  3V89 B;  2V84 A;  3FIR A;  1N04 A;  3SEV A;  5AA2 A;  4R74 A;  4LZ7 A;  1TFD A;  1ATG A;  4RNS A;  3OOA A;  4G68 C;  4NF5 B;  1WOD A;  4JSD A;  4EDP A;  1SD3 A;  3EF7 A;  4H65 A;  3IB0 A;  4OFJ A;  1H3D A;  5I59 A;  5TPA B;  4MFI A;  3MPK A;  1UIU A;  2AIX A;  2F7C A;  3K2D A;  1SVX B;  2QSX A;  3Q29 A;  2RC7 A;  4M4G A;  1TWY A;  4AB5 A;  5EYF A;  5JEI A;  2XXH A;  1FCK A;  1DTG A;  4GXS B;  1B51 A;  3EPE A;  1B46 A;  2VD2 A;  4ECF A;  2F78 A;  3Q27 A;  5H8F B;  3KFM A;  1MM7 A;  3C4M A;  4G68 A;  4ONY A;  2Z23 A;  4XTC Q;  3KN8 A;  5DVI A;  2V3Q A;  3MW0 A;  3S9E A;  2P1S A;  2OBG A;  2RC9 A;  2X7P A;  2P0S A;  3B7D A;  4OQO A;  2XX7 A;  4EQ7 A;  1USY H;  3TOD A;  4YB7 A;  5AE4 A;  1JEV A;  3ZS6 A;  3FV1 A;  4ISU A;  1H76 A;  2VOZ A;  5HM4 B;  4TOZ A;  1OLC A;  2XD3 A;  3OO7 A;  3PPP A;  3FVN A;  4FEC A;  1NMU A;  2XXY A;  2O6A A;  2H5Y A;  4YMB A;  5F1Q A;  5EHS A;  4IGR A;  4F1U A;  3OO6 A;  2UYE A;  5KDT B;  4OYV A;  3T9H B;  1LBB A;  3TTN A;  4BDN A;  2DS9 A;  4C0R A;  3T9U A;  3G3K A;  3TPA A;  3B6T A;  3H4Z A;  1ZU0 A;  4DCY A;  1SW4 A;  4IO5 A;  4XKN A;  1D9Y A;  2YJP A;  3LUY A;  1MQI A;  2HEU A;  3MAM A;  4H6D A;  4KI0 E;  1MDP 1;  4FAJ A;  1N3W A;  2I3W A;  3M8U A;  1JNF A;  2QS1 A;  4U1O A;  3N26 A;  1OQG A;  1GV8 A;  1B4Z A;  1US4 A;  3IL1 B;  4PE5 B;  1S9T A;  4I8C A;  3SES A;  3ZKK A;  4OZ9 A;  2I4B A;  4LUB A;  1QUK A;  3IB1 A;  1B3G A;  3EHT A;  3IOU A;  3C9H A;  4OER A;  3ILT B;  3G3G A;  3TTR A;  3VLU A;  3GBA A;  2A5T A;  3K1M A;  3E9X A;  3UA8 A;  4PET A;  4OMB A;  1QW0 A;  2F97 A;  3CFL A;  4R72 A;  1FTK A;  1UQW A;  2W7Y A;  5LOM A;  4JWO A;  4JB7 A;  3Q28 A;  1UTB B;  3F11 A;  3C31 A;  3EQ1 A;  4N13 A;  2GRV A;  4NF5 A;  4R6K A;  4AB6 A;  2FA7 A;  3FXR A;  3FD3 A;  1B32 A;  1LCF A;  1MXV A;  5TPA A;  1B3E A;  1BIY A;  4JSO A;  1Y1M A;  2ONS A;  1FQA A;  2DXR A;  3QUF A;  4ZEC A;  4X48 A;  2DWH A;  3B6W A;  3M3L A;  2RC8 A;  4K3F A;  1FQB A;  5I58 B;  2OLB A;  2Y7P A;  4N6P A;  3C35 A;  4P0I A;  2ZYK A;  2Q8J A;  4MBP A;  4NF8 A;  5JK4 A;  4O3B A;  3S9M C;  2FYI A;  1FTO A;  2XXW A;  3OSR A;  4IGT A;  2DYX A;  2O68 A;  1M5D A;  1XC1 A;  4F39 A;  4NF6 B;  5CMK A;  1LGB C;  2ZNS A;  2GFE A;  1UTH A;  4OTE A;  3RNN A;  2HZK A;  3CG3 A;  4ZED A;  2Q9T A;  1M5E A;  1ZLQ A;  3UK4 A;  4ZS9 A;  3C33 A;  3SEX A;  1SW1 A;  3O2A A;  3IOW A;  4ZE9 A;  3ONM A;  1P1O A;  4YB6 A;  3SEU A;  1B9J A;  2HFB A;  2DWJ A;  4UAC A;  1IUD A;  2F5X A;  5B7D A;  4GFR A;  1MH3 A;  3QK6 A;  2OZZ A;  1S50 A;  4JXI A;  3G3J A;  3HCQ A;  1WDN A;  5I2N B;  2IEE A;  1MXU A;  2V93 A;  4F1V A;  1MQJ A;  1P1W A;  1WVJ A;  1NFT A;  5AA1 A;  1Q35 A;  3VE1 B;  5K2X A;  1DTZ A;  4LA9 A;  3KOT A;  3S2V A;  1QUJ A;  4YAH X;  1FQF A;  4GL8 A;  3CRB A;  4XKR A;  4LON B;  2PYY A;  4OFO A;  3PPO A;  3EHU A;  1Y3Q A;  4OHN A;  1B52 A;  4H67 A;  1B40 A;  2Q88 A;  1MPB A;  1BKA A;  1MDQ A;  1MPC A;  2IA4 A;  4NED A;  2HQ0 A;  3U92 A;  4G4P A;  1MXY A;  1UTB A;  3TQL A;  2Y84 A;  1BLF A;  1D3K A;  2XHD A;  3KZG A;  1LAX A;  3CSG A;  1O63 A;  4DE8 A;  1MQH A;  1ELJ A;  3MPL A;  4I1D A;  4DZ1 A;  2XXV A;  4G8H A;  3CVG A;  4YU0 A;  4OWD A;  1JQF A;  5I2K B;  1FQD A;  3MZB A;  2OWT A;  3ECR A;  3BBR A;  3K1N A;  3ZSF A;  1LST A;  3FXQ A;  1TXF A;  4O3C A;  4ESX A;  2B3F A;  1MG1 A;  1P1Q A;  3IJO B;  5I58 A;  3TEL A;  1SI0 A;  1SYI A;  4U22 A;  4Q0C A;  3L6H A;  3MVZ A;  3KJ7 A;  3R26 A;  3WAE A;  1US5 A;  4HS7 A;  3A09 A;  1QVS A;  5ICQ A;  1EZ9 A;  3H3G A;  3GXA A;  4IO3 A;  1O64 A;  3O9P A;  3LSW A;  4QF9 A;  3M3F A;  4THI A;  3FVK A;  4PFW A;  5TU0 A;  4WEP A;  4BDR A;  1NNK A;  1URS A;  1NNP A;  2XXX A;  1FQE A;  3H7M A;  2X26 A;  3A3U A;  2THI A;  3T66 A;  4U4X A;  4U21 A;  3U94 A;  4YMA A;  1R9L A;  4G8N A;  3EN3 A;  3D4C A;  3BFU A;  3H6T A;  1GVC A;  4P0G A;  2O1M A;  4UA8 A;  3PUY E;  4XKP A;  1MH4 A;  4LP2 B;  3FJ7 A;  4I9D A;  3OMB A;  3HPI A;  2REJ A;  1OMP A;  4XKQ A;  1LFH A;  2HXW A;  4ZEF A;  1OLA A;  1N84 A;  3LSF B;  2G93 A;  1SYH A;  3THI A;  1QJM A;  3N6U A;  1DPP A;  1N0T A;  3KSX A;  4IO2 A;  3H6U A;  3KG2 A;  1DSN A;  1O7T A;  1TT1 A;  1NNT A;  1LCT A;  3KJT A;  1B1X A;  3DM0 A;  3H6W A;  3G3F A;  4F3G A;  3PUX E;  3O29 A;  3FJG A;  1MXX A;  3LR1 A;  2FNC A;  3OEN A;  4ZE8 A;  5B70 A;  1XS5 A;  4U2R A;  3T93 B;  1H43 A;  3LC8 A;  1POY 1;  5TP9 A;  3P7I A;  3KSJ A;  1QKA A;  1PB9 A;  4E0X A;  3RGY A;  3UP9 A;  2I4C A;  2NUV A;  3FVO A;  1IXH A;  3EHS A;  3R7X A;  4NMY A;  4DXB A;  2ZNT A;  3TDJ A;  4NF4 B;  1NKX A;  4OEV A;  1PC3 A;  3OEM A;  4R75 A;  5DT6 A;  1QKB A;  1B3F A;  3Q26 A;  3TFL A;  1SBP A;  2XX8 A;  3DLN A;  4IB2 A;  4EQB A;  3G7W A;  2F35 A;  2YPN A;  3DEL B;  4QSE A;  5JTY A;  2DE3 A;  3K4U A;  2OJT A;  2V25 A;  3QAX A;  3WAF A;  2ONR A;  3S9L C;  3GLB A;  2D21 A;  3U8Q A;  1OIB A;  2O7U A;  1POT A;  4GWO A;  1Y1Z A;  5DVF A;  1MQD A;  3C34 A;  4GD5 A;  4EXL A;  5I56 B;  3TMG A;  3DP8 A;  2REG A;  1B4H A;  1AH5 A;  5I84 A;  1MY0 A;  2Z8E A;  3KN7 A;  5AA2 D;  3E13 X;  2ZYN A;  1XVY A;  4LZ8 A;  1XOC A;  4E0W A;  1N3X A;  3TCF A;  4H5G A;  1Y4T A;  2NWJ A;  2O69 A;  1F9B A;  4DCX A;  1B1H A;  3HHF A;  3H6V A;  5AA3 A;  3TEP A;  3JYR A;  1Y20 A;  1P99 A;  2ZYM A;  5ITO A;  4GRK A;  4I62 A;  2V3T A;  4JBZ A;  3V8X B;  2QS4 A;  3O66 A;  4QFN A;  3G3I A;  5H8Q A;  1R1N A;  3CI8 A;  1DMB A;  1LBC A;  2XXU A;  5EHM A;  5CMB A;  2XXQ A;  3MP6 A;  3VV5 A;  3T22 A;  2P2A A;  1B2H A;  1VR5 A;  2E0S A;  1A7L A;  1P1N A;  3JZJ A;  1MXW A;  3K01 A;  3SEW A;  1A99 A;  1J1N A;  3N6T A;  2Y7K A;  1Z7N E;  2B65 A;  3IR1 A;  5IAI A;  4DLD A;  3RQT A;  2Y7I A;  4RK9 A;  1II5 A;  4H8I A;  2QS3 A;  3UIF A;  4R73 A;  3FAS A;  5KCJ B;  3MZ1 A;  3K1P A;  3E3K A;  4C1T A;  3TTM A;  5ITP A;  1LB8 A;  4BDQ A;  2QL3 A;  1YCJ A;  3IOT A;  2AYS A;  5H8F A;  1QUL A;  3FJM A;  1AMF A;  1XT8 A;  1NNF A;  3IOV A;  4EF1 A;  4GLI A;  4YIC A;  3SER A;  3RUM A;  5H8H B;  2DP8 A;  2XXT A;  3PPQ A;  4F3P A;  4U1Z A;  4L17 A;  3I5O A;  3USD A;  3RTW B;  3VDF A;  1IIW A;  4JWX A;  3LSX A;  4GOT A;  1MY4 A;  5H8N B;  2ESN A;  2ONK E;  2RIN A;  2DSF A;  5KZT A;  3E4R A;  3L6G A;  2E1S A;  5DEX B;  4ELQ A;  4F22 A;  2DWA A;  1SQY A;  3QSL A;  1B0L A;  2HAU A;  5DYH A;  4YKI A;  2YLN A;  2ZNU A;  3W15 C;  5KDT A;  1R9Q A;  3MVW A;  4PFT A;  3K6W A;  2UVI A;  3K02 A;  4LQ2 A;  1IEJ A;  3O6I A;  3U93 A;  4U23 A;  3QUJ A;  4MH5 A;  1RKM A;  2QMX A;  4HCW A;  1Y4C A;  3MJN A;  2AL4 A;  3OEK A;  1PB7 A;  1FTM A;  3FV2 A;  4P11 A;  4LZ5 A;  1SDX A;  4Z0I A;  5AA2 B;  5I56 A;  1P1U A;  1N7W A;  1MPD A;  1A40 A;  4DIG A;  2UVH A;  2ZYO A;  3HST A;  2H99 A;  3PMV A;  3TUS A;  1EZO A;  1IXG A;  2I58 A;  1M5B A;  4KD5 A;  1GTK A;  3T96 B;  1IIT A;  4FOR A;  1FTL A;  2OK2 A;  3K0V A;  4HW8 A;  2GHA A;  1OVB A;  1IXC A;  1XVX A;  5L9O A;  1GGG A;  2HZL A;  3CSB A;  5H8S A;  5CC2 A;  1SW2 A;  4Q8R A;  4G68 B;  2Q2C A;  2RKM A;  2R9J A;  4RYA A;  4F1Y A;  4NE4 A;  5L8D A;  5FHN A;  1YTV A;  3VVF A;  2ABH A;  3ZKL A;  3RY3 A;  3IO6 A;  3MQ9 A;  2HAV A;  4IO7 A;  3FXU A;  4ZEI A;  5IKB A;  1KWH A;  2XD2 A;  3S9N C;  2F6G A;  5HPQ A;  4G77 A;  4KCC A;  3UN6 A;  2KLF A;  4RPN A;  1B7U A;  1B5H A;  4TQU Q;  2I3V A;  1A8F A;  2G29 A;  4F18 A;  3UGW A;  3D4G A;  2X7Q A;  1ZTY A;  1L5T A;  5KCJ A;  3OSQ A;  1ANF A;  5CI5 A;  3QIM A;  4Z7E A;  1B6H A;  2VD3 A;  2OCU A;  2O84 X;  3O28 A;  3CFX A;  5FHM A;  2QMW A;  1B7H A;  4PP0 A;  3KGC A;  4PFY A;  1LAH E;  2PT2 A;  3KBR A;  3N5L A;  3BKI B;  5H8H A;  4KHZ E;  3MC2 A;  3KEI A;  4ELP A;  3B6Q A;  4NTL A;  1N7X A;  4PQJ A;  3OD7 A;  3LBS A;  3VXB A;  4MLQ A;  4ZZE A;  4YKJ A;  1MRP A;  1EU8 A;  4TLM B;  4DXU A;  4RXL A;  1MY2 A;  2DE4 A;  4NF6 A;  2DVZ A;  4R9G A;  1AIV A;  1JEU A;  1R6Z A;  1ZKB A;  4JWY A;  3QXM A;  5CMC A;  1LB9 A;  3K6X A;  1UIV A;  3FZV A;  2I0C A;  4XIG Q;  2QS2 A;  4MLV A;  5DEX A;  3VFJ A;  1JW5 A;  4XXU A;  4FED A;  1VFD A;  3HV1 A;  2PX1 A;  5DTB A;  4LAT A;  3QYT A;  2F34 A;  3PU5 A;  1H45 A;  2XXR A;  4TLL B;  2A5T B;  4GXA A; 
#chains in the Genus database with same CATH topology
 4RA1 A;  3DP6 A;  4FBP A;  1PBQ A;  2V4C A;  2O7I A;  1XI6 A;  4GBW A;  1D9V A;  2RCA A;  3CR9 A;  5ISU A;  2Q2A A;  2DWI A;  3OEL A;  4X1B A;  1JW4 A;  4OES A;  3K00 A;  5K2Y A;  2WKY A;  1IMA A;  1VDW A;  1LFI A;  3TZA A;  1PEB A;  3C36 A;  5I2N A;  3UOR A;  4GF8 A;  4F3S A;  4OET A;  2UVG A;  4LN5 A;  1MXZ A;  5L9S A;  2D3I A;  4HTG A;  5J1D A;  4ZZA A;  4HCY A;  3W9W A;  3SET A;  5CMM A;  3IOR A;  1EH3 A;  3MST A;  4WED A;  4FJP A;  4OVJ A;  4N07 A;  3VLV A;  1ZMG A;  2ZZV A;  1K9Y A;  4OVP A;  4F31 B;  4P56 A;  5CM6 A;  2DOJ A;  1AL3 A;  5F24 A;  1Y3P A;  5DVJ A;  3IO4 A;  4POX A;  4R9F A;  1OVT A;  3TKD A;  1USY E;  3SEY A;  2UXA A;  3MWB A;  4XFE A;  3RTF B;  5AA4 B;  4NF8 B;  2CZK A;  3GZG A;  2XXI A;  5ET5 A;  1ZBM A;  4GWW A;  3VLW A;  2CMO A;  2QFL A;  5CBR A;  4PTK A;  4FAT A;  1Y9U A;  5F7V A;  3U72 A;  3DP4 A;  3PGF A;  4X1D A;  3M3K A;  1UTH B;  3LV0 A;  4F19 A;  3VVD A;  3I3V A;  5FBP A;  1FBH A;  4RJZ A;  2M8C A;  3GYY A;  5I2K A;  3GBB A;  1M5F A;  4NWC A;  4FIM A;  4YZZ A;  3KN3 A;  2Y7W A;  4QRZ A;  2OWS A;  3PPR A;  1PBP A;  2NVU B;  2NXO A;  3IK6 B;  1K9Z A;  3Q25 A;  1RDY A;  3OXN A;  1A54 A;  4Q5T A;  3TTL A;  4DXC A;  3MVX A;  4JVD A;  4C1U A;  3RT6 B;  4BDO A;  1IMB A;  3R6U A;  2H9B A;  2ALU A;  2XXP A;  4WKM A;  1B7Z A;  1DPE A;  4GWZ A;  1NV1 A;  1JVY A;  3U1O A;  3FGS A;  3HN0 A;  3TTK A;  1MQG A;  1JP4 A;  2R6G E;  4YKK A;  3O6H A;  1YPN A;  3MVY A;  1LBV A;  4QXD A;  3FBP A;  4EXK A;  2H4I A;  4QHQ A;  1NH7 A;  1LAG E;  1XHY A;  5FTI A;  4ZEB A;  1B3H A;  1MY3 A;  2AL5 A;  4POW A;  3V5A A;  3T9X B;  2GHB A;  2NOO A;  2OX3 A;  3FUZ A;  4MAG A;  1GR2 A;  4GQO A;  5A5X B;  3K6U A;  2VGQ A;  3MP1 A;  3IAZ A;  4AQ4 A;  4F2Q A;  2Z8F A;  4OFL A;  3FAT A;  4PBQ A;  1I6A A;  1VE4 A;  2VPO A;  2VHA A;  2QPQ A;  4NAP A;  2I6E A;  2ZZW A;  4O7I A;  5T3J A;  3CIJ A;  1HSJ A;  1RDZ A;  2ZMB A;  4U4S A;  1AOV A;  4DI3 D;  4H1X A;  2F36 A;  2LAO A;  4OXV A;  4RPO A;  1LFG A;  4O94 A;  2ANJ A;  4ZEK A;  4OEN A;  3MYU A;  5EYG A;  4JDF A;  1PB8 A;  3TYH A;  1LBX A;  1I6B A;  1AWB A;  2UVJ A;  4X8R A;  3RT8 A;  4ND9 A;  4R6Y A;  3MZ9 A;  5ICT A;  4QSC A;  2PFZ A;  1HSL A;  2H25 A;  1BP5 A;  2Y7R A;  3S4U A;  2DE2 A;  5I57 B;  5FHO A;  1IZ1 A;  4IR8 A;  3VXC A;  3MUQ A;  1B3L A;  2F6P A;  2I49 A;  2ZXT A;  4H0W A;  4PAI A;  3FVG A;  1B0H A;  2HPG A;  1IMD A;  1BTJ A;  2XX9 A;  4H45 A;  1B05 A;  2Z8D A;  3SDF A;  3H06 B;  4NF4 A;  2RF1 A;  3CG1 A;  5AA4 A;  5ELV A;  3KC1 A;  4Q30 B;  2Q8M A;  4BDL A;  2UYF A;  5CBS A;  4P1L A;  4MIJ A;  4PC9 A;  3KOS A;  4EUO A;  1DK4 A;  3LUZ A;  3N94 A;  4LVQ A;  2R71 A;  4P47 A;  2DQV A;  4BDM A;  4QFP A;  3PUW E;  4N8Y A;  4PFU A;  1NUX A;  4H8J A;  1G0H A;  4GVO A;  4KQP A;  4FEB A;  2QRY A;  3G3H A;  2PVU A;  4RK2 A;  2PBW A;  1M5C A;  2BJJ X;  5BWJ A;  2CZI A;  4MX6 A;  4KFQ A;  3K6V A;  4ELR A;  1PDA A;  3PD9 A;  4G8M A;  4ESW A;  1IQ7 A;  3PV0 E;  4N6D A;  4YKP A;  4EF2 A;  1OQH A;  4O3A A;  1LLS A;  1FW0 A;  1LAF E;  2Q74 A;  4GIZ A;  4LQ5 A;  1FQC A;  2QJE A;  2PCR A;  4GL0 A;  4F2O A;  5ESY A;  1B5J A;  3TCH A;  1FBE A;  1Q1K A;  3RPW A;  3QMF A;  2D5W A;  3HHG A;  3IJX B;  3A3C A;  1RDX A;  2CZH A;  3JV9 A;  4WXJ A;  3T9V A;  4NQ8 A;  5I59 B;  2I48 A;  4MF3 A;  1MM6 A;  4QSD A;  2PMS A;  3ODB A;  1JW1 A;  4KYE A;  2VP1 A;  1MS7 A;  4IY6 A;  4IO4 A;  5CRY A;  1N76 A;  1QUI A;  4DDD A;  4EQ9 A;  3PUZ E;  4X9T A;  5ET8 A;  3V83 A;  1NL5 A;  3HO7 A;  4M1V A;  1Z7M E;  4YB5 A;  3IB2 A;  4PBH A;  3PMW A;  1EZP A;  3ILU B;  1B5I A;  4IY5 A;  5BUU A;  1KA1 A;  3MBP A;  1DOT A;  5HBC A;  2KQZ A;  4H5F A;  2HCA A;  1A55 A;  3ISP A;  5TP9 B;  4KR5 A;  3PPN A;  1VFE A;  3E78 A;  2F7A A;  4KYD A;  1SI1 A;  4F3B A;  4F29 A;  5A5X A;  4GWS A;  2DXY A;  2GH9 A;  5M2V A;  3RPL B;  2O51 A;  3RLF E;  3TCG A;  4ELO A;  4PGN A;  2B3B A;  1URD A;  1ZIU A;  1JET A;  2B4L A;  1CNQ A;  1A8E A;  2H98 A;  2A5S A;  1URG A;  2RCB A;  1YAE A;  4R2B A;  3W9V A;  1TFA A;  1HSE A;  4OAN A;  1SW5 A;  3C32 A;  4KYS A;  3MP8 A;  2Q89 A;  5JTY B;  2V3U A;  3PUV E;  3IX1 A;  3H03 A;  1NUY A;  4HXV A;  2WBD A;  3OO9 A;  5FTH A;  1I69 A;  1CE2 A;  5I57 A;  4G2Z A;  2F7B A;  4ZDM A;  4OEU A;  4JVC A;  1LBW A;  4AS4 A;  4XEQ A;  3OO8 A;  1FTJ A;  2O1L A;  5H8N A;  4RY1 A;  2FIE A;  3PD8 A;  4KPT A;  2XA5 A;  3TAJ A;  4FE8 A;  2F8D A;  1RYO A;  4QFL A;  2ZZX A;  4GX3 A;  5LDZ A;  4BLA A;  3I6V A;  1IXI A;  1S7Y A;  3LSL A;  3CFZ A;  3SZP A;  3T0J A;  3PMX A;  1VSO A;  4HE1 A;  4KCD A;  3BFT A;  4R2F A;  1NUW A;  1JVX A;  1T0K A;  3AXF A;  1MY1 A;  1RYX A;  1I6Q A;  3O97 A;  2XWO A;  2DVC A;  1CB6 A;  4NGU A;  3SKP A;  4R6H A;  2WX9 A;  3VVE A;  1LBZ A;  4NWD A;  4QFO A;  2Z22 A;  1ZJL A;  3TQW A;  4IO6 A;  2XWV A;  1D4N A;  5L9M A;  5IGA A;  4AS5 A;  1NH8 A;  2CZL A;  2QVR A;  5H8Q B;  3RN8 A;  2PT1 A;  1B58 A;  1Y3N A;  1SPI A;  4QFK A;  2I0B A;  3O6G A;  1H44 A;  5I7I A;  4N8G A;  3V89 B;  2V84 A;  3FIR A;  1N04 A;  3SEV A;  5AA2 A;  4R74 A;  4LZ7 A;  1TFD A;  1ATG A;  4RNS A;  3OOA A;  4G68 C;  4NF5 B;  1WOD A;  4JSD A;  4EDP A;  1SD3 A;  3EF7 A;  4H65 A;  3IB0 A;  4OFJ A;  1H3D A;  3CHG A;  5I59 A;  5TPA B;  4MFI A;  3MPK A;  1UIU A;  2AIX A;  2F7C A;  3K2D A;  1SVX B;  1FPG A;  2QSX A;  3Q29 A;  2RC7 A;  4M4G A;  1TWY A;  5DW8 A;  4AB5 A;  5EYF A;  5JEI A;  2XXH A;  1FCK A;  1DTG A;  4GXS B;  1IME A;  2B4M A;  1B51 A;  1KZ8 A;  3EPE A;  3T1B A;  1B46 A;  2VD2 A;  4ECF A;  2F78 A;  3Q27 A;  5H8F B;  3KFM A;  1MM7 A;  3C4M A;  4G68 A;  4ONY A;  2Z23 A;  1FBG A;  1FPI A;  4XTC Q;  3KN8 A;  5DVI A;  2V3Q A;  3MW0 A;  3S9E A;  2WBB A;  2P1S A;  2OBG A;  2RC9 A;  4PAF A;  2L5V A;  5IZ3 B;  2X7P A;  2P0S A;  3B7D A;  2QVU A;  4NN3 A;  4OQO A;  5I3S A;  2XX7 A;  4EQ7 A;  1USY H;  3TOD A;  4YB7 A;  5AE4 A;  2HXR A;  2OWZ A;  3B8B A;  1JEV A;  3ZS6 A;  3FV1 A;  4ISU A;  1H76 A;  2VOZ A;  5HM4 B;  4TOZ A;  1OLC A;  4X04 A;  2XD3 A;  3OO7 A;  3PPP A;  3FVN A;  4FEC A;  1NMU A;  2XXY A;  2O6A A;  2H5Y A;  4YMB A;  5F1Q A;  5EHS A;  4IGR A;  4F1U A;  3OO6 A;  2UYE A;  5KDT B;  4OYV A;  3T9H B;  1LBB A;  3TTN A;  4BDN A;  2DS9 A;  4MEV A;  4C0R A;  1DBZ A;  3T9U A;  3G3K A;  4G61 A;  3TPA A;  3B6T A;  3H4Z A;  1ZU0 A;  4DCY A;  1FBD A;  1SW4 A;  1FBC A;  4IO5 A;  4XKN A;  1D9Y A;  2YJP A;  3LUY A;  4GWU A;  4H46 A;  1MQI A;  2HEU A;  4GWX A;  3MAM A;  4H6D A;  1FPD A;  4KI0 E;  3ROJ A;  1MDP 1;  4FAJ A;  1N3W A;  2I3W A;  3M8U A;  1JNF A;  4N6K A;  2QS1 A;  4U1O A;  3N26 A;  1OQG A;  1NV0 A;  1GV8 A;  1B4Z A;  1US4 A;  3IL1 B;  4PE5 B;  4OVQ A;  1S9T A;  4I8C A;  3SES A;  3ZKK A;  4OZ9 A;  2I4B A;  4LUB A;  1QUK A;  3IB1 A;  1B3G A;  3EHT A;  3IOU A;  3C9H A;  4OER A;  4PDH A;  3ILT B;  3G3G A;  4HE0 A;  3TTR A;  3GBA A;  3VLU A;  5IZZ A;  2A5T A;  3K1M A;  3E9X A;  3UA8 A;  4PET A;  4OMB A;  1QW0 A;  2F97 A;  3CFL A;  4R72 A;  1FTK A;  1UQW A;  2W7Y A;  5LOM A;  4JWO A;  4JB7 A;  3Q28 A;  1UTB B;  3F11 A;  3C31 A;  1NV3 A;  3EQ1 A;  4N13 A;  2GRV A;  4NF5 A;  4R6K A;  4AB6 A;  2FA7 A;  1INP A;  3FXR A;  3FD3 A;  2BJI A;  1B32 A;  1LCF A;  1MXV A;  5TPA A;  1FPB A;  1B3E A;  1BIY A;  4JSO A;  1Y1M A;  2ONS A;  1FQA A;  2DXR A;  3QUF A;  4ZEC A;  4X48 A;  2DWH A;  3B6W A;  3M3L A;  4K3F A;  2RC8 A;  1FQB A;  5I58 B;  2OLB A;  2Y7P A;  4N6P A;  3C35 A;  4P0I A;  2ZYK A;  3HFU A;  4I3Y A;  2Q8J A;  4MBP A;  2CEX A;  4NF8 A;  5JK4 A;  4O3B A;  3S9M C;  2FYI A;  1FTO A;  2XXW A;  2PFY A;  3OSR A;  4IGT A;  2DYX A;  2O68 A;  1M5D A;  4P9K A;  1XC1 A;  2Y5K A;  4NF6 B;  4F39 A;  5CMK A;  1LGB C;  2ZNS A;  2GFE A;  1UTH A;  4OTE A;  2P3V A;  3RNN A;  2HZK A;  3CG3 A;  4ZED A;  4OVR A;  4I3E A;  2Q9T A;  1M5E A;  1ZLQ A;  3UK4 A;  4ZS9 A;  3C33 A;  3SEX A;  1D9Q A;  1SW1 A;  3O2A A;  3IOW A;  4ZE9 A;  3ONM A;  2R8T A;  1P1O A;  4YB6 A;  3SEU A;  1FBF A;  1B9J A;  2HFB A;  3RYD A;  4DI4 B;  2DWJ A;  4OA4 A;  4UAC A;  1IUD A;  2F5X A;  5B7D A;  4GFR A;  1MH3 A;  3QK6 A;  2OZZ A;  1S50 A;  4JXI A;  3G3J A;  3HCQ A;  1WDN A;  5I2N B;  2IEE A;  1MXU A;  2V93 A;  4N17 A;  4F1V A;  1MQJ A;  4OVT A;  1P1W A;  1WVJ A;  1NFT A;  3EKI A;  5AA1 A;  1Q35 A;  4O8M A;  3VE1 B;  4PAK A;  5K2X A;  1DTZ A;  1FPF A;  4LA9 A;  3KOT A;  3S2V A;  2VPN A;  1QUJ A;  4YAH X;  1FQF A;  4GL8 A;  3CRB A;  4XKR A;  4LON B;  2PYY A;  4OFO A;  3PPO A;  3EHU A;  1Y3Q A;  3BIH A;  4NG7 A;  4OHN A;  1B52 A;  4H67 A;  5EQA A;  1B40 A;  4MJO A;  2Q88 A;  1MPB A;  1BKA A;  1MDQ A;  3IFC A;  1MPC A;  2IA4 A;  4NED A;  2HQ0 A;  4PE3 A;  3U92 A;  4G4P A;  1MXY A;  5EYH A;  1UTB A;  3TQL A;  2Y84 A;  1BLF A;  1D3K A;  2XHD A;  3KZG A;  2WEF A;  1LAX A;  3CSG A;  1O63 A;  4DE8 A;  1MQH A;  1ELJ A;  3MPL A;  1LEV A;  4I1D A;  4DZ1 A;  4QBA A;  5LTC A;  4PDD A;  2XXV A;  4G8H A;  3CVG A;  4YU0 A;  2Y5L A;  4OWD A;  5EQ9 A;  1JQF A;  5I2K B;  4N81 A;  1FQD A;  3MZB A;  2OWT A;  3ECR A;  3BBR A;  4GX6 A;  4NF0 A;  3K1N A;  3ZSF A;  1LST A;  3FXQ A;  1TXF A;  3KC0 A;  2CEY A;  4O3C A;  2XWI A;  1QGX A;  4ESX A;  2B3F A;  1MG1 A;  1P1Q A;  3IJO B;  5I58 A;  3TEL A;  1SI0 A;  1SYI A;  4U22 A;  4P3L A;  4Q0C A;  3L6H A;  3MVZ A;  3KJ7 A;  1YZ0 A;  3R26 A;  3WAE A;  1US5 A;  4HS7 A;  3A09 A;  1QVS A;  5ICQ A;  1EZ9 A;  3H3G A;  3GXA A;  4IO3 A;  5EQ7 A;  1O64 A;  3O9P A;  3LSW A;  4QF9 A;  3M3F A;  1FPL A;  4THI A;  3FVK A;  4PFW A;  5TU0 A;  4WEP A;  4BDR A;  1NNK A;  1URS A;  1NNP A;  2XXX A;  1FQE A;  3H7M A;  2X26 A;  3A3U A;  2THI A;  4PFR A;  3T66 A;  4U4X A;  4U21 A;  1FPJ A;  3U94 A;  4YMA A;  1R9L A;  2F3B A;  4G8N A;  3EN3 A;  3D4C A;  3BFU A;  3H6T A;  1GVC A;  4P0G A;  4UA8 A;  2O1M A;  1EYI A;  3D1R A;  3PUY E;  4XKP A;  4P8B A;  1MH4 A;  4LP2 B;  3FJ7 A;  4I9D A;  4PFB A;  1FJ6 A;  3OMB A;  3HPI A;  2REJ A;  1OMP A;  4XKQ A;  1LFH A;  2HXW A;  4ZEF A;  1OLA A;  1N84 A;  5IZ1 A;  3LSF B;  2G93 A;  1SYH A;  3THI A;  1FPE A;  1QJM A;  3N6U A;  1YYZ A;  1DPP A;  1N0T A;  3KSX A;  1BK4 A;  4IO2 A;  3H6U A;  3KG2 A;  1DSN A;  1O7T A;  1TT1 A;  1NNT A;  1LCT A;  3KJT A;  1B1X A;  3DM0 A;  3H6W A;  3G3F A;  4F3G A;  3PUX E;  3O29 A;  3FJG A;  4GBV A;  3NOH A;  1MXX A;  3LR1 A;  2FNC A;  3OEN A;  4ZE8 A;  5B70 A;  1XS5 A;  4PF8 A;  4U2R A;  3T93 B;  1H43 A;  3LC8 A;  1POY 1;  5TP9 A;  3P7I A;  3KSJ A;  1QKA A;  1PB9 A;  4E0X A;  3RGY A;  3UP9 A;  2WYP A;  4MHF A;  2I4C A;  2NUV A;  3FVO A;  1IXH A;  3EHS A;  3RPL A;  3R7X A;  4NMY A;  4DXB A;  2ZNT A;  3TDJ A;  4NF4 B;  5J16 A;  1NKX A;  4OEV A;  1PC3 A;  3OEM A;  3E79 A;  4R75 A;  5DT6 A;  2XWK A;  4JVI A;  1QKB A;  1KA0 A;  2WYK A;  1B3F A;  4MNC A;  3Q26 A;  5EQ8 A;  3TFL A;  1SBP A;  2XX8 A;  1IMC A;  3DLN A;  4IB2 A;  4EQB A;  3G7W A;  2F35 A;  2YPN A;  4NX1 A;  3DEL B;  4QSE A;  5JTY A;  2DE3 A;  3K4U A;  2OJT A;  1G0I A;  2V25 A;  3QAX A;  1NV6 A;  3WAF A;  2ONR A;  3S9L C;  3GLB A;  2D21 A;  3U8Q A;  1OIB A;  2O7U A;  1POT A;  1FBP A;  4GWO A;  1Y1Z A;  5DVF A;  1MQD A;  3C34 A;  4GD5 A;  4XF5 A;  4EXL A;  5I56 B;  3TMG A;  3DP8 A;  2REG A;  1B4H A;  1AH5 A;  5I84 A;  1MY0 A;  2Z8E A;  3KN7 A;  5AA2 D;  3E13 X;  2ZYN A;  1XVY A;  4LZ8 A;  2P3N A;  1XOC A;  4E0W A;  1N3X A;  3TCF A;  4H5G A;  1Y4T A;  2HHM A;  2NWJ A;  2O69 A;  1F9B A;  1FSA A;  4DCX A;  1B1H A;  3HHF A;  3H6V A;  4MNP A;  5AA3 A;  3TEP A;  3JYR A;  1Y20 A;  4N91 A;  1P99 A;  2ZYM A;  5ITO A;  4GRK A;  4I62 A;  2V3T A;  1IMF A;  4JBZ A;  3V8X B;  2QS4 A;  3O66 A;  2KR0 A;  4QFN A;  3G3I A;  5H8Q A;  1R1N A;  3CI8 A;  4MMP A;  1DMB A;  1LBC A;  2XXU A;  5EHM A;  5CMB A;  2XXQ A;  4I40 A;  3MP6 A;  3VV5 A;  1YXI A;  2QVV A;  4P1E A;  3U65 A;  3T22 A;  2P2A A;  1B2H A;  1VR5 A;  2E0S A;  1A7L A;  1FJ9 A;  1P1N A;  3JZJ A;  1MXW A;  3K01 A;  3SEW A;  1A99 A;  4PF6 A;  1J1N A;  3N6T A;  2Y7K A;  2XXK A;  1Z7N E;  2B65 A;  3IR1 A;  5IAI A;  4DLD A;  3RQT A;  1NV2 A;  2Y7I A;  4RK9 A;  1II5 A;  4H8I A;  2QS3 A;  3UIF A;  4R73 A;  3FAS A;  5KCJ B;  3MZ1 A;  3K1P A;  3E3K A;  4C1T A;  3TTM A;  5ITP A;  1LB8 A;  4BDQ A;  2QL3 A;  1YCJ A;  3IOT A;  2AYS A;  5ET6 A;  5H8F A;  1QUL A;  3FJM A;  1AMF A;  4HE2 A;  1XT8 A;  1NNF A;  3IOV A;  4EF1 A;  4GLI A;  4YIC A;  3SER A;  3RUM A;  5H8H B;  2MKZ A;  2DP8 A;  5IZ3 A;  2XXT A;  3PPQ A;  4F3P A;  4U1Z A;  4L17 A;  3I5O A;  1EYJ A;  3USD A;  3RTW B;  3VDF A;  1IIW A;  4JWX A;  4N4U A;  3LSX A;  4GOT A;  1MY4 A;  5H8N B;  2ESN A;  2ONK E;  2RIN A;  2DSF A;  4GX4 A;  5KZT A;  3E4R A;  3L6G A;  2E1S A;  5DEX B;  4ELQ A;  2DWA A;  4F22 A;  1SQY A;  3QSL A;  1B0L A;  2HAU A;  5DYH A;  5ET7 A;  4YKI A;  2YLN A;  2ZNU A;  3W15 C;  5KDT A;  1R9Q A;  1DCU A;  3FXB A;  4PCD A;  3MVW A;  4UAB A;  4PFT A;  3K6W A;  4MCO A;  2UVI A;  3K02 A;  4LQ2 A;  1IEJ A;  3O6I A;  3U93 A;  4U23 A;  3QUJ A;  4MH5 A;  2F3D A;  1RKM A;  2QMX A;  4O7M A;  4HCW A;  1NUZ A;  1Y4C A;  3MJN A;  2AL4 A;  3OEK A;  1PB7 A;  1FTM A;  3FV2 A;  4P11 A;  4LZ5 A;  1SDX A;  4Z0I A;  5AA2 B;  5I56 A;  3PTY A;  3KBZ A;  1P1U A;  1N7W A;  1MPD A;  1A40 A;  4DIG A;  2UVH A;  3A29 A;  2ZYO A;  3HST A;  2H99 A;  3PMV A;  3TUS A;  1EZO A;  1IXG A;  2I58 A;  1M5B A;  2JJK A;  4KD5 A;  1GTK A;  3T96 B;  1IIT A;  4FOR A;  1FTL A;  2OK2 A;  3K0V A;  4HW8 A;  2FVZ A;  2GHA A;  1OVB A;  1IXC A;  1XVX A;  5L9O A;  1GGG A;  2HZL A;  3CSB A;  5H8S A;  5CC2 A;  5IM2 A;  1SW2 A;  1FRP A;  4G68 B;  4Q8R A;  1NV7 A;  2Q2C A;  2RKM A;  2R9J A;  5I5P A;  2VT5 A;  4RYA A;  4F1Y A;  4NE4 A;  5FHN A;  5L8D A;  1YTV A;  3VVF A;  2ABH A;  3ZKL A;  3RY3 A;  3IO6 A;  1Q9D A;  3MQ9 A;  2HAV A;  4IO7 A;  3FXU A;  4ZEI A;  5IKB A;  1KWH A;  2XD2 A;  3S9N C;  4N15 A;  4NHB A;  2F6G A;  5HPQ A;  4G77 A;  4KCC A;  3UN6 A;  2KLF A;  4RPN A;  5A5L A;  1B7U A;  1B5H A;  4TQU Q;  2I3V A;  1A8F A;  2G29 A;  2FIX A;  4F18 A;  3UGW A;  2FHY A;  3D4G A;  2X7Q A;  1ZTY A;  1L5T A;  5KCJ A;  3OSQ A;  1ANF A;  5CI5 A;  3QIM A;  4Z7E A;  1B6H A;  2VD3 A;  4MNI A;  2OCU A;  1EYK A;  2O84 X;  3O28 A;  3CFX A;  5FHM A;  2QMW A;  1B7H A;  4PP0 A;  4PFI A;  3IFA A;  3KGC A;  4PFY A;  1LAH E;  2PT2 A;  3KBR A;  3N5L A;  3BKI B;  5H8H A;  4KHZ E;  1LBY A;  3MC2 A;  3KEI A;  4ELP A;  3B6Q A;  4KXP A;  4NTL A;  1N7X A;  4PQJ A;  3OD7 A;  3LBS A;  3VXB A;  4MLQ A;  2GQ1 A;  4ZZE A;  4YKJ A;  4PGP A;  1MRP A;  1EU8 A;  4TLM B;  4DXU A;  4RXL A;  1MY2 A;  2DE4 A;  4NF6 A;  2DVZ A;  4R9G A;  1AIV A;  4OVS A;  1JEU A;  1FPK A;  1R6Z A;  1ZKB A;  4JWY A;  3QXM A;  5CMC A;  2DDK A;  1LB9 A;  3K6X A;  1UIV A;  1FTA A;  3FZV A;  2I0C A;  4XIG Q;  2QS2 A;  4MLV A;  5DEX A;  3VFJ A;  1JW5 A;  4XXU A;  4FED A;  1VFD A;  2FBP A;  3HV1 A;  2PX1 A;  4GWY A;  1NV4 A;  5DTB A;  4LAT A;  1NV5 A;  3B50 A;  3QYT A;  1NI9 A;  2F34 A;  3PU5 A;  1H45 A;  2XXR A;  4TLL B;  3BIG A;  2A5T B;  4GXA A; 
#chains in the Genus database with same CATH homology
 4RA1 A;  3DP6 A;  1PBQ A;  2O7I A;  1D9V A;  2RCA A;  3CR9 A;  5ISU A;  2Q2A A;  2DWI A;  3OEL A;  4X1B A;  1JW4 A;  4OES A;  3K00 A;  5K2Y A;  2WKY A;  1LFI A;  3TZA A;  1PEB A;  3C36 A;  5I2N A;  3UOR A;  4GF8 A;  4F3S A;  4OET A;  2UVG A;  1MXZ A;  5L9S A;  2D3I A;  4HTG A;  5J1D A;  4ZZA A;  4HCY A;  3W9W A;  3SET A;  5CMM A;  3IOR A;  1EH3 A;  4WED A;  4FJP A;  4OVJ A;  4N07 A;  3VLV A;  1ZMG A;  4F31 B;  5CM6 A;  2DOJ A;  1AL3 A;  1Y3P A;  5DVJ A;  3IO4 A;  4POX A;  4R9F A;  1OVT A;  3TKD A;  1USY E;  3SEY A;  2UXA A;  3MWB A;  3RTF B;  5AA4 B;  4NF8 B;  3GZG A;  2XXI A;  1ZBM A;  3VLW A;  2CMO A;  5CBR A;  4FAT A;  1Y9U A;  5F7V A;  3U72 A;  3DP4 A;  3PGF A;  4X1D A;  3M3K A;  1UTH B;  4F19 A;  3VVD A;  3I3V A;  4RJZ A;  2M8C A;  5I2K A;  3GBB A;  1M5F A;  4NWC A;  4FIM A;  4YZZ A;  3KN3 A;  2Y7W A;  4QRZ A;  2OWS A;  3PPR A;  1PBP A;  2NVU B;  2NXO A;  3IK6 B;  3Q25 A;  3OXN A;  1A54 A;  4Q5T A;  3TTL A;  4DXC A;  3MVX A;  4C1U A;  3RT6 B;  4BDO A;  3R6U A;  2H9B A;  2ALU A;  2XXP A;  4WKM A;  1B7Z A;  1DPE A;  1JVY A;  3U1O A;  3FGS A;  3HN0 A;  3TTK A;  1MQG A;  2R6G E;  4YKK A;  3O6H A;  1YPN A;  3MVY A;  4EXK A;  2H4I A;  4QHQ A;  1NH7 A;  1LAG E;  1XHY A;  5FTI A;  4ZEB A;  1B3H A;  1MY3 A;  2AL5 A;  4POW A;  3V5A A;  3T9X B;  2GHB A;  2NOO A;  3FUZ A;  1GR2 A;  4GQO A;  5A5X B;  3K6U A;  2VGQ A;  3MP1 A;  3IAZ A;  4AQ4 A;  4F2Q A;  2Z8F A;  4OFL A;  3FAT A;  1I6A A;  1VE4 A;  2VHA A;  2QPQ A;  2I6E A;  3CIJ A;  1HSJ A;  2ZMB A;  4U4S A;  1AOV A;  4H1X A;  2F36 A;  2LAO A;  4OXV A;  4RPO A;  1LFG A;  2ANJ A;  4ZEK A;  4OEN A;  4JDF A;  1PB8 A;  3TYH A;  1I6B A;  2UVJ A;  3RT8 A;  4ND9 A;  4R6Y A;  3MZ9 A;  5ICT A;  4QSC A;  1HSL A;  2H25 A;  1BP5 A;  2Y7R A;  3S4U A;  2DE2 A;  5I57 B;  5FHO A;  1IZ1 A;  3VXC A;  3MUQ A;  1B3L A;  2F6P A;  2I49 A;  2ZXT A;  4H0W A;  3FVG A;  1B0H A;  1BTJ A;  2XX9 A;  1B05 A;  2Z8D A;  3SDF A;  3H06 B;  4NF4 A;  2RF1 A;  3CG1 A;  5AA4 A;  5ELV A;  4Q30 B;  4BDL A;  2UYF A;  5CBS A;  3KOS A;  4EUO A;  3N94 A;  4LVQ A;  2R71 A;  2DQV A;  4BDM A;  4QFP A;  3PUW E;  4PFU A;  4H8J A;  4GVO A;  4KQP A;  4FEB A;  2QRY A;  3G3H A;  2PVU A;  4RK2 A;  2PBW A;  1M5C A;  2BJJ X;  5BWJ A;  4KFQ A;  3K6V A;  4ELR A;  1PDA A;  3PD9 A;  4G8M A;  4ESW A;  1IQ7 A;  3PV0 E;  4YKP A;  4EF2 A;  1OQH A;  4O3A A;  1LLS A;  1FW0 A;  1LAF E;  4GIZ A;  4LQ5 A;  1FQC A;  2QJE A;  4GL0 A;  4F2O A;  1B5J A;  3TCH A;  1Q1K A;  3RPW A;  2D5W A;  3HHG A;  3IJX B;  3A3C A;  3JV9 A;  4WXJ A;  3T9V A;  5I59 B;  2I48 A;  4MF3 A;  1MM6 A;  4QSD A;  2PMS A;  3ODB A;  1JW1 A;  4KYE A;  2VP1 A;  1MS7 A;  4IY6 A;  4IO4 A;  5CRY A;  1N76 A;  1QUI A;  4DDD A;  4EQ9 A;  3PUZ E;  4X9T A;  3V83 A;  1NL5 A;  3HO7 A;  4M1V A;  1Z7M E;  4YB5 A;  3IB2 A;  3PMW A;  1EZP A;  3ILU B;  1B5I A;  4IY5 A;  5BUU A;  3MBP A;  1DOT A;  5HBC A;  4H5F A;  2HCA A;  1A55 A;  5TP9 B;  4KR5 A;  3PPN A;  1VFE A;  2F7A A;  4KYD A;  1SI1 A;  4F3B A;  4F29 A;  5A5X A;  2DXY A;  2GH9 A;  5M2V A;  2O51 A;  3RLF E;  3TCG A;  4ELO A;  2B3B A;  1URD A;  1ZIU A;  1JET A;  1A8E A;  2H98 A;  2A5S A;  1URG A;  2RCB A;  1YAE A;  4R2B A;  3W9V A;  1TFA A;  1HSE A;  1SW5 A;  3C32 A;  4KYS A;  3MP8 A;  2Q89 A;  5JTY B;  2V3U A;  3PUV E;  3IX1 A;  3H03 A;  3OO9 A;  5FTH A;  1I69 A;  1CE2 A;  5I57 A;  4G2Z A;  2F7B A;  4ZDM A;  4OEU A;  3OO8 A;  1FTJ A;  2O1L A;  5H8N A;  4RY1 A;  3PD8 A;  4KPT A;  3TAJ A;  4FE8 A;  2F8D A;  1RYO A;  4QFL A;  4BLA A;  3I6V A;  1IXI A;  1S7Y A;  3LSL A;  3CFZ A;  3PMX A;  1VSO A;  4KCD A;  3BFT A;  4R2F A;  1JVX A;  1T0K A;  3AXF A;  1MY1 A;  1RYX A;  1I6Q A;  3O97 A;  2DVC A;  1CB6 A;  3SKP A;  4R6H A;  3VVE A;  4NWD A;  4QFO A;  2Z22 A;  1ZJL A;  3TQW A;  4IO6 A;  1D4N A;  5L9M A;  1NH8 A;  2CZL A;  5H8Q B;  3RN8 A;  2PT1 A;  1B58 A;  1Y3N A;  4QFK A;  2I0B A;  3O6G A;  1H44 A;  3V89 B;  2V84 A;  3FIR A;  1N04 A;  3SEV A;  5AA2 A;  4R74 A;  4LZ7 A;  1TFD A;  1ATG A;  4RNS A;  3OOA A;  4G68 C;  4NF5 B;  1WOD A;  4JSD A;  4EDP A;  1SD3 A;  3EF7 A;  4H65 A;  3IB0 A;  4OFJ A;  1H3D A;  5I59 A;  5TPA B;  4MFI A;  3MPK A;  1UIU A;  2AIX A;  2F7C A;  3K2D A;  1SVX B;  2QSX A;  3Q29 A;  2RC7 A;  4M4G A;  1TWY A;  4AB5 A;  5EYF A;  5JEI A;  2XXH A;  1FCK A;  1DTG A;  4GXS B;  1B51 A;  3EPE A;  1B46 A;  2VD2 A;  4ECF A;  2F78 A;  3Q27 A;  5H8F B;  3KFM A;  1MM7 A;  3C4M A;  4G68 A;  4ONY A;  2Z23 A;  4XTC Q;  3KN8 A;  5DVI A;  2V3Q A;  3MW0 A;  3S9E A;  2P1S A;  2OBG A;  2RC9 A;  2X7P A;  2P0S A;  3B7D A;  4OQO A;  2XX7 A;  4EQ7 A;  1USY H;  3TOD A;  4YB7 A;  5AE4 A;  1JEV A;  3ZS6 A;  3FV1 A;  4ISU A;  1H76 A;  2VOZ A;  5HM4 B;  4TOZ A;  1OLC A;  2XD3 A;  3OO7 A;  3PPP A;  3FVN A;  4FEC A;  1NMU A;  2XXY A;  2O6A A;  2H5Y A;  4YMB A;  5F1Q A;  5EHS A;  4IGR A;  4F1U A;  3OO6 A;  2UYE A;  5KDT B;  4OYV A;  3T9H B;  1LBB A;  3TTN A;  4BDN A;  2DS9 A;  4C0R A;  3T9U A;  3G3K A;  3TPA A;  3B6T A;  3H4Z A;  1ZU0 A;  4DCY A;  1SW4 A;  4IO5 A;  4XKN A;  1D9Y A;  2YJP A;  3LUY A;  1MQI A;  2HEU A;  3MAM A;  4H6D A;  4KI0 E;  1MDP 1;  4FAJ A;  1N3W A;  2I3W A;  3M8U A;  1JNF A;  2QS1 A;  4U1O A;  3N26 A;  1OQG A;  1GV8 A;  1B4Z A;  1US4 A;  3IL1 B;  4PE5 B;  1S9T A;  4I8C A;  3SES A;  3ZKK A;  4OZ9 A;  2I4B A;  4LUB A;  1QUK A;  3IB1 A;  1B3G A;  3EHT A;  3IOU A;  3C9H A;  4OER A;  3ILT B;  3G3G A;  3TTR A;  3VLU A;  3GBA A;  2A5T A;  3K1M A;  3E9X A;  3UA8 A;  4PET A;  4OMB A;  1QW0 A;  2F97 A;  3CFL A;  4R72 A;  1FTK A;  1UQW A;  2W7Y A;  5LOM A;  4JWO A;  4JB7 A;  3Q28 A;  1UTB B;  3F11 A;  3C31 A;  3EQ1 A;  4N13 A;  2GRV A;  4NF5 A;  4R6K A;  4AB6 A;  2FA7 A;  3FXR A;  3FD3 A;  1B32 A;  1LCF A;  1MXV A;  5TPA A;  1B3E A;  1BIY A;  4JSO A;  1Y1M A;  2ONS A;  1FQA A;  2DXR A;  3QUF A;  4ZEC A;  4X48 A;  2DWH A;  3B6W A;  3M3L A;  2RC8 A;  4K3F A;  1FQB A;  5I58 B;  2OLB A;  2Y7P A;  4N6P A;  3C35 A;  4P0I A;  2ZYK A;  2Q8J A;  4MBP A;  4NF8 A;  5JK4 A;  4O3B A;  3S9M C;  2FYI A;  1FTO A;  2XXW A;  3OSR A;  4IGT A;  2DYX A;  2O68 A;  1M5D A;  1XC1 A;  4F39 A;  4NF6 B;  5CMK A;  1LGB C;  2ZNS A;  2GFE A;  1UTH A;  4OTE A;  3RNN A;  2HZK A;  3CG3 A;  4ZED A;  2Q9T A;  1M5E A;  1ZLQ A;  3UK4 A;  4ZS9 A;  3C33 A;  3SEX A;  1SW1 A;  3O2A A;  3IOW A;  4ZE9 A;  3ONM A;  1P1O A;  4YB6 A;  3SEU A;  1B9J A;  2HFB A;  2DWJ A;  4UAC A;  1IUD A;  2F5X A;  5B7D A;  4GFR A;  1MH3 A;  3QK6 A;  2OZZ A;  1S50 A;  4JXI A;  3G3J A;  3HCQ A;  1WDN A;  5I2N B;  2IEE A;  1MXU A;  2V93 A;  4F1V A;  1MQJ A;  1P1W A;  1WVJ A;  1NFT A;  5AA1 A;  1Q35 A;  3VE1 B;  5K2X A;  1DTZ A;  4LA9 A;  3KOT A;  3S2V A;  1QUJ A;  4YAH X;  1FQF A;  4GL8 A;  3CRB A;  4XKR A;  4LON B;  2PYY A;  4OFO A;  3PPO A;  3EHU A;  1Y3Q A;  4OHN A;  1B52 A;  4H67 A;  1B40 A;  2Q88 A;  1MPB A;  1BKA A;  1MDQ A;  1MPC A;  2IA4 A;  4NED A;  2HQ0 A;  3U92 A;  4G4P A;  1MXY A;  1UTB A;  3TQL A;  2Y84 A;  1BLF A;  1D3K A;  2XHD A;  3KZG A;  1LAX A;  3CSG A;  1O63 A;  4DE8 A;  1MQH A;  1ELJ A;  3MPL A;  4I1D A;  4DZ1 A;  2XXV A;  4G8H A;  3CVG A;  4YU0 A;  4OWD A;  1JQF A;  5I2K B;  1FQD A;  3MZB A;  2OWT A;  3ECR A;  3BBR A;  3K1N A;  3ZSF A;  1LST A;  3FXQ A;  1TXF A;  4O3C A;  4ESX A;  2B3F A;  1MG1 A;  1P1Q A;  3IJO B;  5I58 A;  3TEL A;  1SI0 A;  1SYI A;  4U22 A;  4Q0C A;  3L6H A;  3MVZ A;  3KJ7 A;  3R26 A;  3WAE A;  1US5 A;  4HS7 A;  3A09 A;  1QVS A;  5ICQ A;  1EZ9 A;  3H3G A;  3GXA A;  4IO3 A;  1O64 A;  3O9P A;  3LSW A;  4QF9 A;  3M3F A;  4THI A;  3FVK A;  4PFW A;  5TU0 A;  4WEP A;  4BDR A;  1NNK A;  1URS A;  1NNP A;  2XXX A;  1FQE A;  3H7M A;  2X26 A;  3A3U A;  2THI A;  3T66 A;  4U4X A;  4U21 A;  3U94 A;  4YMA A;  1R9L A;  4G8N A;  3EN3 A;  3D4C A;  3BFU A;  3H6T A;  1GVC A;  4P0G A;  2O1M A;  4UA8 A;  3PUY E;  4XKP A;  1MH4 A;  4LP2 B;  3FJ7 A;  4I9D A;  3OMB A;  3HPI A;  2REJ A;  1OMP A;  4XKQ A;  1LFH A;  2HXW A;  4ZEF A;  1OLA A;  1N84 A;  3LSF B;  2G93 A;  1SYH A;  3THI A;  1QJM A;  3N6U A;  1DPP A;  1N0T A;  3KSX A;  4IO2 A;  3H6U A;  3KG2 A;  1DSN A;  1O7T A;  1TT1 A;  1NNT A;  1LCT A;  3KJT A;  1B1X A;  3DM0 A;  3H6W A;  3G3F A;  4F3G A;  3PUX E;  3O29 A;  3FJG A;  1MXX A;  3LR1 A;  2FNC A;  3OEN A;  4ZE8 A;  5B70 A;  1XS5 A;  4U2R A;  3T93 B;  1H43 A;  3LC8 A;  1POY 1;  5TP9 A;  3P7I A;  3KSJ A;  1QKA A;  1PB9 A;  4E0X A;  3RGY A;  3UP9 A;  2I4C A;  2NUV A;  3FVO A;  1IXH A;  3EHS A;  3R7X A;  4NMY A;  4DXB A;  2ZNT A;  3TDJ A;  4NF4 B;  1NKX A;  4OEV A;  1PC3 A;  3OEM A;  4R75 A;  5DT6 A;  1QKB A;  1B3F A;  3Q26 A;  3TFL A;  1SBP A;  2XX8 A;  3DLN A;  4IB2 A;  4EQB A;  3G7W A;  2F35 A;  2YPN A;  3DEL B;  4QSE A;  5JTY A;  2DE3 A;  3K4U A;  2OJT A;  2V25 A;  3QAX A;  3WAF A;  2ONR A;  3S9L C;  3GLB A;  2D21 A;  3U8Q A;  1OIB A;  2O7U A;  1POT A;  4GWO A;  1Y1Z A;  5DVF A;  1MQD A;  3C34 A;  4GD5 A;  4EXL A;  5I56 B;  3TMG A;  3DP8 A;  2REG A;  1B4H A;  1AH5 A;  5I84 A;  1MY0 A;  2Z8E A;  3KN7 A;  5AA2 D;  3E13 X;  2ZYN A;  1XVY A;  4LZ8 A;  1XOC A;  4E0W A;  1N3X A;  3TCF A;  4H5G A;  1Y4T A;  2NWJ A;  2O69 A;  1F9B A;  4DCX A;  1B1H A;  3HHF A;  3H6V A;  5AA3 A;  3TEP A;  3JYR A;  1Y20 A;  1P99 A;  2ZYM A;  5ITO A;  4GRK A;  4I62 A;  2V3T A;  4JBZ A;  3V8X B;  2QS4 A;  3O66 A;  4QFN A;  3G3I A;  5H8Q A;  1R1N A;  3CI8 A;  1DMB A;  1LBC A;  2XXU A;  5EHM A;  5CMB A;  2XXQ A;  3MP6 A;  3VV5 A;  3T22 A;  2P2A A;  1B2H A;  1VR5 A;  2E0S A;  1A7L A;  1P1N A;  3JZJ A;  1MXW A;  3K01 A;  3SEW A;  1A99 A;  1J1N A;  3N6T A;  2Y7K A;  1Z7N E;  2B65 A;  3IR1 A;  5IAI A;  4DLD A;  3RQT A;  2Y7I A;  4RK9 A;  1II5 A;  4H8I A;  2QS3 A;  3UIF A;  4R73 A;  3FAS A;  5KCJ B;  3MZ1 A;  3K1P A;  3E3K A;  4C1T A;  3TTM A;  5ITP A;  1LB8 A;  4BDQ A;  2QL3 A;  1YCJ A;  3IOT A;  2AYS A;  5H8F A;  1QUL A;  3FJM A;  1AMF A;  1XT8 A;  1NNF A;  3IOV A;  4EF1 A;  4GLI A;  4YIC A;  3SER A;  3RUM A;  5H8H B;  2DP8 A;  2XXT A;  3PPQ A;  4F3P A;  4U1Z A;  4L17 A;  3I5O A;  3USD A;  3RTW B;  3VDF A;  1IIW A;  4JWX A;  3LSX A;  4GOT A;  1MY4 A;  5H8N B;  2ESN A;  2ONK E;  2RIN A;  2DSF A;  5KZT A;  3E4R A;  3L6G A;  2E1S A;  5DEX B;  4ELQ A;  4F22 A;  2DWA A;  1SQY A;  3QSL A;  1B0L A;  2HAU A;  5DYH A;  4YKI A;  2YLN A;  2ZNU A;  3W15 C;  5KDT A;  1R9Q A;  3MVW A;  4PFT A;  3K6W A;  2UVI A;  3K02 A;  4LQ2 A;  1IEJ A;  3O6I A;  3U93 A;  4U23 A;  3QUJ A;  4MH5 A;  1RKM A;  2QMX A;  4HCW A;  1Y4C A;  3MJN A;  2AL4 A;  3OEK A;  1PB7 A;  1FTM A;  3FV2 A;  4P11 A;  4LZ5 A;  1SDX A;  4Z0I A;  5AA2 B;  5I56 A;  1P1U A;  1N7W A;  1MPD A;  1A40 A;  4DIG A;  2UVH A;  2ZYO A;  3HST A;  2H99 A;  3PMV A;  3TUS A;  1EZO A;  1IXG A;  2I58 A;  1M5B A;  4KD5 A;  1GTK A;  3T96 B;  1IIT A;  4FOR A;  1FTL A;  2OK2 A;  3K0V A;  4HW8 A;  2GHA A;  1OVB A;  1IXC A;  1XVX A;  5L9O A;  1GGG A;  2HZL A;  3CSB A;  5H8S A;  5CC2 A;  1SW2 A;  4Q8R A;  4G68 B;  2Q2C A;  2RKM A;  2R9J A;  4RYA A;  4F1Y A;  4NE4 A;  5L8D A;  5FHN A;  1YTV A;  3VVF A;  2ABH A;  3ZKL A;  3RY3 A;  3IO6 A;  3MQ9 A;  2HAV A;  4IO7 A;  3FXU A;  4ZEI A;  5IKB A;  1KWH A;  2XD2 A;  3S9N C;  2F6G A;  5HPQ A;  4G77 A;  4KCC A;  3UN6 A;  2KLF A;  4RPN A;  1B7U A;  1B5H A;  4TQU Q;  2I3V A;  1A8F A;  2G29 A;  4F18 A;  3UGW A;  3D4G A;  2X7Q A;  1ZTY A;  1L5T A;  5KCJ A;  3OSQ A;  1ANF A;  5CI5 A;  3QIM A;  4Z7E A;  1B6H A;  2VD3 A;  2OCU A;  2O84 X;  3O28 A;  3CFX A;  5FHM A;  2QMW A;  1B7H A;  4PP0 A;  3KGC A;  4PFY A;  1LAH E;  2PT2 A;  3KBR A;  3N5L A;  3BKI B;  5H8H A;  4KHZ E;  3MC2 A;  3KEI A;  4ELP A;  3B6Q A;  4NTL A;  1N7X A;  4PQJ A;  3OD7 A;  3LBS A;  3VXB A;  4MLQ A;  4ZZE A;  4YKJ A;  1MRP A;  1EU8 A;  4TLM B;  4DXU A;  4RXL A;  1MY2 A;  2DE4 A;  4NF6 A;  2DVZ A;  4R9G A;  1AIV A;  1JEU A;  1R6Z A;  1ZKB A;  4JWY A;  3QXM A;  5CMC A;  1LB9 A;  3K6X A;  1UIV A;  3FZV A;  2I0C A;  4XIG Q;  2QS2 A;  4MLV A;  5DEX A;  3VFJ A;  1JW5 A;  4XXU A;  4FED A;  1VFD A;  3HV1 A;  2PX1 A;  5DTB A;  4LAT A;  3QYT A;  2F34 A;  3PU5 A;  1H45 A;  2XXR A;  4TLL B;  2A5T B;  4GXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...