3RPWA

The crystal structure of an abc transporter from rhodopseudomonas palustris cga009
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
333
structure length
333
Chain Sequence
b'QSNVVIMQDPGGGYGDALRKVMYDPFEKETGIKVVTVQEARSGPRIKAQAEAGKAQWDLTFIFDQETKLLGDCCLADIDYSKLSESAHKTLAAMPDNLKRKKGVALQVIGVGLVYNKDKFKGDKAPQTWADFWDVKKFPGRRCMPAWPRFTFEAALMADGVTKDKLYPIDMDRALKKLKEIKPHVVKWWTTAAQPPQLILDGEADMCLAYTGSMSKLALEGAPIDLTFNQGFVYYDFFSIPKGAPNYDNALKLLSWRLDPKRAAQLTSTFPVALPSKVVFDAATDKNIARYWANNPENVAKAIEWSPDFWGAPSPAGNSTNEEYGQEKLNAML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter
publication title Structural and functional characterization of solute binding proteins for aromatic compounds derived from lignin: p-Coumaric acid and related aromatic acids.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transport protein
total genus 108
structure length 333
sequence length 333
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3rpwA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3rpwA01
4N6PA 4GD5A 1Y1ZA 4RXLA 3FD3A 1URDA 3OELA 4F3GA 1B46A 3EHTA 3K02A 1ZKBA 3FZVA 2KLFA 4RPNA 3HPIA 1EZ9A 3H6WA 3DM0A 4IO3A 2M8CA 1A8EA 3RUMA 3EHUA 5CRYA 2I3VA 1N3WA 3IJXB 2OK2A 3CR9A 2IA4A 3I6VA 3KOTA 1SD3A 4LZ5A 4BDMA 2GHBA 3QYTA 3O29A 1O64A 3HV1A 1B05A 3RTFB 4JXIA 1D3KA 1LSTA 1UIUA 1H45A 3FJGA 5H8QB 3QK6A 2XD3A 4IGTA 2ONKE 4LZ7A 1NH8A 4H67A 1N7XA 2Z23A 4QFPA 1R9QA 4PFUA 1SW5A 2RCBA 4FE8A 3TCGA 1AIVA 3KSJA 3HSTA 4N07A 4WEPA 4R2BA 4I1DA 4KYSA 3MZ1A 1LBCA 4OEUA 3U1OA 3OO7A 1URGA 2R6GE 4ND9A 3TQLA 3K6VA 3G7WA 3SKPA 3TAJA 4R2FA 3K1PA 2VHAA 3FVGA 4OHNA 4OVJA 3V8XB 3HCQA 3OSRA 3R26A 2I0CA 3USDA 4FEDA 2H5YA 4NF4B 3S9MC 4BDRA 1LFIA 4KCDA 4MLVA 3TTNA 1MXWA 4PQJA 4ISUA 3SEWA 5TPAB 1H44A 2UVIA 3OO8A 3OENA 2V3QA 2QS1A 4NEDA 5A5XA 3KOSA 1B40A 2DWAA 2DWIA 3TUSA 1B1XA 1IXHA 4R9GA 3IB0A 4KHZE 1PC3A 2XHDA 4GVOA 2RC8A 2NXOA 4H6DA 2GRVA 3C33A 5EYFA 3CIJA 4ZE8A 4ELRA 2A5TB 3FXUA 3M8UA 3S9NC 3UA8A 3K6WA 1B6HA 2Y7PA 4P11A 4XXUA 4X1DA 1JEUA 3MPLA 3RY3A 1MQJA 3MWBA 1PBPA 3VVFA 5I59B 1OLCA 1JW1A 1DTGA 3KSXA 3FVNA 4IY5A 5KCJB 4GF8A 3U93A 1YCJA 3R7XA 3LC8A 5CMBA 4RYAA 1IXIA 1N84A 2OCUA 1SYIA 1DTZA 2E0SA 4RA1A 4POXA 3TPAA 2Y84A 4C1UA 3M3FA 3AXFA 3SESA 4EDPA 5B7DA 2E1SA 4YKIA 1USYH 5AA4A 4PP0A 4R9FA 3BFTA 2Z8FA 1JEVA 4AB6A 4JDFA 3O6IA 1R6ZA 3H03A 3N6UA 3OO9A 4LA9A 5I58B 1M5BA 3T96B 5I2NB 4AQ4A 5FTIA 2G29A 1Y9UA 3KN7A 2F35A 2RCAA 1B58A 3DLNA 3MVZA 3H6TA 1A40A 2VGQA 2THIA 3MVWA 2PT1A 2XXRA 3KN3A 2AL4A 3ODBA 1MXYA 1WVJA 1MQDA 2QS3A 2RF1A 3H3GA 3L6GA 2VOZA 5KDTA 2ZXTA 2DVCA 2XXHA 2DE4A 3KZGA 3K1MA 2B65A 4KI0E 1OLAA 4OTEA 2F78A 1Q35A 1Y3NA 3FV1A 4JBZA 2H25A 4GWOA 4ZDMA 2O6AA 1DOTA 3MJNA 4OZ9A 3B6TA 2V93A 5CMMA 2ZNUA 4F3BA 4KD5A 1DSNA 2RC9A 1ANFA 3TTKA 1B3FA 1N76A 4O3CA 4X48A 2Z8DA 5DVJA 5K2XA 3KG2A 1IEJA 3VFJA 5JEIA 3V83A 1MDQA 3OEMA 4EF1A 3TFLA 5I58A 4LZ8A 4XIGQ 4FJPA 3TTRA 4QSEA 1M5CA 1MXXA 1HSEA 1NNTA 1SI0A 3PMWA 4E0WA 2NWJA 2GHAA 3CSGA 3MC2A 5I2KB 4YMBA 2OJTA 3BKIB 2DQVA 3CG1A 4I8CA 1SI1A 1XS5A 4F1YA 2HZKA 4JB7A 3OSQA 5H8FB 4IGRA 3PUYE 3O28A 2XX8A 3CVGA 4NTLA 3TTMA 2I6EA 2XXYA 4H8JA 1URSA 2I58A 3RLFE 4NF6B 1B51A 5DEXB 2QL3A 3KEIA 3CFLA 4HCYA 1DPEA 1A8FA 4DCYA 4U22A 1GTKA 3G3GA 1R9LA 3RT8A 1D4NA 2F7CA 1AH5A 5L9OA 4G8NA 3T22A 4RPOA 1TXFA 3N26A 5DVFA 3SERA 4NF5B 4NE4A 3TELA 1YAEA 3CFZA 3CI8A 1USYE 3HN0A 3H06B 1Y3QA 3Q25A 1LFHA 2O69A 1OVTA 2XXPA 2ZYNA 1TWYA 3ILUB 3C32A 3DP6A 3C36A 5FTHA 1SW2A 1ZMGA 5TP9B 3KGCA 4EUOA 2ZNSA 3T9VA 3WAEA 5H8HB 5I2KA 4KCCA 2H9BA 4L17A 3OOAA 3H6VA 4GL0A 4MF3A 2VP1A 3MPKA 3F11A 5CBSA 1MY4A 1SBPA 4QRZA 1FW0A 4XKRA 3T93B 2F6GA 1IXCA 1EH3A 1OVBA 3H6UA 1POY1 3LSWA 2OWSA 2ONRA 3ZS6A 2UXAA 4DZ1A 2YJPA 2O1LA 2XXVA 4G68A 4GXSB 3W15C 1VFDA 3VE1B 1PBQA 3E13X 2O68A 1FQFA 1Q1KA 3E3KA 2Q8JA 1Y3PA 2DWHA 4RY1A 4BLAA 1IQ7A 1B0HA 1FQBA 1JETA 3IX1A 3TTLA 1LBBA 1ZIUA 3SEYA 3TMGA 2B3BA 4QF9A 3O97A 4ESXA 4BDNA 4F1UA 1HSJA 3DP4A 2XX9A 4YZZA 4TLLB 2XD2A 2Q89A 3IOUA 1WDNA 4IO5A 1AOVA 4BDOA 1BTJA 2VD3A 3PD9A 2FYIA 4XTCQ 4F22A 4OWDA 1JW4A 1P99A 2W7YA 2F36A 2XXIA 4TOZA 4Z0IA 1GGGA 1P1QA 3JV9A 3VVEA 3HO7A 1MPBA 1Z7NE 1QJMA 3T9HB 3V5AA 1O63A 3PUZE 3IK6B 2H4IA 2QSXA 4E0XA 2NUVA 3GLBA 3A3CA 4DXBA 3UK4A 1JVXA 2XXQA 3Q26A 3MVXA 3RN8A 4LUBA 3WAFA 5JTYB 4EQ7A 1I6AA 2P2AA 4C0RA 1MQIA 1LAXA 4C1TA 3QUJA 1I69A 3LBSA 2ONSA 2Y7KA 1FTOA 3K1NA 4FORA 4F39A 4OXVA 3IR1A 2DXYA 3U94A 3TZAA 2WKYA 3QXMA 1ATGA 3RT6B 5H8QA 1TFDA 4X9TA 4F2OA 3T66A 1MS7A 3QSLA 1IUDA 2X7PA 5DT6A 2IEEA 3SDFA 4IO6A 4ECFA 4MH5A 1QULA 2F7BA 4N13A 4G8MA 3C9HA 1JNFA 2AYSA 3OXNA 3PUXE 4LONB 4O3BA 4DXCA 5AE4A 1MPDA 3UN6A 2F34A 5K2YA 4RJZA 1XC1A 3K2DA 4HTGA 3EN3A 2Q9TA 1BIYA 1H3DA 1MM7A 1P1OA 1PEBA 3T9UA 1Z7ME 3FUZA 2RKMA 1MXZA 2O51A 3DELB 3U8QA 5L9SA 5TU0A 3KN8A 5JTYA 4QSDA 4GLIA 1OQGA 4PFWA 5HBCA 1VSOA 3GZGA 4NF4A 1II5A 3IB2A 3CFXA 2BJJX 1MG1A 3IL1B 1LAFE 3Q29A 4NF8B 2HXWA 5TPAA 3FJ7A 4GOTA 3RTWB 1H76A 1SYHA 3JZJA 4XKQA 3EPEA 2ZMBA 4IO2A 3TDJA 1US4A 4YAHX 3BBRA 4M4GA 4FECA 3N5LA 1QKAA 2I0BA 1R1NA 4K3FA 4F3PA 4QSCA 1FTJA 2Y7IA 4LP2B 1UTHB 3ZKKA 1SVXB 4AB5A 3MZBA 4PE5B 2UVJA 4YMAA 1B3EA 1YPNA 3KFMA 3Q27A 2A5TA 1MY2A 3MW0A 3S4UA 5IKBA 3GBAA 1H43A 4DXUA 1ZJLA 4H65A 2GFEA 5FHNA 2OZZA 2ZYOA 2Q88A 3FVKA 4QHQA 1ZLQA 5AA2B 2Z8EA 1UTBB 4G68C 2V84A 2XXUA 4X1BA 5I59A 1B5JA 4BDLA 5KCJA 2HCAA 1JQFA 2UVGA 5AA2D 4OFOA 3SETA 3UORA 1LFGA 2I49A 3S9LC 1NNKA 5ICQA 4RK2A 2XXXA 4QFNA 4ZZEA 5L9MA 5DYHA 4KR5A 2D3IA 4DDDA 3I5OA 3MAMA 1WODA 1I6QA 2ZNTA 4F3SA 1CE2A 1LAGE 5CMKA 2HEUA 3PMVA 1PB8A 4XKNA 5I2NA 2XXTA 1SW1A 4ZEBA 5KZTA 2DSFA 1DMBA 3O9PA 3C4MA 2DWJA 4H8IA 1A54A 1TFAA 2X26A 4OFLA 4YICA 2XXWA 3VVDA 3ZKLA 3RNNA 3PU5A 3VXBA 3G3KA 1KWHA 3LUYA 3TYHA 1PDAA 4KYDA 2H99A 3VDFA 5AA2A 2F8DA 3E9XA 4M1VA 3UGWA 2DE2A 5CBRA 2V3UA 4OESA 1FQCA 1B4HA 4F19A 5EHSA 2ALUA 1HSLA 3S2VA 1QUJA 5I57B 3ONMA 3D4GA 4JWYA 4P0GA 4F1VA 3EF7A 4LQ5A 4ELOA 1MY3A 1SW4A 5CC2A 1P1UA 4KQPA 1XOCA 3TCHA 4G8HA 2DE3A 4DCXA 3VLWA 3FXQA 1JW5A 2AL5A 2CMOA 5ISUA 1IXGA 5BUUA 4GFRA 5CMCA 4R74A 4EF2A 1D9VA 4OENA 2PX1A 3K0VA 3V89B 1JVYA 3VV5A 3MUQA 2OBGA 2HFBA 3BFUA 2REJA 3SEVA 3OEKA 5I56B 2REGA 4LVQA 4KYEA 1P1WA 1NMUA 4DIGA 2ANJA 2PVUA 3PUVE 3KBRA 1T0KA 2I48A 3FJMA 4WXJA 5L8DA 5H8FA 3LSLA 3LSFB 2Y7RA 3FASA 4EQ9A 1B9JA 3C35A 3PPRA 3IOTA 4QFLA 3THIA 4UACA 1POTA 3ZSFA 3B6WA 4DE8A 4YB7A 4G77A 3N94A 2XX7A 4NF6A 1AL3A 5DEXA 4IO4A 3MVYA 5BWJA 5CM6A 4GIZA 2R9JA 1B7HA 2DS9A 2RINA 2NOOA 3O6GA 3C34A 4ELQA 5F1QA 4FAJA 1FQAA 3A3UA 1UIVA 1O7TA 3N6TA 4NF5A 3GXAA 3QUFA 1FQDA 1D9YA 3ECRA 3A09A 1NKXA 1LCTA 4BDQA 2RC7A 3FGSA 1QUKA 3RQTA 4MLQA 1FTKA 4HS7A 4XKPA 3ILTB 4QFOA 3MZ9A 2OLBA 5I56A 1EZOA 5TP9A 3QAXA 2ABHA 5H8HA 4U4XA 4TLMB 1CB6A 3T9XB 3QIMA 4EXLA 4OERA 4OYVA 4U1OA 1PB9A 3PD8A 1MM6A 5A5XB 2Q2AA 4POWA 5ELVA 5FHMA 1XHYA 2PMSA 2PBWA 4IB2A 1N04A 3UIFA 3M3KA 2QMXA 1QUIA 1US5A 1TT1A 1B3GA 4OQOA 4PFTA 4Z7EA 2AIXA 5B70A 3PV0E 2I4BA 2F97A 4GQOA 3LSXA 2CZLA 3OO6A 2QMWA 4F18A 5JK4A 4IY6A 4R6YA 5J1DA 2B3FA 3IORA 1XVXA 4WKMA 3TCFA 1SQYA 4LATA 3SEXA 3IOVA 2DP8A 5FHOA 1UQWA 4OEVA 3PPQA 5DTBA 4G2ZA 1FTLA 4WEDA 4MBPA 1OIBA 3G3JA 3O66A 1NFTA 4HW8A 1B7ZA 5AA1A 3B6QA 4FATA 1IZ1A 1NH7A 3G3IA 5AA4B 4F2QA 1B1HA 5HPQA 1MQGA 3K6UA 1DPPA 4NMYA 4GRKA 5I84A 4U23A 2X7QA 4Q5TA 3G3HA 3PMXA 3M3LA 1L5TA 5H8NB 1LAHE 4Q8RA 1PB7A 2YPNA 3TQWA 3U72A 4JWOA 1M5EA 1RYOA 1S50A 3HHFA 1RKMA 4ZEFA 3TEPA 1MPCA 1B7UA 1ZTYA 1YTVA 2H98A 3FIRA 2V25A 3OD7A 4ZE9A 4ZECA 1FTMA 1B32A 4DLDA 3FATA 3VLUA 5HM4B 1B0LA 2I3WA 4RK9A 4LQ2A 3D4CA 5KDTB 4R72A 4GL8A 4R6HA 3KJ7A 1B4ZA 5LOMA 5EHMA 1OMPA 1F9BA 3CSBA 1BLFA 4GXAA 3FXRA 1MY0A 2DXRA 4RNSA 2R71A 4I62A 4MFIA 2QJEA 3EHSA 4O3AA 1NNPA 1MH4A 3P7IA 1EZPA 4ZEDA 3HHGA 2LAOA 3UP9A 4F29A 2HAVA 3RPWA 4ELPA 1BKAA 2F5XA 3FVOA 3SEUA 1MRPA 2ZYKA 4OETA 5H8NA 5AA3A 1GVCA 1B5IA 3O2AA 4ZEIA 2QPQA 4Q0CA 4YU0A 1LCFA 3W9WA 3GBBA 3MBPA 1ZU0A 2DYXA 1QVSA 1GR2A 5F7VA 1IIWA 2QS2A 1MXUA 2QS4A 4THIA 2PT2A 2P0SA 3C31A 1S9TA 4JSDA 2O7UA 1NL5A 3TODA 1N7WA 2UYEA 2VD2A 3K01A 4H5FA 1MQHA 1LB8A 3PPOA 4P0IA 3IB1A 4UA8A 1B3HA 1AMFA 1LGBC 3LR1A 4HCWA 1B2HA 4NF8A 1MDP1 3E4RA 1N3XA 4KPTA 1GV8A 2O7IA 1Y20A 4EQBA 5H8SA 1QW0A 3O6HA 2HZLA 4H0WA 4ZS9A 3G3FA 3JYRA 4I9DA 3VXCA 3PUWE 3VLVA 4JSOA 3B7DA 3K6XA 2GH9A 2F6PA 1FQEA 1VFEA 1Y1MA 1ZBMA 3DP8A 1M5FA 1UTHA 1M5DA 4YKPA 4H5GA 3W9VA 4R73A 2HQ0A 4R75A 1EU8A 3Q28A 5ICTA 2HAUA 3EQ1A 4F31B 3H4ZA 1UTBA 1A55A 2ZYMA 1Y4CA 1MXVA 2UVHA 4OFJA 3PGFA 4PFYA 3IAZA 4IO7A 1FCKA 1NNFA 4FIMA 4R6KA 1MH3A 2FA7A 1Y4TA 3FV2A 5CI5A 2F7AA 1SDXA 2A5SA 1B5HA 3TKDA 1I6BA 4YB6A 3L6HA 1RYXA 3IO4A 4U2RA 3U92A 4PETA 4NWCA 3MP6A 2Y7WA 4U21A 2P1SA 4G68B 2O84X 3IOWA 1LB9A 1N0TA 2D21A 3IO6A 4QFKA 3PPPA 4G4PA 1IITA 1B3LA 3PPNA 4ESWA 1J1NA 3K4UA 4JWXA 1MY1A 5ITPA 2UYFA 2PYYA 4YB5A 2OWTA 5M2VA 1XT8A 4H1XA 5DVIA 5ITOA 3CRBA 2Z22A 3RGYA 1A7LA 3OMBA 1BP5A 4ONYA 2NVUB 3I3VA 4U4SA 4NWDA 1LLSA 2G93A 2YLNA 3R6UA 4EXKA 2O1MA 3S9EA 2DVZA 2V3TA 2DOJA 4ZZAA 5IAIA 4OMBA 1OQHA 3H7MA 1XVYA 2D5WA 2ESNA 2I4CA 3MP1A 3KJTA 1QKBA 1S7YA 5I57A 2QRYA 4FEBA 3CG3A 4YKKA 2FNCA 1VR5A 2Q2CA 1VE4A 3IJOB 4ZEKA 4YKJA 4TQUQ 3MP8A 1B52A 4U1ZA 4Q30B 1P1NA 1ELJA 1A99A 3K00A 4KFQA 3MQ9A
chains in the Genus database with same CATH superfamily
4N6PA 2CZIA 4GD5A 1Y1ZA 4NG7A 1IMDA 4RXLA 3FD3A 1URDA 3OELA 4F3GA 1B46A 3EHTA 3K02A 1ZKBA 3E79A 3FZVA 2KLFA 4RPNA 3HPIA 1EZ9A 3H6WA 3DM0A 4IO3A 2M8CA 1A8EA 3RUMA 3EHUA 5CRYA 2I3VA 1N3WA 3IJXB 2OK2A 3CR9A 2IA4A 3I6VA 3KOTA 1SD3A 4LZ5A 4BDMA 2GHBA 1YZ0A 3QYTA 3O29A 1O64A 3HV1A 1B05A 3RTFB 4JXIA 1D3KA 1LSTA 1UIUA 1H45A 1FBDA 2CEYA 1FPFA 2Q74A 3FJGA 4P1LA 5H8QB 3QK6A 2XD3A 4IGTA 2ONKE 4LZ7A 1NH8A 2GQ1A 4KXPA 4H67A 1N7XA 2Z23A 2L5VA 4QFPA 1R9QA 4PFUA 1SW5A 2RCBA 4FE8A 1NV2A 3TCGA 1AIVA 3KSJA 3HSTA 4N07A 4WEPA 4R2BA 4I1DA 4KYSA 3MZ1A 4PFBA 1LBCA 4OEUA 3U1OA 2HXRA 3OO7A 1URGA 3FXBA 2R6GE 4ND9A 4P3LA 3TQLA 3K6VA 5LTCA 3G7WA 3SKPA 3TAJA 2VT5A 4R2FA 3K1PA 2VHAA 3FVGA 4OHNA 4OVJA 3V8XB 3HCQA 3OSRA 3R26A 2I0CA 3USDA 4FEDA 2H5YA 3KC0A 1FPKA 4NF4B 3S9MC 4BDRA 1LFIA 4KCDA 4MLVA 3TTNA 1MXWA 4PQJA 4ISUA 4OVRA 4LN5A 3SEWA 5TPAB 1H44A 2UVIA 2FIXA 3OO8A 3OENA 2PFZA 2V3QA 2QS1A 4NEDA 5A5XA 3KOSA 1B40A 2DWAA 4O8MA 2DWIA 3TUSA 1B1XA 1IXHA 4R9GA 3IB0A 1FBFA 4KHZE 1PC3A 2XHDA 4GVOA 2RC8A 2NXOA 4H6DA 2GRVA 1LEVA 4PCDA 3C33A 5EYFA 4NGUA 4OVSA 4OANA 3CIJA 4ZE8A 4ELRA 2A5TB 3FXUA 3M8UA 3S9NC 3UA8A 3K6WA 1B6HA 2Y7PA 4PDDA 4P11A 4XXUA 4X1DA 1JEUA 3MPLA 2KR0A 3RY3A 1MQJA 1FBPA 3QMFA 2WEFA 3MWBA 1PBPA 4PC9A 3BIHA 3VVFA 4AS5A 5I59B 2WBBA 1OLCA 1JW1A 1DTGA 3KSXA 3FVNA 4IY5A 5KCJB 4GF8A 3U93A 1YCJA 3R7XA 4MHFA 1FBHA 3LC8A 5CMBA 1IMBA 4RYAA 1IXIA 1N84A 2OCUA 2WBDA 1SYIA 1DTZA 2E0SA 4RA1A 4POXA 1IMCA 3TPAA 2Y84A 4C1UA 3M3FA 3AXFA 3SESA 4EDPA 4OVQA 5B7DA 2E1SA 4YKIA 1USYH 5AA4A 4PP0A 4R9FA 4AS4A 3BFTA 2Z8FA 1JEVA 4AB6A 4JDFA 3O6IA 1R6ZA 3H03A 4N4UA 3N6UA 3OO9A 4LA9A 5I58B 1M5BA 3T96B 5I2NB 3RPLA 4AQ4A 5FTIA 2G29A 1Y9UA 3KN7A 2F35A 2RCAA 1B58A 3DLNA 3MVZA 3H6TA 5EQ9A 1A40A 2VGQA 4X04A 2THIA 4G61A 3MVWA 2PT1A 2XXRA 5DW8A 3KN3A 2AL4A 3ODBA 1MXYA 1WVJA 1MQDA 2QS3A 5ET8A 2RF1A 3H3GA 3L6GA 2VOZA 5KDTA 2ZXTA 2DVCA 2XXHA 2DE4A 3KZGA 3K1MA 2B65A 4NQ8A 3U65A 4KI0E 1OLAA 4OTEA 2F78A 1Q35A 1Y3NA 3FV1A 4JBZA 2H25A 4GWOA 4ZDMA 2O6AA 1DOTA 1RDZA 3B8BA 3MJNA 4OZ9A 3B6TA 2V93A 5CMMA 2ZNUA 4F3BA 4KD5A 1DSNA 2RC9A 1ANFA 3TTKA 1B3FA 1N76A 4O3CA 4X48A 2Z8DA 5DVJA 5K2XA 3KG2A 1IEJA 3VFJA 5JEIA 3V83A 1MDQA 3OEMA 4EF1A 3TFLA 5I58A 3NOHA 4LZ8A 4XIGQ 4FJPA 3TTRA 4QSEA 1M5CA 1MXXA 1HSEA 1NNTA 1SI0A 1DK4A 3PMWA 4E0WA 2FBPA 2NWJA 4MNCA 2GHAA 3CSGA 4XF5A 1DBZA 3MC2A 5I2KB 4YMBA 2OJTA 3BKIB 2DQVA 1NV7A 3CG1A 4I8CA 1SI1A 1XS5A 4F1YA 1IMFA 2HZKA 4JB7A 3OSQA 5H8FB 5FBPA 4IGRA 3PUYE 3GYYA 3O28A 2XX8A 3CVGA 4NTLA 3TTMA 2WX9A 4PF6A 2I6EA 2XXYA 4H8JA 1URSA 2I58A 3RLFE 4NF6B 1B51A 4P9KA 5DEXB 2QL3A 3KEIA 3CFLA 4HCYA 4GX4A 1DPEA 3D1RA 1A8FA 4DCYA 4U22A 1GTKA 3G3GA 1R9LA 3RT8A 1D4NA 2F7CA 1AH5A 5L9OA 4G8NA 3T22A 4RPOA 1TXFA 3N26A 5DVFA 3SERA 4NF5B 4NE4A 3TELA 1YAEA 3CFZA 3CI8A 1USYE 2KQZA 1IMAA 3HN0A 3H06B 1Y3QA 3Q25A 1LFHA 2O69A 1OVTA 2XXPA 2ZYNA 3T0JA 1TWYA 1RDXA 3ILUB 3C32A 3DP6A 3C36A 5FTHA 1SW2A 1ZMGA 5TP9B 3KGCA 4EUOA 1YYZA 2ZNSA 3T9VA 3WAEA 4HXVA 5H8HB 5I2KA 4KCCA 1Q9DA 2H9BA 4L17A 3OOAA 3H6VA 4GL0A 4MF3A 2VP1A 3MPKA 3F11A 5CBSA 1MY4A 1SBPA 4QRZA 1FW0A 4XKRA 3T93B 2F6GA 1IXCA 3SZPA 1EH3A 1OVBA 3H6UA 1POY1 4PFRA 4UABA 3LSWA 2OWSA 2ONRA 3ZS6A 2UXAA 4DZ1A 5A5LA 2YJPA 2O1LA 2XXVA 4G68A 4GXSB 3W15C 1VFDA 3VE1B 1PBQA 3E13X 2O68A 1FQFA 1Q1KA 4GWSA 2WYKA 4QBAA 3E3KA 2Q8JA 1Y3PA 2DWHA 4RY1A 1FJ6A 4BLAA 1IQ7A 1B0HA 1FQBA 1JETA 3IX1A 3TTLA 4X8RA 2CZKA 1LBBA 1ZIUA 3SEYA 1NV3A 3TMGA 2B3BA 4QF9A 3O97A 2R8TA 4ESXA 4BDNA 4F1UA 1DCUA 1LBYA 1NV0A 3IFAA 1HSJA 3DP4A 2XX9A 4YZZA 4TLLB 2XD2A 2Q89A 3IOUA 1WDNA 4IO5A 1AOVA 4BDOA 1BTJA 2VD3A 3PD9A 2FYIA 5I7IA 4NF0A 1NUXA 2FHYA 4XTCQ 4F22A 2ZZWA 4OWDA 1JW4A 1P99A 2W7YA 5EQ7A 2F36A 3KC1A 2XXIA 4TOZA 4Z0IA 1GGGA 1P1QA 3JV9A 3VVEA 3HO7A 1MPBA 1Z7NE 1LBZA 5EQ8A 1QJMA 3T9HB 3V5AA 2F3BA 4I3EA 1O63A 4PE3A 3PUZE 1KA0A 3IK6B 2H4IA 2QSXA 1KA1A 4E0XA 2Y5KA 4MMPA 2NUVA 4GBVA 3GLBA 3A3CA 4P56A 4DXBA 3UK4A 1JVXA 2XXQA 3Q26A 3MVXA 3RN8A 4LUBA 3WAFA 4I40A 5JTYB 4EQ7A 1I6AA 2P2AA 4C0RA 2B4MA 4GWXA 1MQIA 1JP4A 1LAXA 4C1TA 3QUJA 4MIJA 1I69A 3LBSA 2ONSA 5EQAA 2Y7KA 1FTOA 3K1NA 4FORA 4F39A 4OXVA 3IR1A 2DXYA 4JVIA 3U94A 4GX6A 3TZAA 2WKYA 3QXMA 1ATGA 3RT6B 5H8QA 1TFDA 4X9TA 4F2OA 3T66A 4MJOA 1K9YA 1MS7A 3QSLA 1IUDA 2X7PA 5DT6A 2IEEA 3SDFA 4XEQA 4IO6A 4ECFA 5I3SA 4MH5A 1QULA 2F7BA 4N13A 4G8MA 3EKIA 4H46A 4GWUA 3C9HA 1JNFA 2AYSA 3OXNA 3PUXE 4LONB 4O3BA 4DXCA 5AE4A 1MPDA 3UN6A 2F34A 5K2YA 4RJZA 1XC1A 3K2DA 4HTGA 3EN3A 2Q9TA 1BIYA 1H3DA 1MM7A 1P1OA 4N6KA 1PEBA 3T9UA 1Z7ME 3FUZA 2RKMA 1MXZA 2O51A 3DELB 4N15A 3U8QA 5L9SA 5TU0A 3KN8A 5JTYA 4QSDA 4GLIA 1OQGA 4PFWA 5ET6A 5HBCA 1VSOA 1NV1A 3GZGA 4NF4A 1II5A 3IB2A 3CFXA 2BJJX 1MG1A 3IL1B 1LAFE 3Q29A 4NF8B 2PFYA 2HXWA 5TPAA 4PBQA 3FJ7A 4GOTA 3RTWB 1LBXA 1H76A 1SYHA 3JZJA 4XKQA 3EPEA 2ZMBA 4IO2A 3TDJA 1FPIA 1US4A 4YAHX 3BBRA 2P3VA 4M4GA 4FECA 3N5LA 1QKAA 2I0BA 1R1NA 4JVDA 4K3FA 4F3PA 4PAIA 4QSCA 1FTJA 2Y7IA 4LP2B 1UTHB 3ZKKA 1SVXB 4AB5A 3MZBA 1NUZA 4PE5B 2UVJA 4YMAA 1B3EA 1YPNA 3KFMA 4HE2A 3Q27A 2A5TA 1MY2A 2HPGA 3MW0A 3S4UA 5IKBA 3GBAA 4JVCA 1H43A 4DXUA 1ZJLA 4H65A 2GFEA 5FHNA 2OZZA 2ZYOA 2Q88A 3FVKA 4QHQA 1ZLQA 5AA2B 4MAGA 4GWZA 3PTYA 2Z8EA 1UTBB 1FPDA 1FPLA 4G68C 2V84A 2XXUA 4X1BA 5I59A 1B5JA 4BDLA 5KCJA 2HCAA 2P3NA 1JQFA 2UVGA 5AA2D 4OFOA 3SETA 3UORA 1LFGA 1FTAA 2I49A 3S9LC 1NNKA 5ICQA 4RK2A 4O7MA 2XXKA 4PGPA 1FPBA 2XXXA 4QFNA 4ZZEA 5L9MA 5DYHA 4KR5A 2D3IA 4DDDA 3I5OA 3MAMA 1WODA 4NHBA 1I6QA 2ZNTA 4F3SA 1CE2A 1LAGE 5CMKA 2HEUA 3PMVA 1PB8A 4XKNA 5I2NA 2XXTA 1SW1A 4ZEBA 5KZTA 2DSFA 1DMBA 3O9PA 3C4MA 2DWJA 4H8IA 1A54A 5IZ1A 1TFAA 4GWWA 2Q8MA 2X26A 4OFLA 4YICA 2XXWA 3VVDA 3ZKLA 3RNNA 3PU5A 3VXBA 3G3KA 1KWHA 3FBPA 3LUYA 3TYHA 1PDAA 4KYDA 2H99A 3VDFA 5AA2A 4GX3A 2F8DA 3E9XA 4M1VA 3UGWA 2B4LA 2DE2A 5CBRA 2V3UA 1FBCA 4OESA 1FQCA 1FRPA 1B4HA 4F19A 4PTKA 5EHSA 2ALUA 1HSLA 3T1BA 3S2VA 1QUJA 4GBWA 5I57B 3ONMA 2OX3A 3D4GA 4JWYA 4P0GA 4PBHA 4F1VA 3EF7A 4LQ5A 4ELOA 1MY3A 3IFCA 1SW4A 5CC2A 1P1UA 4KQPA 1XOCA 3TCHA 1NUYA 1G0HA 4G8HA 4NAPA 2DE3A 2WYPA 4DCXA 3VLWA 3FXQA 1JW5A 2AL5A 2QVVA 2CMOA 4N81A 5ISUA 1IXGA 5BUUA 4GFRA 5CMCA 4R74A 4EF2A 1BK4A 1D9VA 4OENA 2PX1A 3K0VA 3V89B 1JVYA 4P1EA 3VV5A 3MUQA 2OBGA 2HFBA 3BFUA 2CEXA 2REJA 3SEVA 4O94A 3OEKA 5EYHA 5I56B 2REGA 1SPIA 4LVQA 4KYEA 3ISPA 1P1WA 1NMUA 4DIGA 4OVPA 4DI3D 2ANJA 2PVUA 3PUVE 3KBRA 1T0KA 2I48A 3FJMA 4WXJA 1NUWA 5L8DA 5H8FA 1AWBA 3LSLA 3LSFB 2Y7RA 1YXIA 3FASA 4EQ9A 4MNPA 1B9JA 2HHMA 4OA4A 3C35A 3PPRA 3IOTA 4QFLA 5IGAA 3THIA 4UACA 1POTA 3ZSFA 3B6WA 4DE8A 4YB7A 4G77A 2JJKA 3N94A 2XX7A 4NF6A 1AL3A 5F24A 1QGXA 5DEXA 5J16A 4IO4A 3MYUA 3MVYA 4IR8A 5BWJA 5CM6A 3MSTA 4GIZA 2R9JA 1B7HA 2DS9A 2RINA 2NOOA 1XI6A 3O6GA 3C34A 4ELQA 5F1QA 4FAJA 1FQAA 3A3UA 4MX6A 4PAFA 1UIVA 5LDZA 1O7TA 3N6TA 4NF5A 3GXAA 3QUFA 1FQDA 1D9YA 3ECRA 3A09A 1NKXA 1LCTA 4BDQA 2RC7A 3FGSA 1QUKA 3RQTA 2XWOA 4MLQA 1FTKA 4HS7A 4XKPA 3ILTB 4QFOA 3MZ9A 2OLBA 5I56A 1EZOA 5TP9A 3QAXA 2ABHA 5H8HA 4U4XA 2VPOA 2FVZA 4TLMB 1CB6A 2XA5A 3T9XB 1LBWA 3QIMA 4EXLA 4OERA 4OYVA 4QXDA 1EYIA 4OVTA 4U1OA 1PB9A 3PD8A 1MM6A 2Q2AA 4POWA 5ELVA 5FHMA 5A5XB 1XHYA 2PMSA 2PBWA 4IB2A 1N04A 4N17A 3UIFA 4O7IA 3M3KA 2QMXA 4H45A 1QUIA 1US5A 1TT1A 1B3GA 4OQOA 4PFTA 4Z7EA 3ROJA 2AIXA 5B70A 3PV0E 2XWVA 2I4BA 2F97A 4GQOA 3LSXA 2CZLA 3OO6A 2QMWA 4F18A 5JK4A 4IY6A 4R6YA 5J1DA 2B3FA 3IORA 1XVXA 4WKMA 3TCFA 1SQYA 4LATA 3SEXA 5ET7A 5ESYA 3IOVA 2DP8A 5FHOA 1UQWA 4OEVA 3PPQA 4MEVA 5DTBA 4G2ZA 1FTLA 4WEDA 4MBPA 1OIBA 3G3JA 3O66A 1NFTA 4HW8A 1B7ZA 5AA1A 3B6QA 4FATA 2BJIA 1RDYA 1IZ1A 1NH7A 2MKZA 3G3IA 1VDWA 5AA4B 1FPJA 4F2QA 1B1HA 5HPQA 4GWYA 1MQGA 4N8YA 3K6UA 1DPPA 4NMYA 4GRKA 5I84A 4U23A 2X7QA 4Q5TA 3G3HA 4PFIA 3PMXA 3RPLB 3M3LA 4PGNA 1L5TA 5H8NB 1LAHE 4Q8RA 4P47A 1PB7A 3BIGA 2YPNA 3TQWA 3U72A 4JWOA 1M5EA 1RYOA 1S50A 3HHFA 1RKMA 4ZEFA 3TEPA 1MPCA 1B7UA 3CHGA 1IMEA 1ZTYA 1YTVA 2H98A 3FIRA 2VPNA 2V25A 3OD7A 4ZE9A 4ZECA 1FTMA 1B32A 4DLDA 3FATA 3VLUA 3B50A 5HM4B 1B0LA 2ZZXA 4PF8A 2I3WA 4RK9A 4LQ2A 3D4CA 4I3YA 5KDTB 4R72A 4GL8A 4R6HA 3KJ7A 1B4ZA 2ZZVA 5LOMA 5EHMA 1OMPA 1F9BA 3CSBA 1BLFA 4GXAA 3FXRA 4MNIA 1MY0A 2DXRA 1EYJA 2XWIA 4RNSA 2R71A 4I62A 4MFIA 2QJEA 1D9QA 3EHSA 4O3AA 1NNPA 1FJ9A 1MH4A 3P7IA 1EZPA 4ZEDA 1FBGA 3HHGA 2LAOA 3LV0A 2Y5LA 3UP9A 4F29A 1NI9A 2HAVA 3RPWA 4ELPA 1BKAA 2F5XA 3FVOA 3SEUA 4P8BA 2XWKA 1MRPA 2ZYKA 4OETA 5H8NA 5AA3A 1GVCA 3E78A 1B5IA 3O2AA 4ZEIA 2QPQA 4Q0CA 4YU0A 1NV6A 1LCFA 3W9WA 4DI4B 3GBBA 3MBPA 1ZU0A 2DYXA 1QVSA 1K9ZA 1GR2A 5F7VA 1IIWA 2QS2A 1MXUA 2QS4A 4THIA 2PT2A 2P0SA 3C31A 1S9TA 4JSDA 2O7UA 1NL5A 3TODA 1FBEA 1N7WA 2UYEA 2VD2A 3K01A 4H5FA 1MQHA 1LB8A 3PPOA 4P0IA 3IB1A 5ET5A 2OWZA 4XFEA 4UA8A 1B3HA 1AMFA 1NV4A 2CZHA 1LGBC 3LR1A 4HCWA 1EYKA 1B2HA 3LUZA 4NF8A 1MDP1 3E4RA 3KBZA 1N3XA 4KPTA 1GV8A 2O7IA 1Y20A 4EQBA 5H8SA 1QW0A 3O6HA 2HZLA 4H0WA 4ZS9A 3G3FA 3JYRA 4I9DA 3VXCA 3PUWE 3VLVA 4JSOA 5EYGA 5IZZA 3B7DA 3K6XA 2GH9A 2F6PA 1FQEA 1VFEA 5IZ3B 1Y1MA 1ZBMA 3DP8A 1M5FA 1UTHA 1M5DA 4PDHA 4YKPA 1NV5A 2PCRA 4N91A 4H5GA 3W9VA 4R73A 2HQ0A 4R75A 1EU8A 2QVRA 1INPA 4HE0A 3Q28A 5ICTA 2HAUA 3EQ1A 4F31B 2DDKA 3H4ZA 4N6DA 4HE1A 1UTBA 1A55A 2ZYMA 1Y4CA 1MXVA 2UVHA 4OFJA 3PGFA 4FBPA 4PFYA 3IAZA 4IO7A 1FCKA 1NNFA 4FIMA 4R6KA 1MH3A 2FA7A 1Y4TA 2V4CA 3HFUA 3FV2A 2QFLA 5CI5A 2F7AA 1SDXA 2A5SA 1B5HA 3TKDA 1I6BA 4YB6A 3L6HA 1RYXA 3IO4A 4U2RA 3U92A 4PETA 4NWCA 3MP6A 2Y7WA 4U21A 2P1SA 4N8GA 4G68B 2O84X 3IOWA 1LB9A 1N0TA 2D21A 3IO6A 4QFKA 3PPPA 4G4PA 1IITA 1B3LA 3PPNA 5IM2A 4ESWA 1J1NA 1FPEA 3K4UA 4JWXA 2QVUA 1MY1A 5ITPA 2UYFA 2PYYA 4PAKA 4YB5A 2OWTA 5M2VA 1XT8A 4H1XA 5I5PA 5DVIA 5IZ3A 5ITOA 3CRBA 2Z22A 3RGYA 1A7LA 2F3DA 3OMBA 1BP5A 4NN3A 4ONYA 2NVUB 3I3VA 1FPGA 4U4SA 4NWDA 1KZ8A 1LLSA 1FSAA 2G93A 1G0IA 2YLNA 3R6UA 5T3JA 1LBVA 4EXKA 2O1MA 3S9EA 2DVZA 3A29A 2V3TA 2DOJA 4ZZAA 5IAIA 4OMBA 1OQHA 3H7MA 1XVYA 2D5WA 2ESNA 2I4CA 3MP1A 3KJTA 1QKBA 1S7YA 5I57A 2QRYA 4MCOA 4FEBA 3CG3A 4YKKA 2FNCA 1VR5A 2Q2CA 1VE4A 3IJOB 4ZEKA 4YKJA 2FIEA 4TQUQ 3MP8A 1B52A 1CNQA 4U1ZA 4Q30B 1P1NA 1ELJA 3RYDA 1A99A 3K00A 4KFQA 3MQ9A 4NX1A
chains in the Genus database with same CATH topology
4N6PA 4GD5A 1Y1ZA 4RXLA 3FD3A 1URDA 3OELA 4F3GA 1B46A 3EHTA 3K02A 1ZKBA 3FZVA 2KLFA 4RPNA 3HPIA 1EZ9A 3H6WA 3DM0A 4IO3A 2M8CA 1A8EA 3RUMA 3EHUA 5CRYA 2I3VA 1N3WA 3IJXB 2OK2A 3CR9A 2IA4A 3I6VA 3KOTA 1SD3A 4LZ5A 4BDMA 2GHBA 3QYTA 3O29A 1O64A 3HV1A 1B05A 3RTFB 4JXIA 1D3KA 1LSTA 1UIUA 1H45A 3FJGA 5H8QB 3QK6A 2XD3A 4IGTA 2ONKE 4LZ7A 1NH8A 4H67A 1N7XA 2Z23A 4QFPA 1R9QA 4PFUA 1SW5A 2RCBA 4FE8A 3TCGA 1AIVA 3KSJA 3HSTA 4N07A 4WEPA 4R2BA 4I1DA 4KYSA 3MZ1A 1LBCA 4OEUA 3U1OA 3OO7A 1URGA 2R6GE 4ND9A 3TQLA 3K6VA 3G7WA 3SKPA 3TAJA 4R2FA 3K1PA 2VHAA 3FVGA 4OHNA 4OVJA 3V8XB 3HCQA 3OSRA 3R26A 2I0CA 3USDA 4FEDA 2H5YA 4NF4B 3S9MC 4BDRA 1LFIA 4KCDA 4MLVA 3TTNA 1MXWA 4PQJA 4ISUA 3SEWA 5TPAB 1H44A 2UVIA 3OO8A 3OENA 2V3QA 2QS1A 4NEDA 5A5XA 3KOSA 1B40A 2DWAA 2DWIA 3TUSA 1B1XA 1IXHA 4R9GA 3IB0A 4KHZE 1PC3A 2XHDA 4GVOA 2RC8A 2NXOA 4H6DA 2GRVA 3C33A 5EYFA 3CIJA 4ZE8A 4ELRA 2A5TB 3FXUA 3M8UA 3S9NC 3UA8A 3K6WA 1B6HA 2Y7PA 4P11A 4XXUA 4X1DA 1JEUA 3MPLA 3RY3A 1MQJA 3MWBA 1PBPA 3VVFA 5I59B 1OLCA 1JW1A 1DTGA 3KSXA 3FVNA 4IY5A 5KCJB 4GF8A 3U93A 1YCJA 3R7XA 3LC8A 5CMBA 4RYAA 1IXIA 1N84A 2OCUA 1SYIA 1DTZA 2E0SA 4RA1A 4POXA 3TPAA 2Y84A 4C1UA 3M3FA 3AXFA 3SESA 4EDPA 5B7DA 2E1SA 4YKIA 1USYH 5AA4A 4PP0A 4R9FA 3BFTA 2Z8FA 1JEVA 4AB6A 4JDFA 3O6IA 1R6ZA 3H03A 3N6UA 3OO9A 4LA9A 5I58B 1M5BA 3T96B 5I2NB 4AQ4A 5FTIA 2G29A 1Y9UA 3KN7A 2F35A 2RCAA 1B58A 3DLNA 3MVZA 3H6TA 1A40A 2VGQA 2THIA 3MVWA 2PT1A 2XXRA 3KN3A 2AL4A 3ODBA 1MXYA 1WVJA 1MQDA 2QS3A 2RF1A 3H3GA 3L6GA 2VOZA 5KDTA 2ZXTA 2DVCA 2XXHA 2DE4A 3KZGA 3K1MA 2B65A 4KI0E 1OLAA 4OTEA 2F78A 1Q35A 1Y3NA 3FV1A 4JBZA 2H25A 4GWOA 4ZDMA 2O6AA 1DOTA 3MJNA 4OZ9A 3B6TA 2V93A 5CMMA 2ZNUA 4F3BA 4KD5A 1DSNA 2RC9A 1ANFA 3TTKA 1B3FA 1N76A 4O3CA 4X48A 2Z8DA 5DVJA 5K2XA 3KG2A 1IEJA 3VFJA 5JEIA 3V83A 1MDQA 3OEMA 4EF1A 3TFLA 5I58A 4LZ8A 4XIGQ 4FJPA 3TTRA 4QSEA 1M5CA 1MXXA 1HSEA 1NNTA 1SI0A 3PMWA 4E0WA 2NWJA 2GHAA 3CSGA 3MC2A 5I2KB 4YMBA 2OJTA 3BKIB 2DQVA 3CG1A 4I8CA 1SI1A 1XS5A 4F1YA 2HZKA 4JB7A 3OSQA 5H8FB 4IGRA 3PUYE 3O28A 2XX8A 3CVGA 4NTLA 3TTMA 2I6EA 2XXYA 4H8JA 1URSA 2I58A 3RLFE 4NF6B 1B51A 5DEXB 2QL3A 3KEIA 3CFLA 4HCYA 1DPEA 1A8FA 4DCYA 4U22A 1GTKA 3G3GA 1R9LA 3RT8A 1D4NA 2F7CA 1AH5A 5L9OA 4G8NA 3T22A 4RPOA 1TXFA 3N26A 5DVFA 3SERA 4NF5B 4NE4A 3TELA 1YAEA 3CFZA 3CI8A 1USYE 3HN0A 3H06B 1Y3QA 3Q25A 1LFHA 2O69A 1OVTA 2XXPA 2ZYNA 1TWYA 3ILUB 3C32A 3DP6A 3C36A 5FTHA 1SW2A 1ZMGA 5TP9B 3KGCA 4EUOA 2ZNSA 3T9VA 3WAEA 5H8HB 5I2KA 4KCCA 2H9BA 4L17A 3OOAA 3H6VA 4GL0A 4MF3A 2VP1A 3MPKA 3F11A 5CBSA 1MY4A 1SBPA 4QRZA 1FW0A 4XKRA 3T93B 2F6GA 1IXCA 1EH3A 1OVBA 3H6UA 1POY1 3LSWA 2OWSA 2ONRA 3ZS6A 2UXAA 4DZ1A 2YJPA 2O1LA 2XXVA 4G68A 4GXSB 3W15C 1VFDA 3VE1B 1PBQA 3E13X 2O68A 1FQFA 1Q1KA 3E3KA 2Q8JA 1Y3PA 2DWHA 4RY1A 4BLAA 1IQ7A 1B0HA 1FQBA 1JETA 3IX1A 3TTLA 1LBBA 1ZIUA 3SEYA 3TMGA 2B3BA 4QF9A 3O97A 4ESXA 4BDNA 4F1UA 1HSJA 3DP4A 2XX9A 4YZZA 4TLLB 2XD2A 2Q89A 3IOUA 1WDNA 4IO5A 1AOVA 4BDOA 1BTJA 2VD3A 3PD9A 2FYIA 4XTCQ 4F22A 4OWDA 1JW4A 1P99A 2W7YA 2F36A 2XXIA 4TOZA 4Z0IA 1GGGA 1P1QA 3JV9A 3VVEA 3HO7A 1MPBA 1Z7NE 1QJMA 3T9HB 3V5AA 1O63A 3PUZE 3IK6B 2H4IA 2QSXA 4E0XA 2NUVA 3GLBA 3A3CA 4DXBA 3UK4A 1JVXA 2XXQA 3Q26A 3MVXA 3RN8A 4LUBA 3WAFA 5JTYB 4EQ7A 1I6AA 2P2AA 4C0RA 1MQIA 1LAXA 4C1TA 3QUJA 1I69A 3LBSA 2ONSA 2Y7KA 1FTOA 3K1NA 4FORA 4F39A 4OXVA 3IR1A 2DXYA 3U94A 3TZAA 2WKYA 3QXMA 1ATGA 3RT6B 5H8QA 1TFDA 4X9TA 4F2OA 3T66A 1MS7A 3QSLA 1IUDA 2X7PA 5DT6A 2IEEA 3SDFA 4IO6A 4ECFA 4MH5A 1QULA 2F7BA 4N13A 4G8MA 3C9HA 1JNFA 2AYSA 3OXNA 3PUXE 4LONB 4O3BA 4DXCA 5AE4A 1MPDA 3UN6A 2F34A 5K2YA 4RJZA 1XC1A 3K2DA 4HTGA 3EN3A 2Q9TA 1BIYA 1H3DA 1MM7A 1P1OA 1PEBA 3T9UA 1Z7ME 3FUZA 2RKMA 1MXZA 2O51A 3DELB 3U8QA 5L9SA 5TU0A 3KN8A 5JTYA 4QSDA 4GLIA 1OQGA 4PFWA 5HBCA 1VSOA 3GZGA 4NF4A 1II5A 3IB2A 3CFXA 2BJJX 1MG1A 3IL1B 1LAFE 3Q29A 4NF8B 2HXWA 5TPAA 3FJ7A 4GOTA 3RTWB 1H76A 1SYHA 3JZJA 4XKQA 3EPEA 2ZMBA 4IO2A 3TDJA 1US4A 4YAHX 3BBRA 4M4GA 4FECA 3N5LA 1QKAA 2I0BA 1R1NA 4K3FA 4F3PA 4QSCA 1FTJA 2Y7IA 4LP2B 1UTHB 3ZKKA 1SVXB 4AB5A 3MZBA 4PE5B 2UVJA 4YMAA 1B3EA 1YPNA 3KFMA 3Q27A 2A5TA 1MY2A 3MW0A 3S4UA 5IKBA 3GBAA 1H43A 4DXUA 1ZJLA 4H65A 2GFEA 5FHNA 2OZZA 2ZYOA 2Q88A 3FVKA 4QHQA 1ZLQA 5AA2B 2Z8EA 1UTBB 4G68C 2V84A 2XXUA 4X1BA 5I59A 1B5JA 4BDLA 5KCJA 2HCAA 1JQFA 2UVGA 5AA2D 4OFOA 3SETA 3UORA 1LFGA 2I49A 3S9LC 1NNKA 5ICQA 4RK2A 2XXXA 4QFNA 4ZZEA 5L9MA 5DYHA 4KR5A 2D3IA 4DDDA 3I5OA 3MAMA 1WODA 1I6QA 2ZNTA 4F3SA 1CE2A 1LAGE 5CMKA 2HEUA 3PMVA 1PB8A 4XKNA 5I2NA 2XXTA 1SW1A 4ZEBA 5KZTA 2DSFA 1DMBA 3O9PA 3C4MA 2DWJA 4H8IA 1A54A 1TFAA 2X26A 4OFLA 4YICA 2XXWA 3VVDA 3ZKLA 3RNNA 3PU5A 3VXBA 3G3KA 1KWHA 3LUYA 3TYHA 1PDAA 4KYDA 2H99A 3VDFA 5AA2A 2F8DA 3E9XA 4M1VA 3UGWA 2DE2A 5CBRA 2V3UA 4OESA 1FQCA 1B4HA 4F19A 5EHSA 2ALUA 1HSLA 3S2VA 1QUJA 5I57B 3ONMA 3D4GA 4JWYA 4P0GA 4F1VA 3EF7A 4LQ5A 4ELOA 1MY3A 1SW4A 5CC2A 1P1UA 4KQPA 1XOCA 3TCHA 4G8HA 2DE3A 4DCXA 3VLWA 3FXQA 1JW5A 2AL5A 2CMOA 5ISUA 1IXGA 5BUUA 4GFRA 5CMCA 4R74A 4EF2A 1D9VA 4OENA 2PX1A 3K0VA 3V89B 1JVYA 3VV5A 3MUQA 2OBGA 2HFBA 3BFUA 2REJA 3SEVA 3OEKA 5I56B 2REGA 4LVQA 4KYEA 1P1WA 1NMUA 4DIGA 2ANJA 2PVUA 3PUVE 3KBRA 1T0KA 2I48A 3FJMA 4WXJA 5L8DA 5H8FA 3LSLA 3LSFB 2Y7RA 3FASA 4EQ9A 1B9JA 3C35A 3PPRA 3IOTA 4QFLA 3THIA 4UACA 1POTA 3ZSFA 3B6WA 4DE8A 4YB7A 4G77A 3N94A 2XX7A 4NF6A 1AL3A 5DEXA 4IO4A 3MVYA 5BWJA 5CM6A 4GIZA 2R9JA 1B7HA 2DS9A 2RINA 2NOOA 3O6GA 3C34A 4ELQA 5F1QA 4FAJA 1FQAA 3A3UA 1UIVA 1O7TA 3N6TA 4NF5A 3GXAA 3QUFA 1FQDA 1D9YA 3ECRA 3A09A 1NKXA 1LCTA 4BDQA 2RC7A 3FGSA 1QUKA 3RQTA 4MLQA 1FTKA 4HS7A 4XKPA 3ILTB 4QFOA 3MZ9A 2OLBA 5I56A 1EZOA 5TP9A 3QAXA 2ABHA 5H8HA 4U4XA 4TLMB 1CB6A 3T9XB 3QIMA 4EXLA 4OERA 4OYVA 4U1OA 1PB9A 3PD8A 1MM6A 5A5XB 2Q2AA 4POWA 5ELVA 5FHMA 1XHYA 2PMSA 2PBWA 4IB2A 1N04A 3UIFA 3M3KA 2QMXA 1QUIA 1US5A 1TT1A 1B3GA 4OQOA 4PFTA 4Z7EA 2AIXA 5B70A 3PV0E 2I4BA 2F97A 4GQOA 3LSXA 2CZLA 3OO6A 2QMWA 4F18A 5JK4A 4IY6A 4R6YA 5J1DA 2B3FA 3IORA 1XVXA 4WKMA 3TCFA 1SQYA 4LATA 3SEXA 3IOVA 2DP8A 5FHOA 1UQWA 4OEVA 3PPQA 5DTBA 4G2ZA 1FTLA 4WEDA 4MBPA 1OIBA 3G3JA 3O66A 1NFTA 4HW8A 1B7ZA 5AA1A 3B6QA 4FATA 1IZ1A 1NH7A 3G3IA 5AA4B 4F2QA 1B1HA 5HPQA 1MQGA 3K6UA 1DPPA 4NMYA 4GRKA 5I84A 4U23A 2X7QA 4Q5TA 3G3HA 3PMXA 3M3LA 1L5TA 5H8NB 1LAHE 4Q8RA 1PB7A 2YPNA 3TQWA 3U72A 4JWOA 1M5EA 1RYOA 1S50A 3HHFA 1RKMA 4ZEFA 3TEPA 1MPCA 1B7UA 1ZTYA 1YTVA 2H98A 3FIRA 2V25A 3OD7A 4ZE9A 4ZECA 1FTMA 1B32A 4DLDA 3FATA 3VLUA 5HM4B 1B0LA 2I3WA 4RK9A 4LQ2A 3D4CA 5KDTB 4R72A 4GL8A 4R6HA 3KJ7A 1B4ZA 5LOMA 5EHMA 1OMPA 1F9BA 3CSBA 1BLFA 4GXAA 3FXRA 1MY0A 2DXRA 4RNSA 2R71A 4I62A 4MFIA 2QJEA 3EHSA 4O3AA 1NNPA 1MH4A 3P7IA 1EZPA 4ZEDA 3HHGA 2LAOA 3UP9A 4F29A 2HAVA 3RPWA 4ELPA 1BKAA 2F5XA 3FVOA 3SEUA 1MRPA 2ZYKA 4OETA 5H8NA 5AA3A 1GVCA 1B5IA 3O2AA 4ZEIA 2QPQA 4Q0CA 4YU0A 1LCFA 3W9WA 3GBBA 3MBPA 1ZU0A 2DYXA 1QVSA 1GR2A 5F7VA 1IIWA 2QS2A 1MXUA 2QS4A 4THIA 2PT2A 2P0SA 3C31A 1S9TA 4JSDA 2O7UA 1NL5A 3TODA 1N7WA 2UYEA 2VD2A 3K01A 4H5FA 1MQHA 1LB8A 3PPOA 4P0IA 3IB1A 4UA8A 1B3HA 1AMFA 1LGBC 3LR1A 4HCWA 1B2HA 4NF8A 1MDP1 3E4RA 1N3XA 4KPTA 1GV8A 2O7IA 1Y20A 4EQBA 5H8SA 1QW0A 3O6HA 2HZLA 4H0WA 4ZS9A 3G3FA 3JYRA 4I9DA 3VXCA 3PUWE 3VLVA 4JSOA 3B7DA 3K6XA 2GH9A 2F6PA 1FQEA 1VFEA 1Y1MA 1ZBMA 3DP8A 1M5FA 1UTHA 1M5DA 4YKPA 4H5GA 3W9VA 4R73A 2HQ0A 4R75A 1EU8A 3Q28A 5ICTA 2HAUA 3EQ1A 4F31B 3H4ZA 1UTBA 1A55A 2ZYMA 1Y4CA 1MXVA 2UVHA 4OFJA 3PGFA 4PFYA 3IAZA 4IO7A 1FCKA 1NNFA 4FIMA 4R6KA 1MH3A 2FA7A 1Y4TA 3FV2A 5CI5A 2F7AA 1SDXA 2A5SA 1B5HA 3TKDA 1I6BA 4YB6A 3L6HA 1RYXA 3IO4A 4U2RA 3U92A 4PETA 4NWCA 3MP6A 2Y7WA 4U21A 2P1SA 4G68B 2O84X 3IOWA 1LB9A 1N0TA 2D21A 3IO6A 4QFKA 3PPPA 4G4PA 1IITA 1B3LA 3PPNA 4ESWA 1J1NA 3K4UA 4JWXA 1MY1A 5ITPA 2UYFA 2PYYA 4YB5A 2OWTA 5M2VA 1XT8A 4H1XA 5DVIA 5ITOA 3CRBA 2Z22A 3RGYA 1A7LA 3OMBA 1BP5A 4ONYA 2NVUB 3I3VA 4U4SA 4NWDA 1LLSA 2G93A 2YLNA 3R6UA 4EXKA 2O1MA 3S9EA 2DVZA 2V3TA 2DOJA 4ZZAA 5IAIA 4OMBA 1OQHA 3H7MA 1XVYA 2D5WA 2ESNA 2I4CA 3MP1A 3KJTA 1QKBA 1S7YA 5I57A 2QRYA 4FEBA 3CG3A 4YKKA 2FNCA 1VR5A 2Q2CA 1VE4A 3IJOB 4ZEKA 4YKJA 4TQUQ 3MP8A 1B52A 4U1ZA 4Q30B 1P1NA 1ELJA 1A99A 3K00A 4KFQA 3MQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6P A;  4GD5 A;  1Y1Z A;  4RXL A;  3FD3 A;  1URD A;  3OEL A;  4F3G A;  1B46 A;  3EHT A;  3K02 A;  1ZKB A;  3FZV A;  2KLF A;  4RPN A;  3HPI A;  1EZ9 A;  3H6W A;  3DM0 A;  4IO3 A;  2M8C A;  1A8E A;  3RUM A;  3EHU A;  5CRY A;  2I3V A;  1N3W A;  3IJX B;  2OK2 A;  3CR9 A;  2IA4 A;  3I6V A;  3KOT A;  1SD3 A;  4LZ5 A;  4BDM A;  2GHB A;  3QYT A;  3O29 A;  1O64 A;  3HV1 A;  1B05 A;  3RTF B;  4JXI A;  1D3K A;  1LST A;  1UIU A;  1H45 A;  3FJG A;  5H8Q B;  3QK6 A;  2XD3 A;  4IGT A;  2ONK E;  4LZ7 A;  1NH8 A;  4H67 A;  1N7X A;  2Z23 A;  4QFP A;  1R9Q A;  4PFU A;  1SW5 A;  2RCB A;  4FE8 A;  3TCG A;  1AIV A;  3KSJ A;  3HST A;  4N07 A;  4WEP A;  4R2B A;  4I1D A;  4KYS A;  3MZ1 A;  1LBC A;  4OEU A;  3U1O A;  3OO7 A;  1URG A;  2R6G E;  4ND9 A;  3TQL A;  3K6V A;  3G7W A;  3SKP A;  3TAJ A;  4R2F A;  3K1P A;  2VHA A;  3FVG A;  4OHN A;  4OVJ A;  3V8X B;  3HCQ A;  3OSR A;  3R26 A;  2I0C A;  3USD A;  4FED A;  2H5Y A;  4NF4 B;  3S9M C;  4BDR A;  1LFI A;  4KCD A;  4MLV A;  3TTN A;  1MXW A;  4PQJ A;  4ISU A;  3SEW A;  5TPA B;  1H44 A;  2UVI A;  3OO8 A;  3OEN A;  2V3Q A;  2QS1 A;  4NED A;  5A5X A;  3KOS A;  1B40 A;  2DWA A;  2DWI A;  3TUS A;  1B1X A;  1IXH A;  4R9G A;  3IB0 A;  4KHZ E;  1PC3 A;  2XHD A;  4GVO A;  2RC8 A;  2NXO A;  4H6D A;  2GRV A;  3C33 A;  5EYF A;  3CIJ A;  4ZE8 A;  4ELR A;  2A5T B;  3FXU A;  3M8U A;  3S9N C;  3UA8 A;  3K6W A;  1B6H A;  2Y7P A;  4P11 A;  4XXU A;  4X1D A;  1JEU A;  3MPL A;  3RY3 A;  1MQJ A;  3MWB A;  1PBP A;  3VVF A;  5I59 B;  1OLC A;  1JW1 A;  1DTG A;  3KSX A;  3FVN A;  4IY5 A;  5KCJ B;  4GF8 A;  3U93 A;  1YCJ A;  3R7X A;  3LC8 A;  5CMB A;  4RYA A;  1IXI A;  1N84 A;  2OCU A;  1SYI A;  1DTZ A;  2E0S A;  4RA1 A;  4POX A;  3TPA A;  2Y84 A;  4C1U A;  3M3F A;  3AXF A;  3SES A;  4EDP A;  5B7D A;  2E1S A;  4YKI A;  1USY H;  5AA4 A;  4PP0 A;  4R9F A;  3BFT A;  2Z8F A;  1JEV A;  4AB6 A;  4JDF A;  3O6I A;  1R6Z A;  3H03 A;  3N6U A;  3OO9 A;  4LA9 A;  5I58 B;  1M5B A;  3T96 B;  5I2N B;  4AQ4 A;  5FTI A;  2G29 A;  1Y9U A;  3KN7 A;  2F35 A;  2RCA A;  1B58 A;  3DLN A;  3MVZ A;  3H6T A;  1A40 A;  2VGQ A;  2THI A;  3MVW A;  2PT1 A;  2XXR A;  3KN3 A;  2AL4 A;  3ODB A;  1MXY A;  1WVJ A;  1MQD A;  2QS3 A;  2RF1 A;  3H3G A;  3L6G A;  2VOZ A;  5KDT A;  2ZXT A;  2DVC A;  2XXH A;  2DE4 A;  3KZG A;  3K1M A;  2B65 A;  4KI0 E;  1OLA A;  4OTE A;  2F78 A;  1Q35 A;  1Y3N A;  3FV1 A;  4JBZ A;  2H25 A;  4GWO A;  4ZDM A;  2O6A A;  1DOT A;  3MJN A;  4OZ9 A;  3B6T A;  2V93 A;  5CMM A;  2ZNU A;  4F3B A;  4KD5 A;  1DSN A;  2RC9 A;  1ANF A;  3TTK A;  1B3F A;  1N76 A;  4O3C A;  4X48 A;  2Z8D A;  5DVJ A;  5K2X A;  3KG2 A;  1IEJ A;  3VFJ A;  5JEI A;  3V83 A;  1MDQ A;  3OEM A;  4EF1 A;  3TFL A;  5I58 A;  4LZ8 A;  4XIG Q;  4FJP A;  3TTR A;  4QSE A;  1M5C A;  1MXX A;  1HSE A;  1NNT A;  1SI0 A;  3PMW A;  4E0W A;  2NWJ A;  2GHA A;  3CSG A;  3MC2 A;  5I2K B;  4YMB A;  2OJT A;  3BKI B;  2DQV A;  3CG1 A;  4I8C A;  1SI1 A;  1XS5 A;  4F1Y A;  2HZK A;  4JB7 A;  3OSQ A;  5H8F B;  4IGR A;  3PUY E;  3O28 A;  2XX8 A;  3CVG A;  4NTL A;  3TTM A;  2I6E A;  2XXY A;  4H8J A;  1URS A;  2I58 A;  3RLF E;  4NF6 B;  1B51 A;  5DEX B;  2QL3 A;  3KEI A;  3CFL A;  4HCY A;  1DPE A;  1A8F A;  4DCY A;  4U22 A;  1GTK A;  3G3G A;  1R9L A;  3RT8 A;  1D4N A;  2F7C A;  1AH5 A;  5L9O A;  4G8N A;  3T22 A;  4RPO A;  1TXF A;  3N26 A;  5DVF A;  3SER A;  4NF5 B;  4NE4 A;  3TEL A;  1YAE A;  3CFZ A;  3CI8 A;  1USY E;  3HN0 A;  3H06 B;  1Y3Q A;  3Q25 A;  1LFH A;  2O69 A;  1OVT A;  2XXP A;  2ZYN A;  1TWY A;  3ILU B;  3C32 A;  3DP6 A;  3C36 A;  5FTH A;  1SW2 A;  1ZMG A;  5TP9 B;  3KGC A;  4EUO A;  2ZNS A;  3T9V A;  3WAE A;  5H8H B;  5I2K A;  4KCC A;  2H9B A;  4L17 A;  3OOA A;  3H6V A;  4GL0 A;  4MF3 A;  2VP1 A;  3MPK A;  3F11 A;  5CBS A;  1MY4 A;  1SBP A;  4QRZ A;  1FW0 A;  4XKR A;  3T93 B;  2F6G A;  1IXC A;  1EH3 A;  1OVB A;  3H6U A;  1POY 1;  3LSW A;  2OWS A;  2ONR A;  3ZS6 A;  2UXA A;  4DZ1 A;  2YJP A;  2O1L A;  2XXV A;  4G68 A;  4GXS B;  3W15 C;  1VFD A;  3VE1 B;  1PBQ A;  3E13 X;  2O68 A;  1FQF A;  1Q1K A;  3E3K A;  2Q8J A;  1Y3P A;  2DWH A;  4RY1 A;  4BLA A;  1IQ7 A;  1B0H A;  1FQB A;  1JET A;  3IX1 A;  3TTL A;  1LBB A;  1ZIU A;  3SEY A;  3TMG A;  2B3B A;  4QF9 A;  3O97 A;  4ESX A;  4BDN A;  4F1U A;  1HSJ A;  3DP4 A;  2XX9 A;  4YZZ A;  4TLL B;  2XD2 A;  2Q89 A;  3IOU A;  1WDN A;  4IO5 A;  1AOV A;  4BDO A;  1BTJ A;  2VD3 A;  3PD9 A;  2FYI A;  4XTC Q;  4F22 A;  4OWD A;  1JW4 A;  1P99 A;  2W7Y A;  2F36 A;  2XXI A;  4TOZ A;  4Z0I A;  1GGG A;  1P1Q A;  3JV9 A;  3VVE A;  3HO7 A;  1MPB A;  1Z7N E;  1QJM A;  3T9H B;  3V5A A;  1O63 A;  3PUZ E;  3IK6 B;  2H4I A;  2QSX A;  4E0X A;  2NUV A;  3GLB A;  3A3C A;  4DXB A;  3UK4 A;  1JVX A;  2XXQ A;  3Q26 A;  3MVX A;  3RN8 A;  4LUB A;  3WAF A;  5JTY B;  4EQ7 A;  1I6A A;  2P2A A;  4C0R A;  1MQI A;  1LAX A;  4C1T A;  3QUJ A;  1I69 A;  3LBS A;  2ONS A;  2Y7K A;  1FTO A;  3K1N A;  4FOR A;  4F39 A;  4OXV A;  3IR1 A;  2DXY A;  3U94 A;  3TZA A;  2WKY A;  3QXM A;  1ATG A;  3RT6 B;  5H8Q A;  1TFD A;  4X9T A;  4F2O A;  3T66 A;  1MS7 A;  3QSL A;  1IUD A;  2X7P A;  5DT6 A;  2IEE A;  3SDF A;  4IO6 A;  4ECF A;  4MH5 A;  1QUL A;  2F7B A;  4N13 A;  4G8M A;  3C9H A;  1JNF A;  2AYS A;  3OXN A;  3PUX E;  4LON B;  4O3B A;  4DXC A;  5AE4 A;  1MPD A;  3UN6 A;  2F34 A;  5K2Y A;  4RJZ A;  1XC1 A;  3K2D A;  4HTG A;  3EN3 A;  2Q9T A;  1BIY A;  1H3D A;  1MM7 A;  1P1O A;  1PEB A;  3T9U A;  1Z7M E;  3FUZ A;  2RKM A;  1MXZ A;  2O51 A;  3DEL B;  3U8Q A;  5L9S A;  5TU0 A;  3KN8 A;  5JTY A;  4QSD A;  4GLI A;  1OQG A;  4PFW A;  5HBC A;  1VSO A;  3GZG A;  4NF4 A;  1II5 A;  3IB2 A;  3CFX A;  2BJJ X;  1MG1 A;  3IL1 B;  1LAF E;  3Q29 A;  4NF8 B;  2HXW A;  5TPA A;  3FJ7 A;  4GOT A;  3RTW B;  1H76 A;  1SYH A;  3JZJ A;  4XKQ A;  3EPE A;  2ZMB A;  4IO2 A;  3TDJ A;  1US4 A;  4YAH X;  3BBR A;  4M4G A;  4FEC A;  3N5L A;  1QKA A;  2I0B A;  1R1N A;  4K3F A;  4F3P A;  4QSC A;  1FTJ A;  2Y7I A;  4LP2 B;  1UTH B;  3ZKK A;  1SVX B;  4AB5 A;  3MZB A;  4PE5 B;  2UVJ A;  4YMA A;  1B3E A;  1YPN A;  3KFM A;  3Q27 A;  2A5T A;  1MY2 A;  3MW0 A;  3S4U A;  5IKB A;  3GBA A;  1H43 A;  4DXU A;  1ZJL A;  4H65 A;  2GFE A;  5FHN A;  2OZZ A;  2ZYO A;  2Q88 A;  3FVK A;  4QHQ A;  1ZLQ A;  5AA2 B;  2Z8E A;  1UTB B;  4G68 C;  2V84 A;  2XXU A;  4X1B A;  5I59 A;  1B5J A;  4BDL A;  5KCJ A;  2HCA A;  1JQF A;  2UVG A;  5AA2 D;  4OFO A;  3SET A;  3UOR A;  1LFG A;  2I49 A;  3S9L C;  1NNK A;  5ICQ A;  4RK2 A;  2XXX A;  4QFN A;  4ZZE A;  5L9M A;  5DYH A;  4KR5 A;  2D3I A;  4DDD A;  3I5O A;  3MAM A;  1WOD A;  1I6Q A;  2ZNT A;  4F3S A;  1CE2 A;  1LAG E;  5CMK A;  2HEU A;  3PMV A;  1PB8 A;  4XKN A;  5I2N A;  2XXT A;  1SW1 A;  4ZEB A;  5KZT A;  2DSF A;  1DMB A;  3O9P A;  3C4M A;  2DWJ A;  4H8I A;  1A54 A;  1TFA A;  2X26 A;  4OFL A;  4YIC A;  2XXW A;  3VVD A;  3ZKL A;  3RNN A;  3PU5 A;  3VXB A;  3G3K A;  1KWH A;  3LUY A;  3TYH A;  1PDA A;  4KYD A;  2H99 A;  3VDF A;  5AA2 A;  2F8D A;  3E9X A;  4M1V A;  3UGW A;  2DE2 A;  5CBR A;  2V3U A;  4OES A;  1FQC A;  1B4H A;  4F19 A;  5EHS A;  2ALU A;  1HSL A;  3S2V A;  1QUJ A;  5I57 B;  3ONM A;  3D4G A;  4JWY A;  4P0G A;  4F1V A;  3EF7 A;  4LQ5 A;  4ELO A;  1MY3 A;  1SW4 A;  5CC2 A;  1P1U A;  4KQP A;  1XOC A;  3TCH A;  4G8H A;  2DE3 A;  4DCX A;  3VLW A;  3FXQ A;  1JW5 A;  2AL5 A;  2CMO A;  5ISU A;  1IXG A;  5BUU A;  4GFR A;  5CMC A;  4R74 A;  4EF2 A;  1D9V A;  4OEN A;  2PX1 A;  3K0V A;  3V89 B;  1JVY A;  3VV5 A;  3MUQ A;  2OBG A;  2HFB A;  3BFU A;  2REJ A;  3SEV A;  3OEK A;  5I56 B;  2REG A;  4LVQ A;  4KYE A;  1P1W A;  1NMU A;  4DIG A;  2ANJ A;  2PVU A;  3PUV E;  3KBR A;  1T0K A;  2I48 A;  3FJM A;  4WXJ A;  5L8D A;  5H8F A;  3LSL A;  3LSF B;  2Y7R A;  3FAS A;  4EQ9 A;  1B9J A;  3C35 A;  3PPR A;  3IOT A;  4QFL A;  3THI A;  4UAC A;  1POT A;  3ZSF A;  3B6W A;  4DE8 A;  4YB7 A;  4G77 A;  3N94 A;  2XX7 A;  4NF6 A;  1AL3 A;  5DEX A;  4IO4 A;  3MVY A;  5BWJ A;  5CM6 A;  4GIZ A;  2R9J A;  1B7H A;  2DS9 A;  2RIN A;  2NOO A;  3O6G A;  3C34 A;  4ELQ A;  5F1Q A;  4FAJ A;  1FQA A;  3A3U A;  1UIV A;  1O7T A;  3N6T A;  4NF5 A;  3GXA A;  3QUF A;  1FQD A;  1D9Y A;  3ECR A;  3A09 A;  1NKX A;  1LCT A;  4BDQ A;  2RC7 A;  3FGS A;  1QUK A;  3RQT A;  4MLQ A;  1FTK A;  4HS7 A;  4XKP A;  3ILT B;  4QFO A;  3MZ9 A;  2OLB A;  5I56 A;  1EZO A;  5TP9 A;  3QAX A;  2ABH A;  5H8H A;  4U4X A;  4TLM B;  1CB6 A;  3T9X B;  3QIM A;  4EXL A;  4OER A;  4OYV A;  4U1O A;  1PB9 A;  3PD8 A;  1MM6 A;  5A5X B;  2Q2A A;  4POW A;  5ELV A;  5FHM A;  1XHY A;  2PMS A;  2PBW A;  4IB2 A;  1N04 A;  3UIF A;  3M3K A;  2QMX A;  1QUI A;  1US5 A;  1TT1 A;  1B3G A;  4OQO A;  4PFT A;  4Z7E A;  2AIX A;  5B70 A;  3PV0 E;  2I4B A;  2F97 A;  4GQO A;  3LSX A;  2CZL A;  3OO6 A;  2QMW A;  4F18 A;  5JK4 A;  4IY6 A;  4R6Y A;  5J1D A;  2B3F A;  3IOR A;  1XVX A;  4WKM A;  3TCF A;  1SQY A;  4LAT A;  3SEX A;  3IOV A;  2DP8 A;  5FHO A;  1UQW A;  4OEV A;  3PPQ A;  5DTB A;  4G2Z A;  1FTL A;  4WED A;  4MBP A;  1OIB A;  3G3J A;  3O66 A;  1NFT A;  4HW8 A;  1B7Z A;  5AA1 A;  3B6Q A;  4FAT A;  1IZ1 A;  1NH7 A;  3G3I A;  5AA4 B;  4F2Q A;  1B1H A;  5HPQ A;  1MQG A;  3K6U A;  1DPP A;  4NMY A;  4GRK A;  5I84 A;  4U23 A;  2X7Q A;  4Q5T A;  3G3H A;  3PMX A;  3M3L A;  1L5T A;  5H8N B;  1LAH E;  4Q8R A;  1PB7 A;  2YPN A;  3TQW A;  3U72 A;  4JWO A;  1M5E A;  1RYO A;  1S50 A;  3HHF A;  1RKM A;  4ZEF A;  3TEP A;  1MPC A;  1B7U A;  1ZTY A;  1YTV A;  2H98 A;  3FIR A;  2V25 A;  3OD7 A;  4ZE9 A;  4ZEC A;  1FTM A;  1B32 A;  4DLD A;  3FAT A;  3VLU A;  5HM4 B;  1B0L A;  2I3W A;  4RK9 A;  4LQ2 A;  3D4C A;  5KDT B;  4R72 A;  4GL8 A;  4R6H A;  3KJ7 A;  1B4Z A;  5LOM A;  5EHM A;  1OMP A;  1F9B A;  3CSB A;  1BLF A;  4GXA A;  3FXR A;  1MY0 A;  2DXR A;  4RNS A;  2R71 A;  4I62 A;  4MFI A;  2QJE A;  3EHS A;  4O3A A;  1NNP A;  1MH4 A;  3P7I A;  1EZP A;  4ZED A;  3HHG A;  2LAO A;  3UP9 A;  4F29 A;  2HAV A;  3RPW A;  4ELP A;  1BKA A;  2F5X A;  3FVO A;  3SEU A;  1MRP A;  2ZYK A;  4OET A;  5H8N A;  5AA3 A;  1GVC A;  1B5I A;  3O2A A;  4ZEI A;  2QPQ A;  4Q0C A;  4YU0 A;  1LCF A;  3W9W A;  3GBB A;  3MBP A;  1ZU0 A;  2DYX A;  1QVS A;  1GR2 A;  5F7V A;  1IIW A;  2QS2 A;  1MXU A;  2QS4 A;  4THI A;  2PT2 A;  2P0S A;  3C31 A;  1S9T A;  4JSD A;  2O7U A;  1NL5 A;  3TOD A;  1N7W A;  2UYE A;  2VD2 A;  3K01 A;  4H5F A;  1MQH A;  1LB8 A;  3PPO A;  4P0I A;  3IB1 A;  4UA8 A;  1B3H A;  1AMF A;  1LGB C;  3LR1 A;  4HCW A;  1B2H A;  4NF8 A;  1MDP 1;  3E4R A;  1N3X A;  4KPT A;  1GV8 A;  2O7I A;  1Y20 A;  4EQB A;  5H8S A;  1QW0 A;  3O6H A;  2HZL A;  4H0W A;  4ZS9 A;  3G3F A;  3JYR A;  4I9D A;  3VXC A;  3PUW E;  3VLV A;  4JSO A;  3B7D A;  3K6X A;  2GH9 A;  2F6P A;  1FQE A;  1VFE A;  1Y1M A;  1ZBM A;  3DP8 A;  1M5F A;  1UTH A;  1M5D A;  4YKP A;  4H5G A;  3W9V A;  4R73 A;  2HQ0 A;  4R75 A;  1EU8 A;  3Q28 A;  5ICT A;  2HAU A;  3EQ1 A;  4F31 B;  3H4Z A;  1UTB A;  1A55 A;  2ZYM A;  1Y4C A;  1MXV A;  2UVH A;  4OFJ A;  3PGF A;  4PFY A;  3IAZ A;  4IO7 A;  1FCK A;  1NNF A;  4FIM A;  4R6K A;  1MH3 A;  2FA7 A;  1Y4T A;  3FV2 A;  5CI5 A;  2F7A A;  1SDX A;  2A5S A;  1B5H A;  3TKD A;  1I6B A;  4YB6 A;  3L6H A;  1RYX A;  3IO4 A;  4U2R A;  3U92 A;  4PET A;  4NWC A;  3MP6 A;  2Y7W A;  4U21 A;  2P1S A;  4G68 B;  2O84 X;  3IOW A;  1LB9 A;  1N0T A;  2D21 A;  3IO6 A;  4QFK A;  3PPP A;  4G4P A;  1IIT A;  1B3L A;  3PPN A;  4ESW A;  1J1N A;  3K4U A;  4JWX A;  1MY1 A;  5ITP A;  2UYF A;  2PYY A;  4YB5 A;  2OWT A;  5M2V A;  1XT8 A;  4H1X A;  5DVI A;  5ITO A;  3CRB A;  2Z22 A;  3RGY A;  1A7L A;  3OMB A;  1BP5 A;  4ONY A;  2NVU B;  3I3V A;  4U4S A;  4NWD A;  1LLS A;  2G93 A;  2YLN A;  3R6U A;  4EXK A;  2O1M A;  3S9E A;  2DVZ A;  2V3T A;  2DOJ A;  4ZZA A;  5IAI A;  4OMB A;  1OQH A;  3H7M A;  1XVY A;  2D5W A;  2ESN A;  2I4C A;  3MP1 A;  3KJT A;  1QKB A;  1S7Y A;  5I57 A;  2QRY A;  4FEB A;  3CG3 A;  4YKK A;  2FNC A;  1VR5 A;  2Q2C A;  1VE4 A;  3IJO B;  4ZEK A;  4YKJ A;  4TQU Q;  3MP8 A;  1B52 A;  4U1Z A;  4Q30 B;  1P1N A;  1ELJ A;  1A99 A;  3K00 A;  4KFQ A;  3MQ9 A; 
#chains in the Genus database with same CATH topology
 4N6P A;  2CZI A;  4GD5 A;  1Y1Z A;  4NG7 A;  1IMD A;  4RXL A;  3FD3 A;  1URD A;  3OEL A;  4F3G A;  1B46 A;  3EHT A;  3K02 A;  1ZKB A;  3E79 A;  3FZV A;  2KLF A;  4RPN A;  3HPI A;  1EZ9 A;  3H6W A;  3DM0 A;  4IO3 A;  2M8C A;  1A8E A;  3RUM A;  3EHU A;  5CRY A;  2I3V A;  1N3W A;  3IJX B;  2OK2 A;  3CR9 A;  2IA4 A;  3I6V A;  3KOT A;  1SD3 A;  4LZ5 A;  4BDM A;  2GHB A;  1YZ0 A;  3QYT A;  3O29 A;  1O64 A;  3HV1 A;  1B05 A;  3RTF B;  4JXI A;  1D3K A;  1LST A;  1UIU A;  1H45 A;  1FBD A;  2CEY A;  1FPF A;  2Q74 A;  3FJG A;  4P1L A;  5H8Q B;  3QK6 A;  2XD3 A;  4IGT A;  2ONK E;  4LZ7 A;  1NH8 A;  2GQ1 A;  4KXP A;  4H67 A;  1N7X A;  2Z23 A;  2L5V A;  4QFP A;  1R9Q A;  4PFU A;  1SW5 A;  2RCB A;  4FE8 A;  1NV2 A;  3TCG A;  1AIV A;  3KSJ A;  3HST A;  4N07 A;  4WEP A;  4R2B A;  4I1D A;  4KYS A;  3MZ1 A;  4PFB A;  1LBC A;  4OEU A;  3U1O A;  2HXR A;  3OO7 A;  1URG A;  3FXB A;  2R6G E;  4ND9 A;  4P3L A;  3TQL A;  3K6V A;  5LTC A;  3G7W A;  3SKP A;  3TAJ A;  2VT5 A;  4R2F A;  3K1P A;  2VHA A;  3FVG A;  4OHN A;  4OVJ A;  3V8X B;  3HCQ A;  3OSR A;  3R26 A;  2I0C A;  3USD A;  4FED A;  2H5Y A;  3KC0 A;  1FPK A;  4NF4 B;  3S9M C;  4BDR A;  1LFI A;  4KCD A;  4MLV A;  3TTN A;  1MXW A;  4PQJ A;  4ISU A;  4OVR A;  4LN5 A;  3SEW A;  5TPA B;  1H44 A;  2UVI A;  2FIX A;  3OO8 A;  3OEN A;  2PFZ A;  2V3Q A;  2QS1 A;  4NED A;  5A5X A;  3KOS A;  1B40 A;  2DWA A;  4O8M A;  2DWI A;  3TUS A;  1B1X A;  1IXH A;  4R9G A;  3IB0 A;  1FBF A;  4KHZ E;  1PC3 A;  2XHD A;  4GVO A;  2RC8 A;  2NXO A;  4H6D A;  2GRV A;  1LEV A;  4PCD A;  3C33 A;  5EYF A;  4NGU A;  4OVS A;  4OAN A;  3CIJ A;  4ZE8 A;  4ELR A;  2A5T B;  3FXU A;  3M8U A;  3S9N C;  3UA8 A;  3K6W A;  1B6H A;  2Y7P A;  4PDD A;  4P11 A;  4XXU A;  4X1D A;  1JEU A;  3MPL A;  2KR0 A;  3RY3 A;  1MQJ A;  1FBP A;  3QMF A;  2WEF A;  3MWB A;  1PBP A;  4PC9 A;  3BIH A;  3VVF A;  4AS5 A;  5I59 B;  2WBB A;  1OLC A;  1JW1 A;  1DTG A;  3KSX A;  3FVN A;  4IY5 A;  5KCJ B;  4GF8 A;  3U93 A;  1YCJ A;  3R7X A;  4MHF A;  1FBH A;  3LC8 A;  5CMB A;  1IMB A;  4RYA A;  1IXI A;  1N84 A;  2OCU A;  2WBD A;  1SYI A;  1DTZ A;  2E0S A;  4RA1 A;  4POX A;  1IMC A;  3TPA A;  2Y84 A;  4C1U A;  3M3F A;  3AXF A;  3SES A;  4EDP A;  4OVQ A;  5B7D A;  2E1S A;  4YKI A;  1USY H;  5AA4 A;  4PP0 A;  4R9F A;  4AS4 A;  3BFT A;  2Z8F A;  1JEV A;  4AB6 A;  4JDF A;  3O6I A;  1R6Z A;  3H03 A;  4N4U A;  3N6U A;  3OO9 A;  4LA9 A;  5I58 B;  1M5B A;  3T96 B;  5I2N B;  3RPL A;  4AQ4 A;  5FTI A;  2G29 A;  1Y9U A;  3KN7 A;  2F35 A;  2RCA A;  1B58 A;  3DLN A;  3MVZ A;  3H6T A;  5EQ9 A;  1A40 A;  2VGQ A;  4X04 A;  2THI A;  4G61 A;  3MVW A;  2PT1 A;  2XXR A;  5DW8 A;  3KN3 A;  2AL4 A;  3ODB A;  1MXY A;  1WVJ A;  1MQD A;  2QS3 A;  5ET8 A;  2RF1 A;  3H3G A;  3L6G A;  2VOZ A;  5KDT A;  2ZXT A;  2DVC A;  2XXH A;  2DE4 A;  3KZG A;  3K1M A;  2B65 A;  4NQ8 A;  3U65 A;  4KI0 E;  1OLA A;  4OTE A;  2F78 A;  1Q35 A;  1Y3N A;  3FV1 A;  4JBZ A;  2H25 A;  4GWO A;  4ZDM A;  2O6A A;  1DOT A;  1RDZ A;  3B8B A;  3MJN A;  4OZ9 A;  3B6T A;  2V93 A;  5CMM A;  2ZNU A;  4F3B A;  4KD5 A;  1DSN A;  2RC9 A;  1ANF A;  3TTK A;  1B3F A;  1N76 A;  4O3C A;  4X48 A;  2Z8D A;  5DVJ A;  5K2X A;  3KG2 A;  1IEJ A;  3VFJ A;  5JEI A;  3V83 A;  1MDQ A;  3OEM A;  4EF1 A;  3TFL A;  5I58 A;  3NOH A;  4LZ8 A;  4XIG Q;  4FJP A;  3TTR A;  4QSE A;  1M5C A;  1MXX A;  1HSE A;  1NNT A;  1SI0 A;  1DK4 A;  3PMW A;  4E0W A;  2FBP A;  2NWJ A;  4MNC A;  2GHA A;  3CSG A;  4XF5 A;  1DBZ A;  3MC2 A;  5I2K B;  4YMB A;  2OJT A;  3BKI B;  2DQV A;  1NV7 A;  3CG1 A;  4I8C A;  1SI1 A;  1XS5 A;  4F1Y A;  1IMF A;  2HZK A;  4JB7 A;  3OSQ A;  5H8F B;  5FBP A;  4IGR A;  3PUY E;  3GYY A;  3O28 A;  2XX8 A;  3CVG A;  4NTL A;  3TTM A;  2WX9 A;  4PF6 A;  2I6E A;  2XXY A;  4H8J A;  1URS A;  2I58 A;  3RLF E;  4NF6 B;  1B51 A;  4P9K A;  5DEX B;  2QL3 A;  3KEI A;  3CFL A;  4HCY A;  4GX4 A;  1DPE A;  3D1R A;  1A8F A;  4DCY A;  4U22 A;  1GTK A;  3G3G A;  1R9L A;  3RT8 A;  1D4N A;  2F7C A;  1AH5 A;  5L9O A;  4G8N A;  3T22 A;  4RPO A;  1TXF A;  3N26 A;  5DVF A;  3SER A;  4NF5 B;  4NE4 A;  3TEL A;  1YAE A;  3CFZ A;  3CI8 A;  1USY E;  2KQZ A;  1IMA A;  3HN0 A;  3H06 B;  1Y3Q A;  3Q25 A;  1LFH A;  2O69 A;  1OVT A;  2XXP A;  2ZYN A;  3T0J A;  1TWY A;  1RDX A;  3ILU B;  3C32 A;  3DP6 A;  3C36 A;  5FTH A;  1SW2 A;  1ZMG A;  5TP9 B;  3KGC A;  4EUO A;  1YYZ A;  2ZNS A;  3T9V A;  3WAE A;  4HXV A;  5H8H B;  5I2K A;  4KCC A;  1Q9D A;  2H9B A;  4L17 A;  3OOA A;  3H6V A;  4GL0 A;  4MF3 A;  2VP1 A;  3MPK A;  3F11 A;  5CBS A;  1MY4 A;  1SBP A;  4QRZ A;  1FW0 A;  4XKR A;  3T93 B;  2F6G A;  1IXC A;  3SZP A;  1EH3 A;  1OVB A;  3H6U A;  1POY 1;  4PFR A;  4UAB A;  3LSW A;  2OWS A;  2ONR A;  3ZS6 A;  2UXA A;  4DZ1 A;  5A5L A;  2YJP A;  2O1L A;  2XXV A;  4G68 A;  4GXS B;  3W15 C;  1VFD A;  3VE1 B;  1PBQ A;  3E13 X;  2O68 A;  1FQF A;  1Q1K A;  4GWS A;  2WYK A;  4QBA A;  3E3K A;  2Q8J A;  1Y3P A;  2DWH A;  4RY1 A;  1FJ6 A;  4BLA A;  1IQ7 A;  1B0H A;  1FQB A;  1JET A;  3IX1 A;  3TTL A;  4X8R A;  2CZK A;  1LBB A;  1ZIU A;  3SEY A;  1NV3 A;  3TMG A;  2B3B A;  4QF9 A;  3O97 A;  2R8T A;  4ESX A;  4BDN A;  4F1U A;  1DCU A;  1LBY A;  1NV0 A;  3IFA A;  1HSJ A;  3DP4 A;  2XX9 A;  4YZZ A;  4TLL B;  2XD2 A;  2Q89 A;  3IOU A;  1WDN A;  4IO5 A;  1AOV A;  4BDO A;  1BTJ A;  2VD3 A;  3PD9 A;  2FYI A;  5I7I A;  4NF0 A;  1NUX A;  2FHY A;  4XTC Q;  4F22 A;  2ZZW A;  4OWD A;  1JW4 A;  1P99 A;  2W7Y A;  5EQ7 A;  2F36 A;  3KC1 A;  2XXI A;  4TOZ A;  4Z0I A;  1GGG A;  1P1Q A;  3JV9 A;  3VVE A;  3HO7 A;  1MPB A;  1Z7N E;  1LBZ A;  5EQ8 A;  1QJM A;  3T9H B;  3V5A A;  2F3B A;  4I3E A;  1O63 A;  4PE3 A;  3PUZ E;  1KA0 A;  3IK6 B;  2H4I A;  2QSX A;  1KA1 A;  4E0X A;  2Y5K A;  4MMP A;  2NUV A;  4GBV A;  3GLB A;  3A3C A;  4P56 A;  4DXB A;  3UK4 A;  1JVX A;  2XXQ A;  3Q26 A;  3MVX A;  3RN8 A;  4LUB A;  3WAF A;  4I40 A;  5JTY B;  4EQ7 A;  1I6A A;  2P2A A;  4C0R A;  2B4M A;  4GWX A;  1MQI A;  1JP4 A;  1LAX A;  4C1T A;  3QUJ A;  4MIJ A;  1I69 A;  3LBS A;  2ONS A;  5EQA A;  2Y7K A;  1FTO A;  3K1N A;  4FOR A;  4F39 A;  4OXV A;  3IR1 A;  2DXY A;  4JVI A;  3U94 A;  4GX6 A;  3TZA A;  2WKY A;  3QXM A;  1ATG A;  3RT6 B;  5H8Q A;  1TFD A;  4X9T A;  4F2O A;  3T66 A;  4MJO A;  1K9Y A;  1MS7 A;  3QSL A;  1IUD A;  2X7P A;  5DT6 A;  2IEE A;  3SDF A;  4XEQ A;  4IO6 A;  4ECF A;  5I3S A;  4MH5 A;  1QUL A;  2F7B A;  4N13 A;  4G8M A;  3EKI A;  4H46 A;  4GWU A;  3C9H A;  1JNF A;  2AYS A;  3OXN A;  3PUX E;  4LON B;  4O3B A;  4DXC A;  5AE4 A;  1MPD A;  3UN6 A;  2F34 A;  5K2Y A;  4RJZ A;  1XC1 A;  3K2D A;  4HTG A;  3EN3 A;  2Q9T A;  1BIY A;  1H3D A;  1MM7 A;  1P1O A;  4N6K A;  1PEB A;  3T9U A;  1Z7M E;  3FUZ A;  2RKM A;  1MXZ A;  2O51 A;  3DEL B;  4N15 A;  3U8Q A;  5L9S A;  5TU0 A;  3KN8 A;  5JTY A;  4QSD A;  4GLI A;  1OQG A;  4PFW A;  5ET6 A;  5HBC A;  1VSO A;  1NV1 A;  3GZG A;  4NF4 A;  1II5 A;  3IB2 A;  3CFX A;  2BJJ X;  1MG1 A;  3IL1 B;  1LAF E;  3Q29 A;  4NF8 B;  2PFY A;  2HXW A;  5TPA A;  4PBQ A;  3FJ7 A;  4GOT A;  3RTW B;  1LBX A;  1H76 A;  1SYH A;  3JZJ A;  4XKQ A;  3EPE A;  2ZMB A;  4IO2 A;  3TDJ A;  1FPI A;  1US4 A;  4YAH X;  3BBR A;  2P3V A;  4M4G A;  4FEC A;  3N5L A;  1QKA A;  2I0B A;  1R1N A;  4JVD A;  4K3F A;  4F3P A;  4PAI A;  4QSC A;  1FTJ A;  2Y7I A;  4LP2 B;  1UTH B;  3ZKK A;  1SVX B;  4AB5 A;  3MZB A;  1NUZ A;  4PE5 B;  2UVJ A;  4YMA A;  1B3E A;  1YPN A;  3KFM A;  4HE2 A;  3Q27 A;  2A5T A;  1MY2 A;  2HPG A;  3MW0 A;  3S4U A;  5IKB A;  3GBA A;  4JVC A;  1H43 A;  4DXU A;  1ZJL A;  4H65 A;  2GFE A;  5FHN A;  2OZZ A;  2ZYO A;  2Q88 A;  3FVK A;  4QHQ A;  1ZLQ A;  5AA2 B;  4MAG A;  4GWZ A;  3PTY A;  2Z8E A;  1UTB B;  1FPD A;  1FPL A;  4G68 C;  2V84 A;  2XXU A;  4X1B A;  5I59 A;  1B5J A;  4BDL A;  5KCJ A;  2HCA A;  2P3N A;  1JQF A;  2UVG A;  5AA2 D;  4OFO A;  3SET A;  3UOR A;  1LFG A;  1FTA A;  2I49 A;  3S9L C;  1NNK A;  5ICQ A;  4RK2 A;  4O7M A;  2XXK A;  4PGP A;  1FPB A;  2XXX A;  4QFN A;  4ZZE A;  5L9M A;  5DYH A;  4KR5 A;  2D3I A;  4DDD A;  3I5O A;  3MAM A;  1WOD A;  4NHB A;  1I6Q A;  2ZNT A;  4F3S A;  1CE2 A;  1LAG E;  5CMK A;  2HEU A;  3PMV A;  1PB8 A;  4XKN A;  5I2N A;  2XXT A;  1SW1 A;  4ZEB A;  5KZT A;  2DSF A;  1DMB A;  3O9P A;  3C4M A;  2DWJ A;  4H8I A;  1A54 A;  5IZ1 A;  1TFA A;  4GWW A;  2Q8M A;  2X26 A;  4OFL A;  4YIC A;  2XXW A;  3VVD A;  3ZKL A;  3RNN A;  3PU5 A;  3VXB A;  3G3K A;  1KWH A;  3FBP A;  3LUY A;  3TYH A;  1PDA A;  4KYD A;  2H99 A;  3VDF A;  5AA2 A;  4GX3 A;  2F8D A;  3E9X A;  4M1V A;  3UGW A;  2B4L A;  2DE2 A;  5CBR A;  2V3U A;  1FBC A;  4OES A;  1FQC A;  1FRP A;  1B4H A;  4F19 A;  4PTK A;  5EHS A;  2ALU A;  1HSL A;  3T1B A;  3S2V A;  1QUJ A;  4GBW A;  5I57 B;  3ONM A;  2OX3 A;  3D4G A;  4JWY A;  4P0G A;  4PBH A;  4F1V A;  3EF7 A;  4LQ5 A;  4ELO A;  1MY3 A;  3IFC A;  1SW4 A;  5CC2 A;  1P1U A;  4KQP A;  1XOC A;  3TCH A;  1NUY A;  1G0H A;  4G8H A;  4NAP A;  2DE3 A;  2WYP A;  4DCX A;  3VLW A;  3FXQ A;  1JW5 A;  2AL5 A;  2QVV A;  2CMO A;  4N81 A;  5ISU A;  1IXG A;  5BUU A;  4GFR A;  5CMC A;  4R74 A;  4EF2 A;  1BK4 A;  1D9V A;  4OEN A;  2PX1 A;  3K0V A;  3V89 B;  1JVY A;  4P1E A;  3VV5 A;  3MUQ A;  2OBG A;  2HFB A;  3BFU A;  2CEX A;  2REJ A;  3SEV A;  4O94 A;  3OEK A;  5EYH A;  5I56 B;  2REG A;  1SPI A;  4LVQ A;  4KYE A;  3ISP A;  1P1W A;  1NMU A;  4DIG A;  4OVP A;  4DI3 D;  2ANJ A;  2PVU A;  3PUV E;  3KBR A;  1T0K A;  2I48 A;  3FJM A;  4WXJ A;  1NUW A;  5L8D A;  5H8F A;  1AWB A;  3LSL A;  3LSF B;  2Y7R A;  1YXI A;  3FAS A;  4EQ9 A;  4MNP A;  1B9J A;  2HHM A;  4OA4 A;  3C35 A;  3PPR A;  3IOT A;  4QFL A;  5IGA A;  3THI A;  4UAC A;  1POT A;  3ZSF A;  3B6W A;  4DE8 A;  4YB7 A;  4G77 A;  2JJK A;  3N94 A;  2XX7 A;  4NF6 A;  1AL3 A;  5F24 A;  1QGX A;  5DEX A;  5J16 A;  4IO4 A;  3MYU A;  3MVY A;  4IR8 A;  5BWJ A;  5CM6 A;  3MST A;  4GIZ A;  2R9J A;  1B7H A;  2DS9 A;  2RIN A;  2NOO A;  1XI6 A;  3O6G A;  3C34 A;  4ELQ A;  5F1Q A;  4FAJ A;  1FQA A;  3A3U A;  4MX6 A;  4PAF A;  1UIV A;  5LDZ A;  1O7T A;  3N6T A;  4NF5 A;  3GXA A;  3QUF A;  1FQD A;  1D9Y A;  3ECR A;  3A09 A;  1NKX A;  1LCT A;  4BDQ A;  2RC7 A;  3FGS A;  1QUK A;  3RQT A;  2XWO A;  4MLQ A;  1FTK A;  4HS7 A;  4XKP A;  3ILT B;  4QFO A;  3MZ9 A;  2OLB A;  5I56 A;  1EZO A;  5TP9 A;  3QAX A;  2ABH A;  5H8H A;  4U4X A;  2VPO A;  2FVZ A;  4TLM B;  1CB6 A;  2XA5 A;  3T9X B;  1LBW A;  3QIM A;  4EXL A;  4OER A;  4OYV A;  4QXD A;  1EYI A;  4OVT A;  4U1O A;  1PB9 A;  3PD8 A;  1MM6 A;  2Q2A A;  4POW A;  5ELV A;  5FHM A;  5A5X B;  1XHY A;  2PMS A;  2PBW A;  4IB2 A;  1N04 A;  4N17 A;  3UIF A;  4O7I A;  3M3K A;  2QMX A;  4H45 A;  1QUI A;  1US5 A;  1TT1 A;  1B3G A;  4OQO A;  4PFT A;  4Z7E A;  3ROJ A;  2AIX A;  5B70 A;  3PV0 E;  2XWV A;  2I4B A;  2F97 A;  4GQO A;  3LSX A;  2CZL A;  3OO6 A;  2QMW A;  4F18 A;  5JK4 A;  4IY6 A;  4R6Y A;  5J1D A;  2B3F A;  3IOR A;  1XVX A;  4WKM A;  3TCF A;  1SQY A;  4LAT A;  3SEX A;  5ET7 A;  5ESY A;  3IOV A;  2DP8 A;  5FHO A;  1UQW A;  4OEV A;  3PPQ A;  4MEV A;  5DTB A;  4G2Z A;  1FTL A;  4WED A;  4MBP A;  1OIB A;  3G3J A;  3O66 A;  1NFT A;  4HW8 A;  1B7Z A;  5AA1 A;  3B6Q A;  4FAT A;  2BJI A;  1RDY A;  1IZ1 A;  1NH7 A;  2MKZ A;  3G3I A;  1VDW A;  5AA4 B;  1FPJ A;  4F2Q A;  1B1H A;  5HPQ A;  4GWY A;  1MQG A;  4N8Y A;  3K6U A;  1DPP A;  4NMY A;  4GRK A;  5I84 A;  4U23 A;  2X7Q A;  4Q5T A;  3G3H A;  4PFI A;  3PMX A;  3RPL B;  3M3L A;  4PGN A;  1L5T A;  5H8N B;  1LAH E;  4Q8R A;  4P47 A;  1PB7 A;  3BIG A;  2YPN A;  3TQW A;  3U72 A;  4JWO A;  1M5E A;  1RYO A;  1S50 A;  3HHF A;  1RKM A;  4ZEF A;  3TEP A;  1MPC A;  1B7U A;  3CHG A;  1IME A;  1ZTY A;  1YTV A;  2H98 A;  3FIR A;  2VPN A;  2V25 A;  3OD7 A;  4ZE9 A;  4ZEC A;  1FTM A;  1B32 A;  4DLD A;  3FAT A;  3VLU A;  3B50 A;  5HM4 B;  1B0L A;  2ZZX A;  4PF8 A;  2I3W A;  4RK9 A;  4LQ2 A;  3D4C A;  4I3Y A;  5KDT B;  4R72 A;  4GL8 A;  4R6H A;  3KJ7 A;  1B4Z A;  2ZZV A;  5LOM A;  5EHM A;  1OMP A;  1F9B A;  3CSB A;  1BLF A;  4GXA A;  3FXR A;  4MNI A;  1MY0 A;  2DXR A;  1EYJ A;  2XWI A;  4RNS A;  2R71 A;  4I62 A;  4MFI A;  2QJE A;  1D9Q A;  3EHS A;  4O3A A;  1NNP A;  1FJ9 A;  1MH4 A;  3P7I A;  1EZP A;  4ZED A;  1FBG A;  3HHG A;  2LAO A;  3LV0 A;  2Y5L A;  3UP9 A;  4F29 A;  1NI9 A;  2HAV A;  3RPW A;  4ELP A;  1BKA A;  2F5X A;  3FVO A;  3SEU A;  4P8B A;  2XWK A;  1MRP A;  2ZYK A;  4OET A;  5H8N A;  5AA3 A;  1GVC A;  3E78 A;  1B5I A;  3O2A A;  4ZEI A;  2QPQ A;  4Q0C A;  4YU0 A;  1NV6 A;  1LCF A;  3W9W A;  4DI4 B;  3GBB A;  3MBP A;  1ZU0 A;  2DYX A;  1QVS A;  1K9Z A;  1GR2 A;  5F7V A;  1IIW A;  2QS2 A;  1MXU A;  2QS4 A;  4THI A;  2PT2 A;  2P0S A;  3C31 A;  1S9T A;  4JSD A;  2O7U A;  1NL5 A;  3TOD A;  1FBE A;  1N7W A;  2UYE A;  2VD2 A;  3K01 A;  4H5F A;  1MQH A;  1LB8 A;  3PPO A;  4P0I A;  3IB1 A;  5ET5 A;  2OWZ A;  4XFE A;  4UA8 A;  1B3H A;  1AMF A;  1NV4 A;  2CZH A;  1LGB C;  3LR1 A;  4HCW A;  1EYK A;  1B2H A;  3LUZ A;  4NF8 A;  1MDP 1;  3E4R A;  3KBZ A;  1N3X A;  4KPT A;  1GV8 A;  2O7I A;  1Y20 A;  4EQB A;  5H8S A;  1QW0 A;  3O6H A;  2HZL A;  4H0W A;  4ZS9 A;  3G3F A;  3JYR A;  4I9D A;  3VXC A;  3PUW E;  3VLV A;  4JSO A;  5EYG A;  5IZZ A;  3B7D A;  3K6X A;  2GH9 A;  2F6P A;  1FQE A;  1VFE A;  5IZ3 B;  1Y1M A;  1ZBM A;  3DP8 A;  1M5F A;  1UTH A;  1M5D A;  4PDH A;  4YKP A;  1NV5 A;  2PCR A;  4N91 A;  4H5G A;  3W9V A;  4R73 A;  2HQ0 A;  4R75 A;  1EU8 A;  2QVR A;  1INP A;  4HE0 A;  3Q28 A;  5ICT A;  2HAU A;  3EQ1 A;  4F31 B;  2DDK A;  3H4Z A;  4N6D A;  4HE1 A;  1UTB A;  1A55 A;  2ZYM A;  1Y4C A;  1MXV A;  2UVH A;  4OFJ A;  3PGF A;  4FBP A;  4PFY A;  3IAZ A;  4IO7 A;  1FCK A;  1NNF A;  4FIM A;  4R6K A;  1MH3 A;  2FA7 A;  1Y4T A;  2V4C A;  3HFU A;  3FV2 A;  2QFL A;  5CI5 A;  2F7A A;  1SDX A;  2A5S A;  1B5H A;  3TKD A;  1I6B A;  4YB6 A;  3L6H A;  1RYX A;  3IO4 A;  4U2R A;  3U92 A;  4PET A;  4NWC A;  3MP6 A;  2Y7W A;  4U21 A;  2P1S A;  4N8G A;  4G68 B;  2O84 X;  3IOW A;  1LB9 A;  1N0T A;  2D21 A;  3IO6 A;  4QFK A;  3PPP A;  4G4P A;  1IIT A;  1B3L A;  3PPN A;  5IM2 A;  4ESW A;  1J1N A;  1FPE A;  3K4U A;  4JWX A;  2QVU A;  1MY1 A;  5ITP A;  2UYF A;  2PYY A;  4PAK A;  4YB5 A;  2OWT A;  5M2V A;  1XT8 A;  4H1X A;  5I5P A;  5DVI A;  5IZ3 A;  5ITO A;  3CRB A;  2Z22 A;  3RGY A;  1A7L A;  2F3D A;  3OMB A;  1BP5 A;  4NN3 A;  4ONY A;  2NVU B;  3I3V A;  1FPG A;  4U4S A;  4NWD A;  1KZ8 A;  1LLS A;  1FSA A;  2G93 A;  1G0I A;  2YLN A;  3R6U A;  5T3J A;  1LBV A;  4EXK A;  2O1M A;  3S9E A;  2DVZ A;  3A29 A;  2V3T A;  2DOJ A;  4ZZA A;  5IAI A;  4OMB A;  1OQH A;  3H7M A;  1XVY A;  2D5W A;  2ESN A;  2I4C A;  3MP1 A;  3KJT A;  1QKB A;  1S7Y A;  5I57 A;  2QRY A;  4MCO A;  4FEB A;  3CG3 A;  4YKK A;  2FNC A;  1VR5 A;  2Q2C A;  1VE4 A;  3IJO B;  4ZEK A;  4YKJ A;  2FIE A;  4TQU Q;  3MP8 A;  1B52 A;  1CNQ A;  4U1Z A;  4Q30 B;  1P1N A;  1ELJ A;  3RYD A;  1A99 A;  3K00 A;  4KFQ A;  3MQ9 A;  4NX1 A; 
#chains in the Genus database with same CATH homology
 4N6P A;  4GD5 A;  1Y1Z A;  4RXL A;  3FD3 A;  1URD A;  3OEL A;  4F3G A;  1B46 A;  3EHT A;  3K02 A;  1ZKB A;  3FZV A;  2KLF A;  4RPN A;  3HPI A;  1EZ9 A;  3H6W A;  3DM0 A;  4IO3 A;  2M8C A;  1A8E A;  3RUM A;  3EHU A;  5CRY A;  2I3V A;  1N3W A;  3IJX B;  2OK2 A;  3CR9 A;  2IA4 A;  3I6V A;  3KOT A;  1SD3 A;  4LZ5 A;  4BDM A;  2GHB A;  3QYT A;  3O29 A;  1O64 A;  3HV1 A;  1B05 A;  3RTF B;  4JXI A;  1D3K A;  1LST A;  1UIU A;  1H45 A;  3FJG A;  5H8Q B;  3QK6 A;  2XD3 A;  4IGT A;  2ONK E;  4LZ7 A;  1NH8 A;  4H67 A;  1N7X A;  2Z23 A;  4QFP A;  1R9Q A;  4PFU A;  1SW5 A;  2RCB A;  4FE8 A;  3TCG A;  1AIV A;  3KSJ A;  3HST A;  4N07 A;  4WEP A;  4R2B A;  4I1D A;  4KYS A;  3MZ1 A;  1LBC A;  4OEU A;  3U1O A;  3OO7 A;  1URG A;  2R6G E;  4ND9 A;  3TQL A;  3K6V A;  3G7W A;  3SKP A;  3TAJ A;  4R2F A;  3K1P A;  2VHA A;  3FVG A;  4OHN A;  4OVJ A;  3V8X B;  3HCQ A;  3OSR A;  3R26 A;  2I0C A;  3USD A;  4FED A;  2H5Y A;  4NF4 B;  3S9M C;  4BDR A;  1LFI A;  4KCD A;  4MLV A;  3TTN A;  1MXW A;  4PQJ A;  4ISU A;  3SEW A;  5TPA B;  1H44 A;  2UVI A;  3OO8 A;  3OEN A;  2V3Q A;  2QS1 A;  4NED A;  5A5X A;  3KOS A;  1B40 A;  2DWA A;  2DWI A;  3TUS A;  1B1X A;  1IXH A;  4R9G A;  3IB0 A;  4KHZ E;  1PC3 A;  2XHD A;  4GVO A;  2RC8 A;  2NXO A;  4H6D A;  2GRV A;  3C33 A;  5EYF A;  3CIJ A;  4ZE8 A;  4ELR A;  2A5T B;  3FXU A;  3M8U A;  3S9N C;  3UA8 A;  3K6W A;  1B6H A;  2Y7P A;  4P11 A;  4XXU A;  4X1D A;  1JEU A;  3MPL A;  3RY3 A;  1MQJ A;  3MWB A;  1PBP A;  3VVF A;  5I59 B;  1OLC A;  1JW1 A;  1DTG A;  3KSX A;  3FVN A;  4IY5 A;  5KCJ B;  4GF8 A;  3U93 A;  1YCJ A;  3R7X A;  3LC8 A;  5CMB A;  4RYA A;  1IXI A;  1N84 A;  2OCU A;  1SYI A;  1DTZ A;  2E0S A;  4RA1 A;  4POX A;  3TPA A;  2Y84 A;  4C1U A;  3M3F A;  3AXF A;  3SES A;  4EDP A;  5B7D A;  2E1S A;  4YKI A;  1USY H;  5AA4 A;  4PP0 A;  4R9F A;  3BFT A;  2Z8F A;  1JEV A;  4AB6 A;  4JDF A;  3O6I A;  1R6Z A;  3H03 A;  3N6U A;  3OO9 A;  4LA9 A;  5I58 B;  1M5B A;  3T96 B;  5I2N B;  4AQ4 A;  5FTI A;  2G29 A;  1Y9U A;  3KN7 A;  2F35 A;  2RCA A;  1B58 A;  3DLN A;  3MVZ A;  3H6T A;  1A40 A;  2VGQ A;  2THI A;  3MVW A;  2PT1 A;  2XXR A;  3KN3 A;  2AL4 A;  3ODB A;  1MXY A;  1WVJ A;  1MQD A;  2QS3 A;  2RF1 A;  3H3G A;  3L6G A;  2VOZ A;  5KDT A;  2ZXT A;  2DVC A;  2XXH A;  2DE4 A;  3KZG A;  3K1M A;  2B65 A;  4KI0 E;  1OLA A;  4OTE A;  2F78 A;  1Q35 A;  1Y3N A;  3FV1 A;  4JBZ A;  2H25 A;  4GWO A;  4ZDM A;  2O6A A;  1DOT A;  3MJN A;  4OZ9 A;  3B6T A;  2V93 A;  5CMM A;  2ZNU A;  4F3B A;  4KD5 A;  1DSN A;  2RC9 A;  1ANF A;  3TTK A;  1B3F A;  1N76 A;  4O3C A;  4X48 A;  2Z8D A;  5DVJ A;  5K2X A;  3KG2 A;  1IEJ A;  3VFJ A;  5JEI A;  3V83 A;  1MDQ A;  3OEM A;  4EF1 A;  3TFL A;  5I58 A;  4LZ8 A;  4XIG Q;  4FJP A;  3TTR A;  4QSE A;  1M5C A;  1MXX A;  1HSE A;  1NNT A;  1SI0 A;  3PMW A;  4E0W A;  2NWJ A;  2GHA A;  3CSG A;  3MC2 A;  5I2K B;  4YMB A;  2OJT A;  3BKI B;  2DQV A;  3CG1 A;  4I8C A;  1SI1 A;  1XS5 A;  4F1Y A;  2HZK A;  4JB7 A;  3OSQ A;  5H8F B;  4IGR A;  3PUY E;  3O28 A;  2XX8 A;  3CVG A;  4NTL A;  3TTM A;  2I6E A;  2XXY A;  4H8J A;  1URS A;  2I58 A;  3RLF E;  4NF6 B;  1B51 A;  5DEX B;  2QL3 A;  3KEI A;  3CFL A;  4HCY A;  1DPE A;  1A8F A;  4DCY A;  4U22 A;  1GTK A;  3G3G A;  1R9L A;  3RT8 A;  1D4N A;  2F7C A;  1AH5 A;  5L9O A;  4G8N A;  3T22 A;  4RPO A;  1TXF A;  3N26 A;  5DVF A;  3SER A;  4NF5 B;  4NE4 A;  3TEL A;  1YAE A;  3CFZ A;  3CI8 A;  1USY E;  3HN0 A;  3H06 B;  1Y3Q A;  3Q25 A;  1LFH A;  2O69 A;  1OVT A;  2XXP A;  2ZYN A;  1TWY A;  3ILU B;  3C32 A;  3DP6 A;  3C36 A;  5FTH A;  1SW2 A;  1ZMG A;  5TP9 B;  3KGC A;  4EUO A;  2ZNS A;  3T9V A;  3WAE A;  5H8H B;  5I2K A;  4KCC A;  2H9B A;  4L17 A;  3OOA A;  3H6V A;  4GL0 A;  4MF3 A;  2VP1 A;  3MPK A;  3F11 A;  5CBS A;  1MY4 A;  1SBP A;  4QRZ A;  1FW0 A;  4XKR A;  3T93 B;  2F6G A;  1IXC A;  1EH3 A;  1OVB A;  3H6U A;  1POY 1;  3LSW A;  2OWS A;  2ONR A;  3ZS6 A;  2UXA A;  4DZ1 A;  2YJP A;  2O1L A;  2XXV A;  4G68 A;  4GXS B;  3W15 C;  1VFD A;  3VE1 B;  1PBQ A;  3E13 X;  2O68 A;  1FQF A;  1Q1K A;  3E3K A;  2Q8J A;  1Y3P A;  2DWH A;  4RY1 A;  4BLA A;  1IQ7 A;  1B0H A;  1FQB A;  1JET A;  3IX1 A;  3TTL A;  1LBB A;  1ZIU A;  3SEY A;  3TMG A;  2B3B A;  4QF9 A;  3O97 A;  4ESX A;  4BDN A;  4F1U A;  1HSJ A;  3DP4 A;  2XX9 A;  4YZZ A;  4TLL B;  2XD2 A;  2Q89 A;  3IOU A;  1WDN A;  4IO5 A;  1AOV A;  4BDO A;  1BTJ A;  2VD3 A;  3PD9 A;  2FYI A;  4XTC Q;  4F22 A;  4OWD A;  1JW4 A;  1P99 A;  2W7Y A;  2F36 A;  2XXI A;  4TOZ A;  4Z0I A;  1GGG A;  1P1Q A;  3JV9 A;  3VVE A;  3HO7 A;  1MPB A;  1Z7N E;  1QJM A;  3T9H B;  3V5A A;  1O63 A;  3PUZ E;  3IK6 B;  2H4I A;  2QSX A;  4E0X A;  2NUV A;  3GLB A;  3A3C A;  4DXB A;  3UK4 A;  1JVX A;  2XXQ A;  3Q26 A;  3MVX A;  3RN8 A;  4LUB A;  3WAF A;  5JTY B;  4EQ7 A;  1I6A A;  2P2A A;  4C0R A;  1MQI A;  1LAX A;  4C1T A;  3QUJ A;  1I69 A;  3LBS A;  2ONS A;  2Y7K A;  1FTO A;  3K1N A;  4FOR A;  4F39 A;  4OXV A;  3IR1 A;  2DXY A;  3U94 A;  3TZA A;  2WKY A;  3QXM A;  1ATG A;  3RT6 B;  5H8Q A;  1TFD A;  4X9T A;  4F2O A;  3T66 A;  1MS7 A;  3QSL A;  1IUD A;  2X7P A;  5DT6 A;  2IEE A;  3SDF A;  4IO6 A;  4ECF A;  4MH5 A;  1QUL A;  2F7B A;  4N13 A;  4G8M A;  3C9H A;  1JNF A;  2AYS A;  3OXN A;  3PUX E;  4LON B;  4O3B A;  4DXC A;  5AE4 A;  1MPD A;  3UN6 A;  2F34 A;  5K2Y A;  4RJZ A;  1XC1 A;  3K2D A;  4HTG A;  3EN3 A;  2Q9T A;  1BIY A;  1H3D A;  1MM7 A;  1P1O A;  1PEB A;  3T9U A;  1Z7M E;  3FUZ A;  2RKM A;  1MXZ A;  2O51 A;  3DEL B;  3U8Q A;  5L9S A;  5TU0 A;  3KN8 A;  5JTY A;  4QSD A;  4GLI A;  1OQG A;  4PFW A;  5HBC A;  1VSO A;  3GZG A;  4NF4 A;  1II5 A;  3IB2 A;  3CFX A;  2BJJ X;  1MG1 A;  3IL1 B;  1LAF E;  3Q29 A;  4NF8 B;  2HXW A;  5TPA A;  3FJ7 A;  4GOT A;  3RTW B;  1H76 A;  1SYH A;  3JZJ A;  4XKQ A;  3EPE A;  2ZMB A;  4IO2 A;  3TDJ A;  1US4 A;  4YAH X;  3BBR A;  4M4G A;  4FEC A;  3N5L A;  1QKA A;  2I0B A;  1R1N A;  4K3F A;  4F3P A;  4QSC A;  1FTJ A;  2Y7I A;  4LP2 B;  1UTH B;  3ZKK A;  1SVX B;  4AB5 A;  3MZB A;  4PE5 B;  2UVJ A;  4YMA A;  1B3E A;  1YPN A;  3KFM A;  3Q27 A;  2A5T A;  1MY2 A;  3MW0 A;  3S4U A;  5IKB A;  3GBA A;  1H43 A;  4DXU A;  1ZJL A;  4H65 A;  2GFE A;  5FHN A;  2OZZ A;  2ZYO A;  2Q88 A;  3FVK A;  4QHQ A;  1ZLQ A;  5AA2 B;  2Z8E A;  1UTB B;  4G68 C;  2V84 A;  2XXU A;  4X1B A;  5I59 A;  1B5J A;  4BDL A;  5KCJ A;  2HCA A;  1JQF A;  2UVG A;  5AA2 D;  4OFO A;  3SET A;  3UOR A;  1LFG A;  2I49 A;  3S9L C;  1NNK A;  5ICQ A;  4RK2 A;  2XXX A;  4QFN A;  4ZZE A;  5L9M A;  5DYH A;  4KR5 A;  2D3I A;  4DDD A;  3I5O A;  3MAM A;  1WOD A;  1I6Q A;  2ZNT A;  4F3S A;  1CE2 A;  1LAG E;  5CMK A;  2HEU A;  3PMV A;  1PB8 A;  4XKN A;  5I2N A;  2XXT A;  1SW1 A;  4ZEB A;  5KZT A;  2DSF A;  1DMB A;  3O9P A;  3C4M A;  2DWJ A;  4H8I A;  1A54 A;  1TFA A;  2X26 A;  4OFL A;  4YIC A;  2XXW A;  3VVD A;  3ZKL A;  3RNN A;  3PU5 A;  3VXB A;  3G3K A;  1KWH A;  3LUY A;  3TYH A;  1PDA A;  4KYD A;  2H99 A;  3VDF A;  5AA2 A;  2F8D A;  3E9X A;  4M1V A;  3UGW A;  2DE2 A;  5CBR A;  2V3U A;  4OES A;  1FQC A;  1B4H A;  4F19 A;  5EHS A;  2ALU A;  1HSL A;  3S2V A;  1QUJ A;  5I57 B;  3ONM A;  3D4G A;  4JWY A;  4P0G A;  4F1V A;  3EF7 A;  4LQ5 A;  4ELO A;  1MY3 A;  1SW4 A;  5CC2 A;  1P1U A;  4KQP A;  1XOC A;  3TCH A;  4G8H A;  2DE3 A;  4DCX A;  3VLW A;  3FXQ A;  1JW5 A;  2AL5 A;  2CMO A;  5ISU A;  1IXG A;  5BUU A;  4GFR A;  5CMC A;  4R74 A;  4EF2 A;  1D9V A;  4OEN A;  2PX1 A;  3K0V A;  3V89 B;  1JVY A;  3VV5 A;  3MUQ A;  2OBG A;  2HFB A;  3BFU A;  2REJ A;  3SEV A;  3OEK A;  5I56 B;  2REG A;  4LVQ A;  4KYE A;  1P1W A;  1NMU A;  4DIG A;  2ANJ A;  2PVU A;  3PUV E;  3KBR A;  1T0K A;  2I48 A;  3FJM A;  4WXJ A;  5L8D A;  5H8F A;  3LSL A;  3LSF B;  2Y7R A;  3FAS A;  4EQ9 A;  1B9J A;  3C35 A;  3PPR A;  3IOT A;  4QFL A;  3THI A;  4UAC A;  1POT A;  3ZSF A;  3B6W A;  4DE8 A;  4YB7 A;  4G77 A;  3N94 A;  2XX7 A;  4NF6 A;  1AL3 A;  5DEX A;  4IO4 A;  3MVY A;  5BWJ A;  5CM6 A;  4GIZ A;  2R9J A;  1B7H A;  2DS9 A;  2RIN A;  2NOO A;  3O6G A;  3C34 A;  4ELQ A;  5F1Q A;  4FAJ A;  1FQA A;  3A3U A;  1UIV A;  1O7T A;  3N6T A;  4NF5 A;  3GXA A;  3QUF A;  1FQD A;  1D9Y A;  3ECR A;  3A09 A;  1NKX A;  1LCT A;  4BDQ A;  2RC7 A;  3FGS A;  1QUK A;  3RQT A;  4MLQ A;  1FTK A;  4HS7 A;  4XKP A;  3ILT B;  4QFO A;  3MZ9 A;  2OLB A;  5I56 A;  1EZO A;  5TP9 A;  3QAX A;  2ABH A;  5H8H A;  4U4X A;  4TLM B;  1CB6 A;  3T9X B;  3QIM A;  4EXL A;  4OER A;  4OYV A;  4U1O A;  1PB9 A;  3PD8 A;  1MM6 A;  5A5X B;  2Q2A A;  4POW A;  5ELV A;  5FHM A;  1XHY A;  2PMS A;  2PBW A;  4IB2 A;  1N04 A;  3UIF A;  3M3K A;  2QMX A;  1QUI A;  1US5 A;  1TT1 A;  1B3G A;  4OQO A;  4PFT A;  4Z7E A;  2AIX A;  5B70 A;  3PV0 E;  2I4B A;  2F97 A;  4GQO A;  3LSX A;  2CZL A;  3OO6 A;  2QMW A;  4F18 A;  5JK4 A;  4IY6 A;  4R6Y A;  5J1D A;  2B3F A;  3IOR A;  1XVX A;  4WKM A;  3TCF A;  1SQY A;  4LAT A;  3SEX A;  3IOV A;  2DP8 A;  5FHO A;  1UQW A;  4OEV A;  3PPQ A;  5DTB A;  4G2Z A;  1FTL A;  4WED A;  4MBP A;  1OIB A;  3G3J A;  3O66 A;  1NFT A;  4HW8 A;  1B7Z A;  5AA1 A;  3B6Q A;  4FAT A;  1IZ1 A;  1NH7 A;  3G3I A;  5AA4 B;  4F2Q A;  1B1H A;  5HPQ A;  1MQG A;  3K6U A;  1DPP A;  4NMY A;  4GRK A;  5I84 A;  4U23 A;  2X7Q A;  4Q5T A;  3G3H A;  3PMX A;  3M3L A;  1L5T A;  5H8N B;  1LAH E;  4Q8R A;  1PB7 A;  2YPN A;  3TQW A;  3U72 A;  4JWO A;  1M5E A;  1RYO A;  1S50 A;  3HHF A;  1RKM A;  4ZEF A;  3TEP A;  1MPC A;  1B7U A;  1ZTY A;  1YTV A;  2H98 A;  3FIR A;  2V25 A;  3OD7 A;  4ZE9 A;  4ZEC A;  1FTM A;  1B32 A;  4DLD A;  3FAT A;  3VLU A;  5HM4 B;  1B0L A;  2I3W A;  4RK9 A;  4LQ2 A;  3D4C A;  5KDT B;  4R72 A;  4GL8 A;  4R6H A;  3KJ7 A;  1B4Z A;  5LOM A;  5EHM A;  1OMP A;  1F9B A;  3CSB A;  1BLF A;  4GXA A;  3FXR A;  1MY0 A;  2DXR A;  4RNS A;  2R71 A;  4I62 A;  4MFI A;  2QJE A;  3EHS A;  4O3A A;  1NNP A;  1MH4 A;  3P7I A;  1EZP A;  4ZED A;  3HHG A;  2LAO A;  3UP9 A;  4F29 A;  2HAV A;  3RPW A;  4ELP A;  1BKA A;  2F5X A;  3FVO A;  3SEU A;  1MRP A;  2ZYK A;  4OET A;  5H8N A;  5AA3 A;  1GVC A;  1B5I A;  3O2A A;  4ZEI A;  2QPQ A;  4Q0C A;  4YU0 A;  1LCF A;  3W9W A;  3GBB A;  3MBP A;  1ZU0 A;  2DYX A;  1QVS A;  1GR2 A;  5F7V A;  1IIW A;  2QS2 A;  1MXU A;  2QS4 A;  4THI A;  2PT2 A;  2P0S A;  3C31 A;  1S9T A;  4JSD A;  2O7U A;  1NL5 A;  3TOD A;  1N7W A;  2UYE A;  2VD2 A;  3K01 A;  4H5F A;  1MQH A;  1LB8 A;  3PPO A;  4P0I A;  3IB1 A;  4UA8 A;  1B3H A;  1AMF A;  1LGB C;  3LR1 A;  4HCW A;  1B2H A;  4NF8 A;  1MDP 1;  3E4R A;  1N3X A;  4KPT A;  1GV8 A;  2O7I A;  1Y20 A;  4EQB A;  5H8S A;  1QW0 A;  3O6H A;  2HZL A;  4H0W A;  4ZS9 A;  3G3F A;  3JYR A;  4I9D A;  3VXC A;  3PUW E;  3VLV A;  4JSO A;  3B7D A;  3K6X A;  2GH9 A;  2F6P A;  1FQE A;  1VFE A;  1Y1M A;  1ZBM A;  3DP8 A;  1M5F A;  1UTH A;  1M5D A;  4YKP A;  4H5G A;  3W9V A;  4R73 A;  2HQ0 A;  4R75 A;  1EU8 A;  3Q28 A;  5ICT A;  2HAU A;  3EQ1 A;  4F31 B;  3H4Z A;  1UTB A;  1A55 A;  2ZYM A;  1Y4C A;  1MXV A;  2UVH A;  4OFJ A;  3PGF A;  4PFY A;  3IAZ A;  4IO7 A;  1FCK A;  1NNF A;  4FIM A;  4R6K A;  1MH3 A;  2FA7 A;  1Y4T A;  3FV2 A;  5CI5 A;  2F7A A;  1SDX A;  2A5S A;  1B5H A;  3TKD A;  1I6B A;  4YB6 A;  3L6H A;  1RYX A;  3IO4 A;  4U2R A;  3U92 A;  4PET A;  4NWC A;  3MP6 A;  2Y7W A;  4U21 A;  2P1S A;  4G68 B;  2O84 X;  3IOW A;  1LB9 A;  1N0T A;  2D21 A;  3IO6 A;  4QFK A;  3PPP A;  4G4P A;  1IIT A;  1B3L A;  3PPN A;  4ESW A;  1J1N A;  3K4U A;  4JWX A;  1MY1 A;  5ITP A;  2UYF A;  2PYY A;  4YB5 A;  2OWT A;  5M2V A;  1XT8 A;  4H1X A;  5DVI A;  5ITO A;  3CRB A;  2Z22 A;  3RGY A;  1A7L A;  3OMB A;  1BP5 A;  4ONY A;  2NVU B;  3I3V A;  4U4S A;  4NWD A;  1LLS A;  2G93 A;  2YLN A;  3R6U A;  4EXK A;  2O1M A;  3S9E A;  2DVZ A;  2V3T A;  2DOJ A;  4ZZA A;  5IAI A;  4OMB A;  1OQH A;  3H7M A;  1XVY A;  2D5W A;  2ESN A;  2I4C A;  3MP1 A;  3KJT A;  1QKB A;  1S7Y A;  5I57 A;  2QRY A;  4FEB A;  3CG3 A;  4YKK A;  2FNC A;  1VR5 A;  2Q2C A;  1VE4 A;  3IJO B;  4ZEK A;  4YKJ A;  4TQU Q;  3MP8 A;  1B52 A;  4U1Z A;  4Q30 B;  1P1N A;  1ELJ A;  1A99 A;  3K00 A;  4KFQ A;  3MQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...