3K1PA

Crystal structure of full-length benm e226k mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
303
structure length
303
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVRKVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator benM
publication title Structure of Full-length BenM
rcsb
source organism Acinetobacter sp.
molecule tags Transcription
total genus 77
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k1pA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1pA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1pA03
4ESWA 2E7XA 3Q9VA 3P9KA 4ZEDA 3GYHX 3W6KB 1JXSA 3GBAA 2DPUA 1I6XA 4OFOA 1JVXA 1T0FA 3KCCA 1FYMA 3SESA 4L9TA 5F1RA 5JFRA 3KP7A 1Y1ZA 4ESFA 1FT9A 4BAYA 4JBZA 2Y0MA 2NYXA 1B3LA 5AA4B 4OIQF 3C36A 3D0SA 3G3KA 4YKJA 1QJMA 3DFGA 4HW8A 2M5WA 1R5GA 3HN0A 3KZGA 3F6OA 1F4KA 3L6HA 2P2AA 3VV5A 1USSA 4AD9A 3VLUA 5FLXZ 1VR5A 1IRGA 5E1WA 2DE4A 4EGZA 1NH8A 1B9NA 1XGSA 4YKIA 4IF4A 3T5XA 5B7DA 3RIRA 4IO2A 1MY0A 4PP0A 1URDA 4DXUA 2X0LA 4BQAA 2FF4A 4MEYF 1ZBMA 4IY5A 5E1XA 2EFPA 4KIBA 5CVIA 1EV7A 1NMUA 2H5YA 5D6EA 3ZSFA 5L9OA 1JNFA 2Y7IA 2IA4A 3WU0A 1B6HA 5CM6A 3R7XA 2BE5F 1Z7NE 4TLLB 3N97A 4YB7A 3F8MA 5DTBA 1FSHA 2JSCA 4WXCA 1QUIA 4GWOA 5DEQA 3G7WA 2ZNZA 1FTJA 3W6JB 4QSEA 2V84A 4BHBA 3KEOA 2CYYA 1LQ1A 1H76A 4M6XA 1DPEA 1FCKA 3QXMA 4R6HA 3LA2A 3K1NA 4F39A 2I0CA 1MJ9A 1YG2A 3ULQB 2FRHA 5E20A 1LJ9A 3OO6A 2IA2A 4RGUA 2CMOA 2QLZA 3AAFA 4DDDA 4EJOA 2OWSA 4HQMA 3C4MA 3JSPA 4WKMA 4IRGA 2A5SA 1K7AA 1Y3PA 4BNCA 1KGSA 4BH9A 4U0WA 2XXVA 1AWCA 1MH3A 4X48A 4ONYA 1W7PD 1N04A 3EQLF 3CG1A 4B09A 4GOTA 1Y1MA 4PETA 4R74A 5BMZA 1QKAA 2Z5UA 4HA8A 2EB7A 4WXHA 2V3UA 2E1SA 1P99A 4WXJA 5M2VA 2XIGA 3BJAA 4R72A 1UTBB 2VP1A 4I0AA 4YIIA 4H5GA 1EH7A 4OETA 1ZG1A 3DKWA 4P96A 4NE4A 1R22A 2VOPA 2VE9A 4ZE9A 2YPRA 1B1HA 1LLSA 1FQEA 4PFYA 2Z33A 5TP9B 3ECOA 2G9WA 4RB2C 4EDPA 4PFTA 2Q2CA 4GXSB 1MM7A 4G7OF 3SKPA 1DOTA 3K02A 1DTGA 4FHTA 1T2KA 1G4DA 1ANFA 3HO7A 2I6EA 2G93A 2THIA 3TOBA 5LGUA 3TDJA 3PGFA 1YIOA 1MH4A 2R3SA 3HUGA 4G94A 3T93B 2COMA 2Y7KA 2XX9A 1MY2A 4H6DA 4HQEA 5ELVA 3TO6A 3T8TA 2EA2A 1XD7A 1P2FA 3IJOB 4F3SA 4QSDA 3F72A 4LATA 4IPAA 3ILTB 5ILSA 5DYHA 2ZJ2A 3SEXA 4DE8A 2PMHA 1XSXA 1L3LA 2Q89A 3IJXB 3IRQA 3I0TA 2BV6A 4NQWA 1FSEA 5D5WB 1ZG5A 2I3VA 4KYDA 1B9MA 2HTJA 4NWDA 3T9XB 3Q9SA 1SD7A 5HDNA 1WODA 1PB8A 3N26A 2RQPA 2EFQA 5DT6A 2Y7WA 2HYFA 4MLVA 3I71A 1HKTA 2A6EF 3E6DA 3VVEA 3FATA 3MVWA 4NF8A 1LDJA 4XKRA 4YMAA 1HXDA 2EV6A 2YSRA 1XGOA 3GXAA 3TPAA 3MVZA 4GQOA 4UXNA 1SBPA 1QBJA 1IITA 2Q8JA 3QUJA 3LC8A 5KVRA 3H3GA 3HSRA 1FNNA 4U23A 3R0JA 3UIFA 3K0LA 2K02A 2QZ8A 4IRHA 3QP5A 4BLAA 1B1BA 3BP8A 1KQ9A 3WTUC 1BTJA 4OYVA 4ECFA 4U7DA 2ESNA 2HR3A 2I48A 2VC0A 4U4XA 1NNFA 3WTTC 3TCHA 1B4AA 4MTEA 3CO7C 1YW9A 2OBPA 5CBSA 2VODA 1QZZA 4P5OA 3WTZA 3CFZA 1O3RA 5DCMA 3PU5A 3P9CA 2GXGA 3FXUA 4XTCQ 2CWEA 3F23A 4GIZA 2C6YA 1TT1A 2WKYA 3A09A 1Y3QA 2FXAA 2ZYKA 3VLVA 1A40A 3F8CA 1O3SA 5BUUA 4KDPA 3RGYA 5HDKA 5I59A 2PT1A 4YFNF 2I4BA 3V83A 4ZZEA 2E1CA 1PP8F 3BPVA 1PBQA 3GFIA 4F3BA 4FX4A 3D4CA 1S3JA 2HZTA 1XHYA 4ZZLA 1N7XA 3B6TA 4E0WA 5CBRA 2R9JA 1FYKA 3A3UA 2W25A 2Q88A 2IA1A 5LEJA 5DUIA 4GFRA 4IO3A 1I6QA 4NMYA 3VLWA 4N07A 1YTVA 1SD3A 2NNYA 4FIMA 5TRDA 1KWHA 2L4AA 4Z2YA 1GXQA 4KCCA 4IHSA 4C1TA 5JHUA 3T1BA 3I58A 1POTA 4WEPA 3TQWA 3FM3A 5L3BA 5EHSA 4LGWA 2JTVA 2FU4A 4HBLA 2OLBA 4S05A 1XSDA 4MH5A 2ISZA 3IL1B 1LEBA 1LGBC 4OVJA 1F1ZA 3MAMA 1B3GA 1MDP1 3REOA 4IVNA 3TDUC 3MVXA 1B2HA 4UHTA 3TFLA 1IUDA 2I58A 2NWJA 1LAGE 2D1VA 3F3XA 1R1UA 3OOAA 3CUQA 4X1BA 5JVTA 1GTKA 2XXRA 3KP2A 3L2CA 1HQCA 1F5TA 4YB5A 3ZMVA 3DP6A 4TQUQ 1B05A 3FVKA 3Q26A 3HRUA 1KU2A 3LSLA 3VFJA 1IQ7A 5E8GA 2P7CB 3VVFA 1ZMGA 5L8DA 1E17A 1P4XA 3WGHA 3KFWX 3CR9A 2BYVE 1R9QA 2LAOA 5E17F 3BFTA 2O61A 3RDIA 1TXFA 4RK2A 3LSTA 4JWOA 3ZS6A 5JR3A 5FHOA 4I62A 3DP4A 4PQJA 2XXIA 1NL5A 4NF8B 2NNNA 3S9EA 5D8KB 5DVIA 3E3KA 1R1TA 1SYIA 3LUYA 1W4MA 3V8LA 4XSXF 5KK1A 2EFNA 4Q47A 2F97A 4KQPA 4HLYA 3FHZA 4IJAA 5D4SA 5BPIA 3IWZA 3T8RA 2X26A 2UVJA 3HTUA 2YPNA 1XMAA 1TNSA 4DCYA 4M71A 2QRYA 3DP7A 1YW7A 4HCWA 4BDRA 4MF3A 2NUVA 5E1ZB 3DPTA 4MQ9F 2DQRA 1UQWA 3E4RA 2DXRA 3J80K 3SHFA 1FQAA 4KI0E 1I27A 2IEEA 3O9PA 4U2RA 3M8FA 2O69A 4A5NA 4RB1A 3GZGA 2K7LA 4KN4X 4LG0A 3PFIA 2DI3A 4L18B 4G8HA 2ZYOA 3UGWA 3E5XA 5HS7A 1AOVA 4GXOA 1QPMA 5J8FA 5HOOA 3BY6A 3MP1A 2O7IA 1A55A 2MA3A 3J81K 1P4WA 3N6UA 4G77A 4OIRF 5I59B 4OMZA 1D4NA 1R1NA 3MVYA 2P6SA 3AXFA 5DV5A 4HCYA 3TODA 2GIVA 4ND9A 3EHUA 3F8BA 1MXYA 3L9FA 1FBUA 5ILUA 2O7UA 3PQJA 4YFXF 3ZP5A 3FMRA 4BHPA 1ZREA 3K01A 3VDFA 5I56A 1FP1D 2QS2A 3LQRA 4RYAA 2IA0A 4UVAA 2DW4A 3I59A 1P1OA 3HOSA 2UXXA 1R7JA 2WWYA 3SXYA 3DV8A 4ESXA 4KFCA 4P9UA 5KDTA 5ICGA 3HPIA 3GZ6A 4BDOA 1RUOA 3N94A 5HLIA 1D8KA 3GW2A 3FVGA 3USDA 4JK1X 1Q35A 4FECA 4C0RA 2B0LA 2B65A 5K5RA 3BJ6A 3FF5A 3L7WA 4M72A 1XN7A 2EA4A 4HF0A 3W9VA 2ZNYA 4NWCA 2Q8KA 1T39A 4YKPA 3IB1A 2RINA 5D5VB 2DWAA 2HKXA 4KICA 5DVJA 1J5YA 3CUQB 1R36A 1UTHB 4O6JA 4EM1A 2YLNA 3KEQA 2QS3A 3BKIB 3ILUB 3RLFE 3F11A 2W57A 2XASA 4R1HA 1D3YA 1Y3NA 4ENNA 4F19A 5CVJA 2PEXA 3OEKA 1J0RA 3F8NA 3RN8A 3R60A 1SW5A 3GLXA 2D1HA 3RT6B 4MLQA 4THIA 5CMCA 3E97A 5HVQC 4IO5A 1USTA 2F7BA 4OFLA 4N9IA 4H8JA 2O1LA 2UYFA 2D21A 1PBPA 4M9ZA 4ELQA 2BGCA 4ZS9A 1SW2A 2LDUA 3KP4A 5K2XA 3RTWB 3O28A 4ETSA 3OMBA 1SFEA 4ZZDA 1NFTA 4M6YA 5AA2B 1FTOA 1QUJA 2Z8FA 1US5A 2J5OA 4RJZA 5J8CA 3C32A 4JQFA 5KCJB 1K78B 1O3QA 3U8QA 4Y15A 3COAC 3IK6B 3U94A 3ISPA 1H44A 2PMSA 3HCQA 4KT5C 3PPPA 3MP6A 3LSXA 2M8EA 1HW5A 2FEZA 2F6GA 5IT9K 2OWTA 3MUQA 2L01A 1EH6A 2DSFA 2PFBA 6PAXA 1IF1A 3MC2A 2OU2A 4F18A 4RS8A 1CB6A 5JTYA 5HPQA 1XGMA 3IWFA 3G73A 3IRRA 3FV1A 1N84A 4H0EA 2VBZA 2XAGA 4HS7A 4A6EA 4R6YA 1M5BA 2F5XA 2XXQA 3IX1A 5E8IA 2HKOA 1HBXG 3PQKA 1YCJA 4ZYHA 5LBQA 3OSRA 2VN2A 4GL0A 3EDPA 1B4HA 4H5FA 1L0OC 3I53A 4O3MA 2Y48A 4R2BA 2I3WA 3E3VA 5DYMA 3K4UA 3FJ7A 1G3YA 2I0BA 5DUKA 2ETHA 4UUVA 1DPUA 2DVCA 2GHBA 4ENMA 1UTBA 1DMBA 3E5UA 3IL2A 3UN6A 5I56B 4F3GA 3FV2A 2LKPA 4JB7A 3L6GA 3I3VA 4TOZA 3P9IA 2P8TA 4LK0F 1MY1A 4RB3C 2EV0A 4U0YA 3ECRA 1O7LA 5TP9A 3RTRA 2HS5A 5A2QZ 3G3IA 2HTSA 1R23A 3IB2A 3KFMA 5AIQA 4HX8A 2F5CA 3IOWA 2HGCA 5FGMA 1TW2A 1MQJA 3FJGA 2WC2A 3L09A 1DPRA 3J81Z 1B40A 1URGA 1IW7F 3E6MA 3A3CA 2V1UA 4A12A 1QKBA 3KN3A 4BDLA 3GF2A 1N0TA 1FTKA 2DK8A 1FC3A 4P9FA 4KMFA 1XGNA 4RPNA 1ZRFA 1B3HA 1XT8A 2ZKZA 1JQFA 2IT0A 1NKXA 2QSXA 4IO4A 2KKOA 1TFAA 1BJAA 3C18A 4R6KA 4I7HA 3V89B 3I4PA 5FD6A 4LZ7A 3ML6A 1OR7A 3FXRA 5DEXA 3TCGA 3ZMZA 2CGPA 4WK8F 3CLOA 4G68B 2XXTA 1TW3A 1HKQA 2ZBKA 3H03A 5F7VA 1MRPA 3VFZA 4EJTA 1UFMA 1OQGA 4ZE8A 3RKWA 1XVYA 4QRZA 3P7IA 2VONA 1MD0A 2L02A 3U72A 1G6NA 4R2FA 3HIFA 1J59A 1JHHA 3LA3A 2MLKA 1YFHA 1VE4A 3T66A 1II5A 3M3FA 5ITPA 1POY1 2V6CA 3LAJA 1BP5A 4LJZF 2O51A 3KOTA 1EZPA 4KHZE 5DCFA 4ZZAA 2OZ6A 1SMYF 2LSOA 3EYIA 3UORA 2DWIA 4N9HA 1O64A 2EJRA 2PLYA 3TTNA 1L5TA 1Z91A 5BOXA 5CMKA 4WEDA 1R58A 1X3UA 2XGXA 3T0YA 3GLBA 4UVBA 3O3KA 5JTYB 4A2UA 2EFWA 3ERED 2CQKA 4QWQA 1ODDA 3QIMA 1HSTA 3VODA 1RYXA 4EXKA 3LQQA 3IHUA 2BJJX 2RN7A 2QBYB 5CC2A 4EQ7A 5D4RA 4I1DA 3ZMTA 3K69A 4LB6B 4ELRA 5H8NA 1A04A 2MC3A 3QP6A 3HTSB 1JETA 2AYSA 1P4AA 3O2PE 2VBWA 4U7BA 4EQBA 2Z22A 2NS0A 3RKYA 4FATA 5TPAB 4Q8RA 1F9NA 4FX0A 1EH3A 3TTLA 3BOQA 1OVTA 1U78A 2KIUA 4XIGQ 5IT9Z 3O6HA 1CGPA 3WE3A 4EF1A 5ICQA 2ACJA 3C7JA 1XCVA 1MXXA 2IJLA 4IGTA 3F21A 4BYYA 3MP8A 3U2RA 1Z1DA 1N7WA 1V3FA 3WODF 1KU3A 2UXAA 2JPCA 1U2WA 3U9GA 5LEKA 2P7VB 1T6SA 5LRRA 4EM0B 1B3FA 3WGGA 5IAIA 2ZO4A 3I5UA 3ZMSA 5BS6A 2RDPA 4R73A 4A6DA 4JWXA 3R6UA 2XV4S 2DE2A 3MZBA 4POXA 4HW0A 4YZZA 4JSOA 3CRBA 4RNSA 1BI2A 2Z3YA 3JAMK 2E1NA 3MAJA 2AIXA 4I8CA 1STZA 4H1XA 5L3DA 3BFUA 2ZYMA 4CXFA 3LAPA 4M9SA 4ZYGA 5I57B 3GX4X 3FJMA 2TDXA 1QO0D 3N6TA 1SW4A 2XVCA 1JW1A 1XDUA 5JI6A 1ZGAA 1LB9A 1B0LA 4D0PA 3KGCA 3FMQA 2ONRA 3DQVC 4RXLA 1B51A 1YQAA 4ZECA 2GFEA 2VD2A 2P5KA 3BDDA 5ERIA 2HZKA 5JK4A 5DEXB 1OMIA 1OQHA 2O6GE 3C35A 3RUMA 5HS9A 5BPDA 4U4SA 1ON1A 3M8UA 1S50A 4F31B 2PYYA 1SI0A 2IRFG 4H8IA 2JRTA 2NXOA 2ZNUA 2ELHA 4U0VA 3THIA 3BBRA 4EUOA 2XXYA 3V8XB 1WDNA 3MPLA 4NEDA 1S29A 1LBCA 1Y4CA 2IW5A 1FQBA 4FEDA 1PB7A 1ELJA 2XAHA 2CZLA 4OWDA 4FT8A 4WX9A 4L0ZB 1UIUA 2EK5A 3V7RA 5J1DA 1GVCA 4R9FA 3CUQC 3B73A 2XD3A 1FBQA 3KG2A 2GWRA 2RF1A 4A0XA 3TGNA 3OSQA 1MPBA 1EZ9A 2PVUA 3IR1A 2X4HA 2Z9OA 1NNKA 2QENA 2HQRA 1KYZA 3Q27A 4F1YA 4ZEKA 3TUSA 1LFHA 2Z23A 2B3FA 3O97A 3HHFA 3GZ5A 4DLDA 3NRVA 2DK5A 4AIJA 5FTIA 4HTGA 4DCXA 4QSCA 5TJJA 1KU9A 3PD8A 2KLFA 4IGRA 4S04A 4B8XA 3HYIA 2ZNSA 3Q25A 3R6SA 2W7YA 5H8NB 4PFUA 2FNAA 2DE3A 2DWHA 3QYTA 4EV0A 1MZBA 2K27A 4ZEIA 2CW0F 4KPTA 3S2VA 1LSTA 3IO6A 1O63A 4MNUA 2QUFA 2FYIA 4CDGA 1N76A 1IAWA 3F22A 4LP2B 3TCFA 5FFXA 2PG4A 1MM6A 1ZAOA 3M3KA 3KP3A 2ZMBA 5L9SA 2Y7RA 1J7KA 1VFDA 3GFMA 3K1MA 4ZEBA 2L4MA 4H67A 3RY3A 1JGSA 3GFLA 1QULA 4Y13A 4P55A 3RPUA 2QMXA 1K6OA 1MG1A 1ZIUA 3UA8A 2O0YA 2RNJA 3WG9A 2Q0OA 3BROA 4IXAA 2HCAA 4OEUA 2I4CA 3NEUA 4QLCU 1ZKBA 4U1OA 4L9JA 5ICTA 3WTSC 3RT8A 1BI3A 3ECHA 3UP9A 5D8LB 3CDHA 1A8FA 3ABTA 4UACA 1US4A 5H6QA 3LFKA 2Q9TA 4QFPA 3G3GA 3H6WA 4I2OA 3WE2A 1PEBA 1UTHA 3V5AA 4XXUA 1GGGA 2LF8A 3I6VA 1H3DA 4IHTA 2HAUA 2REGA 3V7CA 1TLHB 4AVPA 5LOMA 2IPQX 4OHNA 4YB6A 3OEMA 1IUYA 4OIOF 3FVNA 4QHQA 2BEOA 2PT2A 3CUOA 4HOBA 4NF6A 4PE5B 3SETA 4JBAA 2OQRA 2UZKA 1LDKB 3K6UA 1ULYA 1SYHA 3M8EA 2DBBA 1SD5A 1QW0A 2R71A 2PBIA 3WGIA 5D5XB 3JAMZ 2F6PA 3IB0A 5I2NA 2ONKE 4XKQA 2RCAA 1M5DA 2ONSA 3OO9A 3CIJA 1XMKA 3K00A 4RB0A 2VBYA 3WAFA 2V1XA 3DELB 5AA2A 3MBPA 4JWYA 1IN4A 1P6RA 3FUZA 4G9YA 5KCJA 1K78A 4KYEA 1M5FA 3TQNA 4L5IA 3PMXA 1ZTYA 3S9LC 4ASNA 3KJ7A 2GHAA 4KYSA 3GEZA 2Y75A 3MZ1A 4POWA 1JW5A 2HDCA 4OMYA 4CO8A 1J2XA 4G8XA 4XSZF 3GBBA 1ZRCA 1Q1HA 1XOCA 1E2XA 1BN5A 1B4ZA 4Q4ZF 1VSOA 3JZJA 4G68C 1SAXA 1Z7ME 4QFNA 5H8SA 2O3FA 1OIBA 1RYOA 4O5VA 1NHAA 1LB8A 1XS5A 2P4WA 2VXZA 5LRSA 2RKMA 5B70A 2F2EA 1HSEA 3BPXA 1S7AA 3I64A 5DDGA 5A2QK 1LVAA 5ED4A 3PMVA 1IXRC 2P6TA 4ZDMA 2L54A 3IOTA 3LSFB 1UIVA 3MFKA 4PGHA 4XLNF 3QRFF 3O6IA 4AB6A 3ZKLA 3B02A 3FGSA 5CMBA 3T9VA 4Z0IA 2QMWA 1EH8A 3CTAA 1LDDA 4LQ2A 2DTRA 3DEUA 1IRFA 2JZYA 1OPCA 4IY6A 3FX3A 2FBKA 2FE3A 4P11A 3TMGA 4F1UA 4EJWA 1MQIA 3U1OA 5I58B 4M1VA 1CE2A 3GXOA 2A5YB 3E6CC 1LAFE 2PQ8A 5L3FA 3L00A 4F1VA 1S8NA 3KE2A 3M3LA 4NB5A 4YU0A 1IXCA 4AIKA 2W85A 4GYGA 4HV5A 1M5CA 3KZYA 2YX7A 1TBXA 1MXVA 1SD4A 4LK1F 3JSOA 2M87A 2ESHA 3MJNA 3R4KA 1T98A 1LFIA 3FWEA 1SQYA 4DXCA 3B6WA 1PC3A 1GVJA 1Z9CA 1LAXA 4DZ1A 5BWJA 3FMSA 5H8FB 4GYIA 1S9TA 5DD4A 4WF2A 1W5TA 4XKPA 5LGNA 3FM5A 3T9UA 1W7PA 5K2YA 2XX8A 1B32A 1ZLQA 5HBCA 1BIBA 3MQ9A 3E13X 3SQNA 4NF4B 1G3SA 4ELOA 1MKMA 4A0ZA 1MQGA 1GHCA 3C9HA 5HLHA 1FTMA 2RC7A 1CF7A 1T38A 4EJVA 3PPOA 4G68A 3SZPA 3G3JA 1Y4TA 1NH7A 4NF6B 4A5MA 4KCDA 2M8CA 1U5TB 4KYWA 3LR1A 4HDVA 4OIPF 1B9JA 3IOVA 1F9BA 3M1EA 4JXIA 4CICA 4F7ZA 1MY4A 5I2NB 3FZVA 3M9AA 3SDFA 1DPPA 3TOAA 1OLAA 5AA3A 2FA5A 2MH2A 2DO7A 4G4PA 1C0WA 3M7GA 4LUBA 2H98A 4O3AA 3PPQA 2AL4A 2AS5F 2PN6A 1JE8A 4GXAA 1DSNA 2HZLA 2DVZA 4LONB 2F34A 3EETA 3F8FA 5HDGA 3WAEA 5AONA 5H6RA 3SERA 3H6UA 2XXWA 2XHDA 5EEHA 3MCZA 1B7HA 1QQIA 1XCBA 5FO5A 3R0AA 2P5LC 1ON2A 2XROA 4HDUA 2OBGA 2WV0A 2O84X 1TFDA 1RIOH 5F64A 5EYFA 4Q5TA 2NRAC 2QBYA 4MEXF 3VE1B 4E0XA 3CG3A 2V9VA 2J5PA 2E0SA 4MQVA 1IZ1A 1V4RA 2FQ3A 1MXUA 2AXLA 1SDXA 1GXPA 4CGZA 2OAZA 5CI5A 3T9HB 2X7PA 4KFQA 1TQMA 5TPAA 2HYGD 2ANJA 1IXSB 3MQ0A 1JVYA 3MWMA 3EHTA 3PUVE 3H92A 1Q1KA 4OERA 4DQ2A 3PUZE 1J9IA 1BBYA 4UA8A 4IB2A 2XAFA 1VTNC 3WTXC 3DM0A 1YPNA 4GVOA 5I2KB 3PUXE 3GO5A 3H3ZA 1ZJLA 1FQCA 3K2DA 1B3EA 3ABUA 1OVBA 3QPTA 2HEOA 4OINF 2O68A 3P7NA 4A0YA 4LB5A 3CSBA 1USYH 2I49A 2V25A 3BZ6A 4DNCA 2OD5A 2GAUA 1ZGJA 2O1MA 4M73A 4LLNA 4HAMA 1R9LA 3ZN1A 5ILVA 5I57A 2ISYA 2RVCA 2NVUB 5IKBA 1D3KA 3IAZA 4PDKA 1OMPA 2Y84A 5F1QA 4WWCA 3EF7A 2G7UA 3PUYE 1W7PB 2V1DA 3TTKA 2PBWA 4BXUA 2ZMEB 4KNYA 1NNPA 1I6AA 4N0BA 2PJPA 4HX4A 4L17A 2L3DA 1WQ2A 3CI8A 2A5TA 3E9XA 2R6GE 3H7MA 1Y9UA 3JTGA 1CF7B 1BIYA 1RUNA 3EN3A 2QVOA 2GXBA 2MH9A 1HSLA 5D6FA 2A3SA 2RC8A 3SEYA 3JTHA 3H6TA 1YYVA 3TTRA 3O6BB 1Z7UA 2HEUA 2XUBA 2EFOA 4G6DA 5EEGA 3OO7A 1D9YA 1ZU0A 2FNCA 4R9GA 3VEPA 4ELPA 4MGRA 1ZN2A 2HAVA 4L9VA 3C31A 3TDZC 1WKMA 5L3GA 2DPDA 1FWZA 1R5HA 1XB4A 2DXYA 3O2AA 4RAYA 1EZOA 4LD5A 2OJTA 1H9TA 3KLOA 2V3TA 2QQ9A 4KUMA 3MZHA 3JYRA 2M1BA 1OKRA 3I54A 3OENA 1J75A 1PP7U 5A5XB 3V8JA 1SFXA 4OEVA 4HX7A 3KEIA 4AIHA 2NAZA 4RGXA 1B5JA 2OZZA 2DLLA 3K6XA 2UVHA 2XXPA 5LGTA 2GRVA 1QZYA 2O03A 3RKXA 2WTEA 5CMMA 2DT5A 2G7HA 3OXNA 2DWJA 1UHWA 5CVUA 4U22A 1UCRA 1SW1A 1GV8A 2GQQA 3RYRA 3MWBA 3W15C 4IRIA 4KR5A 2Q2EA 3WTWC 1FYLA 4GCVA 4HF2A 4G7ZF 3KOSA 3VXCA 1JEVA 3PMWA 1MXZA 1S7YA 1U6GA 3GFJA 3RPQA 2DOJA 3SZTA 3CO6C 5ISUA 3DLNA 4AWXB 4UV8A 1MDMB 3KJTA 4XKNA 2Z8DA 1BIAA 3K1PA 3JW4A 3MW0A 5ICCA 1IEJA 3CFLA 3KSXA 2DP8A 1LAHE 5L3EA 3HRSA 4R75A 1PUEE 1IN8A 4EXLA 4HV6A 1G3WA 1FZPB 2OA4A 2REJA 2ADUA 2CG4A 2F8DA 4LA9A 3QUFA 2RCBA 1TQIA 1TWYA 3C1DA 2KJCA 2QWWA 5K5OA 4GRKA 3E5QA 2EWNA 2QS4A 3QAHA 2Q2AA 4QFOA 4QFLA 3G3FA 1Z6RA 5ICFA 4OOIA 2V3QA 3PPNA 3BWGA 1JW4A 1H45A 1IN7A 2XD2A 5H8HB 5CVVA 4G6QA 2GH9A 4K3FA 5H8QA 2RV8A 1IN6A 2HXWA 1DDNA 1WRJA 3F6VA 5TU0A 1EU8A 4NF5A 1QNTA 2QL3A 4GL8A 4OTEA 2VBXA 5CVRA 3V8KA 2XX7A 5E18F 2H27A 3HOTA 2PX1A 2XXUA 2A61A 3G3HA 1MS7A 2H25A 3GUDA 4MBPA 1FW0A 2A5TB 4LZ8A 3DXJF 4I09A 1MXWA 4E70A 2GA2A 2DS9A 2DU9A 1XDSA 4FE8A 4R79A 1AOYA 3V4GA 5FFZA 1MPDA 1B7UA 2ZYNA 5HS8A 1SVXB 3D5LA 1R1VA 5F6FA 3K6VA 1KQ0A 2HOEA 1BC7C 3Q28A 4YIFA 1SD6A 2W84A 2D3IA 3HHGA 3HV1A 3CVGA 2H09A 5DVFA 1XVXA 3ZKKA 1BM9A 4LVQA 1MQHA 1USYE 1U3EM 1BOAA 1FTLA 2FBIA 3ONMA 4I0BA 1WVJA 4H65A 2ABHA 2F36A 2GA1A 3KLNA 1LCFA 4FORA 3SEVA 4EVIA 1TTYA 2W24A 5ICEA 3RPWA 4BDMA 2Z99A 1UB9A 3VOEA 3KSJA 4IO6A 4G7HF 3EPEA 2XRNA 4OU0A 3GWZA 3RQTA 1U5TC 5FB2A 3HRMA 4WCGA 4Z7EA 5FHNA 2A6HF 2FNPA 4KIFA 2K4BA 3CJNA 1YW8A 4LLGF 1YO5C 1A8EA 2ALUA 4NTLA 4WXDA 3QPHA 1A54A 5AIPA 3SFZA 5AA1A 2YR2A 1ZHFA 4EQ9A 4ON0A 1QVSA 2OK2A 3B6QA 1XC1A 1P1NA 1YS7A 2H4IA 4X1DA 3S4UA 2GZWA 2MD5A 4Q0CA 5LHIA 1LNWA 3WTVC 3MPKA 4JDFA 4F29A 4HYEA 3JV9A 2KRFA 5DD8A 1S7OA 3PV0E 2FSWA 3QK6A 5FTHA 5L9MA 4M4GA 4RPOA 4ZYDA 1FY7A 1KQ8A 1B0HA 3TO9A 2DQVA 4X9TA 5ITOA 1DTZA 5I58A 4MHGA 1B46A 1LB2A 1IN5A 1Y0UA 3G3ZA 3RJPA 3HRTA 2DQLA 2M30A 1RZ4A 4KN7X 3QU6A 2F5FA 2F5DA 3FIRA 3K0VA 4I01A 4DIGA 3S2WA 2VC1A 4C1UA 1T0KA 3O6GA 2MLGA 2YU3A 2F7CA 3MEXA 1WWXA 3R61A 3ZN0A 1RKMA 3Q5FA 5H8FA 1KA8A 1XSVA 3LA7A 1FLIA 2RC9A 1AH5A 1AMFA 3PUWE 1LBBA 3ZMUA 3LWFA 4KIGA 1IXGA 3RI4A 3T22A 5H8QB 1OYYA 3U92A 1MQDA 2R7DA 5K1YA 4G2ZA 5LHHA 4FEBA 1A99A 4NF5B 1A7LA 1I69A 3FXQA 2P0SA 4NF4A 4CHUA 4P0IA 2KIMA 4GGGA 4XBFA 4M74A 3I5OA 5FD5A 4RA1A 4O3BA 3TO7A 3OO8A 4EM2A 1U5TA 4RGRA 5LLQA 1MJBA 4ZH4F 1OYIA 2XAJA 1REPC 3WTYC 2FMYA 3D4GA 2RKHA 3K6WA 2DYXA 4LMYA 3SEUA 3OD7A 2O6AA 1IIWA 2H99A 2XXXA 1MY3A 3CSGA 2LF7A 1I5ZA 4U88A 4Q30B 4OFJA 2STWA 3KN8A 4OZ9A 1H43A 3EQ1A 1SI1A 4ISUA 2FBHA 4N6PA 1D5VA 4O3CA 3IORA 1I1SA 5J6XA 2BBYA 3ZQ7A 2ZFWA 3BJOA 4N13A 2JPBA 2M45A 1Z6TA 2OZUA 3J7AO 3ROUA 2QJEA 3IC7A 1BLFA 1UHMA 4I98B 3OOPA 3HHHA 3K9TA 5L3CA 4YG2F 4AB5A 4KA4A 1HKSA 4L9NA 2PI0A 2UWMA 3KP5A 4ZEFA 1D8JA 2DAOA 1P1WA 4YICA 4RGSA 4YAHX 1K79A 5JEIA 3TAJA 3H06B 4XLPF 3QSLA 1FP2A 5H20A 3HSTA 4I02A 1GR2A 2Y7PA 2IP2A 1YAEA 1FX7A 1O57A 2PMUA 3IKVA 4DXBA 4TV7A 3FD3A 4YKKA 2XXHA 5HLGA 2A69F 3U1DA 5AE4A 4XRFA 4OQOA 2HQ0A 2H9BA 1Y20A 2D5WA 4PFWA 1DP7P 2O8XA 3QU3A 2V93A 3KBRA 4K2EA 1B5IA 3R26A 3PPRA 2B3BA 5DCMB 1QGPA 1AL3A 4QF9A 4NHJA 2DFIA 5I2KA 3NQOA 2MBFA 3ZMDA 4UNOA 3KN7A 4RK9A 3TTMA 3H6VA 4ZYEA 3ODBA 3UK4A 1BC8C 3TEPA 1I1GA 1ZH5A 1B52A 1PB9A 4RY1A 2D45A 4QFKA 1ZG3A 2JT1A 3MZYA 4YMBA 3FASA 1KU7A 4LZ5A 2Z8EA 4H0WA 3TZAA 4F2QA 2E7WA 3C3WA 3S9MC 1O7TA 1KYWA 2VT2A 3IO4A 4BDQA 2FOKA 3H3UA 4Q5SF 1O7FA 3PD9A 4OESA 1VFEA 4ENJA 3HSFA 2F78A 3H4ZA 2RC4A 3VVDA 1P1QA 2ZXTA 3ELKA 4R8HA 3N4MA 1M5EA 3LBSA 2VE8A 1QUKA 4F22A 1J1NA 4F3PA 2G29A 2ZNTA 2X7QA 2ZMEA 4EMSA 1FOKA 1RNLA 2H6BA 3TELA 2QQBA 5FLXK 4HLXA 4EQQA 2VOZA 1FQFA 2F7AA 2HQNA 3SEWA 2EV5A 1Z05A 2ZXJA 1U8RA 5FHMA 4FAJA 1DUXC 2FMLA 2IVMA 5KZTA 1JEUA 3TKYA 2UYEA 3C33A 1D9VA 1TQPA 4L5JA 1H0MA 3O66A 4EGYA 1URSA 2K86A 1JHFA 4PCQA 2D2WA 1R6ZA 2UVIA 3GVAA 2V79A 5AA4A 5IT3A 4Y17A 1B6AA 5BQTA 3KETA 1FQDA 4G8MA 4LQ5A 4GO1A 4M9XA 4GF8A 1ZYRF 3QAXA 1NNTA 3EYYA 1S6LA 1ONVA 4OMBA 4KD5A 4LFUA 1SMTA 1LCTA 3O29A 3B7DA 4CYDA 1PDNC 3DPLC 1HW1A 2P5VA 4FJPA 3TYHA 1MJAA 1ZLKA 4YFKF 5A5XA 2CO5A 1SFUA 5D5UB 1AIVA 2KJBA 2UVGA 1B58A 4BHCA 2OQGA 3KP6A 3RYPA 3VB2A 2QS1A 3RNNA 3N5LA 1P92A 5CYVA 1ZLJA 4HF1A 3CFXA 2VT3A 1BKAA 3V7SA 3TQLA 4KMUX 1B59A 4TLMB 2CSOA 4AQ4A 5HM4B 1LFGA 2YX4A 4OENA 4PZJA 5LHGA 1IXIA 5CJ9A 1B1XA 3U93A 1YLFA 3OELA 4GLIA 1WI9A 5K5QA 3FVOA 3MZ9A 4LLLA 2HFBA 2QQAA 4P0GA 1ZARA 1IXHA 4ENKA 3C34A 4MTDA 4RAZA 2CFXA 4CZZA 3EUHA 5I84A 2VHAA 1MDMA 2A68F 1ATGA 2NOOA 4IO7A 2VOOA 1RI7A 4ESJA 4U1ZA 1BI1A 4UVCA 1WSUA 2AL5A 5CRYA 2XKPA 4F2OA 2LNBA 2XKOA 1ZRDA 4U21A 3OV8A 3DF8A 2YJPA 1BI0A 4G8NA 3K2ZA 4HZFA 1MGTA 3HSEA 2OCUA 1OYWA 2H94A 4LG0B 1YTYA 1G3TA 2K4JA 5CLSA 4Q48A 2RGVA 3TKDA 4EJUA 1H9GA 2VD3A 2STTA 1FPQA 1W5SA 1HW2A 4I9DA 2H6CA 1HSJA 3QOPA 2UXNA 1FBSA 2QPQA 1N3WA 1OLCA 4MFIA 4OXVA 3S9NC 3Q29A 3EHSA 1YS6A 1MDQA 2XHKA 1O3TA 3KZZA 3WU1B 4L0YB 1I6BA 5H8HA 3RTFB 1R00A 2ZCWA 2QM3A 4GD5A 4JSDA 1PDAA 3J80Z 3T96B 1LEAA 3I59B 2P1SA 2QYOA 3E6BA 2XAQA 3IOUA 3ZPLA 5KDTB 4ESBA 3LSWA 1B7ZA 1N3XA 3W9WA 2HFHA 4PGGA 3IKTA 2FA7A 1B5HA 2VGQA 2HWVA 3DP8A 1TNTA 4EF2A 3VXBA 2R7FA 4BDNA 2F35A 2F5EA 1MPCA 5EHMA 2KIFA 1P1UA 2A07F 4UV9A 5AA2D
chains in the Genus database with same CATH superfamily
4ESWA 2E7XA 3Q9VA 3P9KA 4ZEDA 4OWRB 3GYHX 4Y33A 3W6KB 5IP6A 1N77A 1JXSA 3GBAA 1SANA 3G1LA 3QOEA 2DPUA 1I6XA 4OFOA 5IZ1A 1JVXA 2Q8MA 1T0FA 3KCCA 1FYMA 3SESA 1V5FA 4L9TA 5F1RA 4FE4A 5J4VA 1OCTC 5JFRA 3KP7A 1Y1ZA 4ESFA 3RKQA 1FT9A 4BAYA 4JBZA 2Y0MA 2NYXA 1E0EA 1B3LA 5J16A 2HDDA 2EZKA 5AA4B 1RDZA 4FISA 4OIQF 2F3BA 3H9QA 3D0SA 3C36A 3G3KA 1QJMA 3DFGA 3S17J 2QFLA 4YKJA 2M5WA 1R5GA 2A05A 3HN0A 3KZGA 3F6OA 4BE2A 1F4KA 3L6HA 2P2AA 3NWSA 4XONA 3VV5A 2DOAA 1USSA 4AD9A 1UG2A 5FLXZ 1VR5A 3VLUA 1GV5A 1PVEA 5FROA 1IRGA 5E1WA 1NUXA 2DE4A 3J7ZI 4EGZA 1NH8A 1B9NA 1XGSA 4YKIA 1IGNA 2CFOA 4IF4A 3T5XA 1PUFA 5H8FB 5B7DA 2E5NA 3RIRA 5EG0A 4IO2A 1MY0A 4PP0A 1URDA 4DXUA 2X0LA 4BQAA 2FF4A 4MEYF 1ZBMA 4IY5A 5E1XA 2EFPA 4KIBA 5CVIA 4GFBA 1EV7A 1NMUA 2H5YA 2R7QA 5D6EA 3ZSFA 2H1LA 5L9OA 1JNFA 2Y7IA 2IA4A 2XF7A 3WU0A 1B6HA 5CM6A 3HJEA 3R7XA 2IGOA 2BE5F 5J1YA 1Z7NE 4TLLB 2R4GA 1IMBA 5EYGA 3N97A 2OX3A 3F8MA 4YB7A 4U87A 5DTBA 1FSHA 1EYJA 2JSCA 4WXCA 3TW6A 4A3DJ 5DEQA 1QUIA 4GWOA 2R7RA 3G7WA 2ZNZA 1FTJA 3W6JB 3GYYA 2V84A 4QSEA 4BHBA 3KEOA 3AG3H 2CYYA 1LQ1A 1H76A 2AQFA 4M6XA 1DPEA 1FCKA 3QXMA 4R6HA 3LA2A 3K1NA 2JA6J 4F39A 2I0CA 1MJ9A 1YG2A 2ME0A 4HEA2 2FRHA 1OFCX 5E20A 3ULQB 1AWBA 1OCPA 1LJ9A 1IV6A 3OO6A 2IA2A 2GQ1A 2FHYA 3TP3A 4RGUA 1OCOH 2CMOA 4FETA 2QLZA 2O7OA 4BDZA 2LTPA 3AAFA 1G8XA 4DDDA 4EJOA 2OWSA 2WY8Q 4HQMA 3QPSA 3C4MA 3JSPA 4WKMA 4IRGA 3A2KA 1K7AA 2A5SA 1Y3PA 4BNCA 1KGSA 1KA0A 3EUAA 5EZHA 4BH9A 4U0WA 1JKOC 2XXVA 1AWCA 1MH3A 4XLAA 1B72A 2MD0A 3H0GJ 4JP0A 4ONYA 4X48A 1W7PD 1N04A 3EQLF 2OCEA 1LBVA 4B09A 3CG1A 4GOTA 1Y1MA 3SZGA 1ERDA 5KCMA 4PETA 4R74A 5BMZA 1QKAA 2CQNA 2Z5UA 4HA8A 2XA5A 2EB7A 4WXHA 1A31A 2V3UA 3OS1A 4GBWA 3S2HJ 2ZJRF 2VJIA 4IX7A 2LBFA 1P99A 2E1SA 2XIGA 3BJAA 4R72A 4WXJA 3LSHA 5M2VA 1UTBB 1U0JA 4I0AA 1QHGA 1TP4A 4YIIA 1EH7A 3HM5A 2VP1A 4H5GA 2E19A 4OETA 1ZG1A 3DKWA 4P96A 3S1QJ 4NE4A 2DJIA 1R22A 2VOPA 2VE9A 4ZE9A 2YPRA 1VQMI 1IMEA 1B1HA 2LLKA 1LLSA 1FQEA 2OF7A 4PFYA 1Y8RB 1MNDA 1YOVB 2Y0SN 5E3OA 2Z33A 2EIKH 3O8GA 5TP9B 2V1NA 2G9WA 3ECOA 4RB2C 4EDPA 4PFTA 2Q2CA 4GXSB 1MM7A 3BR3A 4G7OF 1INPA 2DA2A 1DOTA 3SKPA 3K02A 2Z1DA 2XGEA 2CU7A 1DTGA 4FHTA 1T2KA 1G4DA 3K70C 1ANFA 3HO7A 4GWUA 1VQKI 2I6EA 2G93A 2THIA 3TOBA 5LGUA 3TDJA 1NV2A 3PGFA 1MH4A 1YIOA 3PNTA 4M3GA 4OVPA 2R3SA 3HUGA 1OLTA 4G94A 2COMA 2Y7KA 3T93B 2XX9A 1MY2A 4H6DA 4HQEA 3V42A 1BW5A 5ELVA 1R6RA 3TO6A 3QQAA 3T8TA 2EA2A 2XWKA 1RC9A 1XD7A 1P2FA 2Y0SA 4XOTA 1VQ6I 3IJOB 4F3SA 4QSDA 3F72A 4LATA 4IPAA 3ILTB 3MYUA 5E79C 5ILSA 4F52A 1W36D 5DYHA 1MBEA 5EZGA 3FIWA 5GP9A 5HLTA 1IJWC 5FLVA 2ZJ2A 3SEXA 4DE8A 2PMHA 1XSXA 1L3LA 2B4MA 2Q89A 5IYBJ 2HHMA 3IJXB 2L9SA 3IRQA 3I0TA 2I10A 2BV6A 4NQWA 2JWTA 1FSEA 2DCEA 2GIZA 5D5WB 2XSDC 3HEFA 1ZG5A 4XN0A 1B9MA 2HTJA 1VQNI 4PFPA 1FBGA 4NWDA 3T9XB 3Q9SA 1SD7A 5HDNA 1WODA 1PB8A 1JKRC 2RQPA 2EFQA 3N26A 5DT6A 4PUSA 3E0JB 2HYFA 2CEYA 2Y7WA 4MLVA 1SVOA 2WAFA 3I71A 4OAZA 1HKTA 2A6EF 3E6DA 2JMWA 3FATA 3FKIJ 3MVWA 1LDJA 4NF8A 4XKRA 5M5WJ 1HXDA 3VVEA 4YMAA 2EV6A 1PUFB 3CCLI 2YSRA 3DKXA 1ZGWA 2KL4A 4CCNA 2M4KA 4XLEA 4F93B 2CH0A 1XGOA 3GXAA 3TPAA 3MVZA 4GQOA 4UXNA 1SBPA 1QBJA 1IITA 2Q8JA 4ABZA 3QUJA 3LC8A 1ETWA 5KVRA 3H3GA 3HSRA 1FNNA 4U23A 3R0JA 3UIFA 3K0LA 1DP3A 1U9OA 3O8HA 2K02A 1CQTA 2QZ8A 3PIOF 4OAYA 3HOZJ 4PFRA 4IRHA 3QP5A 4BLAA 1B1BA 3BP8A 3PUBA 3VSLA 1KQ9A 5C4JJ 3WTUC 1BTJA 4OYVA 3DBLB 1XI6A 4ECFA 4U7DA 2L9VA 2ESNA 2HR3A 2I48A 2VC0A 3BR5A 1NNFA 4U4XA 3WTTC 3TCHA 1B4AA 1TWAJ 4MTEA 3CO7C 4RLFA 1YW9A 2F6CA 2F5VA 2OBPA 2X48A 3ZCOA 2LKXA 5CBSA 1LKXA 2VODA 1QZZA 3PTYA 1OISA 4P5OA 3WTZA 3CFZA 1HDDC 1O3RA 5DCMA 3VWBA 3PU5A 3P9CA 3CD6I 2GXGA 3FXUA 4XTCQ 1ETXA 2FQ4A 2CWEA 1FPLA 3F23A 4ZDOA 1CNQA 2KHMA 4GIZA 2C6YA 2OJED 2DYRH 3CESA 1TT1A 2WKYA 3A09A 1N78A 3LSKA 2FXAA 1Y3QA 3U21A 2ZYKA 1I3QJ 3VLVA 3RCOA 3EPZA 3K4CA 2BJIA 2CW8A 1A40A 3F8CA 3L1PA 1O3SA 5BUUA 4HG2A 3Q0VA 3GMEA 4KDPA 1HA8A 4HE0A 3NAUA 4PSWA 5HDKA 2PT1A 3H5NA 4YFNF 2I4BA 3RGYA 5I59A 3V83A 4ZZEA 2E1CA 1PP8F 3ZQIA 1FBDA 3BPVA 1PBQA 3GFIA 2HOSA 4F3BA 1WHUA 4FCYA 1W1WE 4FX4A 1B8IA 3D4CA 1S3JA 2HZTA 1XHYA 3OR2C 1LUJB 2R7TA 4ZZLA 1N7XA 2F4OB 3B6TA 2K9SA 4E0WA 5CBRA 2R9JA 4NC8A 4CCMA 1FYKA 3A3UA 2W25A 2Q88A 2IA1A 4XK4A 4XRMA 4UUSA 5LEJA 5LDZA 2W48A 5DUIA 4GFRA 2JVHA 4IO3A 1I6QA 4NMYA 4FBPA 3VLWA 2XSJC 4N07A 1YTVA 1SD3A 4XM3A 2NNYA 5TRDA 1KWHA 4FIMA 2L4AA 1JI8A 4Z2YA 1GXQA 2CZIA 4KCCA 2BY0A 4IHSA 5JHUA 4C1TA 3T1BA 3I58A 2DFFA 2XDVA 3GTGJ 1POTA 4WEPA 1WJAA 3TQWA 3FM3A 5L3BA 5EHSA 4LGWA 2JTVA 2FU4A 4HBLA 2OLBA 4S05A 1XSDA 3ZQCA 4NHBA 4MH5A 2ISZA 1YI2I 1LEBA 3F9KA 3OIQA 1LGBC 3IL1B 4OVJA 1F1ZA 3MAMA 4A69C 1B3GA 1MDP1 2JK3A 5CKTA 3ABLH 3REOA 4IVNA 3TDUC 3MVXA 3OR1C 1B2HA 4UHTA 3CLQA 1K83J 3TFLA 5A5LA 1IUDA 1A5JA 2I58A 2NWJA 1LAGE 4P9KA 4ZTJA 2D1VA 3F3XA 1R1UA 3OOAA 3CUQA 4X1BA 5IY5H 5JVTA 2MFZA 1DQUA 1EJ9A 1GTKA 2XXRA 3KP2A 3L2CA 1HQCA 4C2UA 1F5TA 4YB5A 2IS6A 4YEJA 3ZMVA 3A02A 3K6GA 3DP6A 4TQUQ 2ELKA 1B05A 3FVKA 3Q26A 3HRUA 1KU2A 3LSLA 3VFJA 4ZC3A 3CCYA 2OCCH 1IQ7A 2H1KA 1GV2A 1PYVA 1BOBA 1K6YA 5IYDJ 5E8GA 2P7CB 2ZZVA 1FPJA 3VVFA 1ZTRA 3WU2C 1NV0A 1ZMGA 2VPRA 5L8DA 1DGWY 4NQWB 1E17A 1P4XA 2BW3B 3KFWX 3WGHA 3IP4B 3CR9A 2IS4A 2BYVE 1R9QA 2LAOA 5E17F 3W2AA 3BFTA 2ECCA 2IGMA 2ZMEC 2O61A 3RDIA 1TXFA 2FBPA 4RK2A 3LSTA 4JWOA 3ZS6A 5JR3A 5FHOA 2JN6A 4I62A 3DP4A 4PQJA 5B1BH 1N25A 1X19A 3S32A 4BU2A 1NL5A 2XXIA 2NNNA 2L5VA 3ZQFA 3OYAA 2PFYA 4NF8B 5D8KB 4XKBA 3S9EA 5DVIA 3CCQI 2ZB9A 3E3KA 4B3XA 3G6EI 3NOHA 4JOMA 2Y2ZA 2MABA 4M3DA 3OYEA 3JRHA 1R1TA 4QPQA 1SYIA 3LUYA 4W1UA 1W4MA 1G0IA 3V8LA 4XSXF 5KK1A 1TZLA 2X51A 1MBHA 2EFNA 2OV7A 4Q47A 3IV5A 4IJAA 3FHZA 5D4SA 4HLYA 3IWZA 3T8RA 5BPIA 2X26A 4A3GJ 3HTUA 2UVJA 1WGXA 2YPNA 1XMAA 1Y0NA 1TNSA 1VQ8I 2VKEA 2HQ5A 4DCYA 4M71A 2QRYA 4DYRA 2LKSA 3DP7A 1YW7A 2V4JC 1NI9A 4HCWA 4MF3A 2NUVA 3LMMA 1MIJA 3HG9A 4N4NB 5E1ZB 5FKKA 4OANA 3DPTA 4MQ9F 5I7IA 2DQRA 1UQWA 3E4RA 2DXRA 3J80K 1LE8B 1P9QC 3SHFA 4ZYAA 1FQAA 4KI0E 1X58A 3JR9A 1I27A 2IEEA 1TWHJ 4NBQA 1JTXA 2FJ1A 4XMYA 1RKTA 3M8FA 2O69A 3O9PA 4U2RA 4A5NA 4RB1A 1IDYA 2V9KA 3GZGA 2K7LA 2Y5LA 4KN4X 4LG0A 2VASA 2DI3A 3PFIA 5B66C 5M5XJ 4A3EJ 4L18B 2ZYOA 4G8HA 1HLVA 3E5XA 5HS7A 3UGWA 1AOVA 2V4CA 5LFAA 3LSPA 2ZFUA 1J09A 1QPMA 4GXOA 5J8FA 3BY6A 2DOEA 3CMMA 2XF5A 5HOOA 3OS0A 2O7IA 3FK7A 5IYCJ 3J7YJ 2MA3A 3J81K 1A55A 1P4WA 3N6UA 3OYJA 4G77A 4OIRF 5I59B 4OMZA 1D4NA 1R1NA 3MVYA 2P6SA 4PJMA 4XLFA 2RNGA 4B43A 5DV5A 3AXFA 4HCYA 4P8BA 3TODA 2GIVA 4ND9A 3EHUA 4PAIA 3F8BA 3T0JA 3CF2A 1MXYA 3L9FA 1FBUA 5ILUA 5F1JA 2O7UA 5IOYA 3PQJA 4YFXF 3ZP5A 3FMRA 4BHPA 1ZREA 3B8BA 3K01A 2KMUA 2X85A 3VDFA 1FP1D 5EGOB 2QS2A 5I56A 4HRIA 3LQRA 4RYAA 2IA0A 4UVAA 2DW4A 3I59A 4FE7A 2UXXA 4UUSB 3HOSA 1R7JA 1P1OA 4LN5A 3EUHC 3SXYA 3DV8A 3OYLA 4DYQA 2WWYA 4F55A 2IS1A 4ESXA 3JREA 4CSWA 4P9UA 4KFCA 5ICGA 5I5PA 5KDTA 3ZQLA 3HPIA 3GZ6A 4BDOA 1RUOA 1NUYA 4BL0B 3L2QA 3N94A 5HLIA 3H9GA 1D8KA 3GW2A 4D9JA 2WBDA 3FVGA 3USDA 4JK1X 1Q35A 3OSFA 2QSFX 2WY7Q 4FECA 5EQAA 5J47A 2B0LA 4C0RA 1FTAA 1GT0C 5K5RA 2B65A 3BJ6A 4KT6A 2HXOA 3FF5A 4PFOA 4PFIA 3L7WA 3AFHA 4M72A 4HNUA 3OYHA 1A36A 2M2EA 2ZZXA 1XN7A 2EA4A 2K3PA 4HF0A 3W9VA 2ZNYA 3B6AA 3VYUB 4NWCA 2Q8KA 1T39A 2DA4A 4CYCB 4MIMA 2B63J 2VPLA 4YKPA 5JLXA 3IB1A 2RINA 3EKIA 2KQRA 5D5VB 2DWAA 2HKXA 4KICA 5DVJA 4PGPA 1J5YA 3CUQB 1R36A 1EF4A 1UTHB 3FISA 4O6JA 4EM1A 3IH2A 2YLNA 3KEQA 2QS3A 3BKIB 2HYJA 3ILUB 2BXZA 3RLFE 1JTYA 3F11A 4BXFA 2W57A 2XASA 4R1HA 1D3YA 1Y3NA 4ENNA 4F19A 4A3IJ 4C3JJ 3IFCA 5CVJA 1JUSA 1FOXA 2PEXA 3OEKA 1J0RA 3F8NA 3RN8A 3TP0A 3R60A 1SW5A 3MKZA 3GLXA 2D1HA 4G6TB 1NK3P 3RT6B 4MLQA 4THIA 5CMCA 3E97A 5HVQC 4IO5A 1KONA 1USTA 1YIJI 2F7BA 3DTEA 4OFLA 4N9IA 1IMAA 4H8JA 2O1LA 2KIQA 2D21A 1PBPA 2UYFA 4PJJA 1X3WB 2LMDA 4M9ZA 4ELQA 2BGCA 4ZS9A 1SW2A 2LDUA 3KP4A 1LFPA 4AB6A 5CQEA 2HVRA 5K2XA 3ASNH 4QXDA 3RTWB 3O28A 4ETSA 3OMBA 1SFEA 2ELJA 1NTCA 4ZZDA 1NFTA 4M6YA 2VPOA 2XPWA 5AA2B 1FTOA 3BTLA 1QUJA 1US5A 2J5OA 3OL3A 2Z8FA 4NG7A 4RJZA 5J8CA 2W7NA 3C32A 4JQFA 3J7AY 5KCJB 1K78B 4P1LA 4D7MA 2XGDA 1RR7A 2V9PA 3FDYA 1O3QA 3U8QA 5GPAA 2HNHA 4AYBN 4BE1A 4Y15A 3COAC 3IK6B 3U94A 3ERMA 3ISPA 1H44A 4II3A 3G4SI 2OTLI 2PMSA 3HCQA 4KT5C 3PPPA 2HU9A 3K2AA 4XRSA 2M8EA 5E3MA 1HW5A 2FEZA 2F6GA 5IT9K 3LSXA 3MP6A 4RPOA 2OWTA 1FRPA 3HOXJ 3MUQA 1WI3A 2L01A 2B7EA 3S16J 2R7VA 1EH6A 2DSFA 2PFBA 4ZTFA 1FJ6A 6PAXA 1IF1A 3MC2A 2OU2A 4BY1J 4RS8A 1CB6A 4YELA 4F18A 1XGMA 3IWFA 4G12A 3G73A 5FBPA 5HPQA 1OR7C 2H8RA 3IRRA 3FV1A 3CCVI 4H0EA 2VBZA 3S3NA 1N84A 1VDWA 2FIXA 2XAGA 1U8BA 4HS7A 4A6EA 4R6YA 1Y39A 1M5BA 2F5XA 2XXQA 3IX1A 3OIPA 3PNYA 1VFCA 1SPIA 5E8IA 4AYBA 2HKOA 1HBXG 4I99C 3PQKA 1YCJA 4ZYHA 5LBQA 3OSRA 4PDDA 5DM7F 2VN2A 4PC9A 1WH7A 1KA1A 3W2VA 2X6YA 4ITVA 1D5YA 3EDPA 1B4HA 4GL0A 2VUMJ 4H5FA 1L0OC 2V26A 3I53A 4O3MA 2Y48A 4R2BA 2QF7A 1E3OC 2I3WA 1MMDA 1QZEA 3E3VA 5DYMA 3K4UA 3FJ7A 1G3YA 3BTCA 2E36A 2I0BA 5DUKA 2ETHA 1JKPC 4UUVA 3AG2H 1EZOA 3D5RC 5TPAA 1DGRM 1DPUA 2DVCA 2GHBA 3PIPF 4JVDA 2NXNB 3ONQA 1WVRA 4ENMA 1UTBA 4GBVA 1DMBA 5IZZA 2VJ4A 3E5UA 3GBGA 4UB6C 3IL2A 1H89C 1NK2P 3JRCA 2MSYA 3UN6A 4F3GA 4B44A 4IL6C 3F0CA 3I55I 2LKPA 3CCRI 3FV2A 3KBZA 3VSKA 1NUZA 3L6GA 3I3VA 4JB7A 4TOZA 3P9IA 2P8TA 4LK0F 5K7FA 1MY1A 4RB3C 2EV0A 4U0YA 1I39A 1O7LA 2A5WA 3ECRA 4CA0A 5TP9A 3RTRA 1ZQ3P 5H2FC 2HS5A 5A2QZ 3G3IA 2HTSA 1R23A 3IB2A 3KC1A 3KFMA 5AIQA 4HX8A 2F5CA 3IOWA 4I3YA 2HGCA 3CC4I 5FGMA 1TW2A 1MQJA 3FJGA 1FSAA 3K4MA 2WC2A 3L09A 1DPRA 1O4XA 4X04A 3DWLE 3X2QH 3J81Z 1B40A 1URGA 1IW7F 1WJDA 3E6MA 3JRFA 3PUFA 1WJEA 4XKWA 3A3CA 2V1UA 4A12A 3GTQJ 1QKBA 3KN3A 4BDLA 4CCOA 3RPLA 4XICA 3GF2A 3CMAI 1N0TA 4BQOA 1FTKA 2DK8A 2GM4A 1FC3A 1MMGA 2IGKA 4P9FA 2L2OA 3PSIA 4KMFA 1XGNA 4RPNA 1ZRFA 1B3HA 1XT8A 2ZKZA 5C3EJ 2XB5A 1F43A 2IT0A 1JQFA 1NKXA 2L9NA 3FBNB 3Q3SA 2KKOA 1BL0A 1TFAA 2QSXA 4IO4A 1BJAA 2DT7B 3C18A 4R6KA 4I7HA 3V89B 1NV4A 2EZHA 3I4PA 5FD6A 3B50A 4LZ7A 1Z67A 3ML6A 1OR7A 1R5ID 3FXRA 4HSTA 5DEXA 3TCGA 3BR2A 2CMPA 3JRDA 2EQRA 3ZMZA 4LG3A 2CGPA 4WK8F 2R7SA 3CLOA 4G68B 2XXTA 5M3FJ 1TW3A 1MBKA 1HKQA 2ZBKA 3M8JA 3CMYA 4BE0A 3H03A 5F7VA 1MRPA 3PM1A 3VFZA 1UFMA 2DODA 4EJTA 1FJLA 3RKWA 1OQGA 4ZE8A 1XVYA 4QRZA 3P7IA 5IOZA 2AXTC 2VONA 2F97A 1MD0A 2L02A 3U72A 1AKHA 1G6NA 4R2FA 3HIFA 1J59A 1JHHA 3LA3A 2MLKA 1YFHA 3GLLA 3M1CA 1VE4A 1II5A 3T66A 3HC7A 3M3FA 5ITPA 2HVQA 2R5YA 2LY9A 3AG1H 1A6IA 2M9HA 2V6CA 3LAJA 5J1UA 3HL2A 4LJZF 1BP5A 4PFBA 4NNJA 3KYDB 2O51A 3KOTA 1EZPA 4KHZE 5DCFA 2E2IJ 4ZZAA 3K4NA 2OZ6A 2ZJQF 2CV1A 1SMYF 3H35A 4HW8A 2LSOA 3DKYA 3EYIA 3UORA 4AC0A 3JRGA 2DWIA 4N9HA 3FK6A 3LL7A 1T33A 2EJRA 5TISC 1MBJA 4BS9A 2PLYA 1O64A 3TTNA 3SDBA 4W97A 1Z91A 1L5TA 5DTDA 5BOXA 4IHYA 5CMKA 5EDNA 4WEDA 1JUPA 1R58A 1X3UA 2XGXA 3T0YA 2M0MA 3GLBA 3O2AA 1E3PA 2RQQA 4UVBA 1WJCA 3O3KA 5JTYB 4A2UA 2EFWA 3ERED 1AHDP 1UHSA 2Z2SB 2CQKA 4QWQA 1ODDA 4E7LA 3QIMA 1FPFA 4G61A 1HSTA 4A3FJ 3VODA 3ASOH 1RYXA 3LQQA 4EXKA 1SFKA 3IHUA 2CV2A 2BJJX 2L7KA 2RN7A 3DEEA 3H0DA 2QBYB 2NVYJ 1MW7A 5CC2A 3LNQA 4EQ7A 3KPHA 3W3CA 5D4RA 2PJRB 3HOVJ 4I1DA 1S9HA 1EKEA 3ZMTA 2LG4A 3K69A 4LB6B 4A3BJ 4ELRA 5H8NA 1A04A 3HPGA 2MC3A 2QCOA 3QP6A 3HTSB 1JETA 2AYSA 1P4AA 3O2PE 5ET5A 2VBWA 4U7BA 4EQBA 4IOAF 2Z22A 2NS0A 3RKYA 4FATA 5TPAB 2E1OA 4Q8RA 1ETQA 1F9NA 4FX0A 3VDXA 1EH3A 3TTLA 3BOQA 1OVTA 2KP6A 2KIUA 1U78A 4XIGQ 5IT9Z 2IBDA 3O6HA 2E60A 1ETVA 3WE3A 1CGPA 4EF1A 2ACJA 1X1CA 5ICQA 3C7JA 3ZR8X 1XCVA 3PO2J 4PAKA 3A03A 1MXXA 2IJLA 4IGTA 3F21A 1FOWA 5ESYA 3DPUA 4BYYA 3MP8A 1W0TA 3U2RA 1Z1DA 4XIDA 3FXMA 1N7WA 1V3FA 2DMNA 1ACIA 3WODF 1KU3A 5JLWA 2MKZA 3MVPA 2JPCA 2UXAA 1U2WA 3U9GA 3OYGA 4N91A 5LEKA 1XTAA 2P7VB 1T6SA 5LRRA 4GDFA 1X4PA 3QODA 4KJZA 4EM0B 1ZR2A 3WGGA 1B3FA 5IAIA 2ZO4A 3I5UA 3ZMSA 3JRIA 3ZOBA 5GAGJ 5BS6A 2RDPA 2Y69H 4R73A 4A6DA 4JWXA 3R6UA 3ABMH 2XV4S 1K4SA 2DE2A 2WYKA 4HW0A 3MZBA 4H46A 4POXA 5CMMA 4YZZA 4JSOA 3CRBA 2DMQA 3DLAA 3A1YA 1BI2A 4RNSA 2Z3YA 3JAMK 2E1NA 3M07A 3MAJA 4Y3OA 4B47A 1STZA 1NV6A 5L3DA 2AIXA 3BFUA 2ZYMA 4H1XA 4CXFA 3LAPA 4M9SA 1GVDA 4ZYGA 1EYIA 1R4MB 5I57B 3GX4X 1WCMJ 3HXLA 2W00A 3FJMA 2QKLB 3U1KA 4N17A 5F24A 2TDXA 3RPLB 1FIPA 1QO0D 1NH3A 3N6TA 1SW4A 2XVCA 1JW1A 1XDUA 2VKDA 1BA5A 4N6DA 5JI6A 1ZGAA 1LB9A 1B0LA 4D0PA 1IO2A 3KGCA 5T3JA 3FMQA 2ONRA 3DQVC 4RXLA 1B51A 5IP7J 1YQAA 4LIVA 4ZECA 2X6WA 2GFEA 2VD2A 3KYLA 2P5KA 3BDDA 3UNGC 4BJTA 3DU5A 5ERIA 5FRMA 2HZKA 5JK4A 3MD2A 3W6VA 5DEXB 2XXKA 2R5ZA 1OMIA 1OQHA 2O6GE 3C35A 2DA5A 5HS9A 5BPDA 4U4SA 4X8RA 3RUMA 1ON1A 2BW3A 3FKJA 3M8UA 1S50A 4F31B 1APLC 2L7ZA 2PYYA 2M7BA 1SI0A 4CZCA 2R93J 2CUJA 4BGDA 2IRFG 5K7ZA 4H8IA 2JRTA 2NXOA 2ZNUA 2ELHA 4U0VA 3THIA 3BBRA 4EUOA 3PSFA 2XXYA 3V8XB 1WDNA 2JA2A 3TL4X 1AKHB 3MPLA 4X1DA 4NEDA 2JSPA 1S29A 1LBCA 1Y4CA 2IW5A 1FQBA 4FEDA 3RQIA 3B6CA 2R5YB 1YRNB 1ELJA 1PB7A 4PF6A 4EATA 1FPIA 4MNCA 2XAHA 2CZLA 4OWDA 4FT8A 4WX9A 4L0ZB 1UIUA 2EK5A 3V7RA 5J1DA 4BKXA 1GVCA 1OCRH 4II2A 4R9FA 3CUQC 4FTHA 3C2GA 3B73A 2XD3A 1FBQA 3BCBA 4P1WA 3KG2A 2VQHA 2GWRA 3HFUA 4X0GA 2RF1A 4A0XA 1TWCJ 2ID3A 3DEWA 3TGNA 3OSQA 2TCTA 3G1OA 1EZ9A 1MPBA 2PVUA 2X4HA 3IR1A 2Z9OA 1JGGA 1NNKA 2QENA 4AS5A 2HQRA 1KYZA 4C30A 3HOUJ 1RDYA 3CHGA 3Q27A 4MAGA 2P0WA 4HNVA 4F1YA 2CZKA 2NS8A 1LE8A 4ZEKA 1A6QA 2M0CA 3TUSA 1LFHA 2Z23A 2B3FA 3O97A 4Y52J 1LEVA 3HHFA 1T56A 3RQ4A 1MMAA 3GZ5A 1H8AC 4DLDA 3NRVA 1NV5A 2DK5A 4AIJA 2Q2EB 5FTIA 4HTGA 4DCXA 4QSCA 5TJJA 2ZXHA 4C2MJ 4XFEA 3RZDJ 1KU9A 3GTLJ 3PD8A 2KLFA 4IGRA 2ZSIB 4S04A 3MKLA 1R4NB 4B8XA 3HYIA 1S7EA 5M5YJ 2ZNSA 3Q25A 1XC5A 4KITB 3SEZA 3R6SA 1TL8A 2W7YA 3HPHA 4PFUA 2FNAA 2DE3A 5H8NB 2DWHA 3QYTA 4EV0A 1MZBA 2K27A 4F92B 4ZEIA 1FOYA 2CW0F 4KPTA 2QA4I 3VYRB 1LSTA 3S2VA 2I5UA 2IXSA 1SAUA 3IO6A 1XPXA 4NAPA 1O63A 3S2DJ 2HDWA 4MNUA 2QUFA 2DFEA 3LSRA 4CDGA 1N76A 1IAWA 3F22A 2FYIA 4LP2B 2VKHA 5EGOA 3TCFA 5FFXA 1I3AA 2P3NA 4JYKA 2PG4A 1MM6A 1ZAOA 2E35A 3AL0C 2JRMA 4DZJA 3M3KA 1QVUA 1VZ0A 2MC4A 3KP3A 5E3NA 1SEUA 2Y7RA 2ZMBA 5L9SA 1J7KA 2R7OA 1VFDA 3GFMA 3MKWB 2CW7A 4GWXA 3K1MA 4ZEBA 2L4MA 3A29A 4H67A 2WBBA 1JGSA 3GFLA 1QULA 3RY3A 4P55A 4Y13A 3RPUA 1FMVA 1NV7A 4LITA 2QMXA 1K6OA 3CMEI 1MG1A 1ZIUA 4B3AA 3S8PA 3UA8A 3GTMJ 2O0YA 2RNJA 1GDTA 4PBQA 2Y31A 3WG9A 2Q0OA 3BROA 4IXAA 2LK2A 2HCAA 4OEUA 2I4CA 3NEUA 4QLCU 1ZKBA 1T95A 5GTHC 4U1OA 4L9JA 3E1SA 5ICTA 1Z77A 2COBA 3BG5A 3WTSC 3RT8A 1BI3A 3ECHA 4DBRA 3UP9A 4CYCA 5D8LB 3FXKA 1YJNI 3CDHA 1A8FA 4JVIA 3ABTA 4N4OB 4XN3A 4UACA 1US4A 5H6QA 3LFKA 2GOXB 2M34A 2Q9TA 2ID6A 4I2OA 3G3GA 3WE2A 3H6WA 4QFPA 4QSHA 1PEBA 1UTHA 3V5AA 4XXUA 1GGGA 2DA1A 1MNMC 2LF8A 3I6VA 1H3DA 4IHTA 2HAUA 2REGA 3L2WA 3V7CA 3L2UA 1MSEC 1TLHB 4AVPA 4IQ4A 5LOMA 2IPQX 4OHNA 4YB6A 3OEMA 1IUYA 4OIOF 3FVNA 4QHQA 1EA3A 2BEOA 1IDZA 1IUFA 1YX3A 2PT2A 3S1RJ 3DU6A 3CUOA 4PBHA 4HOBA 3TBIA 5K7HA 4NF6A 4OVTA 4PE5B 1NV1A 3SETA 1VNDA 4JBAA 2OQRA 2UZKA 1ITYA 1LDKB 3K6UA 1ULYA 1X3ZB 1SYHA 3M8EA 2DBBA 1JKQC 3M3YJ 1SD5A 2R5ZB 4GX4A 1QW0A 2R71A 2PBIA 3WGIA 5D5XB 5EYRA 3JAMZ 2DA7A 2F6PA 4NF0A 3IB0A 5I2NA 2D5VA 2ONKE 4JX4A 4XKQA 1G59A 4E4HA 3TW7A 1M5DA 2ONSA 2RCAA 3CIJA 3OO9A 1XMKA 1MMNA 3K00A 4RB0A 4IZZA 2VBYA 3WAFA 2V1XA 3DELB 1X1DA 5AA2A 3MBPA 4JWYA 1IN4A 1P6RA 4JX5A 2AQEA 2L7MP 3FUZA 1GUUA 4G9YA 5KCJA 1K78A 4NX1A 1D0ZA 4KYEA 3KZIC 1VQ5I 4E7HA 3WG7H 1M5FA 3TQNA 5M3MJ 4L5IA 3PMXA 4NQ8A 3ZRGA 1ZTYA 2HPGA 3U65A 2CQXA 2CUEA 3BQYA 1F36A 3LFUA 1YJWI 4AM3A 3S9LC 4ASNA 1QVTA 1K4TA 3KJ7A 2GHAA 4KYSA 2AHQA 4ZDLA 2WA0A 1TC3C 3GEZA 2Y75A 4DGWB 2XAUA 3MZ1A 4POWA 2CRGA 1JW5A 2HDCA 3W2WA 4C3HJ 4OMYA 4CO8A 3OL4A 2VKVA 3GTKJ 1J2XA 3CCJI 4G8XA 1FBFA 4XSZF 3GBBA 1ZRCA 1Q1HA 1XOCA 1E2XA 4H45A 1BN5A 1B4ZA 4Q4ZF 1VSOA 3JZJA 4G68C 4P1EA 1SAXA 1Z7ME 2KZVA 4QFNA 5H8SA 2O3FA 3CJRB 5KAFC 1HOMA 1OIBA 1RYOA 2I3VA 4O5VA 4BEHB 1NHAA 1LB8A 1XS5A 1MNEA 2P4WA 2VXZA 5LRSA 1SC7A 2RKMA 2F2EA 2VB6A 1HSEA 4OA4A 3RYDA 5B70A 3BPXA 1S7AA 3I64A 5DDGA 2WV1A 4HPQA 5A2QK 1LVAA 5ED4A 1YHQI 3QPLA 3PMVA 1IXRC 2P6TA 4ZDMA 4B4CA 1Y8QB 1GLNA 2L54A 5HODA 1WZ2A 2ICWG 4LOCA 3IOTA 3LSFB 2X1DA 1UIVA 3MFKA 1ORKA 4PGHA 4XLNF 3JRBA 3QRFF 2WB1A 2HZDA 2KDZA 3O6IA 4I3EA 3ZKLA 3B02A 2F48A 3FGSA 2NVXJ 5CMBA 2F4IA 3BC8A 4Z0IA 3T9VA 2QMWA 5I56B 1EH8A 3CTAA 1LDDA 1D0YA 2DTRA 2BY2A 1IRFA 1D1AA 3DEUA 2JZYA 5TGTA 2JJKA 1OPCA 2OTJI 3FX3A 2E34A 2FBKA 1Y1WJ 2PFZA 2FE3A 4IY6A 4P11A 3TMGA 4F1UA 4EJWA 1MQIA 2DOFA 3U1OA 5I58B 4M1VA 1CE2A 3GXOA 4S0HB 2A5YB 3E6CC 1LAFE 3TEDA 5CPRB 2PQ8A 5L3FA 3L00A 4F1VA 1S8NA 3KE2A 3M3LA 5ET8A 3BR0A 4NB5A 4GX3A 4YU0A 1IXCA 4AIKA 4A3LJ 3IFAA 2W85A 4GYGA 4HV5A 1M5CA 3KZYA 2E1MB 2YX7A 1TBXA 2YS9A 3ZGKA 1MXVA 1SD4A 4LK1F 1Z0XA 3JSOA 4CCJA 2KR0A 4MIJA 5EF6A 2M87A 2ESHA 3S1NJ 3MJNA 3R4KA 1T98A 1LFIA 3FWEA 1IC8A 1SQYA 3B6WA 4DXCA 1PC3A 3K7AJ 1GVJA 4M6VA 1Z9CA 4C9YA 1LAXA 1YYZA 4DZ1A 5BWJA 3FMSA 3A01B 2MW8A 4GRIA 4C3IJ 3OS2A 2BY1A 4PTKA 3KYCB 4GYIA 1UAAA 5DD4A 1S9TA 2K9MA 4MMPA 4WF2A 5IZ3A 1W5TA 1MMSA 4XKPA 5LGNA 1V5GA 3FM5A 2X6XA 3T9UA 2BZTA 1LBYA 3PL8A 1W7PA 5K2YA 4PSXA 2XX8A 3OYNA 1B32A 3GTOJ 3SEQA 1ZLQA 5HBCA 5DS9A 1BIBA 3MQ9A 3E13X 4HXVA 2XRLA 4J00A 3SQNA 4NF4B 1G3SA 4ELOA 2F3DA 1MKMA 4A0ZA 4M3FA 1POGA 1MQGA 1GHCA 3C9HA 5HLHA 4PE3A 2O8KA 1FTMA 2RC7A 3OSGA 1CF7A 1T38A 4EJVA 3PPOA 4G68A 3SZPA 3G3JA 1Y4TA 1NH7A 4NF6B 4A5MA 4KCDA 2M8CA 5EJCA 1U5TB 4KYWA 2CS3A 3LR1A 1RESA 4HDVA 2PCRA 4OIPF 4LIUA 1B9JA 3IOVA 1F9BA 3M1EA 4JXIA 4CICA 5IP9J 2LOOA 2PX9A 4F7ZA 2EH3A 1IRZA 1MY4A 5I2NB 3FZVA 3L2RA 3CQZJ 3K4KA 3M9AA 3TMOA 1RDXA 3SDFA 1DPPA 4UY8I 4BDRA 3TOAA 2LR8A 3HB9A 1FBHA 1OLAA 5AA3A 2FA5A 2MH2A 3K4JA 2DO7A 4G4PA 4KQPA 1C0WA 3M7GA 3QYBA 3OYMA 2JJ7A 1QHHD 4LUBA 2R7XA 2H98A 4CUGA 1OCZH 4D1QA 3PPQA 2AL4A 2AS5F 4O3AA 2PN6A 1NG7A 2RAEA 1D1CA 1JE8A 1HF0A 3LSJA 4MFDA 3DBRB 4GXAA 1SVMA 2EZLA 1DSNA 2DVZA 2HZLA 4LONB 2HXIA 2Z16A 1NV3A 2F34A 3EETA 3F8FA 1QU3A 5HDGA 3WAEA 5AONA 1UG0A 5H6RA 2WADA 2X1EA 3SERA 4L5EA 4BDYA 2XXWA 3H6UA 3BZKA 3K70D 4F3QA 5EEHA 2XHDA 3PO3J 3MCZA 1B7HA 1UZCA 1YZ0A 4MLOA 1QQIA 4RDUA 1XCBA 1AA7A 5FO5A 4AIDA 3RZOJ 1P7IA 3G1MA 3VYTB 5GAHJ 2ECBA 3K4BA 3R0AA 2JA8J 5IGAA 2P5LC 2LY2A 1ON2A 4RAFA 2XROA 4HDUA 1FPKA 2WV0A 5B3SH 2OBGA 2O84X 1FIAA 1TFDA 2CJJA 1RIOH 1ETOA 2ME6A 4A3MJ 1IG7A 5F64A 5EYFA 4Q5TA 5IPAA 2NRAC 1FBCA 2QBYA 4MEXF 3VE1B 4M3BA 2LP0A 3CG3A 2V9VA 4E0XA 1S72I 1V55H 2PJRA 2J5PA 1SFOJ 2JA7J 2E0SA 4MQVA 1IZ1A 1V4RA 2FQ3A 3I9V2 2UV1A 1MXUA 1TWFJ 2AXLA 1SDXA 1FMWA 1NG6A 5F04A 1GXPA 3K4LA 2VT5A 3G71I 4CGZA 2OAZA 4QIWN 3I4NJ 5CI5A 2LC2A 1DBZA 3T9HB 4XKVA 2ZC2A 2X7PA 1MBFA 4KFQA 1TQMA 3CP2A 2HYGD 3S15J 4A93J 1IXSB 3MQ0A 5F27A 2LVSA 3MWMA 1JVYA 2ANJA 2KQZA 3EHTA 4IR8A 4N15A 3PUVE 3H92A 1Q1KA 4MNPA 4OERA 4DQ2A 3PUZE 1J9IA 1JT6A 1BBYA 4UA8A 1EYKA 3Q0WA 4IB2A 2XAFA 1VTNC 1X2MA 3WTXC 3DM0A 4P3LA 1XG1A 2EIMH 4N4UA 2K40A 1YPNA 5JHFA 4GVOA 5I2KB 4N81A 3SYTA 1H88C 3BCAA 3PUXE 4AS4A 3GO5A 3H3ZA 1BJZA 3CCEI 1ZJLA 1FQCA 3MKYB 3K2DA 1B3EA 2CV0A 1HDPA 3ABUA 1QPIA 1OVBA 5C4XJ 2N8GA 3QPTA 2HEOA 2O5RA 4OINF 2O68A 3H9JA 3P7NA 4A0YA 4LB5A 3CSBA 1USYH 2I49A 3BTJA 3AKZA 2Q74A 2K85A 2V25A 1Z3XA 4A3KJ 3N05A 2KLOA 3BZ6A 4DNCA 1NUWA 2OD5A 2GAUA 1ZGJA 2O1MA 4PF8A 4M73A 4LLNA 2XWVA 4N8YA 1Z3YA 4HAMA 1R9LA 3ZN1A 5ILVA 5ET7A 5I57A 2ISYA 2RVCA 3GZNB 2NVUB 1WJBA 1X4OA 4CCLA 1D3KA 3IAZA 5IKBA 4PDKA 1OMPA 1KZ8A 2Y84A 5F1QA 5IZ3B 1WPKA 4WWCA 4ANJA 2IAIA 3EF7A 2G7UA 4BY7J 3PUYE 1W7PB 2V1DA 3BT9A 3TTKA 2PBWA 4O7IA 4BXUA 2ZMEB 4KNYA 1NNPA 1I6AA 4N0BA 1JT0A 2PJPA 4HX4A 3Q0UA 4L17A 2L3DA 1WQ2A 5HNFA 3CI8A 1FPGA 2A5TA 3E9XA 4MCOA 1A35A 3MN2A 2R6GE 4GWYA 3H7MA 1Y9UA 3OYCA 1ZK8A 3JTGA 1CF7B 3HBLA 1BIYA 3FBPA 4UABA 5EQ9A 1RUNA 3EN3A 2QVOA 2GXBA 2MH9A 1HSLA 2FIEA 5D6FA 2A3SA 2DMTA 2RC8A 2XWOA 4NN3A 3SEYA 3JTHA 3E79A 1YYVA 2OUMA 3H6TA 3TTRA 3O6BB 3L2VA 1W5CC 1Z7UA 2HEUA 2AO9A 2IGNA 2XUBA 3QYFA 5F0CA 2EFOA 4G6DA 5EEGA 4Z6YA 5EQ7A 3OO7A 2HPIA 3UKGA 1WJFA 1D9YA 1ZU0A 2FNCA 5JVGF 4R9GA 3VEPA 3FXOA 4ELPA 4MGRA 1ZN2A 2HAVA 2X6OA 4L9VA 1K9ZA 3C31A 3TDZC 1WKMA 5L3GA 2DPDA 1FWZA 1R5HA 1XB4A 2DXYA 2HQAA 3LOCA 4RAYA 3P5JA 2DMUA 1Q1VA 2VQGA 4LD5A 4XNFA 2OJTA 4OVRA 1H9TA 3KLOA 3S3OA 2QQ9A 2V3TA 4IHWA 3CJQB 4I76A 4KUMA 2W82A 3DTKA 3OYFA 2XC7A 3MZHA 2M1BA 3JYRA 1OKRA 1YE9A 5FKMA 5ET6A 3I54A 5HNHA 1J75A 2DTZA 3OENA 1PP7U 5A5XB 3V8JA 1BR4A 1SFXA 2DA3A 4QPOA 4OEVA 4HX7A 3KEIA 4AIHA 2NAZA 2HXRA 4DW6A 4RGXA 1B5JA 2OZZA 2DLLA 4J01A 3K6XA 2VJJA 2BVMA 1I6HJ 2UVHA 5EYHA 4PDHA 2XXPA 5LGTA 2GRVA 1QZYA 2O03A 2M4GA 4EEFG 3RKXA 2WTEA 4CH7A 2DT5A 2G7HA 4YRVA 2ZJPF 1XX5A 1UHWA 4J19A 5CVUA 2DWJA 1UCRA 3OXNA 4U22A 1SW1A 1GV8A 2GQQA 2P81A 3FBIB 3RYRA 3MWBA 3W15C 4IRIA 3OWTA 4KR5A 2Q2EA 3LV0A 4D7NA 2ZXWH 4ZJZA 3WTWC 1FYLA 4GCVA 4HF2A 4XEQA 4G7ZF 3GCMA 1N75A 2QSHX 3KOSA 3KIOA 3OY9A 4BBRJ 1JEVA 1MXZA 3PMWA 3VXCA 1S7YA 4FASD 2DN0A 3PFYA 4PK4A 1U6GA 3GFJA 3RPQA 2DOJA 3DBHB 1I50J 3SZTA 3CO6C 3DLLF 5ISUA 3DLNA 2QQ8A 2Y5KA 4AWXB 4UV8A 5B5EC 1MDMB 4E7IA 3KJTA 3BQZA 4BACA 4XKNA 2Z8DA 1BIAA 3K1PA 3JW4A 4XOPA 3MW0A 5GAEJ 5ICCA 3H3VK 1IEJA 3CFLA 3KSXA 2DP8A 3JRAA 2QSGX 3SDGA 4E7ZA 1LAHE 5L3EA 3HRSA 4RM2A 2K3FA 3BZCA 1PUEE 1IN8A 4R75A 1LBXA 2A6TA 1QA6A 4KXPA 4EXLA 4HV6A 4RM3A 1G3WA 1FZPB 2OA4A 2REJA 1DU0A 2L5QA 2ADUA 2CG4A 2F8DA 4LA9A 4O94A 3GTJJ 3QUFA 4XQFA 2RCBA 1TQIA 2Y9YA 1BK4A 2GOMA 4DBQA 1TWYA 2JVGA 3C1DA 2GBYA 2KJCA 2O9LA 2QWWA 5K5OA 4GRKA 4DIQA 3E5QA 3IH3A 4IEJA 2EWNA 4RBOA 2QS4A 3QAHA 3JCUC 1MSFC 2Q2AA 4QFLA 4QFOA 3LUZA 3G3FA 1Z6RA 5ICFA 3D1NI 4OOIA 4XL9A 5GPCA 2V3QA 3PPNA 3BWGA 1JW4A 1H45A 1IN7A 2KISA 3AG4H 2XD2A 5H8HB 1LBWA 5CVVA 2E71A 2EPFA 3IH4A 2BOLA 2X9DA 4G6QA 2LY1A 3CCMI 1XS9A 2GH9A 1XMXA 2V7FA 1D0XA 4K3FA 5H8QA 2RV8A 4GX6A 1IN6A 3OOUA 2HXWA 1DDNA 3QYEA 1WRJA 3F6VA 3MZ8A 4P47A 5TU0A 1EU8A 4NF5A 1QNTA 2QL3A 4GL8A 4OTEA 5C44J 1VQ7I 2VBXA 5CVRA 3V8KA 3A4CA 2XX7A 5E18F 2H27A 3HOTA 3BG9A 2PX1A 2XXUA 2A61A 3E7LA 4UUTA 1MS7A 3G3HA 2H25A 2MYSA 3GUDA 4MBPA 1FW0A 2A5TB 4LZ8A 2X1CA 3BG6A 5DM6F 5BNGA 3DXJF 4I09A 5CQGA 1MXWA 4KISA 2E1MC 1HCRA 4MX6A 4V2FA 4E70A 2GA2A 2DS9A 2DU9A 1XDSA 2NOJB 3K10A 4FE8A 4R79A 1AOYA 4DOZA 3V4GA 5FFZA 1MPDA 2GLOA 3ZQHA 1B7UA 2ZYNA 5HS8A 1SVXB 2EBIA 3D5LA 4O8MA 1R1VA 5F6FA 3K6VA 1KQ0A 1VQ9I 2HOEA 1BC7C 4FQGA 4H4KC 3Q28A 4YIFA 2CQ7A 4RLQA 1SD6A 1M1EB 2W84A 2D3IA 3HHGA 3HV1A 5JTYA 3MP1A 2LYCA 3CVGA 2H09A 5DVFA 1IV8A 2RREA 1XVXA 1BM9A 2BHZA 3MSTA 4NC6A 1WFXA 1D9QA 3ROJA 3ZKKA 4E7SA 4LVQA 1MQHA 1USYE 4AUXA 1U3EM 1BOAA 1FTLA 2FBIA 4X1EA 3ONMA 4I0BA 1WVJA 5GTIC 4Y7NJ 4H65A 2H8WA 2ABHA 2WX9A 2F36A 2GA1A 3KLNA 1LCFA 2W1OA 4FORA 3A0HC 3HZJA 3SEVA 4EVIA 2CUFA 1TTYA 2M7AA 2WEFA 2Y9ZA 1WJ5A 2W24A 4AVZA 5ICEA 2K5CA 1W0UA 2L0KA 5EG0B 2VLAA 3RPWA 4BDMA 1VQLI 4V19K 2Z99A 1UB9A 3VOEA 3KSJA 1R71A 3HGYA 4G7HF 4IO6A 3EPEA 2XRNA 4OU0A 4A3JJ 3GWZA 3RQTA 1U5TC 3ABKH 3HRMA 5FB2A 4WCGA 4Z7EA 5FHNA 4B1RA 4E7KA 1FEXA 4BEHA 5J1RA 2A6HF 3QMFA 2FNPA 3BG3A 2BXYA 5F0HA 4KIFA 1YXIA 2K4BA 3CJNA 1YW8A 4LLGF 3CDIA 4XLHA 1YO5C 1A8EA 2ALUA 4NTLA 4WXDA 3IAS2 3QPHA 4DYCA 1A54A 5I3SA 1FBEA 5AIPA 4BJ5C 1D1BA 3SFZA 5IM2A 5AA1A 2YR2A 1ZHFA 1YRNA 4ON0A 2E2HJ 1QVSA 4PJLA 1POY1 1XC1A 1P1NA 1YS7A 2ZSHB 4NUBA 2H4IA 2OK2A 3B6QA 2GZWA 2MD5A 5GADJ 5LHIA 4Q0CA 1LNWA 3WTVC 3MPKA 4JDFA 3KX2A 4F29A 2OC6A 4HYEA 3JV9A 2KRFA 5DD8A 1S7OA 4JVCA 5J40A 2FSWA 3PV0E 3QK6A 5FTHA 5L9MA 1RKWA 5LD2C 4M4GA 4ZYDA