3K1PA

Crystal structure of full-length benm e226k mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
303
structure length
303
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVRKVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator benM
publication title Structure of Full-length BenM
rcsb
source organism Acinetobacter sp.
total genus 77
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k1pA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1pA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1pA03
4H8IA 1A54A 4PDKA 5DCMA 2OLBA 2FXAA 3FZVA 3VXCA 4JWXA 1ZBMA 3VVEA 2ZXJA 4XKQA 3TTMA 2QENA 4OIPF 2F36A 4IHTA 4ND9A 3SEVA 3TQNA 2Z8EA 3RYRA 2F5DA 2GZWA 3IKTA 1KYZA 4G9YA 5JK4A 4G7ZF 1HBXG 2WTEA 3OOAA 3ROUA 3RGYA 5IT9K 3KE2A 2GQQA 4ZE9A 5JTYB 3I59B 1SDXA 1SW2A 4C0RA 5BPIA 1SBPA 3T9UA 1O57A 1O3SA 3R26A 2H25A 3M3LA 1AIVA 2HFHA 1MKMA 2FBIA 1I6AA 3SEUA 4BH9A 2X0LA 5A2QK 2VHAA 5CBRA 4GOTA 2IA2A 2PVUA 1JGSA 5LGTA 1YAEA 2QM3A 4ENMA 1ZHFA 1N3XA 4GWOA 4YZZA 4R6HA 3RPQA 2CSOA 3GLBA 1FX7A 5HDKA 1XCVA 2GFEA 4ELRA 3ZMSA 2HCAA 4OTEA 3T9HB 4LG0A 1PB9A 3MZYA 5FHMA 2QS4A 5HPQA 3W6KB 1EH8A 4HLYA 4U22A 4IF4A 4MQ9F 2V84A 2XAGA 3ZMTA 1LAXA 4JSDA 4MBPA 5JEIA 3A09A 3CIJA 2VXZA 3FJ7A 3F8BA 4ENKA 3FMQA 4KI0E 4XRFA 3IL2A 1O64A 1IAWA 4QFOA 2MH2A 4OMYA 3MWMA 3P9KA 4BAYA 1SD6A 1S7YA 2XKPA 1FBUA 2B3FA 4Q30B 3B6WA 2DE3A 4U0VA 2THIA 5F6FA 4F1UA 3IKVA 3K6XA 4G94A 4ESBA 5ILUA 4GCVA 1R22A 3KLNA 4O6JA 3ZN0A 4GXOA 2A61A 1CF7A 4A12A 3T22A 3RTFB 5DEXB 3F23A 2I3WA 4YG2F 4KIGA 3DPLC 1Y4CA 4RGSA 5DDGA 4LATA 2O1MA 4LFUA 2O84X 5EEHA 1KQ9A 1YQAA 2KRFA 2Y7WA 2FA5A 2K4BA 3V8LA 1S7OA 4JDFA 2D1HA 3RT6B 1IZ1A 5KVRA 1PP7U 4OINF 3LA7A 4F3PA 2R7DA 2KJCA 4AB5A 3F8NA 1O7FA 3LA3A 5JR3A 1YTVA 4PFTA 2W7YA 3NRVA 5L3FA 1NHAA 1MXUA 2DQVA 1IW7F 4UXNA 3H6UA 1YCJA 3SFZA 4JBAA 3CVGA 2ACJA 3VEPA 1VR5A 4F18A 3USDA 1N3WA 1I69A 2DWHA 5BUUA 4L17A 1FQCA 1Y9UA 3TUSA 3LSLA 5BPDA 2VONA 1VSOA 2CW0F 2F34A 2P1SA 2DO7A 4PE5B 5A2QZ 2Y84A 2VBWA 1S3JA 2OA4A 2XXWA 5E1WA 3IO6A 3DLNA 2YR2A 3WG9A 1QUIA 3WAFA 1FWZA 1U78A 4LZ8A 4N0BA 5I58B 3SEXA 3FMSA 4OXVA 1KU9A 2RV8A 2MA3A 4U7DA 5FO5A 1LVAA 2H6BA 1FBSA 2DU9A 1LBCA 3K02A 4A0YA 3HHFA 4F2OA 4AVPA 2EFWA 1Z9CA 1UQWA 4RB0A 4HS7A 1XSDA 2M87A 3FXQA 5HDGA 1W5SA 1N7WA 4FJPA 5ICQA 2DW4A 1MZBA 2K86A 3HRSA 3HSTA 3MUQA 3TFLA 2W57A 3V89B 4EGZA 3I0TA 3EUHA 1WODA 2I48A 3CG1A 1MDMA 4QLCU 3O3KA 1FW0A 1Q35A 2QMXA 3GZ5A 4POWA 4HQEA 3KZYA 3C1DA 1J1NA 1JW1A 4K2EA 3LQRA 1JHHA 1ONVA 4PETA 1MQJA 1WI9A 3OEMA 1FQFA 1YTYA 4A0ZA 3MZBA 1EZOA 3MP1A 2HEUA 3TEPA 2UXXA 1GXPA 2RC9A 3WTXC 2RC4A 4A2UA 2V3TA 1XGSA 4GF8A 4KA4A 3W9WA 3ILUB 4C1TA 4LK0F 3KCCA 4EJVA 1M5BA 1USYH 3TO6A 3HSRA 2BEOA 1U6GA 5FTIA 5KCJA 4NF6A 2ZXTA 3GVAA 4YMBA 3EETA 4OENA 5JHUA 2GA1A 5CRYA 1O63A 2DQLA 3MEXA 5TRDA 1RIOH 5L3GA 1SMYF 5L9OA 2A5SA 3HTUA 3MZHA 1B40A 5KK1A 5CMBA 2Z3YA 3FVGA 2GAUA 2DE2A 3M3FA 4AIHA 5HOOA 2Q8KA 3HHGA 3N26A 2H09A 4NF8A 2ZKZA 3TDZC 1FYLA 4GXSB 2V25A 4L0ZB 2P5KA 1G3TA 2PN6A 3TO9A 4B8XA 4DNCA 4Y13A 3V8KA 3K1MA 1MPDA 3FJGA 2PMUA 4OETA 3IL1B 1I5ZA 3HRMA 2XX8A 3HO7A 2VP1A 3U92A 1TW2A 3NEUA 1T0FA 2FYIA 4N9IA 3LA2A 4KUMA 2Q8JA 1TT1A 3UA8A 1LJ9A 1QPMA 1Y0UA 3WTVC 4R8HA 4BYYA 1XDSA 1LAFE 1RKMA 1M5CA 5KDTB 2QS1A 1Z7NE 1G3YA 2YPNA 3FVNA 3RKWA 4GXAA 2W25A 1IXRC 2HQ0A 2D3IA 3MZ9A 2E7XA 3DXJF 1ZGJA 2WV0A 1HSLA 2DSFA 3N4MA 5AA2A 1M5DA 5E1ZB 4ZE8A 4MTEA 3MZ1A 3GFIA 2ZCWA 2QYOA 4AQ4A 3FVKA 3I4PA 4DZ1A 5J8CA 4IO7A 1OIBA 3RY3A 3U94A 3G3JA 3F6VA 4OOIA 2DLLA 1Y1ZA 2UVJA 1ZARA 2Y75A 1A40A 1MXVA 2B0LA 4N9HA 5F1RA 3HSFA 3FV2A 4ZEKA 3V5AA 3K6VA 3DEUA 1DDNA 1B1BA 5LRSA 4H5FA 1FQEA 4OYVA 2D1VA 1H43A 3N6UA 3L09A 2UXNA 1B59A 3MCZA 2IW5A 4BDLA 1YLFA 2R6GE 2FBKA 2VBXA 2PLYA 2QQ9A 1M5EA 3U8QA 3O6IA 4HV6A 2RKHA 1QBJA 4KYSA 2DBBA 2HWVA 3T9XB 4UUVA 4LMYA 4HW0A 3SZPA 3J7AO 3GBAA 2JTVA 1TXFA 1FP2A 2QPQA 2A5TB 1FTOA 1IEJA 4RGRA 1LFGA 2Q2EA 2YX4A 3E6BA 2O6GE 4YAHX 1Y3QA 3WODF 1J0RA 2JSCA 3GZ6A 1R9QA 5H8FA 1LEAA 3DFGA 5CJ9A 4DE8A 3U93A 5ED4A 2XIGA 3E6MA 2RNJA 4DCXA 4DQ2A 3K1NA 4M73A 2ALUA 4K3FA 3DPTA 4LZ5A 2XXIA 4U21A 1P1OA 2VBYA 5BOXA 4Q5SF 2NNNA 1B3EA 3WE2A 3EYYA 1SFUA 1D5VA 5H8SA 2MD5A 2DWJA 4ELPA 5K2XA 4I7HA 4HF2A 2PI0A 1RI7A 1USSA 3KN8A 5FD5A 2ZMEA 3B6QA 1JE8A 2ONRA 4U23A 4OEVA 4EXKA 1I1SA 4RAYA 1SD4A 2M30A 1YS7A 1KQ8A 4OFOA 1A04A 1U5TB 4JSOA 1DTZA 1RYOA 1BJAA 2FU4A 2V6CA 4WX9A 3LSXA 5K1YA 1QUKA 5DEQA 2DPDA 1OVTA 4G4PA 1WRJA 1FP1D 1FZPB 4R74A 3ZQ7A 4WK8F 3CFZA 1J7KA 2JZYA 3KP6A 1V4RA 3EHUA 5CMMA 3KEOA 4WXDA 2RCBA 5AE4A 1J5YA 2ISZA 4HA8A 4M9SA 3J81K 5I56B 1P92A 3WTSC 3QAXA 4M71A 3UIFA 1XVXA 2GIVA 3DM0A 3M8EA 1TBXA 4KHZE 1QW0A 4ZZAA 5CMKA 1T6SA 1B3HA 1Q1KA 3C34A 1K78B 3KOTA 3ERED 3A3UA 3PMWA 2HOEA 3BFUA 4UA8A 2Y0MA 3QAHA 2PEXA 4FORA 2OWTA 3QXMA 5DVIA 3GZGA 1ODDA 2F5FA 3PUWE 1P4XA 1F5TA 1SD7A 4ETSA 4GO1A 1R6ZA 4EDPA 3QK6A 1IXSB 2I58A 5FD6A 3FGSA 3O6BB 1LAGE 5K2YA 2AL5A 4QSEA 4BDNA 2H5YA 4MFIA 3VE1B 1FNNA 1Z6TA 3SKPA 3VVDA 4O3MA 1FOKA 4ESXA 1U2WA 4RB3C 1XOCA 2CO5A 1ZAOA 4A6EA 1T39A 1P99A 3GX4X 3IB0A 4L18B 3IOTA 4BHCA 4R6KA 3RN8A 3K0LA 1WVJA 1R1UA 4F7ZA 5H8QA 1SD3A 1VFDA 2NAZA 1MG1A 3TDJA 2P6SA 4G7HF 2UZKA 5JI6A 3IAZA 5TP9A 3FF5A 2X4HA 5ERIA 4ON0A 2MBFA 4I98B 2QQAA 2PBIA 1MY2A 3L2CA 1BKAA 1YW8A 3H3GA 1MH4A 3QP5A 3GW2A 4HYEA 3EF7A 2F97A 2BV6A 4QSCA 4DXBA 1ZG3A 2FNAA 2I0BA 3IX1A 3TELA 3NQOA 5DD8A 2VOZA 3I71A 1IXCA 1LDKB 3KJ7A 4LA9A 1R5GA 3MPLA 2DOJA 1Z91A 3DV8A 3M7GA 1FTJA 5I57A 3FHZA 5LOMA 2OJTA 1T2KA 5E17F 4E70A 3MQ9A 4A5NA 2XXUA 1H0MA 4I02A 5FLXZ 3LBSA 5I2KA 4KFCA 4I0AA 4KFQA 1SFXA 1USYE 2QJEA 4H0WA 1R5HA 1ZRCA 1ZG1A 2ADUA 4IO3A 2RF1A 4CGZA 2LF8A 3C7JA 2UVHA 1ON2A 3D0SA 1TQPA 3EHTA 2FE3A 2ANJA 4XKRA 1BOAA 3K4UA 3OENA 4ZYHA 4XKPA 1SI1A 3QYTA 2FMYA 2G7HA 2P5LC 4IRIA 2XXPA 3PPOA 1N84A 4IVNA 4LB6B 5LBQA 3LR1A 3V4GA 1KQ0A 3TTLA 2HGCA 1ZRFA 1W7PB 2F7CA 4OQOA 1Z05A 2DT5A 3RQTA 4CO8A 5I2NA 3DP6A 2XAJA 3TZAA 4JB7A 1J59A 2GHBA 3M8UA 1HKQA 1D9YA 1OLCA 4NTLA 1IUDA 4ZZLA 3TQWA 4GYGA 4P55A 5HLGA 3HCQA 5L3BA 2H99A 3TO7A 3ECRA 5ICTA 1XN7A 4LK1F 3BWGA 1NFTA 2REGA 4CHUA 1FSEA 1HKSA 1IN5A 4MTDA 2LKPA 1ZRDA 2F8DA 5AONA 4OIOF 1P1WA 3O6GA 4MH5A 2RQPA 1REPC 2A6EF 4Q4ZF 2OQGA 1UTBB 4LZ7A 5EHMA 2QRYA 5FHNA 1XMAA 3TYHA 4Z7EA 4P0IA 5J1DA 3ECOA 3IORA 3RPUA 2DS9A 3HUGA 1UTHB 1XC1A 1LB8A 5JTYA 4KD5A 3GEZA 2HS5A 1LB2A 1JW4A 3WTWC 2O51A 5J8FA 3RDIA 1OQGA 3CUQB 1MM7A 3PUVE 5IT3A 4IB2A 3RTWB 3ZKKA 2XGXA 1N0TA 2F6PA 5HVQC 5CVIA 3H6WA 3K00A 1A7LA 4KN7X 5CLSA 3CDHA 4O5VA 1UB9A 2M8CA 3QPHA 1OKRA 4M1VA 1QZZA 1BC7C 1H76A 4P96A 1BIAA 1FY7A 1IRFA 1TFAA 3M1EA 3EQ1A 5ISUA 4HW8A 1EZ9A 2ZNUA 1MXWA 3BKIB 2COMA 4XLNF 3O28A 1XHYA 1SMTA 4Z2YA 2STTA 5AA1A 3T93B 4YIIA 4LQ5A 4PCQA 1LSTA 4RXLA 4TLMB 1TNSA 2QBYA 4XSZF 2DI3A 2H27A 4I2OA 5L8DA 3OELA 3S9LC 1L0OC 3QUJA 2V79A 3Q25A 1W7PD 4U1ZA 5I59B 3R6UA 3OXNA 4LLGF 3GXAA 4MF3A 1FYKA 1Z6RA 2VT2A 1B5JA 1H45A 2VODA 4C1UA 4YFKF 3TMGA 3G3HA 4EQQA 4AIJA 2QLZA 5DCFA 4U2RA 3N6TA 5DEXA 2L4MA 5E8GA 1DTGA 2PMHA 1R1NA 3LUYA 2W85A 3C3WA 4YKJA 3MVYA 3JSPA 3E4RA 3T96B 3FATA 1TNTA 3KZGA 4ELQA 3MFKA 2ZNZA 3H7MA 2Q0OA 3F72A 4IGRA 4M9ZA 1TLHB 1KU2A 4L9VA 2GA2A 3K0VA 3KOSA 4LG0B 4RNSA 3PUZE 3UP9A 4PQJA 2IEEA 2QUFA 2FA7A 1J9IA 3TCHA 1Z7ME 3R7XA 2E7WA 1ZLKA 1O3RA 3P9IA 4QFPA 1R00A 3PMVA 3VXBA 3O9PA 1UHWA 1B52A 3T8TA 2DTRA 4LB5A 3D5LA 2QL3A 5L3EA 1YG2A 1S7AA 3EDPA 3ONMA 1A55A 3CFLA 3ECHA 4RA1A 3GBBA 3WTZA 3CUOA 4Q48A 2EFNA 1HW5A 3OOPA 5IT9Z 5ELVA 4ZS9A 1MXXA 2KIFA 3SZTA 3SQNA 1B1XA 4QF9A 3WTYC 1US5A 4I09A 3Q26A 1BN5A 2XXTA 4S04A 3KN7A 1U5TC 3KGCA 4Z0IA 1J2XA 1MJBA 3GO5A 1AH5A 1ATGA 1Z1DA 1CF7B 3RTRA 1URSA 2P4WA 2A5YB 3GFMA 4KPTA 1XSVA 2ETHA 2EA2A 2G9WA 3JYRA 4R75A 3KSXA 3WGHA 5ICEA 4YFNF 3G3ZA 4NF5B 1B51A 3S2WA 1EH7A 2XX9A 4XXUA 1STZA 1J75A 1BI0A 3Q9VA 4RJZA 4KMFA 1OVBA 4AB6A 2Y7RA 4NB5A 3GLXA 1B9MA 5E20A 4O3AA 4HAMA 3TDUC 4HZFA 2QWWA 3R61A 4DXCA 1BLFA 1BI1A 1NNFA 2QS3A 1P4AA 2V93A 4BLAA 1B46A 3V7CA 1NNPA 2PBWA 4I8CA 2OZ6A 2DVCA 4WEDA 2YSRA 1JXSA 1ZG5A 3OEKA 2M5WA 5E1XA 4OIQF 4EV0A 3CG3A 5TPAB 4G8XA 5ILSA 1N04A 5B70A 3BFTA 4S05A 3E3KA 1P1NA 1KA8A 3Q9SA 2YX7A 2HZKA 5D5XB 1QNTA 3L6GA 4UVBA 1GV8A 2EFQA 1R7JA 4PGGA 3ULQB 2DVZA 3FM5A 4G6QA 3H4ZA 4PFYA 1SQYA 5AA4B 2ZFWA 2CWEA 3MAJA 1M5FA 4KYDA 4H8JA 3BPXA 3ZS6A 1U3EM 1IRGA 3QUFA 5FHOA 2F5CA 2V1XA 1G6NA 1OQHA 1FTKA 1DSNA 3W9VA 3OMBA 1FLIA 4F2QA 1LCFA 4ZYEA 4JQFA 1ELJA 3DP8A 4M6YA 4FAJA 1ZLJA 1YW7A 3O2PE 3F8CA 3IRRA 2Z33A 1LBBA 1HSEA 1YIOA 3PUXE 1Q1HA 4G77A 2DK8A 2F5EA 5HS9A 4IO6A 4WCGA 3CSGA 4IO5A 1MQHA 2XD3A 3DF8A 3DQVC 2Z8FA 1SW4A 4AD9A 3IHUA 4YKIA 3HIFA 3TCGA 1LNWA 4U0YA 2Y48A 3DP7A 4F1YA 3TAJA 1MY4A 1I1GA 5HDNA 4JBZA 1B7HA 3QSLA 2VBZA 5E8IA 4FHTA 4G8MA 2WKYA 4YU0A 5AA3A 4YB7A 2O3FA 2UWMA 3ZMZA 4BHBA 4ESJA 5LHHA 4Q8RA 1U8RA 2OAZA 2UXAA 1DPPA 2FQ3A 2FNCA 4NF4A 3PQKA 5H8HB 2O7IA 3F22A 3KBRA 4UVCA 2ZYKA 3BZ6A 1OMPA 3WU1B 2EB7A 1K7AA 3G3GA 1XGNA 3U9GA 4NHJA 1US4A 4FT8A 3E97A 1T98A 4L0YB 2EV5A 5CMCA 1P2FA 4QWQA 1W5TA 1AOVA 2QMWA 5H8NA 1PUEE 1IN4A 1S6LA 3PGFA 2Y7IA 2F7AA 4MHGA 3A3CA 1GXQA 2XVCA 2LF7A 4F1VA 3V83A 3U1DA 2XAHA 3QOPA 2EA4A 2D45A 3Q29A 4OZ9A 4UV9A 2Q88A 1KU3A 2YLNA 1SAXA 4R6YA 1GTKA 4GRKA 4OERA 4EJWA 2XD2A 3M9AA 2PYYA 5D4SA 1MQIA 3KP2A 5FTHA 3RIRA 4OHNA 4Q0CA 2RGVA 1V3FA 4ZH4F 4KYWA 1LFHA 5I84A 4ZYDA 4U0WA 3I58A 2OQRA 2RKMA 4TQUQ 1MQDA 4WWCA 2FSWA 3TODA 3L6HA 4XTCQ 1MXZA 4RGUA 2A68F 1SD5A 5LRRA 3CUQC 2PG4A 2UVGA 5F1QA 1YFHA 3O97A 4F39A 2XRNA 2IJLA 5HS8A 4P11A 4N6PA 3OV8A 3R0JA 2NS0A 1D3KA 1QKBA 2OK2A 1PDNC 5CBSA 1CE2A 5IAIA 1DPEA 1WKMA 3BJAA 1Y20A 3H92A 1YW9A 2X7PA 4MGRA 4KCCA 4XIGQ 2GXBA 3G3KA 3K69A 2J5PA 2RCAA 3C9HA 3PMXA 1IF1A 5D6FA 1L3LA 2OZUA 2BBYA 4EM0B 4YICA 2HKXA 4KMUX 4HF0A 2HFBA 3QP6A 1B3LA 2QS2A 3S9NC 3R0AA 3M3KA 3PPPA 1P4WA 4BHPA 2K02A 1P1QA 2VD3A 3IC7A 3H06B 1B4HA 1GVCA 3KFWX 2XHDA 1U5TA 2ZO4A 3ABUA 3C31A 3G3IA 2FRHA 2D2WA 2ZNYA 2VE8A 5HS7A 1I6QA 1X3UA 1USTA 5ILVA 1R1TA 2XX7A 4YKKA 4HDUA 1G3SA 2ISYA 2E0SA 4E0WA 3OSRA 3MQ0A 4RS8A 2BE5F 3F6OA 2HDCA 5I56A 3BOQA 1Y3NA 4ZDMA 1UIVA 3UGWA 3GUDA 4EUOA 3FD3A 4ESFA 1K78A 1ZIUA 2P8TA 2F7BA 4IRGA 4WEPA 4XBFA 3IOVA 3MC2A 1B0LA 3JAMK 3TPAA 2BJJX 2ZBKA 4RAZA 3H6VA 2KLFA 2OCUA 4M4GA 4YB6A 5L9SA 5DT6A 4NWCA 5CVRA 4BXUA 2PQ8A 3IJOB 2A07F 2ZMEB 3KETA 3LSTA 5FB2A 2RN7A 2V1DA 2DFIA 1PBPA 2A69F 3FXUA 4PGHA 1C0WA 2MLKA 4D0PA 2HTSA 1Y4TA 1ZKBA 1PBQA 3L9FA 4H0EA 1KU7A 3DELB 3FVOA 1MY1A 1LDJA 1B9JA 4OEUA 3IB1A 4POXA 1FTLA 6PAXA 1B7ZA 3OSQA 5ITOA 2LAOA 3EHSA 4YMAA 1IXIA 3KZZA 1OYYA 1QQIA 1F9NA 3RLFE 1MY3A 3OO9A 3QU3A 1A99A 3BBRA 4TOZA 2A3SA 3TTNA 4F22A 1IN7A 2MLGA 5DYHA 2M1BA 3VLWA 2FOKA 2FMLA 2QVOA 4ENJA 4JWYA 3VDFA 1EH3A 5ICGA 3B02A 2JT1A 3J80K 2STWA 4BDMA 1B5HA 2O61A 2NOOA 2X26A 2O7UA 4CZZA 2ONSA 5CC2A 5IKBA 2H6CA 3IO4A 2IP2A 4P5OA 3DKWA 3FJMA 3ZKLA 2WWYA 5A5XB 4U7BA 4FEDA 2P5VA 3K1PA 1H3DA 2PFBA 1R36A 3QIMA 3IOUA 5M2VA 3MP6A 4R73A 3SDFA 4GIZA 2W84A 3GFLA 5FFZA 1O3TA 3LWFA 1II5A 3SETA 5CYVA 1VE4A 1W4MA 3ZMVA 2EWNA 2XROA 3LAPA 4DLDA 1I27A 5B7DA 1R58A 2L54A 1ZU0A 3T0YA 1IN6A 4LJZF 1R23A 1GVJA 3CTAA 1ZYRF 4BNCA 1EU8A 5ICFA 3IJXB 3F8MA 3V7RA 3S9EA 5H8QB 2HQRA 4OWDA 1RZ4A 2FEZA 3CO7C 2AIXA 2EV6A 3QPTA 2ABHA 2ZNTA 4GL8A 1W7PA 3J81Z 3MAMA 2PT1A 3HPIA 2C6YA 1RUOA 4KCDA 4HV5A 3FMRA 4LQ2A 3T5XA 3Q5FA 1MPCA 3BROA 5DVFA 2HXWA 2AYSA 2D5WA 3SXYA 2OZZA 4M74A 2LDUA 4WXHA 4GFRA 5TU0A 4KQPA 4GVOA 3BP8A 1MJAA 1TTYA 5I57B 1QO0D 1JETA 3MJNA 4OU0A 3G73A 2Y7PA 2ZYMA 3GYHX 4EGYA 3IWZA 4IRHA 3H6TA 3HYIA 1MDQA 4FX0A 1EH6A 4G68B 2PMSA 2IVMA 2RC7A 4AWXB 3PQJA 4EQ9A 4OVJA 3UK4A 1B3GA 4GD5A 1UTBA 3F3XA 2F35A 2LNBA 3M8FA 3ZSFA 1B4AA 2MC3A 2PJPA 5DD4A 4NMYA 4IGTA 5H6RA 4O3BA 2FF4A 4JK1X 4KYEA 2VOOA 1CGPA 4N07A 4IHSA 1LQ1A 2F6GA 2K4JA 4MLQA 3HRUA 2DYXA 3C32A 4KIFA 3CUQA 3PU5A 3L00A 2R71A 2IPQX 3TTKA 2CGPA 2HKOA 3PUYE 5DV5A 4M9XA 1OLAA 1YYVA 2DAOA 1ZLQA 2Z8DA 3I59A 4TV7A 1BTJA 2JPCA 2Z99A 4ZEFA 4ZECA 4E0XA 2Y7KA 1F1ZA 3COAC 4FATA 4LVQA 4EQ7A 2R9JA 3WU0A 1B3FA 4X9TA 2HYGD 1URGA 3HTSB 1SVXB 1UHMA 3O2AA 2VN2A 2I4BA 4BDRA 1JQFA 3P7NA 3WGIA 4HX4A 2P7VB 3EQLF 5BWJA 3KP7A 3W15C 1A8FA 3ELKA 5HLHA 1ZREA 3FIRA 3EN3A 4PFWA 5AIQA 3OD7A 3VV5A 2UYFA 2TDXA 1GHCA 4IO4A 1QUJA 4I01A 1QULA 1IN8A 4L9NA 2Z5UA 3F11A 5I59A 1IQ7A 2GH9A 2E1SA 2F78A 3UORA 3P7IA 3TKDA 1OR7A 4HX7A 4QRZA 3K9TA 1Z7UA 5DCMB 1XT8A 4OFLA 4F3SA 3I54A 3W6JB 3R60A 2I49A 2H4IA 3CJNA 4KT5C 1L5TA 1MS7A 4QFNA 2OWSA 3MBPA 1LEBA 1DP7P 4R2BA 5DTBA 3VB2A 1S50A 3LAJA 1WWXA 3CI8A 1KGSA 2O6AA 2P6TA 3H3UA 2O0YA 4KIBA 3TTRA 1IIWA 1Y1MA 2OBPA 1XCBA 2HQNA 5L9MA 5BS6A 2BGCA 3JTHA 1LDDA 3U72A 5HM4B 1KYWA 5ITPA 3PD9A 3FV1A 2M45A 1QVSA 1TQMA 4PZJA 3C36A 2QBYB 5L3DA 2XXRA 1HKTA 1TW3A 2V1UA 3FXRA 2B3BA 2MH9A 5D5UB 5F64A 1NL5A 4G6DA 3TGNA 3S2VA 1H9GA 2P2AA 4F3GA 2ELHA 2HYFA 1H9TA 3WTUC 4G7OF 3OO6A 4HCWA 4ZZEA 4G8HA 2I4CA 2RDPA 3PFIA 2CYYA 2E1CA 4KICA 3E5UA 4QSDA 3PD8A 2P7CB 1FC3A 1E17A 2DPUA 4FECA 1LAHE 1WSUA 4NF5A 4R9GA 3Q27A 3THIA 2XXXA 4GLIA 1HQCA 5K5QA 2ZYNA 5I58A 2NYXA 3P9CA 4U1OA 1NH7A 1PDAA 2V3QA 2DP8A 4ECFA 3CO6C 1GGGA 3B7DA 1JVXA 2O68A 2HEOA 5CVUA 4HCYA 1S8NA 3CLOA 3B73A 4H1XA 1IXHA 1GR2A 2IRFG 1JW5A 4PP0A 2DXYA 5FGMA 1HW2A 1LLSA 1MM6A 1G3WA 2XXHA 4YFXF 3KEIA 4LLNA 1EV7A 4EF1A 2QSXA 3ZMUA 1BIBA 1B05A 5TPAA 3ZMDA 3OO7A 1EZPA 1FCKA 2O69A 4X48A 2H9BA 3G3FA 4N13A 5DUIA 1O7LA 4XKNA 3VOEA 4TLLB 3N94A 5EYFA 5D8LB 4BDQA 1K6OA 1WQ2A 1YS6A 4YIFA 2RC8A 3S4UA 3U1OA 2K7LA 1IXGA 3VODA 1HSJA 1SW1A 2O1LA 4IO2A 3TCFA 4I1DA 5AA4A 1I6XA 4QFLA 5D8KB 3WTTC 4R9FA 5JFRA 2DWIA 3O29A 2ZJ2A 4Q47A 4RK2A 1SYHA 3BJ6A 3MPKA 1FT9A 2DK5A 2VC1A 3FUZA 4OESA 2Q2AA 1KWHA 4MEYF 1OYWA 2FNPA 3UN6A 3V7SA 2YPRA 3D4CA 1D3YA 4M6XA 1BP5A 5L3CA 3EYIA 1B4ZA 1NH8A 2REJA 4I0BA 1RNLA 2ONKE 2B65A 4B09A 4IY5A 1QZYA 1DMBA 2I0CA 1R1VA 2D21A 1MDMB 1NMUA 2AXLA 3O66A 3FASA 5CM6A 2VE9A 1T38A 1IITA 1POTA 3IRQA 1OYIA 3SHFA 3H03A 3JW4A 3KEQA 2K27A 3SERA 3LQQA 3TOAA 1MGTA 1N76A 2PT2A 4R79A 3U2RA 4EQBA 3H3ZA 3HHHA 2CMOA 5DUKA 2R3SA 4DDDA 3MWBA 5CVJA 1MDP1 5H8HA 3I5OA 1FQAA 3V8JA 4H65A 2L3DA 5KCJB 4ENNA 4NF6B 5KDTA 2RVCA 3MVZA 3T8RA 4R1HA 2J5OA 3ZP5A 4FIMA 4O3CA 2O03A 2EJRA 2DWAA 4GQOA 1MPBA 3I53A 4LP2B 1JEUA 3SESA 3AAFA 1PB7A 2H98A 5CI5A 1FQBA 3CFXA 1FYMA 4BDOA 5E18F 4RPOA 4L9JA 4DIGA 4EJOA 1O7TA 3S9MC 3QRFF 5EEGA 1RUNA 5F7VA 1SW5A 2ZNSA 2L4AA 3VFZA 5ICCA 1B2HA 2RINA 4NF8B 3HOSA 3JTGA 3ML6A 1LB9A 2NNYA 4YKPA 4H5GA 3RUMA 3GFJA 3RNNA 5BMZA 2UVIA 2GXGA 2XUBA 4G68C 5FFXA 1IUYA 4CICA 2A6HF 3HSEA 1RYXA 3V8XB 3E5QA 4Y15A 3RT8A 5LLQA 3LSFB 2G7UA 5TJJA 1D8KA 2HZLA 1UCRA 3ISPA 1B1HA 1PP8F 1NNKA 2Q89A 3I6VA 3JZJA 4MQVA 1MRPA 2IA0A 4KNYA 4NF4B 4IJAA 2NWJA 3WAEA 3IK6B 1XB4A 2X7QA 4EMSA 1JVYA 2OU2A 3G7WA 2W24A 4OMZA 1FTMA 3TKYA 1B5IA 4RPNA 4HDVA 4MLVA 2EV0A 1POY1 3HOTA 1ZN2A 2YJPA 1OPCA 4FEBA 4LONB 1D4NA 5H8NB 1SYIA 5K5RA 4WKMA 1BM9A 4F3BA 3FWEA 3MVWA 4GYIA 4IPAA 5D5WB 1ZH5A 4GL0A 1ZJLA 4OFJA 2A5TA 5AA2B 1D8JA 1VTNC 4DXUA 3RKXA 5LHIA 1MD0A 1Y3PA 3JV9A 4DCYA 4P0GA 1P6RA 3OO8A 5LGNA 3ILTB 4F19A 3E3VA 4I62A 5CVVA 3GXOA 1XDUA 1XGOA 4EJTA 4ZZDA 2XHKA 2IT0A 1XS5A 2CZLA 4PFUA 4UNOA 2GWRA 3K01A 1BI3A 2HAUA 5LEKA 1FSHA 4NE4A 1O3QA 3VLVA 5H20A 1BI2A 4HQMA 4AIKA 2Z22A 2R7FA 3E9XA 4WXJA 4ZEIA 1TWYA 4EJUA 2JPBA 1JEVA 4LUBA 3KP5A 2Z9OA 1URDA 1ULYA 2VD2A 4CXFA 3SEYA 3C35A 3R6SA 4A0XA 4HF1A 1B58A 3I64A 3EPEA 3T66A 2M8EA 2AS5F 1CB6A 2FBHA 2WC2A 1BIYA 3VVFA 2IA1A 4U4SA 1YO5C 3HRTA 2PX1A 4FX4A 1QJMA 5H8FB 4EM2A 2QZ8A 3REOA 1QKAA 4MNUA 2ESNA 2XV4S 2XXQA 2DE4A 4ONYA 4U4XA 4G8NA 2O8XA 4H6DA 1PB8A 3RKYA 1R9LA 2ZYOA 4P9UA 4OIRF 4RB2C 3BDDA 1P1UA 5BQTA 3MW0A 4QHQA 3N97A 4ESWA 4F29A 4WF2A 1ANFA 1XVYA 1LGBC 1S9TA 2XAFA 1B32A 5AA2D 5FLXK 2KJBA 1NKXA 4IY6A 1UIUA 3AXFA 2EFPA 2ESHA 5J6XA 2F2EA 1XD7A 1ON1A 1YPNA 4X1BA 2G93A 5LGUA 5AIPA 4G2ZA 4HLXA 4UV8A 3ZN1A 4Y17A 3PPNA 1XSXA 3SEWA 1HW1A 3QU6A 5HBCA 4HTGA 2VC0A 3DP4A 2VT3A 4HOBA 1JNFA 2VOPA 3KSJA 3KJTA 4CYDA 4X1DA 4EXLA 3N5LA 3GF2A 2F5XA 1A8EA 3I3VA 2UYEA 5A5XA 3ABTA 4KN4X 2I3VA 2BYVE 3T9VA 4A6DA 3K2DA 1B6HA 1DUXC 4JXIA 4R72A 1FBQA 2L02A 1HXDA 1LFIA 3LSWA 5HLIA 3LFKA 1AMFA 2OD5A 4RYAA 1XGMA 3FX3A 4THIA 2Q9TA 2P0SA 4H67A 4YB5A 4Q5TA 3VFJA 4A5MA 2NVUB 1SI0A 3ZPLA 5D6EA 4JWOA 3BPVA 4NQWA 3K6WA 3C33A 2EFOA 4RB1A 2L01A 4WXCA 2JRTA 4QFKA 2YU3A 2Z23A 1PEBA 1DPRA 1AWCA 3IR1A 1BBYA 3RJPA 1LCTA 4OMBA 2E1NA 4EM1A 1TFDA 1DOTA 1G4DA 4U88A 3E6CC 4HBLA 2GRVA 2KKOA 2HTJA 1MQGA 2NXOA 4ASNA 2EK5A 1ZGAA 2NUVA 3E5XA 5H6QA 3WGGA 3RI4A 3FM3A 1HSTA 2CG4A 2OBGA 1ZTYA 1SFEA 4GGGA 1T0KA 3IWFA 4R2FA 3WE3A 3IOWA 4M72A 5LHGA 3I5UA 3L7WA 3Q28A 3JSOA 2HZTA 2IA4A 1B9NA 4L5JA 2HAVA 1B6AA 3JAMZ 5EHSA 2DQRA 2XXVA 5TP9B 4L9TA 3F21A 3IB2A 1VFEA 3PPRA 2H94A 3C4MA 3O6HA 3C18A 1FPQA 1F4KA 4ZEBA 1F9BA 5K5OA 3D4GA 4LD5A 3ODBA 3PPQA 5DVJA 5KZTA 4ZYGA 4G68A 4UACA 4NWDA 2XAQA 4KDPA 5D4RA 4RGXA 3RYPA 2GHAA 2KIUA 3TOBA 2Q2CA 2G29A 4BQAA 3F8FA 4EF2A 1K79A 4P9FA 2ZMBA 5I2KB 4ELOA 5DYMA 1S29A 1MXYA 1MH3A 1MY0A 1DPUA 4CDGA 3MP8A 3K6UA 3RPWA 1I6BA 2KIMA 4UVAA 3KFMA 2VGQA 3R4KA 2V9VA 2QQBA 4ISUA 5D5VB 3J80Z 2LSOA 5JVTA 1B7UA 1UTHA 1NNTA 3PV0E 3CSBA 3KG2A 4FE8A 3TQLA 4XLPF 3HV1A 4KR5A 3BJOA 1B0HA 1BC8C 4ZEDA 4I9DA 4LLLA 1UFMA 1AL3A 3K2ZA 2HR3A 1WDNA 3HN0A 2XKOA 1N7XA 4EVIA 4RY1A 1E2XA 2CQKA 1ZMGA 4F31B 2NRAC 1PC3A 1TQIA 2I6EA 4MEXF 2DXRA 4L5IA 4HX8A 1FQDA 2AL4A 3BY6A 4XSXF 4NEDA 3GWZA 3CRBA 5I2NB 3E6DA 3VLUA 2XXYA 1D9VA 4LGWA 4UHTA 3KLOA 2CFXA 3KP4A 3CR9A 1H44A 4IXAA 3LC8A 3B6TA 1QGPA 3KN3A 2XASA 1AOYA 3E13X 4RK9A 3MVXA 1MJ9A 1OMIA 3T1BA 5LEJA 1XMKA 2V3UA 3KP3A 1JHFA
chains in the Genus database with same CATH superfamily
4H8IA 1WJDA 3CP2A 4XLCA 1JUSA 1JKPC 2M4KA 1A54A 4PDKA 5J47A 5DCMA 5E3LA 2ZXHA 2IXSA 2OLBA 2FXAA 3FZVA 3VXCA 1IGNA 4JWXA 1T0FC 2DOFA 1ZBMA 3VVEA 1GUUA 2ZXJA 4XKQA 3TTMA 2QENA 4E7IA 4OIPF 2F36A 4IHTA 4ND9A 3SEVA 3TQNA 1HDDC 3LSJA 2Z8EA 2CMPA 2F5DA 2GZWA 4NBQA 3RYRA 3MKZA 3IKTA 1KYZA 5BNGA 4G9YA 4BDZA 5JK4A 4G7ZF 1HBXG 2WTEA 3OOAA 2VKVA 3ROUA 1Q9DA 3RGYA 2V9KA 5IT9K 3HUGB 3KE2A 2GQQA 4ITVA 4D7NA 1FBPA 4ZE9A 5JTYB 3I59B 1SDXA 3OYDA 2E2IJ 1SW2A 4UUSA 4C0RA 5BPIA 1FMWA 1SBPA 3T9UA 4BDYA 1O57A 1O3SA 1VFCA 3R26A 2V26A 1Z7LA 2H25A 3M3LA 2HFHA 4B3AA 1AIVA 1MKMA 2FBIA 2FD5A 1I6AA 3SEUA 4BH9A 4Y3OA 3U65A 2H8RA 1FRPA 2ZZWA 2X0LA 5A2QK 3QPLA 2VHAA 5CBRA 4DBQA 4GOTA 2IA2A 2PVUA 1JGSA 5LGTA 1YAEA 2QM3A 4ENMA 1ZHFA 1N3XA 2DMTA 1WJBA 4GWOA 4E7LA 3VWBA 4YZZA 4R6HA 3RPQA 2CSOA 3S15J 1FX7A 3CJTB 3GLBA 3D5SC 1XCVA 5HDKA 2GFEA 4ELRA 3LSKA 3ZMSA 2XPWA 5B3SH 2HCAA 4OTEA 4LG0A 1PB9A 3MZYA 5FHMA 2QS4A 3T9HB 5HPQA 3W6KB 1EH8A 3GTLJ 4HLYA 4U22A 4N4OB 4IF4A 2DA3A 4MQ9F 4XONA 2V84A 1PUFA 1R49A 2XAGA 1R5ID 1IV8A 3ZMTA 1LAXA 2VQCA 4JSDA 2NOGA 4MBPA 5JEIA 2LR8A 3A09A 3CIJA 4QPOA 5GAHJ 2VXZA 3FJ7A 2LVSA 3F8BA 4ENKA 4XRSA 3FMQA 4KI0E 4XRFA 3IL2A 1O64A 1IAWA 4QFOA 2MH2A 4OMYA 3MWMA 3P9KA 4BAYA 1SD6A 4RLFA 1S7YA 2XKPA 1XC5A 1FBUA 2B3FA 2BW3B 4ZDOA 3GTJJ 4Q30B 4XRSG 3B6WA 2KISA 2DE3A 4U0VA 2P81A 3KEYA 2B63J 5F6FA 2THIA 3IKVA 3OYMA 3CCEI 4F1UA 3S1NJ 3K6XA 4G94A 2E35A 4ESBA 5ILUA 4GCVA 1K4TA 1R22A 3KLNA 1QRYA 4O6JA 3ZN0A 2OX3A 4GXOA 2A61A 5E3NA 2HVSA 2F4MB 1CF7A 1X1AA 5TISC 4X0GA 4A12A 4IOAF 3T22A 4O8MA 2CQQA 3OIQA 4AC0A 3JRCA 3RTFB 1J09A 3F23A 5DEXB 3KIOA 2I3WA 4YG2F 4KIGA 3HOWJ 3DPLC 1G0HA 1Y4CA 4RGSA 5DDGA 2R7TA 3RZDJ 4LATA 2O1MA 4LFUA 2FJ1A 2O84X 5EG0A 4F52A 5EEHA 1KQ9A 1YQAA 2KRFA 2Y7WA 2FA5A 2K4BA 3V8LA 1S7OA 4JDFA 4PDDA 2Q74A 5GADJ 4N17A 2D1HA 1IRXA 3RT6B 1IZ1A 5KVRA 1PP7U 3TL4X 2R7VA 1K9YA 4OINF 3HOYJ 3LA7A 1UJ8A 4F3PA 2R7DA 5EZGA 2KJCA 4AB5A 3F8NA 3WHCA 1D1CA 1O7FA 3LA3A 3DLAA 3RPUD 5JR3A 1YTVA 4PFTA 2W7YA 3NRVA 3IAM2 3OL3A 5L3FA 1NHAA 3M3YJ 1LE8B 3CZ6A 1MXUA 2DQVA 1IW7F 4UXNA 3SZGA 3H6UA 1AU7A 1YCJA 3SFZA 1IUFA 4JBAA 3CVGA 2ACJA 3VEPA 2H1LA 1EYKA 3E1SA 1VR5A 4MCOA 3USDA 4F18A 2HNHA 1N3WA 2X6OA 1I69A 2DWHA 5BUUA 4L17A 1ZELA 1FQCA 1Y9UA 3TUSA 3LSLA 4NAPA 5BPDA 2VONA 4V2GA 3OWTA 1VSOA 2ZMEC 1LBWA 2CW0F 1QVTA 2F34A 2P1SA 2BHYA 2DO7A 3VPRA 5A2QZ 4PE5B 1T33A 2XSJC 4RBOA 2Y84A 4N15A 4NX1A 3S8PA 2VBWA 1S3JA 2OA4A 2XXWA 4QXDA 2Y31A 5E1WA 3IO6A 3DLNA 2YR2A 3WG9A 3K4NA 5ET8A 5DM7F 2HDDA 5C44J 1QUIA 3WAFA 1FWZA 1U78A 4LZ8A 4N0BA 5I58B 5KHDA 3SEXA 4A3FJ 4NQ8A 3FMSA 1DP3A 1K9ZA 4D5CA 2NVXJ 4OXVA 1KU9A 4FE4A 5IZ3A 2XAUA 2GM4A 2RV8A 2MA3A 3DEWA 4U7DA 5FO5A 1LVAA 1FPLA 2ME6A 2H6BA 4IHVA 1FBSA 2DU9A 5KNLA 5CPRB 1LBCA 4A0YA 1NUXA 3HHFA 3K02A 2V1NA 4F2OA 2ZZXA 4IKFA 4PAFA 4AVPA 2EFWA 1Z9CA 1UQWA 4RB0A 2M0MA 2K85A 4HS7A 1XSDA 2M87A 3FXQA 5HDGA 1W5SA 1N7WA 4FJPA 1SVLA 5ICQA 2DW4A 1MZBA 2K86A 3HRSA 3HSTA 3MUQA 3TFLA 2W57A 3L2WA 3V89B 4EGZA 3I0TA 3EUHA 1WODA 2I48A 3ASOH 3CG1A 1SVOA 1MDMA 5EQAA 2MKZA 1OJLA 4HSTA 4QLCU 3O3KA 3ZRGA 3AKZA 1KZHA 3WHBA 1FW0A 3GZ5A 3OYIA 3CCMI 1IMEA 1Q35A 2QMXA 4HQEA 3KZYA 3C1DA 1J1NA 4POWA 1JW1A 4K2EA 2KR0A 3LQRA 1JHHA 1ONVA 4LITA 4RMNA 2X6WA 1WH5A 4BBSJ 1HF0A 1IMCA 1WI9A 1MQJA 4PETA 2WBMA 3OEMA 4UB8C 2EQRA 2ZXWH 1FQFA 1YTYA 4A0ZA 1HLVA 3MZBA 1EZOA 3MP1A 2HEUA 3FBNB 3TEPA 2UXXA 4J01A 1GXPA 2RC9A 3WTXC 2RC4A 4A2UA 2V3TA 1XGSA 3FIWA 4KA4A 1X3WB 4GF8A 3H36A 3ILUB 3QYBA 4LK0F 3W9WA 1F43A 4C1TA 1HC8A 3KCCA 4EJVA 1M5BA 1USYH 3TO6A 1APLC 2MSYA 3FHNA 3HSRA 2K3PA 2BEOA 4LIUA 1U6GA 5EDNA 1MMNA 5FTIA 3HEFA 5KCJA 2AQFA 4NF6A 2L9RA 3HOXJ 4XFEA 3O8HA 3SESA 2ZXTA 3GVAA 4YMBA 3EETA 4OENA 5JHUA 2GA1A 1N75A 5CRYA 1OQYA 1WVRA 4XLEA 1O63A 3BCAA 4M6VA 2DQLA 3MEXA 5CQGA 5TRDA 1RIOH 4A3EJ 1YX3A 4CCOA 5CQEA 5L3GA 4OVPA 2XRLA 5EQ9A 1SMYF 5L9OA 2R92J 2A5SA 3HTUA 3MZHA 1B40A 2LMDA 4HSRA 5KK1A 5CMBA 2ZFUA 4IHXA 3DKXA 2Z3YA 3FVGA 1ACIA 1ETOA 2GAUA 2DE2A 3M3FA 4AIHA 5HOOA 2Q8KA 2M0CA 3HHGA 3N26A 2H09A 3FXMA 4NF8A 2YS9A 4PDHA 2ZKZA 3TDZC 1FYLA 4GXSB 2V25A 1B8IB 4BE0A 2V6EA 4L0ZB 2P5KA 4JVIA 1G3TA 2PN6A 3TO9A 4B8XA 4E7JA 1ZGWA 2R7UA 4DNCA 4BQQA 3V8KA 4Y13A 3K1MA 3HC7A 1MPDA 3FJGA 2PMUA 4OETA 3IL1B 2CEYA 1I5ZA 3HRMA 2CU7A 2XX8A 3DBLB 3M4OJ 4ANJA 3HO7A 2CZKA 2VP1A 3U92A 1TW2A 5M3FJ 3NEUA 1T0FA 2FYIA 2L9VA 4N9IA 2VPLA 3LA2A 3BC8A 2I8DA 3PNVA 1QGXA 3CMYA 4KUMA 4II2A 2Q8JA 1TT1A 3OY9A 1NV3A 3UA8A 4IX7A 5IPAA 1LJ9A 1QPMA 3SJMA 5J1RA 1Y0UA 3WTVC 3GYYA 4R8HA 4I99C 4BYYA 1XDSA 1LAFE 1RKMA 1M5CA 5KDTB 2QS1A 4PSWA 1Z7NE 3ERMA 1G3YA 4C2TA 2YPNA 3S3NA 3FVNA 3RKWA 4GXAA 2W25A 2WAQA 1IXRC 2HQ0A 1TWCJ 1YHQI 2D3IA 4MNPA 4F39A 2DDAA 1X3ZB 3MZ9A 2E7XA 3DXJF 3M8JA 4XN3A 1ZGJA 2WV0A 4C3IJ 1HSLA 2DSFA 3N4MA 5AA2A 1M5DA 4NC7A 3FISA 5EJCA 5E1ZB 2ZJQF 4Y33A 4ZE8A 4MTEA 3H35A 3MZ1A 3GFIA 2EILH 3HGYA 2ZCWA 2QYOA 4AQ4A 3FVKA 2E60A 3I4PA 4DZ1A 2JA8J 2Z1DA 5J8CA 2JJKA 4IO7A 4CH7A 1NV6A 2B9SA 3H0DA 1OIBA 3G3JA 3RY3A 3U94A 5I5PA 3F6VA 4OOIA 2DLLA 1Y1ZA 2UVJA 3Q3SA 5JLXA 1E3HA 1ZARA 2DA1A 2Y75A 1A40A 1MXVA 2OC6A 2B0LA 4N9HA 5F1RA 3HSFA 5IYCJ 3FV2A 4ZEKA 3HOVJ 3V5AA 3K6VA 3DEUA 1DDNA 2GBYA 2M2EA 3JRDA 2MYSA 1B1BA 5LRSA 3HKZN 4H5FA 1FQEA 2X48A 3CC7I 2CEXA 4OYVA 2D1VA 1DGWY 1H43A 3N6UA 3L09A 2UXNA 1B59A 3MCZA 2IW5A 4H4KC 4BDLA 1YLFA 2R6GE 4HE1A 2O5RA 2FBKA 2VBXA 2PLYA 2QQ9A 1M5EA 5F1JA 3CCYA 3U8QA 3O6IA 4C9YA 1LBYA 4NN3A 4HV6A 2RKHA 1QBJA 1NUWA 4KYSA 2AQEA 2DBBA 2HWVA 3T9XB 1H88C 4UUVA 4LMYA 4B48A 4HW0A 2QSHX 4BJTA 1DGRM 1CQTA 1LBVA 3SZPA 3J7AO 1AA7A 1S5LC 1NH3A 2X1CA 4XOPA 1KA1A 3GBAA 3OIOA 4P47A 2JTVA 4RAGA 1TXFA 1FP2A 2QPQA 2R5ZB 2JN6A 4GDFA 2A5TB 3DEEA 3TW7A 1FTOA 1IEJA 2F3BA 4RGRA 1LFGA 2Q2EA 1R4MB 2YX4A 3E6BA 2O6GE 5LTCA 4YAHX 2X6YA 3OYAA 1Y3QA 2K40A 3WODF 1J0RA 2JSCA 3GZ6A 1R9QA 1G2HA 5H8FA 2R7RA 2B4MA 1LEAA 1XMXA 3DFGA 5CJ9A 4DE8A 3U93A 3A0HC 5ED4A 2XIGA 3E6MA 2RNJA 3JRBA 4DQ2A 4DCXA 4DGWB 3K1NA 4M73A 2IGOA 2ALUA 4K3FA 3DPTA 3BIGA 1DCUA 2XXIA 4LZ5A 4CSWA 2VKDA 4U21A 1P1OA 1I39A 1LPQA 4E6KG 2VBYA 3OL4A 4KT6A 2NNNA 5BOXA 4Q5SF 1B3EA 2LFBA 3EYYA 3WE2A 1SFUA 1D5VA 5H8SA 5K7HA 2MD5A 2DWJA 4ELPA 5K2XA 2WAQN 4I7HA 4HF2A 2PI0A 1RI7A 1USSA 4J00A 3KN8A 5FD5A 2ZMEA 3B6QA 2HYJA 3HL2A 1JE8A 2ONRA 4U23A 4OEVA 4EXKA 1I1SA 4RAYA 2X6XA 1SD4A 2KDOA 2M30A 3FBPA 1YS7A 3U1KA 3KX2A 1KQ8A 4NC8A 5IYBJ 1A04A 4OFOA 1U5TB 4JSOA 2DT6A 1IDYA 1DTZA 1RYOA 1BJAA 2FU4A 2V6CA 2L5VA 4WX9A 2E34A 3LOCA 3LSXA 5K1YA 1QUKA 5DEQA 5F04A 2DPDA 1OVTA 4CCLA 4N4NB 4G4PA 1WRJA 1FP1D 1FZPB 3HFUA 4DYRA 4R74A 3X2QH 3FBIB 3ZQ7A 4WK8F 3H5NA 2ECBA 3NOHA 3ZQCA 2DXIA 3CFZA 1J7KA 2JZYA 3H9GA 3KP6A 1V4RA 3EHUA 1YE9A 2LH9A 1H89C 3S2DJ 3L2RA 3KEOA 4WXDA 2RCBA 4KITB 3KC1A 5AE4A 3H5RA 1J5YA 1Q1VA 2ISZA 2HDWA 4HA8A 4M9SA 2NXNB 3J81K 3ESWB 1P92A 3WTSC 5I56B 3QAXA 4M71A 3UIFA 1XVXA 2GIVA 3DM0A 2LD5A 2VJ4A 3M8EA 1QA6A 1TBXA 4KHZE 1QW0A 4ZZAA 5CMKA 3CESA 1T6SA 1B3HA 1BW6A 2HQ5A 1Q1KA 1K78B 3C34A 2KRHA 3KOTA 3ERED 1ENHA 3A3UA 3PMWA 2HOEA 3BFUA 4UA8A 2Y0MA 3QAHA 2PEXA 4FORA 2OWTA 3QXMA 5DVIA 5EYHA 3GZGA 1ODDA 2F5FA 1RRJA 3PUWE 1P4XA 1F5TA 1SD7A 1XX5A 4GO1A 1P9QC 4ETSA 1R6ZA 1OLTA 1P7IA 1IXSB 3QK6A 2I58A 4EDPA 5FD6A 2KQRA 3FGSA 3O6BB 1RR8C 1LAGE 1OCTC 1RESA 5K2YA 1CNQA 2AL5A 4QSEA 4BDNA 3VYUB 2H5YA 4MFIA 3MN2A 3VE1B 1FNNA 1Z6TA 3A01B 3SKPA 3K6GA 3VVDA 4O3MA 1FOKA 4ESXA 1U2WA 4P3LA 4RB3C 1LVKA 1WI3A 3OYCA 1XOCA 2CO5A 1ZAOA 4A6EA 4CZCA 1BJZA 4XLHA 4RAFA 1I50J 1T39A 3W6VA 3DTEA 1P99A 3GX4X 3IB0A 3JRHA 1SANA 3NWTA 4AIDA 4PUSA 2BOLA 4L18B 4AM3A 3IOTA 1YOVB 4BHCA 4R6KA 3RN8A 3K0LA 2VUMJ 1WVJA 4PAIA 1R1UA 2V4JC 2K9LA 4F7ZA 5H8QA 3GTPJ 1SD3A 2NAZA 1VFDA 1MG1A 3KC0A 3TDJA 3L1PA 2P6SA 4DYQA 4G7HF 4PBQA 2UZKA 5JI6A 2Y2ZA 3IAZA 5TP9A 3FF5A 2X4HA 5ERIA 4ON0A 2MBFA 4I98B 2QQAA 2PBIA 1MMSA 3DTKA 3L2CA 1MY2A 3B8BA 4GWWA 1FTAA 1BKAA 3MKLA 1YW8A 3H3GA 1MH4A 2NVYJ 3GW2A 3QP5A 4HYEA 3EF7A 2F97A 2BV6A 4QSCA 4DXBA 1ZG3A 4NF0A 2FNAA 2I0BA 3IX1A 3TELA 3EKIA 3NQOA 2COBA 1SAUA 5DD8A 3K2AA 2VOZA 3VYRB 3I71A 4NC6A 1IXCA 2DCEA 1T56A 3BTLA 1LDKB 3KJ7A 1EA3A 4LA9A 1R5GA 3MPLA 1SFKA 2DOJA 1Z91A 2LP0A 3BR1A 3DV8A 3M7GA 4XL9A 1VQ6I 1FTJA 3ABKH 3FHZA 5I57A 5LOMA 2OJTA 2QVRA 1T2KA 5E17F 3FXOA 4E70A 3MQ9A 4A5NA 2XXUA 1H0MA 2CZIA 4I02A 1IC8A 5FLXZ 3LBSA 5I2KA 3NAUA 3ZQHA 4XORA 4KFCA 4I0AA 4KFQA 1SFXA 1USYE 2QJEA 4H0WA 2HZDA 1R5HA 1ZRCA 4NGUA 2ELJA 1ZG1A 2ADUA 4GBVA 4IO3A 5H2FC 3K4LA 4BQOA 3LNQA 3OSFA 2RF1A 4MO7A 4MIMA 1TT0A 1V5EA 4CGZA 2LF8A 3C7JA 2UVHA 1ON2A 3D0SA 3RYDA 1TQPA 3EHTA 2FE3A 4N8YA 2HQAA 4AU7A 5HLTA 2R7XA 1OCPA 1JUMA 2ANJA 2KHMA 4XKRA 1BOAA 3K4UA 3OENA 4JYKA 3GTOJ 4ZYHA 4XKPA 1SI1A 3QYTA 2FMYA 4JOMA 2G7HA 4BJ6C 2P5LC 4IRIA 2XXPA 3PPOA 1N84A 4IVNA 4JP0A 4LB6B 4MNIA 2GOMA 1NG7A 2XWIA 4P1LA 5LBQA 1HOMA 3LR1A 1WFXA 2FUG2 4UABA 3GZNB 3V4GA 1KQ0A 3QQAA 5FJ8J 2HGCA 2QGUA 4Y52J 4N91A 1ZRFA 3WU2C 3TTLA 2JA5J 1DU0A 3PFYA 1W7PB 2F7CA 5F0HA 4OQOA 1Z05A 5A5LA 2DT5A 3RQTA 4II3A 1FSAA 4CO8A 3H1CA 2WX9A 1OCCH 2VQHA 4GX6A 3DP6A 5I2NA 2XAJA 3K70D 3TZAA 4JB7A 1J59A 2GHBA 2EIMH 2PMZN 3M8UA 1HKQA 4EATA 5EGOB 3IH3A 1D9YA 1OLCA 4NTLA 1IUDA 4ZZLA 3TQWA 4GYGA 4P55A 5HLGA 3HCQA 5L3BA 2H99A 3TO7A 3ECRA 5ICTA 1XN7A 1YJWI 4LK1F 3BWGA 1NFTA 2REGA 4CHUA 3RQ4A 1FSEA 1HKSA 2EZKA 1IN5A 4MTDA 3VYTB 2LKPA 1ZRDA 2F8DA 1KZ8A 4E7HA 5AONA 4IHYA 4OIOF 1P1WA 3ZR8X 3O6GA 1RDYA 1JUPA 2RQPA 1REPC 4MH5A 1RC9A 2A6EF 2MFZA 4CUGA 4PSXA 5GPAA 1NV5A 4Q4ZF 3K4MA 4GWYA 3DU6A 2OQGA 3K10A 3TP3A 1UTBB 4LZ7A 2DMPA 2QRYA 2QKLB 4QHQA 5EHMA 5FHNA 1D1BA 4QTRA 1XMAA 2ELKA 5C4XJ 3TYHA 4Z7EA 1DK4A 4UB6C 1HCRA 4P0IA 5J1DA 1D1AA 3ECOA 1FPGA 3RPUA 2DS9A 3IORA 2KL4A 1VQ8I 4GX3A 3HUGA 1UTHB 1XC1A 1JGGA 1LB8A 2LY9A 5JTYA 4XKWA 4HE2A 1TL8A 3E7LA 4KD5A 3ZQQA 3HPHA 5EF6A 1IJWC 4XKVA 3GEZA 2FHYA 4M3DA 2HS5A 1LB2A 1JW4A 3WTWC 2O51A 5J8FA 3RDIA 1OQGA 3CUQB 1MM7A 3PUVE 4BE2A 5IT3A 2FIEA 4IB2A 1P7JA 3RTWB 3ZKKA 1GV5A 2XGXA 1N0TA 2F6PA 4B43A 5HVQC 3W2WA 4X8RA 2BVLA 3QYFA 5CVIA 3H6WA 4PAKA 3K00A 1A7LA 4KN7X 5CLSA 3CDHA 4O5VA 1UB9A 2M8CA 3QPHA 3S1MJ 1OKRA 4M1VA 2MGQA 1QZZA 1BC7C 1H76A 4OWRB 1WJCA 2HI3A 3N05A 4P96A 1BIAA 4DBRA 1FY7A 3AFHA 1IRFA 1TFAA 3M1EA 3EQ1A 5JVGF 5ISUA 2VKHA 2XB5A 4HW8A 3JRAA 1TWFJ 3MVPA 1EZ9A 1TP4A 5CKTA 3DLLF 2EIJH 5FLVA 2EZLA 1MXWA 2ZNUA 3BKIB 4I3EA 2COMA 4XLNF 2A05A 1V5GA 3O28A 4XOTA 1V55H 1XHYA 4XKBA 1SMTA 4Z2YA 2STTA 5AA1A 1WJAA 1X1BA 3K4JA 4YIIA 3T93B 1Y1VJ 3FXLA 4PCQA 4A69C 1LSTA 2Y5LA 4LQ5A 4P8BA 4RXLA 4TLMB 1TNSA 3HM5A 3IH4A 4ZJZA 2QBYA 4XSZF 1JT0A 2DI3A 2H27A 4I2OA 1FTTA 5L8DA 1YJNI 3OELA 3S9LC 2M9HA 3LSMA 1L0OC 1ETQA 3QUJA 2V79A 3C2GA 3Q25A 4DI4B 2B7EA 4MAGA 1W7PD 2BW3A 3KYDB 1GDTA 1IMFA 3R6UA 3OXNA 4U1ZA 5I59B 4LLGF 3TW6A 1ETYA 2E19A 3GXAA 4MF3A 4ZDLA 2MD0A 1FYKA 4M3FA 3L2QA 4IZZA 1Z6RA 3IAS2 2VT2A 2R7OA 4UUSB 1B5JA 1EYJA 3FXKA 2VODA 1H45A 4YFKF 1BR1A 3VDXA 4GBWA 3TMGA 4C1UA 3G3HA 4EQQA 4AIJA 2QLZA 5DCFA 1R9TJ 4U2RA 3N6TA 5DEXA 2L4MA 5E8GA 1DTGA 2PMHA 4AS5A 1R1NA 5ESYA 1BOBA 3LUYA 2W85A 3C3WA 3LV0A 3MVYA 3JSPA 3E4RA 4YKJA 3FATA 1TNTA 3T96B 5IOYA 3KZGA 2HPIA 4ELQA 3MFKA 2ZNZA 3CP8A 2B4LA 3H7MA 4OVTA 2Q0OA 3F72A 4IGRA 4M9ZA 2LLKA 1TLHB 1KU2A 2EIKH 1OCRH 4L9VA 2GA2A 5I3SA 3K0VA 3KOSA 4LG0B 4XKCA 4RNSA 3OYHA 4HE0A 4FCYA 3PUZE 3UP9A 4PQJA 2IEEA 2QUFA 2FA7A 2Y9YA 1J9IA 3TCHA 3OS1A 1Z7ME 1PUFB 2V4CA 2JA2A 3R7XA 1X1PA 2E7WA 1FPKA 1ZLKA 3GTGJ 1O3RA 3P9IA 4HEA2 4QFPA 1R00A 3PO3J 3PMVA 3VXBA 2M7BA 3O9PA 2WB1A 1UHWA 3PTYA 1VNDA 3T8TA 3PO2J 2DTRA 4LB5A 1B52A 3D5LA 1YIJI 2QL3A 5L3EA 5HNFA 1YG2A 1S7AA 1W1WE 2K9MA 3EDPA 4HPQA 2XC7A 3AL0B 1A55A 3CFLA 3ECHA 3ONMA 2HPGA 4RA1A 3GBBA 2W48A 3WTZA 3CUOA 4Q48A 2EFNA 1HW5A 3OOPA 5C4JJ 5IT9Z 5ELVA 4BXXJ 2KIFA 3SZTA 3SQNA 1MXXA 4ZS9A 1B1XA 4QF9A 3G2BA 3WTYC 4I09A 2L9NA 1US5A 1BN5A 3Q26A 2XXTA 1FBDA 3CDLA 4IL6C 4S04A 2E1MC 1U5TC 3BCBA 3KGCA 3KN7A 4Z0IA 1J2XA 1MJBA 3GO5A 1AH5A 5LDZA 4B3XA 2CQXA 1ATGA 1Z1DA 1CF7B 2CUFA 3FK6A 2VASA 4PGPA 3RTRA 3CMMA 2LRDA 2QKMB 1URSA 2P4WA 2A5YB 3GFMA 4CCJA 1XSVA 2ETHA 2EA2A 4KPTA 2G9WA 3JYRA 4R75A 3KSXA 3WGHA 5IYDJ 5ICEA 4YFNF 3G3ZA 2I5UA 2VL8A 1B51A 4E7KA 4NF5B 5TGTA 2K5CA 3S2WA 1EH7A 4EEFG 3OYKA 1STZA 2XX9A 1J75A 2X85A 4XXUA 1BI0A 3Q9VA 5T3JA 4RJZA 1XPXA 4KMFA 1OVBA 4AB6A 2Y7RA 4NB5A 3GLXA 1B9MA 5E20A 4XIDA 4O3AA 4HAMA 4AVZA 3D5RC 3TDUC 4HZFA 1BW5A 1UMQA 2QWWA 2P3NA 3OYGA 3R61A 4DXCA 1D0XA 1BLFA 1BI1A 3OYJA 3BZCA 1NNFA 2QS3A 2JUCA 5LD2C 1P4AA 2V93A 4BLAA 1B46A 3H5AA 3V7CA 4D1QA 1NNPA 2PBWA 4I8CA 4JVDA 2OZ6A 2DVCA 4WEDA 2Z16A 2YSRA 3GMEA 1JXSA 4A3CJ 4X1EA 1ZG5A 5J4YA 3IFCA 3OEKA 3GBGA 2M5WA 5E1XA 4OIQF 4EV0A 1I6HJ 3CG3A 5TPAB 2CUJA 4G8XA 5ILSA 1N04A 5B70A 2HPMA 3BFTA 2R4GA 5FKMA 4S05A 5CMMA 5FROA 3E3KA 3AG4H 5EQ8A 1P1NA 1KA8A 3Q9SA 2YX7A 2HZKA 5D5XB 1QNTA 3BG9A 3AG1H 3H0GJ 3W3CA 3L6GA 2LBFB 4E7ZA 3VSLA 4UVBA 1GV8A 2EFQA 4MFDA 1R7JA 2Q8MA 1A6IA 4PGGA 3ULQB 3FM5A 1FJ6A 2DVZA 2VT5A 1D0ZA 2K9SA 4LOCA 4CYCB 2DYRH 4DJAA 5FKLA 4OA4A 1YITI 4G6QA 3H4ZA 4PFYA 1SQYA 2RREA 5AA4B 4PCDA 2ZFWA 2CWEA 5M5XJ 3MAJA 1M5FA 4KYDA 1OFCX 4H8JA 3BPXA 3ROJA 3ZS6A 1U3EM 1BR2A 2RQQA 1IRGA 3QUFA 5FHOA 2F5CA 3BR6A 2V1XA 1G6NA 2CQNA 4L5EA 4Y4RA 1OQHA 1PJRA 2A6TA 1FTKA 3HKZA 4RM3A 1DSNA 2WB1N 3W9VA 3ZGKA 3OMBA 1FLIA 4F2QA 2GLOA 2XWOA 1LCFA 4ZYEA 5FRMA 5DM6F 4JQFA 4ABZA 1ELJA 3DP8A 1B8IA 2M8GX 1WH7A 4M6YA 1VQ9I 2JA6J 4FAJA 1ZLJA 1YW7A 3O2PE 3F8CA 3IRRA 2Z33A 1EKEA 2Q1ZB 1HDPA 1Y0NA 1HSEA 1YIOA 1LBBA 2BJIA 3BT9A 3PUXE 1Q1HA 4G77A 2DK8A 3J7AY 4RA2A 2F5EA 2X1EA 4CCMA 3MSTA 5HS9A 4IO6A 5EQ7A 4WCGA 1QHGA 3LL7A 3CSGA 4IO5A 1MQHA 2XD3A 2LY2A 2X9DA 3DF8A 3DQVC 2Z8FA 5IGAA 1SW4A 4AD9A 3IHUA 4YKIA 1RR7A 3HIFA 3TCGA 1LNWA 1TWHJ 2ZB9A 1OCOH 4U0YA 2VJ5A 1Z77A 2Y48A 3SDBA 3DP7A 1FOXA 3QWLA 3TAJA 4F1YA 4KISA 1MY4A 1I1GA 2KT0A 5HDNA 4QPQA 4JBZA 2BY3A 1B7HA 3CJRB 3LFUA 3QSLA 2VBZA 5E8IA 4FHTA 2VJJA 4XQFA 2WKYA 4G8MA 4YU0A 2KZGA 5AA3A 3LUZA 4HRIA 4YB7A 2O3FA 3K4BA 4NUBA 2MG4A 3LSIA 2UWMA 5FKNA 1MSEC 3ZMZA 4BHBA 4D9JA 5LHHA 4ESJA 4Q8RA 4E7SA 2DODA 1JTXA 1U8RA 2OAZA 2UXAA 1JTYA 1A31A 1I3AA 1DPPA 2FQ3A 3HB9A 2FNCA 4NF4A 3PQKA 5H8HB 1MMAA 2O7IA 3F22A 2NVTJ 3KBRA 4UVCA 2ZYKA 3BZ6A 1OMPA 2IAIA 2EB7A 2JJ7A 2VQGA 3WU1B 2DDKA 1ETVA 1K7AA 3G3GA 1XGNA 3U9GA 4BL0B 1SEUA 4NHJA 1US4A 2HXOA 5IP9J 4FT8A 3I4MJ 3E97A 1T98A 4L0YB 2EV5A 5CMCA 2MW8A 2JA7J 1P2FA 1F36A 4QWQA 1W5TA 1AOVA 2QMWA 1MMDA 1RKTA 1PUEE 4XEQA 1IN4A 1U9NA 1V5FA 3MZ8A 1S6LA 1Z3YA 5E3MA 3PGFA 4IEJA 2Y7IA 4YEJA 2OJED 1YXIA 2FOWA 2F7AA 3QOEA 3QPSA 1HA8A 1K4SA 4MHGA 1WPKA 1YJ9I 5FLMJ 1GXQA 2EZHA 2LF7A 2XVCA 2HOSA 1FPEA 3A3CA 4F1VA 3V83A 2XAHA 3IUOA 2EA4A 3QOPA 3U1DA 4BBRJ 4F55A 4IO9F 4UV9A 2D45A 2Q88A 3Q29A 2Y69H 3O8GA 3BZKA 1KU3A 4JX5A 1UZCA 2YLNA 4N6KA 3MD2A 1SAXA 4R6YA 1SPIA 1GTKA 4ZTJA 2CV1A 4GRKA 4I3YA 1Y8QB 3NARA 4OERA 4EJWA 2R8TA 2XD2A 5J1UA 3M9AA 1Y6IA 2PYYA 2QQ8A 3MMYB 5D4SA 3A2KA 5E79C 1MQIA 2XGCA 3KP2A 1D0YA 3OYNA 5DS9A 3RIRA 5C3EJ 2UUZA 2R5YB 1A35A 4PJJA 2XB0X 4OHNA 4Q0CA 3KZIC 1N78A 4DI3D 2EBIA 1E3PA 2RGVA 1V3FA 3VSKA 4ZH4F 4KYWA 3SYTA 5B1BH 5I84A 1LFHA 4PFRA 4ZYDA 1R4NB 2FBPA 4DIQA 4U0WA 3I58A 2OQRA 1VF9A 2RKMA 4TQUQ 1MQDA 5KZTA 1JJ6C 4WWCA 2FSWA 3TODA 3L6HA 4XTCQ 1MXZA 4RGUA 2A68F 1SD5A 4JX6A 5LRRA 3CUQC 2M34A 3OMYA 2PG4A 2UVGA 1A36A 5F1QA 1YFHA 3O97A 5FKOA 2XRNA 2IJLA 4M3GA 5HS8A 4LN5A 4P11A 4N6PA 3OV8A 3R0JA 2UV1A 1RKWA 2NS0A 1D3KA 1QKBA 2OK2A 1PDNC 3HPGA 5CBSA 2WADA 5EEAA 3M07A 1CE2A 1A5JA 1WKMA 1DQUA 2ICWG 3BJAA 1SC7A 1DPEA 5IAIA 3BG3A 4CCKA 1Y20A 4BY1J 2CJJA 2JVHA 4D5FA 3H92A 1YW9A 2X7PA 4MGRA 2Y0SN 4KCCA 4XIGQ 2GXBA 3G3KA 3H9JA 3K69A 2J5PA 2RCAA 3SEQA 3C9HA 2VI6A 3EUKL 2OCEA 1R71A 1IF1A 4PJ0C 3PMXA 2KQZA 2E1OA 2BY0A 5D6FA 2CV2A 1L3LA 2OZUA 2BBYA 4OANA 4EM0B 4YICA 2HKXA 4KMUX 4HF0A 2HFBA 3QP6A 1B3LA 2QS2A 3S9NC 3R0AA 3M3KA 1EJ9A 3PPPA 1P4WA 3RZOJ 1VQOI 4IOCF 4BHPA 2K02A 2CW8A 3PNYA 3UKGA 1P1QA 2VD3A 1T95A 2VJIA 3IC7A 3FXJA 3H06B 1T8IA 1B4HA 1GVCA 1WJ5A 4BEHA 2LYCA 3KFWX 2DA7A 1U5TA 2XHDA 2ZO4A 3ABUA 3C31A 1OR7C 2LTPA 1NUZA 2FRHA 3G3IA 2D2WA 4RDUA 1FPDA 2ZNYA 2VE8A 2KMUA 4F3QA 5HS7A 1I6QA 1X3UA 1USTA 5ILVA 5DW8A 3LSGA 1ITYA 3RQIA 1R1TA 2ZJRF 2XX7A 4YKKA 3BR3A 4HDUA 5J3LA 1G3SA 2ISYA 4CCNA 2XDVA 2DA2A 4Z6YA 1E3OC 2E0SA 4X04A 4E0WA 3OSRA 2Q2EB 3MQ0A 1POGA 4RS8A 1WHUA 2BE5F 1D5YA 5IY5H 2CZHA 3F6OA 2HDCA 3HDDA 5GP9A 4B44A 5DTDA 5I56A 3BOQA 1Y3NA 1GV2A 4ZDMA 2VB6A 1UIVA 3UGWA 2L7KA 1IRZA 3L2UA 3D1RA 1OISA 3GUDA 2M3AA 4EUOA 3FD3A 4ESFA 3G71I 1K78A 1ZIUA 2P8TA 2F7BA 4IRGA 4WEPA 3A02A 4G6TB 4XBFA 2DFHA 3IOVA 3MC2A 3LSRA 4C2UA 1B0LA 2JWTA 3JAMK 3TPAA 2Y30A 2BJJX 2ZBKA 4RAZA 1YRNA 1NV2A 4GWZA 4PC9A 3H6VA 3A03A 3DBHB 4ZYAA 4YELA 4C3JJ 1N25A 4YIRX 2KLFA 2OCUA 4M4GA 4PFIA 4YB6A 4XRMA 5L9SA 5DT6A 1QPIA 4NWCA 1FMVA 5CVRA 2PQ8A 4BXUA 1B72B 2A07F 3IJOB 2ZMEB 3A01A 3KETA 4N6DA 3LSTA 5FB2A 2RN7A 2V1DA 2DFIA 3AL0C 2A69F 1PBPA 3FXUA 4PGHA 1C0WA 2BHZA 2MLKA 4D0PA 1X1DA 2HTSA 5EZHA 2DDBA 4W1UA 2ZJPF 4FTHA 2BY2A 2KDZA 1Y39A 3L9FA 1PBQA 1ZKBA 3B50A 3BG5A 4H0EA 1KU7A 3DELB 2O9LA 3FVOA 1MY1A 1LDJA 4OAZA 4W97A 1B9JA 4OEUA 3BQZA 3IB1A 3B6AA 3OR2C 1U8BA 4POXA 1FTLA 4BGDA 6PAXA 1B7ZA 3OSQA 3PSIA 5ITOA 2PMZA 2LAOA 3EHSA 3HG9A 4FQGA 1E0EA 2YU9J 1IXIA 3KZZA 4YMAA 1OYYA 5IP7J 1QQIA 3W2VA 3IFAA 1F9NA 3RLFE 1MY3A 3Q0UA 3OO9A 3QU3A 1W0TA 2DN0A 1A99A 1YX5A 3BBRA 4TOZA 2A3SA 3TTNA 5KAFC 1IN7A 2MLGA 2G0EA 5DYHA 4F22A 2M1BA 3VLWA 2FOKA 2FMLA 2QVOA 4ENJA 2D5VA 4JWYA 3VDFA 1EH3A 5ICGA 3B02A 2JT1A 3QYEA 3J80K 2XXKA 2STWA 4ZDPA 4BDMA 1B5HA 2O61A 1QZEA 1BK4A 3E0JB 2NOOA 5GAGJ 2O7UA 4CZZA 2ONSA 2WBDA 2X26A 4PFBA 5CC2A 5IKBA 2H6CA 3IO4A 2IP2A 4P5OA 3DKWA 3FJMA 3ZKLA 2WWYA 3C2BA 3TP0A 5A5XB 4U7BA 4FEDA 2P5VA 3K1PA 3GTMJ 1X4PA 1H3DA 2PFBA 1R36A 5KAIC 3QIMA 4HG2A 3IOUA 2XF5A 5M2VA 1FPJA 1WZ2A 3MP6A 4R73A 2WEFA 3SDFA 4GIZA 2W84A 3MYUA 3GFLA 2X51A 5FFZA 1O3TA 4PGNA 2W00A 3LWFA 1X1CA 2QEXI 1TC3C 2IS4A 4I40A 3S16J 2K3FA 1II5A 3E79A 3SETA 5CYVA 1VE4A 3T0JA 4NQWB 4MJOA 1W4MA 3ZMVA 2EWNA 3OIPA 2XROA 3LAPA 4DLDA 3CCLI 1I27A 5B7DA 1R58A 1AHDP 1MBHA 2L54A 1ZU0A 4A3GJ 2R0QC 3T0YA 2GQ1A 4A3KJ 1IN6A 2FIXA 4LJZF 1M1EB 1R23A 3W2AA 3JRGA 1GVJA 1I3QJ 3CTAA 5GTHC 4MMPA 3DKYA 1ZYRF 2DT7B 3ZOBA 5K7ZA 4BNCA 1FPFA 1EU8A 5ICFA 2LKSA 1JKQC 3F8MA 3IJXB 4Y7NJ 3CCJI 1ETWA 2XWKA 3RPLA 2HVRA 3V7RA 3S9EA 5H8QB 2PJRB 2HQRA 4OWDA 1RZ4A 1EYIA 2FEZA 3CO7C 2AIXA 2EV6A 4N81A 1AKHB 3QPTA 2ABHA 2ZNTA 3G4SI 4GL8A 1W7PA 3J81Z 3MAMA 1BA5A 2PT1A 2M4GA 3A29A 3HPIA 2C6YA 9ANTA 4LG3A 1RUOA 4KCDA 4HV5A 3FMRA 2PCRA 2R7WA 3T5XA 3Q5FA 1MPCA 4LQ2A 3BROA 3ZQFA 2OWZA 2HXWA 4N8GA 5DVFA 2AYSA 2D5WA 3SXYA 5EGOA 2OZZA 4M74A 4RLQA 5M5YJ 2LDUA 1DU6A 4WXHA 4XF5A 1FBEA 2VIXA 4GFRA 5TU0A 4KQPA 3JR9A 4GVOA 2W7NA 3DWLE 3BP8A 1MJAA 1TTYA 2OV7A 5I57B 1QO0D 1JETA 3MJNA 2CS3A 4OU0A 3G73A 2Y7PA 2DMUA 2KPMA 3GYHX 2ZYMA 2EZIA 4EGYA 3IWZA 4IRHA 3H6TA 3HYIA 2OCCH 3RCOA 3HBLA 4FX0A 1EH6A 2H8WA 2L7FP 2F6CA 2L9SA 4IHWA 2OTJI 1MDQA 2PMSA 2CRGA 2IVMA 2RC7A 4G68B 4AWXB 3PQJA 4EQ9A 4OVJA 3UK4A 1B3GA 4GD5A 1UTBA 2V7FA 3F3XA 2LNBA 2F35A 3M8FA 4JX4A 3ZSFA 1B4AA 1NI9A 2MC3A 2PJPA 5DD4A 4NMYA 3JRIA 5H6RA 5JHFA 4IGTA 4O3BA 1ETKA 2FF4A 4JK1X 4KYEA 2VOOA 1CGPA 4ZTFA 4N07A 2O8KA 1LQ1A 4IHSA 3G6EI 2F6GA 2K4JA 4MLQA 1UG0A 3HRUA 3T66A 2DYXA 3S3OA 3C32A 4MHFA 4KIFA 3CUQA 2Y9ZA 3L00A 2WY8Q 2IPQX 2R71A 3PU5A 3TTKA 4IQJA 2CGPA 2HKOA 1Z67A 3PUYE 1ZKGA 3FKJA 2PFYA 3K4KA 1G59A 4G61A 2KFDA 1XS9A 1K83J 4YRVA 5DV5A 2OUMA 4M9XA 1X4OA 1YYVA 2DAOA 3A1YA 3BTJA 4B4CA 4D7MA 1OLAA 3I59A 4TV7A 3CQZJ 1BTJA 1FPIA 2JPCA 2Z99A 3CHGA 4OVQA 4ZEFA 4ZECA 4E0XA 2Y7KA 5I7IA 1X2NA 1F1ZA 1NG6A 3F0CA 3COAC 4FATA 4LVQA 1UHSA 4EQ7A 5F0FA 1RDXA 2R9JA 4X6AJ 3WU0A 1B3FA 4HXVA 4X9TA 2HYGD 4C3HJ 1URGA 3HTSB 1SVXB 1UHMA 3PIPF 3O2AA 2VN2A 3G1OA 3JRFA 2I4BA 4BDRA 1JQFA 3P7NA 4HX4A 3WGIA 3JCUC 2P7VB 3EQLF 5BWJA 4OAYA 3KP7A 4C2MJ 3W15C 1ZQ3P 1A8FA 3ELKA 5HLHA 1ZREA 3FIRA 2TCTA 3EN3A 2E2JJ 4PFWA 5AIQA 1VI0A 3OD7A 2UYFA 3E78A 3VV5A 4PFPA 2TDXA 3OOUA 1GHCA 4IO4A 3PL8A 1QUJA 4I01A 3J7ZI 3CF5F 1QULA 1IN8A 2ZSHB 4L9NA 2Z5UA 4A3LJ 3F11A 5I59A 4XK4A 2L7ZA 1IQ7A 2GH9A 4JVCA 2E1SA 5ET7A 2F78A 4IR8A 3UORA 3P7IA 1NV7A 2M7AA 2DOAA 1OR7A 4HX7A 3TKDA 2WYKA 1Y8RB 4P56A 4QRZA 3K9TA 1Z7UA 5DCMB 1XT8A 2XPUA 4OFLA 4F3SA 3I54A 3W6JB 3UR3C 2VPNA 1MNMC 3R60A 2I49A 2H4IA 2GOXB 2HOAA 3CJNA 4KT5C 1R6RA 1LFUP 1L5TA 1KA0A 2W4SA 3BQYA 3CC4I 1MS7A 4QFNA 2OWSA 3MBPA 1LEBA 1DP7P 1IMDA 4R2BA 5DTBA 3BTCA 3VB2A 3J7YJ 1S50A 4PFOA 3LAJA 1WWXA 1BL0A 2DFFA 3CI8A 4GRIA 3RKQA 1O4XA 1KGSA 2MABA 2O6AA 2P6TA 4B47A 3H3UA 3A4CA 2O0YA 4KIBA 3TTRA 1UELB 3S1QJ 1IIWA 1Y1MA 2OBPA 1Z0XA 1XCBA 2HQNA 5L9MA 2HXIA 5BS6A 3S14J 2BGCA 2IGNA 3JTHA 1LDDA 3U72A 3PIOF 5HM4B 1KYWA 2IS2A 5ITPA 3PD9A 3FV1A 2M45A 2VXDA 2HHMA 1QVSA 1TQMA 4PZJA 3C36A 2QBYB 2L7MP 2KP6A 5L3DA 2XXRA 1LBXA 2K9QA 4V2FA 4A3DJ 3DTIA 1HKTA 1TW3A 5IP6A 2V1UA 3FXRA 2JQ7A 1MIJA 2MH9A 2B3BA 5D5UB 4GWUA 5F64A 1NL5A 4G6DA 3TGNA 1MW7A 4BE1A 3S2VA 1H9GA 2P2AA 1MBFA 3K7AJ 3F9KA 4F3GA 1DBZA 2O7OA 3S1RJ 4OVSA 2ELHA 1LE8A 2HYFA 3SFIA 5GTIC 1H9TA 3WTUC 4G7OF 3OO6A 4HCWA 4ZZEA 4G8HA 3G1LA 3BG6A 3GLLA 2I4CA 1X58A 2PX9A 3CJQB 2RDPA 3PFIA 1NK3P 4FBPA 2CYYA 2E1CA 2Z8DA 3L2VA 1FBFA 4KICA 3E5UA 4QSDA 4FETA 5HNHA 2IS1A 3PD8A 3OYFA 1FC3A 2P7CB 1MMGA 3PJRA 1E17A 2LK2A 2DPUA 1KONA 4FECA 5J4VA 1LAHE 3JREA 1WSUA 3I3LA 4NF5A 4R9GA 3Q27A 2IBDA 3THIA 4G12A 2XXXA 2TRTA 5J16A 1S9HA 4GLIA 2LOOA 1HQCA 5K5QA 1N77A 1ORKA 2ZYNA 5I58A 2F5VA 3T9VA 2NYXA 3P9CA 2AXTC 4U1OA 1NH7A 1PDAA 1VZ0A 4O94A 2V3QA 4S0HB 3U21A 1ZR2A 1IO2A 2DP8A 2CQ7A 4M3BA 4ECFA 2F48A 1FOYA 3CO6C 1GGGA 3B7DA 1JVXA 2O68A 2HEOA 4AS4A 2NS7A 5CVUA 4HCYA 1S8NA 2ID3A 3CLOA 3B73A 4BQNA 4H1XA 1IXHA 3ONQA 2IRFG 5EG0B 1GR2A 1JW5A 4PP0A 4AUXA 3IV5A 2DXYA 5FGMA 1HW2A 2H1KA 1LLSA 3FKIJ 1MM6A 1G3WA 2XXHA 4RM2A 4YFXF 3KEIA 4LLNA 1EV7A 1NV1A 4EF1A 1G8XA 2QSXA 3I4NJ 3ZMUA 1BIBA 2JUGA 1Y1WJ 3HGGA 2DYSH 1B05A 1FBCA 4MFEA 5TPAA 3ZMDA 3OO7A 1EZPA 1FCKA 2O69A 2OPTA 4PBHA 5JLWA 4X48A 4PF6A 2H9BA 3G3FA 4N13A 5DUIA 5J40A 1O7LA 4XKNA 2LBFA 1BR4A 3VOEA 4GWSA 3N94A 4TLLB 5EYFA 5D8LB 4BDQA 1K6OA 1WQ2A 1YS6A 4PF8A 4YIFA 2RC8A 3FXBA 2MC4A 3S32A 3S4UA 1ZLQA 3U1OA 2K7LA 1W36D 1IXGA 3VODA 1HSJA 1SW1A 4CYCA 2O1LA 2W82A 4IO2A 3BG7A 1JT6A 3TCFA 4I1DA 5AA4A 4BS9A 2WBBA 3I56I 1G0IA 1YZ0A 1I6XA 4QFLA 5D8KB 1VQNI 3K70C 3WTTC 4R9FA 5IOZA 1WCMJ 5JFRA 4F93B 2DWIA 3O29A 2DOEA 2ZJ2A 4Q47A 4RK2A 1SYHA 3BJ6A 3MPKA 1FT9A 2A5WA 2DK5A 2N8GA 2VC1A 2QF7A 4BU2A 2Q2AA 1KWHA 3FUZA 4OESA 4MEYF 1OYWA 2FNPA 3UN6A 5IZ3B 3OS2A 3V7SA 1QHHD 2YPRA 3D4CA 4FASD 4F92B 4GFBA 2JSPA 1D3YA 4M6XA 3GTKJ 4PE3A 1LEVA 1BP5A 4UUTA 5L3CA 3EYIA 1B4ZA 3CMEI 1NH8A 2REJA 4I0BA 1RNLA 2ONKE 2K9NA 2L0KA 2B65A 3NWSA 4B09A 4IY5A 1QZYA 2R93J 3B6CA 1DMBA 2BXZA 2I0CA 1R1VA 1AWBA 2D21A 1MDMB 1NMUA 2AXLA 3D1NI 1FBHA 3O66A 3ZCOA 5B66C 3FASA 5CM6A 2VE9A 1VQLI 3A0BC 1T38A 1IITA 1POTA 5K7FA 3IRQA 1OYIA 3SHFA 3H03A 5M3MJ 3JW4A 3KEQA 2K27A 3SERA 1VQKI 2QVVA 4M3EA 2DJIA 3LQQA 4MX6A 3P5JA 3TOAA 1MGTA 4DYCA 2QCOA 2VLAA 1N76A 2PT2A 3TMOA 4R79A 1K61A 3U2RA 4EQBA 3H3ZA 3HHHA 2CMOA 5DUKA 3RSNA 1W0UA 2R3SA 4DDDA 2BVMA 3MWBA 2Y0SA 4KXPA 5CVJA 1MDP1 5H8HA 5F08A 2BZTA 5M5WJ 1OCZH 2Y5KA 3I5OA 1FQAA 3V8JA 2QSGX 2BXYA 2L3DA 4H65A 5KCJB 4BJ5C 4ENNA 1JJ8C 4NF6B 4PTKA