3K1PA

Crystal structure of full-length benm e226k mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
303
structure length
303
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVRKVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Full-length BenM
rcsb
source organism Acinetobacter sp.
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator benM
total genus 77
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k1pA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1pA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1pA03
3SERA 1MZBA 1VFDA 3C33A 4XSXF 5HOOA 1URGA 4GQOA 3I53A 4WXJA 4ELRA 3ZMVA 1B1BA 3DEUA 3C34A 3ERED 3CUQB 3MVYA 4Q8RA 4DZ1A 3TDUC 3OSQA 5CYVA 1FTLA 4JWXA 4KIBA 1ONVA 2KJCA 4KFCA 4JSOA 2OQRA 4YZZA 4R9FA 3W6KB 4I0AA 2XROA 1QVSA 4ELPA 4ECFA 1OIBA 3MZYA 5D5UB 3JYRA 1H9GA 4OETA 3TEPA 1IRFA 4H8JA 2V6CA 3RDIA 4UHTA 3CTAA 4BHBA 3TO9A 3EQLF 1MGTA 2RINA 3DM0A 1A40A 3TCFA 5I2KA 4ENMA 4DXCA 1O63A 3CO6C 4P11A 1FTJA 1IXSB 3WTZA 1JHFA 5A5XA 3KCCA 3IK6B 4F7ZA 1Y1MA 5L3FA 4H6DA 4F22A 2I0CA 3EHUA 3O66A 1XOCA 4H5GA 2V93A 3RKYA 1Z05A 1B0HA 4OWDA 1TQMA 4ZEBA 5L3GA 4WXDA 3G3JA 4JQFA 1MJ9A 2REJA 1D3YA 4GXAA 2IVMA 3USDA 1WODA 3GYHX 4RPOA 1NNPA 4OYVA 3TTLA 1MQHA 4R74A 3ZMUA 1IITA 3K69A 2OZ6A 1XCBA 2G29A 3IRRA 5D8LB 3J81Z 2RQPA 4M72A 3IO6A 3PFIA 1D8KA 4FJPA 5IKBA 2ZMEB 3GZGA 5H6QA 3V7RA 3ZMSA 1DDNA 3K6UA 5FD6A 2M87A 3VV5A 2E1NA 1MS7A 1WWXA 5AA2B 2THIA 2FBIA 1VSOA 1LVAA 1HSJA 4H8IA 3SESA 2O1LA 4TLLB 1MXVA 4Y13A 2ONKE 5FO5A 1YIOA 5I56A 1RI7A 4XXUA 3EDPA 3C31A 3N4MA 5L3EA 1MM6A 1QKBA 4O3CA 1P1NA 1XT8A 3GVAA 3LQQA 3ML6A 5IAIA 4IPAA 5ICEA 3UN6A 1PDAA 3U1DA 2AS5F 2RCAA 2CW0F 5DV5A 2IA2A 2Y7PA 4G68A 1QUJA 3LSLA 3TFLA 1FBUA 3U9GA 3RTWB 3T9VA 2B65A 3U72A 1KYWA 3T1BA 2W7YA 5K2XA 1R58A 2JT1A 2DE2A 3F23A 2ZCWA 3SEVA 2BJJX 3OELA 5KCJA 1VE4A 5JR3A 5LRSA 1U3EM 3QUJA 4MFIA 2VT2A 2Z99A 4YFNF 5BPDA 4B8XA 3MAJA 4I1DA 1ZRDA 2HGCA 1SFEA 3VXBA 3M9AA 2D3IA 2XXWA 2QLZA 1TTYA 3BOQA 3UGWA 1IRGA 2M8EA 4A0XA 2X7QA 3CG3A 4AQ4A 3FXQA 3KEOA 3KSJA 1B5IA 5LLQA 3GF2A 2ELHA 3CO7C 1BJAA 5EYFA 5CVVA 2QSXA 1IQ7A 2FU4A 2ZNTA 1ELJA 1FC3A 3MP1A 3KGCA 2DAOA 1FQAA 4FORA 1LFGA 2KIUA 4YB5A 3KFMA 4PETA 3GW2A 1SW2A 1G3TA 4EQQA 4QFPA 3I6VA 4HTGA 4OIRF 4O3BA 3SDFA 3MQ9A 1GVCA 2K86A 3ZSFA 2UVIA 4M4GA 1S29A 1HBXG 4OHNA 3DQVC 4HDVA 1IXGA 4EJUA 2XVCA 3KFWX 3EYIA 3LA7A 1MPDA 1QW0A 2H99A 2V84A 1ZG3A 3MC2A 3OEMA 4IY6A 2TDXA 3HRSA 3HUGA 3WTUC 3I5OA 4YFKF 1R7JA 4K3FA 1A04A 2CWEA 3W9WA 3K2DA 1B51A 3FUZA 2E7XA 4NF6A 2QS4A 2G7UA 4H0WA 3FHZA 2A3SA 4MTDA 2VHAA 3I3VA 3ISPA 2F7CA 3IAZA 1MG1A 4ZYGA 3KEIA 2XAGA 2Z5UA 2GXGA 4GXSB 4G94A 2QMWA 3FJGA 1O3SA 1MXXA 1IXHA 3G3HA 2RC7A 1Z7ME 2HFBA 4XLNF 4U1OA 2P4WA 2P5VA 1TXFA 3FVKA 1XB4A 4BLAA 4O6JA 4KN7X 4POWA 2HEUA 4H5FA 2A5SA 1JHHA 2DTRA 3TMGA 3LSFB 1S9TA 1WQ2A 2DP8A 2ZNUA 1URSA 1MXZA 3F6VA 1I6XA 4Q4ZF 3TZAA 1B7ZA 3QYTA 1MJBA 5ICCA 4ND9A 4IRIA 3TDZC 4LB5A 3ZMZA 1PP8F 1GR2A 1I6BA 3RQTA 3BWGA 4TV7A 5JHUA 4F3GA 3T0YA 1MQDA 3NEUA 1IUYA 4I0BA 3F3XA 4BDNA 2DW4A 2OA4A 2QWWA 3B6TA 1NL5A 1OKRA 1PUEE 2DQLA 4WXHA 2B3BA 3T96B 4I62A 5D5XB 1EZOA 3MW0A 1JW4A 3U1OA 3IB0A 1S6LA 1B52A 2Q8KA 3QU3A 1EH7A 3SZPA 2OWSA 4XLPF 2IRFG 4XKPA 4P0IA 4FATA 2V3TA 1RYXA 4CHUA 1R1TA 3HCQA 3RT8A 1QNTA 3IOVA 3LBSA 3TYHA 2Z22A 4FEDA 1IF1A 2YSRA 4KFQA 2PLYA 2IW5A 1X3UA 3GWZA 3FMRA 1KQ0A 3BFTA 3IR1A 3BBRA 4GL0A 1USYH 2HKOA 2ZXTA 2H09A 5AA2A 4CGZA 3M7GA 1S7YA 3I59A 1SDXA 2X7PA 3CRBA 2BYVE 4MTEA 2RVCA 1U5TA 1WRJA 5H8NB 4S05A 3HTSB 2QS2A 3H06B 3MZBA 2A6HF 3OO8A 1NH8A 3TO6A 3J80Z 4DXUA 4LVQA 4E0WA 3ZQ7A 5EHMA 1UTBA 4OEVA 2ZMBA 4KCDA 1OR7A 3SEXA 1JQFA 1CE2A 4LK1F 5HVQC 3EN3A 3G3GA 4NF5B 3IOTA 4ZE9A 2QPQA 2Y48A 4A12A 4FEBA 3C7JA 3MPLA 4IGTA 1D8JA 2HZKA 1N3XA 3VVEA 4DQ2A 4A6EA 3E6CC 4DCYA 1XSVA 3VB2A 3HN0A 1DPEA 3R60A 4OIPF 1U5TC 3DF8A 1ZJLA 3O6IA 5HDKA 1LCTA 4L9TA 3WGHA 2CZLA 3FV1A 3IWFA 3IJOB 1ODDA 1MY1A 3LAJA 4TQUQ 1EZPA 2F5XA 1PP7U 3QXMA 1O57A 4QF9A 2YX7A 1KGSA 2F2EA 2ZNYA 2I58A 1O64A 1FT9A 3VEPA 1DPRA 3WG9A 2L01A 1JXSA 3SZTA 4KHZE 1LBBA 1WI9A 2FNAA 5K5QA 3IKVA 2UZKA 3K1MA 1YO5C 1UCRA 4DXBA 2VOPA 1LAHE 1EH3A 1RZ4A 2ZO4A 4R2FA 3RN8A 3Q26A 4F29A 3CUQC 2ONRA 3UIFA 2A69F 2QBYB 4PFYA 2XAFA 3R6UA 4ZEFA 1YFHA 5BMZA 1XMAA 3PUWE 4ETSA 3DV8A 3PUYE 4LZ7A 3UP9A 2CSOA 1A7LA 1HKQA 1T39A 1OLAA 3GFJA 2O68A 2PFBA 4EV0A 3I0TA 3MVWA 1B59A 2GZWA 2Y7KA 3Q5FA 3JV9A 1ZGJA 3PMVA 3TUSA 5HS7A 1Z7NE 3T66A 1OVBA 3ILUB 4G2ZA 2WWYA 2CO5A 1HXDA 4ZZDA 3SEUA 3FASA 2JRTA 5JI6A 4UVBA 1HSTA 2QVOA 2F35A 3LSTA 4HV6A 3VODA 1TLHB 4N0BA 3EYYA 5CC2A 1R1NA 3N6UA 1SD6A 2HEOA 4IRGA 3M3LA 2QJEA 4ZEKA 5BWJA 3K1PA 2Y7RA 5L9SA 4R75A 4WKMA 4HYEA 1V4RA 5AA4A 1P4WA 5HS8A 1F5TA 4ZS9A 1USSA 4R73A 5I2NA 4UV9A 2B3FA 1XGSA 4RB3C 1B9JA 4ASNA 2XXRA 4UUVA 3PU5A 1XC1A 4IO6A 1YTYA 1MXWA 2O84X 1ZREA 2R6GE 4KPTA 1FYLA 5CJ9A 3RYPA 4YIFA 5ICGA 1B3LA 2IEEA 4OFLA 3F21A 4XKNA 2RN7A 2HKXA 4I02A 4H65A 2O61A 2MD5A 4A0ZA 1AWCA 5LGUA 4KR5A 1BC8C 2EK5A 4RAYA 4KD5A 1NH7A 3F8CA 5HBCA 3MFKA 2OJTA 2XV4S 2O03A 3M8UA 2XAJA 3S9LC 1N84A 4BDQA 4UXNA 1Y4CA 3BJ6A 3LA3A 1RIOH 1N76A 2A6EF 1WDNA 2XX9A 4N6PA 5FHNA 1K6OA 1MDP1 1XHYA 2XGXA 1ZLJA 4DDDA 1B7HA 2NUVA 4ONYA 1NFTA 1B46A 1POTA 2V1UA 5AIPA 4FECA 4LQ5A 4R6KA 3E6DA 5E20A 2GFEA 3RPUA 4I98B 1JVXA 1NNFA 5BQTA 1T0KA 3FJ7A 4YKJA 5TU0A 3UORA 1ZHFA 2F97A 3JW4A 3KZGA 4M9SA 1ZAOA 1JETA 2QM3A 3E5UA 1B3EA 2PYYA 4G4PA 4NEDA 1EZ9A 3H4ZA 3U8QA 2DQRA 4Q5SF 2XXPA 2QZ8A 1B05A 4EQBA 1P92A 4PFWA 5BUUA 2PBWA 3IB1A 4YIIA 3KEQA 1USYE 1D5VA 1L3LA 4JBZA 4KMFA 4GIZA 4IO4A 2NWJA 2GA2A 4LLNA 1US4A 3G3FA 4MH5A 4M73A 2Y84A 1ZH5A 2E7WA 1GHCA 1SQYA 4TLMB 4WCGA 1O7FA 3RYRA 3LAPA 4GYGA 4YMBA 3REOA 2MBFA 3P9KA 5CLSA 1QKAA 2L4MA 3F8NA 2H27A 1UTBB 4U2RA 3DFGA 3DELB 1LB9A 4OOIA 1AMFA 4EGZA 4AVPA 5CBSA 2XD3A 2X0LA 1O3TA 4HCWA 1U2WA 2HZLA 1R1VA 2ISZA 4RGUA 3QUFA 5KDTB 2OLBA 4GO1A 3L00A 1M5DA 3IKTA 4LG0A 4AB5A 4L18B 4LZ8A 5JTYB 2DO7A 1AOYA 2ETHA 1UIUA 1ZLKA 3K01A 3KN3A 3CG1A 2RF1A 2DVZA 1HW5A 3KOSA 2I49A 4TOZA 3ECOA 5D5WB 1MQGA 5DTBA 2VT3A 1PDNC 2HXWA 3IHUA 2HQNA 3F6OA 1H43A 2K4BA 2XXUA 2VODA 2PMUA 5D4SA 3ZMTA 2FEZA 5DD8A 2HYFA 5E1WA 2XX8A 2EA4A 3OENA 4THIA 4ZZAA 2OAZA 5E8GA 2P5KA 3S9EA 4UV8A 1T6SA 2MLGA 4O3AA 1RNLA 2D2WA 5DEXA 2O7IA 2WC2A 1LDJA 4N13A 4PP0A 1BTJA 3MP8A 3DXJF 4RB0A 4M6XA 1ZG1A 4Q5TA 1XVYA 4ZH4F 3O9PA 3KETA 3E6BA 1ANFA 5AE4A 1P1OA 1DTGA 1TT1A 4KIFA 2VOOA 2HQ0A 2A5TA 4QHQA 2ACJA 5FB2A 1UTHB 2XXQA 4P0GA 4WEDA 4CO8A 3KP7A 3QAHA 2Z3YA 5K2YA 1B40A 1CGPA 4PGGA 2EFOA 3HSFA 3V8JA 3EHSA 4NMYA 1KYZA 4B09A 4RGSA 2A68F 3FJMA 3E9XA 2IJLA 1MQIA 1XGOA 3T5XA 2Q89A 4IB2A 4HLXA 4R9GA 2V79A 4NE4A 2OBGA 2LKPA 1LFIA 3RTFB 3MUQA 2A5YB 3F22A 3O97A 4EM0B 4AD9A 2GAUA 1JGSA 2QS1A 3GFIA 2FNPA 4DCXA 3FIRA 1YW9A 4N9IA 2FQ3A 1FOKA 3MPKA 3DLNA 3KE2A 3IOUA 4L9JA 2NXOA 4U0VA 1LDKB 2ABHA 1ZLQA 3H6WA 4KQPA 1W7PA 2FOKA 4AB6A 2C6YA 1TQIA 4PQJA 1JW5A 1DSNA 3TTRA 5KZTA 3CDHA 3TKDA 5K5RA 1H44A 1USTA 1TNTA 2LNBA 1PB8A 3KP3A 3S2VA 1YW8A 1VTNC 4G68C 1M5EA 1L5TA 2F7AA 5ILSA 5D6EA 5D4RA 4OINF 5HLGA 2XIGA 2L54A 4YG2F 4HAMA 4ZZLA 2HDCA 2FA7A 5A2QK 1N7XA 1ZYRF 3V5AA 1B7UA 4L9VA 3J80K 5KK1A 2Q2EA 4E0XA 1B9MA 5JK4A 2HS5A 1GV8A 4QWQA 1BLFA 5DVFA 2DFIA 1KU9A 4LGWA 2DLLA 2Q9TA 2P0SA 3WU0A 3C32A 3PPQA 1MRPA 2P2AA 2CGPA 3H03A 2I4BA 3FGSA 4OVJA 4DIGA 4JBAA 1MKMA 2XXYA 1B58A 3H6UA 3RUMA 5CBRA 5FTHA 3E6MA 5FLXZ 3V7CA 4Q0CA 3QPHA 3WODF 1YTVA 4KDPA 1E2XA 2RC8A 4R2BA 2ZMEA 4C1TA 4BDMA 1SMTA 4F39A 1RUOA 1UQWA 5E17F 1Q1HA 2OU2A 3BZ6A 4BXUA 1P1QA 4I7HA 2PX1A 4KICA 5H8HB 3RTRA 2R71A 1M5CA 2Z23A 4R6HA 2DE4A 4XSZF 1ATGA 2QMXA 2ZYNA 5LBQA 2AL4A 2V1DA 4XIGQ 3F8BA 2ESHA 5BOXA 4LP2B 3LQRA 1QO0D 2R7FA 2Z8DA 4KUMA 2VOZA 2WKYA 5KVRA 5HS9A 1CF7B 4I09A 4GLIA 4QSCA 4HDUA 2D1VA 3K00A 3R7XA 1ZTYA 5EEHA 1Y3NA 3PPOA 3WU1B 2AL5A 5H8FA 2AYSA 3TELA 1PB9A 3K6XA 4KYDA 3MZHA 4NTLA 1WVJA 5H8QB 2EWNA 2XAHA 3WGIA 1ZARA 2DPDA 1EH8A 1UIVA 3BJOA 2VE9A 1K79A 4QFKA 2HAVA 1IAWA 4HLYA 1OYWA 3ROUA 2LAOA 4ESXA 2I3WA 1D3KA 2UXAA 4KYSA 4BQAA 2UYFA 1AOVA 3R4KA 4DNCA 3IRQA 3OOPA 3ABUA 3FMSA 1JEUA 1MY2A 3TKYA 2YR2A 1GGGA 3EHTA 5EEGA 1QGPA 3TTNA 4NF5A 1HW1A 5DEXB 2NNYA 4EJVA 3SEWA 5HPQA 4HF1A 3QPTA 5H8SA 2R9JA 4GF8A 5CVUA 3IOWA 3BPVA 1FX7A 3F72A 3BY6A 1TW3A 2BE5F 3MCZA 2UVHA 1H76A 1OYIA 4IVNA 2RCBA 4P9FA 4IGRA 5DDGA 4U23A 1LAXA 4O5VA 2RC4A 1TNSA 4HV5A 3ABTA 3T8RA 3KN8A 2CFXA 2HZTA 2K02A 3HOTA 1T2KA 1FYKA 2K4JA 5IT3A 2NNNA 4EF2A 5ITPA 3I58A 3S9MC 2EV0A 2XD2A 4LA9A 1IN6A 3U92A 2PBIA 2BGCA 1XN7A 1LSTA 3OO6A 4BH9A 5F1QA 1TWYA 2Y75A 5DYHA 5A5XB 1MQJA 4RA1A 2P8TA 4FAJA 2OD5A 2STWA 1GXQA 1T98A 2EJRA 3RIRA 3KG2A 3H6VA 3V4GA 3FV2A 3PPNA 4JK1X 3QU6A 1BI3A 4GRKA 2P5LC 1W7PB 5DEQA 1R22A 3SQNA 4EF1A 4POXA 2YU3A 4RGXA 4U7DA 4LZ5A 1IN7A 2B0LA 5I2KB 2QENA 5ELVA 1A8EA 1W4MA 3AXFA 4F2QA 1ZIUA 4YICA 5CMCA 4R1HA 3BJAA 1OQHA 2EV5A 1SD4A 4UVAA 5J1DA 2YJPA 1R5GA 1MY4A 4NF4A 1D9YA 1QZZA 3LR1A 4BNCA 4RS8A 1B4ZA 2NOOA 1IW7F 1EH6A 4IHTA 1P4AA 3ZN0A 1FYMA 1BI1A 2UWMA 3ZN1A 1SBPA 2F7BA 2BEOA 5I2NB 2CMOA 4EUOA 4M6YA 3LWFA 2BBYA 3GEZA 5LHIA 4P5OA 1FSHA 4YKIA 1B6AA 3D0SA 4KIGA 1A8FA 2VP1A 2PMHA 1AL3A 2A5TB 1AH5A 2O6AA 1SMYF 2VN2A 1B1HA 4D0PA 3V83A 3QK6A 2DOJA 3DP8A 2GWRA 2K27A 1HSEA 3ILTB 1FQEA 4LATA 2VC0A 3Q29A 4OEUA 4IF4A 2Z8EA 1SW1A 3V8XB 3MAMA 1Y20A 2R3SA 3HV1A 2GHAA 2WTEA 4NHJA 4U4SA 4OFOA 4WEPA 4HS7A 4RYAA 1B3HA 3PQKA 1G6NA 2DBBA 3CR9A 3EUHA 1LQ1A 1QUIA 3FXUA 3HHFA 4UVCA 2QQBA 3NQOA 3MWBA 3PV0E 3E5XA 1MM7A 4H0EA 4OIQF 4MF3A 3H6TA 4U22A 1UHMA 1UB9A 3T22A 4NF8A 4QFNA 1U5TB 2G9WA 2GXBA 3E97A 3BPXA 2Y7WA 2COMA 1JVYA 3I54A 2OWTA 1B5JA 1FPQA 5I58B 2HR3A 1WKMA 4F31B 2M1BA 3C36A 5L8DA 2MH9A 2J5PA 2J5OA 4OU0A 2W25A 2EFPA 1MH3A 5TP9B 4G8HA 4X1DA 2V25A 3L2CA 4YFXF 3P9CA 4R79A 5BPIA 3E4RA 4RB1A 1H0MA 2Q2CA 4MGRA 3HOSA 3RI4A 5D6FA 3BKIB 1LB8A 1S3JA 2CG4A 5H8QA 4ON0A 3ECRA 3R0JA 2O69A 5CMMA 4JWYA 1SAXA 3Q28A 4JXIA 1BI2A 1LNWA 5TJJA 3ONMA 2ZNSA 1PB7A 1DP7P 2F6PA 1R5HA 3W6JB 5AIQA 1SD5A 1LEBA 3U2RA 1QQIA 2M8CA 2ZYOA 1YW7A 4MBPA 4ESBA 4XTCQ 4F1VA 2NVUB 1ZBMA 2EV6A 1GVJA 4FX4A 3CUQA 1B1XA 1S7AA 1J0RA 5KDTA 2DE3A 2DWIA 5DD4A 3HIFA 2BV6A 3PUZE 1XDUA 1FY7A 3B7DA 1Z6TA 4PGHA 1WSUA 4M9ZA 5CVJA 3FATA 1FBQA 3WAFA 2XHKA 3M8FA 3P9IA 4GGGA 2RKHA 3H3GA 1FWZA 4KYWA 3VFJA 1IN5A 1G3YA 3PUXE 3DPTA 5FFXA 3PD8A 4PZJA 4UACA 4R72A 5K5OA 1JEVA 1BOAA 1S50A 1TBXA 4Y17A 3F8FA 1C0WA 1S8NA 5L3DA 2Z9OA 1R6ZA 2DXRA 3CVGA 3O28A 2IPQX 4X1BA 5FTIA 2XKPA 1YLFA 4LQ2A 4EXKA 2UXXA 1Y1ZA 2V3QA 1O7LA 1YS7A 3VDFA 3E3VA 1LBCA 4IXAA 1G3WA 3K6VA 3RJPA 3GXOA 3F11A 4U0WA 5E8IA 1KQ8A 4MNUA 3EPEA 3TGNA 1RUNA 2O0YA 2VE8A 4JB7A 2QS3A 4OESA 3ZS6A 3L6GA 1IZ1A 5LEJA 5TRDA 2Q8JA 4EJTA 2KIMA 4E70A 1II5A 2QL3A 3PUVE 1BN5A 1LDDA 4CXFA 2P7CB 3HRUA 4ENJA 2DSFA 2EFNA 2GHBA 4G7HF 1SFXA 4MHGA 2DWAA 4N9HA 1HKTA 2O7UA 1Y0UA 1IXCA 3M8EA 4LJZF 2HFHA 2P7VB 4PFUA 2E0SA 5I56B 3GZ5A 4ELOA 2PG4A 1I5ZA 1ZRFA 5CMBA 1QBJA 3PD9A 3CSBA 2ZNZA 1ZMGA 4IY5A 3FM3A 3FVOA 4P96A 3N5LA 1F9BA 3C3WA 5TP9A 3DP7A 2W24A 2RDPA 2JSCA 1SFUA 3CI8A 4OMZA 2QYOA 3TO7A 3KJ7A 2GIVA 3E13X 3VXCA 1UHWA 2IA4A 1SD7A 4L5IA 2DWJA 1FQFA 1XDSA 3KJTA 3C9HA 3QSLA 4XRFA 1SYIA 4IO2A 5EHSA 3K4UA 4YKKA 4OQOA 1JNFA 4RK9A 3FD3A 3KOTA 2DXYA 4PE5B 4R8HA 3WTYC 1K7AA 1SYHA 2RV8A 3FF5A 1B3GA 4KI0E 3J7AO 2ZFWA 3VLVA 4HX4A 1H45A 2M5WA 1LAGE 2NS0A 3CFLA 3N6TA 4FE8A 2D45A 1BI0A 4ESFA 3DKWA 4EMSA 4GWOA 3I59B 4ESWA 4F18A 3MP6A 1I27A 3GLXA 2H5YA 4FIMA 3RNNA 1FP1D 3RPQA 3HYIA 4GL8A 3BP8A 5LOMA 4AIJA 2XX7A 1Z9CA 2ANJA 2F5EA 3N97A 4Q30B 1F1ZA 4A5MA 4FX0A 3M1EA 2DWHA 5DCFA 3OOAA 2Q88A 2M45A 4KNYA 5LHGA 4EJWA 5DT6A 2VC1A 3M3FA 3R61A 5D8KB 1FZPB 4YKPA 1LJ9A 4BHPA 2RNJA 4CYDA 2HYGD 3Q25A 2VBZA 3FZVA 3M3KA 3T93B 2XASA 4BAYA 3VVDA 3QOPA 4LB6B 3HSTA 2VBYA 4KT5C 3K6WA 1PEBA 3C4MA 3SETA 2LSOA 4P55A 1NMUA 5HLIA 1DTZA 4GXOA 3HTUA 4EGYA 4HW8A 3BROA 4LG0B 1B2HA 4WXCA 1XGNA 5L9MA 3DP6A 5FLXK 5I59A 2UVGA 5IT9Z 2HQRA 2FRHA 1T38A 3A3UA 3LC8A 4JDFA 1P6RA 1J9IA 1JW1A 4G7OF 3KZZA 1B4HA 1N04A 1OLCA 3QIMA 4I8CA 3TDJA 3EETA 4G8MA 1VR5A 3B6QA 5B70A 2FA5A 1M5BA 4PDKA 5L3BA 5ERIA 4HX7A 4GD5A 3K0VA 2HOEA 2W85A 2O3FA 1LLSA 4HBLA 5AA3A 4YAHX 4M9XA 1I1SA 4HQMA 4YB6A 1IXIA 3CFXA 1U6GA 3HHGA 5DUKA 2FNCA 3RPWA 4LMYA 4LD5A 5LGNA 5H8FB 4GOTA 2H6CA 2IP2A 5E1ZB 2O51A 2DT5A 3B02A 2Z33A 4EXLA 3ZP5A 3WTXC 4RNSA 3K2ZA 2F78A 3H7MA 1KU7A 1DPPA 2EFQA 2AIXA 2FXAA 2XXXA 3WGGA 2P1SA 1ON1A 2MLKA 5I58A 3IC7A 1MXYA 3PPPA 4OIOF 2FE3A 4OTEA 3L09A 3W9VA 1OPCA 4F19A 1XSXA 2V9VA 2JPCA 3H3ZA 3OO7A 2HTSA 5E18F 3O2AA 1OQGA 5ITOA 3MVZA 2XUBA 2REGA 3O3KA 4KCCA 5LGTA 4G8XA 1W7PD 1Z1DA 3WTWC 2LF7A 1N3WA 2ZJ2A 3HPIA 3N26A 1YG2A 4OENA 2D5WA 5JVTA 2RC9A 4MQ9F 3IL1B 3D4GA 3DPLC 3KN7A 3OEKA 1ZN2A 1MJAA 4ZEDA 2Q2AA 2F8DA 3MZ9A 5LEKA 3MQ0A 1OVTA 3TPAA 3ULQB 1HW2A 1DOTA 1R23A 1D4NA 4MEXF 3VE1B 2JPBA 4F1UA 3FVNA 1VFEA 3TCGA 2OZUA 3RGYA 2HCAA 3L6HA 3R26A 2GH9A 3KBRA 3HSEA 1A54A 2VXZA 1R00A 1MD0A 2CYYA 4Q47A 4BYYA 3TQLA 5DYMA 1BIBA 3QP6A 1FW0A 1H9TA 4FT8A 3IL2A 1M5FA 5J8FA 1XSDA 4Q48A 2L02A 1ZKBA 3V7SA 3QP5A 1FQBA 2H98A 1G4DA 6PAXA 4RXLA 5LRRA 3TQWA 1B9NA 1Y3PA 3IO4A 1QZYA 2L3DA 4AIKA 4WX9A 4EVIA 3I64A 1IN4A 3ZPLA 5ICTA 3C35A 3OMBA 2OK2A 1I69A 4RAZA 5FFZA 4EJOA 5L3CA 5FHMA 3GZ6A 2XHDA 1R9QA 3Q9SA 1YAEA 3B73A 1U8RA 4LLLA 2FBHA 5F1RA 2E1CA 3IJXB 1J1NA 2PMSA 4AIHA 2PI0A 3R6SA 4U4XA 5HLHA 1IUDA 1MDQA 4X48A 3E5QA 4HZFA 4GCVA 3D4CA 4ZYEA 2PEXA 3D5LA 4NF4B 1FBSA 3Q27A 2ZKZA 5HM4B 2MH2A 4S04A 3FXRA 3TOBA 1P4XA 3K9TA 5K1YA 1URDA 3LUYA 4DLDA 2PJPA 1ULYA 3J81K 1NKXA 1FTOA 2OZZA 3RLFE 3HO7A 4QSEA 1B0LA 3R0AA 2RKMA 3TTKA 5H20A 2QQAA 1ZRCA 4LFUA 1SVXB 4YB7A 5JFRA 3TOAA 1SW5A 4OERA 2XRNA 1IEJA 4PCQA 2PQ8A 4WF2A 4IRHA 3H92A 1BBYA 3OD7A 4FHTA 2PVUA 5JTYA 5DUIA 2FF4A 4I01A 4ZZEA 3TAJA 4QSDA 1MY0A 1YQAA 1OMPA 3EF7A 4KMUX 3KP6A 3BDDA 2DYXA 2O8XA 4EDPA 3U94A 5DCMA 4XKRA 5I59B 1R36A 1W5TA 3VLWA 4H67A 2R7DA 2F36A 1Z6RA 4G8NA 3GX4X 1J75A 1XS5A 4Z0IA 5ICFA 2UVJA 2IA1A 4L0ZB 3S4UA 2P6TA 4U7BA 1QULA 4ZYHA 3GFLA 1HKSA 4JSDA 4I9DA 5AONA 2YX4A 2FMYA 4LLGF 3U93A 4MQVA 1EV7A 4UNOA 3GXAA 1MXUA 5A2QZ 3I5UA 2PT1A 5CVIA 4ENNA 2H9BA 3LFKA 3T9XB 4BHCA 3VFZA 4L17A 1RKMA 2JZYA 2VBWA 2F34A 3QAXA 3F8MA 5B7DA 3G73A 1SD3A 4CDGA 5H6RA 3OV8A 4U1ZA 2H94A 1G3SA 5I84A 4RPNA 2Y7IA 4ZDMA 1Z7UA 1KQ9A 3VOEA 4WK8F 1TFDA 3ZKKA 3LSWA 1SW4A 1UTHA 3GLBA 4CICA 1EU8A 3V89B 1NNKA 2W84A 2MA3A 1QPMA 2I4CA 2XXTA 3KP2A 3C18A 2P6SA 4X9TA 2FMLA 1DUXC 4ENKA 2FBKA 3A3CA 3VLUA 2OQGA 1OMIA 1P1UA 2EA2A 3B6WA 3JSOA 1PC3A 2O1MA 1NHAA 3L9FA 1BC7C 5FHOA 1D9VA 3G7WA 2HAUA 1DPUA 3GFMA 1B3FA 3KSXA 1Y3QA 3FMQA 3P7IA 4RK2A 5DVIA 4M74A 1YYVA 3O2PE 3IX1A 3ZMDA 2ISYA 4EM2A 3HSRA 1IIWA 2GQQA 5L9OA 3CFZA 5M2VA 1Q1KA 4H1XA 2V3UA 3QRFF 2E1SA 3GBAA 3JTGA 5H8NA 3TCHA 3CJNA 2PN6A 1US5A 3PMXA 3TTMA 3COAC 4U88A 4G6QA 4MLQA 3WTVC 2ESNA 4GVOA 4G77A 2HTJA 3KLNA 1NNTA 2A07F 3TQNA 5DVJA 2LF8A 4L9NA 2Q0OA 4L0YB 1O7TA 4C0RA 2L4AA 4UA8A 4ESJA 2I48A 1B4AA 2LDUA 3JAMZ 3P7NA 2GRVA 2I6EA 2VONA 1W5SA 4L5JA 3SXYA 3EQ1A 1YPNA 2MC3A 2NYXA 4QFOA 3I4PA 1LCFA 3ODBA 4HW0A 2AXLA 2KLFA 3SFZA 1ZG5A 3PQJA 3BFUA 3MJNA 4F1YA 3OSRA 2ZXJA 3WAEA 1GXPA 4BDRA 4KA4A 2F5DA 3JAMK 5DCMB 2OBPA 2XKOA 1ZU0A 1KWHA 3MEXA 2DPUA 4IO3A 4DE8A 1R9LA 3E3KA 1KA8A 4KYEA 3I71A 1O3RA 3ECHA 2I3VA 4OXVA 4HCYA 2ZBKA 1FLIA 5ICQA 3CUOA 4ZYDA 3S2WA 4HQEA 1I6QA 2IT0A 3S9NC 3TODA 3T9HB 4QFLA 1J7KA 5LHHA 2V1XA 1QJMA 1B32A 4U21A 4XBFA 3WTTC 5HDGA 5F7VA 1FP2A 2QBYA 5CVRA 1S7OA 2YPNA 1FTMA 4G9YA 1HSLA 1QUKA 3O29A 1P2FA 4G6DA 2WV0A 5IT9K 2KJBA 3Q9VA 4WWCA 1H3DA 2NRAC 3W15C 1OYYA 1K78A 1LB2A 1XGMA 3MZ1A 4K2EA 4IHSA 3IB2A 3PMWA 1LGBC 3IORA 3ELKA 1RYOA 4IO5A 3K1NA 2FYIA 2DVCA 3PPRA 4G7ZF 1R1UA 5J8CA 1UFMA 3O6BB 2KKOA 2DQVA 1XD7A 5F6FA 2Z8FA 1LAFE 4ZECA 3C1DA 2DI3A 2UXNA 4P9UA 3WE3A 1CF7A 1AIVA 3MWMA 4HA8A 4HF2A 4LK0F 2FSWA 2G93A 1KU2A 4IJAA 1MH4A 4ZEIA 3GO5A 5ILVA 1B6HA 2G7HA 2XXVA 1A55A 1V3FA 3JTHA 2QRYA 1N7WA 2K7LA 3K02A 3AAFA 1BKAA 2D1HA 1PBQA 1TFAA 1J59A 3MVXA 3T9UA 2Y0MA 4Z2YA 3T8TA 1YS6A 1XCVA 2PT2A 2KRFA 1TQPA 3LA2A 1IN8A 2ZYMA 1T0FA 1I6AA 1SI0A 3IWZA 3ZKLA 3FX3A 3KZYA 3CIJA 3G3IA 1ON2A 5CI5A 3A09A 4EM1A 5AA2D 4ISUA 4MEYF 1LFHA 3KLOA 4Y15A 5I57B 4GYIA 1Q35A 5CM6A 2O6GE 3K0LA 4F3PA 2QQ9A 1I1GA 3SKPA 1CB6A 5JEIA 1BM9A 3JZJA 1XVXA 3NRVA 4EQ9A 3V8KA 4KN4X 4BDOA 1N0TA 4YU0A 5TPAB 4RB2C 2DS9A 2VD2A 2YLNA 3WE2A 1PBPA 4RY1A 3UA8A 2IA0A 4GFRA 4OZ9A 3VVFA 2VBXA 2X26A 1ZGAA 3CSGA 4R6YA 3THIA 4C1UA 2CQKA 2XXIA 2XAQA 1P1WA 5CRYA 3LSXA 1Y4TA 1MPCA 4BDLA 1P99A 1FCKA 2YPRA 3RY3A 1JE8A 4U0YA 5I57A 3SEYA 4NB5A 5ILUA 2VD3A 1E17A 2I0BA 1BIAA 1POY1 3MBPA 3O6HA 4A0YA 4OMBA 4EQ7A 2H6BA 1YCJA 3FM5A 4A6DA 3JSPA 2W57A 4F2OA 1FTKA 2RGVA 3N94A 5TPAA 3OXNA 2ALUA 2STTA 5ED4A 2DU9A 4CZZA 3HHHA 1O3QA 1A99A 1GTKA 2F6GA 1Y9UA 5ISUA 2NAZA 1FSEA 4F3SA 3FVGA 2D21A 4HF0A 4OFJA 3HRMA 4M71A 2XXHA 5FGMA 2JTVA 3UK4A 1FNNA 1BIYA 4NF6B 4A2UA 4QRZA 4G68B 1FQCA 3L7WA 2ADUA 2A61A 4MLVA 2ZYKA 4IO7A 3H3UA 1MDMA 4I2OA 3SHFA 5KCJB 1Z91A 2F5CA 2KIFA 4PFTA 1DMBA 5H8HA 4OMYA 5E1XA 4NWDA 4O3MA 4LUBA 3O6GA 2H4IA 1MY3A 2VGQA 3G3KA 4HOBA 1J2XA 1SI1A 2EB7A 2QUFA 3WTSC 4ELQA 2ONSA 1HQCA 2UYEA 3G3ZA 3KP4A 4F3BA 2OCUA 3GUDA 3V8LA 1BP5A 5J6XA 1FQDA 5F64A 1IXRC 5FD5A 2DK5A 3RKWA 1B5HA 3PGFA 3GBBA 4LONB 2M30A 5AA4B 4Z7EA 1TW2A 5CMKA 2F5FA 4AWXB 1MDMB 2HWVA 1U78A 4N07A 4A5NA 4ZE8A 3RT6B 3HRTA 5HDNA 1STZA 3CLOA 1MPBA 1K78B 4QLCU 1L0OC 4NF8B 2X4HA 4NWCA 3RKXA 3OO9A 4RJZA 4JWOA 4XKQA 2EFWA 1F4KA 2GA1A 2H25A 4NQWA 4RGRA 1F9NA 1REPC 1XMKA 4YMAA 4HX8A 3FWEA 3KP5A 5BS6A 1KU3A 5D5VB 3DP4A 4M1VA 2DK8A 5AA1A 1J5YA 1LEAA
chains in the Genus database with same CATH superfamily
4F93B 3SERA 4LOCA 1MZBA 1VFDA 4XKBA 2DPDA 3C33A 4XSXF 5HOOA 1DQUA 2MYSA 1URGA 4GQOA 3I53A 4WXJA 4ELRA 1LBYA 1H8AC 2PJRB 3ZMVA 3VDXA 1B1BA 1RDYA 3DEUA 3C34A 3ERED 4DYCA 3CUQB 2W7NA 1JKOC 1UG0A 1HCRA 3GTQJ 3MVYA 4II3A 4DZ1A 3S3MA 4Q8RA 4J19A 3TDUC 3OSQA 5CYVA 1FTLA 4JWXA 2VI6A 4KIBA 3CMMA 1ONVA 2KJCA 4KFCA 4JSOA 2OQRA 4PGPA 3GBGA 4YZZA 2K5CA 4R9FA 2DODA 3W6KB 4I0AA 1MMGA 5ET7A 2XROA 1NV4A 1QVSA 4ELPA 3CLQA 4ECFA 1OIBA 3MZYA 5HODA 5D5UB 1H9GA 1FBCA 3JYRA 4OETA 1IRFA 1IV8A 4H8JA 2V6CA 3TEPA 3RDIA 1F43A 4UHTA 3CTAA 3RPLB 4XLHA 2LC2A 4BHBA 4P9KA 1U0JA 3TO9A 3EQLF 2B7EA 2VQCA 3X2QH 1MGTA 4FASD 2RINA 1ZR4A 4S0HB 1BA5A 1A40A 3HOXJ 4BY7J 3DM0A 3HZJA 4PBQA 4ENMA 3TCFA 5I2KA 3VPRA 4ANJA 3CO6C 3CCRI 1O63A 1FTJA 1IXSB 3WTZA 1JHFA 4EEFG 1G59A 3KCCA 4P11A 3IK6B 5A5XA 4F7ZA 2ME6A 3RZDJ 1Y1MA 1FJ6A 5L3FA 5M5WJ 4H6DA 4F22A 2I0CA 3EHUA 1X1AA 4BBSJ 4DZPA 2KDOA 2Q2EB 3O66A 1XOCA 1GV5A 4H5GA 4IR8A 2V93A 4PSWA 2M3AA 5J3LA 3RKYA 4CCKA 1WPKA 3EPZA 1Z05A 4JOMA 2R92J 1B0HA 3OMYA 4OWDA 5E3MA 1TQMA 4ZEBA 5L3GA 3PNYA 4WXDA 4A3GJ 3G3JA 4JQFA 1MJ9A 2REJA 5FLVA 1D3YA 2EIKH 4GXAA 2IVMA 3LSGA 3QYFA 1MBJA 1WODA 3U65A 3USDA 1B8IB 3GYHX 3KEYA 4RPOA 3A03A 2OX3A 1NNPA 4OYVA 4OVRA 3TTLA 2WB1A 1MQHA 4RLFA 5KAIC 4R74A 3ZMUA 3K6GA 4BXFA 1IITA 3K69A 2DT7B 1XCBA 2OZ6A 2E2JJ 2G29A 3IRRA 4M3GA 5D8LB 4PC9A 1MSEC 2QVUA 3J81Z 2RQPA 4M72A 3IO6A 2L0KA 3PFIA 1D8KA 4FJPA 5IKBA 2ZMEB 2MFZA 5H6QA 5IY5H 3V7RA 1W36D 3ZMSA 3GZGA 1DDNA 3K6UA 4AS5A 3LSIA 1HA8A 5FD6A 2M87A 3VV5A 1UZCA 2E1NA 2K9MA 5FKMA 4D5CA 1MS7A 1WWXA 2CUFA 4F91B 5FLMJ 2RNGA 5AA2B 3A1YA 2THIA 2FBIA 1VSOA 2WY8Q 1LVAA 1HSJA 4KITB 4FCYA 3UKGA 2B4LA 4H8IA 1OCOH 4CSWA 2RQQA 3SESA 2O1LA 4TLLB 1MXVA 4Y13A 2ONKE 1S72I 5FO5A 1YIOA 2O7OA 5I56A 1RI7A 4XXUA 3EDPA 4PK4A 4N6DA 3C31A 3N4MA 4PAIA 3OYJA 1B8IA 2LTPA 5L3EA 1MM6A 2LVSA 1QKBA 4O3CA 1P1NA 4B48A 4UUSA 2R7XA 1XT8A 3GVAA 3LQQA 4XLCA 3ML6A 5J4YA 3CF2A 4IPAA 5ICEA 3UN6A 5IAIA 1PDAA 3U1DA 2AS5F 2RCAA 3CCYA 2CW0F 5DV5A 2IA2A 2Y7PA 4G68A 1QUJA 3LSLA 1OCZH 3M07A 1D5YA 3TFLA 1FBUA 3U9GA 1VQOI 3RTWB 3T9VA 2B65A 3U72A 4ZJZA 4P1EA 1KYWA 3T1BA 3CC7I 2W7YA 5K2XA 3FBNB 1R58A 2JT1A 1G0HA 2DE2A 3F23A 2ZCWA 3SEVA 2BJJX 3OELA 5KCJA 4DI3D 2LY1A 1VE4A 4RA2A 5JR3A 5LRSA 1U3EM 2HVRA 2MG4A 4P56A 4FISA 2LRDA 2KIQA 3HFUA 2ME0A 3QUJA 4MFIA 2VT2A 2Z99A 4YFNF 5BPDA 4B8XA 3MAJA 3JRBA 1ZRDA 4I1DA 2HGCA 1J09A 2Y69H 1IMEA 1SFEA 3VXBA 3M9AA 2D3IA 2XXWA 3DLAA 5ET6A 1WGXA 2QLZA 1TTYA 1VQ6I 1IMCA 3BR5A 2H8RA 3BOQA 4V2GA 3AL0B 1IRGA 3UGWA 3IP4B 2M8EA 2DTZA 4A0XA 2X7QA 3CG3A 2PX9A 2GM4A 4AQ4A 2A6TA 3FXQA 4M3DA 5M3MJ 4P47A 3KEOA 3KSJA 3RPLA 1B5IA 1ORKA 2IBDA 2ELHA 3GF2A 5LLQA 2M8GX 1BJAA 3CO7C 5EYFA 5CVVA 2QSXA 3HC7A 1MW7A 4HNTA 2FU4A 2K9NA 3BR1A 3OYDA 1IQ7A 2ZNTA 4M6VA 2LY2A 1B72B 1ELJA 2QGUA 1FC3A 2VJ4A 1QPIA 3MP1A 3KGCA 3FXJA 2DAOA 1FQAA 4DIQA 4FORA 3ZCOA 1LFGA 5FKLA 4RM3A 2KIUA 5DTDA 4YB5A 4YIRX 3KFMA 3K4CA 1MBGA 3GW2A 1SW2A 1G3TA 4EQQA 4PETA 3I6VA 4QFPA 3OSGA 2JA2A 4HTGA 4OIRF 4O3BA 3SDFA 3MQ9A 1GVCA 2HVQA 2K86A 3ZSFA 2UVIA 4LN5A 4GWYA 4BEHB 2KPMA 4M4GA 1S29A 2ECBA 1QZEA 3BR0A 1HBXG 1ENHA 3IFCA 4OHNA 2CQQA 3DQVC 4HDVA 1IXGA 4N6KA 4EJUA 3FHNA 2XVCA 3KFWX 3OL3A 3EYIA 1E3HA 3LA7A 4AYBN 1MPDA 1QW0A 2H99A 2V84A 1ZG3A 3BIGA 3MC2A 3OEMA 5GPAA 2TDXA 3HRSA 3HUGA 3WTUC 2P3VA 3I5OA 2UUZA 4YFKF 3CCMI 1R7JA 4K3FA 1X19A 1A04A 2CWEA 3W9WA 2OF7A 3PJRA 3K2DA 1B51A 1FBFA 3FUZA 2E7XA 4NF6A 2QS4A 2I5UA 4BQOA 2G7UA 1ZTRA 4C2MJ 2R5ZB 3FHZA 4H0WA 2A3SA 1WJDA 3OIPA 4MTDA 2VHAA 3ISPA 2F7CA 3I3VA 3H5AA 5HNFA 3IAZA 1JUSA 1MG1A 1A35A 4ZYGA 3KEIA 2XAGA 2Z5UA 3KZIC 4QPOA 2GXGA 1NI9A 4GXSB 1VQPI 4G94A 1MBHA 5KCMA 2QMWA 3FJGA 3ZQHA 1OLTA 1O3SA 2H1KA 1MXXA 1IXHA 3G3HA 4FBPA 2RC7A 2HQAA 4W1UA 1DCUA 1Z7ME 2HFBA 1MMSA 1NH3A 3MYUA 4XLNF 4U1OA 2P4WA 2P5VA 1TXFA 3FVKA 1XB4A 2Q1ZB 1WJ5A 3VYTB 3OYIA 2KLOA 4BLAA 2QSHX 3HUGB 2Y31A 4O6JA 1A6QA 4KN7X 4ZC3A 3I55I 2ZJPF 1XI6A 4POWA 2HEUA 5F0CA 4W97A 4H5FA 2A5SA 1JHHA 2DTRA 3TMGA 3LSFB 1S9TA 2XAUA 1WQ2A 2DP8A 1W0TA 2ZNUA 1URSA 1VQ5I 1MXZA 2RAEA 3F6VA 2WEFA 1I6XA 1ZKGA 4Q4ZF 3QQAA 3TZAA 4PJJA 1B7ZA 4G6TB 1Z67A 3FBPA 3QYTA 1MJBA 5ICCA 4ND9A 2XSJC 3TDZC 4IRIA 3DPUA 2M4KA 4LB5A 3ZMZA 1TWCJ 1PP8F 1I6HJ 1GR2A 1I6BA 3BWGA 3VSLA 3RQTA 4TV7A 5JHUA 4F3GA 3T0YA 4AU7A 1MQDA 2XRLA 3NEUA 1IUYA 3DU6A 4RM2A 1NTCA 4C2UA 4I0BA 1T33A 3F3XA 2DW4A 2OA4A 1I50J 2QWWA 3B6TA 1IUFA 1NL5A 4BDNA 1OKRA 1PUEE 1A36A 2DQLA 4WXHA 2B3BA 4MMPA 3T96B 4I62A 5D5XB 1EZOA 3MW0A 1JW4A 3H35A 3IB0A 3U1OA 1S6LA 4CZCA 2Q8KA 3I4MJ 1B52A 2ZZVA 4HNVA 3QU3A 1EH7A 3SZPA 3TBIA 4XLPF 2DJIA 4E7JA 2HDDA 2IRFG 4ABZA 2OWSA 4KJZA 4P0IA 4XKPA 2V3TA 1RYXA 3ZQIA 4FATA 2BVLA 4A69C 4CHUA 1R1TA 3VYUB 5FBPA 3HCQA 3RT8A 1LFUP 1QNTA 3RKQA 2R0QC 3IOVA 3OY9A 1IV6A 1AKHA 1LVKA 2MD0A 3W3CA 2EILH 3LBSA 3TYHA 2BY1A 2Z22A 4FEDA 1OCCH 4IQ4A 4H45A 1JP4A 1IF1A 2YSRA 3H5NA 3LUZA 4KFQA 2PLYA 1D0ZA 1YITI 2IW5A 1X3UA 2JA8J 1U9OA 3GWZA 3FMRA 1KQ0A 3ESWB 3BFTA 3IR1A 2LREA 5IPAA 2DOAA 3BBRA 4GL0A 4PFRA 5EQ7A 1USYH 2HKOA 2ZXTA 3HOUJ 2H09A 2ID3A 5TGTA 5B3SH 4CGZA 2ZXWH 1R4NB 3DKYA 5AA2A 3M7GA 2AO9A 1S7YA 3TMOA 4MLOA 3I59A 1SDXA 2CZKA 2X7PA 3CRBA 2BYVE 4MTEA 2RVCA 4PGNA 3FXBA 1U5TA 1WRJA 4XLEA 4DBRA 2VQGA 5H8NB 1DU6A 4S05A 1Z21A 3HTSB 2QS2A 4LIUA 3H06B 3MZBA 2A6HF 3OO8A 1NH8A 3TO6A 4XLFA 3J80Z 4DXUA 4LVQA 4E0WA 3ZQ7A 1RPWA 2R7VA 5EHMA 5C4XJ 2DYRH 1UTBA 2ZMBA 4OEVA 3OIQA 1OR7A 1WHUA 4KCDA 3SEXA 1JQFA 1OCTC 1CE2A 4LK1F 5HVQC 3EN3A 3G3GA 4NF5B 3IOTA 3CQZJ 4ZE9A 2QPQA 2Y48A 2P3NA 5J40A 4OVQA 4A12A 4PAKA 1XMXA 3IH2A 4FEBA 1I3QJ 3C7JA 3MPLA 4IGTA 4PBHA 4OVPA 2JVHA 1D8JA 2NVTJ 2FVZA 2HZKA 1N3XA 3VVEA 4DQ2A 3LMMA 4X0GA 4A6EA 3ROJA 3E6CC 2JN6A 1XC5A 3BR6A 1XSVA 3VB2A 3HN0A 4DCYA 1FPDA 1DPEA 3R60A 4OIPF 3DF8A 1U5TC 1ZJLA 3O6IA 3JCUC 5HDKA 3RQIA 1LCTA 4L9TA 2DMQA 1IDYA 3WGHA 3HOZJ 2DN0A 4A3EJ 2E1MB 4XKCA 2PFZA 2CZLA 3FV1A 3IWFA 3IJOB 5FROA 1ODDA 1MY1A 3LAJA 4TQUQ 1EZPA 3FDYA 2F5XA 1PP7U 3QXMA 3PUFA 1HDPA 1O57A 3QWLA 4QF9A 1U9NA 2YX7A 1KGSA 2DOEA 1QHHD 2F2EA 2ZNYA 4NBQA 2R7SA 2I58A 1O64A 1RDXA 1FT9A 3MKYB 2G0EA 5EGOB 4QBAA 3VEPA 2BY0A 1DPRA 3WG9A 2KQZA 3FKJA 5JVGF 2L01A 1JXSA 2V4JC 3SZTA 3E0JB 3OYAA 1LBBA 4KHZE 1WI9A 2FNAA 3HXLA 5K5QA 3IKVA 2UZKA 2CV0A 3K1MA 1YO5C 1X3ZB 2WB1N 1ZR2A 1UCRA 1B72A 4DXBA 3QYEA 2VOPA 1LAHE 2F3BA 1X2MA 1EH3A 4NG7A 4CCMA 1RZ4A 2ZO4A 4R2FA 3K10A 3Q26A 2WBMA 3RN8A 4F29A 2OPTA 1PJRA 1MMNA 3CUQC 2ONRA 3UIFA 2A69F 4V2FA 2QBYB 4PFYA 2XAFA 3R6UA 4ZEFA 1YFHA 1X4OA 3NARA 1XMAA 4JX6A 5CPRB 5BMZA 4ETSA 3DV8A 1VFCA 3PUWE 3PUYE 2CSOA 1A7LA 1HKQA 1T39A 1OLAA 3GFJA 2O68A 4LZ7A 3UP9A 2PFBA 4EV0A 3I0TA 3QODA 3MVWA 1B59A 2GZWA 2Y7KA 3Q5FA 3JV9A 1ZGJA 1FPBA 3PMVA 3TUSA 3PSFA 5HS7A 1Z7NE 3T66A 1OVBA 3DLLF 3ILUB 4G2ZA 2CO5A 2WWYA 1JJ6C 2UV1A 1Y8RB 3OYEA 1HXDA 3A4CA 3MMYB 1ITYA 4ZZDA 3SEUA 3Q0VA 1ETKA 4XICA 3J7ZI 3FASA 4GWWA 2JRTA 4UVBA 5JI6A 3RSNA 1HSTA 1TZLA 2QVOA 2F35A 3KIOA 3LSTA 4HV6A 3VODA 1TLHB 3Q3SA 4N0BA 3EYYA 4N15A 1R1NA 3N6UA 5CC2A 4Y3OA 4ZTJA 1SD6A 2HEOA 4IRGA 3M3LA 2QJEA 4ZEKA 3S17J 5BWJA 1GLNA 1X4PA 3K1PA 2Y7RA 5L9SA 4R75A 5A5LA 4WKMA 2LOOA 4HYEA 1V4RA 4D7NA 5AA4A 1P4WA 5HS8A 1F5TA 2XWKA 4ZS9A 4E7ZA 1USSA 2NS8A 3D1NI 2CV2A 2FIXA 4UV9A 4R73A 5GAHJ 3S3OA 5I2NA 2Z16A 2B3FA 1XGSA 3LSHA 4RB3C 5ET8A 1B9JA 4ASNA 1BR4A 2XXRA 2LK2A 4UUVA 3PU5A 1XC1A 4AVZA 4IO6A 4B43A 1YTYA 3AL0C 2X6XA 4GRIA 3KYCB 1MXWA 1ZREA 2O84X 2R6GE 4KPTA 1FYLA 5CJ9A 3RYPA 4YIFA 5ICGA 1B3LA 2IEEA 1NV3A 3F21A 4OFLA 2RN7A 2HKXA 4I02A 4H65A 4XKNA 2O61A 2MD5A 4A0ZA 1AWCA 1SVMA 4A3CJ 5LGUA 3DTKA 2EPFA 1BC8C 2EK5A 4KR5A 1JUPA 4RAYA 4F55A 4KD5A 3VWBA 1NH7A 1SVLA 3F8CA 5HBCA 3MFKA 3OR1C 2OJTA 2LKXA 2XF7A 2XV4S 2O03A 4RLQA 4IHVA 3M8UA 2XAJA 3S9LC 1N84A 4BDQA 4NHBA 4UXNA 1Y4CA 3BJ6A 3LA3A 1RIOH 1N76A 1YI2I 1NUYA 2A6EF 1WDNA 2XX9A 4N6PA 5FHNA 1K6OA 3IAM2 1MDP1 1XHYA 2XGXA 1ZLJA 1D1CA 4I40A 5BNGA 4DDDA 1B7HA 3CMYA 2NUVA 4ONYA 1NFTA 1B46A 2ELKA 1POTA 2M7BA 2V1UA 2FHYA 1YRNB 5AIPA 4FECA 1IRZA 3GTLJ 1FIPA 1WJEA 2E19A 4LQ5A 4R6KA 3E6DA 5E20A 5IYDJ 2GFEA 3RPUA 4I98B 5T3JA 1JVXA 1NNFA 5BQTA 1T0KA 2EBIA 3FJ7A 3VYSB 4DYRA 4YKJA 5TU0A 3UORA 1ZHFA 3PNVA 3JW4A 3K7AJ 4M9SA 2F97A 3KZGA 2XWIA 1ZAOA 3PIOF 1JETA 2QM3A 2Y5LA 2W00A 1YHQI 3E5UA 5EEAA 2JJ7A 1O4XA 1B3EA 2PYYA 4G4PA 4NEDA 3A02A 4UUTA 1EZ9A 3H4ZA 3U8QA 2DQRA 2MW8A 4Q5SF 1IMAA 2IGMA 3OYBA 2XXPA 2QZ8A 1B05A 1T8IA 4ZDOA 1P92A 2DA6A 4PFWA 3RYDA 4EQBA 2PBWA 5GTIC 5GPCA 4KT6A 1SPIA 3IB1A 4YIIA 3KEQA 4HE2A 1USYE 2ID6A 3AG2H 1D5VA 1L3LA 1EF4A 4JBZA 4KMFA 4E6KG 4GIZA 4IO4A 2NWJA 2FBPA 1IGNA 3CCSI 2L7KA 2GA2A 2Z1DA 4LLNA 1US4A 3G3FA 4MH5A 4M73A 2Y84A 2HQ5A 2E7WA 1ZH5A 5J1UA 1GHCA 1SQYA 1FBHA 1BL0A 4TLMB 4WCGA 1O7FA 2XF5A 3RYRA 2DA5A 4KISA 3LAPA 4GYGA 4YMBA 3FK6A 3REOA 4OWRB 2MBFA 2LMDA 3P9KA 5CLSA 5FRMA 2L4MA 1QKAA 2HHMA 3F8NA 2H27A 1UTBB 5EQ8A 1VQ7I 3M4OJ 3DFGA 3DELB 4Q5TA 4U2RA 1LB9A 4OOIA 1AMFA 4EGZA 4AVPA 5CBSA 4BE0A 2XD3A 3G6EI 2X0LA 1O3TA 4HCWA 1U2WA 2HZLA 1RR7A 1SAUA 1X2NA 1R1VA 1FPFA 2ISZA 4RGUA 3QUFA 1GDTA 2OLBA 5KDTB 1OISA 1Z3XA 2JMWA 3HBLA 4GO1A 4DJAA 4PFBA 3L00A 3H9GA 4YEJA 1M5DA 3IKTA 3CVGA 3TP3A 1JUMA 4LG0A 4AB5A 4IHWA 3QYBA 4L18B 4LZ8A 5ET5A 2DO7A 5JTYB 1V55H 1AOYA 2ETHA 1UIUA 1ZLKA 1VZ0A 2KL4A 3K01A 3KN3A 3CG1A 2RF1A 1XS9A 2DVZA 2F5VA 1HW5A 2XPVA 3KOSA 2I49A 3LSKA 3ECOA 2KFDA 5D5WB 1MQGA 1NV7A 4TOZA 5DTBA 2VT3A 5LDZA 1PDNC 1I3AA 2HXWA 3ZQFA 3IHUA 2HQNA 3F6OA 1H43A 2K4BA 2XXUA 2VODA 1Z77A 3OR2C 3IH3A 2VKHA 5GTHC 2PMUA 5D4SA 3ZMTA 2FEZA 5DD8A 2HYFA 5E1WA 2ICWG 2XX8A 2EA4A 3OYMA 3OENA 4THIA 4ZZAA 2OAZA 2WAEA 4NNJA 5E8GA 2P5KA 3RCOA 3S9EA 4HSTA 2R93J 2L7MP 4UV8A 2AQFA 1T6SA 2MLGA 2EIMH 4O3AA 1RNLA 2D2WA 1ETXA 3CJQB 4NN3A 5IYCJ 1DU0A 2VASA 4BGDA 2O7IA 5DEXA 2LH9A 1DBZA 2VJJA 3H9QA 9ANTA 2WC2A 1LDJA 2X51A 4N13A 3CC2I 4PP0A 1BTJA 1FBDA 3MP8A 3BZKA 4BDZA 1KA1A 3OYGA 3DXJF 1ETQA 2JSPA 4M6XA 4RB0A 3L2RA 1ZG1A 1JJ8C 4YELA 4ZH4F 1XVYA 3B6AA 3CMAI 3O9PA 1PVEA 3KETA 3E6BA 3CESA 1ANFA 5AE4A 4B3AA 1P1OA 3AKZA 2YUSA 4E7HA 1DTGA 1TT1A 4KIFA 2CS3A 2VOOA 1UG2A 3PL8A 1E3PA 2HQ0A 1T56A 4M3EA 3JREA 2HOTA 4BS9A 2A5TA 4QHQA 3ZQCA 2LY9A 2ACJA 5FB2A 3KC0A 1PUFB 4DXCA 3DTEA 4DOZA 1UTHB 2XXQA 4P0GA 4WEDA 4CO8A 3KP7A 2KRCA 3QAHA 2Z3YA 5K2YA 1B40A 2P81A 1CGPA 4PGGA 2EFOA 3HSFA 3V8JA 3EHSA 3ZGKA 4NMYA 3BIHA 1KYZA 2H1LA 4II2A 4B09A 3CDIA 2K85A 4RGSA 2A68F 3FJMA 1DGWY 1D1AA 3E9XA 2IJLA 1MQIA 1XGOA 3T5XA 3WU2C 2Q89A 5J1YA 4HLXA 1UHSA 5C4JJ 3ZRGA 2E1OA 2R7TA 4IB2A 2V79A 4NE4A 4O7IA 4XQFA 2LKPA 1LFIA 2OBGA 3RTFB 2CUEA 2JUCA 2A5YB 3TW7A 4BJ6C 3ERMA 3MUQA 3F22A 4GX4A 4UABA 3O97A 4EM0B 1BK4A 4AD9A 2GAUA 3BG7A 1JGSA 3S1NJ 2QS1A 1VF9A 3GFIA 2FNPA 3S1QJ 1HOMA 1YW9A 3FIRA 4DCXA 3OSFA 3T9XB 4N9IA 2FQ3A 1FOKA 1ERDA 3DLNA 3KE2A 3IOUA 4L9JA 2NXOA 3MPKA 1XPXA 3RZOJ 4U0VA 3S14J 3FKIJ 1LDKB 1FSAA 2ABHA 1TT0A 2QEXI 1RR8C 1ZLQA 3H6WA 1QHGA 4KQPA 1QRYA 2DA2A 1W7PA 2FOKA 3DEWA 4BEHA 4AB6A 2C6YA 2DCEA 1TQIA 4PQJA 3PM1A 3ZR8X 2L5QA 1JW5A 3A2KA 4N8YA 4N8GA 1DSNA 3TTRA 5KZTA 2K3PA 3CDHA 3TKDA 5K5RA 1H44A 1USTA 4PJ0C 1Z0XA 1TNTA 2LNBA 1QA6A 3ABMH 1PB8A 3NOHA 3KP3A 4C3JJ 3S2VA 1JT6A 1ETYA 1YW8A 1OQYA 5EGOA 1VTNC 1MBEA 4G68C 1VI0A 1M5EA 1L5TA 2R7UA 2F7AA 5ILSA 3OYFA 2EZLA 1ETVA 5D6EA 5GAEJ 3ZQGA 5D4RA 1ETWA 4OINF 4C3IJ 5IOYA 2XIGA 5HLGA 2L54A 4YG2F 5M5YJ 4HAMA 4ZZLA 4I6ZA 1S5LC 2HDCA 2FA7A 2XB5A 5A2QK 2XGEA 1N7XA 1ZYRF 3V5AA 2L2OA 1B7UA 4L9VA 2XGDA 4C9YA 4GWSA 3J80K 5KK1A 2Q2EA 1S9HA 2V9KA 4E0XA 2IAIA 1EYIA 1F36A 1B9MA 3FK7A 3LSRA 1NV2A 1LBWA 5JK4A 2HS5A 1GV8A 4QWQA 2LG4A 1BLFA 5DVFA 5IM2A 1BR1A 3BG5A 2DFIA 1KU9A 4LGWA 2DLLA 4NDLA 1K83J 5EZHA 4HPQA 1FTTA 2P0SA 2Q9TA 3H1CA 2CQNA 3WU0A 2VL8A 4CCJA 2DA1A 2VIXA 4V19K 3C32A 1MRPA 2P2AA 3PPQA 3EUAA 2CGPA 2EZIA 1NV1A 2I4BA 3FGSA 3H03A 4GWXA 4OVJA 4DIGA 4JBAA 1MKMA 2XXYA 1LUJB 1B58A 5B66C 3H6UA 3RUMA 5CBRA 2LYCA 5FTHA 3E6MA 5FLXZ 3V7CA 4Q0CA 3QPHA 1H89C 2EIJH 3FISA 1A31A 3WODF 1YTVA 2IS1A 4KDPA 1E2XA 1SANA 2RC8A 4R2BA 4XEQA 2ZMEA 2E36A 3HGGA 4IHXA 3HKZA 2K9LA 4BDMA 4C1TA 1SMTA 4XL9A 4XOPA 1YX3A 5FKNA 4XFEA 4F39A 1RUOA 1UQWA 5E17F 1NUZA 1Q1HA 2OU2A 3BZ6A 4BXUA 4E7LA 1P1QA 2PCRA 4I7HA 2PX1A 4KICA 5H8HB 2E71A 3RTRA 2R71A 1NG7A 3BZCA 1M5CA 2Z23A 4R6HA 1NV6A 4XSZF 1ATGA 2DE4A 2QMXA 5LBQA 2ZYNA 5I3SA 2AL4A 2V1DA 4HRIA 5IGAA 2KR0A 5IP7J 4XIGQ 3F8BA 2ESHA 5BOXA 4LP2B 3LQRA 4JP0A 1QO0D 2R7FA 1BW5A 2Z8DA 4KUMA 1VQ4I 2VOZA 2WKYA 5KVRA 5HS9A 2GXAA 4MCOA 1CF7B 4RAFA 4I09A 4GLIA 4QSCA 4CCOA 4HDUA 2D1VA 4BU2A 3S2HJ 4IL6C 1VQ9I 3K00A 3R7XA 3EKIA 1ZTYA 5EEHA 1TT5B 1Y3NA 2F4OB 3PPOA 3WU1B 2AL5A 5H8FA 2AYSA 2E1MC 4NX1A 3TELA 2E5NA 1EA3A 1PB9A 3TP0A 3K6XA 2A05A 3MZHA 4KYDA 4NTLA 1WVJA 5H8QB 2EWNA 2XAHA 3K4KA 3WGIA 1ZARA 3BT9A 1X1DA 2NOJB 3MKLA 1EH8A 3OYKA 3BJOA 2VE9A 1K79A 1UIVA 4QFKA 2HAVA 5EZGA 2ECCA 1IAWA 4HLYA 3F9KA 1AU7A 1OYWA 3GCMA 3ROUA 5C3EJ 2LAOA 4ESXA 1V5GA 2OV7A 1K9ZA 1NK2P 2I3WA 1D3KA 2GQ1A 2UXAA 4KYSA 2W4SA 4BQAA 3GLLA 1EYJA 2UYFA 1AOVA 4D1QA 3R4KA 2VKDA 4DYQA 4DNCA 3K4LA 3IRQA 3GTPJ 3OOPA 5EYGA 3MSTA 3ABUA 3FMSA 1DK4A 1JEUA 3TKYA 1MY2A 2YR2A 1N78A 2X1CA 1GGGA 5EEGA 3EHTA 1QGPA 3TTNA 4NF5A 1HW1A 5DEXB 1LFBA 2NVXJ 2NNYA 2VQHA 2Y30A 3B6CA 4EJVA 3MZ8A 3SEWA 3BG3A 2O9LA 5HPQA 4HF1A 3QPTA 5H8SA 2R9JA 4GF8A 2I8DA 5CVUA 4F92B 3IOWA 1R4MB 3BPVA 4PFPA 3U1KA 1FX7A 3F72A 4AM3A 2V7FA 3BY6A 3SJMA 1TW3A 2BE5F 3MCZA 3GTOJ 2UVHA 5F08A 1H76A 2D5VA 1OYIA 4IVNA 2RCBA 4P9FA 3I56I 4IGRA 1R6RA 5DDGA 4U23A 4MFDA 4MFEA 1LAXA 4O5VA 1JGGA 2RC4A 1CQTA 2OCCH 1TNSA 4HV5A 4IKFA 3ABTA 3T8RA 3KN8A 2R4GA 2CFXA 2HZTA 2K02A 3HOTA 1T2KA 1FYKA 2K4JA 5IT3A 2NNNA 4EF2A 5ITPA 3I58A 4ZDPA 3S9MC 2EV0A 4RMNA 1FPJA 2XD2A 3S3NA 4GWUA 4LA9A 3WHBA 1MBFA 1VQ8I 1IN6A 3G1LA 4DZJA 3PO2J 3U92A 1WH7A 2PBIA 2BGCA 1XN7A 2QSFX 3G1OA 4Y33A 2YU9J 1LSTA 3OO6A 2XSDC 4BH9A 2PJRA 2L9SA 2JQ7A 4PDDA 5F1QA 1TWYA 4H4KC 2K9SA 2Y75A 3HGYA 5DYHA 5I5PA 2DFFA 1YIJI 5A5XB 1MQJA 4RA1A 2LLKA 1V5EA 2P8TA 3CZ6A 4D9JA 2V1NA 4C3HJ 4FAJA 2OD5A 5M5XJ 2STWA 5IP6A 1GXQA 1T98A 2EJRA 3RIRA 3KG2A 2ZB9A 3H6VA 3NAUA 3V4GA 1FTZA 3FV2A 3PPNA 1IMDA 4JK1X 1LBVA 4JVCA 3QU6A 1BI3A 2VJIA 1K6YA 1A5JA 4GRKA 4BJTA 2P5LC 1W7PB 5DEQA 1R22A 3SQNA 4D5FA 4EF1A 1DGRM 4Y7NJ 4POXA 2YU3A 1LFPA 4XMYA 2W48A 4RGXA 4U7DA 3S2DJ 1RKWA 1IN7A 3CJRB 2B0LA 1FBPA 4LZ5A 4OVSA 5I2KB 3IFAA 2QENA 2DDKA 4FE4A 5ELVA 1A8EA 3HDDA 1W4MA 3SFIA 3S1MJ 3AXFA 4F2QA 1ZIUA 4YICA 5CMCA 4R1HA 2QFLA 1X1CA 3BJAA 2EV5A 1OQHA 3OYCA 2COBA 1SD4A 4UVAA 2DT6A 3HOWJ 1R5GA 1MY4A 2YJPA 5J1DA 4NF4A 1D9YA 2ZC2A 2KDZA 3BTIA 1QZZA 2FUG2 4BNCA 2L9VA 3LR1A 3C2HA 4RS8A 1B4ZA 2R5YB 2NOOA 1WI3A 2X85A 1IW7F 3FXLA 1EH6A 4IHTA 1P4AA 1T08B 3ZN0A 2K9QA 2XWOA 1VQMI 1FYMA 1BI1A 2UWMA 3ZN1A 1SBPA 2F7BA 1NV0A 1WFXA 2BEOA 4F52A 4P8BA 3OIOA 2CMOA 4EUOA 4M6YA 2BBYA 3LWFA 5I2NB 3GEZA 5LHIA 4P5OA 1FSHA 1R49A 4YKIA 1EJ9A 1B6AA 3D0SA 2ZXHA 4KIGA 1A8FA 2VP1A 2PMHA 1AL3A 2A5TB 1AH5A 2O6AA 3Q0WA 4MNCA 2Q74A 1SMYF 2VN2A 2NVYJ 2B9SA 1E3OC 1WJCA 4D0PA 1B1HA 3QK6A 2DOJA 3DP8A 2GWRA 2JRMA 2K27A 3BQYA 1HSEA 3ILTB 1FQEA 4LATA 1Y1VJ 1UMQA 1JKQC 2CW7A 2DYSH 2VC0A 3Q29A 4OEUA 5KAFC 4IF4A 1R5ID 1GVDA 2BW3A 2Z8EA 1SW1A 3V8XB 5FRNA 4MJOA 3MAMA 1Y20A 2Y0SN 2R3SA 3HV1A 5B5EC 2GHAA 2WTEA 4NHJA 3I4NJ 1GV2A 4U4SA 4OFOA 4WEPA 2CMPA 2DMUA 4HS7A 5LTCA 2ZSIB 4RYAA 1B3HA 3PQKA 2CZIA 1G6NA 2DBBA 3V83A 4I76A 3CR9A 3EUHA 1LQ1A 1QUIA 3A0HC 3FXUA 2L7FP 4N4NB 2CEYA 2WYKA 3HHFA 4UVCA 2QQBA 3NQOA 3MWBA 3PV0E 3E5XA 1MM7A 2DDBA 5B1BH 4H0EA 4OIQF 4MF3A 3DCFA 5IOZA 3H6TA 4U22A 1IO2A 1UHMA 3GTJJ 1UB9A 3T22A 4NF8A 4QFNA 1U5TB 2G9WA 2GXBA 2DA3A 3S1RJ 2Y9ZA 3A29A 4PE3A 3ZQQA 1QVUA 3BPXA 3E97A 2Y7WA 2COMA 1JVYA 3I54A 2OWTA 1B5JA 1FPQA 2AHQA 1D0XA 5I58B 2HR3A 1YJWI 4A3IJ 2CW8A 1WKMA 4F31B 5EDNA 2BXYA 2ZSHB 3DEEA 2M1BA 3C36A 5L8DA 2MH9A 2J5PA 2J5OA 4OU0A 2W25A 2EFPA 4IY6A 1MH3A 3M3YJ 5TP9B 4G8HA 2GLOA 4MNPA 2V25A 4X1DA 3L2CA 4YFXF 4M3FA 3P9CA 4R79A 3G1MA 5BPIA 3JR9A 1LE8A 3E4RA 4RB1A 4P3LA 4FTHA 1H0MA 2Q2CA 5JLXA 1CNQA 5BUUA 4MGRA 3HOSA 3RI4A 5D6FA 4A3LJ 2L5VA 3BKIB 1LB8A 1X1BA 1S3JA 2CG4A 5H8QA 4ON0A 3ECRA 4GBWA 2XGCA 3R0JA 2DJNA 4G12A 2O69A 5CMMA 4L5EA 4XKVA 4JWYA 1SAXA 2LP0A 1JTXA 3Q28A 3DKXA 4JXIA 4EATA 1BI2A 4PJLA 3FBIB 1LNWA 5TJJA 3ONMA 5K7FA 2ZNSA 1UAAA 1PB7A 1TWAJ 1DP7P 2F6PA 1R5HA 3W6JB 5AIQA 2CEXA 3K70D 1YZ0A 1SD5A 2CJJA 1LEBA 2KISA 2XF6A 3LFUA 4NC7A 1QQIA 3U2RA 2M8CA 2ZYOA 1UJ8A 1YW7A 2QQ8A 4ESBA 4MBPA 3TEDA 4XTCQ 4F1VA 1TWGJ 2NVUB 4QPQA 1ZBMA 2EV6A 1AA7A 4O94A 3PFYA 3DBHB 1GVJA 4FX4A 4NQ8A 3CUQA 1B1XA 1S7AA 1J0RA 4PFIA 5KDTA 3ONQA 4IO9F 2QVVA 2BY2A 4HSRA 2AXTC 1IG7A 5DD4A 2DE3A 2DWIA 3HIFA 2BV6A 3CHGA 3PUZE 1XDUA 1FY7A 2R5YA 3B7DA 2HU9A 1Z6TA 4PGHA 4E4HA 4M9ZA 5CVJA 3CCQI 1WSUA 1FBQA 1HLVA 2JA7J 1KZ8A 3FATA 4HXVA 3WAFA 2XHKA 3M8FA 3P9IA 4GGGA 2RKHA 2FJ1A 3H3GA 1FWZA 1AWBA 3UNGC 4KYWA 2QVRA 3VFJA 1IN5A 1G3YA 1FRPA 3PUXE 3DPTA 5FFXA 2L9RA 4PZJA 3S93A 3PD8A 5JLWA 4R72A 5K5OA 4UACA 1JEVA 1BOAA 1S50A 2DMPA 1TBXA 4Y17A 3F8FA 1C0WA 1S8NA 3CJTB 5L3DA 2Z9OA 1R6ZA 2DXRA 3O28A 2IPQX 4X1BA 5FTIA 2DXIA 2XKPA 1YLFA 4OAYA 4LQ2A 2UXXA 4EXKA 1Y1ZA 2V3QA 1O7LA 1YS7A 4PTKA 3KYDB 2IS2A 3E3VA 5K7HA 3VDFA 1LBCA 2DA7A 3BG6A 4IXAA 5EQAA 1G3WA 2ZJQF 3HL2A 2DOFA 3RJPA 3GXOA 3K6VA 3F11A 4AC0A 4U0WA 2P0WA 5E8IA 1KQ8A 4MNUA 4HE0A 3EPEA 3TGNA 1RUNA 2KQRA 2DFHA 2JJKA 3E7LA 2O0YA 2VE8A 1Y39A 3HOVJ 2JWTA 2QS3A 4JB7A 4OESA 2KZGA 4KXPA 3ZS6A 2K3FA 3L6GA 1IZ1A 5LEJA 5TRDA 3W2AA 2Q8JA 4EJTA 2KIMA 4E70A 1II5A 2QL3A 2M9HA 3AG4H 3PUVE 1BN5A 5E3LA 3ABKH 1LDDA 4CXFA 2P7CB 1WJAA 3HRUA 1WVRA 4XONA 4ENJA 2VKEA 4HG2A 2EFNA 2DSFA 2GHBA 4G7HF 1TC3C 1SFXA 4MHGA 2DWAA 2FOWA 4N9HA 1HKTA 2O7UA 2VPOA 1Y0UA 1IXCA 3M8EA 4LJZF 5KNLA 3GTMJ 1X58A 2HFHA 2P7VB 2F4MB 4NC8A 4PJMA 2KRHA 2E0SA 4PFUA 3K4JA 4IOAF 5I56B 3GZ5A 2ZJRF 4ELOA 3KPHA 2PG4A 1I5ZA 1ZRFA 5CMBA 3S15J 1QBJA 3PD9A 4CYCB 3CSBA 2ZNZA 4B47A 5JHFA 1ZMGA 4IY5A 3FM3A 3FVOA 4P96A 3N5LA 1F9BA 2LBFB 4GX6A 3C3WA 5TP9A 3DP7A 2W24A 4F3QA 2RDPA 2EZKA 2CUZA 2JSCA 1SFUA 3CI8A 4OMZA 2N8GA 2QYOA 3TO7A 3KJ7A 2GIVA 3E13X 2KHMA 5DW8A 3VXCA 1UHWA 3M1CA 2VPNA 3LL7A 2X6OA 3DWLE 2GOMA 2IA4A 1E0EA 1SD7A 2HZDA 4L5IA 1GT0C 1FQFA 3I9V2 2DWJA 1XDSA 3KJTA 3C9HA 4N91A 3QSLA 4XRFA 1SYIA 4IO2A 5EHSA 4A3BJ 3K4UA 5DM6F 4OQOA 1JNFA 4RK9A 1YXIA 3FD3A 4YKKA 3KOTA 2DXYA 1K61A 3MD2A 4PE5B 3DTIA 1TL8A 4R8HA 3WTYC 1K7AA 1FPGA 3OWTA 1SYHA 2RV8A 2E35A 3FF5A 3KC1A 1B3GA 4KI0E 1G0IA 3J7AO 1IC8A 2ZFWA 4XK4A 4CYCA 3VLVA 4HX4A 1H45A 2M5WA 1LAGE 4Y52J 5M3FJ 2NS0A 3CFLA 3QMFA 3N6TA 1P7JA 4FE8A 2D45A 1BI0A 4ESFA 3DKWA 4EMSA 4GWOA 3I59B 1QGXA 4ESWA 4A3KJ 1U8BA 4BDYA 4F18A 2VB6A 3MP6A 2L7ZA 1I27A 3GLXA 1Y0NA 2H5YA 4FIMA 3RNNA 3F0CA 1FP1D 2LKSA 3RPQA 3KBZA 3HPGA 3HYIA 3BP8A 4GL8A 3LSPA 4XR6A 5LOMA 4AIJA 3TL4X 1FEXA 2XX7A 3CCVI 1Z9CA 2ANJA 2Y9YA 2F5EA 1RKTA 3N97A 3E79A 4Q30B 1F1ZA 4A5MA 4FX0A 1TWFJ 3M1EA 2DWHA 5DCFA 4CH7A 2Q88A 3A01B 3OOAA 2M45A 4KNYA 2HDWA 5LHGA 4EJWA 2F3DA 5CQEA 5DT6A 1ZK8A 2VC1A 3FXKA 3M3FA 3FIWA 3R61A 5D8KB 1FZPB 4YKPA 1D1BA 2WY7Q 2Y0SA 1LJ9A 2B63J 5J4VA 1VQLI 4BHPA 2RNJA 4CYDA 2HYGD 3Q25A 2VBZA 3FZVA 3M3KA 3T93B 2XASA 4BAYA 2OTLI 4BQQA 4B4CA 2H8WA 1I39A 4CA0A 3VVDA 3QOPA 4LB6B 3HSTA 2VBYA 1FPIA 1K4SA 4KT5C 3K6WA 1PEBA 3C4MA 3SETA 2LSOA 4P55A 1NMUA 5HLIA 2MABA 4N17A 2BXZA 1DTZA 2CQXA 4GXOA 3HTUA 3IV5A 3D5SC 2LR8A 4EGYA 4HW8A 3BROA 1MNEA 4LG0B 1WCMJ 1B2HA 4WXCA 1XGNA 1RETA 5L9MA 2Z2SB 2XB0X 3DP6A 5FLXK 5I59A 3EUHC 1WJBA 2UVGA 4A3DJ 5IT9Z 2HQRA 2FRHA 1T38A 3A3UA 3LC8A 2M0MA 1P6RA 3MKZA 4JDFA 1J9IA 4U4XA 1JW1A 1KONA 4G7OF 3KZZA 1B4HA 1N04A 1OLCA 3QIMA 2CRGA 4I8CA 3TDJA 3EETA 2X6WA 2FD5A 4G8MA 1VR5A 3B6QA 1PYVA 5B70A 2MSYA 1FMWA 2FA5A 1M5BA 1XTAA 3OL4A 4PDKA 5ERIA 5F27A 5L3BA 4DBQA 4HX7A 4GD5A 3K0VA 2HOEA 2W85A 2O3FA 2PMZN 4HBLA 1LLSA 2OJED 2VKVA 1YX5A 5AA3A 3CCJI 3KYLA 4YAHX 4M9XA 4C2TA 1I1SA 1BOBA 4HQMA 3SZGA 4X8RA 1LKXA 1W36C 3L2UA 3S16J 1SC7A 2WA0A 4UY8I 1IXIA 1JI8A 4YB6A 3CCUI 3CFXA 1U6GA 3W6VA 4G61A 3HHGA 5DUKA 2FNCA 2WV1A 4LMYA 3RPWA 4LD5A 5LGNA 4IHYA 3HG9A 5H8FB 4GOTA 2H6CA 2IP2A 5E1ZB 1LEVA 2O51A 4BQNA 2DT5A 2DMNA 3B02A 5EF6A 2Z33A 4EXLA 3ZP5A 1MIJA 2CUJA 3WTXC 4RNSA 3K2ZA 1YOVB 2F78A 3H7MA 4Y4RA 4AYBA 1KU7A 1DPPA 5IZ3A 4IQJA 2EFQA 2AIXA 4ZYAA 2FXAA 2XXXA 1FBGA 3WGGA 4QIWN 1ETOA 5CKTA 5H2FC 2P1SA 4PCDA 1N77A 1ON1A 2M4GA 3AFHA 1Y6IA 2MLKA 3K70C 5I58A 3IC7A 3CC4I 1X3WB 1MXYA 3PPPA 4OIOF 3VYRB 4X04A 2FE3A 4U87A 4OTEA 3L09A 4BE1A 2ELJA 3W9VA 1OPCA 4E7IA 4F19A 1EKEA 4HEA2 2BOLA 2TRTA 1XSXA 4JYKA 4A3MJ 2V9VA 2AQEA 1WH5A 2JPCA 3H3ZA 4PUSA 3OO7A 2HTSA 5E18F 1AKHB 3O2AA 5EQ9A 1OQGA 1VQKI 4PJNA 2E2IJ 5ITOA 3MVZA 2XUBA 2REGA 3O3KA 4KCCA 4DW6A 5LGTA 4G8XA 1W7PD 1Z1DA 1APLC 3WTWC 3DBRB 2LF7A 2ZJ2A 2E60A 1Y1WJ 3WG7H 1N3WA 3HPIA 1YJNI 3N26A 3EUKL 3JRAA 3RPUD 1YG2A 4OENA 5DS9A 5E3OA 3OS0A 2D5WA 5JVTA 2JVGA 3CDLA 2RC9A 4MQ9F 3IL1B 3D4GA 3T0JA 3DPLC 3KN7A 1FOYA 3OEKA 1ZN2A 1MJAA 4ZEDA 2Q2AA 2F8DA 1XG1A 3MZ9A 5LEKA 3MQ0A 1OVTA 1MMAA 3BCBA 3TPAA 3ULQB 4BBRJ 4LG3A 1NK3P 1HW2A 1SFOJ 1DOTA 5F0FA 1VDWA 1R23A 2CU7A 4MEXF 1D4NA 2DDAA 2JPBA 3IUOA 4N81A 3SDBA 3VE1B 4F1UA 4BUPA 3FVNA 1SVOA 1VFEA 3TCGA 2OZUA 3RGYA 3CCEI 2HCAA 3L6HA 4UB8C 2GH9A 3R26A 3KBRA 3HSEA 1ZGWA 1DP3A 2VXZA 1A54A 1R00A 1MD0A 2CYYA 4Q47A 3S8PA 4BYYA 4N4UA 1RRJA 3TQLA 1BW6A 5DYMA 1BIBA 3QP6A 1FW0A 5I7IA 1POGA 5ESYA 1H9TA 3ZXSA 4FT8A 3IL2A 1M5FA 3A0BC 1MNDA 5J8FA 1XSDA 4Q48A 2VXDA 4AIDA 2EH3A 2L02A 1YRNA 4HE1A 4XOTA 4A3JJ 3JRDA 1ZKBA 3V7SA 3QP5A 1FQBA 2H98A 1G4DA 2CFOA 6PAXA 1Z3YA 3RQ4A 4RXLA 2W1OA 3BG9A 5LRRA 4B44A 3TQWA 1B9NA 1Y3PA 1JTYA 2I10A 3IO4A 1SEUA 3K4MA 1QZYA 2L3DA 2ZFUA 4WX9A 4AIKA 4EVIA 3I64A 1IN4A 3U21A 3ZPLA 5ICTA 4J01A 2CV1A 3C35A 3OMBA 4MEVA 2OK2A 1I69A 4RAZA 5FFZA 4EJOA 5L3CA 2QKMB 4CCNA 4QXDA 2XDVA 4ITVA 5FHMA 3GZ6A 3PIPF 1IRXA 3HM5A 2XHDA 1R9QA 3Q9SA 3IAS2 3K2AA 1YAEA 3B73A 1U8RA 4MO7A 3HEFA 4LLLA 2HPGA 2FBHA 2QCOA 2GOXB 4A3FJ 4I3YA 5F1RA 4O8MA 2E1CA 4M3BA 1J1NA 3IJXB 2PMSA 1MBKA 1QVTA 4AIHA 3R6SA 3G2BA 5HLHA 3BTLA 1R9TJ 2PI0A 1IUDA 1MDQA 3E5QA 1R71A 3J7YJ 5F04A 2VUMJ 4X48A 4HZFA 4GCVA 4RAGA 2OC6A 4ZYEA 3D4CA 4I3EA 2PEXA 5LD2C 3D5LA 4NF4B 1FBSA 3Q27A 2ZKZA 4NF0A 5HM4B 2MH2A 4S04A 3FXRA 3TOBA 1Y56A 1P4XA 3K9TA 5K1YA 1URDA 3LUYA 1BR2A 3ZOBA 4DLDA 2PJPA 1ULYA 3J81K 3CF5F 1NKXA 3JRHA 2X9DA 4J00A 1FTOA 2OZZA 3RLFE 3SEQA 2XXKA 3HO7A 3B8BA 4QSEA 1B0LA 3R0AA 2RKMA 3TTKA 5H20A 3DBLB 2QQAA 1ZRCA 4OANA 4LFUA 5IZ3B 2KT0A 3E1SA 4MIMA 1SVXB 4YB7A 5JFRA 3TOAA 4NUBA 2R7OA 1SW5A 3LSJA 2XRNA 4XRSG 1IEJA 4OERA 4PCQA 2PQ8A 4WF2A 2OWZA 2OUMA 3LV0A 2IGKA 1MMDA 4BJ5C 4E7SA 4IRHA 1FIAA 3QPSA 3H92A 1BBYA 3OD7A 3OS2A 3GTGJ 4FHTA 2PVUA 5JTYA 1FPLA 5DUIA 2FF4A 4I01A 4ZZEA 3TAJA 2LBFA 1WJFA 4QSDA 2HOSA 1MY0A 5EG0A 2QKLB 1YQAA 1OMPA 3EF7A 3BC8A 3KP6A 3BDDA 4KMUX 1LPQA 3LSMA 2DYXA 2CZHA 2O8XA 3SEZA 4EDPA 4C30A 3U94A 5DCMA 2MGQA 3PSIA 2R7ZJ 4XKRA 5I59B 1R36A 2JUGA 3NWSA 3O8GA 2WBDA 1W5TA 3VLWA 4H67A 2R7DA 4PDHA 2F36A 1Z6RA 4G8NA 5FJ8J 3GX4X 4ZDLA 1J75A 1XS5A 4Z0IA 5ICFA 2UVJA 2VQLA 3FXOA 2IA1A 4L0ZB 3S4UA 2P6TA 4U7BA 3E78A 1QULA 4ZYHA 2HXRA 3GFLA 1HKSA 2MC4A 4JSDA 4I9DA 5AONA 4RDUA 1MSFC 2YX4A 3GTKJ 2IGNA 2VPRA 2FMYA 2QA4I 4Z6YA 4LLGF 3U93A 3QPLA 4MQVA 1EV7A 4UNOA 2R7RA 3GXAA 1NUWA 1MXUA 3W2VA 3I5UA 5A2QZ 2PT1A 4OVTA 5CVIA 2CQ7A 3ASOH 4ENNA 2H9BA<