3K1PA

Crystal structure of full-length benm e226k mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
303
structure length
303
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVRKVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Full-length BenM
rcsb
source organism Acinetobacter sp.
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator benM
total genus 77
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k1pA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1pA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1pA03
3IRQA 1B3HA 5L3DA 4AIJA 1KQ9A 5L3GA 1P2FA 3BFUA 2E7XA 1MQDA 2LNBA 3PPOA 2HGCA 3VEPA 3UN6A 3DFGA 3KETA 2H9BA 4A2UA 3RT6B 1FT9A 4IF4A 1F4KA 4MEYF 2P4WA 3LBSA 1X3UA 5EHSA 3ZMTA 2JTVA 2EB7A 1AL3A 2O7UA 4TLLB 1P1OA 4KDPA 3GYHX 3GVAA 4HLYA 2H27A 1BC8C 2HYFA 4MBPA 4NMYA 1B4ZA 4HTGA 3W6KB 3EUHA 3K4UA 4YFKF 1RIOH 3EHSA 3M8EA 1P1NA 2DE3A 4CDGA 1J59A 4GXOA 1IN6A 1G4DA 4LP2B 1HSJA 4O6JA 2OZZA 3PGFA 3HO7A 4YB6A 4LJZF 3T93B 3U9GA 5ICEA 1CGPA 1S8NA 1SYHA 5CBRA 2O6GE 2DU9A 4U22A 1ULYA 5ED4A 4GQOA 3B73A 4HLXA 4HX7A 3B7DA 4HDVA 2R71A 3LSWA 3T96B 5FGMA 3VFJA 2GA1A 4FE8A 1MM7A 3GBBA 3J7AO 4RGRA 3HTSB 4S04A 2ISZA 4KYSA 3HHHA 4WF2A 2DXRA 4R2BA 4G68C 1S7OA 1LDKB 3C18A 1II5A 3CI8A 5JTYB 4IO4A 4R6YA 1J7KA 3L7WA 4OOIA 4A0ZA 2VOPA 3LSTA 5I58B 4ENKA 4RK2A 4A5MA 3J81K 1POTA 4KYEA 3L9FA 3WGIA 2JRTA 2K27A 5CJ9A 1N84A 4DXUA 4QRZA 4U1OA 3TO6A 1L3LA 4OIPF 2Y75A 3Q9SA 3R61A 3WTXC 1FX7A 1NNPA 1MS7A 4OEUA 5L3CA 4CXFA 3B6WA 4BDQA 3ABUA 1A7LA 1PEBA 3EPEA 4H0EA 1YFHA 1A8FA 3RUMA 1ZH5A 1REPC 1U5TC 4UNOA 5ELVA 2ADUA 4GD5A 5F1QA 4KIFA 2DVCA 3QK6A 4KN7X 1SW4A 1TXFA 2I4CA 4M1VA 1B7UA 1PB9A 2RKMA 1GGGA 3K6WA 2FOKA 3F6VA 3PPPA 4QSEA 5BPIA 4EJTA 3TDJA 5L3FA 4KMFA 2EFNA 3M9AA 4PFWA 3QUJA 4XIGQ 3VLWA 1SI0A 3KOSA 3DKWA 3H6UA 4RJZA 2QBYA 4XTCQ 5H8FA 3Q27A 4H5GA 4Q30B 5I59A 2OWSA 1FTJA 1N04A 1UHWA 3JTGA 1FTLA 5CVIA 2IA4A 2NNNA 5H6RA 2DWHA 4ESXA 3RLFE 1F9NA 4GRKA 1EH3A 2P7VB 5IKBA 1BN5A 5JHUA 5LEKA 1L5TA 1J75A 1SMYF 2DW4A 4HZFA 4AIHA 1HKTA 3TKDA 3MP6A 1YLFA 2PN6A 3T9HB 5I59B 5DUKA 2FNAA 3RGYA 1DTGA 5FB2A 2Y48A 4LG0A 4JWOA 1USYE 3ISPA 3RKXA 4EGYA 1SW1A 1B1XA 2C6YA 3PQJA 3W6JB 1XS5A 3GXAA 3HSEA 2DPUA 3OOAA 3MUQA 2FYIA 3RKYA 4U2RA 1P4XA 3ZMDA 2KLFA 4OQOA 4X1BA 2E1SA 5KDTA 3OEKA 3MEXA 1G3WA 1B5JA 4FEDA 4XKRA 3MZ1A 5DVFA 1DPRA 5DYHA 4ZZDA 4DCYA 4B8XA 3BZ6A 2OAZA 2VBWA 3PU5A 1SD4A 3HRUA 1B9NA 1QULA 1C0WA 1MY2A 2B65A 2I49A 3BY6A 5FHNA 5JI6A 4JXIA 3M7GA 3F8CA 2L4AA 2ZNZA 5LEJA 3CR9A 2JZYA 1ZG3A 4KT5C 3U93A 2YPRA 2L54A 2ESHA 4R2FA 5L3EA 4DXCA 1Z7UA 1FQCA 1EH8A 1XVYA 3PFIA 3E4RA 3UK4A 4AQ4A 2G7UA 2EA2A 1YAEA 1LFHA 2Z8FA 2J5OA 3EQ1A 4ONYA 4IGRA 3MWMA 2R6GE 4F7ZA 4AB6A 3CRBA 2QMXA 3HTUA 2UVJA 3O2PE 1SBPA 2UXNA 3V7SA 3TAJA 2DS9A 1HW5A 2XGXA 3EQLF 3PMVA 5HDKA 4GXAA 3M3FA 2UVHA 4I9DA 5LHHA 1HSLA 1RUNA 3IL2A 1IUDA 1YS7A 3JSPA 1KU2A 4KFCA 2OJTA 1J0RA 4L9TA 4MQVA 4N07A 4E0XA 4A6EA 1K78B 5K5QA 4G94A 3VVDA 2A5SA 2NUVA 3ODBA 1I6AA 1RUOA 1ZN2A 2NVUB 1K7AA 3G3KA 5ERIA 3K6VA 3GXOA 4ZEDA 1HSEA 4LFUA 4Z2YA 2Z3YA 3PUWE 2A3SA 4X1DA 3ECRA 5TU0A 1ATGA 1I27A 1IW7F 3DP4A 4YKPA 4ELOA 4F2QA 2O7IA 1S9TA 4KA4A 2O61A 4HCYA 4ECFA 4ESWA 1IN7A 3U2RA 2Q9TA 2ABHA 1JQFA 1OVBA 1UTHA 1KU7A 1DTZA 1H76A 1KA8A 3QUFA 2HCAA 1R1UA 2YX4A 3KP7A 4D0PA 2LF8A 2IEEA 3KN8A 3CG3A 3IK6B 4G9YA 3RN8A 1JE8A 4KCCA 4IO3A 1YCJA 2OK2A 3K1MA 3KP3A 3OMBA 3BJ6A 1Y3QA 3FZVA 3TEPA 5TP9B 1ZBMA 2PLYA 1PDAA 1A99A 3DEUA 1QW0A 3BPXA 1RNLA 4JK1X 4F18A 5ICFA 2XXUA 3P9IA 2HTJA 1ZU0A 2V9VA 2V1DA 5LGNA 4EUOA 3DP8A 2FE3A 4H6DA 4Y15A 3WGHA 3SDFA 4GL8A 3REOA 4GCVA 5TP9A 5KDTB 3WODF 1QKBA 4K2EA 2Z23A 1BTJA 5E17F 3E6BA 4EGZA 3JYRA 1ZRFA 4XKNA 4UVCA 2A5YB 4G6DA 4GFRA 2ZXTA 4QLCU 2HFBA 5DVIA 2VP1A 2V3QA 1OVTA 4OENA 4F3BA 1J1NA 1FQFA 1BIAA 1FBSA 1E2XA 5D6EA 3SEUA 4Q5SF 4LD5A 3W9WA 3IOUA 4OTEA 4YICA 2KJBA 4EM1A 4IHTA 3ELKA 1GV8A 5DCMA 2DE2A 1ZHFA 3IKVA 1I1GA 4R6KA 2QL3A 1U2WA 3R0JA 2DSFA 5CMMA 1DSNA 5H20A 4G7HF 1M5BA 4M6YA 3TTRA 3KP5A 3E5XA 4NTLA 1ANFA 4TLMB 2A61A 3MAMA 2A5TA 1F9BA 4JBAA 1B9JA 3KZGA 5JEIA 5E18F 4NB5A 1N3WA 3U94A 1MGTA 4MNUA 3ZKLA 1FBUA 1QNTA 1ZRDA 4PE5B 1OMIA 1TW3A 4EV0A 4KI0E 5AA2B 3CUQC 2OZ6A 4G6QA 3GZGA 5D4SA 1RKMA 1JW5A 4ZEKA 3HRTA 2UXXA 3A3UA 3RPQA 4EJWA 3OO9A 1KYZA 1SFEA 2VXZA 3Q29A 3FJMA 4R6HA 1FSEA 3T9XB 1XT8A 3MVWA 4PGHA 4HV6A 3Q28A 1BBYA 1HKSA 1FLIA 3K0LA 4UVAA 4ZECA 1B7HA 4BH9A 3LC8A 3T9UA 1I6QA 2P5KA 2OCUA 1NNKA 2RN7A 3IC7A 4BDNA 1H0MA 1XSVA 2FNCA 1L0OC 5L9MA 3FV1A 3R7XA 4BHCA 1CE2A 4FIMA 1DMBA 4ND9A 1B3GA 1YPNA 4EM0B 1FWZA 3UIFA 1YTVA 4NE4A 1MQJA 3MZHA 4IRHA 4P5OA 2D45A 4DLDA 5F64A 1YW9A 4ON0A 4UV8A 1R9LA 3HCQA 4KMUX 4ZZLA 5FFZA 4TOZA 2OD5A 2DQLA 3TMGA 5F1RA 2LF7A 5I2KA 1WRJA 4HA8A 3H4ZA 4OIQF 3HHFA 4POXA 2HKXA 2DWJA 3V7RA 3LR1A 2XV4S 1B4AA 3PMWA 4PFUA 2DI3A 3TTMA 2ZYKA 2W84A 3S9NC 3H92A 3TOAA 2MH2A 3FJGA 3SZTA 3FATA 4G8HA 1URSA 1IN5A 2XXWA 3R6UA 1GXQA 5ICGA 5ICQA 3E6MA 1R23A 5D5UB 4OMZA 1FTMA 2MH9A 1WODA 1J2XA 3FIRA 3CFZA 3C1DA 2F5XA 4LGWA 2RC9A 4OETA 4L9VA 1MG1A 5JVTA 4IB2A 3IOVA 2M1BA 1J9IA 3MCZA 1NMUA 2HKOA 3GEZA 4A0YA 5HS8A 3GWZA 2OQRA 4GLIA 4N9HA 4PZJA 1BI3A 2D3IA 1SQYA 4F2OA 3O2AA 5LRRA 3ECOA 1IEJA 4F3PA 2ZNSA 1Y20A 4KFQA 3VV5A 2V6CA 2MC3A 4OERA 2A69F 1XDUA 5E1XA 2Z8EA 3KLOA 2JPBA 4FEBA 3HIFA 1IF1A 1T6SA 3LAPA 2DXYA 4I09A 1ZGAA 4ENJA 3WE3A 5BQTA 3KP2A 2I0BA 4G2ZA 4WK8F 4N13A 1HW1A 2K4BA 2XASA 4A0XA 4WXDA 3GF2A 1Y1ZA 3QSLA 3R26A 3CG1A 1QZZA 2F35A 3H6WA 2I3VA 4KCDA 2HZKA 3TTNA 1O57A 3EDPA 3T66A 1ZYRF 5AE4A 2ZMBA 3FXUA 1MY3A 4BNCA 3LSLA 3ZMUA 1P6RA 5DD4A 2HYGD 3H6TA 1JNFA 4B09A 4UVBA 3BROA 4RY1A 1JW1A 1STZA 2V1UA 2E1NA 1K79A 1YIOA 5AA3A 2TDXA 2QS2A 5E8GA 5KK1A 2ONSA 3MFKA 1B52A 3TOBA 2I6EA 1GHCA 5I84A 3RNNA 5CVUA 2V1XA 2YX7A 2JPCA 5DCMB 1LJ9A 4R75A 3I0TA 1Z6RA 4GO1A 1DPEA 4S05A 1DDNA 2XHKA 1FYKA 2O3FA 5L3BA 2VT2A 2H94A 2FBKA 4P0IA 2PT2A 1LNWA 1PP7U 2RC7A 2MLGA 3BJAA 2XXTA 1U78A 3KP4A 2Y7PA 1BOAA 1UTBB 2DLLA 1KGSA 3V7CA 5FD5A 4DCXA 4M9XA 3J80K 1UTHB 3OO7A 4WXJA 5FHOA 2JSCA 2QENA 1QGPA 2Z99A 3IO6A 1G3YA 1B46A 4JDFA 3M1EA 3EYYA 1QJMA 5L9OA 4BXUA 4EF1A 1IXSB 2Y7RA 4YMBA 1YW7A 2AL4A 3ML6A 3SESA 2UVGA 3K00A 3HSRA 1CF7B 1FQEA 2DFIA 4AWXB 2YPNA 2WV0A 4U4SA 3DXJF 1AOYA 5BPDA 1B1HA 2BYVE 5HDGA 1R1NA 4IY6A 3HSTA 1AWCA 3QPHA 2CFXA 5M2VA 3EHUA 2NAZA 1R5GA 4GOTA 2OU2A 3N5LA 4Z7EA 4R72A 1DPUA 1S6LA 1Y1MA 2ZYMA 2PT1A 1WKMA 2PVUA 3OV8A 4IGTA 3F3XA 2A68F 2P6TA 2GH9A 4HAMA 1SW2A 3GFMA 4Y17A 2XAQA 3MVZA 1LFIA 1G3SA 1MY4A 1B3LA 3KEQA 2Z9OA 1LB2A 2GFEA 1KU9A 5TRDA 1FCKA 4HDUA 5BS6A 1PB8A 5ITPA 3DPTA 4Q48A 2RDPA 1SAXA 1N7WA 2DQVA 2ACJA 3QP6A 3SZPA 1M5DA 1MPBA 4YKKA 4E0WA 2FF4A 1VFDA 4F1YA 3MVXA 2THIA 4ZS9A 2O03A 3K6UA 4OU0A 1T0FA 3S4UA 2BGCA 3V83A 2B3FA 1OLCA 3F72A 2XKPA 1QUJA 3IX1A 3LSFB 3ZKKA 3K0VA 1D4NA 3SERA 5H8HA 3GFJA 1OQHA 5TPAB 1MJAA 3EETA 4RGSA 4I2OA 2F5DA 4M4GA 2P1SA 3D5LA 2DO7A 4HOBA 2ZNYA 1LBBA 5F7VA 2IJLA 3C3WA 2M30A 5FTHA 3CFLA 2QUFA 3AAFA 2O84X 5CYVA 4LA9A 5H8NB 3KEOA 4OINF 1OYWA 4NF5A 3KBRA 4XBFA 1U5TA 4DNCA 2UYEA 5DD8A 4BYYA 4N6PA 3DP7A 4EJVA 3TYHA 4IRGA 2P5VA 4POWA 4U0YA 2VBXA 2HXWA 4IO6A 2K4JA 4RB1A 3L09A 1U3EM 2UXAA 1Q35A 3ZS6A 5DEXB 4DDDA 2HFHA 3VLVA 2HQRA 3WE2A 2HEOA 4ELQA 1XGOA 1NH7A 4DXBA 3C36A 4U1ZA 1LB9A 2F34A 2Y84A 2DVZA 5CRYA 4YB5A 4WWCA 2CW0F 1QQIA 1MXWA 1H9GA 3Q5FA 1ZLKA 3S2WA 3ILTB 1BLFA 3TELA 2BJJX 1WWXA 4Q4ZF 5JFRA 4XSXF 5I57A 3E3KA 1JVXA 4X9TA 2R9JA 4GIZA 1HW2A 2FMYA 5H8FB 4G68A 1GR2A 2YJPA 3H3ZA 3GUDA 3WTUC 1M5EA 2OLBA 1R36A 1PBQA 1W5TA 1O3RA 1S7YA 2L3DA 2VOZA 4QSCA 4KQPA 3TZAA 2DTRA 3E6DA 3KEIA 2XXIA 1FQAA 4LONB 2Y7WA 1G6NA 3K9TA 1B1BA 1OYYA 3MQ0A 3KOTA 2HWVA 3WGGA 4MGRA 3V8KA 3QAHA 4Y13A 3CVGA 1BC7C 2XHDA 4TQUQ 4LATA 3FXRA 4I0AA 1URDA 2Q8KA 1YS6A 4L0YB 1PUEE 4O3CA 3IO4A 2K02A 3G3ZA 1EU8A 3IB2A 4BHBA 1Z91A 3HHGA 1H3DA 4FAJA 4R9GA 2ZFWA 1FC3A 1ZRCA 1Z05A 2KJCA 4NF8B 4EXLA 1H43A 2EFQA 3RIRA 4KPTA 1I5ZA 2LKPA 2R3SA 4UUVA 4H65A 2F7CA 2KIMA 2Q2AA 4M73A 3CIJA 3LAJA 4PDKA 4L0ZB 3I4PA 4E70A 3L6HA 1Z7NE 2BE5F 1K6OA 2ZNUA 3USDA 1O3QA 3U8QA 2PI0A 4EQ7A 2CYYA 1XMKA 3L2CA 4I01A 2RGVA 2M8EA 2DT5A 1MH3A 2HQ0A 1Q1KA 2EFPA 2VBYA 3BOQA 1HSTA 2ZXJA 2E0SA 4I7HA 4KR5A 3UP9A 2W85A 3FVKA 3ECHA 5KCJB 3IRRA 1MZBA 3C33A 1T39A 4QFNA 3ABTA 4LK0F 2ZYOA 1WQ2A 3F8MA 3ZN0A 4KHZE 1EV7A 3IORA 3T8RA 3IHUA 1D9VA 3C34A 1XGNA 3IL1B 5FTIA 5FFXA 2M87A 5I2NA 3QU3A 4GYIA 4KN4X 2HOEA 2MBFA 2XKOA 3LA7A 1P4AA 5FLXZ 2PMHA 1OMPA 3MZYA 5DVJA 1IRGA 1TLHB 1D3YA 3G7WA 3VXCA 4F29A 4JB7A 1IXCA 1SW5A 4NF6A 3TCFA 2P0SA 4TV7A 5EEHA 1N76A 4M71A 4Z0IA 3TODA 3I64A 1JHHA 3F8NA 2PQ8A 3ZN1A 2RC4A 2DK8A 4LK1F 5B70A 3GZ6A 5K2YA 3EHTA 4XXUA 1SMTA 1B6HA 2QRYA 2AIXA 1B5HA 3VVFA 3N26A 4LZ8A 2KIUA 3JAMK 5IT3A 4I02A 5LHGA 1NKXA 1FOKA 4U7BA 4G68B 3VODA 3V5AA 2DPDA 3SEVA 3UGWA 1ZMGA 2RINA 1SD7A 3ZP5A 4U88A 2DWIA 1TFDA 2X7QA 3DF8A 2FNPA 3N6TA 2P7CB 4FT8A 1LGBC 2VBZA 1H9TA 3FMRA 3MWBA 5I56A 1R00A 1USTA 1ZAOA 2Y7KA 3NEUA 1RYXA 1CB6A 2FMLA 5HOOA 1MXVA 1XOCA 2H4IA 1ODDA 2CSOA 2FQ3A 2PX1A 3D4CA 2QZ8A 4NF8A 3IAZA 4YU0A 2PJPA 5CVJA 1MDMA 2X0LA 1P1QA 1FPQA 2LSOA 4ZYDA 2A6HF 5IT9K 4CZZA 3GFLA 4YKJA 2M45A 4F3SA 1J5YA 1R58A 4BDRA 2AL5A 4WKMA 1I1SA 4BDOA 2IA1A 4EF2A 3O9PA 1N0TA 2Y0MA 2D1VA 3BKIB 3EYIA 2V93A 1S29A 3KN3A 3KN7A 2CWEA 3VE1B 2P6SA 3H03A 1VTNC 2EK5A 4LLNA 2PEXA 4G7OF 3JW4A 5ILVA 3SQNA 1USYH 2XD2A 3J80Z 1JEVA 2WC2A 4FX4A 1FTOA 3MQ9A 4HF2A 2RCAA 2BEOA 2P2AA 1TWYA 1PP8F 2YU3A 1B59A 3MZBA 1SD3A 3WU0A 4DE8A 3ZPLA 1RI7A 2VE8A 3ZMVA 3OEMA 4A12A 3WTTC 2CZLA 1SFXA 3RYRA 3OENA 2Q2CA 2OBGA 2REJA 5A2QK 4OIRF 2NOOA 5A5XB 3KLNA 4R8HA 3T5XA 1MY1A 4QHQA 4LB5A 1MXZA 4LUBA 4RA1A 3K69A 4AVPA 3QXMA 2F97A 3KP6A 3KZZA 3CLOA 1FYMA 3WTSC 1BM9A 3HOSA 4GF8A 4ELPA 2ELHA 3N6UA 3ERED 2HQNA 5JR3A 1E17A 2O51A 1Z1DA 1T98A 2QQ9A 4ZYGA 2AYSA 3JTHA 1QO0D 3VXBA 2ALUA 5D4RA 2FU4A 2F6PA 3M8FA 2WWYA 3FUZA 3VDFA 4PGGA 3TO9A 3IKTA 4ZEIA 3E5UA 1ZKBA 2ZKZA 5DYMA 1ZJLA 4ZYHA 5BOXA 4LMYA 3PQKA 3HRMA 3TQNA 4KNYA 1SYIA 3E6CC 3AXFA 4OYVA 3SETA 1TQPA 3CUOA 3PUXE 5FHMA 1TQMA 4NF5B 4ASNA 4X48A 1B7ZA 2DAOA 4ESFA 1P1UA 3DV8A 1LLSA 3TFLA 2GA2A 2RC8A 5D6FA 2QJEA 4OIOF 4QFOA 2BBYA 5KVRA 3T1BA 2LDUA 4LLLA 5J8FA 1TNSA 3J81Z 1UHMA 3EF7A 4YFXF 1GVCA 3L00A 3TTKA 1B6AA 1XMAA 5K5OA 3TTLA 5CC2A 3V8LA 2RKHA 4PFYA 1LVAA 2H6CA 3P9CA 5ICCA 4CICA 5J6XA 2F7BA 4MF3A 4IO5A 2ZNTA 5CM6A 5F6FA 3CSBA 4QFKA 4Q8RA 5J1DA 4G8MA 1JXSA 1QVSA 1BKAA 1IRFA 2ZBKA 5L9SA 2DP8A 1ELJA 4O3BA 4OHNA 1DPPA 3WU1B 5H6QA 2ZMEB 4DQ2A 2PMSA 3IJOB 3MW0A 5LGTA 5ILUA 1XSDA 4XLNF 1EH6A 2IT0A 3OOPA 3K2ZA 3KJ7A 1NNFA 3C4MA 2QVOA 4OWDA 2L01A 2ZMEA 5ILSA 2BV6A 4JSDA 1BIYA 4AB5A 4CYDA 2IRFG 3T0YA 1OYIA 3GFIA 2UWMA 1YW8A 2B3BA 5DEXA 5K2XA 4PQJA 3VB2A 4BDMA 3IOTA 1MJ9A 4UXNA 5CVRA 3S9EA 2HDCA 4BHPA 3DLNA 2IVMA 4WEPA 2WKYA 4EXKA 1A8EA 2XXQA 4YKIA 4H1XA 1R7JA 1B05A 3MBPA 3VVEA 2F5EA 4OESA 2YSRA 3TQLA 1IXHA 4I62A 1QZYA 3E5QA 1FYLA 1LAHE 5HBCA 2QS3A 3COAC 3V8JA 2XD3A 3GLXA 3PUYE 3RTWB 1V3FA 2F36A 2HEUA 2P8TA 3O6HA 2M5WA 2NS0A 1N7XA 1IN8A 2RNJA 4RPNA 2XIGA 3FX3A 2IA0A 5ISUA 2JT1A 5HDNA 5CLSA 3SHFA 1T0KA 3HV1A 1TFAA 1U8RA 1MXXA 1D9YA 4RB2C 3LQQA 4ZYEA 5D5WB 1AMFA 1FZPB 3ZMSA 2J5PA 4FORA 3QRFF 1SDXA 3I58A 3A09A 3MC2A 3THIA 3I5UA 1KYWA 3WTYC 2V84A 3HPIA 3LA3A 2K86A 3O29A 1Z6TA 5D5VB 4FJPA 2RV8A 4P9UA 5BMZA 4RPOA 3SEWA 1DOTA 2XVCA 1XB4A 3G3FA 4HX4A 4LQ5A 3IB1A 3VLUA 4YZZA 4RK9A 2FA5A 4G77A 3G3HA 1JEUA 2O6AA 4RYAA 3JZJA 1B0LA 3I53A 3DP6A 4ZZAA 3IR1A 3SEYA 2VC1A 5DDGA 3G3GA 4NF4A 4F1VA 3CO6C 2D5WA 2F7AA 4LVQA 2ETHA 1I6BA 1IITA 3SEXA 3O66A 4U21A 3O6BB 3B02A 2MA3A 3O6IA 4EM2A 4Q5TA 1R6ZA 3FM5A 4BDLA 1B40A 3TCGA 3F21A 5TJJA 1ZGJA 2GAUA 1EZOA 4IHSA 2I48A 4PP0A 2FXAA 4H67A 4OMYA 4G8XA 1DUXC 3WAFA 2X26A 3DPLC 3FMQA 3PUZE 1O64A 1ZLJA 2OBPA 5DV5A 5LLQA 5FLXK 3FVGA 4YIIA 4DZ1A 1W7PA 1XGMA 3MJNA 1VFEA 2KRFA 3PUVE 1XCBA 5AA1A 2XX9A 3R6SA 4BLAA 1O3TA 2GXGA 3MZ9A 1MPCA 3CDHA 2A5TB 4OZ9A 4M9ZA 1G3TA 1USSA 1XDSA 3NQOA 4ZZEA 1B58A 4RNSA 3V8XB 5B7DA 3WTVC 3ROUA 2UVIA 2XAGA 1A55A 2M8CA 3R0AA 1LSTA 1PB7A 1R9QA 1S7AA 3U1OA 1NFTA 3QP5A 3ONMA 2XAFA 4KD5A 5D8KB 3QU6A 4FHTA 4RB0A 3ZMZA 1LEBA 3VOEA 1SD5A 1YG2A 2VOOA 1IIWA 5FO5A 4U0VA 3H06B 3U72A 4XRFA 3L6GA 4HQMA 3LSXA 1O3SA 2O8XA 2DBBA 2UYFA 2EWNA 5LGUA 3PPRA 1DP7P 4ZEBA 3PV0E 3LWFA 4N9IA 2XUBA 2WTEA 4ZE8A 3K01A 5ITOA 2COMA 4BQAA 3RDIA 3F8FA 4LB6B 4EDPA 5AA4B 1A54A 3N94A 3TQWA 1B9MA 1QPMA 1US5A 3WTWC 1M5CA 2F5CA 2NRAC 4IO2A 1VE4A 4U4XA 5DUIA 4ZEFA 4KYDA 3I71A 2QM3A 4WX9A 1FP1D 1D8JA 3FJ7A 4KUMA 3FHZA 1UCRA 4OVJA 2EA4A 1IAWA 1OKRA 5I56B 2KKOA 3RQTA 2H5YA 1FNNA 1I69A 3TCHA 3CO7C 1BIBA 1B2HA 2PFBA 5DEQA 1ZARA 3OD7A 2IA2A 2ZO4A 5AA4A 2V25A 1TQIA 3F11A 4WXHA 2HZLA 4UHTA 5LHIA 5IAIA 1MQIA 3TKYA 1LB8A 1ZREA 2GHBA 3U92A 4HV5A 3A3CA 2VHAA 3R60A 2V79A 3FVOA 4GVOA 4DIGA 2G7HA 3TO7A 3B6TA 2QYOA 4ELRA 4QFPA 4KICA 3P7IA 1RZ4A 5EYFA 4G7ZF 1W5SA 1TNTA 2QQBA 5LOMA 3FM3A 4I0BA 2VE9A 2GHAA 1LDJA 2DYXA 1UIUA 4I8CA 1S50A 2L02A 2I4BA 3PMXA 2X4HA 2XAJA 4EQQA 4NWCA 3OSRA 4MTEA 3FF5A 3E3VA 4MEXF 4N0BA 3BJOA 1IQ7A 3W9VA 1F1ZA 4ZH4F 3S9MC 5H8SA 2F6GA 2O68A 4OEVA 4L9JA 4LLGF 3R4KA 1FSHA 1YO5C 4YMAA 2F78A 3S2VA 4EQ9A 4L9NA 4IPAA 4F19A 3FVNA 2Z8DA 4HF1A 4JSOA 3N4MA 1MJBA 1MPDA 3KJTA 3SKPA 4O3AA 4RGXA 5FD6A 3T9VA 4F31B 1U5TB 3GX4X 1B0HA 2W7YA 4YB7A 2AS5F 4PFTA 3RT8A 1XC1A 3BFTA 3TDZC 4RB3C 1EZPA 4HW0A 4XKQA 1MXUA 1Y9UA 2CG4A 1PDNC 2GXBA 4AD9A 3QIMA 4I1DA 4ZDMA 4L17A 2D1HA 4RGUA 4XLPF 1OR7A 3PPNA 3TPAA 1FQBA 2PMUA 1B51A 3GZ5A 1JGSA 1O7FA 3KFWX 3GBAA 5AIQA 3T22A 1MRPA 2VODA 2QPQA 2RF1A 3LFKA 3TDUC 4ENNA 5LBQA 5E1WA 5HLIA 4GL0A 3RKWA 4HCWA 1D8KA 4HQEA 4JQFA 3V4GA 4HYEA 1HKQA 1R5HA 1R1TA 2GQQA 4MFIA 5AA2D 3DM0A 2GZWA 1Z7ME 5H8QB 3KCCA 3ILUB 3JV9A 3C32A 3I3VA 2O0YA 2Z33A 4CO8A 4JWYA 3CUQA 1EZ9A 1YQAA 5IT9Z 5LRSA 3I54A 1ZLQA 1UTBA 4EMSA 1UIVA 3D0SA 4QF9A 1MM6A 2F2EA 2XXHA 4P11A 4P9FA 2Q89A 4MLQA 2EFOA 3OO6A 3TUSA 1HQCA 3ZSFA 4EJOA 3H6VA 5H8QA 3IB0A 2QBYB 2ZYNA 3I5OA 2ESNA 3MAJA 1GXPA 4NHJA 1UQWA 4UV9A 3RTFB 2HR3A 3VFZA 1F5TA 2V3TA 5HLHA 2Y7IA 4MH5A 1NL5A 3C35A 4AIKA 4MQ9F 5TPAA 4A5NA 1ON2A 1O7LA 1OIBA 2NYXA 2QWWA 1LDDA 2GIVA 1LAFE 1XHYA 4EQBA 4Q0CA 5HM4B 4G4PA 2QLZA 1MDQA 3O28A 5HLGA 4FX0A 3Q26A 5ICTA 4LQ2A 3C7JA 5I2KB 3KFMA 3G73A 1B3EA 3EN3A 3BP8A 3FXQA 3K6XA 2IP2A 3BDDA 4R9FA 1T2KA 2V3UA 2H98A 4OFJA 3B6QA 2QQAA 2DK5A 2OA4A 3K02A 4YG2F 2Q2EA 2STTA 1TBXA 2G9WA 2XX8A 5K1YA 4FATA 5JTYA 3M8UA 4EVIA 1JW4A 1OPCA 2XXXA 1V4RA 5CMCA 5CBSA 4OFLA 3LUYA 4ESJA 1IUYA 2GRVA 4OXVA 1Y0UA 1SI1A 1MQGA 3GO5A 1MKMA 1ZG5A 2QS1A 1LBCA 3CUQB 3OXNA 1FTKA 5EEGA 4A6DA 1R22A 4U7DA 2PBWA 1P4WA 3C31A 1HXDA 2Z5UA 2PBIA 5I2NB 2FRHA 3RPUA 4R1HA 3F8BA 2CMOA 5H8NA 1AOVA 1P1WA 1FW0A 5A5XA 3TGNA 5AONA 2YR2A 1KU3A 2O1LA 2REGA 1LAGE 2HAVA 4MLVA 2K7LA 1B32A 1Y3PA 3HOTA 3G3JA 2CQKA 2UZKA 1YTYA 4OFOA 2FEZA 3P7NA 2G93A 4QWQA 1IXGA 3CJNA 1O7TA 2KIFA 2ONKE 1MQHA 3M3KA 4G8NA 3RTRA 2IW5A 3FGSA 5D5XB 1MD0A 1W7PD 5CMBA 3JAMZ 4M72A 1XD7A 3GW2A 2NNYA 1FQDA 3O3KA 3OSQA 1BI0A 1QKAA 1Y4TA 2MD5A 2IPQX 6PAXA 1US4A 4F22A 4Q47A 4M6XA 2B0LA 1XGSA 5CVVA 4I98B 1TW2A 3QYTA 4R79A 2QSXA 1AIVA 3MPKA 3OO8A 1IZ1A 4UACA 4IVNA 3T8TA 4F1UA 2D2WA 1LCFA 3WAEA 3C9HA 1O63A 2XXPA 4O3MA 3D4GA 3H3UA 4YFNF 1BP5A 1OQGA 2XXYA 2DE4A 2EV6A 3MPLA 1EH7A 1VR5A 5J8CA 1A40A 1NH8A 2OWTA 1ZIUA 4M74A 1H44A 1IN4A 1ZG1A 1ZTYA 2AXLA 5BWJA 1NNTA 4PETA 5KZTA 2EV5A 3BPVA 5L8DA 4HX8A 3WTZA 5KCJA 4P96A 4K3FA 2OZUA 3FASA 2A07F 1Y3NA 2X7PA 2R7DA 1WI9A 2CO5A 1LQ1A 1GTKA 1LFGA 4NF4B 2DWAA 1D3KA 3G3IA 1K78A 1UFMA 2CGPA 4GWOA 5CMKA 4F39A 5E20A 1M5FA 1S3JA 3Q25A 2HTSA 1MXYA 3Q9VA 4P0GA 5HVQC 4UA8A 3FMSA 1I6XA 3U1DA 3W15C 4IO7A 5AIPA 2VC0A 1HBXG 4ETSA 1FY7A 2W24A 3LA2A 1ON1A 4WEDA 4LG0B 3QPTA 2Q8JA 4THIA 2RQPA 2YLNA 1P99A 2XRNA 2PYYA 5EHMA 4YAHX 2E1CA 3HN0A 3RJPA 5HS7A 4U23A 3I59A 1XN7A 3KSJA 1ONVA 4MTDA 1W7PB 2XROA 4LZ7A 2I3WA 3CTAA 3F6OA 1PC3A 3RI4A 3GLBA 4R73A 2XXVA 4WXCA 4FECA 1YYVA 2Q0OA 2H6BA 4CGZA 3FV2A 4JBZA 2VN2A 5HS9A 4P55A 1JVYA 1XSXA 1AH5A 3K2DA 3KGCA 1Q1HA 4C0RA 3KSXA 4H8JA 4KIBA 4RAZA 4H5FA 2VD2A 2XXRA 2ISYA 4RS8A 1BI2A 5BUUA 2H25A 2QS4A 1CF7A 3IOWA 1SFUA 2QMWA 3I6VA 5DTBA 1TTYA 3PPQA 2EFWA 1U6GA 3SFZA 1WDNA 3KG2A 4O5VA 3RPWA 1KQ8A 2D21A 2O1MA 4NEDA 1VSOA 1BJAA 1Z9CA 3IJXB 3DELB 4ZE9A 5CI5A 5E8IA 2ZJ2A 4M9SA 1JETA 2ANJA 3OELA 3F23A 1SD6A 5I57B 3M3LA 4IJAA 4GXSB 5E1ZB 4MHGA 1RYOA 1XVXA 1R1VA 5AA2A 1P92A 2GWRA 3O97A 3QAXA 2VONA 1WSUA 2PG4A 4KIGA 4QSDA 3SXYA 4F3GA 1QUIA 3HUGA 1PBPA 2VD3A 3LQRA 3H3GA 1JHFA 1UB9A 1WVJA 3FD3A 4NF6B 1XCVA 2VT3A 2F8DA 4GYGA 5HPQA 1MDMB 4IRIA 2FA7A 1QBJA 3DQVC 2MLKA 3H7MA 3F22A 3I59B 4L18B 1T38A 2OQGA 4LZ5A 2DOJA 3S9LC 3UORA 2W57A 4PCQA 4IXAA 4RAYA 4L5JA 1OLAA 3MP1A 3HYIA 3KZYA 4H8IA 3KE2A 2R7FA 4BAYA 2EJRA 3E13X 3V89B 2I58A 1QUKA 3HSFA 2E7WA 4RXLA 3ULQB 5K5RA 4KYWA 3FWEA 2NXOA 4HF0A 3MVYA 4H0WA 5H8HB 3BBRA 2XAHA 4C1TA 4NWDA 1POY1 3QOPA 1LAXA 3RY3A 1B3FA 2ZCWA 4NQWA 1IXIA 1H45A 3UA8A 2W25A 4OMBA 2HAUA 1URGA 4EJUA 4ENMA 1LCTA 3ZQ7A 4CHUA 1LEAA 3NRVA 3MP8A 3PD8A 5DCFA 1MY0A 2H09A 4HW8A 1D5VA 2NWJA 5I58A 2RVCA 2Q88A 2DQRA 1GVJA 4JWXA 1BI1A 1KQ0A 5D8LB 4ESBA 2ONRA 2VGQA 1KWHA 2O69A 3HRSA 4C1UA 1B4HA 4XSZF 1W4MA 4ISUA 4HBLA 3BWGA 3PD9A 5DT6A 2LAOA 5A2QZ 3N97A 2RCBA 2FBIA 1SVXB 1TT1A 3E97A 4IY5A 2HZTA 1N3XA 2FSWA 1Y4CA 2H99A 1MH4A 2P5LC 2I0CA 3P9KA 3WG9A 2A6EF 1B5IA 4WCGA 3CSGA 2G29A 2HS5A 1A04A 3IWZA 2XX7A 2STWA 2F5FA 1FP2A 2L4MA 2FBHA 4YIFA 1IXRC 1FBQA 3K1PA 3CFXA 1MDP1 4R74A 3IWFA 3JSOA 3E9XA 4XKPA 4U0WA 2EV0A 4QFLA 5JK4A 4L5IA 1NHAA 3K1NA 4GGGA 3RYPA 2Z22A 3O6GA 4HS7A
chains in the Genus database with same CATH superfamily
3IRQA 5F04A 3W2WA 4S0HB 1LUJB 1FBGA 1VFCA 1B3HA 5M3FJ 1FSAA 5L3DA 4AIJA 1KQ9A 2AQEA 4B47A 5L3GA 1P2FA 2JA5J 2E7XA 2ZXIA 2LNBA 1MQDA 3BFUA 3PPOA 2HGCA 3VEPA 3UN6A 4AS4A 3DFGA 1Z7LA 2W4SA 3KETA 4A2UA 2H9BA 1FT9A 4V2FA 3RT6B 2V4CA 4IF4A 3I56I 4MEYF 1F4KA 2P4WA 1IGNA 1X3UA 2K9LA 2QEXI 2WBMA 3LBSA 5EHSA 3KC0A 1BR1A 3ZMTA 2JTVA 2EB7A 1AL3A 2O7UA 3G1LA 4TLLB 1FTAA 1P1OA 4KDPA 1I39A 3GYHX 3GVAA 4HLYA 2H27A 1BC8C 1WJCA 2HYFA 4MBPA 4NMYA 4IO9F 1B4ZA 3X2QH 3W6KB 4HTGA 3EUHA 4FTHA 3K4UA 3A1YA 4A93J 4BS9A 1R49A 1FPJA 4YFKF 3MYUA 1RIOH 3EHSA 3M8EA 2LH9A 1P1NA 2VXDA 3L2UA 2R7UA 1YYZA 2DE3A 1X1PA 4CDGA 1J59A 2Q8MA 4GXOA 3PO3J 5J4VA 1IN6A 1PJRA 1G4DA 4LP2B 1A6QA 3LSMA 5H8FA 1HSJA 4O6JA 2OZZA 3PGFA 2VL8A 3U65A 1WJEA 5FKKA 4GDFA 3HO7A 4YB6A 3DTIA 3PTYA 4LJZF 1OLTA 3T93B 3U9GA 5ICEA 1CGPA 1S8NA 1Z0XA 1SYHA 1JP4A 5CBRA 2O6GE 2DU9A 3OY9A 1ULYA 4XRSG 5ED4A 4GQOA 4U22A 2XGDA 3B73A 4HLXA 5JLXA 3DEWA 4HX7A 3B7DA 2XF5A 5FBPA 4HDVA 1QVTA 4BL0B 4P9KA 1NUWA 3H9GA 1VQKI 2R71A 1NV3A 3LSWA 3T96B 1I6HJ 1VNDA 5FGMA 1DGRM 3VFJA 2GA1A 4FE8A 2JSPA 1MM7A 3J7AO 3GBBA 4RGRA 1MBFA 3HTSB 4HEA2 4S04A 2ISZA 3HHHA 4WF2A 3GTMJ 2FBPA 2DXRA 4KYSA 4AIDA 4R2BA 2JA2A 3DBHB 2XC7A 1XS9A 4G68C 4OAZA 1S7OA 1LDKB 3C18A 2R7QA 1II5A 1WCMJ 3HGYA 3IP4B 3CI8A 2WAQA 5JTYB 4IO4A 4R6YA 1J7KA 1TP4A 3L7WA 4OOIA 4I76A 3L1PA 4A0ZA 2VOPA 3LSTA 5I58B 3S93A 2OJED 5F27A 4ENKA 1S5LC 3ZQLA 5EZHA 4RK2A 4A5MA 2KRCA 3J81K 1POTA 3IFAA 3ZCOA 4KYEA 3L9FA 3WGIA 5F0FA 2JRTA 2K27A 1RR7A 5CJ9A 1N84A 2WYPA 3OYDA 4DXUA 4F92B 4QRZA 2V1NA 4U1OA 3TO6A 2B4MA 1L3LA 4OIPF 4GBWA 2Y75A 3Q9SA 3R61A 3WTXC 1FX7A 1NNPA 1MS7A 4OEUA 5L3CA 4CXFA 3B6WA 4BDQA 2VQGA 2WEFA 3ABUA 5TISC 1A7LA 1PEBA 3H36A 3EPEA 5GAGJ 4H0EA 1LBVA 3B8BA 5EQ9A 2FX0A 1YFHA 3NWSA 1A8FA 1T08B 3BR6A 3RUMA 1ZH5A 1REPC 1U5TC 1WJBA 1FEXA 2L9VA 2VASA 4UNOA 2XA5A 5ELVA 2ME6A 4X0GA 2ADUA 4GD5A 2VB6A 2GIZA 4KIFA 5F1QA 2DVCA 3QK6A 4KN7X 1SW4A 3D5RC 1TXFA 5E3OA 2X6XA 1FPIA 1B7UA 2I4CA 1PB9A 2RKMA 4M1VA 1GGGA 3K6WA 2FOKA 3F6VA 3BTIA 3PPPA 4QSEA 5BPIA 2DT6A 2JVGA 1MNDA 2JA6J 2PMZN 3A0BC 4EJTA 1QU3A 5L3FA 3TDJA 4KMFA 2EFNA 3M9AA 4ANJA 4D7NA 3QUJA 4PFWA 4XIGQ 1SI0A 3VLWA 3KOSA 3LNQA 3DKWA 2QQ8A 5JLWA 2QBYA 3H6UA 4RJZA 3Q27A 4XTCQ 4H5GA 2R8TA 4OVRA 1EA3A 2K3FA 4Q30B 5I59A 2OWSA 2E2IJ 1FTJA 1N04A 1UHWA 3JTGA 1PUFB 3M4OJ 5CVIA 1FTLA 2IA4A 2NNNA 2MSYA 1E3PA 5H6RA 4JOMA 2DWHA 3RLFE 4ESXA 4HG2A 1F9NA 3BCBA 5FLMJ 4XONA 4GRKA 4GWSA 1EH3A 2P7VB 5IKBA 1BN5A 5JHUA 2K3PA 5LEKA 5M5WJ 1L5TA 2JVHA 3L2RA 1J75A 4KJZA 1NV7A 1SMYF 2LC2A 2DW4A 4HZFA 4AIHA 1HKTA 4MCOA 5IZ1A 3MP6A 3TKDA 1YLFA 2PN6A 3T9HB 5I59B 5DUKA 2FNAA 2HNHA 3RGYA 1DTGA 1BOBA 4E7SA 3QWLA 5H2FC 3CCMI 4XOTA 5FB2A 2Y48A 4XLFA 4LG0A 4HNVA 4JWOA 1USYE 3BR0A 3ISPA 3RKXA 4DZPA 4EGYA 2WAFA 1SW1A 3O8GA 4XMYA 1B1XA 2C6YA 3PQJA 4R6KA 3W6JB 1LFPA 1XS5A 3GXAA 3HSEA 2FIEA 2DPUA 3OOAA 1D0ZA 3D1NI 3MUQA 2FYIA 3RKYA 4YELA 4U2RA 2JUGA 1P4XA 3ZMDA 3HOUJ 3ZR8X 2KLFA 4OQOA 3T0JA 3S8PA 2E1SA 4X1BA 5KDTA 2MGQA 3OEKA 3MEXA 1G3WA 1B5JA 4FEDA 4XKRA 3MZ1A 4CUGA 5DVFA 1DPRA 3DCFA 4ZZDA 5DYHA 4HXVA 4B8XA 4DCYA 1BL0A 3A29A 2DA5A 3BZ6A 2OAZA 1T0FC 2VBWA 3PU5A 1X2MA 1B8IA 1W0TA 1SD4A 2IS1A 4XK4A 2CUFA 3HRUA 1B9NA 2Q1ZB 2BW3B 1QULA 5EF6A 1C0WA 1MY2A 3B6CA 2B65A 2I49A 3BY6A 5FHNA 5JI6A 1B72A 4JXIA 3M7GA 3F8CA 2L4AA 2L7FP 2ZNZA 5LEJA 2E1MC 3QYEA 2JZYA 1ZG3A 4KT5C 3CR9A 4NNJA 1JUSA 3U93A 2YPRA 3I9V2 4CH7A 2L54A 5F24A 2ESHA 4IHWA 4R2FA 1ZR4A 5EYHA 2XB0X 5L3EA 4OVPA 1ZGWA 1Z7UA 2KR0A 1FQCA 1EH8A 3OL4A 3PFIA 1XVYA 3E4RA 4QBAA 1XTAA 3UK4A 4AQ4A 1LFBA 1PYVA 2K5CA 2G7UA 2XWVA 2EA2A 2DOEA 1YAEA 1MMDA 4C2TA 1LFHA 3HOYJ 1IO2A 2Z8FA 2J5OA 2NS7A 3EQ1A 3G1MA 1FBDA 4ONYA 1R71A 4XNFA 5DM6F 4IGRA 3MWMA 3FXMA 2R6GE 2L7ZA 2Y30A 4F7ZA 4AB6A 3CRBA 2QVRA 1UHSA 2QMXA 1TT5B 4YIRX 3HTUA 1ITYA 2UVJA 3O2PE 4ZDMA 1SBPA 2UXNA 2XGCA 3V7SA 4NN3A 3TAJA 3H5AA 2DS9A 1HW5A 2XGXA 3EQLF 3PMVA 5HDKA 1RR8C 4GXAA 3M3FA 3CMMA 2UVHA 4I9DA 5LHHA 4E7KA 1RUNA 1HSLA 3IL2A 1OCRH 2VPRA 1X2NA 2KIQA 1IUDA 1FRPA 1YS7A 2HYJA 3BR3A 3JSPA 3AL0C 1KU2A 4KFCA 1N78A 1UAAA 1VQ7I 2OJTA 4N81A 1J0RA 4L9TA 4MQVA 1VQMI 4N07A 5T3JA 4E0XA 4A6EA 1K78B 5K5QA 3K4NA 1MIJA 2QSFX 4JX6A 2WX9A 4G94A 3MMYB 3VVDA 2BOLA 2A5SA 2NUVA 1I6AA 1T95A 1RUOA 3ODBA 1ZN2A 2NVUB 4QXDA 3B50A 1K7AA 3G3KA 2DMNA 5ERIA 4E7IA 2Y2ZA 3K6VA 4BGDA 3GXOA 4ZEDA 1HSEA 4LFUA 2QGUA 3W2VA 4Z2YA 3RZOJ 4A3CJ 2Z3YA 4N4UA 3PUWE 1SFOJ 2A3SA 3PSFA 4X1DA 3ECRA 4X8RA 2X1EA 3NOHA 5TU0A 1ATGA 1K6YA 1I27A 1IW7F 3DP4A 4YKPA 4ELOA 5F0HA 4F2QA 4XICA 2O7IA 1S9TA 4KA4A 1KA0A 3C2BA 2O61A 4HCYA 4ECFA 4ESWA 1IN7A 3U2RA 1WFXA 1XPXA 2ABHA 2Q9TA 1JQFA 1OVBA 3MN2A 2KRHA 2R4GA 3BG5A 1KU7A 1DTZA 1UTHA 1H76A 4NGUA 1KA8A 3OYMA 3QUFA 2HCAA 1R1UA 2YX4A 3KP7A 1V55H 2DMUA 4D0PA 3A4CA 2LF8A 1WI3A 2IEEA 3KN8A 2ID3A 3CG3A 3IK6B 4G9YA 3RN8A 1JE8A 4KCCA 4IO3A 1YCJA 1JKRC 2OK2A 3K1MA 3KP3A 3K70D 4IHYA 1AHDP 3OMBA 3BJ6A 1ZKGA 1Y3QA 4PAFA 5IYBJ 3FZVA 1NV5A 3TEPA 1I50J 4YRVA 5C44J 3AL0B 4X6AJ 5TP9B 1ZBMA 2PLYA 1PDAA 1OFCX 1A99A 3DEUA 1QW0A 5B5EC 3BPXA 1RNLA 5E79C 4JK1X 3IAS2 4F18A 5ICFA 2XXUA 4Y4RA 5EYGA 3P9IA 2HTJA 1ZU0A 2F4MB 4PAIA 2V9VA 1MW7A 4J19A 5EZGA 1QA6A 1SFKA 2V1DA 5LGNA 4EUOA 3DP8A 2FE3A 4H6DA 4JYKA 3SFIA 1LEVA 4Y15A 3WGHA 2VPLA 4GL8A 3SDFA 4IQJA 3AG1H 3REOA 4GCVA 5IP7J 5TP9A 5KDTB 3WODF 4M3FA 1QKBA 4K2EA 2Z23A 1BTJA 2NXOA 5E17F 3E6BA 4EGZA 3JYRA 2K9NA 3AFHA 1ZRFA 2JJ7A 4XKNA 4UVCA 4PFPA 5FRMA 5EQ8A 2A5YB 4G6DA 4GFRA 2ZXTA 2CEXA 4QLCU 2KQZA 4BQQA 2WADA 2WBDA 2HFBA 5DVIA 4BUPA 2VP1A 2V3QA 2ZXHA 4BEHA 1OVTA 3DU5A 3AG2H 4OENA 1J1NA 4F3BA 1GLNA 1BIAA 1FBSA 1FQFA 1VF9A 1LE8A 4XLHA 1E2XA 5D6EA 4CZCA 3SEUA 4Q5SF 4LD5A 3MKZA 3W9WA 3IOUA 4OTEA 3BZKA 4YICA 2KJBA 1FIAA 4EM1A 3ELKA 4IHTA 1GV8A 1SANA 4GWUA 1Q1VA 3CP2A 1YOVB 1ZHFA 3BG9A 1I1GA 3IKVA 5DCMA 2DE2A 1U2WA 3R0JA 2QL3A 1VDWA 2DSFA 5CMMA 3CCLI 1DSNA 5H20A 4G7HF 1M5BA 4M6YA 3OYLA 3TTRA 3KP5A 4E4HA 2M8GX 3E5XA 4NTLA 1ANFA 4UY8I 4TLMB 2A61A 3MAMA 2A5TA 1F9BA 1MMGA 1VQOI 2JA7J 4JBAA 1B9JA 3KZGA 4LIVA 5E18F 4NB5A 1N3WA 3U94A 5JEIA 1MGTA 1ETOA 4MNUA 1M1EB 4DYCA 3ZKLA 3LSPA 4D5FA 1FBUA 1QNTA 1BJZA 4D9JA 1ZRDA 2HVSA 2PJRA 4KISA 4PE5B 1OMIA 1TW3A 2R7TA 2DDBA 3WU2C 4EV0A 4KI0E 1UZCA 4QSHA 3CUQC 5AA2B 2OZ6A 1WJAA 4PFRA 4G6QA 3GZGA 5D4SA 2ZJPF 1RKMA 2O5RA 2PFYA 1JW5A 4ZEKA 4QTRA 3HRTA 3K4JA 2UXXA 3A3UA 5EQAA 3RPQA 4EJWA 3O8HA 1KYZA 1SFEA 1TWFJ 2VXZA 2ZJQF 3OO9A 3Q29A 3FJMA 4PFIA 1FSEA 4R6HA 1XT8A 3OYIA 4I3EA 3T9XB 3M8JA 3MVWA 4PGHA 4HV6A 3Q28A 1EKEA 2B7EA 1BBYA 1HKSA 2HQ5A 3K0LA 4A3EJ 4UVAA 1FLIA 4ZECA 1B7HA 4BH9A 4RM2A 1N25A 3PUBA 3LC8A 3T9UA 1I6QA 2P5KA 3OR1C 2OCUA 1NNKA 2RN7A 3IC7A 1VQ5I 4BDNA 4PJMA 1YIJI 1XSVA 1H0MA 2FNCA 4PAKA 4P47A 5J47A 1L0OC 3ZQIA 3FV1A 5L9MA 4BHCA 1CE2A 3R7XA 1E3HA 4FIMA 1DMBA 2BY1A 2E60A 4FETA 4ND9A 1B3GA 1YPNA 4EM0B 1FWZA 2PCRA 1YTVA 3UIFA 3QPSA 2ZZVA 4NE4A 5M5YJ 4N6KA 1MQJA 3MZHA 1V5EA 3E79A 4IRHA 2VT5A 2ZZWA 3HOVJ 3CESA 4NF0A 4Y52J 4P5OA 2D45A 4DI3D 4DLDA 5F64A 1YW9A 4OAYA 2NVXJ 4ON0A 4UV8A 1R9LA 3GTLJ 1X4PA 1EF4A 1MSEC 3HCQA 1LFUP 4KMUX 4BE2A 4ZZLA 2QFLA 5EQ7A 5FFZA 4TOZA 5IGAA 2XWOA 3ESWB 2OD5A 3P5JA 2DQLA 2GQ1A 2XPUA 3H3VK 4UB8C 3FKJA 3TMGA 5F1RA 2LF7A 2VKHA 5I2KA 2R92J 1APLC 1T33A 1WRJA 4HA8A 3H4ZA 4OIQF 3HHFA 4POXA 2HKXA 2DWJA 3V7RA 3LR1A 4NQWB 2HZDA 2XV4S 1B4AA 3PMWA 4PFUA 2QSHX 2DI3A 3TTMA 5JVGF 2F3BA 2KHMA 2BZTA 3OIOA 4QIWN 2ZYKA 2W84A 3S9NC 5GTHC 1TZLA 3H92A 3TOAA 5DTDA 2MH2A 5EG0B 3FJGA 3SZTA 5FJ8J 3FATA 4PJ0C 1URSA 1IN5A 4G8HA 4PDDA 3K2AA 2XXWA 3R6UA 1GXQA 4M3GA 1DQUA 1NG6A 5ICGA 2ZSHB 5ICQA 5ICTA 3E6MA 1ORKA 2HOTA 1R23A 3CJQB 3QODA 4C9YA 5D5UB 4OMZA 1FTMA 2MH9A 1DU6A 4IL6C 1WODA 4CA0A 3OL3A 1J2XA 3FIRA 3CFZA 3C1DA 1D1CA 4LGWA 2F5XA 2RC9A 1POGA 2HDWA 2E2HJ 4OETA 1ENHA 1TT0A 3PL8A 1KZ8A 4L9VA 1MG1A 3BIGA 5JVTA 1G8XA 2BHZA 4IB2A 2VKVA 3IOVA 2M1BA 1J9IA 2NOJB 3MCZA 1NMUA 2HKOA 3GEZA 4A0YA 3JRHA 1XI6A 5HS8A 2H8WA 3GWZA 2OQRA 5J1UA 1FPGA 4GLIA 4N9HA 4PZJA 1BI3A 2D3IA 1SQYA 4I40A 4F2OA 2DFEA 4ZYAA 3O2AA 5LRRA 1JTXA 3ECOA 1IEJA 2K40A 2ZZXA 4F3PA 2ZNSA 5EJCA 3L2WA 1Y20A 4KFQA 1FPEA 3Q0VA 4HNTA 3VV5A 4D5CA 1VQ4I 2V6CA 3QPLA 2MC3A 3J7YJ 2A69F 3SYTA 3CCJI 1YHQI 4OERA 4FE7A 1QVUA 1XDUA 5E1XA 2Z8EA 3KLOA 2JPBA 3ZQCA 3N05A 5DS9A 3IAM2 4FEBA 1MMSA 3HIFA 1IF1A 1EYKA 1T6SA 2CEYA 3LAPA 2DXYA 3FK7A 4I09A 1ZGAA 2HXIA 4DBQA 4ENJA 3WE3A 3G71I 5BQTA 2JRMA 3JRGA 3CCSI 3KP2A 1BA5A 1H88C 1G59A 2I0BA 4G2ZA 1R4MB 4WK8F 5B1BH 4EEFG 2MC4A 1HW1A 2K4BA 2XASA 1FPDA 4A0XA 4WXDA 4EATA 3GF2A 4N13A 2DYRH 1Y1ZA 3QSLA 2IGMA 4JVDA 3R26A 3CG1A 1QZZA 2F35A 3H6WA 1N77A 4A3GJ 2I3VA 2Q74A 4KCDA 2HZKA 3TTNA 4LOCA 1O57A 3OYGA 3EDPA 2DODA 1ZYRF 3T66A 5AE4A 2ZMBA 1P9QC 3FXUA 1MY3A 4BNCA 2LBFB 3LSLA 3ZMUA 3LSIA 1P6RA 5DD4A 2KDOA 3SDBA 2HYGD 3H6TA 1JNFA 4B09A 4ZDLA 4UVBA 1BW6A 3BROA 3RCOA 1JKOC 4RY1A 5FKMA 1JW1A 1STZA 3JR9A 2R5YA 2V1UA 2E1NA 5IP6A 1K79A 1LBXA 1YIOA 5AA3A 5ET6A 3M3YJ 2TDXA 3CP8A 5E8GA 1PVEA 1X1DA 5KK1A 1LBYA 2QS2A 2ONSA 3MFKA 2JN6A 1B52A 3QOEA 3TOBA 1SEUA 2WY8Q 3CMAI 5C4XJ 1GHCA 4ZJZA 2I6EA 3RNNA 5I84A 5CVUA 2V1XA 2YX7A 2JPCA 5DCMB 1LJ9A 2EPFA 2CUJA 1GVDA 4R75A 3I0TA 1Z6RA 4GO1A 4E6KG 4AC0A 1DPEA 4S05A 3SEQA 4BKXA 2XHKA 5GPAA 5B66C 1FYKA 1DDNA 2O3FA 5L3BA 5ET7A 2L9RA 4XOPA 1FOYA 2VT2A 2H94A 2FBKA 3GTQJ 1B72B 4P0IA 3GTOJ 1LNWA 1PP7U 2PT2A 2RC7A 2MLGA 3BJAA 2XXTA 1JT6A 2IXSA 1U78A 2WBBA 3KP4A 2Y7PA 1BOAA 3CC4I 3DBRB 1UTBB 2DLLA 1KGSA 3MKWB 4XRMA 3V7CA 5FD5A 4DCXA 3FBIB 4M9XA 3WG7H 2NVYJ 3S32A 2CUZA 2QKLB 3J80K 1UTHB 3OO7A 4HSTA 4WXJA 5FHOA 2JK3A 3OYEA 2JSCA 2QENA 1QGPA 1YJ9I 2Z99A 5DM7F 5IP9J 3IO6A 1G3YA 3KC1A 1B46A 4JDFA 1S9HA 2VKEA 3M1EA 4E7ZA 3EYYA 1QJMA 5L9OA 4BXUA 4EF1A 1IXSB 2Y7RA 3I3LA 1YW7A 2AL4A 4YMBA 3ML6A 3SESA 5HLTA 1OJLA 2UVGA 2CV1A 3K00A 3HSRA 1CF7B 1FQEA 1Y1VJ 2DFIA 3G4SI 2QKMB 4AWXB 4DW6A 4AYBA 2CZIA 2YPNA 2WV0A 3HPGA 3IUOA 4PJLA 4ZDOA 4U4SA 3BG7A 3DXJF 2X85A 1AOYA 5BPDA 1B1HA 2BYVE 5HDGA 1R1NA 4IY6A 3HSTA 1AWCA 3QPHA 1NV6A 2KL4A 1V5GA 2CFXA 5M2VA 2WV1A 2ZJRF 3FISA 4C2UA 3EHUA 2F4IA 4M3EA 2NAZA 1R5GA 4GOTA 2OU2A 3N5LA 4Z7EA 4R72A 4HSRA 1DPUA 2AO9A 1NK2P 1S6LA 5E3MA 1Y1MA 2ZYMA 2PT1A 1WKMA 4DOZA 1K9ZA 2PVUA 3FBPA 3OV8A 4IGTA 1Y8RB 3F3XA 4XORA 3L2VA 2E35A 2A68F 4PFBA 2P6TA 2GH9A 3PNTA 4HAMA 1VQPI 3OYHA 1SW2A 3GFMA 4Y17A 2XAQA 3OWTA 3MVZA 1Y0NA 1LFIA 1G3SA 1MY4A 1B3LA 3KEQA 2Z9OA 1LB2A 4H46A 2GFEA 1KU9A 5TRDA 1FCKA 4HDUA 2Y5KA 5BS6A 4NQ8A 3ZQQA 3HL2A 1JUPA 1PB8A 5ITPA 3DPTA 4Q48A 2RDPA 2EZKA 3VYSB 4A69C 4BU2A 1SAXA 3OOUA 2ACJA 1N7WA 3QP6A 2DQVA 3SZPA 1M5DA 1MPBA 3CHGA 5K7ZA 3M07A 3RPLA 4YKKA 5B3SH 4E0WA 1D0YA 2FF4A 2R5ZB 1VFDA 4F1YA 1JTYA 3MVXA 2BY3A 1CNQA 2THIA 4ZS9A 4A3KJ 2O03A 3K6UA 4OU0A 1NUXA 2DA7A 1T0FA 4G61A 3S4UA 2I8DA 4KXPA 2BGCA 3HGGA 4N4NB 5JHFA 1FBHA 3HFUA 4NC8A 2B3FA 3V83A 1OQYA 1AKHB 1OLCA 3F72A 2XKPA 2CW7A 1QUJA 3IX1A 3LSFB 3ZKKA 3K0VA 1D4NA 1V54H 3SERA 4BEHB 5H8HA 3GFJA 1HCRA 1OQHA 4I3YA 1AWBA 1RKWA 5TPAB 1MJAA 3EETA 3MZ8A 4RGSA 3QMFA 4I2OA 2F5DA 4M4GA 3DLLF 2P1SA 3D5LA 3I4MJ 2DO7A 4HOBA 2ZNYA 2VQCA 1LBBA 4IQ4A 5F7VA 2IJLA 3C3WA 2M30A 3CCQI 1VQ9I 3ZQGA 5FTHA 3CFLA 2LVSA 1GUUA 2QUFA 3AAFA 3LMMA 5CYVA 2FIXA 3OYKA 2O84X 3OMYA 3KEOA 4LA9A 5H8NB 4OINF 3E0JB 1OYWA 4NF5A 3KBRA 2XSJC 4XBFA 1U5TA 4DNCA 2UYEA 5DD8A 4BYYA 5CKTA 4BQOA 1GT0C 3S2HJ 4N6PA 4P1EA 3DP7A 2QF7A 4EJVA 3TYHA 4IRGA 2P5VA 3KPHA 4POWA 3BQZA 4U0YA 2VQHA 1RC9A 2A05A 2VBXA 5FROA 3FXKA 4C30A 2VUMJ 2HXWA 2K4JA 1FJ9A 4LIUA 4D1QA 4IO6A 4RB1A 3L09A 1U3EM 2UXAA 3M1CA 1Q35A 3PUFA 1RDXA 3ZS6A 1E3OC 5DEXB 4DDDA 1X3WB 2HFHA 1TWGJ 2FVZA 3VLVA 3VDXA 2HQRA 3U21A 3WE2A 2HEOA 4ELQA 1XGOA 1NH7A 5F08A 4PSXA 4DXBA 3C36A 4U1ZA 1LB9A 2VJIA 2F34A 2Y84A 2DVZA 3BQYA 5CRYA 4YB5A 3PNYA 2CW0F 4WWCA 2V6EA 1QQIA 1RPWA 2TRTA 3S15J 1HDDC 1MXWA 1H9GA 3Q5FA 1ZLKA 2DA3A 2M0CA 1NUZA 3S2WA 2NXNB 1QRYA 4AVZA 3ILTB 3PNVA 4BY1J 1BLFA 2M7AA 3TELA 2BJJX 4MX6A 1UG0A 1WWXA 2BY0A 3NWTA 3SZGA 4Q4ZF 2YUSA 4XSXF 5JFRA 5E3NA 1IUFA 1K4SA 4H0WA 5I57A 3E3KA 1JVXA 4X9TA 2R9JA 4GIZA 1HW2A 4NX1A 2DMTA 2FMYA 4G68A 5H8FB 4BJ5C 1JJ8C 2CQNA 3H3ZA 1GR2A 2YJPA 3H3GA 3GUDA 3WTUC 1M5EA 2OLBA 1R36A 4F91B 1PBQA 3CCRI 2F6CA 2EINH 1W5TA 1O3RA 1S7YA 2L3DA 5EGOB 2VOZA 4QSCA 4KQPA 3TZAA 2DTRA 4BE1A 3E6DA 3KEIA 2XXIA 1FQAA 4X1EA 1HF0A 1VQNI 3IH2A 3VYTB 4LONB 2O7OA 2Y7WA 2PJRB 1G6NA 3K9TA 1B1BA 4A3BJ 1OYYA 4KITB 2E1MB 1FOWA 4PCDA 4XR6A 2HI3A 3MQ0A 3KOTA 2HWVA 3WGGA 4MGRA 3V8KA 4CYCA 3QAHA 1IMCA 4AS5A 4Y13A 4AU7A 3KZIC 3CVGA 2EH3A 4RMNA 1BC7C 2XHDA 4TQUQ 4LATA 3FXRA 2OUMA 1IRXA 4I0AA 1URDA 4OWRB 2Q8KA 1YS6A 4L0YB 3IH3A 4PGNA 2LY1A 1PUEE 2LTPA 2L9SA 4FBPA 4O3CA 3IO4A 2K02A 3G3ZA 1EU8A 3IB2A 4BHBA 4O7IA 1Z91A 2HPGA 2Z16A 3HHGA 1H3DA 4FAJA 3UKGA 4R9GA 2ZFWA 1FC3A 1JKPC 3DPUA 1ZRCA 3H9JA 1IMFA 1Z05A 2KJCA 4NF8B 4EXLA 1LE8B 2R7WA 2O9LA 1H43A 2EFQA 3RIRA 2RQQA 4KPTA 1I5ZA 2LKPA 2R3SA 4UUVA 4H65A 2F7CA 2KIMA 1HLVA 4M73A 4V19K 2Q2AA 2CV0A 3DKXA 3CIJA 3LAJA 2GOMA 3ERMA 5ESYA 4PDKA 4ZC3A 4L0ZB 2FUG2 3I4PA 4E70A 5IZZA 2BW3A 3L6HA 1Z7NE 1XC5A 2BE5F 3PSIA 1K6OA 2ZNUA 3USDA 1O3QA 2JUCA 3U8QA 2PI0A 4EQ7A 2CYYA 1XMKA 1D0XA 3L2CA 4I01A 2RGVA 2M8EA 1R4NB 2DT5A 1MH3A 1DBZA 2HQ0A 1Q1KA 2BVMA 3BT9A 2EFPA 2VBYA 2CQQA 3OR2C 2ZXWH 3BOQA 1HSTA 2ZXJA 3L2QA 3I4NJ 2E0SA 4I7HA 4KR5A 5LFAA 1NTCA 2W85A 4UUSB 3FVKA 3UP9A 3BZCA 3ECHA 3CD6I 5KCJB 1P7JA 1MZBA 3IRRA 1R5ID 3C33A 1T39A 4QFNA 1YITI 4HRIA 1QZEA 3ABTA 4LK0F 2E1OA 2ZYOA 1WQ2A 2M34A 3F8MA 3KYDB 3Q3SA 2QCOA 3ZN0A 4KHZE 1EV7A 3IORA 3T8RA 3IHUA 2F4OB 3FDYA 3TP0A 3ZRGA 1JGGA 1XGNA 3S1NJ 1D9VA 1FOXA 2OTLI 3C34A 4CCJA 4GBVA 3IL1B 5FTIA 4M3BA 5FFXA 2M87A 3EKIA 5I2NA 2BXYA 1ZTRA 4MFDA 4N8GA 3QU3A 4GYIA 4Y7NJ 4JX4A 2KP6A 4YEJA 4KN4X 2HOEA 2MBFA 1D1BA 2HXOA 2XKOA 3LA7A 4M6VA 5ET8A 1P4AA 5FLXZ 1JT0A 2DYSH 1A31A 2PMHA 4PK4A 1OMPA 3MZYA 5DVJA 1IRGA 2F3DA 2R5YB 4GWYA 2DJNA 1TLHB 1D3YA 2DDKA 5CPRB 3H5RA 3G7WA 3VXCA 3HZJA 1Z77A 4F29A 1INPA 4JB7A 1IXCA 1MBHA 2CU7A 1SW5A 4NF6A 2P0SA 3TCFA 4N8YA 5LDZA 4TV7A 5EEHA 1N76A 4M71A 4Z0IA 3TODA 3I64A 4DIQA 1JHHA 3F8NA 2PQ8A 2HQAA 3ZN1A 4HE2A 2RC4A 2DK8A 1D1AA 4LK1F 2H1KA 5B70A 3GZ6A 5K2YA 4W97A 3JRDA 3EHTA 1IJWC 3A0HC 1SMTA 1CQTA 4XXUA 2K9MA 4F3QA 1B6HA 2QRYA 2AIXA 2ECCA 2CZHA 2GLOA 1B5HA 3VVFA 2Y0SN 2LD5A 3N26A 4LZ8A 1IMAA 2KIUA 4H45A 4B43A 3JRIA 1TL8A 2P3VA 3OYNA 3LUZA 3BR5A 3JAMK 3CZ6A 5IT3A 2EIJH 1SPIA 4I02A 5LHGA 1NKXA 2LY9A 1FOKA 4U7BA 4G68B 3VODA 3V5AA 2DPDA 3SEVA 3UGWA 2R7RA 1ZMGA 5KAFC 2RINA 1SD7A 1X1CA 3OIQA 4U88A 3ZP5A 2DWIA 1TFDA 3OSFA 3FHNA 2X7QA 3DF8A 2FNPA 3N6TA 2P7CB 1DU0A 4RLFA 1LVKA 2HPIA 1IMDA 1E0EA 4FT8A 3RPUD 1LGBC 2VBZA 1H9TA 3FMRA 3MWBA 5I56A 1USTA 1R00A 1Y39A 2O8KA 1ZAOA 2Y7KA 3NEUA 1RYXA 2JJKA 1CB6A 2FMLA 5HOOA 2LFBA 1MXVA 1XOCA 2H4IA 1ODDA 4CCKA 3E1SA 3S3NA 2CSOA 2FQ3A 2PX1A 2JQ7A 2QZ8A 3D4CA 4NF8A 2M4GA 2RNGA 3IAZA 4YU0A 3HUGB 2PJPA 5CVJA 1MDMA 2X0LA 1P1QA 1FPQA 2FJ1A 2GOXB 2LSOA 2I5UA 3ZQFA 4ZYDA 3HOWJ 2A6HF 5IT9K 4CZZA 3GFLA 4YKJA 2M45A 4F3SA 1J5YA 1R58A 5GP9A 4BDRA 2AL5A 4WKMA 2EIKH 1I1SA 4BDOA 2IA1A 4EF2A 2KMUA 3O9PA 1G0IA 1N0TA 2Y0MA 5FKNA 2D1VA 3BKIB 1FBEA 1R6RA 3EYIA 2V93A 1AU7A 1S29A 3KN3A 3KN7A 2CWEA 3VE1B 2P6SA 3HBLA 1VTNC 2EK5A 3H03A 4LLNA 3RKQA 2PEXA 4A3LJ 4G7OF 2NVTJ 3JW4A 5ILVA 3SQNA 2LRDA 4FE4A 2MYSA 1ETXA 1USYH 2XD2A 4IOAF 2Y69H 4NHBA 3J80Z 1JEVA 4MNPA 2WC2A 4FX4A 1FTOA 3MQ9A 4HF2A 2RCAA 2BEOA 2P2AA 1TWYA 1PP8F 2HOAA 2YU3A 1B59A 3K4CA 4C3IJ 1SD3A 2MFZA 3WU0A 3BC8A 3MZBA 3ZPLA 4DE8A 1RI7A 2VE8A 3ZMVA 2E5ZA 3OEMA 2XWKA 4A12A 3WTTC 2CZLA 3VWBA 1SFXA 3LL7A 1NI9A 2X48A 3RYRA 3OENA 3FKIJ 2Q2CA 3WHBA 3K7AJ 3ASOH 2OBGA 2REJA 5A2QK 4OIRF 2VLAA 5LD2C 2NOOA 2KZGA 3KLNA 3HKZA 4R8HA 3T5XA 4DZJA 1MY1A 4QHQA 4QPQA 1I3QJ 5J4YA 4LB5A 4G6TB 1MXZA 2H8RA 4LUBA 4RA1A 3K69A 4AVPA 3QXMA 2F97A 2ID6A 4GRIA 1ZR2A 3KP6A 3KZZA 1G0HA 3CLOA 1FYMA 1A36A 3HM5A 2EIMH 4BDYA 3KX2A 2HVQA 3WTSC 2KFDA 1BM9A 3HOSA 2P0WA 3KYLA 4GF8A 4ELPA 2ELHA 3N6UA 3ERED 2HQNA 2V9PA 5JR3A 1E17A 2VJJA 1Z1DA 2O51A 1T98A 3K4MA 2QQ9A 4ZYGA 2AYSA 3JTHA 1QO0D 3FXLA 3VXBA 2ALUA 5D4RA 2M2EA 4PC9A 2FU4A 2F6PA 3M8FA 2WWYA 3FUZA 3VDFA 1ETWA 4PGGA 3TO9A 3IKTA 4ZEIA 2A5WA 1LPQA 4UABA 3E5UA 1ZKBA 2IBDA 2ZKZA 5DYMA 1ZJLA 1XG1A 3KEYA 4BDZA 2M3AA 1ACIA 4ZYHA 5BOXA 4LMYA 1GV2A 3HRMA 3PQKA 3TQNA 1JKQC 4KNYA 5IYDJ 2AXTC 1SYIA 3E6CC 3AXFA 4OYVA 3SETA 1TQPA 3CUOA 4CCOA 1K9YA 3PUXE 5FHMA 1TQMA 4NF5B 4ASNA 4X48A 1B7ZA 2DAOA 4DBRA 4ESFA 1P1UA 3DV8A 1FPFA 1LLSA 2GA2A 3TFLA 4L5EA 4GWWA 1X4OA 4B3AA 4RAFA 2RC8A 5D6FA 2QJEA 4OIOF 4QFOA 3EPZA 2BBYA 5KVRA 3T1BA 2LDUA 4JVIA 4LLLA 5J8FA 1B8IB 1TNSA 2L2OA 3J81Z 1X58A 1NV2A 4O94A 1UHMA 5HNFA 3PFYA 3EF7A 4YFXF 1GVCA 2X1CA 3L00A 3TTKA 1B6AA 1KZHA 3HOZJ 2IGKA 1XMAA 1SAUA 4H4KC 5J40A 5K5OA 3TTLA 5CC2A 2DA2A 2RKHA 3V8LA 4PFYA 1LVAA 2IGOA 2H6CA 3P9CA 5ICCA 4CICA 5J6XA 3PIOF 3JRBA 4IZZA 2F7BA 2ZNTA 4IO5A 4MF3A 5CM6A 4PF8A 5F6FA 4XIDA 3CSBA 4P1LA 1IDZA 4QFKA 4FQGA 1RDYA 4Q8RA 5J1DA 4P1WA 4G8MA 1JXSA 1QVSA 2ME0A 1IRFA 2ZBKA 1BKAA 2DP8A 1ELJA 2WYKA 4O3BA 4OHNA 5L9SA 3S16J 2FHYA 1DPPA 3WU1B 4PSWA 5H6QA 5IZ3B 4PJNA 2ZMEB 3CC2I 3W2AA 1FPLA 5FKOA 2XB5A 3TW7A 4DQ2A 4IX7A 2M0MA 2PMSA 1S7EA 3IJOB 3MW0A 1FTZA 5LGTA 5ILUA 1XSDA 2I10A 4XLNF 1EH6A 3U1KA 3IV5A 2B4LA 2IT0A 5E3LA 2DT7B 3OOPA 3K2ZA 3KJ7A 1NNFA 3C4MA 3KIOA 3BG3A 3HG9A 2QVOA 2DA1A 4OWDA 1MBEA 2L01A 2ZMEA 5ILSA 2BV6A 1YXIA 3F0CA 1BIYA 4JSDA 4CYDA 2IRFG 4AB5A 4IHVA 3T0YA 1OYIA 3GFIA 3HPHA 3GTGJ 2UWMA 4B1RA 1YW8A 4Y33A 3W6VA 2B3BA 5DEXA 2Q2EB 5K2XA 4BE0A 4PQJA 3VB2A 4BDMA 3IOTA 1MJ9A 2QA4I 3ZXSA 4UXNA 5CVRA 4MLOA 4RDUA 2HDCA 3S9EA 1Y56A 3DTKA 1JI8A 4BHPA 3DLNA 1EYIA 2IVMA 2E71A 5BNGA 2WKYA 4WEPA 4EXKA 4C3HJ 5B1AH 1JUMA 1A8EA 2XXQA 2HPMA 4H1XA 4YKIA 1R7JA 2OC6A 4LITA 4XN3A 5FRNA 2XDVA 1B05A 3MBPA 3VVEA 2F5EA 4OESA 2YSRA 3G1OA 4OANA 3GMEA 2HHMA 2E34A 2MG4A 3S17J 3QYFA 1IXHA 3TQLA 3EUKL 1QZYA 4I62A 3E5QA 2L9NA 1FYLA 3J7AY 1LAHE 4B4CA 4O7MA 2QS3A 5HBCA 3COAC 3V8JA 1IG7A 3GLXA 4E7JA 2XD3A 3PUYE 1V3FA 2F36A 2HEUA 3RTWB 2P8TA 5GPCA 3O6HA 2M5WA 2NS0A 1N7XA 3TP3A 1IN8A 3DKYA 2RNJA 4RPNA 3SEZA 2XIGA 3FX3A 2IA0A 5FLVA 5ISUA 2JT1A 5HDNA 1KA1A 1YZ0A 5CLSA 3SHFA 1T0KA 4GX4A 3RY3A 3HV1A 1TFAA 1U8RA 3HJEA 1MXXA 1D9YA 4RB2C 3LQQA 2E19A 4ZYEA 2W1OA 5D5WB 1FZPB 3ZMSA 1AMFA 2J5PA 4FORA 3TBIA 3QRFF 1SDXA 1IV8A 3I58A 3A09A 3MC2A 3BR1A 3THIA 3I5UA 1KYWA 3WTYC 2HDDA 2V84A 3HPIA 3LA3A 2Y9YA 2K86A 3O29A 1Z6TA 5D5VB 2R5ZA 1Z67A 2RV8A 4P9UA 1ZK8A 4FJPA 5BMZA 4XKWA 1QHGA 4RPOA 3SEWA 3DLAA 1DOTA 2XVCA 3CCUI 4PJJA 1XB4A 3G3FA 4HX4A 2JWTA 3IB1A 4LQ5A 4BBRJ 2NS8A 4YZZA 2G0EA 3VLUA 4RK9A 2FA5A 4G77A 3G3HA 2AHQA 1JEUA 2O6AA 4RYAA 1YRNA 3JZJA 1B0LA 4MIMA 3TW6A 5K7FA 3I53A 3DP6A 4ZZAA 3TMOA 3RQIA 3IR1A 2B9SA 3SEYA 2VC1A 5DDGA 3IFCA 2YU9J 4GWXA 3UR3C 3G3GA 1NV1A 4NF4A 4F1VA 2CV2A 2HU9A 3CO6C 2D5WA 2F7AA 4LVQA 2ETHA 3LFUA 1I6BA 4A3MJ 1IITA 3SEXA 3O66A 4U21A 3O6BB 1IDYA 2W00A 3B02A 5A5LA 2Z1DA 2MA3A 3O6IA 4EM2A 1DP3A 4Q5TA 1R6ZA 3FM5A 4BDLA 2DXIA 1B40A 1Q9DA 9ANTA 1MNMC 3TCGA 3F21A 5TJJA 1FBCA 1ZGJA 2GAUA 3H9QA 1EZOA 4IHSA 2I48A 4PP0A 2V9KA 2FXAA 4H67A 4MJOA 4OMYA 4G8XA 3GTPJ 2QVUA 3FXBA 5IOZA 1DUXC 4XKPA 2CMPA 3WAFA 2X26A 2BVLA 4DI4B 1X1AA 1Z21A 3DPLC 3FMQA 2B63J 3PUZE 2M4KA 1LBZA 4N91A 4PBHA 2V7FA 1O64A 1ZLJA 2HXRA 2OBPA 5DV5A 5LLQA 5FLXK 3FVGA 4YIIA 3FXJA 4DZ1A 3H0DA 1W7PA 1XGMA 1VZ0A 2IGNA 2XXKA 3MJNA 1X19A 1VFEA 4OA4A 2KRFA 2UUZA 1XCBA 3HKZN 3PUVE 3J7ZI 4PBQA 5AA1A 2DTZA 2VKDA 4PF6A 2OPTA 2XX9A 3R6SA 2CQXA 4BLAA 1GDTA 1A5JA 1O3TA 2FD5A 2GXGA 4XQFA 3GLLA 1MPCA 3MZ9A 4DYQA 3CDHA 2A5TB 2R7VA 4OZ9A 4M9ZA 1G3TA 1USSA 1XDSA 3NQOA 2P3NA 3KBZA 4ZZEA 1B58A 4RNSA 3V8XB 4F55A 1TWHJ 5B7DA 3WTVC 2X6OA 3ROUA 2UVIA 2K9SA 2XAGA 1A55A 2K9QA 2DMPA 3WHCA 2M8CA 3A2KA 2ECBA 2DFFA 3R0AA 1U9OA 3F9KA 1W0UA 1LSTA 2KZVA 1PB7A 1R9QA 1S7AA 3U1OA 1EJ9A 1NFTA 4XM3A 3QP5A 2CRGA 2XSDC 3ONMA 2XAFA 2F5VA 3CMEI 3HEFA 4KD5A 5D8KB 3QU6A 4FHTA 4RB0A 3ZMZA 3CJTB 4F93B 4GX6A 1LEBA 3VOEA 4O8MA 3GTKJ 1SD5A 1YG2A 2VOOA 1IIWA 4NC6A 5FO5A 4BXXJ 4V2GA 1NV4A 4U0VA 3H06B 3JREA 3HDDA 3G2BA 3U72A 4XRFA 3L6GA 5I5PA 1HDPA 5KAIC 4HQMA 3LSXA 3MVYA 4C3JJ 1O3SA 2OTJI 2O8XA 2ZFUA 1A6IA 2DBBA 1DK4A 3ZQHA 2UYFA 2EWNA 5LGUA 3PPRA 1DP7P 4ZEBA 3PV0E 2CZKA 3LWFA 4N9IA 1R9TJ 2XUBA 2WTEA 4ZE8A 3K01A 5ITOA 2COMA 4BQAA 3RDIA 1YE9A 3F8FA 4LB6B 4EDPA 5AA4B 1A54A 3N94A 3TQWA 1B9MA 1QPMA 1US5A 5KCMA 3WTWC 4NDLA 2M9HA 1M5CA 2F5CA 2NRAC 4FCYA 4IO2A 1VE4A 4U4XA 3K4KA 5DUIA 4ZEFA 4XN0A 4KYDA 2FQ4A 3GBGA 3I71A 3SDGA 2CUEA 1ERDA 2QM3A 4WX9A 4CCLA 1FP1D 1D8JA 2XWIA 3FJ7A 4KUMA 1WGXA 3FHZA 1UCRA 4OVJA 2EA4A 1IAWA 2E5NA 1OKRA 5I56B 1ETKA 2KKOA 1S72I 2H5YA 1FNNA 1I69A 3RQTA 4B44A 3CO7C 1BIBA 1QPIA 3TCHA 1B2HA 2PFBA 5DEQA 3VYRB 2DMQA 1ZARA 3OD7A 4J01A 2IA2A 2ZO4A 5AA4A 2V25A 1TQIA 3F11A 4WXHA 2HZLA 1NG7A 4UHTA 2BXZA 5LHIA 4GFBA 1MQIA 5IAIA 3TKYA 1LB8A 1ZREA 2GHBA 3U92A 4HV5A 3A3CA 2VHAA 3H0GJ 2V79A 3R60A 3UNGC 1JJ6C 3QQAA 3FVOA 4UUSA 4GVOA 4DIGA 1RETA 2G7HA 4IEJA 3TO7A 3OS0A 3B6TA 2QYOA 1DGWY 2TCTA 4JX5A 4ELRA 2LR8A 4QFPA 4KICA 3P7IA 2WAQN 1RZ4A 5EYFA 3CCVI 4G7ZF 1W5SA 2LKXA 1TNTA 2QQBA 4A3FJ 5LOMA 3RSNA 1FIPA 3DTEA 3FM3A 4I0BA 4N15A 4PTKA 4IOCF 2VE9A 3TL4X 2GHAA 1IC8A 1LDJA 2DYXA 3RQ4A 1UIUA 1ETQA 3NAUA 4I8CA 1S50A 2L02A 2I4BA 3PMXA 2X4HA 2XAJA 2ZMEC 4EQQA 4NWCA 3OSRA 5LTCA 4IKFA 4MTEA 3FF5A 4U87A 3E3VA 4MEXF 2L0KA 4N0BA 4DGWB 3BJOA 1IQ7A 3W9VA 1F1ZA 1J09A 3CCYA 4ZH4F 3S9MC 5H8SA 3Q0WA 3FXOA 2A6TA 2F6GA 5M3MJ 3A01B 2WAEA 4L9JA 4LLGF 2O68A 5GAHJ 3R4KA 4OEVA 2DN0A 1FSHA 4ZTFA 2ZB9A 1YO5C 2EILH 3D1RA 4YMAA 2F78A 3S2VA 5ET5A 4HPQA 4EQ9A 4L9NA 3K10A 4IPAA 4F19A 3FVNA 1SC7A 2CH0A 3SJMA 2X9DA 2Z8DA 4HF1A 4JSOA 3BTLA 2GXAA 2R0QC 3N4MA 1MJBA 1MPDA 3KJTA 3SKPA 1MBGA 4O3AA 1FJLA 4RGXA 3HOXJ 3MSTA 4PE3A 5FD6A 3T9VA 4F31B 1U5TB 1RDZA 3GX4X 1B0HA 4IR8A 3S1QJ 1OCCH 2W7YA 4YB7A 3LSJA 3LOCA 2AS5F 1KONA 1YX3A 1VQ8I 4PFTA 3RT8A 1XC1A 1D9QA 3BFTA 3TDZC 3TEDA 2UV1A 4RB3C 4HW0A 4XKQA 1EZPA 1MXUA 1Y9UA 2CG4A 1UMQA 1PDNC 2GXBA 4AD9A 3QIMA 4ZDPA 1NV0A 4I1DA 4L17A 2LP0A 2D1HA 4RGUA 4XLPF 1OR7A 3PPNA 4RM3A 3V42A 3CMYA 1FQBA 2PMUA 1B51A 3GZ5A 1JGSA 2EZHA 2LBFA 3DBLB 1O7FA 3AKZA 1AKHA 3KFWX 3GBAA 5AIQA 3T22A 3VSKA 3CDIA 1RRJA 3OYJA 4XFEA 1TWCJ 2VODA 1MRPA 2QPQA 2RF1A 2IS6A 3LFKA 3TDUC 4ENNA 1IRZA 1TWAJ 5LBQA 5E1WA 5HLIA 3BLYA 4GL0A 1LKXA 3RKWA 3S1RJ 3MD2A 4HCWA 1D8KA 4HQEA 4JQFA 1IMEA 3V4GA 2MD0A 4HYEA 1HKQA 1R5HA 5HODA 1R1TA 2GQQA 1NK3P 4MFIA 5AA2D 1MSFC 1EYJA 1NUYA 3DM0A 3ONQA 2GZWA 3HC7A 1Z7ME 5H8QB 3KCCA 1VQ6I 3ABMH 1WPKA 2VIXA 3ILUB 3JV9A 4PGPA 3C32A 4XLEA 1K61A 2GM4A 2O0YA 3I3VA 2Z33A 4CCMA 5KHDA 1A35A 4CO8A 5IOYA 4JWYA 4XEQA 1OCPA 3CUQA 2VPNA 1EZ9A 1YQAA 5IT9Z 5LRSA 3I54A 3DU6A 1ZLQA 1UTBA 4EMSA 1UIVA 4B48A 3D0SA 4BXFA 4QF9A 3C2HA 1MM6A 2F2EA 2XXHA 4P11A 2OCCH 4P9FA 2Q89A 2DFHA 4MLQA 2EFOA 4GX3A 3OO6A 3TUSA 1HQCA 3ZSFA 3Q0UA 4EJOA 3H6VA 3IB0A 5H8QA 2QBYB 2ZYNA 3I5OA 3CC7I 1FMWA 2CS3A 2ESNA 3BTCA 3MAJA 1GXPA 2WB1A 2ELJA 4NHJA 1UQWA 3HB9A 4UV9A 3ZOBA 2HR3A 3RTFB 4BY7J 3VFZA 1F5TA 5HLHA 2V3TA 1BK4A 2Y7IA 1MNEA 4BBSJ 4MH5A 1NL5A 3C35A 4AIKA 4MQ9F 5TPAA 4A5NA 1ON2A 1QHHD 1O7LA 1OIBA 3S2DJ 1T8IA 2NYXA 1YJNI 2QWWA 1LDDA 2GIVA 3LSHA 1LAFE 1XHYA 4EQBA 5TGTA 4Q0CA 5HM4B 1F43A 4G4PA 2QLZA 4N4OB 1MDQA 3H5NA 5HLGA 3OYAA 4RBOA 3O28A<