4ZEFA

Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
239
structure length
239
Chain Sequence
ENLYFQGMKKITPKKEKYVIASDSTFAPFEFQNAQGDYVGIDVDLVKRAAELQGFTVEFKFIGFSSAVQAVESGQADGMVAGMTITDDRKKAFDFSVPYFDSGIQIAVKKGNDKIKSYDDLKGKKVGVKIGTESADFLEKNKKKYDYSIKYLDTTDALYSALEIGEVDAMMDDYPVIGYGVAQNQPLATPIPREKGGSYGFAVKKGQNPELLEMFNEGLKEMKRTGEYDKIIGTYVKDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of substrate binding domain 2 (SBD2) OF ABC transporter GLNPQ from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Transport protein
molecule keywords Amino acid ABC transporter amino acid-binding/permease
total genus 84
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4zefA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4zefA02
1SVXB 2VGQA 4XXUA 4IGTA 3M8UA 3FV2A 1LCFA 3OXNA 2V3UA 1FTKA 3OMBA 4GOTA 4E0XA 5AA4B 1FTMA 2QS4A 2XXUA 2P2AA 4G77A 4DXBA 3OENA 4TOZA 1Y20A 4GD5A 4OFOA 3TTMA 1SW5A 1O63A 1MPBA 2XXRA 4POWA 4F19A 4XTCQ 4F18A 3PMVA 4N13A 1RYOA 1B32A 3S9EA 5ICTA 3M3FA 2HFBA 3UA8A 3PUWE 1B3LA 3LSWA 4KCCA 3SEYA 5K2XA 3FD3A 3SEWA 3GXAA 3MVYA 4X48A 4PFWA 4PQJA 5DVJA 5I58B 1P1NA 1DMBA 4DE8A 4EXLA 1ANFA 3TEPA 1NKXA 4O3AA 2QRYA 4YKKA 2HAUA 4GXAA 3EHUA 3IK6B 3Q26A 4WEDA 4DXCA 3MVXA 4M1VA 3VV5A 3ECRA 5TP9A 1MXZA 1BLFA 3DLNA 3M3LA 4QSCA 3RLFE 2DQVA 3TDJA 1AL3A 1LLSA 5H8QA 1NNPA 3HO7A 4YICA 1ZKBA 1F9BA 4Z7EA 1IXIA 1B5IA 3IOVA 2ZNUA 2DE3A 4QFNA 4X1DA 5DYHA 2X7QA 3PUZE 4M4GA 3W9VA 3T9XB 4MF3A 4ZEDA 4UA8A 1SD3A 5DVIA 1B3HA 1MY2A 3HPIA 4G68C 1N84A 4MFIA 1XC1A 1A8FA 2B3BA 1N7XA 1ZMGA 3PD9A 3MJNA 4ZZAA 4OZ9A 1LBCA 4YKIA 3QIMA 3T93B 1H44A 3K6WA 4RYAA 1SI0A 2DWJA 3TMGA 3KJ7A 1EZPA 1PDAA 4OHNA 4OEUA 3VVEA 1NNFA 2GH9A 4FE8A 4EQ7A 1M5DA 5JK4A 4HTGA 5HPQA 3GZGA 1JW4A 3OEKA 4NTLA 3A3UA 4NF6A 5HBCA 3IORA 2UVGA 3VFJA 1LAXA 4FEDA 2DXYA 3L6GA 4YKJA 1SYIA 2D3IA 3IOWA 1PB7A 2DOJA 3MVWA 4H5FA 1IZ1A 4LZ7A 4DCXA 3Q25A 5I59A 4LZ5A 3RQTA 1XS5A 1LFGA 2XD2A 2ZYNA 3C34A 3IB1A 3PUXE 3S4UA 3HN0A 3I6VA 4ZS9A 3WAEA 1SBPA 4HCYA 3RT6B 1B5HA 3PPNA 4I1DA 2O69A 1B58A 1QJMA 3ODBA 1QUIA 2H5YA 3G7WA 1N3WA 3KBRA 4H67A 1Y1ZA 4WXJA 5JTYB 3D4GA 2Z23A 5TP9B 3GBAA 5I2NB 5I57A 4IY5A 4ECFA 4OWDA 5FTIA 3ZKKA 4F3GA 5I56A 2X26A 1B9JA 5I84A 5H8SA 1B52A 1Y4TA 2GHAA 3DP6A 3IB2A 2I6EA 1MPCA 4NWCA 3MC2A 1P1QA 1ATGA 2VD3A 3FXUA 3Q29A 4RK9A 3TCFA 4G8HA 3TTKA 2Q88A 3OSRA 2KLFA 4ESXA 3K1NA 3T96B 3FATA 2F78A 4OETA 5CMCA 3S2VA 4F39A 1PBPA 2ALUA 2NXOA 1T0KA 4OYVA 5IKBA 3U72A 1B46A 2A5TA 5AA3A 5I57B 3S9NC 4ZDMA 1MPDA 4FIMA 4O3BA 2DP8A 5AA2A 4F3SA 2HCAA 1FTJA 1BP5A 1URGA 1ZBMA 3USDA 3IL1B 4EQ9A 1YTVA 1H76A 4JSOA 4U4XA 5AA4A 3O6HA 2XXXA 4K3FA 2CMOA 1NH8A 1VFDA 4DLDA 1I6BA 1XHYA 2QPQA 4H65A 5KZTA 4KYDA 2GRVA 4KR5A 2XD3A 1TWYA 4KYEA 2VOZA 4EF2A 1N04A 3B6WA 3QAXA 1USYH 4BDRA 2V3QA 1XOCA 3A09A 1XVYA 2E0SA 4NF6B 1ZIUA 3K1PA 4F22A 1B7ZA 2OWTA 5CMMA 1B51A 3E9XA 4WEPA 3UN6A 1D9VA 1B7UA 4MLVA 5FHNA 4IY6A 4OTEA 1B0LA 2HZLA 3A3CA 4R6YA 4MH5A 4R72A 1LB9A 5CM6A 2RINA 4QHQA 3U92A 1B2HA 1SW1A 2Z8FA 4H0WA 3CI8A 3PUYE 3DP4A 3GLBA 1Y3QA 3UORA 4P11A 2V25A 2IEEA 4XKNA 2B65A 1QULA 2O84X 4JB7A 5M2VA 1QW0A 1LAFE 2ZXTA 3MWBA 4ELRA 2A5TB 4YMAA 4OXVA 1IXGA 2QJEA 4C1UA 5DT6A 4IB2A 3OEMA 4N07A 4NF4A 4AB6A 4Q5TA 3MP6A 1ZU0A 2B3FA 3ILTB 1FCKA 1PBQA 1S9TA 1QKAA 2RC7A 2RC9A 4GRKA 2RCBA 4FATA 3KG2A 5I2KA 3TUSA 1H3DA 2ZNSA 4KHZE 2M8CA 4LATA 3K02A 3KOTA 3R26A 4GLIA 2DVZA 5I56B 1BTJA 1POY1 4QFKA 3SKPA 1J1NA 3EHTA 3U93A 1FQEA 3IOUA 1JW1A 4R73A 1URSA 1VSOA 3SESA 4H1XA 2BJJX 1NNTA 2VHAA 1UIUA 2ONRA 4IO3A 1MQHA 1MQDA 1OQHA 4BDQA 3CIJA 4RK2A 3KEIA 2ABHA 4KPTA 1BIYA 1NMUA 5ITOA 3IOTA 4YZZA 4RJZA 1JVXA 3SEUA 4OEVA 3VXCA 4OESA 2H98A 1LAHE 3TTNA 3TELA 3EN3A 3SEXA 3UGWA 2DXRA 4G8MA 4IO5A 5TPAA 4Q0CA 2HEUA 3BFTA 3OO6A 1KWHA 3W15C 1O7TA 3RPWA 2ANJA 4ELPA 3IAZA 4GVOA 3PPPA 3OO7A 4FECA 5IAIA 3GBBA 4F2OA 5DTBA 2O68A 2OCUA 4LUBA 2O7UA 4MLQA 2XXWA 1IIWA 2XXHA 2UVJA 3IJOB 1OVBA 4PETA 2UVHA 4F3PA 2R71A 3QK6A 3EF7A 3P7IA 2PBWA 2D21A 4GL8A 1B3FA 1MDQA 1B4HA 1JNFA 1OMPA 2R6GE 2REGA 1RKMA 2GFEA 2V3TA 3O2AA 4HS7A 4ELQA 4EXKA 4ZE9A 2UXAA 1A99A 3LSFB 3MZ9A 3FASA 4X1BA 3O29A 2QMXA 3N6UA 4R74A 1GVCA 3SERA 1PB8A 3K0VA 3KGCA 4DDDA 1USYE 4THIA 3LSLA 3DP8A 4QRZA 4BDOA 1ZJLA 3HCQA 4U4SA 3FJ7A 3CFLA 1TFAA 4JXIA 3N6TA 1VR5A 2DE2A 3M3KA 2Y7RA 4DCYA 4H5GA 1A54A 4YB5A 1A8EA 4Q30B 1LCTA 4EDPA 3PU5A 5DVFA 3EQ1A 5TPAB 5AA2D 2XXVA 3OELA 4UACA 5CBSA 1JVYA 1M5BA 3EPEA 2XXQA 3CSBA 3LSXA 3PPQA 4R75A 3T9HB 3FUZA 1Y1MA 2Q8JA 3O97A 1GGGA 4KQPA 3QUFA 3FZVA 4IO7A 4ONYA 3BBRA 3PUVE 2XXPA 3H6WA 2OJTA 2ESNA 1SQYA 4P0GA 5CI5A 1AIVA 3RTFB 3IJXB 3KSXA 1SW4A 2F8DA 3C9HA 1P99A 3AXFA 4NF5B 5H8NB 1MS7A 1MM7A 2P1SA 5FTHA 1L5TA 4QFOA 4C1TA 3VLVA 4ISUA 3IB0A 3MW0A 2UYEA 3KSJA 4U21A 3TQLA 1GR2A 4QSEA 3U1OA 2HZKA 3K6XA 1H43A 1OVTA 4H8JA 2F35A 1IXCA 3W9WA 1IITA 1ZTYA 4ZEFA 1LFHA 2DWIA 3SEVA 1YCJA 2PT2A 4JWYA 4ND9A 4KYSA 3RGYA 2QS1A 4R2BA 2O1LA 2Y7WA 1FQCA 4MBPA 2DWHA 3B7DA 3SETA 3TCGA 1QUKA 4JWXA 3ILUB 4IO4A 5B70A 1HSEA 2Q2AA 5H8HA 1Y9UA 5L9MA 1B3EA 5JEIA 5J1DA 2OK2A 2I3WA 3PV0E 4U1ZA 1WDNA 3I3VA 3FJGA 1I6QA 2O1MA 4GXSB 3RN8A 4QF9A 4BDLA 3O28A 4KCDA 1DPPA 5FHOA 3PPRA 1DTZA 1YPNA 2QS2A 3RNNA 2W7YA 1AH5A 4G68A 4PFUA 4R6HA 1MY3A 1QVSA 4TLMB 1PC3A 4PE5B 4OENA 4G8NA 4P0IA 1M5EA 3KOSA 1SYHA 2I4BA 5AA2B 4LQ2A 2OLBA 1MXWA 2XXYA 3V5AA 5F1QA 3MQ9A 4YU0A 1A40A 3TPAA 3LBSA 3PMXA 3PD8A 3G3FA 3K6UA 4BLAA 3ONMA 2XX8A 2P0SA 3L6HA 2F34A 4LZ8A 1R1NA 3TFLA 4F1VA 2CZLA 4U1OA 5I2NA 5JTYA 2GHBA 3VLWA 3FGSA 2FNCA 1SW2A 2AYSA 5I2KB 2RCAA 2PVUA 4Z0IA 1VE4A 1MG1A 3H7MA 2I3VA 4XKPA 3QSLA 3VLUA 1MH3A 2NUVA 3K00A 4NF4B 2ZYOA 3LUYA 4U2RA 2Y7KA 2G29A 1EH3A 3E3KA 4JBZA 4XIGQ 3K2DA 1WVJA 3KZGA 5H8HB 1AOVA 3V83A 1B1XA 3Q27A 4LA9A 4U22A 4BDMA 4ZZEA 1CB6A 3O66A 3G3IA 1A55A 5CRYA 4GFRA 1O64A 1DOTA 5EHSA 5H8QB 1LBBA 2H99A 1B40A 3G3HA 5ELVA 1VFEA 2XX7A 1D9YA 4RY1A 1H45A 3MAMA 3O9PA 2AL5A 2FYIA 3MPLA 4C0RA 4PFYA 1I6AA 2DYXA 2OZZA 2V84A 3CG3A 3S9LC 2E1SA 3N26A 1NNKA 2RC8A 3VDFA 1JW5A 1HSLA 2V93A 3PPOA 3TZAA 5H8FA 3V8XB 1P1UA 4LONB 2HQ0A 1CE2A 1B1HA 1NH7A 2Y7PA 3JYRA 3H3GA 4F29A 3MBPA 3TCHA 3K6VA 4FEBA 1TFDA 4AQ4A 3IX1A 4F2QA 2H9BA 3TTLA 2REJA 2Z22A 4I8CA 2YPNA 3OO9A 1MQJA 3T9VA 1R9LA 4G68B 4RA1A 3K01A 2PX1A 5B7DA 1Q35A 2WKYA 3H06B 3H03A 2H4IA 5K2YA 5ITPA 4POXA 3E13X 3MZBA 3R6UA 1MH4A 3F11A 3C35A 3MUQA 4KI0E 2ONSA 1MY4A 2XXTA 1R6ZA 2Y84A 5L8DA 2PYYA 2NOOA 4TLLB 4X9TA 5EHMA 4NF8A 4F1YA 3U8QA 2Q89A 3FXQA 2QMWA 1QUJA 1BKAA 1EZ9A 1AMFA 2YJPA 3H6UA 4U23A 3C4MA 2I4CA 3RT8A 3RY3A 3VVFA 4LVQA 4PP0A 4OQOA 1Z7NE 4DXUA 3Q28A 2VP1A 1TT1A 4QSDA 1DSNA 2QL3A 5ISUA 3VE1B 1US5A 3G3KA 2UYFA 2H25A 5A5XA 3ZS6A 5DEXB 5A5XB 2LAOA 5I58A 4NMYA 1P1WA 3B6TA 3JV9A 4GQOA 2DVCA 4HCWA 4FAJA 1N0TA 4ZEKA 5H8FB 2AL4A 1ZLQA 1B3GA 4RPNA 1OQGA 3C31A 3U94A 2PT1A 1I69A 2D5WA 1FQBA 1DPEA 3JZJA 3CRBA 1MDP1 3SDFA 1N76A 4FORA 3FVOA 2F6GA 4NF5A 4QFLA 5H8NA 3TYHA 4F31B 4OMBA 1A7LA 2ZNTA 2Y7IA 5EYFA 3T66A 1D3KA 4F1UA 2RKMA 4N6PA 3FVKA 3C33A 1OIBA 1UQWA 3RTWB 3OOAA 1FW0A 3S9MC 3VXBA 3KJTA 3T9UA 5BUUA 1LGBC 1SDXA 3K4UA 3OO8A 1B5JA 1HSJA 2THIA 2UVIA 3C36A 4OFJA 1UTBB 2NWJA 4O3CA 3FVNA 2F7BA 2F36A 1JEVA 3QUJA 4NF8B 5CMBA 4Q8RA 2OBGA 1QKBA 3G3JA 1D4NA 4L17A 3K1MA 2XX9A 3FIRA 5KDTB 1PB9A 1UIVA 1XT8A 1YAEA 2F7AA 4EF1A 1FQFA 3HHGA 3H6TA 4EQBA 5L9SA 2YLNA 3KN7A 1JEUA 5KCJB 3MZ1A 2F5XA 3RUMA 5HM4B 4H6DA 2NVUB 2PMSA 2Z8EA 1Y3NA 4XKRA 4RPOA 1MM6A 4BDNA 1JETA 1FTOA 3MVZA 2I0BA 4YB6A 1Q1KA 3KN8A 1MQGA 3FXRA 1FQDA 2G93A 1NFTA 2O6AA 3CVGA 3IR1A 4IGRA 4JDFA 1MXYA 3TKDA 2DSFA 1UTBA 4R2FA 1N7WA 5AA1A 1EU8A 4XKQA 3OSQA 4H8IA 4ZEIA 1LFIA 5L9OA 1MXUA 3UK4A 1FTLA 1OLCA 2O7IA 2Q2CA 2HXWA 3CSGA 4ELOA 2I48A 3TQWA 4G4PA 3IO4A 1LAGE 3C32A 1M5FA 4GL0A 2ONKE 1B7HA 3WAFA 3CFZA 3BKIB 4OVJA 2A5SA 3MPKA 1NL5A 3N94A 1DTGA 4AB5A 1MY1A 1Z7ME 3HHFA 5CC2A 2F6PA 1Y4CA 1PEBA 4HW8A 3EHSA 3I5OA 5LOMA 1GTKA 3QYTA 4NEDA 3R7XA 3TTRA 4LP2B 5AE4A 2OWSA 3KN3A 2AIXA 3IO6A 1IUDA 4E0WA 3OD7A 3FVGA 4OERA 1B0HA 1R9QA 2F7CA 4GWOA 4YB7A 3VVDA 3ZKLA 3O6GA 3BFUA 1MXVA 3KFMA 3CR9A 5DEXA 1TXFA 4I9DA 2VD2A 2ZYMA 1LSTA 4JWOA 2O51A 2DWAA 5TU0A 1M5CA 3DM0A 4IO2A 5CMKA 1EZOA 1B6HA 1MQIA 3LC8A 1IXHA 4DIGA 3T22A 4R9FA 1B05A 1US4A 3CG1A 2XHDA 3MP1A 2DS9A 3H6VA 2IA4A 2I0CA 3CFXA 4PFTA 4EUOA 4R9GA 2DE4A 4ESWA 3DELB 3THIA 1S7YA 1LB8A 3QXMA 2XXIA 3TAJA 1URDA 4GIZA 1IEJA 4YAHX 3D4CA 2F97A 3V89B 1MXXA 5I59B 5CBRA 1UTHA 1ELJA 2QS3A 3G3GA 1OLAA 2ZYKA 4R6KA 5ICQA 3UIFA 1POTA 1S50A 3MP8A 4OFLA 4I62A 4ZECA 4IO6A 1MY0A 4YKPA 5F7VA 3TODA 5BWJA 1XVXA 4GF8A 3N5LA 5FHMA 1II5A 4QFPA 4JSDA 1IQ7A 2HAVA 2I49A 2R9JA 3HV1A 4WKMA 2Q9TA 4ZEBA 3B6QA 3O6IA 3HSTA 3PGFA 4F3BA 3E4RA 4ZE8A 3FV1A 4G2ZA 4RNSA 3ZSFA 4KD5A 1N3XA 4NE4A 1SI1A 2I58A 2ZMBA 4DZ1A 3PMWA 4LQ5A 1GV8A 4TQUQ 2X7PA 3LR1A 5KDTA 1B4ZA 3FJMA 1RYXA 1FQAA 2Z8DA 4YMBA 2QSXA 4KFQA 2FA7A 4NWDA 3UP9A 4RXLA 1JQFA 1MRPA 2RF1A 4FJPA 5KCJA 1P1OA 1WODA 3H4ZA 1UTHB 1Y3PA
chains in the Genus database with same CATH superfamily
1SVXB 4XXUA 4MNIA 3OMBA 5AA4B 2QS4A 1Y20A 3FXBA 1NV4A 4N13A 1B32A 3M3FA 3UA8A 1B3LA 2P3VA 3GXAA 2DDKA 3MVYA 5I58B 1NKXA 4YKKA 3EHUA 3Q26A 1FBCA 5FBPA 4DXCA 2WBBA 3DLNA 4QSCA 5H8QA 4GX6A 1B5IA 2HXRA 3PUZE 4UA8A 5DW8A 1N84A 2B4LA 1A8FA 5EYHA 4YKIA 3T93B 3KJ7A 4EQ7A 4OHNA 4H45A 3D1RA 1JW4A 3OEKA 4NTLA 4XF5A 2D3IA 3C34A 2ZYNA 3HN0A 3I6VA 3WAEA 4HCYA 4MNCA 1FPFA 1B58A 1QUIA 4WXJA 1Y1ZA 2VPNA 4ECFA 4F3GA 2X26A 1B9JA 1Y4TA 2I6EA 4NWCA 1P1QA 1EYIA 3K1NA 3U65A 5CMCA 4OETA 2NXOA 1IMDA 1B46A 4PFIA 3USDA 3IL1B 5AA4A 2XXXA 2CMOA 1VFDA 2GRVA 2VOZA 4EF2A 1IMBA 4BDRA 3K1PA 5CMMA 4NGUA 1D9VA 4MLVA 4OTEA 1B0LA 4R6YA 4MH5A 4OVTA 5EYGA 3DP4A 1Y3QA 2L5VA 1BK4A 2IEEA 4XKNA 2ZXTA 4OXVA 5DT6A 4IB2A 3MP6A 2RC7A 3LV0A 5I2KA 4P1EA 5ET6A 3KOTA 3EKIA 2DVZA 4QFKA 4G61A 3EHTA 3IOUA 1UIUA 1MQHA 1OQHA 4KPTA 1JVXA 4OEVA 3VXCA 1KZ8A 4G8MA 4N17A 3BFTA 3W15C 3OO7A 3GBBA 4F2OA 2O68A 4LUBA 2O7UA 4PETA 2R71A 4H46A 4GL8A 1MDQA 1OMPA 2GFEA 4HS7A 4EXKA 2PFZA 3N6UA 3K0VA 4NG7A 4DDDA 4THIA 4BDOA 1LBZA 2P3NA 4U4SA 3CFLA 4JXIA 3CHGA 1IMCA 5TPAB 4JVIA 5AA2D 2XXVA 3OELA 2FHYA 4GWZA 3EPEA 2XXQA 4MMPA 3PPQA 1Y1MA 3O97A 4O8MA 3BBRA 3SZPA 2ESNA 3T1BA 3C9HA 2F8DA 4ISUA 4U21A 3MW0A 2UYEA 3W9WA 1YZ0A 1YCJA 4ND9A 4R2BA 2O1LA 3B7DA 3ROJA 3ILUB 4IO4A 1HSEA 5H8HA 5J1DA 2OK2A 2I3WA 3PV0E 4GBVA 3FJGA 4GXSB 1NV5A 4BDLA 1DPPA 5FHOA 3RNNA 2F3DA 2W7YA 1AH5A 4FBPA 4TLMB 4OENA 1LBVA 2BJIA 1M5EA 2OLBA 1MXWA 4PAIA 4YU0A 3TPAA 3PMXA 3G3FA 3L6HA 4LZ8A 4U1OA 4GWUA 1SW2A 5I2KB 2PVUA 2ZYOA 2Y7KA 3KZGA 1B1XA 3Q27A 1A55A 1O64A 5H8QB 5ELVA 5IZ3B 3E78A 1I6AA 2DYXA 3S9LC 2QFLA 1NNKA 3PPOA 1P1UA 4LONB 4F2QA 2H9BA 2Z22A 4LN5A 4G68B 3K01A 5B7DA 3H06B 1MH4A 3MUQA 2ONSA 1MY4A 2PYYA 4TLLB 4NF8A 3U8QA 3FXQA 3C4MA 3IFCA 3RY3A 3VVFA 4PP0A 1TT1A 3VE1B 5A5XB 5A5XA 5DEXB 4MCOA 5I58A 1P1WA 4HCWA 4GQOA 2DVCA 5H8FB 3C31A 3U94A 2PT1A 1I69A 2D5WA 1FQBA 1N76A 4NF5A 4QFLA 2ZNTA 2Y7IA 2RKMA 1FPIA 2THIA 1UTBB 4Q8RA 2OBGA 1QKBA 4EQBA 3KN7A 3MZ1A 3BIHA 4H6DA 2NVUB 1Y3NA 4XKRA 4RPOA 1MM6A 3MVZA 1FTOA 4YB6A 2I0BA 1MXYA 3TKDA 1K9YA 2CZHA 4G4PA 3CFZA 2A5SA 3N94A 1Z7ME 1Y4CA 4NEDA 3R7XA 4YB7A 3BIGA 3ZKLA 3O6GA 3BFUA 1MXVA 3CR9A 5TU0A 1NV3A 5CMKA 4DIGA 3MP1A 4ESWA 4DI3D 5IGAA 3V89B 2QS3A 5ET7A 4R6KA 5ICQA 3UIFA 3MP8A 4I62A 4ZECA 5F7VA 2I49A 3HV1A 4WKMA 3PGFA 1EYKA 4G2ZA 4KD5A 3PMWA 1NV0A 4TQUQ 5KDTA 3FJMA 1FQAA 2QSXA 4DI4B 2FA7A 4RXLA 5ESYA 4IR8A 1MRPA 2Y5LA 4FJPA 3MAMA 4IGTA 3OXNA 2V3UA 4E0XA 1FTMA 2XXUA 4G77A 4DXBA 3OENA 4TOZA 4OFOA 3TTMA 4F19A 4XTCQ 1RYOA 2HFBA 3PUWE 3SEYA 4OVPA 3FD3A 4PQJA 5DVJA 1P1NA 1DMBA 4EXLA 3TEPA 4PDDA 4P9KA 2Y5KA 3IK6B 4WEDA 3MVXA 1NV6A 1BLFA 3RLFE 4PFBA 1LLSA 4YICA 1ZKBA 1F9BA 3IOVA 2DE3A 5DVIA 1MY2A 2B3BA 1N7XA 1ZMGA 3MJNA 3K6WA 3TMGA 4HTGA 4MNPA 2PFYA 5HPQA 3A3UA 3IORA 4FEDA 3L6GA 4YKJA 1PB7A 5I59A 1FRPA 3S4UA 3PPNA 4H67A 5I57A 5JTYB 2Z23A 4IY5A 5FTIA 5I56A 5I84A 3DP6A 3IB2A 1MPCA 3RYDA 4ESXA 3T96B 3B8BA 2ALUA 3U72A 5AA3A 3S9NC 1MPDA 4O3BA 4F3SA 1FTJA 1URGA 1ZBMA 4U4XA 3O6HA 1NH8A 4N15A 4DLDA 1I6BA 4H65A 4KYDA 1TWYA 1N04A 3B6WA 1USYH 1XOCA 3NOHA 4F22A 2OWTA 1B51A 3E9XA 3UN6A 3KC1A 3A3CA 4MAGA 4R72A 3U92A 1B2HA 4H0WA 1LBWA 3UORA 2ZZXA 4P11A 1QULA 2B65A 1QW0A 3MWBA 4ELRA 1IXGA 2QJEA 1ZU0A 5T3JA 1FCKA 1PBQA 3KG2A 1H3DA 4OVSA 2ZNSA 4LATA 3K02A 4GLIA 2PCRA 5IZZA 3SKPA 3U93A 4M1VA 1NNTA 2VHAA 4PAFA 4IO3A 4BDQA 5ITOA 3IOTA 2QVVA 4RJZA 1LAHE 3SEXA 2HHMA 4GBWA 5TPAA 4Q0CA 1D9QA 3IAZA 4FECA 5DTBA 3SEWA 2OCUA 2XXWA 3IJOB 2XXHA 4F3PA 1OVBA 1NV7A 1B4HA 4ELQA 1RKMA 2F3BA 4ZE9A 1A99A 4NF0A 3FASA 3O29A 2QMXA 4R74A 1GVCA 3A29A 3KGCA 4PBQA 4QRZA 1TFAA 1VR5A 1NV1A 4DCYA 4H5GA 4YB5A 2R8TA 5I5PA 1FPKA 5CBSA 4O94A 1GGGA 1FPJA 4P0GA 2XXPA 1SQYA 3RPLB 3RTFB 3IJXB 2KQZA 3KSXA 1SW4A 1P99A 5H8NB 2P1SA 4C1TA 1INPA 3VLVA 3U1OA 2HZKA 4JWYA 4QXDA 2GQ1A 1QUKA 2Q2AA 5IZ3A 1Y9UA 5L9MA 1B3EA 1WDNA 3RN8A 4QF9A 3O28A 4KCDA 1DTZA 1YPNA 2QS2A 2KR0A 4G68A 4R6HA 1MY3A 2WYKA 1PC3A 4PE5B 3KOSA 1RDYA 5F1QA 1FPBA 2XX8A 2CZKA 2F34A 1R1NA 5JTYA 2FNCA 2AYSA 4Z0IA 3H7MA 4P56A 3QSLA 3K00A 1FBHA 2FIEA 1WVJA 2XA5A 4ZZEA 1CB6A 3O66A 3G3IA 3G3HA 4RY1A 1D9YA 2CEYA 3MPLA 2VT5A 2E1SA 3N26A 3VDFA 5H8FA 1HSLA 2HQ0A 4PTKA 4FEBA 1LBXA 3IX1A 4I8CA 2YPNA 4NX1A 4RA1A 3H03A 3R6UA 3F11A 4KI0E 5L8DA 1IMAA 1R6ZA 4F1YA 2VPOA 1BKAA 4GWXA 4U23A 4PBHA 2WEFA 4LVQA 1Z7NE 4QSDA 5ISUA 4HE0A 2H25A 3ZS6A 4NMYA 1N0TA 1K9ZA 3CRBA 1MDP1 3SDFA 3TYHA 3IFAA 1A7LA 5EYFA 3T66A 4F1UA 1D3KA 4N6PA 2XWVA 5EQ7A 3FVKA 4GWSA 1FW0A 3T9UA 1SDXA 3OO8A 5KDTB 1UIVA 1XT8A 2F7AA 4EF1A 1SPIA 2F5XA 3RUMA 5BUUA 5ICTA 1JETA 3IR1A 3FXRA 2G93A 2DSFA 4XKQA 3OSQA 4ZEIA 5L9OA 3UK4A 1FTLA 2O7IA 3CSGA 1LAGE 1M5FA 2ONKE 4PC9A 3WAFA 1DTGA 2QVUA 1MY1A 5CC2A 2F6PA 1PEBA 5LOMA 3QYTA 3TTRA 5EQAA 3IO6A 1IUDA 1B0HA 2XHDA 3CFXA 2I0CA 4EUOA 3DELB 4N8YA 1S7YA 3TAJA 2XXIA 1MXXA 3G3GA 4OFLA 5BWJA 1MY0A 1XVXA 1II5A 4JSDA 2HAVA 3B6QA 4F3BA 4P3LA 4RNSA 2I58A 2ZMBA 4DZ1A 2B4MA 3LUZA 2RF1A 5KCJA 1UTHB 2VGQA 3M8UA 3FV2A 1AOVA 4GD5A 1FBDA 1MPBA 4POWA 3E79A 4KCCA 4O7IA 5A5LA 3RPLA 4O3AA 4GXAA 2CEXA 3VV5A 2DQVA 3TDJA 1AWBA 2ZNUA 4X1DA 2X7QA 4M4GA 3W9VA 1FBEA 4ZEDA 1B3HA 3HPIA 1LBYA 1XC1A 3PD9A 4ZZAA 4OZ9A 1LBCA 1H44A 4RYAA 1EZPA 1SI0A 1PDAA 4OEUA 1KA0A 1NNFA 1M5DA 3GZGA 5HBCA 4NF6A 3VFJA 1LAXA 1XI6A 2DXYA 3MVWA 4LZ7A 4HE2A 3Q25A 2XD2A 3PUXE 1SBPA 3RT6B 1B5HA 2O69A 1QJMA 4JVCA 4OWDA 5H8SA 2GHAA 1FJ6A 2VD3A 3TCFA 4F39A 3FATA 2F78A 1PBPA 2FIXA 4OYVA 4ZDMA 5AA2A 4EQ9A 2QPQA 5KZTA 2XD3A 4AS5A 2V3QA 3A09A 2E0SA 4NF6B 2WX9A 1LB9A 5CM6A 4NN3A 4QHQA 1SW1A 2Z8FA 3CI8A 3PUYE 3GLBA 5F24A 2O84X 4JB7A 5M2VA 1RDXA 1LEVA 4N8GA 2A5TB 4N07A 2B3FA 2RCBA 4QBAA 3TUSA 4NHBA 4KHZE 5I56B 1BTJA 1J1NA 4R73A 1DK4A 4I3YA 1FQEA 1URSA 1VSOA 3SESA 1MQDA 4RK2A 3KEIA 2ZZWA 1NMUA 4YZZA 3SEUA 4OESA 2H98A 3TTNA 3TELA 3EN3A 4PF8A 3UGWA 2DXRA 2HEUA 3OO6A 1KWHA 1O7TA 2ANJA 4ELPA 2WYPA 3QK6A 2PBWA 1B3FA 1JNFA 3O2AA 3LSFB 3MZ9A 5IM2A 3SERA 1PB8A 1USYE 3DP8A 3HCQA 3N6TA 2OWZA 1A54A 1A8EA 4EDPA 3PU5A 5DVFA 4PCDA 4UACA 3LSXA 3T9HB 3CSBA 4R75A 3FUZA 4KQPA 4ONYA 2OJTA 5CI5A 1MS7A 5FTHA 4I40A 4OANA 3IB0A 3KSJA 3K6XA 1H43A 1ZTYA 4MIJA 2DWIA 3SEVA 1FQCA 2DWHA 3SETA 5B70A 4U1ZA 4P47A 1NUZA 4PFUA 1QVSA 4P0IA 1SYHA 4LQ2A 3V5AA 2XXYA 1JP4A 3MQ9A 3PD8A 4BLAA 2P0SA 4F1VA 4HXVA 2GHBA 1NV2A 1VE4A 4XKPA 3VLUA 1MH3A 4U2RA 3LUYA 2G29A 5H8HB 4XIGQ 3K2DA 4BDMA 1FPDA 1LBBA 4PE3A 1VFEA 3O9PA 2AL5A 2FYIA 2OZZA 3CG3A 2RC8A 1JW5A 3TZAA 3V8XB 1B1HA 1NH7A 1TFDA 4AQ4A 4OVQA 3OO9A 1MQJA 1R9LA 2JJKA 2PX1A 2WKYA 3GYYA 5K2YA 5ITPA 4POXA 3MZBA 2XXTA 5EHMA 4X9TA 1CNQA 1QUJA 1AMFA 3H6UA 2I4CA 3RT8A 4N91A 4OQOA 3Q28A 1NI9A 2QL3A 1US5A 2LAOA 5J16A 3B6TA 4ZEKA 1ZLQA 1B3GA 4RPNA 1OQGA 1DPEA 3JZJA 4F31B 4FORA 3FVOA 5H8NA 2XWOA 3C33A 1UQWA 3OOAA 3S9MC 3KJTA 1LGBC 3K4UA 3C36A 2UVIA 2NWJA 3FVNA 2F7BA 2F36A 1JEVA 4NF8B 4XEQA 3G3JA 4L17A 2XX9A 3FIRA 1PB9A 1YAEA 3HHGA 2YLNA 2XWIA 3KBZA 4DXUA 1FQDA 4JDFA 4IGRA 4R2FA 1EU8A 4H8IA 1LFIA 1OLCA 4ELOA 2I48A 3T0JA 3TQWA 1B7HA 3BKIB 3MPKA 4AB5A 3HHFA 2FVZA 4HW8A 3I5OA 2AIXA 4E0WA 3FVGA 4OERA 1R9QA 4GWOA 3KFMA 2ZYMA 4JWOA 2O51A 2DWAA 4GX3A 3DM0A 2ZZVA 1B6HA 3KC0A 3T22A 3CG1A 1FTAA 3H6VA 4PFTA 3THIA 1LB8A 1FBGA 1VDWA 1IEJA 3D4CA 1UTHA 1OLAA 4IO6A 4YKPA 4QFPA 4ZEBA 2Q9TA 3O6IA 3FV1A 3ZSFA 4NE4A 4LQ5A 2X7PA 1RYXA 2Z8DA 4YMBA 4KFQA 4NWDA 3UP9A 3S2VA 1Y3PA 1LCFA 2Q8MA 1FTKA 4GOTA 2P2AA 1SW5A 1O63A 2XXRA 4N6DA 4F18A 3PMVA 2WBDA 3S9EA 3LSWA 5K2XA 4NAPA 2Q74A 4X48A 4PFWA 4O7MA 4DE8A 1ANFA 1NUYA 2QRYA 2HAUA 2FBPA 3ECRA 5TP9A 3B50A 1MXZA 3M3LA 1AL3A 1FPLA 1NNPA 3HO7A 4Z7EA 1IXIA 2HPGA 4QFNA 5DYHA 1FSAA 3T9XB 4MF3A 4MEVA 5I3SA 1SD3A 4G68C 4MFIA 5EQ8A 1YXIA 4I3EA 3QIMA 2DWJA 3VVEA 4MX6A 2GH9A 4FE8A 4N81A 5JK4A 5ET8A 2UVGA 1SYIA 3IOWA 4H5FA 4DCXA 2DOJA 1IZ1A 4LZ5A 4PGPA 3RQTA 1XS5A 1LFGA 3IB1A 4ZS9A 1FJ9A 4I1DA 3ODBA 2H5YA 3G7WA 1N3WA 3KBRA 5I2NB 3D4GA 5TP9B 3GBAA 3ZKKA 1B52A 3MC2A 1ATGA 4RK9A 3FXUA 3Q29A 3TTKA 4G8HA 2Q88A 3OSRA 2KLFA 1T0KA 5IKBA 2A5TA 5I57B 5EQ9A 4FIMA 1Q9DA 2DP8A 2HCAA 1BP5A 1YTVA 1H76A 4JSOA 4K3FA 1XHYA 4KR5A 4KYEA 4N6KA 3QAXA 1XVYA 1ZIUA 1B7ZA 4WEPA 1B7UA 1KA1A 4IY6A 2HZLA 5IZ1A 2RINA 2V25A 5I7IA 1LAFE 3HFUA 4YMAA 4C1UA 1FBFA 3OEMA 4NF4A 4AB6A 4Q5TA 1NUXA 4PF6A 3ILTB 4FATA 2RC9A 1S9TA 1QKAA 4GRKA 2M8CA 3R26A 1POY1 1FPEA 1JW1A 1G0IA 4H1XA 2BJJX 2ONRA 3CIJA 2ABHA 1BIYA 4IO5A 3RPWA 4GVOA 3PPPA 5IAIA 4MLQA 1IIWA 4P8BA 2UVJA 2UVHA 3EF7A 1DBZA 3P7IA 5FHNA 2D21A 2V3TA 2R6GE 2REGA 3MYUA 2XXKA 2UXAA 2CZIA 4PGNA 4X1BA 3LSLA 4GX4A 1ZJLA 3FJ7A 3M3KA 2DE2A 2Y7RA 4NQ8A 4Q30B 1LCTA 3EQ1A 1JVYA 4XFEA 1M5BA 4PAKA 2OX3A 2Q8JA 3QUFA 3FZVA 4IO7A 3PUVE 3H6WA 1AIVA 4NF5B 3AXFA 1MM7A 4UABA 1L5TA 4QFOA 3TQLA 2V4CA 1GR2A 4QSEA 4OVRA 1OVTA 4H8JA 2F35A 1IXCA 1IITA 4ZEFA 1LFHA 2PT2A 4KYSA 3RGYA 2QS1A 2Y7WA 4MBPA 3TCGA 4JWXA 5JEIA 3I3VA 1I6QA 2O1MA 5LDZA 3PPRA 4AS4A 1IMFA 4G8NA 2I4BA 5AA2B 4MJOA 1A40A 3LBSA 3K6UA 3ONMA 3TFLA 5I2NA 2CZLA 3VLWA 3FGSA 2RCAA 1MG1A 2I3VA 2NUVA 4NF4B 1EH3A 3E3KA 4JBZA 3V83A 4LA9A 4U22A 3ISPA 5CRYA 4GFRA 1DOTA 5EHSA 2H99A 1B40A 2XX7A 1H45A 4C0RA 4PFYA 2V84A 4JVDA 2V93A 1CE2A 3JYRA 2Y7PA 4F29A 3H3GA 3MBPA 3TCHA 3K6VA 4PFRA 3TTLA 2REJA 3T9VA 1Q35A 2H4IA 3E13X 3C35A 4KXPA 2Y84A 2NOOA 2Q89A 2QMWA 1EZ9A 2YJPA 1YYZA 2VP1A 1DSNA 3G3KA 2UYFA 5LTCA 1QGXA 3JV9A 4FAJA 2AL4A 3FBPA 1RDZA 2QVRA 2F6GA 4OMBA 4GWWA 5ET5A 1OIBA 3RTWB 3VXBA 1B5JA 1HSJA 4OFJA 4X8RA 4O3CA 4OA4A 5CMBA 3QUJA 1D4NA 3K1MA 1FQFA 1G0HA 3H6TA 4X04A 5L9SA 5KCJB 1JEUA 5HM4B 2PMSA 2Z8EA 4BDNA 1Q1KA 3KN8A 1MQGA 3CVGA 1NFTA 2O6AA 1UTBA 1N7WA 5AA1A 1DCUA 1IMEA 1MXUA 2Q2CA 2HXWA 3IO4A 3MSTA 3C32A 4GL0A 4OVJA 1NL5A 3EHSA 1FPGA 1GTKA 4LP2B 5AE4A 2OWSA 3KN3A 3OD7A 4HE1A 2F7CA 3VVDA 4PDHA 4N4UA 5DEXA 1TXFA 4I9DA 2VD2A 1LSTA 1M5CA 4IO2A 1EZOA 1MQIA 3LC8A 1IXHA 1NUWA 4R9FA 1B05A 1US4A 2DS9A 2IA4A 4R9GA 2DE4A 4P1LA 4MHFA 3QXMA 1URDA 4GIZA 4YAHX 4GWYA 2F97A 5I59B 5CBRA 1ELJA 2MKZA 2ZYKA 1POTA 1S50A 3TODA 4GF8A 3N5LA 5FHMA 1IQ7A 2R9JA 3PTYA 3HSTA 3E4RA 4ZE8A 1EYJA 1N3XA 1SI1A 1GV8A 3LR1A 1B4ZA 3QMFA 2XWKA 1JQFA 1FBPA 1P1OA 1WODA 3H4ZA
chains in the Genus database with same CATH topology
1SVXB 2VGQA 4XXUA 4IGTA 3M8UA 3FV2A 1LCFA 3OXNA 2V3UA 1FTKA 3OMBA 4GOTA 4E0XA 5AA4B 1FTMA 2QS4A 2XXUA 2P2AA 4G77A 4DXBA 3OENA 4TOZA 1Y20A 4GD5A 4OFOA 3TTMA 1SW5A 1O63A 1MPBA 2XXRA 4POWA 4F19A 4XTCQ 4F18A 3PMVA 4N13A 1RYOA 1B32A 3S9EA 5ICTA 3M3FA 2HFBA 3UA8A 3PUWE 1B3LA 3LSWA 4KCCA 3SEYA 5K2XA 3FD3A 3SEWA 3GXAA 3MVYA 4X48A 4PFWA 4PQJA 5DVJA 5I58B 1P1NA 1DMBA 4DE8A 4EXLA 1ANFA 3TEPA 1NKXA 4O3AA 2QRYA 4YKKA 2HAUA 4GXAA 3EHUA 3IK6B 3Q26A 4WEDA 4DXCA 3MVXA 4M1VA 3VV5A 3ECRA 5TP9A 1MXZA 1BLFA 3DLNA 3M3LA 4QSCA 3RLFE 2DQVA 3TDJA 1AL3A 1LLSA 5H8QA 1NNPA 3HO7A 4YICA 1ZKBA 1F9BA 4Z7EA 1IXIA 1B5IA 3IOVA 2ZNUA 2DE3A 4QFNA 4X1DA 5DYHA 2X7QA 3PUZE 4M4GA 3W9VA 3T9XB 4MF3A 4ZEDA 4UA8A 1SD3A 5DVIA 1B3HA 1MY2A 3HPIA 4G68C 1N84A 4MFIA 1XC1A 1A8FA 2B3BA 1N7XA 1ZMGA 3PD9A 3MJNA 4ZZAA 4OZ9A 1LBCA 4YKIA 3QIMA 3T93B 1H44A 3K6WA 4RYAA 1SI0A 2DWJA 3TMGA 3KJ7A 1EZPA 1PDAA 4OHNA 4OEUA 3VVEA 1NNFA 2GH9A 4FE8A 4EQ7A 1M5DA 5JK4A 4HTGA 5HPQA 3GZGA 1JW4A 3OEKA 4NTLA 3A3UA 4NF6A 5HBCA 3IORA 2UVGA 3VFJA 1LAXA 4FEDA 2DXYA 3L6GA 4YKJA 1SYIA 2D3IA 3IOWA 1PB7A 2DOJA 3MVWA 4H5FA 1IZ1A 4LZ7A 4DCXA 3Q25A 5I59A 4LZ5A 3RQTA 1XS5A 1LFGA 2XD2A 2ZYNA 3C34A 3IB1A 3PUXE 3S4UA 3HN0A 3I6VA 4ZS9A 3WAEA 1SBPA 4HCYA 3RT6B 1B5HA 3PPNA 4I1DA 2O69A 1B58A 1QJMA 3ODBA 1QUIA 2H5YA 3G7WA 1N3WA 3KBRA 4H67A 1Y1ZA 4WXJA 5JTYB 3D4GA 2Z23A 5TP9B 3GBAA 5I2NB 5I57A 4IY5A 4ECFA 4OWDA 5FTIA 3ZKKA 4F3GA 5I56A 2X26A 1B9JA 5I84A 5H8SA 1B52A 1Y4TA 2GHAA 3DP6A 3IB2A 2I6EA 1MPCA 4NWCA 3MC2A 1P1QA 1ATGA 2VD3A 3FXUA 3Q29A 4RK9A 3TCFA 4G8HA 3TTKA 2Q88A 3OSRA 2KLFA 4ESXA 3K1NA 3T96B 3FATA 2F78A 4OETA 5CMCA 3S2VA 4F39A 1PBPA 2ALUA 2NXOA 1T0KA 4OYVA 5IKBA 3U72A 1B46A 2A5TA 5AA3A 5I57B 3S9NC 4ZDMA 1MPDA 4FIMA 4O3BA 2DP8A 5AA2A 4F3SA 2HCAA 1FTJA 1BP5A 1URGA 1ZBMA 3USDA 3IL1B 4EQ9A 1YTVA 1H76A 4JSOA 4U4XA 5AA4A 3O6HA 2XXXA 4K3FA 2CMOA 1NH8A 1VFDA 4DLDA 1I6BA 1XHYA 2QPQA 4H65A 5KZTA 4KYDA 2GRVA 4KR5A 2XD3A 1TWYA 4KYEA 2VOZA 4EF2A 1N04A 3B6WA 3QAXA 1USYH 4BDRA 2V3QA 1XOCA 3A09A 1XVYA 2E0SA 4NF6B 1ZIUA 3K1PA 4F22A 1B7ZA 2OWTA 5CMMA 1B51A 3E9XA 4WEPA 3UN6A 1D9VA 1B7UA 4MLVA 5FHNA 4IY6A 4OTEA 1B0LA 2HZLA 3A3CA 4R6YA 4MH5A 4R72A 1LB9A 5CM6A 2RINA 4QHQA 3U92A 1B2HA 1SW1A 2Z8FA 4H0WA 3CI8A 3PUYE 3DP4A 3GLBA 1Y3QA 3UORA 4P11A 2V25A 2IEEA 4XKNA 2B65A 1QULA 2O84X 4JB7A 5M2VA 1QW0A 1LAFE 2ZXTA 3MWBA 4ELRA 2A5TB 4YMAA 4OXVA 1IXGA 2QJEA 4C1UA 5DT6A 4IB2A 3OEMA 4N07A 4NF4A 4AB6A 4Q5TA 3MP6A 1ZU0A 2B3FA 3ILTB 1FCKA 1PBQA 1S9TA 1QKAA 2RC7A 2RC9A 4GRKA 2RCBA 4FATA 3KG2A 5I2KA 3TUSA 1H3DA 2ZNSA 4KHZE 2M8CA 4LATA 3K02A 3KOTA 3R26A 4GLIA 2DVZA 5I56B 1BTJA 1POY1 4QFKA 3SKPA 1J1NA 3EHTA 3U93A 1FQEA 3IOUA 1JW1A 4R73A 1URSA 1VSOA 3SESA 4H1XA 2BJJX 1NNTA 2VHAA 1UIUA 2ONRA 4IO3A 1MQHA 1MQDA 1OQHA 4BDQA 3CIJA 4RK2A 3KEIA 2ABHA 4KPTA 1BIYA 1NMUA 5ITOA 3IOTA 4YZZA 4RJZA 1JVXA 3SEUA 4OEVA 3VXCA 4OESA 2H98A 1LAHE 3TTNA 3TELA 3EN3A 3SEXA 3UGWA 2DXRA 4G8MA 4IO5A 5TPAA 4Q0CA 2HEUA 3BFTA 3OO6A 1KWHA 3W15C 1O7TA 3RPWA 2ANJA 4ELPA 3IAZA 4GVOA 3PPPA 3OO7A 4FECA 5IAIA 3GBBA 4F2OA 5DTBA 2O68A 2OCUA 4LUBA 2O7UA 4MLQA 2XXWA 1IIWA 2XXHA 2UVJA 3IJOB 1OVBA 4PETA 2UVHA 4F3PA 2R71A 3QK6A 3EF7A 3P7IA 2PBWA 2D21A 4GL8A 1B3FA 1MDQA 1B4HA 1JNFA 1OMPA 2R6GE 2REGA 1RKMA 2GFEA 2V3TA 3O2AA 4HS7A 4ELQA 4EXKA 4ZE9A 2UXAA 1A99A 3LSFB 3MZ9A 3FASA 4X1BA 3O29A 2QMXA 3N6UA 4R74A 1GVCA 3SERA 1PB8A 3K0VA 3KGCA 4DDDA 1USYE 4THIA 3LSLA 3DP8A 4QRZA 4BDOA 1ZJLA 3HCQA 4U4SA 3FJ7A 3CFLA 1TFAA 4JXIA 3N6TA 1VR5A 2DE2A 3M3KA 2Y7RA 4DCYA 4H5GA 1A54A 4YB5A 1A8EA 4Q30B 1LCTA 4EDPA 3PU5A 5DVFA 3EQ1A 5TPAB 5AA2D 2XXVA 3OELA 4UACA 5CBSA 1JVYA 1M5BA 3EPEA 2XXQA 3CSBA 3LSXA 3PPQA 4R75A 3T9HB 3FUZA 1Y1MA 2Q8JA 3O97A 1GGGA 4KQPA 3QUFA 3FZVA 4IO7A 4ONYA 3BBRA 3PUVE 2XXPA 3H6WA 2OJTA 2ESNA 1SQYA 4P0GA 5CI5A 1AIVA 3RTFB 3IJXB 3KSXA 1SW4A 2F8DA 3C9HA 1P99A 3AXFA 4NF5B 5H8NB 1MS7A 1MM7A 2P1SA 5FTHA 1L5TA 4QFOA 4C1TA 3VLVA 4ISUA 3IB0A 3MW0A 2UYEA 3KSJA 4U21A 3TQLA 1GR2A 4QSEA 3U1OA 2HZKA 3K6XA 1H43A 1OVTA 4H8JA 2F35A 1IXCA 3W9WA 1IITA 1ZTYA 4ZEFA 1LFHA 2DWIA 3SEVA 1YCJA 2PT2A 4JWYA 4ND9A 4KYSA 3RGYA 2QS1A 4R2BA 2O1LA 2Y7WA 1FQCA 4MBPA 2DWHA 3B7DA 3SETA 3TCGA 1QUKA 4JWXA 3ILUB 4IO4A 5B70A 1HSEA 2Q2AA 5H8HA 1Y9UA 5L9MA 1B3EA 5JEIA 5J1DA 2OK2A 2I3WA 3PV0E 4U1ZA 1WDNA 3I3VA 3FJGA 1I6QA 2O1MA 4GXSB 3RN8A 4QF9A 4BDLA 3O28A 4KCDA 1DPPA 5FHOA 3PPRA 1DTZA 1YPNA 2QS2A 3RNNA 2W7YA 1AH5A 4G68A 4PFUA 4R6HA 1MY3A 1QVSA 4TLMB 1PC3A 4PE5B 4OENA 4G8NA 4P0IA 1M5EA 3KOSA 1SYHA 2I4BA 5AA2B 4LQ2A 2OLBA 1MXWA 2XXYA 3V5AA 5F1QA 3MQ9A 4YU0A 1A40A 3TPAA 3LBSA 3PMXA 3PD8A 3G3FA 3K6UA 4BLAA 3ONMA 2XX8A 2P0SA 3L6HA 2F34A 4LZ8A 1R1NA 3TFLA 4F1VA 2CZLA 4U1OA 5I2NA 5JTYA 2GHBA 3VLWA 3FGSA 2FNCA 1SW2A 2AYSA 5I2KB 2RCAA 2PVUA 4Z0IA 1VE4A 1MG1A 3H7MA 2I3VA 4XKPA 3QSLA 3VLUA 1MH3A 2NUVA 3K00A 4NF4B 2ZYOA 3LUYA 4U2RA 2Y7KA 2G29A 1EH3A 3E3KA 4JBZA 4XIGQ 3K2DA 1WVJA 3KZGA 5H8HB 1AOVA 3V83A 1B1XA 3Q27A 4LA9A 4U22A 4BDMA 4ZZEA 1CB6A 3O66A 3G3IA 1A55A 5CRYA 4GFRA 1O64A 1DOTA 5EHSA 5H8QB 1LBBA 2H99A 1B40A 3G3HA 5ELVA 1VFEA 2XX7A 1D9YA 4RY1A 1H45A 3MAMA 3O9PA 2AL5A 2FYIA 3MPLA 4C0RA 4PFYA 1I6AA 2DYXA 2OZZA 2V84A 3CG3A 3S9LC 2E1SA 3N26A 1NNKA 2RC8A 3VDFA 1JW5A 1HSLA 2V93A 3PPOA 3TZAA 5H8FA 3V8XB 1P1UA 4LONB 2HQ0A 1CE2A 1B1HA 1NH7A 2Y7PA 3JYRA 3H3GA 4F29A 3MBPA 3TCHA 3K6VA 4FEBA 1TFDA 4AQ4A 3IX1A 4F2QA 2H9BA 3TTLA 2REJA 2Z22A 4I8CA 2YPNA 3OO9A 1MQJA 3T9VA 1R9LA 4G68B 4RA1A 3K01A 2PX1A 5B7DA 1Q35A 2WKYA 3H06B 3H03A 2H4IA 5K2YA 5ITPA 4POXA 3E13X 3MZBA 3R6UA 1MH4A 3F11A 3C35A 3MUQA 4KI0E 2ONSA 1MY4A 2XXTA 1R6ZA 2Y84A 5L8DA 2PYYA 2NOOA 4TLLB 4X9TA 5EHMA 4NF8A 4F1YA 3U8QA 2Q89A 3FXQA 2QMWA 1QUJA 1BKAA 1EZ9A 1AMFA 2YJPA 3H6UA 4U23A 3C4MA 2I4CA 3RT8A 3RY3A 3VVFA 4LVQA 4PP0A 4OQOA 1Z7NE 4DXUA 3Q28A 2VP1A 1TT1A 4QSDA 1DSNA 2QL3A 5ISUA 3VE1B 1US5A 3G3KA 2UYFA 2H25A 5A5XA 3ZS6A 5DEXB 5A5XB 2LAOA 5I58A 4NMYA 1P1WA 3B6TA 3JV9A 4GQOA 2DVCA 4HCWA 4FAJA 1N0TA 4ZEKA 5H8FB 2AL4A 1ZLQA 1B3GA 4RPNA 1OQGA 3C31A 3U94A 2PT1A 1I69A 2D5WA 1FQBA 1DPEA 3JZJA 3CRBA 1MDP1 3SDFA 1N76A 4FORA 3FVOA 2F6GA 4NF5A 4QFLA 5H8NA 3TYHA 4F31B 4OMBA 1A7LA 2ZNTA 2Y7IA 5EYFA 3T66A 1D3KA 4F1UA 2RKMA 4N6PA 3FVKA 3C33A 1OIBA 1UQWA 3RTWB 3OOAA 1FW0A 3S9MC 3VXBA 3KJTA 3T9UA 5BUUA 1LGBC 1SDXA 3K4UA 3OO8A 1B5JA 1HSJA 2THIA 2UVIA 3C36A 4OFJA 1UTBB 2NWJA 4O3CA 3FVNA 2F7BA 2F36A 1JEVA 3QUJA 4NF8B 5CMBA 4Q8RA 2OBGA 1QKBA 3G3JA 1D4NA 4L17A 3K1MA 2XX9A 3FIRA 5KDTB 1PB9A 1UIVA 1XT8A 1YAEA 2F7AA 4EF1A 1FQFA 3HHGA 3H6TA 4EQBA 5L9SA 2YLNA 3KN7A 1JEUA 5KCJB 3MZ1A 2F5XA 3RUMA 5HM4B 4H6DA 2NVUB 2PMSA 2Z8EA 1Y3NA 4XKRA 4RPOA 1MM6A 4BDNA 1JETA 1FTOA 3MVZA 2I0BA 4YB6A 1Q1KA 3KN8A 1MQGA 3FXRA 1FQDA 2G93A 1NFTA 2O6AA 3CVGA 3IR1A 4IGRA 4JDFA 1MXYA 3TKDA 2DSFA 1UTBA 4R2FA 1N7WA 5AA1A 1EU8A 4XKQA 3OSQA 4H8IA 4ZEIA 1LFIA 5L9OA 1MXUA 3UK4A 1FTLA 1OLCA 2O7IA 2Q2CA 2HXWA 3CSGA 4ELOA 2I48A 3TQWA 4G4PA 3IO4A 1LAGE 3C32A 1M5FA 4GL0A 2ONKE 1B7HA 3WAFA 3CFZA 3BKIB 4OVJA 2A5SA 3MPKA 1NL5A 3N94A 1DTGA 4AB5A 1MY1A 1Z7ME 3HHFA 5CC2A 2F6PA 1Y4CA 1PEBA 4HW8A 3EHSA 3I5OA 5LOMA 1GTKA 3QYTA 4NEDA 3R7XA 3TTRA 4LP2B 5AE4A 2OWSA 3KN3A 2AIXA 3IO6A 1IUDA 4E0WA 3OD7A 3FVGA 4OERA 1B0HA 1R9QA 2F7CA 4GWOA 4YB7A 3VVDA 3ZKLA 3O6GA 3BFUA 1MXVA 3KFMA 3CR9A 5DEXA 1TXFA 4I9DA 2VD2A 2ZYMA 1LSTA 4JWOA 2O51A 2DWAA 5TU0A 1M5CA 3DM0A 4IO2A 5CMKA 1EZOA 1B6HA 1MQIA 3LC8A 1IXHA 4DIGA 3T22A 4R9FA 1B05A 1US4A 3CG1A 2XHDA 3MP1A 2DS9A 3H6VA 2IA4A 2I0CA 3CFXA 4PFTA 4EUOA 4R9GA 2DE4A 4ESWA 3DELB 3THIA 1S7YA 1LB8A 3QXMA 2XXIA 3TAJA 1URDA 4GIZA 1IEJA 4YAHX 3D4CA 2F97A 3V89B 1MXXA 5I59B 5CBRA 1UTHA 1ELJA 2QS3A 3G3GA 1OLAA 2ZYKA 4R6KA 5ICQA 3UIFA 1POTA 1S50A 3MP8A 4OFLA 4I62A 4ZECA 4IO6A 1MY0A 4YKPA 5F7VA 3TODA 5BWJA 1XVXA 4GF8A 3N5LA 5FHMA 1II5A 4QFPA 4JSDA 1IQ7A 2HAVA 2I49A 2R9JA 3HV1A 4WKMA 2Q9TA 4ZEBA 3B6QA 3O6IA 3HSTA 3PGFA 4F3BA 3E4RA 4ZE8A 3FV1A 4G2ZA 4RNSA 3ZSFA 4KD5A 1N3XA 4NE4A 1SI1A 2I58A 2ZMBA 4DZ1A 3PMWA 4LQ5A 1GV8A 4TQUQ 2X7PA 3LR1A 5KDTA 1B4ZA 3FJMA 1RYXA 1FQAA 2Z8DA 4YMBA 2QSXA 4KFQA 2FA7A 4NWDA 3UP9A 4RXLA 1JQFA 1MRPA 2RF1A 4FJPA 5KCJA 1P1OA 1WODA 3H4ZA 1UTHB 1Y3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SVX B;  2VGQ A;  4XXU A;  4IGT A;  3M8U A;  3FV2 A;  1LCF A;  3OXN A;  2V3U A;  1FTK A;  3OMB A;  4GOT A;  4E0X A;  5AA4 B;  1FTM A;  2QS4 A;  2XXU A;  2P2A A;  4G77 A;  4DXB A;  3OEN A;  4TOZ A;  1Y20 A;  4GD5 A;  4OFO A;  3TTM A;  1SW5 A;  1O63 A;  1MPB A;  2XXR A;  4POW A;  4F19 A;  4XTC Q;  4F18 A;  3PMV A;  4N13 A;  1RYO A;  1B32 A;  3S9E A;  5ICT A;  3M3F A;  2HFB A;  3UA8 A;  3PUW E;  1B3L A;  3LSW A;  4KCC A;  3SEY A;  5K2X A;  3FD3 A;  3SEW A;  3GXA A;  3MVY A;  4X48 A;  4PFW A;  4PQJ A;  5DVJ A;  5I58 B;  1P1N A;  1DMB A;  4DE8 A;  4EXL A;  1ANF A;  3TEP A;  1NKX A;  4O3A A;  2QRY A;  4YKK A;  2HAU A;  4GXA A;  3EHU A;  3IK6 B;  3Q26 A;  4WED A;  4DXC A;  3MVX A;  4M1V A;  3VV5 A;  3ECR A;  5TP9 A;  1MXZ A;  1BLF A;  3DLN A;  3M3L A;  4QSC A;  3RLF E;  2DQV A;  3TDJ A;  1AL3 A;  1LLS A;  5H8Q A;  1NNP A;  3HO7 A;  4YIC A;  1ZKB A;  1F9B A;  4Z7E A;  1IXI A;  1B5I A;  3IOV A;  2ZNU A;  2DE3 A;  4QFN A;  4X1D A;  5DYH A;  2X7Q A;  3PUZ E;  4M4G A;  3W9V A;  3T9X B;  4MF3 A;  4ZED A;  4UA8 A;  1SD3 A;  5DVI A;  1B3H A;  1MY2 A;  3HPI A;  4G68 C;  1N84 A;  4MFI A;  1XC1 A;  1A8F A;  2B3B A;  1N7X A;  1ZMG A;  3PD9 A;  3MJN A;  4ZZA A;  4OZ9 A;  1LBC A;  4YKI A;  3QIM A;  3T93 B;  1H44 A;  3K6W A;  4RYA A;  1SI0 A;  2DWJ A;  3TMG A;  3KJ7 A;  1EZP A;  1PDA A;  4OHN A;  4OEU A;  3VVE A;  1NNF A;  2GH9 A;  4FE8 A;  4EQ7 A;  1M5D A;  5JK4 A;  4HTG A;  5HPQ A;  3GZG A;  1JW4 A;  3OEK A;  4NTL A;  3A3U A;  4NF6 A;  5HBC A;  3IOR A;  2UVG A;  3VFJ A;  1LAX A;  4FED A;  2DXY A;  3L6G A;  4YKJ A;  1SYI A;  2D3I A;  3IOW A;  1PB7 A;  2DOJ A;  3MVW A;  4H5F A;  1IZ1 A;  4LZ7 A;  4DCX A;  3Q25 A;  5I59 A;  4LZ5 A;  3RQT A;  1XS5 A;  1LFG A;  2XD2 A;  2ZYN A;  3C34 A;  3IB1 A;  3PUX E;  3S4U A;  3HN0 A;  3I6V A;  4ZS9 A;  3WAE A;  1SBP A;  4HCY A;  3RT6 B;  1B5H A;  3PPN A;  4I1D A;  2O69 A;  1B58 A;  1QJM A;  3ODB A;  1QUI A;  2H5Y A;  3G7W A;  1N3W A;  3KBR A;  4H67 A;  1Y1Z A;  4WXJ A;  5JTY B;  3D4G A;  2Z23 A;  5TP9 B;  3GBA A;  5I2N B;  5I57 A;  4IY5 A;  4ECF A;  4OWD A;  5FTI A;  3ZKK A;  4F3G A;  5I56 A;  2X26 A;  1B9J A;  5I84 A;  5H8S A;  1B52 A;  1Y4T A;  2GHA A;  3DP6 A;  3IB2 A;  2I6E A;  1MPC A;  4NWC A;  3MC2 A;  1P1Q A;  1ATG A;  2VD3 A;  3FXU A;  3Q29 A;  4RK9 A;  3TCF A;  4G8H A;  3TTK A;  2Q88 A;  3OSR A;  2KLF A;  4ESX A;  3K1N A;  3T96 B;  3FAT A;  2F78 A;  4OET A;  5CMC A;  3S2V A;  4F39 A;  1PBP A;  2ALU A;  2NXO A;  1T0K A;  4OYV A;  5IKB A;  3U72 A;  1B46 A;  2A5T A;  5AA3 A;  5I57 B;  3S9N C;  4ZDM A;  1MPD A;  4FIM A;  4O3B A;  2DP8 A;  5AA2 A;  4F3S A;  2HCA A;  1FTJ A;  1BP5 A;  1URG A;  1ZBM A;  3USD A;  3IL1 B;  4EQ9 A;  1YTV A;  1H76 A;  4JSO A;  4U4X A;  5AA4 A;  3O6H A;  2XXX A;  4K3F A;  2CMO A;  1NH8 A;  1VFD A;  4DLD A;  1I6B A;  1XHY A;  2QPQ A;  4H65 A;  5KZT A;  4KYD A;  2GRV A;  4KR5 A;  2XD3 A;  1TWY A;  4KYE A;  2VOZ A;  4EF2 A;  1N04 A;  3B6W A;  3QAX A;  1USY H;  4BDR A;  2V3Q A;  1XOC A;  3A09 A;  1XVY A;  2E0S A;  4NF6 B;  1ZIU A;  3K1P A;  4F22 A;  1B7Z A;  2OWT A;  5CMM A;  1B51 A;  3E9X A;  4WEP A;  3UN6 A;  1D9V A;  1B7U A;  4MLV A;  5FHN A;  4IY6 A;  4OTE A;  1B0L A;  2HZL A;  3A3C A;  4R6Y A;  4MH5 A;  4R72 A;  1LB9 A;  5CM6 A;  2RIN A;  4QHQ A;  3U92 A;  1B2H A;  1SW1 A;  2Z8F A;  4H0W A;  3CI8 A;  3PUY E;  3DP4 A;  3GLB A;  1Y3Q A;  3UOR A;  4P11 A;  2V25 A;  2IEE A;  4XKN A;  2B65 A;  1QUL A;  2O84 X;  4JB7 A;  5M2V A;  1QW0 A;  1LAF E;  2ZXT A;  3MWB A;  4ELR A;  2A5T B;  4YMA A;  4OXV A;  1IXG A;  2QJE A;  4C1U A;  5DT6 A;  4IB2 A;  3OEM A;  4N07 A;  4NF4 A;  4AB6 A;  4Q5T A;  3MP6 A;  1ZU0 A;  2B3F A;  3ILT B;  1FCK A;  1PBQ A;  1S9T A;  1QKA A;  2RC7 A;  2RC9 A;  4GRK A;  2RCB A;  4FAT A;  3KG2 A;  5I2K A;  3TUS A;  1H3D A;  2ZNS A;  4KHZ E;  2M8C A;  4LAT A;  3K02 A;  3KOT A;  3R26 A;  4GLI A;  2DVZ A;  5I56 B;  1BTJ A;  1POY 1;  4QFK A;  3SKP A;  1J1N A;  3EHT A;  3U93 A;  1FQE A;  3IOU A;  1JW1 A;  4R73 A;  1URS A;  1VSO A;  3SES A;  4H1X A;  2BJJ X;  1NNT A;  2VHA A;  1UIU A;  2ONR A;  4IO3 A;  1MQH A;  1MQD A;  1OQH A;  4BDQ A;  3CIJ A;  4RK2 A;  3KEI A;  2ABH A;  4KPT A;  1BIY A;  1NMU A;  5ITO A;  3IOT A;  4YZZ A;  4RJZ A;  1JVX A;  3SEU A;  4OEV A;  3VXC A;  4OES A;  2H98 A;  1LAH E;  3TTN A;  3TEL A;  3EN3 A;  3SEX A;  3UGW A;  2DXR A;  4G8M A;  4IO5 A;  5TPA A;  4Q0C A;  2HEU A;  3BFT A;  3OO6 A;  1KWH A;  3W15 C;  1O7T A;  3RPW A;  2ANJ A;  4ELP A;  3IAZ A;  4GVO A;  3PPP A;  3OO7 A;  4FEC A;  5IAI A;  3GBB A;  4F2O A;  5DTB A;  2O68 A;  2OCU A;  4LUB A;  2O7U A;  4MLQ A;  2XXW A;  1IIW A;  2XXH A;  2UVJ A;  3IJO B;  1OVB A;  4PET A;  2UVH A;  4F3P A;  2R71 A;  3QK6 A;  3EF7 A;  3P7I A;  2PBW A;  2D21 A;  4GL8 A;  1B3F A;  1MDQ A;  1B4H A;  1JNF A;  1OMP A;  2R6G E;  2REG A;  1RKM A;  2GFE A;  2V3T A;  3O2A A;  4HS7 A;  4ELQ A;  4EXK A;  4ZE9 A;  2UXA A;  1A99 A;  3LSF B;  3MZ9 A;  3FAS A;  4X1B A;  3O29 A;  2QMX A;  3N6U A;  4R74 A;  1GVC A;  3SER A;  1PB8 A;  3K0V A;  3KGC A;  4DDD A;  1USY E;  4THI A;  3LSL A;  3DP8 A;  4QRZ A;  4BDO A;  1ZJL A;  3HCQ A;  4U4S A;  3FJ7 A;  3CFL A;  1TFA A;  4JXI A;  3N6T A;  1VR5 A;  2DE2 A;  3M3K A;  2Y7R A;  4DCY A;  4H5G A;  1A54 A;  4YB5 A;  1A8E A;  4Q30 B;  1LCT A;  4EDP A;  3PU5 A;  5DVF A;  3EQ1 A;  5TPA B;  5AA2 D;  2XXV A;  3OEL A;  4UAC A;  5CBS A;  1JVY A;  1M5B A;  3EPE A;  2XXQ A;  3CSB A;  3LSX A;  3PPQ A;  4R75 A;  3T9H B;  3FUZ A;  1Y1M A;  2Q8J A;  3O97 A;  1GGG A;  4KQP A;  3QUF A;  3FZV A;  4IO7 A;  4ONY A;  3BBR A;  3PUV E;  2XXP A;  3H6W A;  2OJT A;  2ESN A;  1SQY A;  4P0G A;  5CI5 A;  1AIV A;  3RTF B;  3IJX B;  3KSX A;  1SW4 A;  2F8D A;  3C9H A;  1P99 A;  3AXF A;  4NF5 B;  5H8N B;  1MS7 A;  1MM7 A;  2P1S A;  5FTH A;  1L5T A;  4QFO A;  4C1T A;  3VLV A;  4ISU A;  3IB0 A;  3MW0 A;  2UYE A;  3KSJ A;  4U21 A;  3TQL A;  1GR2 A;  4QSE A;  3U1O A;  2HZK A;  3K6X A;  1H43 A;  1OVT A;  4H8J A;  2F35 A;  1IXC A;  3W9W A;  1IIT A;  1ZTY A;  4ZEF A;  1LFH A;  2DWI A;  3SEV A;  1YCJ A;  2PT2 A;  4JWY A;  4ND9 A;  4KYS A;  3RGY A;  2QS1 A;  4R2B A;  2O1L A;  2Y7W A;  1FQC A;  4MBP A;  2DWH A;  3B7D A;  3SET A;  3TCG A;  1QUK A;  4JWX A;  3ILU B;  4IO4 A;  5B70 A;  1HSE A;  2Q2A A;  5H8H A;  1Y9U A;  5L9M A;  1B3E A;  5JEI A;  5J1D A;  2OK2 A;  2I3W A;  3PV0 E;  4U1Z A;  1WDN A;  3I3V A;  3FJG A;  1I6Q A;  2O1M A;  4GXS B;  3RN8 A;  4QF9 A;  4BDL A;  3O28 A;  4KCD A;  1DPP A;  5FHO A;  3PPR A;  1DTZ A;  1YPN A;  2QS2 A;  3RNN A;  2W7Y A;  1AH5 A;  4G68 A;  4PFU A;  4R6H A;  1MY3 A;  1QVS A;  4TLM B;  1PC3 A;  4PE5 B;  4OEN A;  4G8N A;  4P0I A;  1M5E A;  3KOS A;  1SYH A;  2I4B A;  5AA2 B;  4LQ2 A;  2OLB A;  1MXW A;  2XXY A;  3V5A A;  5F1Q A;  3MQ9 A;  4YU0 A;  1A40 A;  3TPA A;  3LBS A;  3PMX A;  3PD8 A;  3G3F A;  3K6U A;  4BLA A;  3ONM A;  2XX8 A;  2P0S A;  3L6H A;  2F34 A;  4LZ8 A;  1R1N A;  3TFL A;  4F1V A;  2CZL A;  4U1O A;  5I2N A;  5JTY A;  2GHB A;  3VLW A;  3FGS A;  2FNC A;  1SW2 A;  2AYS A;  5I2K B;  2RCA A;  2PVU A;  4Z0I A;  1VE4 A;  1MG1 A;  3H7M A;  2I3V A;  4XKP A;  3QSL A;  3VLU A;  1MH3 A;  2NUV A;  3K00 A;  4NF4 B;  2ZYO A;  3LUY A;  4U2R A;  2Y7K A;  2G29 A;  1EH3 A;  3E3K A;  4JBZ A;  4XIG Q;  3K2D A;  1WVJ A;  3KZG A;  5H8H B;  1AOV A;  3V83 A;  1B1X A;  3Q27 A;  4LA9 A;  4U22 A;  4BDM A;  4ZZE A;  1CB6 A;  3O66 A;  3G3I A;  1A55 A;  5CRY A;  4GFR A;  1O64 A;  1DOT A;  5EHS A;  5H8Q B;  1LBB A;  2H99 A;  1B40 A;  3G3H A;  5ELV A;  1VFE A;  2XX7 A;  1D9Y A;  4RY1 A;  1H45 A;  3MAM A;  3O9P A;  2AL5 A;  2FYI A;  3MPL A;  4C0R A;  4PFY A;  1I6A A;  2DYX A;  2OZZ A;  2V84 A;  3CG3 A;  3S9L C;  2E1S A;  3N26 A;  1NNK A;  2RC8 A;  3VDF A;  1JW5 A;  1HSL A;  2V93 A;  3PPO A;  3TZA A;  5H8F A;  3V8X B;  1P1U A;  4LON B;  2HQ0 A;  1CE2 A;  1B1H A;  1NH7 A;  2Y7P A;  3JYR A;  3H3G A;  4F29 A;  3MBP A;  3TCH A;  3K6V A;  4FEB A;  1TFD A;  4AQ4 A;  3IX1 A;  4F2Q A;  2H9B A;  3TTL A;  2REJ A;  2Z22 A;  4I8C A;  2YPN A;  3OO9 A;  1MQJ A;  3T9V A;  1R9L A;  4G68 B;  4RA1 A;  3K01 A;  2PX1 A;  5B7D A;  1Q35 A;  2WKY A;  3H06 B;  3H03 A;  2H4I A;  5K2Y A;  5ITP A;  4POX A;  3E13 X;  3MZB A;  3R6U A;  1MH4 A;  3F11 A;  3C35 A;  3MUQ A;  4KI0 E;  2ONS A;  1MY4 A;  2XXT A;  1R6Z A;  2Y84 A;  5L8D A;  2PYY A;  2NOO A;  4TLL B;  4X9T A;  5EHM A;  4NF8 A;  4F1Y A;  3U8Q A;  2Q89 A;  3FXQ A;  2QMW A;  1QUJ A;  1BKA A;  1EZ9 A;  1AMF A;  2YJP A;  3H6U A;  4U23 A;  3C4M A;  2I4C A;  3RT8 A;  3RY3 A;  3VVF A;  4LVQ A;  4PP0 A;  4OQO A;  1Z7N E;  4DXU A;  3Q28 A;  2VP1 A;  1TT1 A;  4QSD A;  1DSN A;  2QL3 A;  5ISU A;  3VE1 B;  1US5 A;  3G3K A;  2UYF A;  2H25 A;  5A5X A;  3ZS6 A;  5DEX B;  5A5X B;  2LAO A;  5I58 A;  4NMY A;  1P1W A;  3B6T A;  3JV9 A;  4GQO A;  2DVC A;  4HCW A;  4FAJ A;  1N0T A;  4ZEK A;  5H8F B;  2AL4 A;  1ZLQ A;  1B3G A;  4RPN A;  1OQG A;  3C31 A;  3U94 A;  2PT1 A;  1I69 A;  2D5W A;  1FQB A;  1DPE A;  3JZJ A;  3CRB A;  1MDP 1;  3SDF A;  1N76 A;  4FOR A;  3FVO A;  2F6G A;  4NF5 A;  4QFL A;  5H8N A;  3TYH A;  4F31 B;  4OMB A;  1A7L A;  2ZNT A;  2Y7I A;  5EYF A;  3T66 A;  1D3K A;  4F1U A;  2RKM A;  4N6P A;  3FVK A;  3C33 A;  1OIB A;  1UQW A;  3RTW B;  3OOA A;  1FW0 A;  3S9M C;  3VXB A;  3KJT A;  3T9U A;  5BUU A;  1LGB C;  1SDX A;  3K4U A;  3OO8 A;  1B5J A;  1HSJ A;  2THI A;  2UVI A;  3C36 A;  4OFJ A;  1UTB B;  2NWJ A;  4O3C A;  3FVN A;  2F7B A;  2F36 A;  1JEV A;  3QUJ A;  4NF8 B;  5CMB A;  4Q8R A;  2OBG A;  1QKB A;  3G3J A;  1D4N A;  4L17 A;  3K1M A;  2XX9 A;  3FIR A;  5KDT B;  1PB9 A;  1UIV A;  1XT8 A;  1YAE A;  2F7A A;  4EF1 A;  1FQF A;  3HHG A;  3H6T A;  4EQB A;  5L9S A;  2YLN A;  3KN7 A;  1JEU A;  5KCJ B;  3MZ1 A;  2F5X A;  3RUM A;  5HM4 B;  4H6D A;  2NVU B;  2PMS A;  2Z8E A;  1Y3N A;  4XKR A;  4RPO A;  1MM6 A;  4BDN A;  1JET A;  1FTO A;  3MVZ A;  2I0B A;  4YB6 A;  1Q1K A;  3KN8 A;  1MQG A;  3FXR A;  1FQD A;  2G93 A;  1NFT A;  2O6A A;  3CVG A;  3IR1 A;  4IGR A;  4JDF A;  1MXY A;  3TKD A;  2DSF A;  1UTB A;  4R2F A;  1N7W A;  5AA1 A;  1EU8 A;  4XKQ A;  3OSQ A;  4H8I A;  4ZEI A;  1LFI A;  5L9O A;  1MXU A;  3UK4 A;  1FTL A;  1OLC A;  2O7I A;  2Q2C A;  2HXW A;  3CSG A;  4ELO A;  2I48 A;  3TQW A;  4G4P A;  3IO4 A;  1LAG E;  3C32 A;  1M5F A;  4GL0 A;  2ONK E;  1B7H A;  3WAF A;  3CFZ A;  3BKI B;  4OVJ A;  2A5S A;  3MPK A;  1NL5 A;  3N94 A;  1DTG A;  4AB5 A;  1MY1 A;  1Z7M E;  3HHF A;  5CC2 A;  2F6P A;  1Y4C A;  1PEB A;  4HW8 A;  3EHS A;  3I5O A;  5LOM A;  1GTK A;  3QYT A;  4NED A;  3R7X A;  3TTR A;  4LP2 B;  5AE4 A;  2OWS A;  3KN3 A;  2AIX A;  3IO6 A;  1IUD A;  4E0W A;  3OD7 A;  3FVG A;  4OER A;  1B0H A;  1R9Q A;  2F7C A;  4GWO A;  4YB7 A;  3VVD A;  3ZKL A;  3O6G A;  3BFU A;  1MXV A;  3KFM A;  3CR9 A;  5DEX A;  1TXF A;  4I9D A;  2VD2 A;  2ZYM A;  1LST A;  4JWO A;  2O51 A;  2DWA A;  5TU0 A;  1M5C A;  3DM0 A;  4IO2 A;  5CMK A;  1EZO A;  1B6H A;  1MQI A;  3LC8 A;  1IXH A;  4DIG A;  3T22 A;  4R9F A;  1B05 A;  1US4 A;  3CG1 A;  2XHD A;  3MP1 A;  2DS9 A;  3H6V A;  2IA4 A;  2I0C A;  3CFX A;  4PFT A;  4EUO A;  4R9G A;  2DE4 A;  4ESW A;  3DEL B;  3THI A;  1S7Y A;  1LB8 A;  3QXM A;  2XXI A;  3TAJ A;  1URD A;  4GIZ A;  1IEJ A;  4YAH X;  3D4C A;  2F97 A;  3V89 B;  1MXX A;  5I59 B;  5CBR A;  1UTH A;  1ELJ A;  2QS3 A;  3G3G A;  1OLA A;  2ZYK A;  4R6K A;  5ICQ A;  3UIF A;  1POT A;  1S50 A;  3MP8 A;  4OFL A;  4I62 A;  4ZEC A;  4IO6 A;  1MY0 A;  4YKP A;  5F7V A;  3TOD A;  5BWJ A;  1XVX A;  4GF8 A;  3N5L A;  5FHM A;  1II5 A;  4QFP A;  4JSD A;  1IQ7 A;  2HAV A;  2I49 A;  2R9J A;  3HV1 A;  4WKM A;  2Q9T A;  4ZEB A;  3B6Q A;  3O6I A;  3HST A;  3PGF A;  4F3B A;  3E4R A;  4ZE8 A;  3FV1 A;  4G2Z A;  4RNS A;  3ZSF A;  4KD5 A;  1N3X A;  4NE4 A;  1SI1 A;  2I58 A;  2ZMB A;  4DZ1 A;  3PMW A;  4LQ5 A;  1GV8 A;  4TQU Q;  2X7P A;  3LR1 A;  5KDT A;  1B4Z A;  3FJM A;  1RYX A;  1FQA A;  2Z8D A;  4YMB A;  2QSX A;  4KFQ A;  2FA7 A;  4NWD A;  3UP9 A;  4RXL A;  1JQF A;  1MRP A;  2RF1 A;  4FJP A;  5KCJ A;  1P1O A;  1WOD A;  3H4Z A;  1UTH B;  1Y3P A; 
#chains in the Genus database with same CATH topology
 1SVX B;  4XXU A;  4MNI A;  3OMB A;  5AA4 B;  2QS4 A;  1Y20 A;  3FXB A;  1NV4 A;  4N13 A;  1B32 A;  3M3F A;  3UA8 A;  1B3L A;  2P3V A;  3GXA A;  2DDK A;  3MVY A;  5I58 B;  1NKX A;  4YKK A;  3EHU A;  3Q26 A;  1FBC A;  5FBP A;  4DXC A;  2WBB A;  3DLN A;  4QSC A;  5H8Q A;  4GX6 A;  1B5I A;  2HXR A;  3PUZ E;  4UA8 A;  5DW8 A;  1N84 A;  2B4L A;  1A8F A;  5EYH A;  4YKI A;  3T93 B;  3KJ7 A;  4EQ7 A;  4OHN A;  4H45 A;  3D1R A;  1JW4 A;  3OEK A;  4NTL A;  4XF5 A;  2D3I A;  3C34 A;  2ZYN A;  3HN0 A;  3I6V A;  3WAE A;  4HCY A;  4MNC A;  1FPF A;  1B58 A;  1QUI A;  4WXJ A;  1Y1Z A;  2VPN A;  4ECF A;  4F3G A;  2X26 A;  1B9J A;  1Y4T A;  2I6E A;  4NWC A;  1P1Q A;  1EYI A;  3K1N A;  3U65 A;  5CMC A;  4OET A;  2NXO A;  1IMD A;  1B46 A;  4PFI A;  3USD A;  3IL1 B;  5AA4 A;  2XXX A;  2CMO A;  1VFD A;  2GRV A;  2VOZ A;  4EF2 A;  1IMB A;  4BDR A;  3K1P A;  5CMM A;  4NGU A;  1D9V A;  4MLV A;  4OTE A;  1B0L A;  4R6Y A;  4MH5 A;  4OVT A;  5EYG A;  3DP4 A;  1Y3Q A;  2L5V A;  1BK4 A;  2IEE A;  4XKN A;  2ZXT A;  4OXV A;  5DT6 A;  4IB2 A;  3MP6 A;  2RC7 A;  3LV0 A;  5I2K A;  4P1E A;  5ET6 A;  3KOT A;  3EKI A;  2DVZ A;  4QFK A;  4G61 A;  3EHT A;  3IOU A;  1UIU A;  1MQH A;  1OQH A;  4KPT A;  1JVX A;  4OEV A;  3VXC A;  1KZ8 A;  4G8M A;  4N17 A;  3BFT A;  3W15 C;  3OO7 A;  3GBB A;  4F2O A;  2O68 A;  4LUB A;  2O7U A;  4PET A;  2R71 A;  4H46 A;  4GL8 A;  1MDQ A;  1OMP A;  2GFE A;  4HS7 A;  4EXK A;  2PFZ A;  3N6U A;  3K0V A;  4NG7 A;  4DDD A;  4THI A;  4BDO A;  1LBZ A;  2P3N A;  4U4S A;  3CFL A;  4JXI A;  3CHG A;  1IMC A;  5TPA B;  4JVI A;  5AA2 D;  2XXV A;  3OEL A;  2FHY A;  4GWZ A;  3EPE A;  2XXQ A;  4MMP A;  3PPQ A;  1Y1M A;  3O97 A;  4O8M A;  3BBR A;  3SZP A;  2ESN A;  3T1B A;  3C9H A;  2F8D A;  4ISU A;  4U21 A;  3MW0 A;  2UYE A;  3W9W A;  1YZ0 A;  1YCJ A;  4ND9 A;  4R2B A;  2O1L A;  3B7D A;  3ROJ A;  3ILU B;  4IO4 A;  1HSE A;  5H8H A;  5J1D A;  2OK2 A;  2I3W A;  3PV0 E;  4GBV A;  3FJG A;  4GXS B;  1NV5 A;  4BDL A;  1DPP A;  5FHO A;  3RNN A;  2F3D A;  2W7Y A;  1AH5 A;  4FBP A;  4TLM B;  4OEN A;  1LBV A;  2BJI A;  1M5E A;  2OLB A;  1MXW A;  4PAI A;  4YU0 A;  3TPA A;  3PMX A;  3G3F A;  3L6H A;  4LZ8 A;  4U1O A;  4GWU A;  1SW2 A;  5I2K B;  2PVU A;  2ZYO A;  2Y7K A;  3KZG A;  1B1X A;  3Q27 A;  1A55 A;  1O64 A;  5H8Q B;  5ELV A;  5IZ3 B;  3E78 A;  1I6A A;  2DYX A;  3S9L C;  2QFL A;  1NNK A;  3PPO A;  1P1U A;  4LON B;  4F2Q A;  2H9B A;  2Z22 A;  4LN5 A;  4G68 B;  3K01 A;  5B7D A;  3H06 B;  1MH4 A;  3MUQ A;  2ONS A;  1MY4 A;  2PYY A;  4TLL B;  4NF8 A;  3U8Q A;  3FXQ A;  3C4M A;  3IFC A;  3RY3 A;  3VVF A;  4PP0 A;  1TT1 A;  3VE1 B;  5A5X B;  5A5X A;  5DEX B;  4MCO A;  5I58 A;  1P1W A;  4HCW A;  4GQO A;  2DVC A;  5H8F B;  3C31 A;  3U94 A;  2PT1 A;  1I69 A;  2D5W A;  1FQB A;  1N76 A;  4NF5 A;  4QFL A;  2ZNT A;  2Y7I A;  2RKM A;  1FPI A;  2THI A;  1UTB B;  4Q8R A;  2OBG A;  1QKB A;  4EQB A;  3KN7 A;  3MZ1 A;  3BIH A;  4H6D A;  2NVU B;  1Y3N A;  4XKR A;  4RPO A;  1MM6 A;  3MVZ A;  1FTO A;  4YB6 A;  2I0B A;  1MXY A;  3TKD A;  1K9Y A;  2CZH A;  4G4P A;  3CFZ A;  2A5S A;  3N94 A;  1Z7M E;  1Y4C A;  4NED A;  3R7X A;  4YB7 A;  3BIG A;  3ZKL A;  3O6G A;  3BFU A;  1MXV A;  3CR9 A;  5TU0 A;  1NV3 A;  5CMK A;  4DIG A;  3MP1 A;  4ESW A;  4DI3 D;  5IGA A;  3V89 B;  2QS3 A;  5ET7 A;  4R6K A;  5ICQ A;  3UIF A;  3MP8 A;  4I62 A;  4ZEC A;  5F7V A;  2I49 A;  3HV1 A;  4WKM A;  3PGF A;  1EYK A;  4G2Z A;  4KD5 A;  3PMW A;  1NV0 A;  4TQU Q;  5KDT A;  3FJM A;  1FQA A;  2QSX A;  4DI4 B;  2FA7 A;  4RXL A;  5ESY A;  4IR8 A;  1MRP A;  2Y5L A;  4FJP A;  3MAM A;  4IGT A;  3OXN A;  2V3U A;  4E0X A;  1FTM A;  2XXU A;  4G77 A;  4DXB A;  3OEN A;  4TOZ A;  4OFO A;  3TTM A;  4F19 A;  4XTC Q;  1RYO A;  2HFB A;  3PUW E;  3SEY A;  4OVP A;  3FD3 A;  4PQJ A;  5DVJ A;  1P1N A;  1DMB A;  4EXL A;  3TEP A;  4PDD A;  4P9K A;  2Y5K A;  3IK6 B;  4WED A;  3MVX A;  1NV6 A;  1BLF A;  3RLF E;  4PFB A;  1LLS A;  4YIC A;  1ZKB A;  1F9B A;  3IOV A;  2DE3 A;  5DVI A;  1MY2 A;  2B3B A;  1N7X A;  1ZMG A;  3MJN A;  3K6W A;  3TMG A;  4HTG A;  4MNP A;  2PFY A;  5HPQ A;  3A3U A;  3IOR A;  4FED A;  3L6G A;  4YKJ A;  1PB7 A;  5I59 A;  1FRP A;  3S4U A;  3PPN A;  4H67 A;  5I57 A;  5JTY B;  2Z23 A;  4IY5 A;  5FTI A;  5I56 A;  5I84 A;  3DP6 A;  3IB2 A;  1MPC A;  3RYD A;  4ESX A;  3T96 B;  3B8B A;  2ALU A;  3U72 A;  5AA3 A;  3S9N C;  1MPD A;  4O3B A;  4F3S A;  1FTJ A;  1URG A;  1ZBM A;  4U4X A;  3O6H A;  1NH8 A;  4N15 A;  4DLD A;  1I6B A;  4H65 A;  4KYD A;  1TWY A;  1N04 A;  3B6W A;  1USY H;  1XOC A;  3NOH A;  4F22 A;  2OWT A;  1B51 A;  3E9X A;  3UN6 A;  3KC1 A;  3A3C A;  4MAG A;  4R72 A;  3U92 A;  1B2H A;  4H0W A;  1LBW A;  3UOR A;  2ZZX A;  4P11 A;  1QUL A;  2B65 A;  1QW0 A;  3MWB A;  4ELR A;  1IXG A;  2QJE A;  1ZU0 A;  5T3J A;  1FCK A;  1PBQ A;  3KG2 A;  1H3D A;  4OVS A;  2ZNS A;  4LAT A;  3K02 A;  4GLI A;  2PCR A;  5IZZ A;  3SKP A;  3U93 A;  4M1V A;  1NNT A;  2VHA A;  4PAF A;  4IO3 A;  4BDQ A;  5ITO A;  3IOT A;  2QVV A;  4RJZ A;  1LAH E;  3SEX A;  2HHM A;  4GBW A;  5TPA A;  4Q0C A;  1D9Q A;  3IAZ A;  4FEC A;  5DTB A;  3SEW A;  2OCU A;  2XXW A;  3IJO B;  2XXH A;  4F3P A;  1OVB A;  1NV7 A;  1B4H A;  4ELQ A;  1RKM A;  2F3B A;  4ZE9 A;  1A99 A;  4NF0 A;  3FAS A;  3O29 A;  2QMX A;  4R74 A;  1GVC A;  3A29 A;  3KGC A;  4PBQ A;  4QRZ A;  1TFA A;  1VR5 A;  1NV1 A;  4DCY A;  4H5G A;  4YB5 A;  2R8T A;  5I5P A;  1FPK A;  5CBS A;  4O94 A;  1GGG A;  1FPJ A;  4P0G A;  2XXP A;  1SQY A;  3RPL B;  3RTF B;  3IJX B;  2KQZ A;  3KSX A;  1SW4 A;  1P99 A;  5H8N B;  2P1S A;  4C1T A;  1INP A;  3VLV A;  3U1O A;  2HZK A;  4JWY A;  4QXD A;  2GQ1 A;  1QUK A;  2Q2A A;  5IZ3 A;  1Y9U A;  5L9M A;  1B3E A;  1WDN A;  3RN8 A;  4QF9 A;  3O28 A;  4KCD A;  1DTZ A;  1YPN A;  2QS2 A;  2KR0 A;  4G68 A;  4R6H A;  1MY3 A;  2WYK A;  1PC3 A;  4PE5 B;  3KOS A;  1RDY A;  5F1Q A;  1FPB A;  2XX8 A;  2CZK A;  2F34 A;  1R1N A;  5JTY A;  2FNC A;  2AYS A;  4Z0I A;  3H7M A;  4P56 A;  3QSL A;  3K00 A;  1FBH A;  2FIE A;  1WVJ A;  2XA5 A;  4ZZE A;  1CB6 A;  3O66 A;  3G3I A;  3G3H A;  4RY1 A;  1D9Y A;  2CEY A;  3MPL A;  2VT5 A;  2E1S A;  3N26 A;  3VDF A;  5H8F A;  1HSL A;  2HQ0 A;  4PTK A;  4FEB A;  1LBX A;  3IX1 A;  4I8C A;  2YPN A;  4NX1 A;  4RA1 A;  3H03 A;  3R6U A;  3F11 A;  4KI0 E;  5L8D A;  1IMA A;  1R6Z A;  4F1Y A;  2VPO A;  1BKA A;  4GWX A;  4U23 A;  4PBH A;  2WEF A;  4LVQ A;  1Z7N E;  4QSD A;  5ISU A;  4HE0 A;  2H25 A;  3ZS6 A;  4NMY A;  1N0T A;  1K9Z A;  3CRB A;  1MDP 1;  3SDF A;  3TYH A;  3IFA A;  1A7L A;  5EYF A;  3T66 A;  4F1U A;  1D3K A;  4N6P A;  2XWV A;  5EQ7 A;  3FVK A;  4GWS A;  1FW0 A;  3T9U A;  1SDX A;  3OO8 A;  5KDT B;  1UIV A;  1XT8 A;  2F7A A;  4EF1 A;  1SPI A;  2F5X A;  3RUM A;  5BUU A;  5ICT A;  1JET A;  3IR1 A;  3FXR A;  2G93 A;  2DSF A;  4XKQ A;  3OSQ A;  4ZEI A;  5L9O A;  3UK4 A;  1FTL A;  2O7I A;  3CSG A;  1LAG E;  1M5F A;  2ONK E;  4PC9 A;  3WAF A;  1DTG A;  2QVU A;  1MY1 A;  5CC2 A;  2F6P A;  1PEB A;  5LOM A;  3QYT A;  3TTR A;  5EQA A;  3IO6 A;  1IUD A;  1B0H A;  2XHD A;  3CFX A;  2I0C A;  4EUO A;  3DEL B;  4N8Y A;  1S7Y A;  3TAJ A;  2XXI A;  1MXX A;  3G3G A;  4OFL A;  5BWJ A;  1MY0 A;  1XVX A;  1II5 A;  4JSD A;  2HAV A;  3B6Q A;  4F3B A;  4P3L A;  4RNS A;  2I58 A;  2ZMB A;  4DZ1 A;  2B4M A;  3LUZ A;  2RF1 A;  5KCJ A;  1UTH B;  2VGQ A;  3M8U A;  3FV2 A;  1AOV A;  4GD5 A;  1FBD A;  1MPB A;  4POW A;  3E79 A;  4KCC A;  4O7I A;  5A5L A;  3RPL A;  4O3A A;  4GXA A;  2CEX A;  3VV5 A;  2DQV A;  3TDJ A;  1AWB A;  2ZNU A;  4X1D A;  2X7Q A;  4M4G A;  3W9V A;  1FBE A;  4ZED A;  1B3H A;  3HPI A;  1LBY A;  1XC1 A;  3PD9 A;  4ZZA A;  4OZ9 A;  1LBC A;  1H44 A;  4RYA A;  1EZP A;  1SI0 A;  1PDA A;  4OEU A;  1KA0 A;  1NNF A;  1M5D A;  3GZG A;  5HBC A;  4NF6 A;  3VFJ A;  1LAX A;  1XI6 A;  2DXY A;  3MVW A;  4LZ7 A;  4HE2 A;  3Q25 A;  2XD2 A;  3PUX E;  1SBP A;  3RT6 B;  1B5H A;  2O69 A;  1QJM A;  4JVC A;  4OWD A;  5H8S A;  2GHA A;  1FJ6 A;  2VD3 A;  3TCF A;  4F39 A;  3FAT A;  2F78 A;  1PBP A;  2FIX A;  4OYV A;  4ZDM A;  5AA2 A;  4EQ9 A;  2QPQ A;  5KZT A;  2XD3 A;  4AS5 A;  2V3Q A;  3A09 A;  2E0S A;  4NF6 B;  2WX9 A;  1LB9 A;  5CM6 A;  4NN3 A;  4QHQ A;  1SW1 A;  2Z8F A;  3CI8 A;  3PUY E;  3GLB A;  5F24 A;  2O84 X;  4JB7 A;  5M2V A;  1RDX A;  1LEV A;  4N8G A;  2A5T B;  4N07 A;  2B3F A;  2RCB A;  4QBA A;  3TUS A;  4NHB A;  4KHZ E;  5I56 B;  1BTJ A;  1J1N A;  4R73 A;  1DK4 A;  4I3Y A;  1FQE A;  1URS A;  1VSO A;  3SES A;  1MQD A;  4RK2 A;  3KEI A;  2ZZW A;  1NMU A;  4YZZ A;  3SEU A;  4OES A;  2H98 A;  3TTN A;  3TEL A;  3EN3 A;  4PF8 A;  3UGW A;  2DXR A;  2HEU A;  3OO6 A;  1KWH A;  1O7T A;  2ANJ A;  4ELP A;  2WYP A;  3QK6 A;  2PBW A;  1B3F A;  1JNF A;  3O2A A;  3LSF B;  3MZ9 A;  5IM2 A;  3SER A;  1PB8 A;  1USY E;  3DP8 A;  3HCQ A;  3N6T A;  2OWZ A;  1A54 A;  1A8E A;  4EDP A;  3PU5 A;  5DVF A;  4PCD A;  4UAC A;  3LSX A;  3T9H B;  3CSB A;  4R75 A;  3FUZ A;  4KQP A;  4ONY A;  2OJT A;  5CI5 A;  1MS7 A;  5FTH A;  4I40 A;  4OAN A;  3IB0 A;  3KSJ A;  3K6X A;  1H43 A;  1ZTY A;  4MIJ A;  2DWI A;  3SEV A;  1FQC A;  2DWH A;  3SET A;  5B70 A;  4U1Z A;  4P47 A;  1NUZ A;  4PFU A;  1QVS A;  4P0I A;  1SYH A;  4LQ2 A;  3V5A A;  2XXY A;  1JP4 A;  3MQ9 A;  3PD8 A;  4BLA A;  2P0S A;  4F1V A;  4HXV A;  2GHB A;  1NV2 A;  1VE4 A;  4XKP A;  3VLU A;  1MH3 A;  4U2R A;  3LUY A;  2G29 A;  5H8H B;  4XIG Q;  3K2D A;  4BDM A;  1FPD A;  1LBB A;  4PE3 A;  1VFE A;  3O9P A;  2AL5 A;  2FYI A;  2OZZ A;  3CG3 A;  2RC8 A;  1JW5 A;  3TZA A;  3V8X B;  1B1H A;  1NH7 A;  1TFD A;  4AQ4 A;  4OVQ A;  3OO9 A;  1MQJ A;  1R9L A;  2JJK A;  2PX1 A;  2WKY A;  3GYY A;  5K2Y A;  5ITP A;  4POX A;  3MZB A;  2XXT A;  5EHM A;  4X9T A;  1CNQ A;  1QUJ A;  1AMF A;  3H6U A;  2I4C A;  3RT8 A;  4N91 A;  4OQO A;  3Q28 A;  1NI9 A;  2QL3 A;  1US5 A;  2LAO A;  5J16 A;  3B6T A;  4ZEK A;  1ZLQ A;  1B3G A;  4RPN A;  1OQG A;  1DPE A;  3JZJ A;  4F31 B;  4FOR A;  3FVO A;  5H8N A;  2XWO A;  3C33 A;  1UQW A;  3OOA A;  3S9M C;  3KJT A;  1LGB C;  3K4U A;  3C36 A;  2UVI A;  2NWJ A;  3FVN A;  2F7B A;  2F36 A;  1JEV A;  4NF8 B;  4XEQ A;  3G3J A;  4L17 A;  2XX9 A;  3FIR A;  1PB9 A;  1YAE A;  3HHG A;  2YLN A;  2XWI A;  3KBZ A;  4DXU A;  1FQD A;  4JDF A;  4IGR A;  4R2F A;  1EU8 A;  4H8I A;  1LFI A;  1OLC A;  4ELO A;  2I48 A;  3T0J A;  3TQW A;  1B7H A;  3BKI B;  3MPK A;  4AB5 A;  3HHF A;  2FVZ A;  4HW8 A;  3I5O A;  2AIX A;  4E0W A;  3FVG A;  4OER A;  1R9Q A;  4GWO A;  3KFM A;  2ZYM A;  4JWO A;  2O51 A;  2DWA A;  4GX3 A;  3DM0 A;  2ZZV A;  1B6H A;  3KC0 A;  3T22 A;  3CG1 A;  1FTA A;  3H6V A;  4PFT A;  3THI A;  1LB8 A;  1FBG A;  1VDW A;  1IEJ A;  3D4C A;  1UTH A;  1OLA A;  4IO6 A;  4YKP A;  4QFP A;  4ZEB A;  2Q9T A;  3O6I A;  3FV1 A;  3ZSF A;  4NE4 A;  4LQ5 A;  2X7P A;  1RYX A;  2Z8D A;  4YMB A;  4KFQ A;  4NWD A;  3UP9 A;  3S2V A;  1Y3P A;  1LCF A;  2Q8M A;  1FTK A;  4GOT A;  2P2A A;  1SW5 A;  1O63 A;  2XXR A;  4N6D A;  4F18 A;  3PMV A;  2WBD A;  3S9E A;  3LSW A;  5K2X A;  4NAP A;  2Q74 A;  4X48 A;  4PFW A;  4O7M A;  4DE8 A;  1ANF A;  1NUY A;  2QRY A;  2HAU A;  2FBP A;  3ECR A;  5TP9 A;  3B50 A;  1MXZ A;  3M3L A;  1AL3 A;  1FPL A;  1NNP A;  3HO7 A;  4Z7E A;  1IXI A;  2HPG A;  4QFN A;  5DYH A;  1FSA A;  3T9X B;  4MF3 A;  4MEV A;  5I3S A;  1SD3 A;  4G68 C;  4MFI A;  5EQ8 A;  1YXI A;  4I3E A;  3QIM A;  2DWJ A;  3VVE A;  4MX6 A;  2GH9 A;  4FE8 A;  4N81 A;  5JK4 A;  5ET8 A;  2UVG A;  1SYI A;  3IOW A;  4H5F A;  4DCX A;  2DOJ A;  1IZ1 A;  4LZ5 A;  4PGP A;  3RQT A;  1XS5 A;  1LFG A;  3IB1 A;  4ZS9 A;  1FJ9 A;  4I1D A;  3ODB A;  2H5Y A;  3G7W A;  1N3W A;  3KBR A;  5I2N B;  3D4G A;  5TP9 B;  3GBA A;  3ZKK A;  1B52 A;  3MC2 A;  1ATG A;  4RK9 A;  3FXU A;  3Q29 A;  3TTK A;  4G8H A;  2Q88 A;  3OSR A;  2KLF A;  1T0K A;  5IKB A;  2A5T A;  5I57 B;  5EQ9 A;  4FIM A;  1Q9D A;  2DP8 A;  2HCA A;  1BP5 A;  1YTV A;  1H76 A;  4JSO A;  4K3F A;  1XHY A;  4KR5 A;  4KYE A;  4N6K A;  3QAX A;  1XVY A;  1ZIU A;  1B7Z A;  4WEP A;  1B7U A;  1KA1 A;  4IY6 A;  2HZL A;  5IZ1 A;  2RIN A;  2V25 A;  5I7I A;  1LAF E;  3HFU A;  4YMA A;  4C1U A;  1FBF A;  3OEM A;  4NF4 A;  4AB6 A;  4Q5T A;  1NUX A;  4PF6 A;  3ILT B;  4FAT A;  2RC9 A;  1S9T A;  1QKA A;  4GRK A;  2M8C A;  3R26 A;  1POY 1;  1FPE A;  1JW1 A;  1G0I A;  4H1X A;  2BJJ X;  2ONR A;  3CIJ A;  2ABH A;  1BIY A;  4IO5 A;  3RPW A;  4GVO A;  3PPP A;  5IAI A;  4MLQ A;  1IIW A;  4P8B A;  2UVJ A;  2UVH A;  3EF7 A;  1DBZ A;  3P7I A;  5FHN A;  2D21 A;  2V3T A;  2R6G E;  2REG A;  3MYU A;  2XXK A;  2UXA A;  2CZI A;  4PGN A;  4X1B A;  3LSL A;  4GX4 A;  1ZJL A;  3FJ7 A;  3M3K A;  2DE2 A;  2Y7R A;  4NQ8 A;  4Q30 B;  1LCT A;  3EQ1 A;  1JVY A;  4XFE A;  1M5B A;  4PAK A;  2OX3 A;  2Q8J A;  3QUF A;  3FZV A;  4IO7 A;  3PUV E;  3H6W A;  1AIV A;  4NF5 B;  3AXF A;  1MM7 A;  4UAB A;  1L5T A;  4QFO A;  3TQL A;  2V4C A;  1GR2 A;  4QSE A;  4OVR A;  1OVT A;  4H8J A;  2F35 A;  1IXC A;  1IIT A;  4ZEF A;  1LFH A;  2PT2 A;  4KYS A;  3RGY A;  2QS1 A;  2Y7W A;  4MBP A;  3TCG A;  4JWX A;  5JEI A;  3I3V A;  1I6Q A;  2O1M A;  5LDZ A;  3PPR A;  4AS4 A;  1IMF A;  4G8N A;  2I4B A;  5AA2 B;  4MJO A;  1A40 A;  3LBS A;  3K6U A;  3ONM A;  3TFL A;  5I2N A;  2CZL A;  3VLW A;  3FGS A;  2RCA A;  1MG1 A;  2I3V A;  2NUV A;  4NF4 B;  1EH3 A;  3E3K A;  4JBZ A;  3V83 A;  4LA9 A;  4U22 A;  3ISP A;  5CRY A;  4GFR A;  1DOT A;  5EHS A;  2H99 A;  1B40 A;  2XX7 A;  1H45 A;  4C0R A;  4PFY A;  2V84 A;  4JVD A;  2V93 A;  1CE2 A;  3JYR A;  2Y7P A;  4F29 A;  3H3G A;  3MBP A;  3TCH A;  3K6V A;  4PFR A;  3TTL A;  2REJ A;  3T9V A;  1Q35 A;  2H4I A;  3E13 X;  3C35 A;  4KXP A;  2Y84 A;  2NOO A;  2Q89 A;  2QMW A;  1EZ9 A;  2YJP A;  1YYZ A;  2VP1 A;  1DSN A;  3G3K A;  2UYF A;  5LTC A;  1QGX A;  3JV9 A;  4FAJ A;  2AL4 A;  3FBP A;  1RDZ A;  2QVR A;  2F6G A;  4OMB A;  4GWW A;  5ET5 A;  1OIB A;  3RTW B;  3VXB A;  1B5J A;  1HSJ A;  4OFJ A;  4X8R A;  4O3C A;  4OA4 A;  5CMB A;  3QUJ A;  1D4N A;  3K1M A;  1FQF A;  1G0H A;  3H6T A;  4X04 A;  5L9S A;  5KCJ B;  1JEU A;  5HM4 B;  2PMS A;  2Z8E A;  4BDN A;  1Q1K A;  3KN8 A;  1MQG A;  3CVG A;  1NFT A;  2O6A A;  1UTB A;  1N7W A;  5AA1 A;  1DCU A;  1IME A;  1MXU A;  2Q2C A;  2HXW A;  3IO4 A;  3MST A;  3C32 A;  4GL0 A;  4OVJ A;  1NL5 A;  3EHS A;  1FPG A;  1GTK A;  4LP2 B;  5AE4 A;  2OWS A;  3KN3 A;  3OD7 A;  4HE1 A;  2F7C A;  3VVD A;  4PDH A;  4N4U A;  5DEX A;  1TXF A;  4I9D A;  2VD2 A;  1LST A;  1M5C A;  4IO2 A;  1EZO A;  1MQI A;  3LC8 A;  1IXH A;  1NUW A;  4R9F A;  1B05 A;  1US4 A;  2DS9 A;  2IA4 A;  4R9G A;  2DE4 A;  4P1L A;  4MHF A;  3QXM A;  1URD A;  4GIZ A;  4YAH X;  4GWY A;  2F97 A;  5I59 B;  5CBR A;  1ELJ A;  2MKZ A;  2ZYK A;  1POT A;  1S50 A;  3TOD A;  4GF8 A;  3N5L A;  5FHM A;  1IQ7 A;  2R9J A;  3PTY A;  3HST A;  3E4R A;  4ZE8 A;  1EYJ A;  1N3X A;  1SI1 A;  1GV8 A;  3LR1 A;  1B4Z A;  3QMF A;  2XWK A;  1JQF A;  1FBP A;  1P1O A;  1WOD A;  3H4Z A; 
#chains in the Genus database with same CATH homology
 1SVX B;  2VGQ A;  4XXU A;  4IGT A;  3M8U A;  3FV2 A;  1LCF A;  3OXN A;  2V3U A;  1FTK A;  3OMB A;  4GOT A;  4E0X A;  5AA4 B;  1FTM A;  2QS4 A;  2XXU A;  2P2A A;  4G77 A;  4DXB A;  3OEN A;  4TOZ A;  1Y20 A;  4GD5 A;  4OFO A;  3TTM A;  1SW5 A;  1O63 A;  1MPB A;  2XXR A;  4POW A;  4F19 A;  4XTC Q;  4F18 A;  3PMV A;  4N13 A;  1RYO A;  1B32 A;  3S9E A;  5ICT A;  3M3F A;  2HFB A;  3UA8 A;  3PUW E;  1B3L A;  3LSW A;  4KCC A;  3SEY A;  5K2X A;  3FD3 A;  3SEW A;  3GXA A;  3MVY A;  4X48 A;  4PFW A;  4PQJ A;  5DVJ A;  5I58 B;  1P1N A;  1DMB A;  4DE8 A;  4EXL A;  1ANF A;  3TEP A;  1NKX A;  4O3A A;  2QRY A;  4YKK A;  2HAU A;  4GXA A;  3EHU A;  3IK6 B;  3Q26 A;  4WED A;  4DXC A;  3MVX A;  4M1V A;  3VV5 A;  3ECR A;  5TP9 A;  1MXZ A;  1BLF A;  3DLN A;  3M3L A;  4QSC A;  3RLF E;  2DQV A;  3TDJ A;  1AL3 A;  1LLS A;  5H8Q A;  1NNP A;  3HO7 A;  4YIC A;  1ZKB A;  1F9B A;  4Z7E A;  1IXI A;  1B5I A;  3IOV A;  2ZNU A;  2DE3 A;  4QFN A;  4X1D A;  5DYH A;  2X7Q A;  3PUZ E;  4M4G A;  3W9V A;  3T9X B;  4MF3 A;  4ZED A;  4UA8 A;  1SD3 A;  5DVI A;  1B3H A;  1MY2 A;  3HPI A;  4G68 C;  1N84 A;  4MFI A;  1XC1 A;  1A8F A;  2B3B A;  1N7X A;  1ZMG A;  3PD9 A;  3MJN A;  4ZZA A;  4OZ9 A;  1LBC A;  4YKI A;  3QIM A;  3T93 B;  1H44 A;  3K6W A;  4RYA A;  1SI0 A;  2DWJ A;  3TMG A;  3KJ7 A;  1EZP A;  1PDA A;  4OHN A;  4OEU A;  3VVE A;  1NNF A;  2GH9 A;  4FE8 A;  4EQ7 A;  1M5D A;  5JK4 A;  4HTG A;  5HPQ A;  3GZG A;  1JW4 A;  3OEK A;  4NTL A;  3A3U A;  4NF6 A;  5HBC A;  3IOR A;  2UVG A;  3VFJ A;  1LAX A;  4FED A;  2DXY A;  3L6G A;  4YKJ A;  1SYI A;  2D3I A;  3IOW A;  1PB7 A;  2DOJ A;  3MVW A;  4H5F A;  1IZ1 A;  4LZ7 A;  4DCX A;  3Q25 A;  5I59 A;  4LZ5 A;  3RQT A;  1XS5 A;  1LFG A;  2XD2 A;  2ZYN A;  3C34 A;  3IB1 A;  3PUX E;  3S4U A;  3HN0 A;  3I6V A;  4ZS9 A;  3WAE A;  1SBP A;  4HCY A;  3RT6 B;  1B5H A;  3PPN A;  4I1D A;  2O69 A;  1B58 A;  1QJM A;  3ODB A;  1QUI A;  2H5Y A;  3G7W A;  1N3W A;  3KBR A;  4H67 A;  1Y1Z A;  4WXJ A;  5JTY B;  3D4G A;  2Z23 A;  5TP9 B;  3GBA A;  5I2N B;  5I57 A;  4IY5 A;  4ECF A;  4OWD A;  5FTI A;  3ZKK A;  4F3G A;  5I56 A;  2X26 A;  1B9J A;  5I84 A;  5H8S A;  1B52 A;  1Y4T A;  2GHA A;  3DP6 A;  3IB2 A;  2I6E A;  1MPC A;  4NWC A;  3MC2 A;  1P1Q A;  1ATG A;  2VD3 A;  3FXU A;  3Q29 A;  4RK9 A;  3TCF A;  4G8H A;  3TTK A;  2Q88 A;  3OSR A;  2KLF A;  4ESX A;  3K1N A;  3T96 B;  3FAT A;  2F78 A;  4OET A;  5CMC A;  3S2V A;  4F39 A;  1PBP A;  2ALU A;  2NXO A;  1T0K A;  4OYV A;  5IKB A;  3U72 A;  1B46 A;  2A5T A;  5AA3 A;  5I57 B;  3S9N C;  4ZDM A;  1MPD A;  4FIM A;  4O3B A;  2DP8 A;  5AA2 A;  4F3S A;  2HCA A;  1FTJ A;  1BP5 A;  1URG A;  1ZBM A;  3USD A;  3IL1 B;  4EQ9 A;  1YTV A;  1H76 A;  4JSO A;  4U4X A;  5AA4 A;  3O6H A;  2XXX A;  4K3F A;  2CMO A;  1NH8 A;  1VFD A;  4DLD A;  1I6B A;  1XHY A;  2QPQ A;  4H65 A;  5KZT A;  4KYD A;  2GRV A;  4KR5 A;  2XD3 A;  1TWY A;  4KYE A;  2VOZ A;  4EF2 A;  1N04 A;  3B6W A;  3QAX A;  1USY H;  4BDR A;  2V3Q A;  1XOC A;  3A09 A;  1XVY A;  2E0S A;  4NF6 B;  1ZIU A;  3K1P A;  4F22 A;  1B7Z A;  2OWT A;  5CMM A;  1B51 A;  3E9X A;  4WEP A;  3UN6 A;  1D9V A;  1B7U A;  4MLV A;  5FHN A;  4IY6 A;  4OTE A;  1B0L A;  2HZL A;  3A3C A;  4R6Y A;  4MH5 A;  4R72 A;  1LB9 A;  5CM6 A;  2RIN A;  4QHQ A;  3U92 A;  1B2H A;  1SW1 A;  2Z8F A;  4H0W A;  3CI8 A;  3PUY E;  3DP4 A;  3GLB A;  1Y3Q A;  3UOR A;  4P11 A;  2V25 A;  2IEE A;  4XKN A;  2B65 A;  1QUL A;  2O84 X;  4JB7 A;  5M2V A;  1QW0 A;  1LAF E;  2ZXT A;  3MWB A;  4ELR A;  2A5T B;  4YMA A;  4OXV A;  1IXG A;  2QJE A;  4C1U A;  5DT6 A;  4IB2 A;  3OEM A;  4N07 A;  4NF4 A;  4AB6 A;  4Q5T A;  3MP6 A;  1ZU0 A;  2B3F A;  3ILT B;  1FCK A;  1PBQ A;  1S9T A;  1QKA A;  2RC7 A;  2RC9 A;  4GRK A;  2RCB A;  4FAT A;  3KG2 A;  5I2K A;  3TUS A;  1H3D A;  2ZNS A;  4KHZ E;  2M8C A;  4LAT A;  3K02 A;  3KOT A;  3R26 A;  4GLI A;  2DVZ A;  5I56 B;  1BTJ A;  1POY 1;  4QFK A;  3SKP A;  1J1N A;  3EHT A;  3U93 A;  1FQE A;  3IOU A;  1JW1 A;  4R73 A;  1URS A;  1VSO A;  3SES A;  4H1X A;  2BJJ X;  1NNT A;  2VHA A;  1UIU A;  2ONR A;  4IO3 A;  1MQH A;  1MQD A;  1OQH A;  4BDQ A;  3CIJ A;  4RK2 A;  3KEI A;  2ABH A;  4KPT A;  1BIY A;  1NMU A;  5ITO A;  3IOT A;  4YZZ A;  4RJZ A;  1JVX A;  3SEU A;  4OEV A;  3VXC A;  4OES A;  2H98 A;  1LAH E;  3TTN A;  3TEL A;  3EN3 A;  3SEX A;  3UGW A;  2DXR A;  4G8M A;  4IO5 A;  5TPA A;  4Q0C A;  2HEU A;  3BFT A;  3OO6 A;  1KWH A;  3W15 C;  1O7T A;  3RPW A;  2ANJ A;  4ELP A;  3IAZ A;  4GVO A;  3PPP A;  3OO7 A;  4FEC A;  5IAI A;  3GBB A;  4F2O A;  5DTB A;  2O68 A;  2OCU A;  4LUB A;  2O7U A;  4MLQ A;  2XXW A;  1IIW A;  2XXH A;  2UVJ A;  3IJO B;  1OVB A;  4PET A;  2UVH A;  4F3P A;  2R71 A;  3QK6 A;  3EF7 A;  3P7I A;  2PBW A;  2D21 A;  4GL8 A;  1B3F A;  1MDQ A;  1B4H A;  1JNF A;  1OMP A;  2R6G E;  2REG A;  1RKM A;  2GFE A;  2V3T A;  3O2A A;  4HS7 A;  4ELQ A;  4EXK A;  4ZE9 A;  2UXA A;  1A99 A;  3LSF B;  3MZ9 A;  3FAS A;  4X1B A;  3O29 A;  2QMX A;  3N6U A;  4R74 A;  1GVC A;  3SER A;  1PB8 A;  3K0V A;  3KGC A;  4DDD A;  1USY E;  4THI A;  3LSL A;  3DP8 A;  4QRZ A;  4BDO A;  1ZJL A;  3HCQ A;  4U4S A;  3FJ7 A;  3CFL A;  1TFA A;  4JXI A;  3N6T A;  1VR5 A;  2DE2 A;  3M3K A;  2Y7R A;  4DCY A;  4H5G A;  1A54 A;  4YB5 A;  1A8E A;  4Q30 B;  1LCT A;  4EDP A;  3PU5 A;  5DVF A;  3EQ1 A;  5TPA B;  5AA2 D;  2XXV A;  3OEL A;  4UAC A;  5CBS A;  1JVY A;  1M5B A;  3EPE A;  2XXQ A;  3CSB A;  3LSX A;  3PPQ A;  4R75 A;  3T9H B;  3FUZ A;  1Y1M A;  2Q8J A;  3O97 A;  1GGG A;  4KQP A;  3QUF A;  3FZV A;  4IO7 A;  4ONY A;  3BBR A;  3PUV E;  2XXP A;  3H6W A;  2OJT A;  2ESN A;  1SQY A;  4P0G A;  5CI5 A;  1AIV A;  3RTF B;  3IJX B;  3KSX A;  1SW4 A;  2F8D A;  3C9H A;  1P99 A;  3AXF A;  4NF5 B;  5H8N B;  1MS7 A;  1MM7 A;  2P1S A;  5FTH A;  1L5T A;  4QFO A;  4C1T A;  3VLV A;  4ISU A;  3IB0 A;  3MW0 A;  2UYE A;  3KSJ A;  4U21 A;  3TQL A;  1GR2 A;  4QSE A;  3U1O A;  2HZK A;  3K6X A;  1H43 A;  1OVT A;  4H8J A;  2F35 A;  1IXC A;  3W9W A;  1IIT A;  1ZTY A;  4ZEF A;  1LFH A;  2DWI A;  3SEV A;  1YCJ A;  2PT2 A;  4JWY A;  4ND9 A;  4KYS A;  3RGY A;  2QS1 A;  4R2B A;  2O1L A;  2Y7W A;  1FQC A;  4MBP A;  2DWH A;  3B7D A;  3SET A;  3TCG A;  1QUK A;  4JWX A;  3ILU B;  4IO4 A;  5B70 A;  1HSE A;  2Q2A A;  5H8H A;  1Y9U A;  5L9M A;  1B3E A;  5JEI A;  5J1D A;  2OK2 A;  2I3W A;  3PV0 E;  4U1Z A;  1WDN A;  3I3V A;  3FJG A;  1I6Q A;  2O1M A;  4GXS B;  3RN8 A;  4QF9 A;  4BDL A;  3O28 A;  4KCD A;  1DPP A;  5FHO A;  3PPR A;  1DTZ A;  1YPN A;  2QS2 A;  3RNN A;  2W7Y A;  1AH5 A;  4G68 A;  4PFU A;  4R6H A;  1MY3 A;  1QVS A;  4TLM B;  1PC3 A;  4PE5 B;  4OEN A;  4G8N A;  4P0I A;  1M5E A;  3KOS A;  1SYH A;  2I4B A;  5AA2 B;  4LQ2 A;  2OLB A;  1MXW A;  2XXY A;  3V5A A;  5F1Q A;  3MQ9 A;  4YU0 A;  1A40 A;  3TPA A;  3LBS A;  3PMX A;  3PD8 A;  3G3F A;  3K6U A;  4BLA A;  3ONM A;  2XX8 A;  2P0S A;  3L6H A;  2F34 A;  4LZ8 A;  1R1N A;  3TFL A;  4F1V A;  2CZL A;  4U1O A;  5I2N A;  5JTY A;  2GHB A;  3VLW A;  3FGS A;  2FNC A;  1SW2 A;  2AYS A;  5I2K B;  2RCA A;  2PVU A;  4Z0I A;  1VE4 A;  1MG1 A;  3H7M A;  2I3V A;  4XKP A;  3QSL A;  3VLU A;  1MH3 A;  2NUV A;  3K00 A;  4NF4 B;  2ZYO A;  3LUY A;  4U2R A;  2Y7K A;  2G29 A;  1EH3 A;  3E3K A;  4JBZ A;  4XIG Q;  3K2D A;  1WVJ A;  3KZG A;  5H8H B;  1AOV A;  3V83 A;  1B1X A;  3Q27 A;  4LA9 A;  4U22 A;  4BDM A;  4ZZE A;  1CB6 A;  3O66 A;  3G3I A;  1A55 A;  5CRY A;  4GFR A;  1O64 A;  1DOT A;  5EHS A;  5H8Q B;  1LBB A;  2H99 A;  1B40 A;  3G3H A;  5ELV A;  1VFE A;  2XX7 A;  1D9Y A;  4RY1 A;  1H45 A;  3MAM A;  3O9P A;  2AL5 A;  2FYI A;  3MPL A;  4C0R A;  4PFY A;  1I6A A;  2DYX A;  2OZZ A;  2V84 A;  3CG3 A;  3S9L C;  2E1S A;  3N26 A;  1NNK A;  2RC8 A;  3VDF A;  1JW5 A;  1HSL A;  2V93 A;  3PPO A;  3TZA A;  5H8F A;  3V8X B;  1P1U A;  4LON B;  2HQ0 A;  1CE2 A;  1B1H A;  1NH7 A;  2Y7P A;  3JYR A;  3H3G A;  4F29 A;  3MBP A;  3TCH A;  3K6V A;  4FEB A;  1TFD A;  4AQ4 A;  3IX1 A;  4F2Q A;  2H9B A;  3TTL A;  2REJ A;  2Z22 A;  4I8C A;  2YPN A;  3OO9 A;  1MQJ A;  3T9V A;  1R9L A;  4G68 B;  4RA1 A;  3K01 A;  2PX1 A;  5B7D A;  1Q35 A;  2WKY A;  3H06 B;  3H03 A;  2H4I A;  5K2Y A;  5ITP A;  4POX A;  3E13 X;  3MZB A;  3R6U A;  1MH4 A;  3F11 A;  3C35 A;  3MUQ A;  4KI0 E;  2ONS A;  1MY4 A;  2XXT A;  1R6Z A;  2Y84 A;  5L8D A;  2PYY A;  2NOO A;  4TLL B;  4X9T A;  5EHM A;  4NF8 A;  4F1Y A;  3U8Q A;  2Q89 A;  3FXQ A;  2QMW A;  1QUJ A;  1BKA A;  1EZ9 A;  1AMF A;  2YJP A;  3H6U A;  4U23 A;  3C4M A;  2I4C A;  3RT8 A;  3RY3 A;  3VVF A;  4LVQ A;  4PP0 A;  4OQO A;  1Z7N E;  4DXU A;  3Q28 A;  2VP1 A;  1TT1 A;  4QSD A;  1DSN A;  2QL3 A;  5ISU A;  3VE1 B;  1US5 A;  3G3K A;  2UYF A;  2H25 A;  5A5X A;  3ZS6 A;  5DEX B;  5A5X B;  2LAO A;  5I58 A;  4NMY A;  1P1W A;  3B6T A;  3JV9 A;  4GQO A;  2DVC A;  4HCW A;  4FAJ A;  1N0T A;  4ZEK A;  5H8F B;  2AL4 A;  1ZLQ A;  1B3G A;  4RPN A;  1OQG A;  3C31 A;  3U94 A;  2PT1 A;  1I69 A;  2D5W A;  1FQB A;  1DPE A;  3JZJ A;  3CRB A;  1MDP 1;  3SDF A;  1N76 A;  4FOR A;  3FVO A;  2F6G A;  4NF5 A;  4QFL A;  5H8N A;  3TYH A;  4F31 B;  4OMB A;  1A7L A;  2ZNT A;  2Y7I A;  5EYF A;  3T66 A;  1D3K A;  4F1U A;  2RKM A;  4N6P A;  3FVK A;  3C33 A;  1OIB A;  1UQW A;  3RTW B;  3OOA A;  1FW0 A;  3S9M C;  3VXB A;  3KJT A;  3T9U A;  5BUU A;  1LGB C;  1SDX A;  3K4U A;  3OO8 A;  1B5J A;  1HSJ A;  2THI A;  2UVI A;  3C36 A;  4OFJ A;  1UTB B;  2NWJ A;  4O3C A;  3FVN A;  2F7B A;  2F36 A;  1JEV A;  3QUJ A;  4NF8 B;  5CMB A;  4Q8R A;  2OBG A;  1QKB A;  3G3J A;  1D4N A;  4L17 A;  3K1M A;  2XX9 A;  3FIR A;  5KDT B;  1PB9 A;  1UIV A;  1XT8 A;  1YAE A;  2F7A A;  4EF1 A;  1FQF A;  3HHG A;  3H6T A;  4EQB A;  5L9S A;  2YLN A;  3KN7 A;  1JEU A;  5KCJ B;  3MZ1 A;  2F5X A;  3RUM A;  5HM4 B;  4H6D A;  2NVU B;  2PMS A;  2Z8E A;  1Y3N A;  4XKR A;  4RPO A;  1MM6 A;  4BDN A;  1JET A;  1FTO A;  3MVZ A;  2I0B A;  4YB6 A;  1Q1K A;  3KN8 A;  1MQG A;  3FXR A;  1FQD A;  2G93 A;  1NFT A;  2O6A A;  3CVG A;  3IR1 A;  4IGR A;  4JDF A;  1MXY A;  3TKD A;  2DSF A;  1UTB A;  4R2F A;  1N7W A;  5AA1 A;  1EU8 A;  4XKQ A;  3OSQ A;  4H8I A;  4ZEI A;  1LFI A;  5L9O A;  1MXU A;  3UK4 A;  1FTL A;  1OLC A;  2O7I A;  2Q2C A;  2HXW A;  3CSG A;  4ELO A;  2I48 A;  3TQW A;  4G4P A;  3IO4 A;  1LAG E;  3C32 A;  1M5F A;  4GL0 A;  2ONK E;  1B7H A;  3WAF A;  3CFZ A;  3BKI B;  4OVJ A;  2A5S A;  3MPK A;  1NL5 A;  3N94 A;  1DTG A;  4AB5 A;  1MY1 A;  1Z7M E;  3HHF A;  5CC2 A;  2F6P A;  1Y4C A;  1PEB A;  4HW8 A;  3EHS A;  3I5O A;  5LOM A;  1GTK A;  3QYT A;  4NED A;  3R7X A;  3TTR A;  4LP2 B;  5AE4 A;  2OWS A;  3KN3 A;  2AIX A;  3IO6 A;  1IUD A;  4E0W A;  3OD7 A;  3FVG A;  4OER A;  1B0H A;  1R9Q A;  2F7C A;  4GWO A;  4YB7 A;  3VVD A;  3ZKL A;  3O6G A;  3BFU A;  1MXV A;  3KFM A;  3CR9 A;  5DEX A;  1TXF A;  4I9D A;  2VD2 A;  2ZYM A;  1LST A;  4JWO A;  2O51 A;  2DWA A;  5TU0 A;  1M5C A;  3DM0 A;  4IO2 A;  5CMK A;  1EZO A;  1B6H A;  1MQI A;  3LC8 A;  1IXH A;  4DIG A;  3T22 A;  4R9F A;  1B05 A;  1US4 A;  3CG1 A;  2XHD A;  3MP1 A;  2DS9 A;  3H6V A;  2IA4 A;  2I0C A;  3CFX A;  4PFT A;  4EUO A;  4R9G A;  2DE4 A;  4ESW A;  3DEL B;  3THI A;  1S7Y A;  1LB8 A;  3QXM A;  2XXI A;  3TAJ A;  1URD A;  4GIZ A;  1IEJ A;  4YAH X;  3D4C A;  2F97 A;  3V89 B;  1MXX A;  5I59 B;  5CBR A;  1UTH A;  1ELJ A;  2QS3 A;  3G3G A;  1OLA A;  2ZYK A;  4R6K A;  5ICQ A;  3UIF A;  1POT A;  1S50 A;  3MP8 A;  4OFL A;  4I62 A;  4ZEC A;  4IO6 A;  1MY0 A;  4YKP A;  5F7V A;  3TOD A;  5BWJ A;  1XVX A;  4GF8 A;  3N5L A;  5FHM A;  1II5 A;  4QFP A;  4JSD A;  1IQ7 A;  2HAV A;  2I49 A;  2R9J A;  3HV1 A;  4WKM A;  2Q9T A;  4ZEB A;  3B6Q A;  3O6I A;  3HST A;  3PGF A;  4F3B A;  3E4R A;  4ZE8 A;  3FV1 A;  4G2Z A;  4RNS A;  3ZSF A;  4KD5 A;  1N3X A;  4NE4 A;  1SI1 A;  2I58 A;  2ZMB A;  4DZ1 A;  3PMW A;  4LQ5 A;  1GV8 A;  4TQU Q;  2X7P A;  3LR1 A;  5KDT A;  1B4Z A;  3FJM A;  1RYX A;  1FQA A;  2Z8D A;  4YMB A;  2QSX A;  4KFQ A;  2FA7 A;  4NWD A;  3UP9 A;  4RXL A;  1JQF A;  1MRP A;  2RF1 A;  4FJP A;  5KCJ A;  1P1O A;  1WOD A;  3H4Z A;  1UTH B;  1Y3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...