4ZEFA

Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
239
structure length
239
Chain Sequence
ENLYFQGMKKITPKKEKYVIASDSTFAPFEFQNAQGDYVGIDVDLVKRAAELQGFTVEFKFIGFSSAVQAVESGQADGMVAGMTITDDRKKAFDFSVPYFDSGIQIAVKKGNDKIKSYDDLKGKKVGVKIGTESADFLEKNKKKYDYSIKYLDTTDALYSALEIGEVDAMMDDYPVIGYGVAQNQPLATPIPREKGGSYGFAVKKGQNPELLEMFNEGLKEMKRTGEYDKIIGTYVKDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Amino acid ABC transporter amino acid-binding/permease
publication title Crystal structure of substrate binding domain 2 (SBD2) OF ABC transporter GLNPQ from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
total genus 84
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4zefA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4zefA02
3K6XA 1Y1MA 3O6HA 3B7DA 1LAHE 3VDFA 4GLIA 4H8JA 4KPTA 3V5AA 5F7VA 1FW0A 1JW5A 4G4PA 2I4CA 2HXWA 2RCBA 2DVZA 1B3FA 5H8HA 3L6GA 4AB5A 3MZ1A 1PB8A 1GTKA 4KD5A 2AL4A 3KJTA 3C9HA 3USDA 3TMGA 4C0RA 4HS7A 1GR2A 1Y1ZA 4ND9A 4OESA 4LQ5A 4BLAA 1PB7A 4Q0CA 4H0WA 3MWBA 4C1TA 1I6AA 4U2RA 1WDNA 3MVYA 1N3WA 4F2QA 5LOMA 2E0SA 3VVEA 2I3WA 4IGTA 4YKIA 4FEBA 5I58B 3G3JA 1B3GA 2O6AA 3A09A 5M2VA 4F1YA 3PUVE 1LFIA 3CFXA 3KSXA 3OO9A 2DXYA 1QUJA 3CRBA 3CI8A 2V84A 1ZJLA 3QAXA 4Z0IA 2PBWA 3ODBA 3PPRA 5I59B 3RPWA 2Z23A 1DOTA 1MS7A 5I2NB 4G68B 1Y4CA 1JW1A 4U1OA 2I58A 1S7YA 3MJNA 3A3UA 4U1ZA 1B1HA 1SW1A 4KFQA 4GXAA 1B7HA 4HCWA 4N07A 4O3AA 1IIWA 2YJPA 2ZYOA 1M5FA 4EF1A 2VHAA 2XXTA 2O7UA 1D4NA 4YICA 3O6GA 5FHOA 3IOWA 1A8EA 4RXLA 1D9YA 1SBPA 4IO2A 4IGRA 4IO5A 5EYFA 1MDP1 3JV9A 4YKKA 4EQ9A 4DE8A 1DTGA 1H44A 3T9UA 2DVCA 2RINA 4LA9A 4R9FA 2I3VA 3TDJA 4ZE9A 1FTOA 3H6WA 4U21A 4GQOA 4Z7EA 3G3HA 3PPPA 4YU0A 3MW0A 2QJEA 1N04A 4ZECA 3VLUA 3QK6A 4F1UA 4AB6A 4YZZA 3GBAA 1URGA 3TTKA 1N7XA 2XX7A 4OMBA 2DWJA 1O64A 2QMXA 2GH9A 3QUFA 2ONRA 1UTBB 2XXIA 3M3FA 5DYHA 5CI5A 5KCJA 5I57B 1LBCA 5CMBA 3W9VA 1Q1KA 1Y3QA 1Q35A 4DZ1A 1MY4A 4PETA 4EXKA 2RC8A 1A55A 4JWYA 3VXCA 2CZLA 4U23A 3DP6A 1EZ9A 3O97A 1Y3NA 3PPQA 3RQTA 2H5YA 5L8DA 1TFAA 4DIGA 4F29A 1WODA 4BDQA 4NF6A 3EF7A 3OENA 4XXUA 4RYAA 4TQUQ 3TTRA 1MPCA 1B3LA 1NKXA 4O3BA 3FZVA 2PT2A 3IR1A 4NE4A 4ISUA 1IZ1A 2Y7WA 1QUIA 3K00A 4IY6A 1MPDA 1ANFA 2HFBA 3QUJA 1LCFA 4PFUA 4QHQA 3U1OA 1FTLA 2YPNA 4ZEFA 4WKMA 2BJJX 4QSCA 3W9WA 3QIMA 1FQCA 1NH8A 2OJTA 2R71A 4ZZEA 5FTIA 4TOZA 1H43A 1USYE 3T66A 1B4HA 4ECFA 4I62A 2XHDA 5DTBA 1EH3A 2NWJA 5BUUA 1FQAA 3ZS6A 2DP8A 4BDOA 5IKBA 2HQ0A 1PBQA 3N5LA 4NF4B 3Q28A 5AA1A 1BP5A 3D4GA 1Z7ME 4BDNA 3MUQA 1R6ZA 3I3VA 5I59A 3OEMA 2Y84A 3TYHA 1QULA 3OO7A 2ZYNA 4DDDA 4GVOA 1YCJA 4H6DA 4G68A 5CMCA 2UYFA 2V3TA 4TLLB 1WVJA 2ESNA 5AA4B 5EHSA 4U4XA 2Z22A 3FUZA 1PEBA 3TELA 3T22A 3C35A 5CMMA 3OO8A 2W7YA 3V8XB 2FYIA 3B6QA 4P0GA 4R72A 4Q8RA 1NNPA 4M1VA 3H6VA 4OQOA 4TLMB 4H8IA 1IITA 3VV5A 5TP9A 3OSQA 1UTHB 4Q30B 4R74A 3H4ZA 2F7BA 3EN3A 4OTEA 1B7UA 1QJMA 2F6GA 1O63A 1OMPA 2KLFA 3BFUA 3QXMA 4FJPA 2RF1A 2XXRA 1LFGA 1MY3A 2RKMA 4FIMA 1MXUA 2OWTA 2DS9A 3VFJA 4H1XA 3FXQA 3MP1A 1JQFA 5B7DA 2DQVA 3RGYA 4PFTA 2DWHA 1ZU0A 3U94A 4DCXA 1LGBC 1MY2A 2B3FA 3OD7A 3LSLA 3IO6A 3R26A 5FTHA 4ZEBA 3PD9A 2ANJA 3IAZA 4FEDA 3K01A 1KWHA 3I5OA 3TQLA 3SEYA 4R6KA 3E4RA 2ZNTA 5I57A 1TT1A 1JVXA 3K6VA 5H8QB 3H03A 5A5XB 4PQJA 2XD2A 3MPLA 1PB9A 1CB6A 4DXCA 4KHZE 1NMUA 1IEJA 1P1NA 1M5DA 1IXGA 4LZ8A 1R9LA 3MVZA 1CE2A 2OZZA 3FJMA 3UP9A 1MXVA 3A3CA 3IOUA 3SERA 4K3FA 1RYXA 1AOVA 1N84A 1MH4A 3VLVA 5CMKA 1SD3A 5TU0A 2THIA 1B0HA 4I9DA 3DP4A 2O7IA 3IOTA 4LZ5A 3Q26A 4EDPA 1IXHA 1ZIUA 3P7IA 3T9XB 1B32A 1MRPA 2X7QA 5DT6A 4F1VA 1B05A 2X26A 5CM6A 1DPEA 4XTCQ 4H5GA 1N3XA 3DELB 1ELJA 1TWYA 1MQGA 2QPQA 5TPAB 3TZAA 2NOOA 2XXYA 2Y7PA 1FQDA 3IX1A 3ILUB 4QFLA 3EHUA 3RT8A 2O68A 3CFZA 4KCDA 1D3KA 5AA2B 4YKPA 4N13A 1LCTA 5ITOA 3K6WA 1JVYA 4QFKA 1O7TA 5I56A 1FQEA 3ZKLA 2F78A 5HM4B 3E13X 4BDMA 3MP8A 2Q8JA 1VFDA 3C36A 2UVIA 3N94A 4NF5B 1GV8A 2R9JA 2G93A 4NF4A 4E0XA 1MM7A 5I84A 1POY1 1SDXA 2O1LA 1FQFA 4DCYA 2HAVA 3T9VA 1OLCA 3CFLA 3K02A 5EHMA 2B65A 3HHGA 5H8SA 1QKAA 4YMAA 2XXXA 3K1PA 1P1UA 3VVDA 5CC2A 4F3PA 1LB9A 1A99A 2Z8EA 3GXAA 1USYH 1VFEA 4R6HA 4RA1A 1XT8A 1S9TA 2Q89A 5BWJA 2A5TA 3VE1B 1VR5A 4POWA 3HPIA 1MG1A 3TUSA 3FJGA 3AXFA 2V3QA 4Q5TA 1UTHA 4C1UA 1SI1A 2Q2AA 1M5CA 3SEUA 1P1WA 1A40A 1MY0A 2O69A 2PT1A 3CR9A 2F6PA 4QFOA 4X9TA 3CG3A 2F35A 1RKMA 1QVSA 1VE4A 2OLBA 2YLNA 4JBZA 1NFTA 4RJZA 4KYSA 5CBRA 1N76A 3ZKKA 4GWOA 5I2KA 3SESA 1L5TA 2F7CA 4OFJA 1XHYA 4LVQA 4OEVA 4F22A 5KDTB 4KCCA 2DWAA 4BDLA 3LUYA 4NMYA 4HW8A 1P1QA 1N0TA 4LZ7A 2PYYA 2QS3A 4IY5A 3CG1A 2Q2CA 4F3GA 3TPAA 3KG2A 4EQ7A 1ZTYA 5H8QA 1I6BA 5A5XA 2VD2A 3S9EA 4G8NA 2AL5A 5AA2D 2I6EA 2GHAA 4ONYA 4QFNA 2AYSA 4G8HA 3QYTA 3U92A 2OCUA 1MQIA 4H67A 1BTJA 3TQWA 1B1XA 3H06B 4ZEDA 3PMVA 2I49A 1TXFA 3MQ9A 3TTMA 1B5JA 2G29A 3LSXA 3FGSA 3KZGA 3DLNA 3PUYE 2F36A 4QFPA 1RYOA 1M5BA 4R6YA 1DTZA 4MFIA 3K0VA 1MQJA 4ZEKA 1UIVA 1B2HA 5K2XA 3IJOB 4RK9A 4YKJA 2Y7KA 3B6TA 2XD3A 3KN8A 3O6IA 4PE5B 1NNKA 4LP2B 4IO6A 3N6UA 5ICTA 3OMBA 4KYEA 5H8HB 1JW4A 4XIGQ 4MF3A 4F3BA 4DXBA 4OYVA 4XKQA 5AA2A 3ILTB 3V89B 4FAJA 3G7WA 2PX1A 5ELVA 4F3SA 3EHTA 2OWSA 2XXQA 1YTVA 2D5WA 5I58A 1HSJA 4I1DA 4NF5A 1MXXA 1YAEA 5F1QA 3RY3A 2VOZA 2VD3A 4P0IA 1NNTA 3MVWA 2ZXTA 3PUZE 4H5FA 3UK4A 3MBPA 2D3IA 3VXBA 3TCFA 5AE4A 3FV2A 1A7LA 4ELRA 5H8NB 4R73A 4POXA 3UN6A 3S9NC 1AIVA 2WKYA 1LSTA 5DVIA 5I2NA 2F5XA 4UACA 3OO6A 4G8MA 1YPNA 2DWIA 1Y3PA 4U4SA 4NTLA 3GLBA 3PPNA 3T96B 3TCHA 1B3HA 5JTYB 1PBPA 1OVTA 1SW4A 4G68C 1NH7A 4OERA 5K2YA 4F39A 2VGQA 4OFLA 1DPPA 2XXVA 1ZLQA 4QSEA 4OXVA 3RT6B 4EF2A 2I0BA 3PU5A 3T9HB 3K2DA 1B5HA 2HCAA 3C33A 3GZGA 1J1NA 3JZJA 3RTFB 3OXNA 2NVUB 1OVBA 1Y20A 1UQWA 2RC7A 3PUXE 3FVKA 3DM0A 4MBPA 1H45A 1B9JA 2GRVA 3R7XA 4ZZAA 3MZ9A 4NF8B 4YB5A 3Q27A 3RUMA 5KDTA 2H99A 3BKIB 1H76A 3SEWA 4ZEIA 3FVGA 1LAGE 2IEEA 1B0LA 4IO3A 3KEIA 1UTBA 4JSDA 3C34A 3RTWB 4NWDA 3W15C 3G3GA 3TTNA 5FHMA 4QRZA 1MDQA 5ICQA 2XX8A 1JNFA 3E9XA 3IORA 4ZDMA 4ZS9A 2OBGA 3K1MA 3Q29A 1B7ZA 3FXUA 4THIA 4KI0E 5KCJB 1URDA 4GFRA 2Q88A 2ABHA 1XOCA 4ELQA 4MLQA 2R6GE 3HSTA 3FATA 1D9VA 3BFTA 2DE2A 4GL0A 3SEXA 4O3CA 4KQPA 3EHSA 1XVXA 1ZKBA 3TKDA 5ITPA 4FORA 1A8FA 5J1DA 4E0WA 4EQBA 4NF6B 3FJ7A 4LONB 3TTLA 1B5IA 3KBRA 2DXRA 5B70A 3EQ1A 5FHNA 3L6HA 1B58A 3KN7A 3M3KA 4LUBA 2F8DA 3FASA 3S2VA 1B40A 1FTMA 4PFWA 3N6TA 3IJXB 1JEUA 4G2ZA 4R9GA 3H6TA 3PGFA 1B3EA 4QF9A 4U22A 2HZLA 3OEKA 3H3GA 1OIBA 3O28A 4GIZA 4GXSB 1IXCA 1Y4TA 1LBBA 1OLAA 3FV1A 1I6QA 2QS1A 1MQHA 2XXWA 2FA7A 3UA8A 5L9SA 4X1BA 1Z7NE 3ECRA 1IUDA 3FVOA 3M3LA 1F9BA 1EZPA 1EU8A 5L9MA 4JXIA 3C31A 2XXHA 2Y7RA 4OVJA 1LFHA 1EZOA 4EUOA 3FXRA 3QSLA 3SETA 2UXAA 3PMXA 2AIXA 5DEXB 3OOAA 2HZKA 4OFOA 1LB8A 3VVFA 3O29A 5H8NA 4H65A 4JB7A 3WAFA 1T0KA 2FNCA 2ONKE 4RK2A 4NEDA 1Y9UA 1BIYA 1ZBMA 2Z8DA 4FECA 4NWCA 4IO7A 3U72A 3MPKA 5AA4A 3G3FA 4PFYA 2IA4A 3B6WA 5AA3A 3MAMA 4GF8A 5JTYA 2P1SA 4FE8A 2OK2A 1B46A 2P2AA 1XS5A 3S9MC 1I69A 1N7WA 2NUVA 2I48A 5HBCA 4IO4A 3TEPA 1HSLA 3O9PA 1II5A 1GGGA 3H6UA 3OSRA 2D21A 3S9LC 2VP1A 4OZ9A 5TP9B 5L9OA 2DYXA 2QS4A 1SW2A 4JWOA 2H4IA 4ELPA 4LATA 5JEIA 2F97A 4NF8A 5H8FB 2A5SA 3UIFA 3K1NA 2ZNUA 3KSJA 4JDFA 1PDAA 4HTGA 2ZNSA 3U8QA 2QS2A 5CBSA 1SI0A 4BDRA 3ZSFA 2ONSA 2GFEA 2X7PA 2V25A 4RPOA 3D4CA 1MQDA 4RNSA 3N26A 5JK4A 4OETA 1ZMGA 5IAIA 2QMWA 4KR5A 3IB2A 2XXPA 1A54A 2I4BA 3WAEA 3CVGA 3CSBA 1ATGA 1R1NA 2F34A 2HAUA 1IQ7A 3IO4A 3LC8A 1UIUA 1US4A 4UA8A 4X1DA 1FQBA 4JWXA 3TFLA 3O2AA 2REGA 4RY1A 2B3BA 3M8UA 3TAJA 4R2FA 4F31B 4MLVA 2O1MA 3RNNA 3MVXA 3T93B 2PVUA 4HCYA 1MXZA 1B51A 2PMSA 3IB1A 2ZMBA 3KGCA 3PUWE 3C32A 3PPOA 1NL5A 2RCAA 3EPEA 5ISUA 3HCQA 3TODA 3VLWA 3THIA 1HSEA 1PC3A 3KFMA 2DOJA 1XVYA 1MXYA 4WEDA 1QW0A 3PMWA 4ELOA 5TPAA 3U93A 4GOTA 1R9QA 1M5EA 3G3IA 1OQHA 4F18A 4QSDA 1H3DA 3FVNA 3KOSA 3KN3A 3SKPA 3IK6B 2Q9TA 2H25A 2QL3A 1QUKA 3O66A 3S4UA 1P99A 3RLFE 4I8CA 1SW5A 1AMFA 4MH5A 3UORA 3HN0A 2P0SA 3IL1B 1P1OA 3C4MA 3R6UA 3V83A 3MZBA 3FD3A 2Y7IA 4IB2A 1SYIA 4F19A 5DEXA 5I56B 1S50A 1VSOA 3E3KA 4RPNA 1QKBA 3SDFA 2Z8FA 5CRYA 4P11A 4XKNA 4ZE8A 2M8CA 2UVHA 4R75A 4DXUA 4F2OA 2UVJA 3OELA 4R2BA 2DE3A 4EXLA 4GL8A 2O51A 4ESWA 3BBRA 2ZYKA 2QSXA 1MH3A 1US5A 2QRYA 3K4UA 1TFDA 1URSA 4YB6A 1SQYA 1MM6A 3F11A 4GRKA 2F7AA 3TCGA 1LAFE 4PP0A 4WEPA 2HEUA 3SEVA 4L17A 1XC1A 2ZYMA 3DP8A 2V3UA 4OEUA 2A5TB 3H7MA 4FATA 1LAXA 1B52A 3K6UA 2H9BA 3I6VA 5DVFA 4AQ4A 4YAHX 1FTKA 2REJA 3LSFB 4OHNA 2UYEA 3UGWA 3FIRA 5H8FA 5KZTA 3IB0A 2CMOA 2I0CA 2GHBA 2XXUA 1AH5A 3MC2A 4X48A 4YB7A 3PD8A 1MPBA 2XX9A 3LSWA 2NXOA 4GD5A 2DE4A 1SVXB 4OWDA 1B6HA 3HHFA 5I2KB 3RN8A 3IOVA 1MY1A 3CIJA 2ALUA 1AL3A 3LR1A 4WXJA 1NNFA 4KYDA 1GVCA 1SYHA 4DLDA 3GBBA 3HV1A 4ESXA 2RC9A 3KJ7A 3KOTA 2O84X 2DSFA 3PV0E 4LQ2A 4OENA 5HPQA 1B4ZA 3ONMA 4G77A 1IXIA 1BLFA 2V93A 1POTA 3MP6A 3CSGA 2UVGA 3HO7A 4M4GA 1LLSA 2H98A 1DMBA 3LBSA 1JETA 2E1SA 1JEVA 1FTJA 4XKRA 3G3KA 5DVJA 1BKAA 3Q25A 1FCKA 1MXWA 1OQGA 1DSNA 4JSOA 4N6PA 4XKPA 4YMBA 2LAOA 3JYRA
chains in the Genus database with same CATH superfamily
3K6XA 1Y1MA 3O6HA 3BIHA 1RDZA 3B7DA 1LAHE 3VDFA 4GLIA 4H8JA 4KPTA 3V5AA 5F7VA 1FW0A 1JW5A 4G4PA 2I4CA 2HXWA 4OA4A 4N17A 2RCBA 2DVZA 1B3FA 5H8HA 3L6GA 1YXIA 4AB5A 3MZ1A 1PB8A 1GTKA 2KR0A 4KD5A 4XFEA 4HXVA 2AL4A 3HFUA 3KJTA 3C9HA 4MAGA 3USDA 3TMGA 4C0RA 4HS7A 2XWVA 2WBDA 1GR2A 1Y1ZA 3U65A 4ND9A 4OESA 4LQ5A 4MMPA 4BLAA 1PB7A 4Q0CA 4H0WA 3MWBA 4C1TA 1I6AA 4U2RA 1WDNA 3MVYA 3NOHA 1N3WA 4F2QA 5LOMA 2R8TA 2E0SA 3VVEA 4PGPA 2Q8MA 2I3WA 4IGTA 4YKIA 4FEBA 5I58B 3G3JA 1FRPA 1NV3A 1B3GA 4GWUA 2O6AA 3A09A 5M2VA 4F1YA 3PUVE 1LFIA 3CFXA 3KSXA 3OO9A 2DXYA 1QUJA 3CRBA 3CI8A 2V84A 1ZJLA 3QAXA 4Z0IA 2KQZA 2PBWA 3ODBA 3PPRA 3MYUA 5I59B 3RPWA 2Z23A 1FBFA 1DOTA 5DW8A 1MS7A 5I2NB 4G68B 1Y4CA 1JW1A 4U1OA 2I58A 1S7YA 2XWIA 3MJNA 3A3UA 4PCDA 4U1ZA 1B1HA 1SW1A 4X04A 4KFQA 2PFYA 4GXAA 1B7HA 4HCWA 4N07A 4O3AA 1IIWA 2YJPA 2ZYOA 1M5FA 4EF1A 2VHAA 2V4CA 2XXTA 2O7UA 1K9YA 1D4NA 5EQAA 1NV0A 4YICA 3O6GA 5FHOA 3IOWA 1A8EA 4RXLA 4PC9A 1D9YA 1SBPA 4IO2A 4IGRA 4IO5A 5EYFA 1MDP1 3JV9A 4YKKA 4EQ9A 4DE8A 1DTGA 1H44A 2RINA 2DVCA 3T9UA 4LA9A 4R9FA 2I3VA 4P8BA 3TDJA 4ZE9A 3LV0A 1FTOA 3KC1A 3H6WA 4U21A 4GQOA 4Z7EA 3ROJA 3G3HA 4JVDA 3PPPA 4YU0A 3MW0A 2QJEA 4MNPA 1YZ0A 1N04A 4ZECA 3VLUA 3QK6A 4F1UA 4AB6A 4YZZA 2FVZA 3GBAA 1URGA 3TTKA 1N7XA 2XX7A 2OX3A 4OMBA 2DWJA 1O64A 2QMXA 2GH9A 3QUFA 2ONRA 1AWBA 4MJOA 1UTBB 4DI4B 2XXIA 3M3FA 5DYHA 5CI5A 5KCJA 5I57B 1LBCA 4HE0A 5CMBA 3W9VA 1Q1KA 1Y3QA 1Q35A 4DZ1A 1MY4A 4PETA 1IMCA 4EXKA 2RC8A 1A55A 4JWYA 3VXCA 2CZLA 4U23A 3DP6A 1EZ9A 3O97A 1Y3NA 3PPQA 1NV4A 3RQTA 2H5YA 5L8DA 1TFAA 4N8GA 4DIGA 4F29A 1WODA 4BDQA 4NF6A 3EF7A 3OENA 4XXUA 4RYAA 4TQUQ 3TTRA 1MPCA 2WBBA 1B3LA 1NKXA 2XXKA 4O3BA 3FZVA 2PT2A 3IR1A 4PDDA 4NE4A 4ISUA 1IZ1A 2Y7WA 1QUIA 3K00A 4IY6A 1MPDA 1ANFA 2HFBA 3QUJA 5ET6A 1LCFA 4PFUA 1NUZA 4QHQA 3U1OA 1FTLA 2YPNA 4ZEFA 1LBXA 4WKMA 2BJJX 4QSCA 3E78A 3W9WA 3QIMA 1FQCA 2MKZA 5IZ3B 1NH8A 4P3LA 2OJTA 2R71A 1EYJA 4ZZEA 5FTIA 4TOZA 1H43A 5EYHA 3QMFA 1USYE 3T66A 1B4HA 4ECFA 4I62A 2XHDA 5DTBA 1EH3A 2NWJA 5BUUA 1FQAA 3ZS6A 2DP8A 4BDOA 5IKBA 2HQ0A 1FPDA 1PBQA 4GBVA 3N5LA 4QBAA 2B4LA 4NF4B 3IFCA 3Q28A 5AA1A 1BP5A 3D4GA 1Z7ME 5IZZA 4BDNA 4PBQA 3MUQA 4GWWA 1R6ZA 1INPA 3I3VA 5I59A 3OEMA 2Y84A 3TYHA 1QULA 3OO7A 2ZYNA 1FPKA 4DDDA 1FBCA 1FJ9A 4GVOA 1YCJA 4PGNA 4H6DA 4G68A 1JP4A 2ZZWA 5CMCA 2UYFA 2V3TA 3BIGA 4TLLB 5I5PA 1WVJA 2ESNA 5AA4B 5EHSA 2VPOA 4U4XA 2Z22A 3FUZA 1PEBA 3TELA 3T22A 3C35A 5CMMA 3OO8A 2W7YA 3V8XB 2FYIA 3B6QA 4P0GA 4R72A 4Q8RA 1NNPA 4M1VA 3H6VA 2WYKA 4OQOA 4TLMB 4H8IA 5T3JA 1IITA 3VV5A 5TP9A 3OSQA 1UTHB 4Q30B 1FJ6A 4R74A 3H4ZA 2F7BA 3EN3A 4OTEA 1SPIA 1B7UA 1DBZA 1QJMA 2F6GA 1O63A 1OMPA 2KLFA 3BFUA 3QXMA 4FJPA 2RF1A 2XXRA 1LFGA 1MY3A 2RKMA 4FIMA 1MXUA 2OWTA 2DS9A 3VFJA 4H1XA 3FXQA 3MP1A 1JQFA 5B7DA 2DQVA 3RGYA 4PFTA 2DWHA 3RPLB 2DDKA 1ZU0A 3U94A 4DCXA 2QFLA 1LGBC 1MY2A 2B3FA 3OD7A 1NV5A 3LSLA 3IO6A 4N6DA 3R26A 5FTHA 4GBWA 4ZEBA 4FBPA 3PD9A 2ANJA 3IAZA 4FEDA 3K01A 1KWHA 3I5OA 4OVQA 3TQLA 3SEYA 4R6KA 3E4RA 2ZNTA 5I57A 1TT1A 1JVXA 3K6VA 5H8QB 3H03A 5A5XB 4PQJA 3EKIA 2XD2A 3MPLA 1PB9A 1G0HA 1IMBA 1CB6A 4DXCA 4KHZE 1NMUA 1IEJA 1P1NA 1M5DA 4PDHA 1IXGA 4LZ8A 1R9LA 2OWZA 3MVZA 1CE2A 4PE3A 2OZZA 3FJMA 3UP9A 1MXVA 3A3CA 3IOUA 4O8MA 3SERA 4K3FA 4NG7A 1RYXA 1AOVA 1N84A 1MH4A 3VLVA 3SZPA 4HE2A 5CMKA 4NQ8A 1SD3A 5TU0A 1IMDA 2THIA 1B0HA 4I9DA 3DP4A 2O7IA 2L5VA 3IOTA 3Q26A 4LZ5A 1IXHA 4EDPA 1ZIUA 3P7IA 5ET5A 3T9XB 1B32A 1MRPA 2X7QA 4MEVA 5DT6A 4F1VA 1B05A 4PFIA 2X26A 5CM6A 1DPEA 4XTCQ 4H5GA 1N3XA 3DELB 1ELJA 5EQ9A 1RDXA 1TWYA 1MQGA 3T0JA 2QPQA 5TPAB 3TZAA 2NOOA 2XXYA 2Y7PA 1FQDA 3IX1A 3ILUB 4QFLA 3EHUA 3RT8A 1QGXA 2O68A 3CFZA 4KCDA 1D3KA 5AA2B 4YKPA 4N13A 1LCTA 5ITOA 3K6WA 1JVYA 4QFKA 5LTCA 1O7TA 5I56A 1FQEA 4I3EA 3ZKLA 2F78A 5HM4B 3E13X 4BDMA 3MP8A 2Q8JA 1VFDA 3C36A 2UVIA 3N94A 4NF5B 1GV8A 2R9JA 2G93A 2VPNA 4NF4A 1FPEA 4E0XA 1LBWA 1MM7A 5I84A 1POY1 1SDXA 2O1LA 1FQFA 4DCYA 2HAVA 3T9VA 1OLCA 3CFLA 4PF8A 3K02A 2HHMA 5EHMA 2B65A 4OVPA 3HHGA 4N81A 5H8SA 1QKAA 4YMAA 2XXXA 3K1PA 1P1UA 3VVDA 5CC2A 4F3PA 1LB9A 1A99A 4N91A 5ET7A 2Z8EA 3GXAA 1USYH 1VFEA 5F24A 4R6HA 4RA1A 4OVTA 1XT8A 1S9TA 2Q89A 4O7MA 4PBHA 5BWJA 2A5TA 4N4UA 3VE1B 1VR5A 4POWA 2B4MA 3HPIA 1MG1A 3TUSA 3FJGA 3AXFA 2V3QA 4PFBA 4Q5TA 1UTHA 4C1UA 1DCUA 1SI1A 2Q2AA 1M5CA 3SEUA 5IGAA 1EYIA 1P1WA 4P1LA 1A40A 1MY0A 2O69A 2PT1A 3CR9A 2F6PA 4QFOA 4X9TA 4LN5A 3CG3A 2F35A 1RKMA 1QVSA 1VE4A 2OLBA 2YLNA 4JBZA 1NFTA 4RJZA 4KYSA 2FIXA 4DI3D 5CBRA 1N76A 3ZKKA 4GWOA 5I2KA 3SESA 1L5TA 2F7CA 4OFJA 1XHYA 4LVQA 4OEVA 3RPLA 4F22A 5ESYA 5KDTB 4KCCA 2DWAA 4BDLA 3LUYA 4NMYA 2F3BA 4HW8A 1P1QA 1N0TA 4LZ7A 2PYYA 2QS3A 4IY5A 3CG1A 2Q2CA 4GWZA 4F3GA 3TPAA 3KG2A 4EQ7A 1ZTYA 5H8QA 1I6BA 5A5XA 4AS4A 2VD2A 3S9EA 5I7IA 4G8NA 1NV6A 2AL5A 5AA2D 2I6EA 2XA5A 1NV2A 4MHFA 2GHAA 1K9ZA 4ONYA 4QFNA 2AYSA 4G8HA 1CNQA 3QYTA 3U92A 2Q74A 2OCUA 1MQIA 4H67A 1BTJA 3D1RA 3TQWA 1B1XA 3H06B 4ZEDA 3PMVA 1FBHA 2I49A 1TXFA 3MQ9A 3TTMA 1B5JA 1RDYA 2G29A 3LSXA 3FGSA 3KZGA 3DLNA 3PUYE 2F36A 4QFPA 4MNIA 1RYOA 2HXRA 1M5BA 4R6YA 1DTZA 4MFIA 3K0VA 1MQJA 4ZEKA 4JVCA 1UIVA 1B2HA 5K2XA 3IJOB 4RK9A 4YKJA 3RYDA 2Y7KA 3B6TA 2XD3A 5EQ8A 3KN8A 3O6IA 3ISPA 4PE5B 1NNKA 2Y5KA 4LP2B 4IO6A 3N6UA 5ICTA 3OMBA 4KYEA 5H8HB 1JW4A 5EQ7A 2CZKA 4XIGQ 4MF3A 4F3BA 4DXBA 4PAFA 4OYVA 4XKQA 5AA2A 3ILTB 3MSTA 4IR8A 3V89B 4QXDA 4FAJA 3G7WA 2PX1A 5ELVA 4F3SA 4MX6A 3EHTA 2OWSA 2XXQA 1YTVA 2D5WA 5I58A 1HSJA 4I1DA 4NF5A 1MXXA 1YAEA 1LBZA 5F1QA 3RY3A 2CEYA 2VOZA 2VD3A 4P0IA 1NNTA 3MVWA 2ZXTA 3PUZE 4H5FA 3UK4A 3KC0A 3MBPA 2D3IA 3VXBA 2WX9A 3TCFA 4P9KA 5AE4A 3FV2A 1A7LA 1Q9DA 4ELRA 4PAIA 5H8NB 4R73A 4POXA 1FPGA 3UN6A 3S9NC 1AIVA 2WKYA 1LSTA 5DVIA 2QVVA 3B50A 5I2NA 2F5XA 2QVRA 4UACA 3OO6A 4G8MA 1BK4A 1YPNA 2DWIA 1Y3PA 4U4SA 1G0IA 4NTLA 3GLBA 3PPNA 3T96B 3TCHA 1B3HA 5JTYB 2QVUA 1PBPA 1OVTA 1SW4A 4G68C 2GQ1A 1NH7A 4OERA 5K2YA 4F39A 2VGQA 4OFLA 4AS5A 1DPPA 2XXVA 1ZLQA 4QSEA 4OXVA 3RT6B 4EF2A 2PFZA 2I0BA 3PU5A 5EYGA 3T9HB 3K2DA 1FTAA 1B5HA 2HCAA 4GX6A 4PFRA 3C33A 3GZGA 1J1NA 3JZJA 3RTFB 3OXNA 2NVUB 1OVBA 1Y20A 1UQWA 2RC7A 3PUXE 3FVKA 3DM0A 4MBPA 1H45A 1B9JA 2GRVA 3R7XA 4MIJA 1LBYA 4ZZAA 1FBGA 3MZ9A 4NF8B 4YB5A 3Q27A 3RUMA 5KDTA 2FBPA 4P47A 4I40A 2H99A 4N6KA 3BKIB 1H76A 3SEWA 4ZEIA 3FVGA 1LAGE 2IEEA 1FPJA 1B0LA 4IO3A 3KEIA 4GWSA 1NUXA 1UTBA 4GX4A 4JSDA 3C34A 3RTWB 4NWDA 3W15C 3G3GA 5FHMA 3TTNA 4QRZA 2F3DA 3FXBA 1MDQA 5ICQA 2XX8A 1JNFA 2VT5A 3E9XA 2WEFA 3IORA 4ZDMA 4ZS9A 2OBGA 1FPIA 3K1MA 3Q29A 2XWOA 1B7ZA 3FXUA 4THIA 4KI0E 5KCJB 1URDA 4GFRA 2Q88A 5I3SA 2ABHA 1XOCA 4ELQA 4MLQA 1FSAA 2R6GE 2CZIA 3HSTA 3FATA 1D9VA 3BFTA 2DE2A 1VDWA 4GL0A 3SEXA 1KZ8A 4O3CA 4KQPA 3EHSA 1XVXA 1ZKBA 4NHBA 3TKDA 5ITPA 4FORA 1A8FA 2Y5LA 5J1DA 4E0WA 4EQBA 4NF6B 4GWXA 3FJ7A 4LONB 3TTLA 2HPGA 1B5IA 3KBRA 2DXRA 5B70A 3EQ1A 5FHNA 3L6HA 1B58A 3KN7A 3M3KA 4LUBA 2F8DA 3FASA 3S2VA 1B40A 1FTMA 4PFWA 4NN3A 1FPLA 3N6TA 3IJXB 1JEUA 4G2ZA 4R9GA 5IZ3A 3H6TA 3PGFA 1B3EA 4QF9A 4U22A 2HZLA 3OEKA 3H3GA 1OIBA 3O28A 4GIZA 4GXSB 4I3YA 1IXCA 4UABA 1Y4TA 1LBBA 1OLAA 3FV1A 1I6QA 1D9QA 2QS1A 1MQHA 2XXWA 2FA7A 3UA8A 5L9SA 4X1BA 1FBPA 1Z7NE 3ECRA 1IUDA 3FVOA 3M3LA 1F9BA 1EZPA 1EU8A 5L9MA 2WYPA 4JXIA 3C31A 2XXHA 2Y7RA 4OVJA 1LFHA 1EZOA 4EUOA 3FXRA 3QSLA 3GYYA 3SETA 2UXAA 3PMXA 2AIXA 5DEXB 3OOAA 2HZKA 4OFOA 1LB8A 3VVFA 3O29A 5H8NA 4H65A 4JB7A 4H45A 3WAFA 1T0KA 2FNCA 2ONKE 4RK2A 4NEDA 1NV1A 1Y9UA 1BIYA 1ZBMA 2Z8DA 4FECA 4NWCA 4IO7A 3U72A 3MPKA 5AA4A 3G3FA 4PFYA 2IA4A 3B6WA 5AA3A 3MAMA 4GF8A 5JTYA 2P1SA 4FE8A 2OK2A 1B46A 2P3NA 2P2AA 1XS5A 4N15A 3S9MC 1I69A 1N7WA 5J16A 2NUVA 4NX1A 2I48A 5HBCA 4IO4A 3TEPA 1HSLA 3O9PA 1II5A 1FBDA 1GGGA 3H6UA 3OSRA 2D21A 3S9LC 2VP1A 3IFAA 4OZ9A 3FBPA 4XEQA 5TP9B 5L9OA 2DYXA 2QS4A 1SW2A 4JWOA 2H4IA 4ELPA 4LATA 1LEVA 1IMEA 5JEIA 5FBPA 2F97A 4NF8A 5H8FB 2A5SA 3UIFA 3K1NA 2ZNUA 3KSJA 4JDFA 1PDAA 4HTGA 2ZNSA 3U8QA 2QS2A 5CBSA 1SI0A 4BDRA 3ZSFA 1YYZA 2ONSA 2GFEA 2X7PA 2V25A 4RPOA 3D4CA 1MQDA 5LDZA 4RNSA 3N26A 5JK4A 4OETA 1ZMGA 2CEXA 5IAIA 2QMWA 4KR5A 3IB2A 2XXPA 1A54A 2I4BA 3WAEA 3CVGA 3CSBA 1ATGA 1FPFA 1R1NA 2F34A 2HAUA 1IQ7A 3IO4A 5A5LA 3LC8A 1UIUA 1NUWA 2ZZXA 4OVSA 3T1BA 1US4A 4UA8A 4X1DA 1FQBA 4JWXA 3TFLA 3O2AA 4O94A 2REGA 4RY1A 2B3BA 3M8UA 3TAJA 4R2FA 4F31B 4O7IA 4MLVA 2O1MA 3RNNA 3MVXA 3T93B 2PVUA 4HCYA 1MXZA 1B51A 2PMSA 1FPBA 3IB1A 2ZMBA 3KGCA 3PUWE 3C32A 4P1EA 3PPOA 1NL5A 2RCAA 3E79A 3EPEA 5ISUA 3HCQA 3TODA 3VLWA 3THIA 1HSEA 1PC3A 3KFMA 2DOJA 1XVYA 1MXYA 4WEDA 1QW0A 3PMWA 4ELOA 5TPAA 3U93A 4GOTA 1R9QA 4PF6A 1M5EA 3G3IA 1OQHA 1NUYA 4QSDA 4F18A 1H3DA 1IMFA 3FVNA 3KOSA 3KN3A 4GWYA 3SKPA 3IK6B 2Q9TA 2H25A 2P3VA 4NGUA 3CHGA 2QL3A 1QUKA 3O66A 3S4UA 1P99A 3RLFE 4GX3A 4I8CA 1SW5A 1AMFA 4MH5A 1NI9A 3HN0A 1NV7A 3UORA 1FBEA 3B8BA 2P0SA 3IL1B 1P1OA 3C4MA 3R6UA 3V83A 3MZBA 3FD3A 2Y7IA 4IB2A 1SYIA 4F19A 5DEXA 5I56B 1LBVA 1S50A 1VSOA 3E3KA 4RPNA 1QKBA 3SDFA 2Z8FA 5CRYA 2FIEA 4P11A 4XKNA 4KXPA 4OVRA 4ZE8A 2M8CA 4HE1A 1KA1A 2UVHA 4R75A 2PCRA 4DXUA 4F2OA 2UVJA 3OELA 4R2BA 2DE3A 4EXLA 4GL8A 2O51A 4ESWA 1EYKA 3BBRA 2ZYKA 2QSXA 1MH3A 1US5A 2QRYA 3A29A 3K4UA 1TFDA 1URSA 4YB6A 1SQYA 1MM6A 3F11A 4GRKA 2F7AA 3TCGA 1LAFE 4PP0A 4MNCA 4WEPA 1XI6A 2HEUA 3SEVA 4L17A 1XC1A 2ZYMA 3DP8A 2V3UA 4OEUA 2A5TB 3H7MA 2CZHA 4FATA 1LAXA 1B52A 3K6UA 2H9BA 3I6VA 5IZ1A 5DVFA 4AQ4A 4YAHX 3PTYA 1FTKA 2REJA 3LSFB 4OHNA 2UYEA 4G61A 1KA0A 3UGWA 2BJIA 3FIRA 5H8FA 5KZTA 3IB0A 2CMOA 2I0CA 4PAKA 2GHBA 2XXUA 1AH5A 3MC2A 2ZZVA 4P56A 4X48A 4YB7A 3PD8A 1MPBA 4MCOA 2XX9A 3LSWA 2NXOA 4GD5A 1DK4A 2DE4A 1SVXB 4OWDA 1B6HA 2XWKA 3HHFA 5I2KB 3RN8A 3IOVA 1MY1A 3CIJA 2ALUA 1AL3A 3LR1A 4PTKA 4WXJA 4X8RA 1NNFA 4KYDA 1GVCA 4N8YA 5IM2A 4JVIA 1SYHA 4DLDA 3GBBA 3HV1A 4ESXA 2RC9A 4OANA 4NF0A 3KJ7A 4XF5A 3KOTA 2O84X 2DSFA 3PV0E 4LQ2A 4OENA 5HPQA 1B4ZA 3ONMA 4G77A 1IXIA 1BLFA 2V93A 5ET8A 4NAPA 1POTA 3MP6A 3CSGA 2UVGA 3HO7A 4M4GA 1LLSA 2H98A 1DMBA 3KBZA 3LBSA 1IMAA 2JJKA 1JETA 2E1SA 1JEVA 1FTJA 4XKRA 2FHYA 3G3KA 5DVJA 1BKAA 3Q25A 1FCKA 1MXWA 1OQGA 1DSNA 4JSOA 4N6PA 4XKPA 3LUZA 4H46A 4YMBA 2LAOA 3JYRA
chains in the Genus database with same CATH topology
3K6XA 1Y1MA 3O6HA 3B7DA 1LAHE 3VDFA 4GLIA 4H8JA 4KPTA 3V5AA 5F7VA 1FW0A 1JW5A 4G4PA 2I4CA 2HXWA 2RCBA 2DVZA 1B3FA 5H8HA 3L6GA 4AB5A 3MZ1A 1PB8A 1GTKA 4KD5A 2AL4A 3KJTA 3C9HA 3USDA 3TMGA 4C0RA 4HS7A 1GR2A 1Y1ZA 4ND9A 4OESA 4LQ5A 4BLAA 1PB7A 4Q0CA 4H0WA 3MWBA 4C1TA 1I6AA 4U2RA 1WDNA 3MVYA 1N3WA 4F2QA 5LOMA 2E0SA 3VVEA 2I3WA 4IGTA 4YKIA 4FEBA 5I58B 3G3JA 1B3GA 2O6AA 3A09A 5M2VA 4F1YA 3PUVE 1LFIA 3CFXA 3KSXA 3OO9A 2DXYA 1QUJA 3CRBA 3CI8A 2V84A 1ZJLA 3QAXA 4Z0IA 2PBWA 3ODBA 3PPRA 5I59B 3RPWA 2Z23A 1DOTA 1MS7A 5I2NB 4G68B 1Y4CA 1JW1A 4U1OA 2I58A 1S7YA 3MJNA 3A3UA 4U1ZA 1B1HA 1SW1A 4KFQA 4GXAA 1B7HA 4HCWA 4N07A 4O3AA 1IIWA 2YJPA 2ZYOA 1M5FA 4EF1A 2VHAA 2XXTA 2O7UA 1D4NA 4YICA 3O6GA 5FHOA 3IOWA 1A8EA 4RXLA 1D9YA 1SBPA 4IO2A 4IGRA 4IO5A 5EYFA 1MDP1 3JV9A 4YKKA 4EQ9A 4DE8A 1DTGA 1H44A 3T9UA 2DVCA 2RINA 4LA9A 4R9FA 2I3VA 3TDJA 4ZE9A 1FTOA 3H6WA 4U21A 4GQOA 4Z7EA 3G3HA 3PPPA 4YU0A 3MW0A 2QJEA 1N04A 4ZECA 3VLUA 3QK6A 4F1UA 4AB6A 4YZZA 3GBAA 1URGA 3TTKA 1N7XA 2XX7A 4OMBA 2DWJA 1O64A 2QMXA 2GH9A 3QUFA 2ONRA 1UTBB 2XXIA 3M3FA 5DYHA 5CI5A 5KCJA 5I57B 1LBCA 5CMBA 3W9VA 1Q1KA 1Y3QA 1Q35A 4DZ1A 1MY4A 4PETA 4EXKA 2RC8A 1A55A 4JWYA 3VXCA 2CZLA 4U23A 3DP6A 1EZ9A 3O97A 1Y3NA 3PPQA 3RQTA 2H5YA 5L8DA 1TFAA 4DIGA 4F29A 1WODA 4BDQA 4NF6A 3EF7A 3OENA 4XXUA 4RYAA 4TQUQ 3TTRA 1MPCA 1B3LA 1NKXA 4O3BA 3FZVA 2PT2A 3IR1A 4NE4A 4ISUA 1IZ1A 2Y7WA 1QUIA 3K00A 4IY6A 1MPDA 1ANFA 2HFBA 3QUJA 1LCFA 4PFUA 4QHQA 3U1OA 1FTLA 2YPNA 4ZEFA 4WKMA 2BJJX 4QSCA 3W9WA 3QIMA 1FQCA 1NH8A 2OJTA 2R71A 4ZZEA 5FTIA 4TOZA 1H43A 1USYE 3T66A 1B4HA 4ECFA 4I62A 2XHDA 5DTBA 1EH3A 2NWJA 5BUUA 1FQAA 3ZS6A 2DP8A 4BDOA 5IKBA 2HQ0A 1PBQA 3N5LA 4NF4B 3Q28A 5AA1A 1BP5A 3D4GA 1Z7ME 4BDNA 3MUQA 1R6ZA 3I3VA 5I59A 3OEMA 2Y84A 3TYHA 1QULA 3OO7A 2ZYNA 4DDDA 4GVOA 1YCJA 4H6DA 4G68A 5CMCA 2UYFA 2V3TA 4TLLB 1WVJA 2ESNA 5AA4B 5EHSA 4U4XA 2Z22A 3FUZA 1PEBA 3TELA 3T22A 3C35A 5CMMA 3OO8A 2W7YA 3V8XB 2FYIA 3B6QA 4P0GA 4R72A 4Q8RA 1NNPA 4M1VA 3H6VA 4OQOA 4TLMB 4H8IA 1IITA 3VV5A 5TP9A 3OSQA 1UTHB 4Q30B 4R74A 3H4ZA 2F7BA 3EN3A 4OTEA 1B7UA 1QJMA 2F6GA 1O63A 1OMPA 2KLFA 3BFUA 3QXMA 4FJPA 2RF1A 2XXRA 1LFGA 1MY3A 2RKMA 4FIMA 1MXUA 2OWTA 2DS9A 3VFJA 4H1XA 3FXQA 3MP1A 1JQFA 5B7DA 2DQVA 3RGYA 4PFTA 2DWHA 1ZU0A 3U94A 4DCXA 1LGBC 1MY2A 2B3FA 3OD7A 3LSLA 3IO6A 3R26A 5FTHA 4ZEBA 3PD9A 2ANJA 3IAZA 4FEDA 3K01A 1KWHA 3I5OA 3TQLA 3SEYA 4R6KA 3E4RA 2ZNTA 5I57A 1TT1A 1JVXA 3K6VA 5H8QB 3H03A 5A5XB 4PQJA 2XD2A 3MPLA 1PB9A 1CB6A 4DXCA 4KHZE 1NMUA 1IEJA 1P1NA 1M5DA 1IXGA 4LZ8A 1R9LA 3MVZA 1CE2A 2OZZA 3FJMA 3UP9A 1MXVA 3A3CA 3IOUA 3SERA 4K3FA 1RYXA 1AOVA 1N84A 1MH4A 3VLVA 5CMKA 1SD3A 5TU0A 2THIA 1B0HA 4I9DA 3DP4A 2O7IA 3IOTA 4LZ5A 3Q26A 4EDPA 1IXHA 1ZIUA 3P7IA 3T9XB 1B32A 1MRPA 2X7QA 5DT6A 4F1VA 1B05A 2X26A 5CM6A 1DPEA 4XTCQ 4H5GA 1N3XA 3DELB 1ELJA 1TWYA 1MQGA 2QPQA 5TPAB 3TZAA 2NOOA 2XXYA 2Y7PA 1FQDA 3IX1A 3ILUB 4QFLA 3EHUA 3RT8A 2O68A 3CFZA 4KCDA 1D3KA 5AA2B 4YKPA 4N13A 1LCTA 5ITOA 3K6WA 1JVYA 4QFKA 1O7TA 5I56A 1FQEA 3ZKLA 2F78A 5HM4B 3E13X 4BDMA 3MP8A 2Q8JA 1VFDA 3C36A 2UVIA 3N94A 4NF5B 1GV8A 2R9JA 2G93A 4NF4A 4E0XA 1MM7A 5I84A 1POY1 1SDXA 2O1LA 1FQFA 4DCYA 2HAVA 3T9VA 1OLCA 3CFLA 3K02A 5EHMA 2B65A 3HHGA 5H8SA 1QKAA 4YMAA 2XXXA 3K1PA 1P1UA 3VVDA 5CC2A 4F3PA 1LB9A 1A99A 2Z8EA 3GXAA 1USYH 1VFEA 4R6HA 4RA1A 1XT8A 1S9TA 2Q89A 5BWJA 2A5TA 3VE1B 1VR5A 4POWA 3HPIA 1MG1A 3TUSA 3FJGA 3AXFA 2V3QA 4Q5TA 1UTHA 4C1UA 1SI1A 2Q2AA 1M5CA 3SEUA 1P1WA 1A40A 1MY0A 2O69A 2PT1A 3CR9A 2F6PA 4QFOA 4X9TA 3CG3A 2F35A 1RKMA 1QVSA 1VE4A 2OLBA 2YLNA 4JBZA 1NFTA 4RJZA 4KYSA 5CBRA 1N76A 3ZKKA 4GWOA 5I2KA 3SESA 1L5TA 2F7CA 4OFJA 1XHYA 4LVQA 4OEVA 4F22A 5KDTB 4KCCA 2DWAA 4BDLA 3LUYA 4NMYA 4HW8A 1P1QA 1N0TA 4LZ7A 2PYYA 2QS3A 4IY5A 3CG1A 2Q2CA 4F3GA 3TPAA 3KG2A 4EQ7A 1ZTYA 5H8QA 1I6BA 5A5XA 2VD2A 3S9EA 4G8NA 2AL5A 5AA2D 2I6EA 2GHAA 4ONYA 4QFNA 2AYSA 4G8HA 3QYTA 3U92A 2OCUA 1MQIA 4H67A 1BTJA 3TQWA 1B1XA 3H06B 4ZEDA 3PMVA 2I49A 1TXFA 3MQ9A 3TTMA 1B5JA 2G29A 3LSXA 3FGSA 3KZGA 3DLNA 3PUYE 2F36A 4QFPA 1RYOA 1M5BA 4R6YA 1DTZA 4MFIA 3K0VA 1MQJA 4ZEKA 1UIVA 1B2HA 5K2XA 3IJOB 4RK9A 4YKJA 2Y7KA 3B6TA 2XD3A 3KN8A 3O6IA 4PE5B 1NNKA 4LP2B 4IO6A 3N6UA 5ICTA 3OMBA 4KYEA 5H8HB 1JW4A 4XIGQ 4MF3A 4F3BA 4DXBA 4OYVA 4XKQA 5AA2A 3ILTB 3V89B 4FAJA 3G7WA 2PX1A 5ELVA 4F3SA 3EHTA 2OWSA 2XXQA 1YTVA 2D5WA 5I58A 1HSJA 4I1DA 4NF5A 1MXXA 1YAEA 5F1QA 3RY3A 2VOZA 2VD3A 4P0IA 1NNTA 3MVWA 2ZXTA 3PUZE 4H5FA 3UK4A 3MBPA 2D3IA 3VXBA 3TCFA 5AE4A 3FV2A 1A7LA 4ELRA 5H8NB 4R73A 4POXA 3UN6A 3S9NC 1AIVA 2WKYA 1LSTA 5DVIA 5I2NA 2F5XA 4UACA 3OO6A 4G8MA 1YPNA 2DWIA 1Y3PA 4U4SA 4NTLA 3GLBA 3PPNA 3T96B 3TCHA 1B3HA 5JTYB 1PBPA 1OVTA 1SW4A 4G68C 1NH7A 4OERA 5K2YA 4F39A 2VGQA 4OFLA 1DPPA 2XXVA 1ZLQA 4QSEA 4OXVA 3RT6B 4EF2A 2I0BA 3PU5A 3T9HB 3K2DA 1B5HA 2HCAA 3C33A 3GZGA 1J1NA 3JZJA 3RTFB 3OXNA 2NVUB 1OVBA 1Y20A 1UQWA 2RC7A 3PUXE 3FVKA 3DM0A 4MBPA 1H45A 1B9JA 2GRVA 3R7XA 4ZZAA 3MZ9A 4NF8B 4YB5A 3Q27A 3RUMA 5KDTA 2H99A 3BKIB 1H76A 3SEWA 4ZEIA 3FVGA 1LAGE 2IEEA 1B0LA 4IO3A 3KEIA 1UTBA 4JSDA 3C34A 3RTWB 4NWDA 3W15C 3G3GA 3TTNA 5FHMA 4QRZA 1MDQA 5ICQA 2XX8A 1JNFA 3E9XA 3IORA 4ZDMA 4ZS9A 2OBGA 3K1MA 3Q29A 1B7ZA 3FXUA 4THIA 4KI0E 5KCJB 1URDA 4GFRA 2Q88A 2ABHA 1XOCA 4ELQA 4MLQA 2R6GE 3HSTA 3FATA 1D9VA 3BFTA 2DE2A 4GL0A 3SEXA 4O3CA 4KQPA 3EHSA 1XVXA 1ZKBA 3TKDA 5ITPA 4FORA 1A8FA 5J1DA 4E0WA 4EQBA 4NF6B 3FJ7A 4LONB 3TTLA 1B5IA 3KBRA 2DXRA 5B70A 3EQ1A 5FHNA 3L6HA 1B58A 3KN7A 3M3KA 4LUBA 2F8DA 3FASA 3S2VA 1B40A 1FTMA 4PFWA 3N6TA 3IJXB 1JEUA 4G2ZA 4R9GA 3H6TA 3PGFA 1B3EA 4QF9A 4U22A 2HZLA 3OEKA 3H3GA 1OIBA 3O28A 4GIZA 4GXSB 1IXCA 1Y4TA 1LBBA 1OLAA 3FV1A 1I6QA 2QS1A 1MQHA 2XXWA 2FA7A 3UA8A 5L9SA 4X1BA 1Z7NE 3ECRA 1IUDA 3FVOA 3M3LA 1F9BA 1EZPA 1EU8A 5L9MA 4JXIA 3C31A 2XXHA 2Y7RA 4OVJA 1LFHA 1EZOA 4EUOA 3FXRA 3QSLA 3SETA 2UXAA 3PMXA 2AIXA 5DEXB 3OOAA 2HZKA 4OFOA 1LB8A 3VVFA 3O29A 5H8NA 4H65A 4JB7A 3WAFA 1T0KA 2FNCA 2ONKE 4RK2A 4NEDA 1Y9UA 1BIYA 1ZBMA 2Z8DA 4FECA 4NWCA 4IO7A 3U72A 3MPKA 5AA4A 3G3FA 4PFYA 2IA4A 3B6WA 5AA3A 3MAMA 4GF8A 5JTYA 2P1SA 4FE8A 2OK2A 1B46A 2P2AA 1XS5A 3S9MC 1I69A 1N7WA 2NUVA 2I48A 5HBCA 4IO4A 3TEPA 1HSLA 3O9PA 1II5A 1GGGA 3H6UA 3OSRA 2D21A 3S9LC 2VP1A 4OZ9A 5TP9B 5L9OA 2DYXA 2QS4A 1SW2A 4JWOA 2H4IA 4ELPA 4LATA 5JEIA 2F97A 4NF8A 5H8FB 2A5SA 3UIFA 3K1NA 2ZNUA 3KSJA 4JDFA 1PDAA 4HTGA 2ZNSA 3U8QA 2QS2A 5CBSA 1SI0A 4BDRA 3ZSFA 2ONSA 2GFEA 2X7PA 2V25A 4RPOA 3D4CA 1MQDA 4RNSA 3N26A 5JK4A 4OETA 1ZMGA 5IAIA 2QMWA 4KR5A 3IB2A 2XXPA 1A54A 2I4BA 3WAEA 3CVGA 3CSBA 1ATGA 1R1NA 2F34A 2HAUA 1IQ7A 3IO4A 3LC8A 1UIUA 1US4A 4UA8A 4X1DA 1FQBA 4JWXA 3TFLA 3O2AA 2REGA 4RY1A 2B3BA 3M8UA 3TAJA 4R2FA 4F31B 4MLVA 2O1MA 3RNNA 3MVXA 3T93B 2PVUA 4HCYA 1MXZA 1B51A 2PMSA 3IB1A 2ZMBA 3KGCA 3PUWE 3C32A 3PPOA 1NL5A 2RCAA 3EPEA 5ISUA 3HCQA 3TODA 3VLWA 3THIA 1HSEA 1PC3A 3KFMA 2DOJA 1XVYA 1MXYA 4WEDA 1QW0A 3PMWA 4ELOA 5TPAA 3U93A 4GOTA 1R9QA 1M5EA 3G3IA 1OQHA 4F18A 4QSDA 1H3DA 3FVNA 3KOSA 3KN3A 3SKPA 3IK6B 2Q9TA 2H25A 2QL3A 1QUKA 3O66A 3S4UA 1P99A 3RLFE 4I8CA 1SW5A 1AMFA 4MH5A 3UORA 3HN0A 2P0SA 3IL1B 1P1OA 3C4MA 3R6UA 3V83A 3MZBA 3FD3A 2Y7IA 4IB2A 1SYIA 4F19A 5DEXA 5I56B 1S50A 1VSOA 3E3KA 4RPNA 1QKBA 3SDFA 2Z8FA 5CRYA 4P11A 4XKNA 4ZE8A 2M8CA 2UVHA 4R75A 4DXUA 4F2OA 2UVJA 3OELA 4R2BA 2DE3A 4EXLA 4GL8A 2O51A 4ESWA 3BBRA 2ZYKA 2QSXA 1MH3A 1US5A 2QRYA 3K4UA 1TFDA 1URSA 4YB6A 1SQYA 1MM6A 3F11A 4GRKA 2F7AA 3TCGA 1LAFE 4PP0A 4WEPA 2HEUA 3SEVA 4L17A 1XC1A 2ZYMA 3DP8A 2V3UA 4OEUA 2A5TB 3H7MA 4FATA 1LAXA 1B52A 3K6UA 2H9BA 3I6VA 5DVFA 4AQ4A 4YAHX 1FTKA 2REJA 3LSFB 4OHNA 2UYEA 3UGWA 3FIRA 5H8FA 5KZTA 3IB0A 2CMOA 2I0CA 2GHBA 2XXUA 1AH5A 3MC2A 4X48A 4YB7A 3PD8A 1MPBA 2XX9A 3LSWA 2NXOA 4GD5A 2DE4A 1SVXB 4OWDA 1B6HA 3HHFA 5I2KB 3RN8A 3IOVA 1MY1A 3CIJA 2ALUA 1AL3A 3LR1A 4WXJA 1NNFA 4KYDA 1GVCA 1SYHA 4DLDA 3GBBA 3HV1A 4ESXA 2RC9A 3KJ7A 3KOTA 2O84X 2DSFA 3PV0E 4LQ2A 4OENA 5HPQA 1B4ZA 3ONMA 4G77A 1IXIA 1BLFA 2V93A 1POTA 3MP6A 3CSGA 2UVGA 3HO7A 4M4GA 1LLSA 2H98A 1DMBA 3LBSA 1JETA 2E1SA 1JEVA 1FTJA 4XKRA 3G3KA 5DVJA 1BKAA 3Q25A 1FCKA 1MXWA 1OQGA 1DSNA 4JSOA 4N6PA 4XKPA 4YMBA 2LAOA 3JYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6X A;  1Y1M A;  3O6H A;  3B7D A;  1LAH E;  3VDF A;  4GLI A;  4H8J A;  4KPT A;  3V5A A;  5F7V A;  1FW0 A;  1JW5 A;  4G4P A;  2I4C A;  2HXW A;  2RCB A;  2DVZ A;  1B3F A;  5H8H A;  3L6G A;  4AB5 A;  3MZ1 A;  1PB8 A;  1GTK A;  4KD5 A;  2AL4 A;  3KJT A;  3C9H A;  3USD A;  3TMG A;  4C0R A;  4HS7 A;  1GR2 A;  1Y1Z A;  4ND9 A;  4OES A;  4LQ5 A;  4BLA A;  1PB7 A;  4Q0C A;  4H0W A;  3MWB A;  4C1T A;  1I6A A;  4U2R A;  1WDN A;  3MVY A;  1N3W A;  4F2Q A;  5LOM A;  2E0S A;  3VVE A;  2I3W A;  4IGT A;  4YKI A;  4FEB A;  5I58 B;  3G3J A;  1B3G A;  2O6A A;  3A09 A;  5M2V A;  4F1Y A;  3PUV E;  1LFI A;  3CFX A;  3KSX A;  3OO9 A;  2DXY A;  1QUJ A;  3CRB A;  3CI8 A;  2V84 A;  1ZJL A;  3QAX A;  4Z0I A;  2PBW A;  3ODB A;  3PPR A;  5I59 B;  3RPW A;  2Z23 A;  1DOT A;  1MS7 A;  5I2N B;  4G68 B;  1Y4C A;  1JW1 A;  4U1O A;  2I58 A;  1S7Y A;  3MJN A;  3A3U A;  4U1Z A;  1B1H A;  1SW1 A;  4KFQ A;  4GXA A;  1B7H A;  4HCW A;  4N07 A;  4O3A A;  1IIW A;  2YJP A;  2ZYO A;  1M5F A;  4EF1 A;  2VHA A;  2XXT A;  2O7U A;  1D4N A;  4YIC A;  3O6G A;  5FHO A;  3IOW A;  1A8E A;  4RXL A;  1D9Y A;  1SBP A;  4IO2 A;  4IGR A;  4IO5 A;  5EYF A;  1MDP 1;  3JV9 A;  4YKK A;  4EQ9 A;  4DE8 A;  1DTG A;  1H44 A;  3T9U A;  2DVC A;  2RIN A;  4LA9 A;  4R9F A;  2I3V A;  3TDJ A;  4ZE9 A;  1FTO A;  3H6W A;  4U21 A;  4GQO A;  4Z7E A;  3G3H A;  3PPP A;  4YU0 A;  3MW0 A;  2QJE A;  1N04 A;  4ZEC A;  3VLU A;  3QK6 A;  4F1U A;  4AB6 A;  4YZZ A;  3GBA A;  1URG A;  3TTK A;  1N7X A;  2XX7 A;  4OMB A;  2DWJ A;  1O64 A;  2QMX A;  2GH9 A;  3QUF A;  2ONR A;  1UTB B;  2XXI A;  3M3F A;  5DYH A;  5CI5 A;  5KCJ A;  5I57 B;  1LBC A;  5CMB A;  3W9V A;  1Q1K A;  1Y3Q A;  1Q35 A;  4DZ1 A;  1MY4 A;  4PET A;  4EXK A;  2RC8 A;  1A55 A;  4JWY A;  3VXC A;  2CZL A;  4U23 A;  3DP6 A;  1EZ9 A;  3O97 A;  1Y3N A;  3PPQ A;  3RQT A;  2H5Y A;  5L8D A;  1TFA A;  4DIG A;  4F29 A;  1WOD A;  4BDQ A;  4NF6 A;  3EF7 A;  3OEN A;  4XXU A;  4RYA A;  4TQU Q;  3TTR A;  1MPC A;  1B3L A;  1NKX A;  4O3B A;  3FZV A;  2PT2 A;  3IR1 A;  4NE4 A;  4ISU A;  1IZ1 A;  2Y7W A;  1QUI A;  3K00 A;  4IY6 A;  1MPD A;  1ANF A;  2HFB A;  3QUJ A;  1LCF A;  4PFU A;  4QHQ A;  3U1O A;  1FTL A;  2YPN A;  4ZEF A;  4WKM A;  2BJJ X;  4QSC A;  3W9W A;  3QIM A;  1FQC A;  1NH8 A;  2OJT A;  2R71 A;  4ZZE A;  5FTI A;  4TOZ A;  1H43 A;  1USY E;  3T66 A;  1B4H A;  4ECF A;  4I62 A;  2XHD A;  5DTB A;  1EH3 A;  2NWJ A;  5BUU A;  1FQA A;  3ZS6 A;  2DP8 A;  4BDO A;  5IKB A;  2HQ0 A;  1PBQ A;  3N5L A;  4NF4 B;  3Q28 A;  5AA1 A;  1BP5 A;  3D4G A;  1Z7M E;  4BDN A;  3MUQ A;  1R6Z A;  3I3V A;  5I59 A;  3OEM A;  2Y84 A;  3TYH A;  1QUL A;  3OO7 A;  2ZYN A;  4DDD A;  4GVO A;  1YCJ A;  4H6D A;  4G68 A;  5CMC A;  2UYF A;  2V3T A;  4TLL B;  1WVJ A;  2ESN A;  5AA4 B;  5EHS A;  4U4X A;  2Z22 A;  3FUZ A;  1PEB A;  3TEL A;  3T22 A;  3C35 A;  5CMM A;  3OO8 A;  2W7Y A;  3V8X B;  2FYI A;  3B6Q A;  4P0G A;  4R72 A;  4Q8R A;  1NNP A;  4M1V A;  3H6V A;  4OQO A;  4TLM B;  4H8I A;  1IIT A;  3VV5 A;  5TP9 A;  3OSQ A;  1UTH B;  4Q30 B;  4R74 A;  3H4Z A;  2F7B A;  3EN3 A;  4OTE A;  1B7U A;  1QJM A;  2F6G A;  1O63 A;  1OMP A;  2KLF A;  3BFU A;  3QXM A;  4FJP A;  2RF1 A;  2XXR A;  1LFG A;  1MY3 A;  2RKM A;  4FIM A;  1MXU A;  2OWT A;  2DS9 A;  3VFJ A;  4H1X A;  3FXQ A;  3MP1 A;  1JQF A;  5B7D A;  2DQV A;  3RGY A;  4PFT A;  2DWH A;  1ZU0 A;  3U94 A;  4DCX A;  1LGB C;  1MY2 A;  2B3F A;  3OD7 A;  3LSL A;  3IO6 A;  3R26 A;  5FTH A;  4ZEB A;  3PD9 A;  2ANJ A;  3IAZ A;  4FED A;  3K01 A;  1KWH A;  3I5O A;  3TQL A;  3SEY A;  4R6K A;  3E4R A;  2ZNT A;  5I57 A;  1TT1 A;  1JVX A;  3K6V A;  5H8Q B;  3H03 A;  5A5X B;  4PQJ A;  2XD2 A;  3MPL A;  1PB9 A;  1CB6 A;  4DXC A;  4KHZ E;  1NMU A;  1IEJ A;  1P1N A;  1M5D A;  1IXG A;  4LZ8 A;  1R9L A;  3MVZ A;  1CE2 A;  2OZZ A;  3FJM A;  3UP9 A;  1MXV A;  3A3C A;  3IOU A;  3SER A;  4K3F A;  1RYX A;  1AOV A;  1N84 A;  1MH4 A;  3VLV A;  5CMK A;  1SD3 A;  5TU0 A;  2THI A;  1B0H A;  4I9D A;  3DP4 A;  2O7I A;  3IOT A;  4LZ5 A;  3Q26 A;  4EDP A;  1IXH A;  1ZIU A;  3P7I A;  3T9X B;  1B32 A;  1MRP A;  2X7Q A;  5DT6 A;  4F1V A;  1B05 A;  2X26 A;  5CM6 A;  1DPE A;  4XTC Q;  4H5G A;  1N3X A;  3DEL B;  1ELJ A;  1TWY A;  1MQG A;  2QPQ A;  5TPA B;  3TZA A;  2NOO A;  2XXY A;  2Y7P A;  1FQD A;  3IX1 A;  3ILU B;  4QFL A;  3EHU A;  3RT8 A;  2O68 A;  3CFZ A;  4KCD A;  1D3K A;  5AA2 B;  4YKP A;  4N13 A;  1LCT A;  5ITO A;  3K6W A;  1JVY A;  4QFK A;  1O7T A;  5I56 A;  1FQE A;  3ZKL A;  2F78 A;  5HM4 B;  3E13 X;  4BDM A;  3MP8 A;  2Q8J A;  1VFD A;  3C36 A;  2UVI A;  3N94 A;  4NF5 B;  1GV8 A;  2R9J A;  2G93 A;  4NF4 A;  4E0X A;  1MM7 A;  5I84 A;  1POY 1;  1SDX A;  2O1L A;  1FQF A;  4DCY A;  2HAV A;  3T9V A;  1OLC A;  3CFL A;  3K02 A;  5EHM A;  2B65 A;  3HHG A;  5H8S A;  1QKA A;  4YMA A;  2XXX A;  3K1P A;  1P1U A;  3VVD A;  5CC2 A;  4F3P A;  1LB9 A;  1A99 A;  2Z8E A;  3GXA A;  1USY H;  1VFE A;  4R6H A;  4RA1 A;  1XT8 A;  1S9T A;  2Q89 A;  5BWJ A;  2A5T A;  3VE1 B;  1VR5 A;  4POW A;  3HPI A;  1MG1 A;  3TUS A;  3FJG A;  3AXF A;  2V3Q A;  4Q5T A;  1UTH A;  4C1U A;  1SI1 A;  2Q2A A;  1M5C A;  3SEU A;  1P1W A;  1A40 A;  1MY0 A;  2O69 A;  2PT1 A;  3CR9 A;  2F6P A;  4QFO A;  4X9T A;  3CG3 A;  2F35 A;  1RKM A;  1QVS A;  1VE4 A;  2OLB A;  2YLN A;  4JBZ A;  1NFT A;  4RJZ A;  4KYS A;  5CBR A;  1N76 A;  3ZKK A;  4GWO A;  5I2K A;  3SES A;  1L5T A;  2F7C A;  4OFJ A;  1XHY A;  4LVQ A;  4OEV A;  4F22 A;  5KDT B;  4KCC A;  2DWA A;  4BDL A;  3LUY A;  4NMY A;  4HW8 A;  1P1Q A;  1N0T A;  4LZ7 A;  2PYY A;  2QS3 A;  4IY5 A;  3CG1 A;  2Q2C A;  4F3G A;  3TPA A;  3KG2 A;  4EQ7 A;  1ZTY A;  5H8Q A;  1I6B A;  5A5X A;  2VD2 A;  3S9E A;  4G8N A;  2AL5 A;  5AA2 D;  2I6E A;  2GHA A;  4ONY A;  4QFN A;  2AYS A;  4G8H A;  3QYT A;  3U92 A;  2OCU A;  1MQI A;  4H67 A;  1BTJ A;  3TQW A;  1B1X A;  3H06 B;  4ZED A;  3PMV A;  2I49 A;  1TXF A;  3MQ9 A;  3TTM A;  1B5J A;  2G29 A;  3LSX A;  3FGS A;  3KZG A;  3DLN A;  3PUY E;  2F36 A;  4QFP A;  1RYO A;  1M5B A;  4R6Y A;  1DTZ A;  4MFI A;  3K0V A;  1MQJ A;  4ZEK A;  1UIV A;  1B2H A;  5K2X A;  3IJO B;  4RK9 A;  4YKJ A;  2Y7K A;  3B6T A;  2XD3 A;  3KN8 A;  3O6I A;  4PE5 B;  1NNK A;  4LP2 B;  4IO6 A;  3N6U A;  5ICT A;  3OMB A;  4KYE A;  5H8H B;  1JW4 A;  4XIG Q;  4MF3 A;  4F3B A;  4DXB A;  4OYV A;  4XKQ A;  5AA2 A;  3ILT B;  3V89 B;  4FAJ A;  3G7W A;  2PX1 A;  5ELV A;  4F3S A;  3EHT A;  2OWS A;  2XXQ A;  1YTV A;  2D5W A;  5I58 A;  1HSJ A;  4I1D A;  4NF5 A;  1MXX A;  1YAE A;  5F1Q A;  3RY3 A;  2VOZ A;  2VD3 A;  4P0I A;  1NNT A;  3MVW A;  2ZXT A;  3PUZ E;  4H5F A;  3UK4 A;  3MBP A;  2D3I A;  3VXB A;  3TCF A;  5AE4 A;  3FV2 A;  1A7L A;  4ELR A;  5H8N B;  4R73 A;  4POX A;  3UN6 A;  3S9N C;  1AIV A;  2WKY A;  1LST A;  5DVI A;  5I2N A;  2F5X A;  4UAC A;  3OO6 A;  4G8M A;  1YPN A;  2DWI A;  1Y3P A;  4U4S A;  4NTL A;  3GLB A;  3PPN A;  3T96 B;  3TCH A;  1B3H A;  5JTY B;  1PBP A;  1OVT A;  1SW4 A;  4G68 C;  1NH7 A;  4OER A;  5K2Y A;  4F39 A;  2VGQ A;  4OFL A;  1DPP A;  2XXV A;  1ZLQ A;  4QSE A;  4OXV A;  3RT6 B;  4EF2 A;  2I0B A;  3PU5 A;  3T9H B;  3K2D A;  1B5H A;  2HCA A;  3C33 A;  3GZG A;  1J1N A;  3JZJ A;  3RTF B;  3OXN A;  2NVU B;  1OVB A;  1Y20 A;  1UQW A;  2RC7 A;  3PUX E;  3FVK A;  3DM0 A;  4MBP A;  1H45 A;  1B9J A;  2GRV A;  3R7X A;  4ZZA A;  3MZ9 A;  4NF8 B;  4YB5 A;  3Q27 A;  3RUM A;  5KDT A;  2H99 A;  3BKI B;  1H76 A;  3SEW A;  4ZEI A;  3FVG A;  1LAG E;  2IEE A;  1B0L A;  4IO3 A;  3KEI A;  1UTB A;  4JSD A;  3C34 A;  3RTW B;  4NWD A;  3W15 C;  3G3G A;  3TTN A;  5FHM A;  4QRZ A;  1MDQ A;  5ICQ A;  2XX8 A;  1JNF A;  3E9X A;  3IOR A;  4ZDM A;  4ZS9 A;  2OBG A;  3K1M A;  3Q29 A;  1B7Z A;  3FXU A;  4THI A;  4KI0 E;  5KCJ B;  1URD A;  4GFR A;  2Q88 A;  2ABH A;  1XOC A;  4ELQ A;  4MLQ A;  2R6G E;  3HST A;  3FAT A;  1D9V A;  3BFT A;  2DE2 A;  4GL0 A;  3SEX A;  4O3C A;  4KQP A;  3EHS A;  1XVX A;  1ZKB A;  3TKD A;  5ITP A;  4FOR A;  1A8F A;  5J1D A;  4E0W A;  4EQB A;  4NF6 B;  3FJ7 A;  4LON B;  3TTL A;  1B5I A;  3KBR A;  2DXR A;  5B70 A;  3EQ1 A;  5FHN A;  3L6H A;  1B58 A;  3KN7 A;  3M3K A;  4LUB A;  2F8D A;  3FAS A;  3S2V A;  1B40 A;  1FTM A;  4PFW A;  3N6T A;  3IJX B;  1JEU A;  4G2Z A;  4R9G A;  3H6T A;  3PGF A;  1B3E A;  4QF9 A;  4U22 A;  2HZL A;  3OEK A;  3H3G A;  1OIB A;  3O28 A;  4GIZ A;  4GXS B;  1IXC A;  1Y4T A;  1LBB A;  1OLA A;  3FV1 A;  1I6Q A;  2QS1 A;  1MQH A;  2XXW A;  2FA7 A;  3UA8 A;  5L9S A;  4X1B A;  1Z7N E;  3ECR A;  1IUD A;  3FVO A;  3M3L A;  1F9B A;  1EZP A;  1EU8 A;  5L9M A;  4JXI A;  3C31 A;  2XXH A;  2Y7R A;  4OVJ A;  1LFH A;  1EZO A;  4EUO A;  3FXR A;  3QSL A;  3SET A;  2UXA A;  3PMX A;  2AIX A;  5DEX B;  3OOA A;  2HZK A;  4OFO A;  1LB8 A;  3VVF A;  3O29 A;  5H8N A;  4H65 A;  4JB7 A;  3WAF A;  1T0K A;  2FNC A;  2ONK E;  4RK2 A;  4NED A;  1Y9U A;  1BIY A;  1ZBM A;  2Z8D A;  4FEC A;  4NWC A;  4IO7 A;  3U72 A;  3MPK A;  5AA4 A;  3G3F A;  4PFY A;  2IA4 A;  3B6W A;  5AA3 A;  3MAM A;  4GF8 A;  5JTY A;  2P1S A;  4FE8 A;  2OK2 A;  1B46 A;  2P2A A;  1XS5 A;  3S9M C;  1I69 A;  1N7W A;  2NUV A;  2I48 A;  5HBC A;  4IO4 A;  3TEP A;  1HSL A;  3O9P A;  1II5 A;  1GGG A;  3H6U A;  3OSR A;  2D21 A;  3S9L C;  2VP1 A;  4OZ9 A;  5TP9 B;  5L9O A;  2DYX A;  2QS4 A;  1SW2 A;  4JWO A;  2H4I A;  4ELP A;  4LAT A;  5JEI A;  2F97 A;  4NF8 A;  5H8F B;  2A5S A;  3UIF A;  3K1N A;  2ZNU A;  3KSJ A;  4JDF A;  1PDA A;  4HTG A;  2ZNS A;  3U8Q A;  2QS2 A;  5CBS A;  1SI0 A;  4BDR A;  3ZSF A;  2ONS A;  2GFE A;  2X7P A;  2V25 A;  4RPO A;  3D4C A;  1MQD A;  4RNS A;  3N26 A;  5JK4 A;  4OET A;  1ZMG A;  5IAI A;  2QMW A;  4KR5 A;  3IB2 A;  2XXP A;  1A54 A;  2I4B A;  3WAE A;  3CVG A;  3CSB A;  1ATG A;  1R1N A;  2F34 A;  2HAU A;  1IQ7 A;  3IO4 A;  3LC8 A;  1UIU A;  1US4 A;  4UA8 A;  4X1D A;  1FQB A;  4JWX A;  3TFL A;  3O2A A;  2REG A;  4RY1 A;  2B3B A;  3M8U A;  3TAJ A;  4R2F A;  4F31 B;  4MLV A;  2O1M A;  3RNN A;  3MVX A;  3T93 B;  2PVU A;  4HCY A;  1MXZ A;  1B51 A;  2PMS A;  3IB1 A;  2ZMB A;  3KGC A;  3PUW E;  3C32 A;  3PPO A;  1NL5 A;  2RCA A;  3EPE A;  5ISU A;  3HCQ A;  3TOD A;  3VLW A;  3THI A;  1HSE A;  1PC3 A;  3KFM A;  2DOJ A;  1XVY A;  1MXY A;  4WED A;  1QW0 A;  3PMW A;  4ELO A;  5TPA A;  3U93 A;  4GOT A;  1R9Q A;  1M5E A;  3G3I A;  1OQH A;  4F18 A;  4QSD A;  1H3D A;  3FVN A;  3KOS A;  3KN3 A;  3SKP A;  3IK6 B;  2Q9T A;  2H25 A;  2QL3 A;  1QUK A;  3O66 A;  3S4U A;  1P99 A;  3RLF E;  4I8C A;  1SW5 A;  1AMF A;  4MH5 A;  3UOR A;  3HN0 A;  2P0S A;  3IL1 B;  1P1O A;  3C4M A;  3R6U A;  3V83 A;  3MZB A;  3FD3 A;  2Y7I A;  4IB2 A;  1SYI A;  4F19 A;  5DEX A;  5I56 B;  1S50 A;  1VSO A;  3E3K A;  4RPN A;  1QKB A;  3SDF A;  2Z8F A;  5CRY A;  4P11 A;  4XKN A;  4ZE8 A;  2M8C A;  2UVH A;  4R75 A;  4DXU A;  4F2O A;  2UVJ A;  3OEL A;  4R2B A;  2DE3 A;  4EXL A;  4GL8 A;  2O51 A;  4ESW A;  3BBR A;  2ZYK A;  2QSX A;  1MH3 A;  1US5 A;  2QRY A;  3K4U A;  1TFD A;  1URS A;  4YB6 A;  1SQY A;  1MM6 A;  3F11 A;  4GRK A;  2F7A A;  3TCG A;  1LAF E;  4PP0 A;  4WEP A;  2HEU A;  3SEV A;  4L17 A;  1XC1 A;  2ZYM A;  3DP8 A;  2V3U A;  4OEU A;  2A5T B;  3H7M A;  4FAT A;  1LAX A;  1B52 A;  3K6U A;  2H9B A;  3I6V A;  5DVF A;  4AQ4 A;  4YAH X;  1FTK A;  2REJ A;  3LSF B;  4OHN A;  2UYE A;  3UGW A;  3FIR A;  5H8F A;  5KZT A;  3IB0 A;  2CMO A;  2I0C A;  2GHB A;  2XXU A;  1AH5 A;  3MC2 A;  4X48 A;  4YB7 A;  3PD8 A;  1MPB A;  2XX9 A;  3LSW A;  2NXO A;  4GD5 A;  2DE4 A;  1SVX B;  4OWD A;  1B6H A;  3HHF A;  5I2K B;  3RN8 A;  3IOV A;  1MY1 A;  3CIJ A;  2ALU A;  1AL3 A;  3LR1 A;  4WXJ A;  1NNF A;  4KYD A;  1GVC A;  1SYH A;  4DLD A;  3GBB A;  3HV1 A;  4ESX A;  2RC9 A;  3KJ7 A;  3KOT A;  2O84 X;  2DSF A;  3PV0 E;  4LQ2 A;  4OEN A;  5HPQ A;  1B4Z A;  3ONM A;  4G77 A;  1IXI A;  1BLF A;  2V93 A;  1POT A;  3MP6 A;  3CSG A;  2UVG A;  3HO7 A;  4M4G A;  1LLS A;  2H98 A;  1DMB A;  3LBS A;  1JET A;  2E1S A;  1JEV A;  1FTJ A;  4XKR A;  3G3K A;  5DVJ A;  1BKA A;  3Q25 A;  1FCK A;  1MXW A;  1OQG A;  1DSN A;  4JSO A;  4N6P A;  4XKP A;  4YMB A;  2LAO A;  3JYR A; 
#chains in the Genus database with same CATH topology
 3K6X A;  1Y1M A;  3O6H A;  3BIH A;  1RDZ A;  3B7D A;  1LAH E;  3VDF A;  4GLI A;  4H8J A;  4KPT A;  3V5A A;  5F7V A;  1FW0 A;  1JW5 A;  4G4P A;  2I4C A;  2HXW A;  4OA4 A;  4N17 A;  2RCB A;  2DVZ A;  1B3F A;  5H8H A;  3L6G A;  1YXI A;  4AB5 A;  3MZ1 A;  1PB8 A;  1GTK A;  2KR0 A;  4KD5 A;  4XFE A;  4HXV A;  2AL4 A;  3HFU A;  3KJT A;  3C9H A;  4MAG A;  3USD A;  3TMG A;  4C0R A;  4HS7 A;  2XWV A;  2WBD A;  1GR2 A;  1Y1Z A;  3U65 A;  4ND9 A;  4OES A;  4LQ5 A;  4MMP A;  4BLA A;  1PB7 A;  4Q0C A;  4H0W A;  3MWB A;  4C1T A;  1I6A A;  4U2R A;  1WDN A;  3MVY A;  3NOH A;  1N3W A;  4F2Q A;  5LOM A;  2R8T A;  2E0S A;  3VVE A;  4PGP A;  2Q8M A;  2I3W A;  4IGT A;  4YKI A;  4FEB A;  5I58 B;  3G3J A;  1FRP A;  1NV3 A;  1B3G A;  4GWU A;  2O6A A;  3A09 A;  5M2V A;  4F1Y A;  3PUV E;  1LFI A;  3CFX A;  3KSX A;  3OO9 A;  2DXY A;  1QUJ A;  3CRB A;  3CI8 A;  2V84 A;  1ZJL A;  3QAX A;  4Z0I A;  2KQZ A;  2PBW A;  3ODB A;  3PPR A;  3MYU A;  5I59 B;  3RPW A;  2Z23 A;  1FBF A;  1DOT A;  5DW8 A;  1MS7 A;  5I2N B;  4G68 B;  1Y4C A;  1JW1 A;  4U1O A;  2I58 A;  1S7Y A;  2XWI A;  3MJN A;  3A3U A;  4PCD A;  4U1Z A;  1B1H A;  1SW1 A;  4X04 A;  4KFQ A;  2PFY A;  4GXA A;  1B7H A;  4HCW A;  4N07 A;  4O3A A;  1IIW A;  2YJP A;  2ZYO A;  1M5F A;  4EF1 A;  2VHA A;  2V4C A;  2XXT A;  2O7U A;  1K9Y A;  1D4N A;  5EQA A;  1NV0 A;  4YIC A;  3O6G A;  5FHO A;  3IOW A;  1A8E A;  4RXL A;  4PC9 A;  1D9Y A;  1SBP A;  4IO2 A;  4IGR A;  4IO5 A;  5EYF A;  1MDP 1;  3JV9 A;  4YKK A;  4EQ9 A;  4DE8 A;  1DTG A;  1H44 A;  2RIN A;  2DVC A;  3T9U A;  4LA9 A;  4R9F A;  2I3V A;  4P8B A;  3TDJ A;  4ZE9 A;  3LV0 A;  1FTO A;  3KC1 A;  3H6W A;  4U21 A;  4GQO A;  4Z7E A;  3ROJ A;  3G3H A;  4JVD A;  3PPP A;  4YU0 A;  3MW0 A;  2QJE A;  4MNP A;  1YZ0 A;  1N04 A;  4ZEC A;  3VLU A;  3QK6 A;  4F1U A;  4AB6 A;  4YZZ A;  2FVZ A;  3GBA A;  1URG A;  3TTK A;  1N7X A;  2XX7 A;  2OX3 A;  4OMB A;  2DWJ A;  1O64 A;  2QMX A;  2GH9 A;  3QUF A;  2ONR A;  1AWB A;  4MJO A;  1UTB B;  4DI4 B;  2XXI A;  3M3F A;  5DYH A;  5CI5 A;  5KCJ A;  5I57 B;  1LBC A;  4HE0 A;  5CMB A;  3W9V A;  1Q1K A;  1Y3Q A;  1Q35 A;  4DZ1 A;  1MY4 A;  4PET A;  1IMC A;  4EXK A;  2RC8 A;  1A55 A;  4JWY A;  3VXC A;  2CZL A;  4U23 A;  3DP6 A;  1EZ9 A;  3O97 A;  1Y3N A;  3PPQ A;  1NV4 A;  3RQT A;  2H5Y A;  5L8D A;  1TFA A;  4N8G A;  4DIG A;  4F29 A;  1WOD A;  4BDQ A;  4NF6 A;  3EF7 A;  3OEN A;  4XXU A;  4RYA A;  4TQU Q;  3TTR A;  1MPC A;  2WBB A;  1B3L A;  1NKX A;  2XXK A;  4O3B A;  3FZV A;  2PT2 A;  3IR1 A;  4PDD A;  4NE4 A;  4ISU A;  1IZ1 A;  2Y7W A;  1QUI A;  3K00 A;  4IY6 A;  1MPD A;  1ANF A;  2HFB A;  3QUJ A;  5ET6 A;  1LCF A;  4PFU A;  1NUZ A;  4QHQ A;  3U1O A;  1FTL A;  2YPN A;  4ZEF A;  1LBX A;  4WKM A;  2BJJ X;  4QSC A;  3E78 A;  3W9W A;  3QIM A;  1FQC A;  2MKZ A;  5IZ3 B;  1NH8 A;  4P3L A;  2OJT A;  2R71 A;  1EYJ A;  4ZZE A;  5FTI A;  4TOZ A;  1H43 A;  5EYH A;  3QMF A;  1USY E;  3T66 A;  1B4H A;  4ECF A;  4I62 A;  2XHD A;  5DTB A;  1EH3 A;  2NWJ A;  5BUU A;  1FQA A;  3ZS6 A;  2DP8 A;  4BDO A;  5IKB A;  2HQ0 A;  1FPD A;  1PBQ A;  4GBV A;  3N5L A;  4QBA A;  2B4L A;  4NF4 B;  3IFC A;  3Q28 A;  5AA1 A;  1BP5 A;  3D4G A;  1Z7M E;  5IZZ A;  4BDN A;  4PBQ A;  3MUQ A;  4GWW A;  1R6Z A;  1INP A;  3I3V A;  5I59 A;  3OEM A;  2Y84 A;  3TYH A;  1QUL A;  3OO7 A;  2ZYN A;  1FPK A;  4DDD A;  1FBC A;  1FJ9 A;  4GVO A;  1YCJ A;  4PGN A;  4H6D A;  4G68 A;  1JP4 A;  2ZZW A;  5CMC A;  2UYF A;  2V3T A;  3BIG A;  4TLL B;  5I5P A;  1WVJ A;  2ESN A;  5AA4 B;  5EHS A;  2VPO A;  4U4X A;  2Z22 A;  3FUZ A;  1PEB A;  3TEL A;  3T22 A;  3C35 A;  5CMM A;  3OO8 A;  2W7Y A;  3V8X B;  2FYI A;  3B6Q A;  4P0G A;  4R72 A;  4Q8R A;  1NNP A;  4M1V A;  3H6V A;  2WYK A;  4OQO A;  4TLM B;  4H8I A;  5T3J A;  1IIT A;  3VV5 A;  5TP9 A;  3OSQ A;  1UTH B;  4Q30 B;  1FJ6 A;  4R74 A;  3H4Z A;  2F7B A;  3EN3 A;  4OTE A;  1SPI A;  1B7U A;  1DBZ A;  1QJM A;  2F6G A;  1O63 A;  1OMP A;  2KLF A;  3BFU A;  3QXM A;  4FJP A;  2RF1 A;  2XXR A;  1LFG A;  1MY3 A;  2RKM A;  4FIM A;  1MXU A;  2OWT A;  2DS9 A;  3VFJ A;  4H1X A;  3FXQ A;  3MP1 A;  1JQF A;  5B7D A;  2DQV A;  3RGY A;  4PFT A;  2DWH A;  3RPL B;  2DDK A;  1ZU0 A;  3U94 A;  4DCX A;  2QFL A;  1LGB C;  1MY2 A;  2B3F A;  3OD7 A;  1NV5 A;  3LSL A;  3IO6 A;  4N6D A;  3R26 A;  5FTH A;  4GBW A;  4ZEB A;  4FBP A;  3PD9 A;  2ANJ A;  3IAZ A;  4FED A;  3K01 A;  1KWH A;  3I5O A;  4OVQ A;  3TQL A;  3SEY A;  4R6K A;  3E4R A;  2ZNT A;  5I57 A;  1TT1 A;  1JVX A;  3K6V A;  5H8Q B;  3H03 A;  5A5X B;  4PQJ A;  3EKI A;  2XD2 A;  3MPL A;  1PB9 A;  1G0H A;  1IMB A;  1CB6 A;  4DXC A;  4KHZ E;  1NMU A;  1IEJ A;  1P1N A;  1M5D A;  4PDH A;  1IXG A;  4LZ8 A;  1R9L A;  2OWZ A;  3MVZ A;  1CE2 A;  4PE3 A;  2OZZ A;  3FJM A;  3UP9 A;  1MXV A;  3A3C A;  3IOU A;  4O8M A;  3SER A;  4K3F A;  4NG7 A;  1RYX A;  1AOV A;  1N84 A;  1MH4 A;  3VLV A;  3SZP A;  4HE2 A;  5CMK A;  4NQ8 A;  1SD3 A;  5TU0 A;  1IMD A;  2THI A;  1B0H A;  4I9D A;  3DP4 A;  2O7I A;  2L5V A;  3IOT A;  3Q26 A;  4LZ5 A;  1IXH A;  4EDP A;  1ZIU A;  3P7I A;  5ET5 A;  3T9X B;  1B32 A;  1MRP A;  2X7Q A;  4MEV A;  5DT6 A;  4F1V A;  1B05 A;  4PFI A;  2X26 A;  5CM6 A;  1DPE A;  4XTC Q;  4H5G A;  1N3X A;  3DEL B;  1ELJ A;  5EQ9 A;  1RDX A;  1TWY A;  1MQG A;  3T0J A;  2QPQ A;  5TPA B;  3TZA A;  2NOO A;  2XXY A;  2Y7P A;  1FQD A;  3IX1 A;  3ILU B;  4QFL A;  3EHU A;  3RT8 A;  1QGX A;  2O68 A;  3CFZ A;  4KCD A;  1D3K A;  5AA2 B;  4YKP A;  4N13 A;  1LCT A;  5ITO A;  3K6W A;  1JVY A;  4QFK A;  5LTC A;  1O7T A;  5I56 A;  1FQE A;  4I3E A;  3ZKL A;  2F78 A;  5HM4 B;  3E13 X;  4BDM A;  3MP8 A;  2Q8J A;  1VFD A;  3C36 A;  2UVI A;  3N94 A;  4NF5 B;  1GV8 A;  2R9J A;  2G93 A;  2VPN A;  4NF4 A;  1FPE A;  4E0X A;  1LBW A;  1MM7 A;  5I84 A;  1POY 1;  1SDX A;  2O1L A;  1FQF A;  4DCY A;  2HAV A;  3T9V A;  1OLC A;  3CFL A;  4PF8 A;  3K02 A;  2HHM A;  5EHM A;  2B65 A;  4OVP A;  3HHG A;  4N81 A;  5H8S A;  1QKA A;  4YMA A;  2XXX A;  3K1P A;  1P1U A;  3VVD A;  5CC2 A;  4F3P A;  1LB9 A;  1A99 A;  4N91 A;  5ET7 A;  2Z8E A;  3GXA A;  1USY H;  1VFE A;  5F24 A;  4R6H A;  4RA1 A;  4OVT A;  1XT8 A;  1S9T A;  2Q89 A;  4O7M A;  4PBH A;  5BWJ A;  2A5T A;  4N4U A;  3VE1 B;  1VR5 A;  4POW A;  2B4M A;  3HPI A;  1MG1 A;  3TUS A;  3FJG A;  3AXF A;  2V3Q A;  4PFB A;  4Q5T A;  1UTH A;  4C1U A;  1DCU A;  1SI1 A;  2Q2A A;  1M5C A;  3SEU A;  5IGA A;  1EYI A;  1P1W A;  4P1L A;  1A40 A;  1MY0 A;  2O69 A;  2PT1 A;  3CR9 A;  2F6P A;  4QFO A;  4X9T A;  4LN5 A;  3CG3 A;  2F35 A;  1RKM A;  1QVS A;  1VE4 A;  2OLB A;  2YLN A;  4JBZ A;  1NFT A;  4RJZ A;  4KYS A;  2FIX A;  4DI3 D;  5CBR A;  1N76 A;  3ZKK A;  4GWO A;  5I2K A;  3SES A;  1L5T A;  2F7C A;  4OFJ A;  1XHY A;  4LVQ A;  4OEV A;  3RPL A;  4F22 A;  5ESY A;  5KDT B;  4KCC A;  2DWA A;  4BDL A;  3LUY A;  4NMY A;  2F3B A;  4HW8 A;  1P1Q A;  1N0T A;  4LZ7 A;  2PYY A;  2QS3 A;  4IY5 A;  3CG1 A;  2Q2C A;  4GWZ A;  4F3G A;  3TPA A;  3KG2 A;  4EQ7 A;  1ZTY A;  5H8Q A;  1I6B A;  5A5X A;  4AS4 A;  2VD2 A;  3S9E A;  5I7I A;  4G8N A;  1NV6 A;  2AL5 A;  5AA2 D;  2I6E A;  2XA5 A;  1NV2 A;  4MHF A;  2GHA A;  1K9Z A;  4ONY A;  4QFN A;  2AYS A;  4G8H A;  1CNQ A;  3QYT A;  3U92 A;  2Q74 A;  2OCU A;  1MQI A;  4H67 A;  1BTJ A;  3D1R A;  3TQW A;  1B1X A;  3H06 B;  4ZED A;  3PMV A;  1FBH A;  2I49 A;  1TXF A;  3MQ9 A;  3TTM A;  1B5J A;  1RDY A;  2G29 A;  3LSX A;  3FGS A;  3KZG A;  3DLN A;  3PUY E;  2F36 A;  4QFP A;  4MNI A;  1RYO A;  2HXR A;  1M5B A;  4R6Y A;  1DTZ A;  4MFI A;  3K0V A;  1MQJ A;  4ZEK A;  4JVC A;  1UIV A;  1B2H A;  5K2X A;  3IJO B;  4RK9 A;  4YKJ A;  3RYD A;  2Y7K A;  3B6T A;  2XD3 A;  5EQ8 A;  3KN8 A;  3O6I A;  3ISP A;  4PE5 B;  1NNK A;  2Y5K A;  4LP2 B;  4IO6 A;  3N6U A;  5ICT A;  3OMB A;  4KYE A;  5H8H B;  1JW4 A;  5EQ7 A;  2CZK A;  4XIG Q;  4MF3 A;  4F3B A;  4DXB A;  4PAF A;  4OYV A;  4XKQ A;  5AA2 A;  3ILT B;  3MST A;  4IR8 A;  3V89 B;  4QXD A;  4FAJ A;  3G7W A;  2PX1 A;  5ELV A;  4F3S A;  4MX6 A;  3EHT A;  2OWS A;  2XXQ A;  1YTV A;  2D5W A;  5I58 A;  1HSJ A;  4I1D A;  4NF5 A;  1MXX A;  1YAE A;  1LBZ A;  5F1Q A;  3RY3 A;  2CEY A;  2VOZ A;  2VD3 A;  4P0I A;  1NNT A;  3MVW A;  2ZXT A;  3PUZ E;  4H5F A;  3UK4 A;  3KC0 A;  3MBP A;  2D3I A;  3VXB A;  2WX9 A;  3TCF A;  4P9K A;  5AE4 A;  3FV2 A;  1A7L A;  1Q9D A;  4ELR A;  4PAI A;  5H8N B;  4R73 A;  4POX A;  1FPG A;  3UN6 A;  3S9N C;  1AIV A;  2WKY A;  1LST A;  5DVI A;  2QVV A;  3B50 A;  5I2N A;  2F5X A;  2QVR A;  4UAC A;  3OO6 A;  4G8M A;  1BK4 A;  1YPN A;  2DWI A;  1Y3P A;  4U4S A;  1G0I A;  4NTL A;  3GLB A;  3PPN A;  3T96 B;  3TCH A;  1B3H A;  5JTY B;  2QVU A;  1PBP A;  1OVT A;  1SW4 A;  4G68 C;  2GQ1 A;  1NH7 A;  4OER A;  5K2Y A;  4F39 A;  2VGQ A;  4OFL A;  4AS5 A;  1DPP A;  2XXV A;  1ZLQ A;  4QSE A;  4OXV A;  3RT6 B;  4EF2 A;  2PFZ A;  2I0B A;  3PU5 A;  5EYG A;  3T9H B;  3K2D A;  1FTA A;  1B5H A;  2HCA A;  4GX6 A;  4PFR A;  3C33 A;  3GZG A;  1J1N A;  3JZJ A;  3RTF B;  3OXN A;  2NVU B;  1OVB A;  1Y20 A;  1UQW A;  2RC7 A;  3PUX E;  3FVK A;  3DM0 A;  4MBP A;  1H45 A;  1B9J A;  2GRV A;  3R7X A;  4MIJ A;  1LBY A;  4ZZA A;  1FBG A;  3MZ9 A;  4NF8 B;  4YB5 A;  3Q27 A;  3RUM A;  5KDT A;  2FBP A;  4P47 A;  4I40 A;  2H99 A;  4N6K A;  3BKI B;  1H76 A;  3SEW A;  4ZEI A;  3FVG A;  1LAG E;  2IEE A;  1FPJ A;  1B0L A;  4IO3 A;  3KEI A;  4GWS A;  1NUX A;  1UTB A;  4GX4 A;  4JSD A;  3C34 A;  3RTW B;  4NWD A;  3W15 C;  3G3G A;  5FHM A;  3TTN A;  4QRZ A;  2F3D A;  3FXB A;  1MDQ A;  5ICQ A;  2XX8 A;  1JNF A;  2VT5 A;  3E9X A;  2WEF A;  3IOR A;  4ZDM A;  4ZS9 A;  2OBG A;  1FPI A;  3K1M A;  3Q29 A;  2XWO A;  1B7Z A;  3FXU A;  4THI A;  4KI0 E;  5KCJ B;  1URD A;  4GFR A;  2Q88 A;  5I3S A;  2ABH A;  1XOC A;  4ELQ A;  4MLQ A;  1FSA A;  2R6G E;  2CZI A;  3HST A;  3FAT A;  1D9V A;  3BFT A;  2DE2 A;  1VDW A;  4GL0 A;  3SEX A;  1KZ8 A;  4O3C A;  4KQP A;  3EHS A;  1XVX A;  1ZKB A;  4NHB A;  3TKD A;  5ITP A;  4FOR A;  1A8F A;  2Y5L A;  5J1D A;  4E0W A;  4EQB A;  4NF6 B;  4GWX A;  3FJ7 A;  4LON B;  3TTL A;  2HPG A;  1B5I A;  3KBR A;  2DXR A;  5B70 A;  3EQ1 A;  5FHN A;  3L6H A;  1B58 A;  3KN7 A;  3M3K A;  4LUB A;  2F8D A;  3FAS A;  3S2V A;  1B40 A;  1FTM A;  4PFW A;  4NN3 A;  1FPL A;  3N6T A;  3IJX B;  1JEU A;  4G2Z A;  4R9G A;  5IZ3 A;  3H6T A;  3PGF A;  1B3E A;  4QF9 A;  4U22 A;  2HZL A;  3OEK A;  3H3G A;  1OIB A;  3O28 A;  4GIZ A;  4GXS B;  4I3Y A;  1IXC A;  4UAB A;  1Y4T A;  1LBB A;  1OLA A;  3FV1 A;  1I6Q A;  1D9Q A;  2QS1 A;  1MQH A;  2XXW A;  2FA7 A;  3UA8 A;  5L9S A;  4X1B A;  1FBP A;  1Z7N E;  3ECR A;  1IUD A;  3FVO A;  3M3L A;  1F9B A;  1EZP A;  1EU8 A;  5L9M A;  2WYP A;  4JXI A;  3C31 A;  2XXH A;  2Y7R A;  4OVJ A;  1LFH A;  1EZO A;  4EUO A;  3FXR A;  3QSL A;  3GYY A;  3SET A;  2UXA A;  3PMX A;  2AIX A;  5DEX B;  3OOA A;  2HZK A;  4OFO A;  1LB8 A;  3VVF A;  3O29 A;  5H8N A;  4H65 A;  4JB7 A;  4H45 A;  3WAF A;  1T0K A;  2FNC A;  2ONK E;  4RK2 A;  4NED A;  1NV1 A;  1Y9U A;  1BIY A;  1ZBM A;  2Z8D A;  4FEC A;  4NWC A;  4IO7 A;  3U72 A;  3MPK A;  5AA4 A;  3G3F A;  4PFY A;  2IA4 A;  3B6W A;  5AA3 A;  3MAM A;  4GF8 A;  5JTY A;  2P1S A;  4FE8 A;  2OK2 A;  1B46 A;  2P3N A;  2P2A A;  1XS5 A;  4N15 A;  3S9M C;  1I69 A;  1N7W A;  5J16 A;  2NUV A;  4NX1 A;  2I48 A;  5HBC A;  4IO4 A;  3TEP A;  1HSL A;  3O9P A;  1II5 A;  1FBD A;  1GGG A;  3H6U A;  3OSR A;  2D21 A;  3S9L C;  2VP1 A;  3IFA A;  4OZ9 A;  3FBP A;  4XEQ A;  5TP9 B;  5L9O A;  2DYX A;  2QS4 A;  1SW2 A;  4JWO A;  2H4I A;  4ELP A;  4LAT A;  1LEV A;  1IME A;  5JEI A;  5FBP A;  2F97 A;  4NF8 A;  5H8F B;  2A5S A;  3UIF A;  3K1N A;  2ZNU A;  3KSJ A;  4JDF A;  1PDA A;  4HTG A;  2ZNS A;  3U8Q A;  2QS2 A;  5CBS A;  1SI0 A;  4BDR A;  3ZSF A;  1YYZ A;  2ONS A;  2GFE A;  2X7P A;  2V25 A;  4RPO A;  3D4C A;  1MQD A;  5LDZ A;  4RNS A;  3N26 A;  5JK4 A;  4OET A;  1ZMG A;  2CEX A;  5IAI A;  2QMW A;  4KR5 A;  3IB2 A;  2XXP A;  1A54 A;  2I4B A;  3WAE A;  3CVG A;  3CSB A;  1ATG A;  1FPF A;  1R1N A;  2F34 A;  2HAU A;  1IQ7 A;  3IO4 A;  5A5L A;  3LC8 A;  1UIU A;  1NUW A;  2ZZX A;  4OVS A;  3T1B A;  1US4 A;  4UA8 A;  4X1D A;  1FQB A;  4JWX A;  3TFL A;  3O2A A;  4O94 A;  2REG A;  4RY1 A;  2B3B A;  3M8U A;  3TAJ A;  4R2F A;  4F31 B;  4O7I A;  4MLV A;  2O1M A;  3RNN A;  3MVX A;  3T93 B;  2PVU A;  4HCY A;  1MXZ A;  1B51 A;  2PMS A;  1FPB A;  3IB1 A;  2ZMB A;  3KGC A;  3PUW E;  3C32 A;  4P1E A;  3PPO A;  1NL5 A;  2RCA A;  3E79 A;  3EPE A;  5ISU A;  3HCQ A;  3TOD A;  3VLW A;  3THI A;  1HSE A;  1PC3 A;  3KFM A;  2DOJ A;  1XVY A;  1MXY A;  4WED A;  1QW0 A;  3PMW A;  4ELO A;  5TPA A;  3U93 A;  4GOT A;  1R9Q A;  4PF6 A;  1M5E A;  3G3I A;  1OQH A;  1NUY A;  4QSD A;  4F18 A;  1H3D A;  1IMF A;  3FVN A;  3KOS A;  3KN3 A;  4GWY A;  3SKP A;  3IK6 B;  2Q9T A;  2H25 A;  2P3V A;  4NGU A;  3CHG A;  2QL3 A;  1QUK A;  3O66 A;  3S4U A;  1P99 A;  3RLF E;  4GX3 A;  4I8C A;  1SW5 A;  1AMF A;  4MH5 A;  1NI9 A;  3HN0 A;  1NV7 A;  3UOR A;  1FBE A;  3B8B A;  2P0S A;  3IL1 B;  1P1O A;  3C4M A;  3R6U A;  3V83 A;  3MZB A;  3FD3 A;  2Y7I A;  4IB2 A;  1SYI A;  4F19 A;  5DEX A;  5I56 B;  1LBV A;  1S50 A;  1VSO A;  3E3K A;  4RPN A;  1QKB A;  3SDF A;  2Z8F A;  5CRY A;  2FIE A;  4P11 A;  4XKN A;  4KXP A;  4OVR A;  4ZE8 A;  2M8C A;  4HE1 A;  1KA1 A;  2UVH A;  4R75 A;  2PCR A;  4DXU A;  4F2O A;  2UVJ A;  3OEL A;  4R2B A;  2DE3 A;  4EXL A;  4GL8 A;  2O51 A;  4ESW A;  1EYK A;  3BBR A;  2ZYK A;  2QSX A;  1MH3 A;  1US5 A;  2QRY A;  3A29 A;  3K4U A;  1TFD A;  1URS A;  4YB6 A;  1SQY A;  1MM6 A;  3F11 A;  4GRK A;  2F7A A;  3TCG A;  1LAF E;  4PP0 A;  4MNC A;  4WEP A;  1XI6 A;  2HEU A;  3SEV A;  4L17 A;  1XC1 A;  2ZYM A;  3DP8 A;  2V3U A;  4OEU A;  2A5T B;  3H7M A;  2CZH A;  4FAT A;  1LAX A;  1B52 A;  3K6U A;  2H9B A;  3I6V A;  5IZ1 A;  5DVF A;  4AQ4 A;  4YAH X;  3PTY A;  1FTK A;  2REJ A;  3LSF B;  4OHN A;  2UYE A;  4G61 A;  1KA0 A;  3UGW A;  2BJI A;  3FIR A;  5H8F A;  5KZT A;  3IB0 A;  2CMO A;  2I0C A;  4PAK A;  2GHB A;  2XXU A;  1AH5 A;  3MC2 A;  2ZZV A;  4P56 A;  4X48 A;  4YB7 A;  3PD8 A;  1MPB A;  4MCO A;  2XX9 A;  3LSW A;  2NXO A;  4GD5 A;  1DK4 A;  2DE4 A;  1SVX B;  4OWD A;  1B6H A;  2XWK A;  3HHF A;  5I2K B;  3RN8 A;  3IOV A;  1MY1 A;  3CIJ A;  2ALU A;  1AL3 A;  3LR1 A;  4PTK A;  4WXJ A;  4X8R A;  1NNF A;  4KYD A;  1GVC A;  4N8Y A;  5IM2 A;  4JVI A;  1SYH A;  4DLD A;  3GBB A;  3HV1 A;  4ESX A;  2RC9 A;  4OAN A;  4NF0 A;  3KJ7 A;  4XF5 A;  3KOT A;  2O84 X;  2DSF A;  3PV0 E;  4LQ2 A;  4OEN A;  5HPQ A;  1B4Z A;  3ONM A;  4G77 A;  1IXI A;  1BLF A;  2V93 A;  5ET8 A;  4NAP A;  1POT A;  3MP6 A;  3CSG A;  2UVG A;  3HO7 A;  4M4G A;  1LLS A;  2H98 A;  1DMB A;  3KBZ A;  3LBS A;  1IMA A;  2JJK A;  1JET A;  2E1S A;  1JEV A;  1FTJ A;  4XKR A;  2FHY A;  3G3K A;  5DVJ A;  1BKA A;  3Q25 A;  1FCK A;  1MXW A;  1OQG A;  1DSN A;  4JSO A;  4N6P A;  4XKP A;  3LUZ A;  4H46 A;  4YMB A;  2LAO A;  3JYR A; 
#chains in the Genus database with same CATH homology
 3K6X A;  1Y1M A;  3O6H A;  3B7D A;  1LAH E;  3VDF A;  4GLI A;  4H8J A;  4KPT A;  3V5A A;  5F7V A;  1FW0 A;  1JW5 A;  4G4P A;  2I4C A;  2HXW A;  2RCB A;  2DVZ A;  1B3F A;  5H8H A;  3L6G A;  4AB5 A;  3MZ1 A;  1PB8 A;  1GTK A;  4KD5 A;  2AL4 A;  3KJT A;  3C9H A;  3USD A;  3TMG A;  4C0R A;  4HS7 A;  1GR2 A;  1Y1Z A;  4ND9 A;  4OES A;  4LQ5 A;  4BLA A;  1PB7 A;  4Q0C A;  4H0W A;  3MWB A;  4C1T A;  1I6A A;  4U2R A;  1WDN A;  3MVY A;  1N3W A;  4F2Q A;  5LOM A;  2E0S A;  3VVE A;  2I3W A;  4IGT A;  4YKI A;  4FEB A;  5I58 B;  3G3J A;  1B3G A;  2O6A A;  3A09 A;  5M2V A;  4F1Y A;  3PUV E;  1LFI A;  3CFX A;  3KSX A;  3OO9 A;  2DXY A;  1QUJ A;  3CRB A;  3CI8 A;  2V84 A;  1ZJL A;  3QAX A;  4Z0I A;  2PBW A;  3ODB A;  3PPR A;  5I59 B;  3RPW A;  2Z23 A;  1DOT A;  1MS7 A;  5I2N B;  4G68 B;  1Y4C A;  1JW1 A;  4U1O A;  2I58 A;  1S7Y A;  3MJN A;  3A3U A;  4U1Z A;  1B1H A;  1SW1 A;  4KFQ A;  4GXA A;  1B7H A;  4HCW A;  4N07 A;  4O3A A;  1IIW A;  2YJP A;  2ZYO A;  1M5F A;  4EF1 A;  2VHA A;  2XXT A;  2O7U A;  1D4N A;  4YIC A;  3O6G A;  5FHO A;  3IOW A;  1A8E A;  4RXL A;  1D9Y A;  1SBP A;  4IO2 A;  4IGR A;  4IO5 A;  5EYF A;  1MDP 1;  3JV9 A;  4YKK A;  4EQ9 A;  4DE8 A;  1DTG A;  1H44 A;  3T9U A;  2DVC A;  2RIN A;  4LA9 A;  4R9F A;  2I3V A;  3TDJ A;  4ZE9 A;  1FTO A;  3H6W A;  4U21 A;  4GQO A;  4Z7E A;  3G3H A;  3PPP A;  4YU0 A;  3MW0 A;  2QJE A;  1N04 A;  4ZEC A;  3VLU A;  3QK6 A;  4F1U A;  4AB6 A;  4YZZ A;  3GBA A;  1URG A;  3TTK A;  1N7X A;  2XX7 A;  4OMB A;  2DWJ A;  1O64 A;  2QMX A;  2GH9 A;  3QUF A;  2ONR A;  1UTB B;  2XXI A;  3M3F A;  5DYH A;  5CI5 A;  5KCJ A;  5I57 B;  1LBC A;  5CMB A;  3W9V A;  1Q1K A;  1Y3Q A;  1Q35 A;  4DZ1 A;  1MY4 A;  4PET A;  4EXK A;  2RC8 A;  1A55 A;  4JWY A;  3VXC A;  2CZL A;  4U23 A;  3DP6 A;  1EZ9 A;  3O97 A;  1Y3N A;  3PPQ A;  3RQT A;  2H5Y A;  5L8D A;  1TFA A;  4DIG A;  4F29 A;  1WOD A;  4BDQ A;  4NF6 A;  3EF7 A;  3OEN A;  4XXU A;  4RYA A;  4TQU Q;  3TTR A;  1MPC A;  1B3L A;  1NKX A;  4O3B A;  3FZV A;  2PT2 A;  3IR1 A;  4NE4 A;  4ISU A;  1IZ1 A;  2Y7W A;  1QUI A;  3K00 A;  4IY6 A;  1MPD A;  1ANF A;  2HFB A;  3QUJ A;  1LCF A;  4PFU A;  4QHQ A;  3U1O A;  1FTL A;  2YPN A;  4ZEF A;  4WKM A;  2BJJ X;  4QSC A;  3W9W A;  3QIM A;  1FQC A;  1NH8 A;  2OJT A;  2R71 A;  4ZZE A;  5FTI A;  4TOZ A;  1H43 A;  1USY E;  3T66 A;  1B4H A;  4ECF A;  4I62 A;  2XHD A;  5DTB A;  1EH3 A;  2NWJ A;  5BUU A;  1FQA A;  3ZS6 A;  2DP8 A;  4BDO A;  5IKB A;  2HQ0 A;  1PBQ A;  3N5L A;  4NF4 B;  3Q28 A;  5AA1 A;  1BP5 A;  3D4G A;  1Z7M E;  4BDN A;  3MUQ A;  1R6Z A;  3I3V A;  5I59 A;  3OEM A;  2Y84 A;  3TYH A;  1QUL A;  3OO7 A;  2ZYN A;  4DDD A;  4GVO A;  1YCJ A;  4H6D A;  4G68 A;  5CMC A;  2UYF A;  2V3T A;  4TLL B;  1WVJ A;  2ESN A;  5AA4 B;  5EHS A;  4U4X A;  2Z22 A;  3FUZ A;  1PEB A;  3TEL A;  3T22 A;  3C35 A;  5CMM A;  3OO8 A;  2W7Y A;  3V8X B;  2FYI A;  3B6Q A;  4P0G A;  4R72 A;  4Q8R A;  1NNP A;  4M1V A;  3H6V A;  4OQO A;  4TLM B;  4H8I A;  1IIT A;  3VV5 A;  5TP9 A;  3OSQ A;  1UTH B;  4Q30 B;  4R74 A;  3H4Z A;  2F7B A;  3EN3 A;  4OTE A;  1B7U A;  1QJM A;  2F6G A;  1O63 A;  1OMP A;  2KLF A;  3BFU A;  3QXM A;  4FJP A;  2RF1 A;  2XXR A;  1LFG A;  1MY3 A;  2RKM A;  4FIM A;  1MXU A;  2OWT A;  2DS9 A;  3VFJ A;  4H1X A;  3FXQ A;  3MP1 A;  1JQF A;  5B7D A;  2DQV A;  3RGY A;  4PFT A;  2DWH A;  1ZU0 A;  3U94 A;  4DCX A;  1LGB C;  1MY2 A;  2B3F A;  3OD7 A;  3LSL A;  3IO6 A;  3R26 A;  5FTH A;  4ZEB A;  3PD9 A;  2ANJ A;  3IAZ A;  4FED A;  3K01 A;  1KWH A;  3I5O A;  3TQL A;  3SEY A;  4R6K A;  3E4R A;  2ZNT A;  5I57 A;  1TT1 A;  1JVX A;  3K6V A;  5H8Q B;  3H03 A;  5A5X B;  4PQJ A;  2XD2 A;  3MPL A;  1PB9 A;  1CB6 A;  4DXC A;  4KHZ E;  1NMU A;  1IEJ A;  1P1N A;  1M5D A;  1IXG A;  4LZ8 A;  1R9L A;  3MVZ A;  1CE2 A;  2OZZ A;  3FJM A;  3UP9 A;  1MXV A;  3A3C A;  3IOU A;  3SER A;  4K3F A;  1RYX A;  1AOV A;  1N84 A;  1MH4 A;  3VLV A;  5CMK A;  1SD3 A;  5TU0 A;  2THI A;  1B0H A;  4I9D A;  3DP4 A;  2O7I A;  3IOT A;  4LZ5 A;  3Q26 A;  4EDP A;  1IXH A;  1ZIU A;  3P7I A;  3T9X B;  1B32 A;  1MRP A;  2X7Q A;  5DT6 A;  4F1V A;  1B05 A;  2X26 A;  5CM6 A;  1DPE A;  4XTC Q;  4H5G A;  1N3X A;  3DEL B;  1ELJ A;  1TWY A;  1MQG A;  2QPQ A;  5TPA B;  3TZA A;  2NOO A;  2XXY A;  2Y7P A;  1FQD A;  3IX1 A;  3ILU B;  4QFL A;  3EHU A;  3RT8 A;  2O68 A;  3CFZ A;  4KCD A;  1D3K A;  5AA2 B;  4YKP A;  4N13 A;  1LCT A;  5ITO A;  3K6W A;  1JVY A;  4QFK A;  1O7T A;  5I56 A;  1FQE A;  3ZKL A;  2F78 A;  5HM4 B;  3E13 X;  4BDM A;  3MP8 A;  2Q8J A;  1VFD A;  3C36 A;  2UVI A;  3N94 A;  4NF5 B;  1GV8 A;  2R9J A;  2G93 A;  4NF4 A;  4E0X A;  1MM7 A;  5I84 A;  1POY 1;  1SDX A;  2O1L A;  1FQF A;  4DCY A;  2HAV A;  3T9V A;  1OLC A;  3CFL A;  3K02 A;  5EHM A;  2B65 A;  3HHG A;  5H8S A;  1QKA A;  4YMA A;  2XXX A;  3K1P A;  1P1U A;  3VVD A;  5CC2 A;  4F3P A;  1LB9 A;  1A99 A;  2Z8E A;  3GXA A;  1USY H;  1VFE A;  4R6H A;  4RA1 A;  1XT8 A;  1S9T A;  2Q89 A;  5BWJ A;  2A5T A;  3VE1 B;  1VR5 A;  4POW A;  3HPI A;  1MG1 A;  3TUS A;  3FJG A;  3AXF A;  2V3Q A;  4Q5T A;  1UTH A;  4C1U A;  1SI1 A;  2Q2A A;  1M5C A;  3SEU A;  1P1W A;  1A40 A;  1MY0 A;  2O69 A;  2PT1 A;  3CR9 A;  2F6P A;  4QFO A;  4X9T A;  3CG3 A;  2F35 A;  1RKM A;  1QVS A;  1VE4 A;  2OLB A;  2YLN A;  4JBZ A;  1NFT A;  4RJZ A;  4KYS A;  5CBR A;  1N76 A;  3ZKK A;  4GWO A;  5I2K A;  3SES A;  1L5T A;  2F7C A;  4OFJ A;  1XHY A;  4LVQ A;  4OEV A;  4F22 A;  5KDT B;  4KCC A;  2DWA A;  4BDL A;  3LUY A;  4NMY A;  4HW8 A;  1P1Q A;  1N0T A;  4LZ7 A;  2PYY A;  2QS3 A;  4IY5 A;  3CG1 A;  2Q2C A;  4F3G A;  3TPA A;  3KG2 A;  4EQ7 A;  1ZTY A;  5H8Q A;  1I6B A;  5A5X A;  2VD2 A;  3S9E A;  4G8N A;  2AL5 A;  5AA2 D;  2I6E A;  2GHA A;  4ONY A;  4QFN A;  2AYS A;  4G8H A;  3QYT A;  3U92 A;  2OCU A;  1MQI A;  4H67 A;  1BTJ A;  3TQW A;  1B1X A;  3H06 B;  4ZED A;  3PMV A;  2I49 A;  1TXF A;  3MQ9 A;  3TTM A;  1B5J A;  2G29 A;  3LSX A;  3FGS A;  3KZG A;  3DLN A;  3PUY E;  2F36 A;  4QFP A;  1RYO A;  1M5B A;  4R6Y A;  1DTZ A;  4MFI A;  3K0V A;  1MQJ A;  4ZEK A;  1UIV A;  1B2H A;  5K2X A;  3IJO B;  4RK9 A;  4YKJ A;  2Y7K A;  3B6T A;  2XD3 A;  3KN8 A;  3O6I A;  4PE5 B;  1NNK A;  4LP2 B;  4IO6 A;  3N6U A;  5ICT A;  3OMB A;  4KYE A;  5H8H B;  1JW4 A;  4XIG Q;  4MF3 A;  4F3B A;  4DXB A;  4OYV A;  4XKQ A;  5AA2 A;  3ILT B;  3V89 B;  4FAJ A;  3G7W A;  2PX1 A;  5ELV A;  4F3S A;  3EHT A;  2OWS A;  2XXQ A;  1YTV A;  2D5W A;  5I58 A;  1HSJ A;  4I1D A;  4NF5 A;  1MXX A;  1YAE A;  5F1Q A;  3RY3 A;  2VOZ A;  2VD3 A;  4P0I A;  1NNT A;  3MVW A;  2ZXT A;  3PUZ E;  4H5F A;  3UK4 A;  3MBP A;  2D3I A;  3VXB A;  3TCF A;  5AE4 A;  3FV2 A;  1A7L A;  4ELR A;  5H8N B;  4R73 A;  4POX A;  3UN6 A;  3S9N C;  1AIV A;  2WKY A;  1LST A;  5DVI A;  5I2N A;  2F5X A;  4UAC A;  3OO6 A;  4G8M A;  1YPN A;  2DWI A;  1Y3P A;  4U4S A;  4NTL A;  3GLB A;  3PPN A;  3T96 B;  3TCH A;  1B3H A;  5JTY B;  1PBP A;  1OVT A;  1SW4 A;  4G68 C;  1NH7 A;  4OER A;  5K2Y A;  4F39 A;  2VGQ A;  4OFL A;  1DPP A;  2XXV A;  1ZLQ A;  4QSE A;  4OXV A;  3RT6 B;  4EF2 A;  2I0B A;  3PU5 A;  3T9H B;  3K2D A;  1B5H A;  2HCA A;  3C33 A;  3GZG A;  1J1N A;  3JZJ A;  3RTF B;  3OXN A;  2NVU B;  1OVB A;  1Y20 A;  1UQW A;  2RC7 A;  3PUX E;  3FVK A;  3DM0 A;  4MBP A;  1H45 A;  1B9J A;  2GRV A;  3R7X A;  4ZZA A;  3MZ9 A;  4NF8 B;  4YB5 A;  3Q27 A;  3RUM A;  5KDT A;  2H99 A;  3BKI B;  1H76 A;  3SEW A;  4ZEI A;  3FVG A;  1LAG E;  2IEE A;  1B0L A;  4IO3 A;  3KEI A;  1UTB A;  4JSD A;  3C34 A;  3RTW B;  4NWD A;  3W15 C;  3G3G A;  3TTN A;  5FHM A;  4QRZ A;  1MDQ A;  5ICQ A;  2XX8 A;  1JNF A;  3E9X A;  3IOR A;  4ZDM A;  4ZS9 A;  2OBG A;  3K1M A;  3Q29 A;  1B7Z A;  3FXU A;  4THI A;  4KI0 E;  5KCJ B;  1URD A;  4GFR A;  2Q88 A;  2ABH A;  1XOC A;  4ELQ A;  4MLQ A;  2R6G E;  3HST A;  3FAT A;  1D9V A;  3BFT A;  2DE2 A;  4GL0 A;  3SEX A;  4O3C A;  4KQP A;  3EHS A;  1XVX A;  1ZKB A;  3TKD A;  5ITP A;  4FOR A;  1A8F A;  5J1D A;  4E0W A;  4EQB A;  4NF6 B;  3FJ7 A;  4LON B;  3TTL A;  1B5I A;  3KBR A;  2DXR A;  5B70 A;  3EQ1 A;  5FHN A;  3L6H A;  1B58 A;  3KN7 A;  3M3K A;  4LUB A;  2F8D A;  3FAS A;  3S2V A;  1B40 A;  1FTM A;  4PFW A;  3N6T A;  3IJX B;  1JEU A;  4G2Z A;  4R9G A;  3H6T A;  3PGF A;  1B3E A;  4QF9 A;  4U22 A;  2HZL A;  3OEK A;  3H3G A;  1OIB A;  3O28 A;  4GIZ A;  4GXS B;  1IXC A;  1Y4T A;  1LBB A;  1OLA A;  3FV1 A;  1I6Q A;  2QS1 A;  1MQH A;  2XXW A;  2FA7 A;  3UA8 A;  5L9S A;  4X1B A;  1Z7N E;  3ECR A;  1IUD A;  3FVO A;  3M3L A;  1F9B A;  1EZP A;  1EU8 A;  5L9M A;  4JXI A;  3C31 A;  2XXH A;  2Y7R A;  4OVJ A;  1LFH A;  1EZO A;  4EUO A;  3FXR A;  3QSL A;  3SET A;  2UXA A;  3PMX A;  2AIX A;  5DEX B;  3OOA A;  2HZK A;  4OFO A;  1LB8 A;  3VVF A;  3O29 A;  5H8N A;  4H65 A;  4JB7 A;  3WAF A;  1T0K A;  2FNC A;  2ONK E;  4RK2 A;  4NED A;  1Y9U A;  1BIY A;  1ZBM A;  2Z8D A;  4FEC A;  4NWC A;  4IO7 A;  3U72 A;  3MPK A;  5AA4 A;  3G3F A;  4PFY A;  2IA4 A;  3B6W A;  5AA3 A;  3MAM A;  4GF8 A;  5JTY A;  2P1S A;  4FE8 A;  2OK2 A;  1B46 A;  2P2A A;  1XS5 A;  3S9M C;  1I69 A;  1N7W A;  2NUV A;  2I48 A;  5HBC A;  4IO4 A;  3TEP A;  1HSL A;  3O9P A;  1II5 A;  1GGG A;  3H6U A;  3OSR A;  2D21 A;  3S9L C;  2VP1 A;  4OZ9 A;  5TP9 B;  5L9O A;  2DYX A;  2QS4 A;  1SW2 A;  4JWO A;  2H4I A;  4ELP A;  4LAT A;  5JEI A;  2F97 A;  4NF8 A;  5H8F B;  2A5S A;  3UIF A;  3K1N A;  2ZNU A;  3KSJ A;  4JDF A;  1PDA A;  4HTG A;  2ZNS A;  3U8Q A;  2QS2 A;  5CBS A;  1SI0 A;  4BDR A;  3ZSF A;  2ONS A;  2GFE A;  2X7P A;  2V25 A;  4RPO A;  3D4C A;  1MQD A;  4RNS A;  3N26 A;  5JK4 A;  4OET A;  1ZMG A;  5IAI A;  2QMW A;  4KR5 A;  3IB2 A;  2XXP A;  1A54 A;  2I4B A;  3WAE A;  3CVG A;  3CSB A;  1ATG A;  1R1N A;  2F34 A;  2HAU A;  1IQ7 A;  3IO4 A;  3LC8 A;  1UIU A;  1US4 A;  4UA8 A;  4X1D A;  1FQB A;  4JWX A;  3TFL A;  3O2A A;  2REG A;  4RY1 A;  2B3B A;  3M8U A;  3TAJ A;  4R2F A;  4F31 B;  4MLV A;  2O1M A;  3RNN A;  3MVX A;  3T93 B;  2PVU A;  4HCY A;  1MXZ A;  1B51 A;  2PMS A;  3IB1 A;  2ZMB A;  3KGC A;  3PUW E;  3C32 A;  3PPO A;  1NL5 A;  2RCA A;  3EPE A;  5ISU A;  3HCQ A;  3TOD A;  3VLW A;  3THI A;  1HSE A;  1PC3 A;  3KFM A;  2DOJ A;  1XVY A;  1MXY A;  4WED A;  1QW0 A;  3PMW A;  4ELO A;  5TPA A;  3U93 A;  4GOT A;  1R9Q A;  1M5E A;  3G3I A;  1OQH A;  4F18 A;  4QSD A;  1H3D A;  3FVN A;  3KOS A;  3KN3 A;  3SKP A;  3IK6 B;  2Q9T A;  2H25 A;  2QL3 A;  1QUK A;  3O66 A;  3S4U A;  1P99 A;  3RLF E;  4I8C A;  1SW5 A;  1AMF A;  4MH5 A;  3UOR A;  3HN0 A;  2P0S A;  3IL1 B;  1P1O A;  3C4M A;  3R6U A;  3V83 A;  3MZB A;  3FD3 A;  2Y7I A;  4IB2 A;  1SYI A;  4F19 A;  5DEX A;  5I56 B;  1S50 A;  1VSO A;  3E3K A;  4RPN A;  1QKB A;  3SDF A;  2Z8F A;  5CRY A;  4P11 A;  4XKN A;  4ZE8 A;  2M8C A;  2UVH A;  4R75 A;  4DXU A;  4F2O A;  2UVJ A;  3OEL A;  4R2B A;  2DE3 A;  4EXL A;  4GL8 A;  2O51 A;  4ESW A;  3BBR A;  2ZYK A;  2QSX A;  1MH3 A;  1US5 A;  2QRY A;  3K4U A;  1TFD A;  1URS A;  4YB6 A;  1SQY A;  1MM6 A;  3F11 A;  4GRK A;  2F7A A;  3TCG A;  1LAF E;  4PP0 A;  4WEP A;  2HEU A;  3SEV A;  4L17 A;  1XC1 A;  2ZYM A;  3DP8 A;  2V3U A;  4OEU A;  2A5T B;  3H7M A;  4FAT A;  1LAX A;  1B52 A;  3K6U A;  2H9B A;  3I6V A;  5DVF A;  4AQ4 A;  4YAH X;  1FTK A;  2REJ A;  3LSF B;  4OHN A;  2UYE A;  3UGW A;  3FIR A;  5H8F A;  5KZT A;  3IB0 A;  2CMO A;  2I0C A;  2GHB A;  2XXU A;  1AH5 A;  3MC2 A;  4X48 A;  4YB7 A;  3PD8 A;  1MPB A;  2XX9 A;  3LSW A;  2NXO A;  4GD5 A;  2DE4 A;  1SVX B;  4OWD A;  1B6H A;  3HHF A;  5I2K B;  3RN8 A;  3IOV A;  1MY1 A;  3CIJ A;  2ALU A;  1AL3 A;  3LR1 A;  4WXJ A;  1NNF A;  4KYD A;  1GVC A;  1SYH A;  4DLD A;  3GBB A;  3HV1 A;  4ESX A;  2RC9 A;  3KJ7 A;  3KOT A;  2O84 X;  2DSF A;  3PV0 E;  4LQ2 A;  4OEN A;  5HPQ A;  1B4Z A;  3ONM A;  4G77 A;  1IXI A;  1BLF A;  2V93 A;  1POT A;  3MP6 A;  3CSG A;  2UVG A;  3HO7 A;  4M4G A;  1LLS A;  2H98 A;  1DMB A;  3LBS A;  1JET A;  2E1S A;  1JEV A;  1FTJ A;  4XKR A;  3G3K A;  5DVJ A;  1BKA A;  3Q25 A;  1FCK A;  1MXW A;  1OQG A;  1DSN A;  4JSO A;  4N6P A;  4XKP A;  4YMB A;  2LAO A;  3JYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...