2F6PA

Benm effector binding domain- semet derivative
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
218
structure length
218
Chain Sequence
KTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPNWLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator benM
publication title Distinct Effector-binding Sites Enable Synergistic Transcriptional Activation by BenM, a LysR-type Regulator.
pubmed doi rcsb
source organism Acinetobacter baylyi
total genus 66
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f6pA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f6pA02
3IJXB 1HSLA 4R2BA 3VVFA 1N76A 3L6HA 5L9MA 2A5TA 4QFNA 2DYXA 3TYHA 4G4PA 3FVKA 3CG3A 4OTEA 1R6ZA 4P0IA 2Y7PA 4JSDA 3D4GA 4NF8A 2O84X 2UXAA 3PPPA 4OMBA 3S9LC 4M1VA 2FNCA 3GLBA 3RGYA 2F6GA 1A8FA 4JBZA 1LAGE 4GL8A 4F18A 3OXNA 3ONMA 1LGBC 4XKNA 1JETA 5H8NA 2H5YA 4IY6A 2VOZA 2QMXA 5K2YA 3Q25A 4GF8A 3MZ9A 4R6YA 3MW0A 4FEDA 1TWYA 3DP8A 4LONB 3W9WA 1XS5A 2B3FA 4YMBA 1MPCA 3N5LA 4IY5A 3TKDA 4HTGA 1XT8A 4WEDA 1B3GA 2UYEA 3KZGA 4YB6A 3PUXE 3I3VA 2UVJA 4I1DA 1LAHE 2DVCA 3FASA 4PQJA 1FCKA 1P1WA 2ALUA 4AB5A 3TELA 3VLUA 2VHAA 3KN7A 4K3FA 1DMBA 4Q30B 4GVOA 1USYE 3U72A 1OLAA 3SETA 1QKBA 3R26A 3TTLA 5I59A 5I2NA 2B65A 1SBPA 5ICTA 1JW5A 5L9SA 2VD3A 2A5SA 4TOZA 1FTMA 5LOMA 3MZBA 1WVJA 4YZZA 4GIZA 4IO2A 2QS2A 4FORA 1A7LA 1UQWA 4I62A 2DE4A 3EF7A 3VLVA 4ZEIA 3M3FA 1H43A 3T9UA 5M2VA 4U1OA 5I57B 3H6VA 1AMFA 4LVQA 5CC2A 3S2VA 4XIGQ 1MY3A 3PD8A 4U21A 1NH7A 5JK4A 4R6KA 2XXWA 2DE2A 4YMAA 1NH8A 3IOUA 2LAOA 3CFLA 3HCQA 5F7VA 4NWDA 1LCTA 5I2KB 3A09A 2V93A 4Q0CA 4RPOA 5I58B 4ZE9A 2XXQA 5I84A 3IO6A 2I6EA 4MF3A 2GHAA 4KD5A 3SESA 1IZ1A 3K2DA 1XHYA 4KI0E 3UN6A 3W9VA 4AB6A 2V3UA 2V25A 1B1HA 1ANFA 4XKPA 1D4NA 1MQGA 4QF9A 1RYXA 1TXFA 2R9JA 1MH4A 1MQDA 1URSA 4NE4A 3CIJA 2VGQA 3O66A 4WKMA 4MBPA 4U2RA 1MY2A 1OVTA 3A3UA 4R72A 1SW2A 2OWSA 4Z0IA 3DLNA 3TTMA 3PPOA 3ZKLA 2QPQA 2OZZA 3KN8A 2HZKA 3I6VA 4QFKA 2RC7A 2GHBA 1Y20A 4RYAA 3U94A 1IQ7A 3OELA 3HPIA 4RXLA 1MRPA 1YCJA 3T9XB 3MPLA 4KR5A 1PB7A 4IO6A 1MDP1 3G3KA 4F19A 3B7DA 3KJTA 4QFLA 4FECA 1LCFA 2AIXA 3OO8A 4EF1A 4ZECA 1ZBMA 5HBCA 3ZSFA 1QJMA 1R9QA 3FJ7A 3TQWA 2THIA 4RJZA 1XOCA 1POY1 3THIA 3T9HB 3USDA 3PMVA 3K00A 4U4XA 3C36A 1L5TA 3FD3A 3IO4A 1IXCA 1LB9A 4KYDA 4F3SA 1LAXA 2I0BA 4PFWA 1MXXA 4GOTA 3MPKA 1IITA 1H45A 1EZ9A 4G68C 1SVXB 2F7CA 3K6UA 4TQUQ 1B2HA 3MVWA 1B05A 1VFDA 4ELPA 1UTHB 5DYHA 2B3BA 1A8EA 4F3BA 1B3EA 1US4A 1B32A 2QS4A 1B0HA 4DLDA 4GD5A 3OEKA 1CE2A 1SW4A 4IO5A 4MH5A 3MC2A 4KYEA 3TCFA 1NNPA 4UA8A 1JEVA 3TODA 3MBPA 4RPNA 1YPNA 4FAJA 4GQOA 1MM6A 5TU0A 4GWOA 2P2AA 3BFUA 1P99A 2F7BA 5HPQA 3RLFE 1SYHA 1QULA 3S9MC 4DXUA 2QS3A 1Y1ZA 1UTBA 1QUIA 3P7IA 3FVNA 4OVJA 4QHQA 2ZMBA 3ZS6A 3G3FA 1JNFA 2V84A 1B3HA 4PETA 2HQ0A 4HCYA 3ILTB 2P1SA 4GLIA 5AA1A 2CMOA 4ZZEA 1M5CA 4H1XA 1EU8A 1MXYA 3VFJA 3Q26A 1AIVA 3B6WA 1B5IA 5CMMA 3UORA 2I3WA 2Y7WA 1FQAA 5KCJA 4R9GA 3BBRA 4R74A 4RA1A 1R1NA 1POTA 3HV1A 3A3CA 3K01A 2XXIA 1MH3A 3FATA 1N84A 2XX8A 4YB5A 4POWA 5H8QB 3H4ZA 1IXGA 3DELB 1QKAA 1S50A 1ZTYA 2PMSA 1NNFA 1Y3PA 3EHTA 3KBRA 2O1LA 1B58A 3IK6B 4H5GA 3CSBA 4F29A 1Q35A 3AXFA 2O6AA 1N7XA 3F11A 4ELQA 1EZOA 3Q29A 1N3WA 4H65A 1LB8A 4LQ2A 3MP8A 3SEVA 3FXRA 3HN0A 4TLLB 4AQ4A 4H0WA 1PBPA 1B51A 4OZ9A 3FV2A 3RN8A 4LZ8A 1UTBB 3TFLA 3GBBA 4G8HA 4ECFA 3SERA 3K1NA 5FHMA 2YLNA 3IJOB 1LFIA 1MXVA 1DTZA 2DXRA 3CRBA 1P1OA 2X7QA 1F9BA 3BKIB 5H8SA 3FVOA 4LZ7A 4WXJA 3TCGA 1BIYA 4EQ9A 2V3QA 5DEXA 4DZ1A 3LR1A 4PP0A 3S9NC 2HAVA 3FGSA 1B4HA 5JTYB 3MP6A 3CI8A 4IGTA 4LATA 1CB6A 3TQLA 5AA2D 4F3PA 5L8DA 1SW5A 4ZDMA 3B6QA 3UA8A 3ILUB 3WAFA 2DXYA 4DXBA 1N7WA 1FTOA 2XHDA 2KLFA 3TTKA 1GR2A 3RNNA 5H8FA 4XKQA 4ZEKA 3FZVA 4X1BA 1NMUA 3HO7A 2Y7RA 2AYSA 3UP9A 4NF5A 5TP9B 4RK9A 4GXAA 1A55A 1ZIUA 5TPAB 4IGRA 2CZLA 1ZMGA 1NKXA 3RPWA 5AA2B 4QFPA 1IXHA 3KFMA 4EXLA 3E13X 5ITOA 1B1XA 1QUKA 3E3KA 4OQOA 1Y1MA 2D3IA 3PGFA 4NEDA 1Q1KA 3K1PA 2E0SA 1WODA 3GZGA 4PFTA 4BDRA 3OO7A 1M5BA 4YKJA 2DVZA 2OK2A 1I6AA 4F2OA 3CFXA 3N94A 2A5TB 2NOOA 3VXCA 2FA7A 1B40A 2Q8JA 1B7ZA 5DTBA 3KGCA 1RKMA 3TTNA 3PU5A 4OFOA 2OCUA 3CG1A 3RY3A 1SI1A 4NF8B 3C4MA 1B6HA 4XKRA 1D3KA 4KCCA 4HCWA 2FYIA 3W15C 3O97A 3MJNA 2WKYA 4JB7A 2O51A 1SYIA 4XXUA 3CR9A 2PBWA 4BDLA 1A54A 5H8NB 3S9EA 1H3DA 2XX7A 2DE3A 3FXUA 3WAEA 1GVCA 2XXYA 1MY4A 1ZJLA 3IOTA 4MLVA 1BTJA 1VE4A 1FQDA 4KCDA 3UIFA 3TDJA 2O7UA 3O6IA 2O1MA 4IB2A 3C33A 2XXTA 2F35A 4H67A 2H99A 1O64A 1B4ZA 3MP1A 2O7IA 5KDTA 3RTFB 4YKPA 1I69A 4Z7EA 3TZAA 1LBCA 4R73A 3KN3A 4ZZAA 1I6BA 3LSXA 3MVYA 2IEEA 3K4UA 3G3HA 2X26A 3G7WA 4PFYA 2DOJA 1QVSA 3SEWA 3EHSA 4ZS9A 1FTJA 1SW1A 3MAMA 5I59B 5I2NB 4KYSA 4G77A 3CVGA 1OQGA 5H8HA 1URDA 1N04A 4UACA 5DVJA 3LSLA 4G8NA 3U1OA 2D21A 4YAHX 1SQYA 2Y7KA 2NVUB 4QFOA 1NNKA 3OO6A 1P1UA 2DWHA 3PV0E 1NFTA 4NF6A 3TMGA 4THIA 2YJPA 1DPPA 3OEMA 4JWXA 5I56A 2NUVA 3QSLA 3EHUA 3QIMA 2QJEA 3Q27A 4GXSB 5CMCA 4LP2B 1II5A 3GXAA 4NMYA 2RKMA 4YB7A 1XVXA 2RC9A 3TAJA 4DDDA 1TFAA 2QMWA 1FQBA 1B3LA 1PC3A 3VE1B 1IXIA 4RNSA 2PVUA 4OERA 1SD3A 3G3GA 5FTHA 2BJJX 4KPTA 5DVFA 4ESWA 3C9HA 3H3GA 3LSWA 4PE5B 3PPQA 2I0CA 2F36A 4U1ZA 2HFBA 2DP8A 5CMKA 4LA9A 4BDNA 5AA4A 5B7DA 2W7YA 1SI0A 2Z8FA 4X1DA 4FEBA 1AOVA 1BP5A 3O2AA 3UGWA 5A5XA 1B9JA 1DSNA 3SDFA 1R9LA 3IAZA 2G93A 3VVDA 3OSRA 4O3AA 1MS7A 3OENA 3RT8A 3EN3A 2Q89A 2ABHA 4QSCA 3PUZE 1TFDA 5K2XA 5IKBA 1B0LA 4F1UA 1US5A 4GFRA 1MG1A 3N6TA 2F97A 2I58A 1GGGA 1M5FA 2XXHA 4E0WA 4L17A 3G3JA 3KSXA 3QAXA 4ONYA 1NNTA 2DWIA 2DS9A 3KG2A 3H03A 4HS7A 3JV9A 2ZNUA 4FATA 1KWHA 4QRZA 1M5EA 1JEUA 4R6HA 4POXA 1YTVA 2PX1A 1B7HA 2XXUA 4N13A 1IUDA 3QUFA 1LAFE 3O29A 3E9XA 3IORA 2RC8A 5CM6A 5AA3A 4U4SA 2NXOA 1S9TA 4O3BA 1YAEA 1PB9A 2ZYMA 3H6WA 2Q2AA 1JQFA 4H8JA 4JXIA 2ONRA 1MPDA 5EHMA 1MXWA 1XC1A 4ZE8A 2ZNSA 3T22A 2M8CA 4EQ7A 3UK4A 2DSFA 3FVGA 4EQBA 1TT1A 2PYYA 1FQFA 4P0GA 4X48A 2I4CA 3E4RA 1EH3A 3TEPA 4MLQA 4YKKA 3LBSA 3H6TA 1MM7A 3B6TA 2VD2A 3BFTA 3V8XB 4ND9A 4JWOA 4RY1A 1JVYA 4EDPA 2GRVA 4OETA 3FJMA 4P11A 1T0KA 4ESXA 1M5DA 4OYVA 4ISUA 3ODBA 5BUUA 3MVZA 3N6UA 4GRKA 5HM4B 5CBSA 3T66A 2X7PA 1ELJA 4QSEA 2O69A 5ITPA 4IO3A 3DP4A 2Z8DA 1DTGA 4XTCQ 2ONSA 5KCJB 3FJGA 2ESNA 1FTLA 2QL3A 2XD3A 2Z22A 2XX9A 5I57A 1H44A 2F5XA 3TUSA 3H06B 3OMBA 1B3FA 3LSFB 4JSOA 1FTKA 1VSOA 1Y4TA 3ECRA 4JWYA 1DPEA 3V5AA 3IB1A 3ZKKA 5FHNA 1Y9UA 2R71A 4NF4A 4H5FA 5I2KA 3O6HA 2Q2CA 5I58A 4F3GA 2F7AA 4FIMA 1Z7NE 3FIRA 4FE8A 4BDMA 2ZNTA 3JZJA 1FQCA 1NL5A 4U22A 3C35A 3O9PA 4C0RA 1DOTA 2I4BA 1JVXA 1VR5A 4G68A 2H25A 4ELRA 4QSDA 4OESA 3U93A 3U8QA 4F31B 2E1SA 2Y84A 2VP1A 3U92A 2ZYOA 3KJ7A 4EF2A 3KEIA 4IO4A 5IAIA 4JDFA 3JYRA 5EHSA 2XXXA 1N3XA 5DEXB 1P1QA 3H7MA 1Y4CA 1D9VA 1URGA 2D5WA 1EZPA 1XVYA 3QK6A 4OHNA 1O7TA 3M3LA 2XXPA 2RCBA 1LFHA 1D9YA 1PEBA 1OIBA 1HSJA 4M4GA 4BDQA 1B5JA 2GH9A 5BWJA 3FUZA 2RCAA 5DVIA 4R2FA 2F34A 2UVIA 1RYOA 4OWDA 5H8FB 3H6UA 3VVEA 4IO7A 3QYTA 2I49A 4G2ZA 3N26A 4BDOA 3M8UA 4NF5B 3RTWB 3IOWA 1BKAA 4NF4B 3PUWE 2OLBA 2Q9TA 2H9BA 3IB0A 1MDQA 1MQIA 1B46A 4N6PA 2REJA 3SEYA 2HEUA 1MQJA 4I9DA 4LQ5A 1OVBA 5CMBA 4F1YA 3PPNA 2H98A 5ISUA 3PD9A 1Z7ME 5JEIA 3GBAA 3SEXA 4G68B 1ZU0A 3PMXA 4OFLA 2DQVA 3HSTA 4OXVA 3Q28A 3K6VA 2REGA 4DXCA 1UTHA 1B5HA 1MXZA 4YICA 2H4IA 3MZ1A 3FXQA 2I3VA 3CFZA 2DWAA 3RT6B 4ZEFA 4KHZE 1AH5A 4F22A 5ICQA 3IX1A 2ZYKA 4OEVA 1JW1A 1OLCA 4MFIA 3OSQA 3G3IA 1I6QA 1MY0A 5F1QA 3OO9A 4U23A 2F8DA 2ZXTA 5J1DA 4LUBA 2QS1A 3T93B 1ZLQA 1ATGA 4HW8A 1UIUA 3PUVE 1Y3QA 3OD7A 3I5OA 3K02A 1OMPA 3PPRA 1J1NA 3K6XA 3TTRA 2UVGA 4DCYA 4G8MA 3EQ1A 4DE8A 1FW0A 4DIGA 5FHOA 3K6WA 1HSEA 1GV8A 2P0SA 4X9TA 2OJTA 1BLFA 1SDXA 2PT2A 2XD2A 3O28A 3KOTA 1O63A 4ZEDA 5KDTB 4OEUA 5B70A 5H8QA 3SEUA 1Y3NA 4F39A 3RQTA 1A40A 1MY1A 1ZKBA 3VLWA 2R6GE 3PMWA 4YKIA 5ELVA 4R75A 5EYFA 5DT6A 3S4UA 1QW0A 1GTKA 1QUJA 3FV1A 4NTLA 3IR1A 2UYFA 3O6GA 3K0VA 3CSGA 1LSTA 3TPAA 5H8HB 5L9OA 4Q5TA 1PB8A 3R6UA 3L6GA 3VXBA 3LC8A 4F1VA 3QXMA 4FJPA 4BLAA 3PUYE 2GFEA 3C31A 4O3CA 2AL5A 5KZTA 3MUQA 1LFGA 3HHGA 4N07A 3SKPA 2HZLA 2ONKE 4NF6B 5AE4A 3TCHA 2XXVA 4KQPA 3IB2A 4KFQA 2NWJA 5I56B 5CI5A 4LZ5A 1PDAA 4R9FA 1MXUA 3VV5A 1B52A 4RK2A 2HCAA 4OFJA 1VFEA 2ZYNA 2RINA 3LUYA 1B7UA 4GL0A 2OWTA 2I48A 3T9VA 4EUOA 3MWBA 1IIWA 4NWCA 2OBGA 1WDNA 3OOAA 1PBQA 4ZEBA 5JTYA 3R7XA 3KSJA 2O68A 1LBBA 4H6DA 4DCXA 2DWJA 4C1UA 2HAUA 1AL3A 2QRYA 1IEJA 1MQHA 5FTIA 1P1NA 2PT1A 5CBRA 3EPEA 1S7YA 2ANJA 2F6PA 3K1MA 3HHFA 1UIVA 1N0TA 1USYH 2Y7IA 1A99A 3V83A 4E0XA 4Q8RA 4YU0A 5AA4B 3RUMA 3IL1B 4EXKA 4OENA 4C1TA 5A5XB 3C34A 2QSXA 3KOSA 5TP9A 3IOVA 3DP6A 5TPAA 3D4CA 2Q88A 2YPNA 2Z8EA 3QUJA 4I8CA 3VDFA 5AA2A 2IA4A 1FQEA 4TLMB 4PFUA 3MQ9A 3V89B 3C32A 1OQHA 1JW4A 3MVXA 4WEPA 2V3TA 2XXRA 1MPBA 3DM0A 3M3KA 3T96B 2UVHA 2F78A 2HXWA 2G29A 4H8IA 4ELOA 2AL4A 5CRYA 1H76A 2Z23A 2RF1A 4F2QA 1LLSA
chains in the Genus database with same CATH superfamily
2CZHA 3IJXB 2ZZXA 4P47A 1HSLA 1NV6A 4KXPA 4R2BA 3VVFA 1N76A 4NHBA 3L6HA 5L9MA 2A5TA 4MNIA 4QFNA 2DYXA 3TYHA 4G4PA 3FVKA 3CG3A 4OTEA 1R6ZA 4P0IA 2Y7PA 2Y5LA 4JSDA 3D4GA 4NF8A 2O84X 2UXAA 3PPPA 4OMBA 3S9LC 1EYIA 4M1VA 2FNCA 3GLBA 3RGYA 2F6GA 1A8FA 4JBZA 1LAGE 4GL8A 4F18A 3OXNA 3ONMA 4O7IA 1LGBC 4I3EA 4XKNA 2R8TA 1JETA 5H8NA 2H5YA 4IY6A 2VOZA 2QMXA 1FPFA 4MAGA 5K2YA 3Q25A 4GF8A 3MZ9A 4R6YA 3MW0A 4FEDA 1TWYA 3DP8A 4LONB 3W9WA 1XS5A 2B3FA 4YMBA 1MPCA 3N5LA 4IY5A 3RYDA 3TKDA 4HTGA 1XT8A 4WEDA 1B3GA 2UYEA 3KZGA 4YB6A 3PUXE 1FBDA 3I3VA 2UVJA 4I1DA 1LAHE 2DVCA 3FASA 4PQJA 2VT5A 1FCKA 1P1WA 2ALUA 4AB5A 3TELA 3VLUA 4OVRA 2VHAA 3KN7A 4K3FA 1DMBA 4Q30B 4GVOA 1USYE 3U72A 4GWSA 1IMCA 1OLAA 3SETA 1QKBA 1AWBA 3R26A 1K9ZA 3TTLA 5I59A 2MKZA 5I2NA 2B65A 1SBPA 4P1EA 5IZ3B 5ICTA 1JW5A 5L9SA 2VD3A 2A5SA 4TOZA 1FTMA 5LOMA 3MZBA 1WVJA 4YZZA 2OWZA 4GIZA 4IO2A 2QS2A 4FORA 1A7LA 3BIHA 1UQWA 4I62A 2DE4A 2BJIA 3EF7A 4ZEIA 3VLVA 3M3FA 1INPA 1H43A 3T9UA 5M2VA 4U1OA 5I57B 3H6VA 1AMFA 4LVQA 5CC2A 3S2VA 4XIGQ 1LBVA 1MY3A 3PD8A 4U21A 1NH7A 5JK4A 4R6KA 2XXWA 2DE2A 4YMAA 1NH8A 3IOUA 2LAOA 3CFLA 3HCQA 5F7VA 1IMEA 4NWDA 1LCTA 2WX9A 5I2KB 3A09A 2V93A 1JP4A 2XWVA 4HXVA 4Q0CA 4RPOA 5I58B 4XFEA 4ZE9A 1G0HA 2XXQA 5I84A 3IO6A 2I6EA 4MF3A 2GHAA 4KD5A 3SESA 2L5VA 1IZ1A 3K2DA 1DCUA 1XHYA 1YXIA 4KI0E 3UN6A 3W9VA 5I7IA 4AB6A 2V3UA 1FJ6A 1NUWA 2V25A 1B1HA 1ANFA 4XKPA 1D4NA 1MQGA 4QF9A 1RYXA 1TXFA 4OA4A 4GWUA 2R9JA 1MH4A 1MQDA 1URSA 4NE4A 3CIJA 2B4LA 2VGQA 3O66A 4WKMA 4MBPA 4U2RA 1MY2A 1OVTA 3A3UA 4MNCA 2PFYA 4R72A 1SW2A 2OWSA 4Z0IA 4NAPA 3DLNA 3TTMA 3PPOA 3ZKLA 2QPQA 2OZZA 3RPLA 3KN8A 2HZKA 3I6VA 4QFKA 2RC7A 2GHBA 4GBWA 1Y20A 4RYAA 3U94A 1IQ7A 3OELA 3HPIA 4RXLA 1MRPA 1YCJA 3T9XB 3MPLA 1RDXA 4KR5A 1PB7A 4IO6A 1MDP1 3G3KA 4F19A 3B7DA 3KJTA 4H46A 2GQ1A 4QFLA 4FECA 1LCFA 1G0IA 2AIXA 3OO8A 4EF1A 4ZECA 1ZBMA 5HBCA 3ZSFA 1QJMA 1R9QA 3FJ7A 3TQWA 2THIA 4RJZA 1XOCA 1POY1 3THIA 3T9HB 3USDA 3PMVA 3K00A 5I3SA 4U4XA 3C36A 4LN5A 1L5TA 3FD3A 3IO4A 1IXCA 1LB9A 4KYDA 4F3SA 1LAXA 2I0BA 4PFWA 1MXXA 4GOTA 3MPKA 1IITA 2PFZA 1H45A 1EZ9A 4PDDA 4G68C 1SVXB 2F7CA 3K6UA 4TQUQ 1KZ8A 1B2HA 3MVWA 1B05A 1VFDA 4ELPA 5LTCA 4XEQA 1UTHB 5DYHA 2B3BA 1A8EA 4F3BA 3KC0A 1B3EA 1US4A 4PFRA 1XI6A 1B32A 2QS4A 1B0HA 4DLDA 4GD5A 3OEKA 4MH5A 1CE2A 1SW4A 4IO5A 3MC2A 4KYEA 3TCFA 1NNPA 4UA8A 1DBZA 1JEVA 3TODA 4PGNA 3MBPA 4RPNA 1YPNA 4FAJA 4GQOA 1MM6A 5TU0A 4GWOA 2P2AA 3BFUA 2QVUA 2XWKA 1P99A 2F7BA 5HPQA 3RLFE 1SYHA 1QULA 3S9MC 4DXUA 4PF8A 2QS3A 3IFAA 1Y1ZA 4JVIA 1UTBA 1QUIA 3P7IA 3FVNA 4PF6A 4OVJA 4QHQA 2ZMBA 4MIJA 3ZS6A 3G3FA 1JNFA 3ISPA 2V84A 1B3HA 4PETA 2HQ0A 4HCYA 4H45A 4XF5A 2XWIA 3ILTB 2P1SA 4GLIA 3MSTA 5AA1A 2CMOA 4ZZEA 1M5CA 4H1XA 1EU8A 5ET7A 1MXYA 3VFJA 3Q26A 1NV7A 2WYKA 1NUZA 1AIVA 3B6WA 1B5IA 5CMMA 3UORA 2I3WA 2Y7WA 2VPOA 1FQAA 4GWWA 5KCJA 4R9GA 3BBRA 4R74A 4RA1A 1R1NA 1POTA 3HV1A 3A3CA 3K01A 2XXIA 1MH3A 3FATA 1N84A 2XX8A 4YB5A 4POWA 5H8QB 3H4ZA 1FSAA 1IXGA 3DELB 1QKAA 1S50A 1ZTYA 2PMSA 1NNFA 1Y3PA 3EHTA 5J16A 4HE2A 3KBRA 2O1LA 1B58A 3LV0A 3IK6B 4H5GA 3CSBA 4F29A 1Q35A 2Q8MA 3AXFA 2O6AA 1N7XA 3LUZA 3FXBA 3F11A 4ELQA 1EZOA 3Q29A 1N3WA 4H65A 5EQ7A 1LB8A 4LQ2A 3MP8A 3SEVA 3FXRA 1FRPA 3HN0A 4MNPA 4JVCA 4TLLB 5EQAA 2CZKA 4H0WA 4AQ4A 1PBPA 1B51A 4OZ9A 3FV2A 3RN8A 4LZ8A 1UTBB 3TFLA 3GBBA 4G8HA 2F3BA 4ECFA 3SERA 3K1NA 5FHMA 2YLNA 4GX4A 3IJOB 1LFIA 1MXVA 1DTZA 2DXRA 3CRBA 4DI3D 1P1OA 2X7QA 4X8RA 1F9BA 3BKIB 5H8SA 3FVOA 4LZ7A 1FBHA 4WXJA 3TCGA 1BIYA 4EQ9A 2V3QA 4P3LA 5DEXA 4DZ1A 3LR1A 3T1BA 4JVDA 4PBQA 4PP0A 3S9NC 2HAVA 3FGSA 1YYZA 1B4HA 5JTYB 3MP6A 3CI8A 4IGTA 4LATA 1CB6A 3TQLA 5AA2D 4F3PA 5L8DA 1K9YA 1SW5A 4ZDMA 3B6QA 3UA8A 3ILUB 3WAFA 2DXYA 4DXBA 1N7WA 1FTOA 2XHDA 2KLFA 4P9KA 3TTKA 1GR2A 3RNNA 5H8FA 4XKQA 4ZEKA 3FZVA 4X1BA 2FIXA 2B4MA 1NMUA 4GWZA 3HO7A 2Y7RA 2AYSA 3UP9A 4I3YA 4NF5A 5TP9B 4RK9A 4GXAA 1A55A 1IMBA 1ZIUA 5TPAB 4IGRA 2CZLA 4PGPA 1ZMGA 4MJOA 1NKXA 5FBPA 3RPWA 5AA2B 1KA1A 4QFPA 1IXHA 3KFMA 4EXLA 3E13X 5ITOA 1B1XA 1QUKA 3E3KA 4OQOA 1Y1MA 2D3IA 3PGFA 4NEDA 1Q1KA 2HPGA 1RDZA 3K1PA 2E0SA 1WODA 4GBVA 3GZGA 5I5PA 4PFTA 4PFBA 4BDRA 1BK4A 3OO7A 1M5BA 4YKJA 2DVZA 5ET8A 2OK2A 1I6AA 4F2OA 3CFXA 3N94A 2A5TB 2NOOA 3QMFA 3VXCA 2FA7A 1B40A 2Q8JA 1B7ZA 5DTBA 3KGCA 1RKMA 3TTNA 3PU5A 4OFOA 4OVSA 2OCUA 3CG1A 4IR8A 3RY3A 1LBXA 1SI1A 4NF8B 4MMPA 2CEXA 3T0JA 1FBEA 2ZZVA 3C4MA 1B6HA 4XKRA 1D3KA 4KCCA 4HCWA 2FYIA 3W15C 3O97A 1FBCA 3MJNA 2WKYA 4JB7A 2O51A 2WYPA 1SYIA 4XXUA 3CR9A 2PBWA 4NG7A 4BDLA 1A54A 5H8NB 1SPIA 1FPKA 3S9EA 1H3DA 2XX7A 2DE3A 3FXUA 4PBHA 3WAEA 1GVCA 2XXYA 1MY4A 1ZJLA 3IOTA 4MLVA 1BTJA 1VE4A 1FQDA 4KCDA 3UIFA 3TDJA 2O7UA 3O6IA 2O1MA 4IB2A 3C33A 2XXTA 2F35A 4H67A 2H99A 1O64A 1B4ZA 3MP1A 1EYKA 2O7IA 5KDTA 2WBDA 3RTFB 4YKPA 1FJ9A 1NI9A 1I69A 2FHYA 4Z7EA 3TZAA 1LBCA 4R73A 3KN3A 4ZZAA 1I6BA 3LSXA 3MVYA 2IEEA 3K4UA 2DDKA 3G3HA 2X26A 3G7WA 4PFYA 2DOJA 1QVSA 3SEWA 3EHSA 4ZS9A 1FTJA 1SW1A 3MAMA 5I59B 1FPIA 4MCOA 5I2NB 4KYSA 4G77A 3CVGA 1OQGA 5H8HA 1URDA 2ZZWA 4N8YA 1N04A 4UACA 3MYUA 5DVJA 3LSLA 1QGXA 4X04A 4G8NA 3U1OA 2D21A 4YAHX 1SQYA 2Y7KA 2NVUB 4QFOA 1NNKA 3OO6A 1P1UA 2DWHA 3PV0E 1NFTA 4NF6A 3TMGA 3KBZA 4THIA 2YJPA 1DPPA 3OEMA 1NV0A 4JWXA 5I56A 2NUVA 4HE1A 3QSLA 3EHUA 1FPEA 3QIMA 2QJEA 3Q27A 4GXSB 5CMCA 4LP2B 1II5A 3A29A 3GXAA 1VDWA 4NMYA 2RKMA 4YB7A 1XVXA 2RC9A 3TAJA 4DDDA 2QFLA 1TFAA 2QMWA 1PC3A 1B3LA 1FQBA 3VE1B 1IXIA 4RNSA 1FPJA 2PVUA 5EYHA 1FPLA 4OERA 1SD3A 3G3GA 5FTHA 2BJJX 4KPTA 4GX3A 1NV2A 5DVFA 4ESWA 3C9HA 3H3GA 3LSWA 4PE5B 3PPQA 2I0CA 2F36A 4U1ZA 2HFBA 2DP8A 5CMKA 4LA9A 4BDNA 5AA4A 5B7DA 2W7YA 1SI0A 2Z8FA 4FEBA 4X1DA 1AOVA 1BP5A 3O2AA 3UGWA 5A5XA 1B9JA 1DSNA 1NV5A 3SDFA 1R9LA 3IAZA 2G93A 4NF0A 3VVDA 3OSRA 4O3AA 1MS7A 3OENA 3RT8A 3EN3A 4N8GA 2Q89A 2ABHA 4QSCA 4NN3A 1FPGA 3PUZE 3RPLB 1TFDA 5K2XA 5IKBA 1B0LA 4F1UA 3PTYA 1US5A 4GFRA 1MG1A 3N6TA 2F97A 2I58A 1GGGA 4QXDA 1M5FA 2XXHA 2FBPA 4E0WA 4L17A 3G3JA 3KSXA 3QAXA 4ONYA 1NNTA 2DWIA 2DS9A 3KG2A 3H03A 4P1LA 4NGUA 4HS7A 4OVTA 3JV9A 2ZNUA 4FATA 1KWHA 3E78A 4GX6A 4QRZA 1M5EA 1JEUA 4R6HA 4POXA 1YTVA 2PX1A 1B7HA 2XXUA 4N13A 1IUDA 3QUFA 1LAFE 3O29A 3E9XA 3IORA 2Y5KA 2RC8A 5CM6A 1DK4A 5AA3A 5IZ1A 4U4SA 2NXOA 5EYGA 1S9TA 4O3BA 1YAEA 1PB9A 2ZYMA 4AS4A 3H6WA 2Q2AA 1JQFA 4H8JA 4JXIA 2ONRA 1MPDA 5EHMA 2HXRA 1MXWA 1XC1A 4ZE8A 2ZNSA 4N81A 2CEYA 3T22A 2M8CA 3UK4A 4EQ7A 2DSFA 3FVGA 4EQBA 4GWYA 1TT1A 2PYYA 1FQFA 4P0GA 4X48A 2I4CA 3E4RA 1EH3A 1FPDA 5EQ8A 3TEPA 4O8MA 4MLQA 4YKKA 3LBSA 3H6TA 4OVPA 2JJKA 1MM7A 3B6TA 2VD2A 3BFTA 3V8XB 4AS5A 4ND9A 4JWOA 4RY1A 1JVYA 4EDPA 2GRVA 4OETA 4FBPA 3FJMA 4P11A 1T0KA 4ESXA 1M5DA 5ESYA 4OYVA 4ISUA 3ODBA 5BUUA 3MVZA 3N6UA 4GRKA 5HM4B 3KC1A 1IMDA 5CBSA 3T66A 2VPNA 4NX1A 2X7PA 1ELJA 4QSEA 2O69A 5ITPA 5DW8A 5IZ3A 4HE0A 4QBAA 4IO3A 3DP4A 2Z8DA 1DTGA 3BIGA 4XTCQ 2ONSA 3ROJA 5KCJB 3FJGA 2ESNA 2FIEA 1FTLA 2QL3A 5LDZA 2PCRA 1FPBA 2XD3A 2Z22A 2XX9A 5I57A 1H44A 2F5XA 3TUSA 3H06B 3OMBA 2P3NA 1B3FA 3LSFB 3U65A 4JSOA 1FTKA 1VSOA 1LBYA 1Y4TA 3ECRA 4JWYA 1DPEA 3V5AA 3IB1A 3ZKKA 5FHNA 1LBWA 1Y9UA 2R71A 4NF4A 4H5FA 5I2KA 3O6HA 2Q2CA 5I58A 4F3GA 2F7AA 4FIMA 1Z7NE 3FIRA 4FE8A 4BDMA 2ZNTA 3JZJA 1FQCA 1NL5A 4U22A 3C35A 3O9PA 4C0RA 2FVZA 1DOTA 2OX3A 2I4BA 1JVXA 1VR5A 3D1RA 4G68A 2H25A 4ELRA 4QSDA 4OESA 3U93A 3U8QA 4F31B 2E1SA 2Y84A 2QVVA 2VP1A 5ET5A 3U92A 2ZYOA 3KJ7A 4EF2A 3KEIA 4IO4A 5IAIA 2P3VA 4JDFA 4GWXA 3JYRA 5EHSA 2XXXA 1N3XA 5DEXB 1P1QA 4NQ8A 3H7MA 1Y4CA 4O94A 1D9VA 1URGA 2D5WA 1EZPA 1XVYA 4DI4B 3QK6A 4OHNA 1O7TA 3M3LA 2XXPA 2RCBA 1LFHA 1D9YA 1PEBA 1OIBA 1HSJA 4M4GA 4BDQA 1B5JA 2WEFA 2GH9A 2XWOA 5BWJA 3FUZA 2RCAA 1NV4A 5DVIA 2XA5A 4R2FA 2F34A 2UVIA 1RYOA 4OWDA 5IM2A 5H8FB 3H6UA 1LBZA 3VVEA 1EYJA 4IO7A 3QYTA 2I49A 4G2ZA 3N26A 1FTAA 4BDOA 3M8UA 4NF5B 3RTWB 3IOWA 1BKAA 4NF4B 3PUWE 2OLBA 2Q9TA 4MEVA 2H9BA 2KQZA 3IB0A 1MDQA 1MQIA 1B46A 4N6PA 5T3JA 2REJA 3SEYA 2HEUA 4N6DA 1MQJA 3FBPA 4I9DA 4LQ5A 1OVBA 5CMBA 4F1YA 3PPNA 2H98A 4PFIA 2CZIA 5ISUA 3PD9A 1Z7ME 4PE3A 5JEIA 3GBAA 3SEXA 4G68B 1ZU0A 4PAKA 3PMXA 4OFLA 2DQVA 3HSTA 4OXVA 3Q28A 4P56A 3K6VA 2REGA 4DXCA 4N91A 1UTHA 1B5HA 1MXZA 4YICA 2H4IA 3MZ1A 4PAIA 3FXQA 2I3VA 3CFZA 2DWAA 3RT6B 4PTKA 4KHZE 4ZEFA 4OANA 1AH5A 4F22A 5ICQA 3CHGA 3IX1A 2ZYKA 4OEVA 1JW1A 1OLCA 4N17A 4MFIA 3OSQA 3G3IA 1I6QA 1MY0A 5F1QA 3OO9A 4U23A 2F8DA 2ZXTA 5J1DA 4LUBA 1FBGA 2QS1A 3T93B 1ZLQA 1ATGA 2V4CA 4HW8A 4P8BA 1UIUA 3PUVE 1YZ0A 2KR0A 1Y3QA 3OD7A 3I5OA 3K02A 1OMPA 3PPRA 1J1NA 3K6XA 3TTRA 2UVGA 4DCYA 1NV3A 4G8MA 5ET6A 3EQ1A 4N15A 4DE8A 1FW0A 4DIGA 5FHOA 3K6WA 5A5LA 1HSEA 1GV8A 2P0SA 1LEVA 4I40A 4X9TA 2OJTA 1BLFA 2Q74A 1SDXA 2PT2A 2XD2A 3O28A 3KOTA 1O63A 4ZEDA 1CNQA 2F3DA 5KDTB 4OEUA 5B70A 5H8QA 3SEUA 1D9QA 3B8BA 1Y3NA 4F39A 3RQTA 1A40A 1MY1A 3IFCA 1ZKBA 3VLWA 2WBBA 2R6GE 3EKIA 3PMWA 4YKIA 4MHFA 5ELVA 4G61A 4R75A 5EYFA 5DT6A 3S4UA 1QW0A 1GTKA 1KA0A 1QUJA 2QVRA 3FV1A 4NTLA 3IR1A 2UYFA 3O6GA 3K0VA 4MX6A 3CSGA 1LSTA 3TPAA 5H8HB 5L9OA 4Q5TA 1PB8A 3L6GA 3R6UA 3VXBA 3LC8A 4F1VA 3QXMA 4FJPA 4PC9A 4BLAA 3E79A 4O7MA 3PUYE 1IMFA 4PCDA 5IZZA 2GFEA 3C31A 4O3CA 2AL5A 1RDYA 4N4UA 3MUQA 5KZTA 1LFGA 4UABA 3HHGA 4N07A 3SKPA 2HZLA 2ONKE 4NF6B 5AE4A 3TCHA 2XXVA 4KQPA 3IB2A 4KFQA 2NWJA 5I56B 5CI5A 4LZ5A 1PDAA 4R9FA 4OVQA 1MXUA 3VV5A 1B52A 4RK2A 2HCAA 4OFJA 1Q9DA 1VFEA 2ZYNA 2RINA 3LUYA 1B7UA 4GL0A 2OWTA 2I48A 3T9VA 4EUOA 3MWBA 1IIWA 4NWCA 5IGAA 2OBGA 1WDNA 3OOAA 1PBQA 4ZEBA 5JTYA 3R7XA 3KSJA 2O68A 1LBBA 4H6DA 4DCXA 2DWJA 4C1UA 2HAUA 1AL3A 2QRYA 1IEJA 1MQHA 4N6KA 5FTIA 1P1NA 2PT1A 5CBRA 3EPEA 1S7YA 2ANJA 2F6PA 3K1MA 4PAFA 3HHFA 3B50A 1NUYA 1UIVA 1N0TA 5EQ9A 1USYH 3GYYA 2Y7IA 1A99A 3V83A 4E0XA 4Q8RA 4YU0A 3IL1B 3RUMA 5AA4B 4PDHA 4EXKA 4OENA 4C1TA 5A5XB 3C34A 1NV1A 1FBFA 2HHMA 2QSXA 5F24A 2XXKA 3KOSA 5TP9A 3IOVA 3DP6A 5TPAA 1IMAA 3D4CA 2Q88A 1NUXA 2YPNA 2Z8EA 3QUJA 4I8CA 3VDFA 3NOHA 5AA2A 2IA4A 1FQEA 4TLMB 4PFUA 3MQ9A 3V89B 3C32A 1OQHA 1JW4A 3MVXA 4WEPA 2V3TA 2XXRA 3HFUA 1MPBA 3DM0A 3M3KA 3T96B 2UVHA 1FBPA 2F78A 2HXWA 2G29A 4H8IA 4ELOA 2AL4A 5CRYA 1H76A 3SZPA 2Z23A 2RF1A 4F2QA 1LLSA
chains in the Genus database with same CATH topology
3IJXB 1HSLA 4R2BA 3VVFA 1N76A 3L6HA 5L9MA 2A5TA 4QFNA 2DYXA 3TYHA 4G4PA 3FVKA 3CG3A 4OTEA 1R6ZA 4P0IA 2Y7PA 4JSDA 3D4GA 4NF8A 2O84X 2UXAA 3PPPA 4OMBA 3S9LC 4M1VA 2FNCA 3GLBA 3RGYA 2F6GA 1A8FA 4JBZA 1LAGE 4GL8A 4F18A 3OXNA 3ONMA 1LGBC 4XKNA 1JETA 5H8NA 2H5YA 4IY6A 2VOZA 2QMXA 5K2YA 3Q25A 4GF8A 3MZ9A 4R6YA 3MW0A 4FEDA 1TWYA 3DP8A 4LONB 3W9WA 1XS5A 2B3FA 4YMBA 1MPCA 3N5LA 4IY5A 3TKDA 4HTGA 1XT8A 4WEDA 1B3GA 2UYEA 3KZGA 4YB6A 3PUXE 3I3VA 2UVJA 4I1DA 1LAHE 2DVCA 3FASA 4PQJA 1FCKA 1P1WA 2ALUA 4AB5A 3TELA 3VLUA 2VHAA 3KN7A 4K3FA 1DMBA 4Q30B 4GVOA 1USYE 3U72A 1OLAA 3SETA 1QKBA 3R26A 3TTLA 5I59A 5I2NA 2B65A 1SBPA 5ICTA 1JW5A 5L9SA 2VD3A 2A5SA 4TOZA 1FTMA 5LOMA 3MZBA 1WVJA 4YZZA 4GIZA 4IO2A 2QS2A 4FORA 1A7LA 1UQWA 4I62A 2DE4A 3EF7A 3VLVA 4ZEIA 3M3FA 1H43A 3T9UA 5M2VA 4U1OA 5I57B 3H6VA 1AMFA 4LVQA 5CC2A 3S2VA 4XIGQ 1MY3A 3PD8A 4U21A 1NH7A 5JK4A 4R6KA 2XXWA 2DE2A 4YMAA 1NH8A 3IOUA 2LAOA 3CFLA 3HCQA 5F7VA 4NWDA 1LCTA 5I2KB 3A09A 2V93A 4Q0CA 4RPOA 5I58B 4ZE9A 2XXQA 5I84A 3IO6A 2I6EA 4MF3A 2GHAA 4KD5A 3SESA 1IZ1A 3K2DA 1XHYA 4KI0E 3UN6A 3W9VA 4AB6A 2V3UA 2V25A 1B1HA 1ANFA 4XKPA 1D4NA 1MQGA 4QF9A 1RYXA 1TXFA 2R9JA 1MH4A 1MQDA 1URSA 4NE4A 3CIJA 2VGQA 3O66A 4WKMA 4MBPA 4U2RA 1MY2A 1OVTA 3A3UA 4R72A 1SW2A 2OWSA 4Z0IA 3DLNA 3TTMA 3PPOA 3ZKLA 2QPQA 2OZZA 3KN8A 2HZKA 3I6VA 4QFKA 2RC7A 2GHBA 1Y20A 4RYAA 3U94A 1IQ7A 3OELA 3HPIA 4RXLA 1MRPA 1YCJA 3T9XB 3MPLA 4KR5A 1PB7A 4IO6A 1MDP1 3G3KA 4F19A 3B7DA 3KJTA 4QFLA 4FECA 1LCFA 2AIXA 3OO8A 4EF1A 4ZECA 1ZBMA 5HBCA 3ZSFA 1QJMA 1R9QA 3FJ7A 3TQWA 2THIA 4RJZA 1XOCA 1POY1 3THIA 3T9HB 3USDA 3PMVA 3K00A 4U4XA 3C36A 1L5TA 3FD3A 3IO4A 1IXCA 1LB9A 4KYDA 4F3SA 1LAXA 2I0BA 4PFWA 1MXXA 4GOTA 3MPKA 1IITA 1H45A 1EZ9A 4G68C 1SVXB 2F7CA 3K6UA 4TQUQ 1B2HA 3MVWA 1B05A 1VFDA 4ELPA 1UTHB 5DYHA 2B3BA 1A8EA 4F3BA 1B3EA 1US4A 1B32A 2QS4A 1B0HA 4DLDA 4GD5A 3OEKA 1CE2A 1SW4A 4IO5A 4MH5A 3MC2A 4KYEA 3TCFA 1NNPA 4UA8A 1JEVA 3TODA 3MBPA 4RPNA 1YPNA 4FAJA 4GQOA 1MM6A 5TU0A 4GWOA 2P2AA 3BFUA 1P99A 2F7BA 5HPQA 3RLFE 1SYHA 1QULA 3S9MC 4DXUA 2QS3A 1Y1ZA 1UTBA 1QUIA 3P7IA 3FVNA 4OVJA 4QHQA 2ZMBA 3ZS6A 3G3FA 1JNFA 2V84A 1B3HA 4PETA 2HQ0A 4HCYA 3ILTB 2P1SA 4GLIA 5AA1A 2CMOA 4ZZEA 1M5CA 4H1XA 1EU8A 1MXYA 3VFJA 3Q26A 1AIVA 3B6WA 1B5IA 5CMMA 3UORA 2I3WA 2Y7WA 1FQAA 5KCJA 4R9GA 3BBRA 4R74A 4RA1A 1R1NA 1POTA 3HV1A 3A3CA 3K01A 2XXIA 1MH3A 3FATA 1N84A 2XX8A 4YB5A 4POWA 5H8QB 3H4ZA 1IXGA 3DELB 1QKAA 1S50A 1ZTYA 2PMSA 1NNFA 1Y3PA 3EHTA 3KBRA 2O1LA 1B58A 3IK6B 4H5GA 3CSBA 4F29A 1Q35A 3AXFA 2O6AA 1N7XA 3F11A 4ELQA 1EZOA 3Q29A 1N3WA 4H65A 1LB8A 4LQ2A 3MP8A 3SEVA 3FXRA 3HN0A 4TLLB 4AQ4A 4H0WA 1PBPA 1B51A 4OZ9A 3FV2A 3RN8A 4LZ8A 1UTBB 3TFLA 3GBBA 4G8HA 4ECFA 3SERA 3K1NA 5FHMA 2YLNA 3IJOB 1LFIA 1MXVA 1DTZA 2DXRA 3CRBA 1P1OA 2X7QA 1F9BA 3BKIB 5H8SA 3FVOA 4LZ7A 4WXJA 3TCGA 1BIYA 4EQ9A 2V3QA 5DEXA 4DZ1A 3LR1A 4PP0A 3S9NC 2HAVA 3FGSA 1B4HA 5JTYB 3MP6A 3CI8A 4IGTA 4LATA 1CB6A 3TQLA 5AA2D 4F3PA 5L8DA 1SW5A 4ZDMA 3B6QA 3UA8A 3ILUB 3WAFA 2DXYA 4DXBA 1N7WA 1FTOA 2XHDA 2KLFA 3TTKA 1GR2A 3RNNA 5H8FA 4XKQA 4ZEKA 3FZVA 4X1BA 1NMUA 3HO7A 2Y7RA 2AYSA 3UP9A 4NF5A 5TP9B 4RK9A 4GXAA 1A55A 1ZIUA 5TPAB 4IGRA 2CZLA 1ZMGA 1NKXA 3RPWA 5AA2B 4QFPA 1IXHA 3KFMA 4EXLA 3E13X 5ITOA 1B1XA 1QUKA 3E3KA 4OQOA 1Y1MA 2D3IA 3PGFA 4NEDA 1Q1KA 3K1PA 2E0SA 1WODA 3GZGA 4PFTA 4BDRA 3OO7A 1M5BA 4YKJA 2DVZA 2OK2A 1I6AA 4F2OA 3CFXA 3N94A 2A5TB 2NOOA 3VXCA 2FA7A 1B40A 2Q8JA 1B7ZA 5DTBA 3KGCA 1RKMA 3TTNA 3PU5A 4OFOA 2OCUA 3CG1A 3RY3A 1SI1A 4NF8B 3C4MA 1B6HA 4XKRA 1D3KA 4KCCA 4HCWA 2FYIA 3W15C 3O97A 3MJNA 2WKYA 4JB7A 2O51A 1SYIA 4XXUA 3CR9A 2PBWA 4BDLA 1A54A 5H8NB 3S9EA 1H3DA 2XX7A 2DE3A 3FXUA 3WAEA 1GVCA 2XXYA 1MY4A 1ZJLA 3IOTA 4MLVA 1BTJA 1VE4A 1FQDA 4KCDA 3UIFA 3TDJA 2O7UA 3O6IA 2O1MA 4IB2A 3C33A 2XXTA 2F35A 4H67A 2H99A 1O64A 1B4ZA 3MP1A 2O7IA 5KDTA 3RTFB 4YKPA 1I69A 4Z7EA 3TZAA 1LBCA 4R73A 3KN3A 4ZZAA 1I6BA 3LSXA 3MVYA 2IEEA 3K4UA 3G3HA 2X26A 3G7WA 4PFYA 2DOJA 1QVSA 3SEWA 3EHSA 4ZS9A 1FTJA 1SW1A 3MAMA 5I59B 5I2NB 4KYSA 4G77A 3CVGA 1OQGA 5H8HA 1URDA 1N04A 4UACA 5DVJA 3LSLA 4G8NA 3U1OA 2D21A 4YAHX 1SQYA 2Y7KA 2NVUB 4QFOA 1NNKA 3OO6A 1P1UA 2DWHA 3PV0E 1NFTA 4NF6A 3TMGA 4THIA 2YJPA 1DPPA 3OEMA 4JWXA 5I56A 2NUVA 3QSLA 3EHUA 3QIMA 2QJEA 3Q27A 4GXSB 5CMCA 4LP2B 1II5A 3GXAA 4NMYA 2RKMA 4YB7A 1XVXA 2RC9A 3TAJA 4DDDA 1TFAA 2QMWA 1FQBA 1B3LA 1PC3A 3VE1B 1IXIA 4RNSA 2PVUA 4OERA 1SD3A 3G3GA 5FTHA 2BJJX 4KPTA 5DVFA 4ESWA 3C9HA 3H3GA 3LSWA 4PE5B 3PPQA 2I0CA 2F36A 4U1ZA 2HFBA 2DP8A 5CMKA 4LA9A 4BDNA 5AA4A 5B7DA 2W7YA 1SI0A 2Z8FA 4X1DA 4FEBA 1AOVA 1BP5A 3O2AA 3UGWA 5A5XA 1B9JA 1DSNA 3SDFA 1R9LA 3IAZA 2G93A 3VVDA 3OSRA 4O3AA 1MS7A 3OENA 3RT8A 3EN3A 2Q89A 2ABHA 4QSCA 3PUZE 1TFDA 5K2XA 5IKBA 1B0LA 4F1UA 1US5A 4GFRA 1MG1A 3N6TA 2F97A 2I58A 1GGGA 1M5FA 2XXHA 4E0WA 4L17A 3G3JA 3KSXA 3QAXA 4ONYA 1NNTA 2DWIA 2DS9A 3KG2A 3H03A 4HS7A 3JV9A 2ZNUA 4FATA 1KWHA 4QRZA 1M5EA 1JEUA 4R6HA 4POXA 1YTVA 2PX1A 1B7HA 2XXUA 4N13A 1IUDA 3QUFA 1LAFE 3O29A 3E9XA 3IORA 2RC8A 5CM6A 5AA3A 4U4SA 2NXOA 1S9TA 4O3BA 1YAEA 1PB9A 2ZYMA 3H6WA 2Q2AA 1JQFA 4H8JA 4JXIA 2ONRA 1MPDA 5EHMA 1MXWA 1XC1A 4ZE8A 2ZNSA 3T22A 2M8CA 4EQ7A 3UK4A 2DSFA 3FVGA 4EQBA 1TT1A 2PYYA 1FQFA 4P0GA 4X48A 2I4CA 3E4RA 1EH3A 3TEPA 4MLQA 4YKKA 3LBSA 3H6TA 1MM7A 3B6TA 2VD2A 3BFTA 3V8XB 4ND9A 4JWOA 4RY1A 1JVYA 4EDPA 2GRVA 4OETA 3FJMA 4P11A 1T0KA 4ESXA 1M5DA 4OYVA 4ISUA 3ODBA 5BUUA 3MVZA 3N6UA 4GRKA 5HM4B 5CBSA 3T66A 2X7PA 1ELJA 4QSEA 2O69A 5ITPA 4IO3A 3DP4A 2Z8DA 1DTGA 4XTCQ 2ONSA 5KCJB 3FJGA 2ESNA 1FTLA 2QL3A 2XD3A 2Z22A 2XX9A 5I57A 1H44A 2F5XA 3TUSA 3H06B 3OMBA 1B3FA 3LSFB 4JSOA 1FTKA 1VSOA 1Y4TA 3ECRA 4JWYA 1DPEA 3V5AA 3IB1A 3ZKKA 5FHNA 1Y9UA 2R71A 4NF4A 4H5FA 5I2KA 3O6HA 2Q2CA 5I58A 4F3GA 2F7AA 4FIMA 1Z7NE 3FIRA 4FE8A 4BDMA 2ZNTA 3JZJA 1FQCA 1NL5A 4U22A 3C35A 3O9PA 4C0RA 1DOTA 2I4BA 1JVXA 1VR5A 4G68A 2H25A 4ELRA 4QSDA 4OESA 3U93A 3U8QA 4F31B 2E1SA 2Y84A 2VP1A 3U92A 2ZYOA 3KJ7A 4EF2A 3KEIA 4IO4A 5IAIA 4JDFA 3JYRA 5EHSA 2XXXA 1N3XA 5DEXB 1P1QA 3H7MA 1Y4CA 1D9VA 1URGA 2D5WA 1EZPA 1XVYA 3QK6A 4OHNA 1O7TA 3M3LA 2XXPA 2RCBA 1LFHA 1D9YA 1PEBA 1OIBA 1HSJA 4M4GA 4BDQA 1B5JA 2GH9A 5BWJA 3FUZA 2RCAA 5DVIA 4R2FA 2F34A 2UVIA 1RYOA 4OWDA 5H8FB 3H6UA 3VVEA 4IO7A 3QYTA 2I49A 4G2ZA 3N26A 4BDOA 3M8UA 4NF5B 3RTWB 3IOWA 1BKAA 4NF4B 3PUWE 2OLBA 2Q9TA 2H9BA 3IB0A 1MDQA 1MQIA 1B46A 4N6PA 2REJA 3SEYA 2HEUA 1MQJA 4I9DA 4LQ5A 1OVBA 5CMBA 4F1YA 3PPNA 2H98A 5ISUA 3PD9A 1Z7ME 5JEIA 3GBAA 3SEXA 4G68B 1ZU0A 3PMXA 4OFLA 2DQVA 3HSTA 4OXVA 3Q28A 3K6VA 2REGA 4DXCA 1UTHA 1B5HA 1MXZA 4YICA 2H4IA 3MZ1A 3FXQA 2I3VA 3CFZA 2DWAA 3RT6B 4ZEFA 4KHZE 1AH5A 4F22A 5ICQA 3IX1A 2ZYKA 4OEVA 1JW1A 1OLCA 4MFIA 3OSQA 3G3IA 1I6QA 1MY0A 5F1QA 3OO9A 4U23A 2F8DA 2ZXTA 5J1DA 4LUBA 2QS1A 3T93B 1ZLQA 1ATGA 4HW8A 1UIUA 3PUVE 1Y3QA 3OD7A 3I5OA 3K02A 1OMPA 3PPRA 1J1NA 3K6XA 3TTRA 2UVGA 4DCYA 4G8MA 3EQ1A 4DE8A 1FW0A 4DIGA 5FHOA 3K6WA 1HSEA 1GV8A 2P0SA 4X9TA 2OJTA 1BLFA 1SDXA 2PT2A 2XD2A 3O28A 3KOTA 1O63A 4ZEDA 5KDTB 4OEUA 5B70A 5H8QA 3SEUA 1Y3NA 4F39A 3RQTA 1A40A 1MY1A 1ZKBA 3VLWA 2R6GE 3PMWA 4YKIA 5ELVA 4R75A 5EYFA 5DT6A 3S4UA 1QW0A 1GTKA 1QUJA 3FV1A 4NTLA 3IR1A 2UYFA 3O6GA 3K0VA 3CSGA 1LSTA 3TPAA 5H8HB 5L9OA 4Q5TA 1PB8A 3R6UA 3L6GA 3VXBA 3LC8A 4F1VA 3QXMA 4FJPA 4BLAA 3PUYE 2GFEA 3C31A 4O3CA 2AL5A 5KZTA 3MUQA 1LFGA 3HHGA 4N07A 3SKPA 2HZLA 2ONKE 4NF6B 5AE4A 3TCHA 2XXVA 4KQPA 3IB2A 4KFQA 2NWJA 5I56B 5CI5A 4LZ5A 1PDAA 4R9FA 1MXUA 3VV5A 1B52A 4RK2A 2HCAA 4OFJA 1VFEA 2ZYNA 2RINA 3LUYA 1B7UA 4GL0A 2OWTA 2I48A 3T9VA 4EUOA 3MWBA 1IIWA 4NWCA 2OBGA 1WDNA 3OOAA 1PBQA 4ZEBA 5JTYA 3R7XA 3KSJA 2O68A 1LBBA 4H6DA 4DCXA 2DWJA 4C1UA 2HAUA 1AL3A 2QRYA 1IEJA 1MQHA 5FTIA 1P1NA 2PT1A 5CBRA 3EPEA 1S7YA 2ANJA 2F6PA 3K1MA 3HHFA 1UIVA 1N0TA 1USYH 2Y7IA 1A99A 3V83A 4E0XA 4Q8RA 4YU0A 5AA4B 3RUMA 3IL1B 4EXKA 4OENA 4C1TA 5A5XB 3C34A 2QSXA 3KOSA 5TP9A 3IOVA 3DP6A 5TPAA 3D4CA 2Q88A 2YPNA 2Z8EA 3QUJA 4I8CA 3VDFA 5AA2A 2IA4A 1FQEA 4TLMB 4PFUA 3MQ9A 3V89B 3C32A 1OQHA 1JW4A 3MVXA 4WEPA 2V3TA 2XXRA 1MPBA 3DM0A 3M3KA 3T96B 2UVHA 2F78A 2HXWA 2G29A 4H8IA 4ELOA 2AL4A 5CRYA 1H76A 2Z23A 2RF1A 4F2QA 1LLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IJX B;  1HSL A;  4R2B A;  3VVF A;  1N76 A;  3L6H A;  5L9M A;  2A5T A;  4QFN A;  2DYX A;  3TYH A;  4G4P A;  3FVK A;  3CG3 A;  4OTE A;  1R6Z A;  4P0I A;  2Y7P A;  4JSD A;  3D4G A;  4NF8 A;  2O84 X;  2UXA A;  3PPP A;  4OMB A;  3S9L C;  4M1V A;  2FNC A;  3GLB A;  3RGY A;  2F6G A;  1A8F A;  4JBZ A;  1LAG E;  4GL8 A;  4F18 A;  3OXN A;  3ONM A;  1LGB C;  4XKN A;  1JET A;  5H8N A;  2H5Y A;  4IY6 A;  2VOZ A;  2QMX A;  5K2Y A;  3Q25 A;  4GF8 A;  3MZ9 A;  4R6Y A;  3MW0 A;  4FED A;  1TWY A;  3DP8 A;  4LON B;  3W9W A;  1XS5 A;  2B3F A;  4YMB A;  1MPC A;  3N5L A;  4IY5 A;  3TKD A;  4HTG A;  1XT8 A;  4WED A;  1B3G A;  2UYE A;  3KZG A;  4YB6 A;  3PUX E;  3I3V A;  2UVJ A;  4I1D A;  1LAH E;  2DVC A;  3FAS A;  4PQJ A;  1FCK A;  1P1W A;  2ALU A;  4AB5 A;  3TEL A;  3VLU A;  2VHA A;  3KN7 A;  4K3F A;  1DMB A;  4Q30 B;  4GVO A;  1USY E;  3U72 A;  1OLA A;  3SET A;  1QKB A;  3R26 A;  3TTL A;  5I59 A;  5I2N A;  2B65 A;  1SBP A;  5ICT A;  1JW5 A;  5L9S A;  2VD3 A;  2A5S A;  4TOZ A;  1FTM A;  5LOM A;  3MZB A;  1WVJ A;  4YZZ A;  4GIZ A;  4IO2 A;  2QS2 A;  4FOR A;  1A7L A;  1UQW A;  4I62 A;  2DE4 A;  3EF7 A;  3VLV A;  4ZEI A;  3M3F A;  1H43 A;  3T9U A;  5M2V A;  4U1O A;  5I57 B;  3H6V A;  1AMF A;  4LVQ A;  5CC2 A;  3S2V A;  4XIG Q;  1MY3 A;  3PD8 A;  4U21 A;  1NH7 A;  5JK4 A;  4R6K A;  2XXW A;  2DE2 A;  4YMA A;  1NH8 A;  3IOU A;  2LAO A;  3CFL A;  3HCQ A;  5F7V A;  4NWD A;  1LCT A;  5I2K B;  3A09 A;  2V93 A;  4Q0C A;  4RPO A;  5I58 B;  4ZE9 A;  2XXQ A;  5I84 A;  3IO6 A;  2I6E A;  4MF3 A;  2GHA A;  4KD5 A;  3SES A;  1IZ1 A;  3K2D A;  1XHY A;  4KI0 E;  3UN6 A;  3W9V A;  4AB6 A;  2V3U A;  2V25 A;  1B1H A;  1ANF A;  4XKP A;  1D4N A;  1MQG A;  4QF9 A;  1RYX A;  1TXF A;  2R9J A;  1MH4 A;  1MQD A;  1URS A;  4NE4 A;  3CIJ A;  2VGQ A;  3O66 A;  4WKM A;  4MBP A;  4U2R A;  1MY2 A;  1OVT A;  3A3U A;  4R72 A;  1SW2 A;  2OWS A;  4Z0I A;  3DLN A;  3TTM A;  3PPO A;  3ZKL A;  2QPQ A;  2OZZ A;  3KN8 A;  2HZK A;  3I6V A;  4QFK A;  2RC7 A;  2GHB A;  1Y20 A;  4RYA A;  3U94 A;  1IQ7 A;  3OEL A;  3HPI A;  4RXL A;  1MRP A;  1YCJ A;  3T9X B;  3MPL A;  4KR5 A;  1PB7 A;  4IO6 A;  1MDP 1;  3G3K A;  4F19 A;  3B7D A;  3KJT A;  4QFL A;  4FEC A;  1LCF A;  2AIX A;  3OO8 A;  4EF1 A;  4ZEC A;  1ZBM A;  5HBC A;  3ZSF A;  1QJM A;  1R9Q A;  3FJ7 A;  3TQW A;  2THI A;  4RJZ A;  1XOC A;  1POY 1;  3THI A;  3T9H B;  3USD A;  3PMV A;  3K00 A;  4U4X A;  3C36 A;  1L5T A;  3FD3 A;  3IO4 A;  1IXC A;  1LB9 A;  4KYD A;  4F3S A;  1LAX A;  2I0B A;  4PFW A;  1MXX A;  4GOT A;  3MPK A;  1IIT A;  1H45 A;  1EZ9 A;  4G68 C;  1SVX B;  2F7C A;  3K6U A;  4TQU Q;  1B2H A;  3MVW A;  1B05 A;  1VFD A;  4ELP A;  1UTH B;  5DYH A;  2B3B A;  1A8E A;  4F3B A;  1B3E A;  1US4 A;  1B32 A;  2QS4 A;  1B0H A;  4DLD A;  4GD5 A;  3OEK A;  1CE2 A;  1SW4 A;  4IO5 A;  4MH5 A;  3MC2 A;  4KYE A;  3TCF A;  1NNP A;  4UA8 A;  1JEV A;  3TOD A;  3MBP A;  4RPN A;  1YPN A;  4FAJ A;  4GQO A;  1MM6 A;  5TU0 A;  4GWO A;  2P2A A;  3BFU A;  1P99 A;  2F7B A;  5HPQ A;  3RLF E;  1SYH A;  1QUL A;  3S9M C;  4DXU A;  2QS3 A;  1Y1Z A;  1UTB A;  1QUI A;  3P7I A;  3FVN A;  4OVJ A;  4QHQ A;  2ZMB A;  3ZS6 A;  3G3F A;  1JNF A;  2V84 A;  1B3H A;  4PET A;  2HQ0 A;  4HCY A;  3ILT B;  2P1S A;  4GLI A;  5AA1 A;  2CMO A;  4ZZE A;  1M5C A;  4H1X A;  1EU8 A;  1MXY A;  3VFJ A;  3Q26 A;  1AIV A;  3B6W A;  1B5I A;  5CMM A;  3UOR A;  2I3W A;  2Y7W A;  1FQA A;  5KCJ A;  4R9G A;  3BBR A;  4R74 A;  4RA1 A;  1R1N A;  1POT A;  3HV1 A;  3A3C A;  3K01 A;  2XXI A;  1MH3 A;  3FAT A;  1N84 A;  2XX8 A;  4YB5 A;  4POW A;  5H8Q B;  3H4Z A;  1IXG A;  3DEL B;  1QKA A;  1S50 A;  1ZTY A;  2PMS A;  1NNF A;  1Y3P A;  3EHT A;  3KBR A;  2O1L A;  1B58 A;  3IK6 B;  4H5G A;  3CSB A;  4F29 A;  1Q35 A;  3AXF A;  2O6A A;  1N7X A;  3F11 A;  4ELQ A;  1EZO A;  3Q29 A;  1N3W A;  4H65 A;  1LB8 A;  4LQ2 A;  3MP8 A;  3SEV A;  3FXR A;  3HN0 A;  4TLL B;  4AQ4 A;  4H0W A;  1PBP A;  1B51 A;  4OZ9 A;  3FV2 A;  3RN8 A;  4LZ8 A;  1UTB B;  3TFL A;  3GBB A;  4G8H A;  4ECF A;  3SER A;  3K1N A;  5FHM A;  2YLN A;  3IJO B;  1LFI A;  1MXV A;  1DTZ A;  2DXR A;  3CRB A;  1P1O A;  2X7Q A;  1F9B A;  3BKI B;  5H8S A;  3FVO A;  4LZ7 A;  4WXJ A;  3TCG A;  1BIY A;  4EQ9 A;  2V3Q A;  5DEX A;  4DZ1 A;  3LR1 A;  4PP0 A;  3S9N C;  2HAV A;  3FGS A;  1B4H A;  5JTY B;  3MP6 A;  3CI8 A;  4IGT A;  4LAT A;  1CB6 A;  3TQL A;  5AA2 D;  4F3P A;  5L8D A;  1SW5 A;  4ZDM A;  3B6Q A;  3UA8 A;  3ILU B;  3WAF A;  2DXY A;  4DXB A;  1N7W A;  1FTO A;  2XHD A;  2KLF A;  3TTK A;  1GR2 A;  3RNN A;  5H8F A;  4XKQ A;  4ZEK A;  3FZV A;  4X1B A;  1NMU A;  3HO7 A;  2Y7R A;  2AYS A;  3UP9 A;  4NF5 A;  5TP9 B;  4RK9 A;  4GXA A;  1A55 A;  1ZIU A;  5TPA B;  4IGR A;  2CZL A;  1ZMG A;  1NKX A;  3RPW A;  5AA2 B;  4QFP A;  1IXH A;  3KFM A;  4EXL A;  3E13 X;  5ITO A;  1B1X A;  1QUK A;  3E3K A;  4OQO A;  1Y1M A;  2D3I A;  3PGF A;  4NED A;  1Q1K A;  3K1P A;  2E0S A;  1WOD A;  3GZG A;  4PFT A;  4BDR A;  3OO7 A;  1M5B A;  4YKJ A;  2DVZ A;  2OK2 A;  1I6A A;  4F2O A;  3CFX A;  3N94 A;  2A5T B;  2NOO A;  3VXC A;  2FA7 A;  1B40 A;  2Q8J A;  1B7Z A;  5DTB A;  3KGC A;  1RKM A;  3TTN A;  3PU5 A;  4OFO A;  2OCU A;  3CG1 A;  3RY3 A;  1SI1 A;  4NF8 B;  3C4M A;  1B6H A;  4XKR A;  1D3K A;  4KCC A;  4HCW A;  2FYI A;  3W15 C;  3O97 A;  3MJN A;  2WKY A;  4JB7 A;  2O51 A;  1SYI A;  4XXU A;  3CR9 A;  2PBW A;  4BDL A;  1A54 A;  5H8N B;  3S9E A;  1H3D A;  2XX7 A;  2DE3 A;  3FXU A;  3WAE A;  1GVC A;  2XXY A;  1MY4 A;  1ZJL A;  3IOT A;  4MLV A;  1BTJ A;  1VE4 A;  1FQD A;  4KCD A;  3UIF A;  3TDJ A;  2O7U A;  3O6I A;  2O1M A;  4IB2 A;  3C33 A;  2XXT A;  2F35 A;  4H67 A;  2H99 A;  1O64 A;  1B4Z A;  3MP1 A;  2O7I A;  5KDT A;  3RTF B;  4YKP A;  1I69 A;  4Z7E A;  3TZA A;  1LBC A;  4R73 A;  3KN3 A;  4ZZA A;  1I6B A;  3LSX A;  3MVY A;  2IEE A;  3K4U A;  3G3H A;  2X26 A;  3G7W A;  4PFY A;  2DOJ A;  1QVS A;  3SEW A;  3EHS A;  4ZS9 A;  1FTJ A;  1SW1 A;  3MAM A;  5I59 B;  5I2N B;  4KYS A;  4G77 A;  3CVG A;  1OQG A;  5H8H A;  1URD A;  1N04 A;  4UAC A;  5DVJ A;  3LSL A;  4G8N A;  3U1O A;  2D21 A;  4YAH X;  1SQY A;  2Y7K A;  2NVU B;  4QFO A;  1NNK A;  3OO6 A;  1P1U A;  2DWH A;  3PV0 E;  1NFT A;  4NF6 A;  3TMG A;  4THI A;  2YJP A;  1DPP A;  3OEM A;  4JWX A;  5I56 A;  2NUV A;  3QSL A;  3EHU A;  3QIM A;  2QJE A;  3Q27 A;  4GXS B;  5CMC A;  4LP2 B;  1II5 A;  3GXA A;  4NMY A;  2RKM A;  4YB7 A;  1XVX A;  2RC9 A;  3TAJ A;  4DDD A;  1TFA A;  2QMW A;  1FQB A;  1B3L A;  1PC3 A;  3VE1 B;  1IXI A;  4RNS A;  2PVU A;  4OER A;  1SD3 A;  3G3G A;  5FTH A;  2BJJ X;  4KPT A;  5DVF A;  4ESW A;  3C9H A;  3H3G A;  3LSW A;  4PE5 B;  3PPQ A;  2I0C A;  2F36 A;  4U1Z A;  2HFB A;  2DP8 A;  5CMK A;  4LA9 A;  4BDN A;  5AA4 A;  5B7D A;  2W7Y A;  1SI0 A;  2Z8F A;  4X1D A;  4FEB A;  1AOV A;  1BP5 A;  3O2A A;  3UGW A;  5A5X A;  1B9J A;  1DSN A;  3SDF A;  1R9L A;  3IAZ A;  2G93 A;  3VVD A;  3OSR A;  4O3A A;  1MS7 A;  3OEN A;  3RT8 A;  3EN3 A;  2Q89 A;  2ABH A;  4QSC A;  3PUZ E;  1TFD A;  5K2X A;  5IKB A;  1B0L A;  4F1U A;  1US5 A;  4GFR A;  1MG1 A;  3N6T A;  2F97 A;  2I58 A;  1GGG A;  1M5F A;  2XXH A;  4E0W A;  4L17 A;  3G3J A;  3KSX A;  3QAX A;  4ONY A;  1NNT A;  2DWI A;  2DS9 A;  3KG2 A;  3H03 A;  4HS7 A;  3JV9 A;  2ZNU A;  4FAT A;  1KWH A;  4QRZ A;  1M5E A;  1JEU A;  4R6H A;  4POX A;  1YTV A;  2PX1 A;  1B7H A;  2XXU A;  4N13 A;  1IUD A;  3QUF A;  1LAF E;  3O29 A;  3E9X A;  3IOR A;  2RC8 A;  5CM6 A;  5AA3 A;  4U4S A;  2NXO A;  1S9T A;  4O3B A;  1YAE A;  1PB9 A;  2ZYM A;  3H6W A;  2Q2A A;  1JQF A;  4H8J A;  4JXI A;  2ONR A;  1MPD A;  5EHM A;  1MXW A;  1XC1 A;  4ZE8 A;  2ZNS A;  3T22 A;  2M8C A;  4EQ7 A;  3UK4 A;  2DSF A;  3FVG A;  4EQB A;  1TT1 A;  2PYY A;  1FQF A;  4P0G A;  4X48 A;  2I4C A;  3E4R A;  1EH3 A;  3TEP A;  4MLQ A;  4YKK A;  3LBS A;  3H6T A;  1MM7 A;  3B6T A;  2VD2 A;  3BFT A;  3V8X B;  4ND9 A;  4JWO A;  4RY1 A;  1JVY A;  4EDP A;  2GRV A;  4OET A;  3FJM A;  4P11 A;  1T0K A;  4ESX A;  1M5D A;  4OYV A;  4ISU A;  3ODB A;  5BUU A;  3MVZ A;  3N6U A;  4GRK A;  5HM4 B;  5CBS A;  3T66 A;  2X7P A;  1ELJ A;  4QSE A;  2O69 A;  5ITP A;  4IO3 A;  3DP4 A;  2Z8D A;  1DTG A;  4XTC Q;  2ONS A;  5KCJ B;  3FJG A;  2ESN A;  1FTL A;  2QL3 A;  2XD3 A;  2Z22 A;  2XX9 A;  5I57 A;  1H44 A;  2F5X A;  3TUS A;  3H06 B;  3OMB A;  1B3F A;  3LSF B;  4JSO A;  1FTK A;  1VSO A;  1Y4T A;  3ECR A;  4JWY A;  1DPE A;  3V5A A;  3IB1 A;  3ZKK A;  5FHN A;  1Y9U A;  2R71 A;  4NF4 A;  4H5F A;  5I2K A;  3O6H A;  2Q2C A;  5I58 A;  4F3G A;  2F7A A;  4FIM A;  1Z7N E;  3FIR A;  4FE8 A;  4BDM A;  2ZNT A;  3JZJ A;  1FQC A;  1NL5 A;  4U22 A;  3C35 A;  3O9P A;  4C0R A;  1DOT A;  2I4B A;  1JVX A;  1VR5 A;  4G68 A;  2H25 A;  4ELR A;  4QSD A;  4OES A;  3U93 A;  3U8Q A;  4F31 B;  2E1S A;  2Y84 A;  2VP1 A;  3U92 A;  2ZYO A;  3KJ7 A;  4EF2 A;  3KEI A;  4IO4 A;  5IAI A;  4JDF A;  3JYR A;  5EHS A;  2XXX A;  1N3X A;  5DEX B;  1P1Q A;  3H7M A;  1Y4C A;  1D9V A;  1URG A;  2D5W A;  1EZP A;  1XVY A;  3QK6 A;  4OHN A;  1O7T A;  3M3L A;  2XXP A;  2RCB A;  1LFH A;  1D9Y A;  1PEB A;  1OIB A;  1HSJ A;  4M4G A;  4BDQ A;  1B5J A;  2GH9 A;  5BWJ A;  3FUZ A;  2RCA A;  5DVI A;  4R2F A;  2F34 A;  2UVI A;  1RYO A;  4OWD A;  5H8F B;  3H6U A;  3VVE A;  4IO7 A;  3QYT A;  2I49 A;  4G2Z A;  3N26 A;  4BDO A;  3M8U A;  4NF5 B;  3RTW B;  3IOW A;  1BKA A;  4NF4 B;  3PUW E;  2OLB A;  2Q9T A;  2H9B A;  3IB0 A;  1MDQ A;  1MQI A;  1B46 A;  4N6P A;  2REJ A;  3SEY A;  2HEU A;  1MQJ A;  4I9D A;  4LQ5 A;  1OVB A;  5CMB A;  4F1Y A;  3PPN A;  2H98 A;  5ISU A;  3PD9 A;  1Z7M E;  5JEI A;  3GBA A;  3SEX A;  4G68 B;  1ZU0 A;  3PMX A;  4OFL A;  2DQV A;  3HST A;  4OXV A;  3Q28 A;  3K6V A;  2REG A;  4DXC A;  1UTH A;  1B5H A;  1MXZ A;  4YIC A;  2H4I A;  3MZ1 A;  3FXQ A;  2I3V A;  3CFZ A;  2DWA A;  3RT6 B;  4ZEF A;  4KHZ E;  1AH5 A;  4F22 A;  5ICQ A;  3IX1 A;  2ZYK A;  4OEV A;  1JW1 A;  1OLC A;  4MFI A;  3OSQ A;  3G3I A;  1I6Q A;  1MY0 A;  5F1Q A;  3OO9 A;  4U23 A;  2F8D A;  2ZXT A;  5J1D A;  4LUB A;  2QS1 A;  3T93 B;  1ZLQ A;  1ATG A;  4HW8 A;  1UIU A;  3PUV E;  1Y3Q A;  3OD7 A;  3I5O A;  3K02 A;  1OMP A;  3PPR A;  1J1N A;  3K6X A;  3TTR A;  2UVG A;  4DCY A;  4G8M A;  3EQ1 A;  4DE8 A;  1FW0 A;  4DIG A;  5FHO A;  3K6W A;  1HSE A;  1GV8 A;  2P0S A;  4X9T A;  2OJT A;  1BLF A;  1SDX A;  2PT2 A;  2XD2 A;  3O28 A;  3KOT A;  1O63 A;  4ZED A;  5KDT B;  4OEU A;  5B70 A;  5H8Q A;  3SEU A;  1Y3N A;  4F39 A;  3RQT A;  1A40 A;  1MY1 A;  1ZKB A;  3VLW A;  2R6G E;  3PMW A;  4YKI A;  5ELV A;  4R75 A;  5EYF A;  5DT6 A;  3S4U A;  1QW0 A;  1GTK A;  1QUJ A;  3FV1 A;  4NTL A;  3IR1 A;  2UYF A;  3O6G A;  3K0V A;  3CSG A;  1LST A;  3TPA A;  5H8H B;  5L9O A;  4Q5T A;  1PB8 A;  3R6U A;  3L6G A;  3VXB A;  3LC8 A;  4F1V A;  3QXM A;  4FJP A;  4BLA A;  3PUY E;  2GFE A;  3C31 A;  4O3C A;  2AL5 A;  5KZT A;  3MUQ A;  1LFG A;  3HHG A;  4N07 A;  3SKP A;  2HZL A;  2ONK E;  4NF6 B;  5AE4 A;  3TCH A;  2XXV A;  4KQP A;  3IB2 A;  4KFQ A;  2NWJ A;  5I56 B;  5CI5 A;  4LZ5 A;  1PDA A;  4R9F A;  1MXU A;  3VV5 A;  1B52 A;  4RK2 A;  2HCA A;  4OFJ A;  1VFE A;  2ZYN A;  2RIN A;  3LUY A;  1B7U A;  4GL0 A;  2OWT A;  2I48 A;  3T9V A;  4EUO A;  3MWB A;  1IIW A;  4NWC A;  2OBG A;  1WDN A;  3OOA A;  1PBQ A;  4ZEB A;  5JTY A;  3R7X A;  3KSJ A;  2O68 A;  1LBB A;  4H6D A;  4DCX A;  2DWJ A;  4C1U A;  2HAU A;  1AL3 A;  2QRY A;  1IEJ A;  1MQH A;  5FTI A;  1P1N A;  2PT1 A;  5CBR A;  3EPE A;  1S7Y A;  2ANJ A;  2F6P A;  3K1M A;  3HHF A;  1UIV A;  1N0T A;  1USY H;  2Y7I A;  1A99 A;  3V83 A;  4E0X A;  4Q8R A;  4YU0 A;  5AA4 B;  3RUM A;  3IL1 B;  4EXK A;  4OEN A;  4C1T A;  5A5X B;  3C34 A;  2QSX A;  3KOS A;  5TP9 A;  3IOV A;  3DP6 A;  5TPA A;  3D4C A;  2Q88 A;  2YPN A;  2Z8E A;  3QUJ A;  4I8C A;  3VDF A;  5AA2 A;  2IA4 A;  1FQE A;  4TLM B;  4PFU A;  3MQ9 A;  3V89 B;  3C32 A;  1OQH A;  1JW4 A;  3MVX A;  4WEP A;  2V3T A;  2XXR A;  1MPB A;  3DM0 A;  3M3K A;  3T96 B;  2UVH A;  2F78 A;  2HXW A;  2G29 A;  4H8I A;  4ELO A;  2AL4 A;  5CRY A;  1H76 A;  2Z23 A;  2RF1 A;  4F2Q A;  1LLS A; 
#chains in the Genus database with same CATH topology
 2CZH A;  3IJX B;  2ZZX A;  4P47 A;  1HSL A;  1NV6 A;  4KXP A;  4R2B A;  3VVF A;  1N76 A;  4NHB A;  3L6H A;  5L9M A;  2A5T A;  4MNI A;  4QFN A;  2DYX A;  3TYH A;  4G4P A;  3FVK A;  3CG3 A;  4OTE A;  1R6Z A;  4P0I A;  2Y7P A;  2Y5L A;  4JSD A;  3D4G A;  4NF8 A;  2O84 X;  2UXA A;  3PPP A;  4OMB A;  3S9L C;  1EYI A;  4M1V A;  2FNC A;  3GLB A;  3RGY A;  2F6G A;  1A8F A;  4JBZ A;  1LAG E;  4GL8 A;  4F18 A;  3OXN A;  3ONM A;  4O7I A;  1LGB C;  4I3E A;  4XKN A;  2R8T A;  1JET A;  5H8N A;  2H5Y A;  4IY6 A;  2VOZ A;  2QMX A;  1FPF A;  4MAG A;  5K2Y A;  3Q25 A;  4GF8 A;  3MZ9 A;  4R6Y A;  3MW0 A;  4FED A;  1TWY A;  3DP8 A;  4LON B;  3W9W A;  1XS5 A;  2B3F A;  4YMB A;  1MPC A;  3N5L A;  4IY5 A;  3RYD A;  3TKD A;  4HTG A;  1XT8 A;  4WED A;  1B3G A;  2UYE A;  3KZG A;  4YB6 A;  3PUX E;  1FBD A;  3I3V A;  2UVJ A;  4I1D A;  1LAH E;  2DVC A;  3FAS A;  4PQJ A;  2VT5 A;  1FCK A;  1P1W A;  2ALU A;  4AB5 A;  3TEL A;  3VLU A;  4OVR A;  2VHA A;  3KN7 A;  4K3F A;  1DMB A;  4Q30 B;  4GVO A;  1USY E;  3U72 A;  4GWS A;  1IMC A;  1OLA A;  3SET A;  1QKB A;  1AWB A;  3R26 A;  1K9Z A;  3TTL A;  5I59 A;  2MKZ A;  5I2N A;  2B65 A;  1SBP A;  4P1E A;  5IZ3 B;  5ICT A;  1JW5 A;  5L9S A;  2VD3 A;  2A5S A;  4TOZ A;  1FTM A;  5LOM A;  3MZB A;  1WVJ A;  4YZZ A;  2OWZ A;  4GIZ A;  4IO2 A;  2QS2 A;  4FOR A;  1A7L A;  3BIH A;  1UQW A;  4I62 A;  2DE4 A;  2BJI A;  3EF7 A;  4ZEI A;  3VLV A;  3M3F A;  1INP A;  1H43 A;  3T9U A;  5M2V A;  4U1O A;  5I57 B;  3H6V A;  1AMF A;  4LVQ A;  5CC2 A;  3S2V A;  4XIG Q;  1LBV A;  1MY3 A;  3PD8 A;  4U21 A;  1NH7 A;  5JK4 A;  4R6K A;  2XXW A;  2DE2 A;  4YMA A;  1NH8 A;  3IOU A;  2LAO A;  3CFL A;  3HCQ A;  5F7V A;  1IME A;  4NWD A;  1LCT A;  2WX9 A;  5I2K B;  3A09 A;  2V93 A;  1JP4 A;  2XWV A;  4HXV A;  4Q0C A;  4RPO A;  5I58 B;  4XFE A;  4ZE9 A;  1G0H A;  2XXQ A;  5I84 A;  3IO6 A;  2I6E A;  4MF3 A;  2GHA A;  4KD5 A;  3SES A;  2L5V A;  1IZ1 A;  3K2D A;  1DCU A;  1XHY A;  1YXI A;  4KI0 E;  3UN6 A;  3W9V A;  5I7I A;  4AB6 A;  2V3U A;  1FJ6 A;  1NUW A;  2V25 A;  1B1H A;  1ANF A;  4XKP A;  1D4N A;  1MQG A;  4QF9 A;  1RYX A;  1TXF A;  4OA4 A;  4GWU A;  2R9J A;  1MH4 A;  1MQD A;  1URS A;  4NE4 A;  3CIJ A;  2B4L A;  2VGQ A;  3O66 A;  4WKM A;  4MBP A;  4U2R A;  1MY2 A;  1OVT A;  3A3U A;  4MNC A;  2PFY A;  4R72 A;  1SW2 A;  2OWS A;  4Z0I A;  4NAP A;  3DLN A;  3TTM A;  3PPO A;  3ZKL A;  2QPQ A;  2OZZ A;  3RPL A;  3KN8 A;  2HZK A;  3I6V A;  4QFK A;  2RC7 A;  2GHB A;  4GBW A;  1Y20 A;  4RYA A;  3U94 A;  1IQ7 A;  3OEL A;  3HPI A;  4RXL A;  1MRP A;  1YCJ A;  3T9X B;  3MPL A;  1RDX A;  4KR5 A;  1PB7 A;  4IO6 A;  1MDP 1;  3G3K A;  4F19 A;  3B7D A;  3KJT A;  4H46 A;  2GQ1 A;  4QFL A;  4FEC A;  1LCF A;  1G0I A;  2AIX A;  3OO8 A;  4EF1 A;  4ZEC A;  1ZBM A;  5HBC A;  3ZSF A;  1QJM A;  1R9Q A;  3FJ7 A;  3TQW A;  2THI A;  4RJZ A;  1XOC A;  1POY 1;  3THI A;  3T9H B;  3USD A;  3PMV A;  3K00 A;  5I3S A;  4U4X A;  3C36 A;  4LN5 A;  1L5T A;  3FD3 A;  3IO4 A;  1IXC A;  1LB9 A;  4KYD A;  4F3S A;  1LAX A;  2I0B A;  4PFW A;  1MXX A;  4GOT A;  3MPK A;  1IIT A;  2PFZ A;  1H45 A;  1EZ9 A;  4PDD A;  4G68 C;  1SVX B;  2F7C A;  3K6U A;  4TQU Q;  1KZ8 A;  1B2H A;  3MVW A;  1B05 A;  1VFD A;  4ELP A;  5LTC A;  4XEQ A;  1UTH B;  5DYH A;  2B3B A;  1A8E A;  4F3B A;  3KC0 A;  1B3E A;  1US4 A;  4PFR A;  1XI6 A;  1B32 A;  2QS4 A;  1B0H A;  4DLD A;  4GD5 A;  3OEK A;  4MH5 A;  1CE2 A;  1SW4 A;  4IO5 A;  3MC2 A;  4KYE A;  3TCF A;  1NNP A;  4UA8 A;  1DBZ A;  1JEV A;  3TOD A;  4PGN A;  3MBP A;  4RPN A;  1YPN A;  4FAJ A;  4GQO A;  1MM6 A;  5TU0 A;  4GWO A;  2P2A A;  3BFU A;  2QVU A;  2XWK A;  1P99 A;  2F7B A;  5HPQ A;  3RLF E;  1SYH A;  1QUL A;  3S9M C;  4DXU A;  4PF8 A;  2QS3 A;  3IFA A;  1Y1Z A;  4JVI A;  1UTB A;  1QUI A;  3P7I A;  3FVN A;  4PF6 A;  4OVJ A;  4QHQ A;  2ZMB A;  4MIJ A;  3ZS6 A;  3G3F A;  1JNF A;  3ISP A;  2V84 A;  1B3H A;  4PET A;  2HQ0 A;  4HCY A;  4H45 A;  4XF5 A;  2XWI A;  3ILT B;  2P1S A;  4GLI A;  3MST A;  5AA1 A;  2CMO A;  4ZZE A;  1M5C A;  4H1X A;  1EU8 A;  5ET7 A;  1MXY A;  3VFJ A;  3Q26 A;  1NV7 A;  2WYK A;  1NUZ A;  1AIV A;  3B6W A;  1B5I A;  5CMM A;  3UOR A;  2I3W A;  2Y7W A;  2VPO A;  1FQA A;  4GWW A;  5KCJ A;  4R9G A;  3BBR A;  4R74 A;  4RA1 A;  1R1N A;  1POT A;  3HV1 A;  3A3C A;  3K01 A;  2XXI A;  1MH3 A;  3FAT A;  1N84 A;  2XX8 A;  4YB5 A;  4POW A;  5H8Q B;  3H4Z A;  1FSA A;  1IXG A;  3DEL B;  1QKA A;  1S50 A;  1ZTY A;  2PMS A;  1NNF A;  1Y3P A;  3EHT A;  5J16 A;  4HE2 A;  3KBR A;  2O1L A;  1B58 A;  3LV0 A;  3IK6 B;  4H5G A;  3CSB A;  4F29 A;  1Q35 A;  2Q8M A;  3AXF A;  2O6A A;  1N7X A;  3LUZ A;  3FXB A;  3F11 A;  4ELQ A;  1EZO A;  3Q29 A;  1N3W A;  4H65 A;  5EQ7 A;  1LB8 A;  4LQ2 A;  3MP8 A;  3SEV A;  3FXR A;  1FRP A;  3HN0 A;  4MNP A;  4JVC A;  4TLL B;  5EQA A;  2CZK A;  4H0W A;  4AQ4 A;  1PBP A;  1B51 A;  4OZ9 A;  3FV2 A;  3RN8 A;  4LZ8 A;  1UTB B;  3TFL A;  3GBB A;  4G8H A;  2F3B A;  4ECF A;  3SER A;  3K1N A;  5FHM A;  2YLN A;  4GX4 A;  3IJO B;  1LFI A;  1MXV A;  1DTZ A;  2DXR A;  3CRB A;  4DI3 D;  1P1O A;  2X7Q A;  4X8R A;  1F9B A;  3BKI B;  5H8S A;  3FVO A;  4LZ7 A;  1FBH A;  4WXJ A;  3TCG A;  1BIY A;  4EQ9 A;  2V3Q A;  4P3L A;  5DEX A;  4DZ1 A;  3LR1 A;  3T1B A;  4JVD A;  4PBQ A;  4PP0 A;  3S9N C;  2HAV A;  3FGS A;  1YYZ A;  1B4H A;  5JTY B;  3MP6 A;  3CI8 A;  4IGT A;  4LAT A;  1CB6 A;  3TQL A;  5AA2 D;  4F3P A;  5L8D A;  1K9Y A;  1SW5 A;  4ZDM A;  3B6Q A;  3UA8 A;  3ILU B;  3WAF A;  2DXY A;  4DXB A;  1N7W A;  1FTO A;  2XHD A;  2KLF A;  4P9K A;  3TTK A;  1GR2 A;  3RNN A;  5H8F A;  4XKQ A;  4ZEK A;  3FZV A;  4X1B A;  2FIX A;  2B4M A;  1NMU A;  4GWZ A;  3HO7 A;  2Y7R A;  2AYS A;  3UP9 A;  4I3Y A;  4NF5 A;  5TP9 B;  4RK9 A;  4GXA A;  1A55 A;  1IMB A;  1ZIU A;  5TPA B;  4IGR A;  2CZL A;  4PGP A;  1ZMG A;  4MJO A;  1NKX A;  5FBP A;  3RPW A;  5AA2 B;  1KA1 A;  4QFP A;  1IXH A;  3KFM A;  4EXL A;  3E13 X;  5ITO A;  1B1X A;  1QUK A;  3E3K A;  4OQO A;  1Y1M A;  2D3I A;  3PGF A;  4NED A;  1Q1K A;  2HPG A;  1RDZ A;  3K1P A;  2E0S A;  1WOD A;  4GBV A;  3GZG A;  5I5P A;  4PFT A;  4PFB A;  4BDR A;  1BK4 A;  3OO7 A;  1M5B A;  4YKJ A;  2DVZ A;  5ET8 A;  2OK2 A;  1I6A A;  4F2O A;  3CFX A;  3N94 A;  2A5T B;  2NOO A;  3QMF A;  3VXC A;  2FA7 A;  1B40 A;  2Q8J A;  1B7Z A;  5DTB A;  3KGC A;  1RKM A;  3TTN A;  3PU5 A;  4OFO A;  4OVS A;  2OCU A;  3CG1 A;  4IR8 A;  3RY3 A;  1LBX A;  1SI1 A;  4NF8 B;  4MMP A;  2CEX A;  3T0J A;  1FBE A;  2ZZV A;  3C4M A;  1B6H A;  4XKR A;  1D3K A;  4KCC A;  4HCW A;  2FYI A;  3W15 C;  3O97 A;  1FBC A;  3MJN A;  2WKY A;  4JB7 A;  2O51 A;  2WYP A;  1SYI A;  4XXU A;  3CR9 A;  2PBW A;  4NG7 A;  4BDL A;  1A54 A;  5H8N B;  1SPI A;  1FPK A;  3S9E A;  1H3D A;  2XX7 A;  2DE3 A;  3FXU A;  4PBH A;  3WAE A;  1GVC A;  2XXY A;  1MY4 A;  1ZJL A;  3IOT A;  4MLV A;  1BTJ A;  1VE4 A;  1FQD A;  4KCD A;  3UIF A;  3TDJ A;  2O7U A;  3O6I A;  2O1M A;  4IB2 A;  3C33 A;  2XXT A;  2F35 A;  4H67 A;  2H99 A;  1O64 A;  1B4Z A;  3MP1 A;  1EYK A;  2O7I A;  5KDT A;  2WBD A;  3RTF B;  4YKP A;  1FJ9 A;  1NI9 A;  1I69 A;  2FHY A;  4Z7E A;  3TZA A;  1LBC A;  4R73 A;  3KN3 A;  4ZZA A;  1I6B A;  3LSX A;  3MVY A;  2IEE A;  3K4U A;  2DDK A;  3G3H A;  2X26 A;  3G7W A;  4PFY A;  2DOJ A;  1QVS A;  3SEW A;  3EHS A;  4ZS9 A;  1FTJ A;  1SW1 A;  3MAM A;  5I59 B;  1FPI A;  4MCO A;  5I2N B;  4KYS A;  4G77 A;  3CVG A;  1OQG A;  5H8H A;  1URD A;  2ZZW A;  4N8Y A;  1N04 A;  4UAC A;  3MYU A;  5DVJ A;  3LSL A;  1QGX A;  4X04 A;  4G8N A;  3U1O A;  2D21 A;  4YAH X;  1SQY A;  2Y7K A;  2NVU B;  4QFO A;  1NNK A;  3OO6 A;  1P1U A;  2DWH A;  3PV0 E;  1NFT A;  4NF6 A;  3TMG A;  3KBZ A;  4THI A;  2YJP A;  1DPP A;  3OEM A;  1NV0 A;  4JWX A;  5I56 A;  2NUV A;  4HE1 A;  3QSL A;  3EHU A;  1FPE A;  3QIM A;  2QJE A;  3Q27 A;  4GXS B;  5CMC A;  4LP2 B;  1II5 A;  3A29 A;  3GXA A;  1VDW A;  4NMY A;  2RKM A;  4YB7 A;  1XVX A;  2RC9 A;  3TAJ A;  4DDD A;  2QFL A;  1TFA A;  2QMW A;  1PC3 A;  1B3L A;  1FQB A;  3VE1 B;  1IXI A;  4RNS A;  1FPJ A;  2PVU A;  5EYH A;  1FPL A;  4OER A;  1SD3 A;  3G3G A;  5FTH A;  2BJJ X;  4KPT A;  4GX3 A;  1NV2 A;  5DVF A;  4ESW A;  3C9H A;  3H3G A;  3LSW A;  4PE5 B;  3PPQ A;  2I0C A;  2F36 A;  4U1Z A;  2HFB A;  2DP8 A;  5CMK A;  4LA9 A;  4BDN A;  5AA4 A;  5B7D A;  2W7Y A;  1SI0 A;  2Z8F A;  4FEB A;  4X1D A;  1AOV A;  1BP5 A;  3O2A A;  3UGW A;  5A5X A;  1B9J A;  1DSN A;  1NV5 A;  3SDF A;  1R9L A;  3IAZ A;  2G93 A;  4NF0 A;  3VVD A;  3OSR A;  4O3A A;  1MS7 A;  3OEN A;  3RT8 A;  3EN3 A;  4N8G A;  2Q89 A;  2ABH A;  4QSC A;  4NN3 A;  1FPG A;  3PUZ E;  3RPL B;  1TFD A;  5K2X A;  5IKB A;  1B0L A;  4F1U A;  3PTY A;  1US5 A;  4GFR A;  1MG1 A;  3N6T A;  2F97 A;  2I58 A;  1GGG A;  4QXD A;  1M5F A;  2XXH A;  2FBP A;  4E0W A;  4L17 A;  3G3J A;  3KSX A;  3QAX A;  4ONY A;  1NNT A;  2DWI A;  2DS9 A;  3KG2 A;  3H03 A;  4P1L A;  4NGU A;  4HS7 A;  4OVT A;  3JV9 A;  2ZNU A;  4FAT A;  1KWH A;  3E78 A;  4GX6 A;  4QRZ A;  1M5E A;  1JEU A;  4R6H A;  4POX A;  1YTV A;  2PX1 A;  1B7H A;  2XXU A;  4N13 A;  1IUD A;  3QUF A;  1LAF E;  3O29 A;  3E9X A;  3IOR A;  2Y5K A;  2RC8 A;  5CM6 A;  1DK4 A;  5AA3 A;  5IZ1 A;  4U4S A;  2NXO A;  5EYG A;  1S9T A;  4O3B A;  1YAE A;  1PB9 A;  2ZYM A;  4AS4 A;  3H6W A;  2Q2A A;  1JQF A;  4H8J A;  4JXI A;  2ONR A;  1MPD A;  5EHM A;  2HXR A;  1MXW A;  1XC1 A;  4ZE8 A;  2ZNS A;  4N81 A;  2CEY A;  3T22 A;  2M8C A;  3UK4 A;  4EQ7 A;  2DSF A;  3FVG A;  4EQB A;  4GWY A;  1TT1 A;  2PYY A;  1FQF A;  4P0G A;  4X48 A;  2I4C A;  3E4R A;  1EH3 A;  1FPD A;  5EQ8 A;  3TEP A;  4O8M A;  4MLQ A;  4YKK A;  3LBS A;  3H6T A;  4OVP A;  2JJK A;  1MM7 A;  3B6T A;  2VD2 A;  3BFT A;  3V8X B;  4AS5 A;  4ND9 A;  4JWO A;  4RY1 A;  1JVY A;  4EDP A;  2GRV A;  4OET A;  4FBP A;  3FJM A;  4P11 A;  1T0K A;  4ESX A;  1M5D A;  5ESY A;  4OYV A;  4ISU A;  3ODB A;  5BUU A;  3MVZ A;  3N6U A;  4GRK A;  5HM4 B;  3KC1 A;  1IMD A;  5CBS A;  3T66 A;  2VPN A;  4NX1 A;  2X7P A;  1ELJ A;  4QSE A;  2O69 A;  5ITP A;  5DW8 A;  5IZ3 A;  4HE0 A;  4QBA A;  4IO3 A;  3DP4 A;  2Z8D A;  1DTG A;  3BIG A;  4XTC Q;  2ONS A;  3ROJ A;  5KCJ B;  3FJG A;  2ESN A;  2FIE A;  1FTL A;  2QL3 A;  5LDZ A;  2PCR A;  1FPB A;  2XD3 A;  2Z22 A;  2XX9 A;  5I57 A;  1H44 A;  2F5X A;  3TUS A;  3H06 B;  3OMB A;  2P3N A;  1B3F A;  3LSF B;  3U65 A;  4JSO A;  1FTK A;  1VSO A;  1LBY A;  1Y4T A;  3ECR A;  4JWY A;  1DPE A;  3V5A A;  3IB1 A;  3ZKK A;  5FHN A;  1LBW A;  1Y9U A;  2R71 A;  4NF4 A;  4H5F A;  5I2K A;  3O6H A;  2Q2C A;  5I58 A;  4F3G A;  2F7A A;  4FIM A;  1Z7N E;  3FIR A;  4FE8 A;  4BDM A;  2ZNT A;  3JZJ A;  1FQC A;  1NL5 A;  4U22 A;  3C35 A;  3O9P A;  4C0R A;  2FVZ A;  1DOT A;  2OX3 A;  2I4B A;  1JVX A;  1VR5 A;  3D1R A;  4G68 A;  2H25 A;  4ELR A;  4QSD A;  4OES A;  3U93 A;  3U8Q A;  4F31 B;  2E1S A;  2Y84 A;  2QVV A;  2VP1 A;  5ET5 A;  3U92 A;  2ZYO A;  3KJ7 A;  4EF2 A;  3KEI A;  4IO4 A;  5IAI A;  2P3V A;  4JDF A;  4GWX A;  3JYR A;  5EHS A;  2XXX A;  1N3X A;  5DEX B;  1P1Q A;  4NQ8 A;  3H7M A;  1Y4C A;  4O94 A;  1D9V A;  1URG A;  2D5W A;  1EZP A;  1XVY A;  4DI4 B;  3QK6 A;  4OHN A;  1O7T A;  3M3L A;  2XXP A;  2RCB A;  1LFH A;  1D9Y A;  1PEB A;  1OIB A;  1HSJ A;  4M4G A;  4BDQ A;  1B5J A;  2WEF A;  2GH9 A;  2XWO A;  5BWJ A;  3FUZ A;  2RCA A;  1NV4 A;  5DVI A;  2XA5 A;  4R2F A;  2F34 A;  2UVI A;  1RYO A;  4OWD A;  5IM2 A;  5H8F B;  3H6U A;  1LBZ A;  3VVE A;  1EYJ A;  4IO7 A;  3QYT A;  2I49 A;  4G2Z A;  3N26 A;  1FTA A;  4BDO A;  3M8U A;  4NF5 B;  3RTW B;  3IOW A;  1BKA A;  4NF4 B;  3PUW E;  2OLB A;  2Q9T A;  4MEV A;  2H9B A;  2KQZ A;  3IB0 A;  1MDQ A;  1MQI A;  1B46 A;  4N6P A;  5T3J A;  2REJ A;  3SEY A;  2HEU A;  4N6D A;  1MQJ A;  3FBP A;  4I9D A;  4LQ5 A;  1OVB A;  5CMB A;  4F1Y A;  3PPN A;  2H98 A;  4PFI A;  2CZI A;  5ISU A;  3PD9 A;  1Z7M E;  4PE3 A;  5JEI A;  3GBA A;  3SEX A;  4G68 B;  1ZU0 A;  4PAK A;  3PMX A;  4OFL A;  2DQV A;  3HST A;  4OXV A;  3Q28 A;  4P56 A;  3K6V A;  2REG A;  4DXC A;  4N91 A;  1UTH A;  1B5H A;  1MXZ A;  4YIC A;  2H4I A;  3MZ1 A;  4PAI A;  3FXQ A;  2I3V A;  3CFZ A;  2DWA A;  3RT6 B;  4PTK A;  4KHZ E;  4ZEF A;  4OAN A;  1AH5 A;  4F22 A;  5ICQ A;  3CHG A;  3IX1 A;  2ZYK A;  4OEV A;  1JW1 A;  1OLC A;  4N17 A;  4MFI A;  3OSQ A;  3G3I A;  1I6Q A;  1MY0 A;  5F1Q A;  3OO9 A;  4U23 A;  2F8D A;  2ZXT A;  5J1D A;  4LUB A;  1FBG A;  2QS1 A;  3T93 B;  1ZLQ A;  1ATG A;  2V4C A;  4HW8 A;  4P8B A;  1UIU A;  3PUV E;  1YZ0 A;  2KR0 A;  1Y3Q A;  3OD7 A;  3I5O A;  3K02 A;  1OMP A;  3PPR A;  1J1N A;  3K6X A;  3TTR A;  2UVG A;  4DCY A;  1NV3 A;  4G8M A;  5ET6 A;  3EQ1 A;  4N15 A;  4DE8 A;  1FW0 A;  4DIG A;  5FHO A;  3K6W A;  5A5L A;  1HSE A;  1GV8 A;  2P0S A;  1LEV A;  4I40 A;  4X9T A;  2OJT A;  1BLF A;  2Q74 A;  1SDX A;  2PT2 A;  2XD2 A;  3O28 A;  3KOT A;  1O63 A;  4ZED A;  1CNQ A;  2F3D A;  5KDT B;  4OEU A;  5B70 A;  5H8Q A;  3SEU A;  1D9Q A;  3B8B A;  1Y3N A;  4F39 A;  3RQT A;  1A40 A;  1MY1 A;  3IFC A;  1ZKB A;  3VLW A;  2WBB A;  2R6G E;  3EKI A;  3PMW A;  4YKI A;  4MHF A;  5ELV A;  4G61 A;  4R75 A;  5EYF A;  5DT6 A;  3S4U A;  1QW0 A;  1GTK A;  1KA0 A;  1QUJ A;  2QVR A;  3FV1 A;  4NTL A;  3IR1 A;  2UYF A;  3O6G A;  3K0V A;  4MX6 A;  3CSG A;  1LST A;  3TPA A;  5H8H B;  5L9O A;  4Q5T A;  1PB8 A;  3L6G A;  3R6U A;  3VXB A;  3LC8 A;  4F1V A;  3QXM A;  4FJP A;  4PC9 A;  4BLA A;  3E79 A;  4O7M A;  3PUY E;  1IMF A;  4PCD A;  5IZZ A;  2GFE A;  3C31 A;  4O3C A;  2AL5 A;  1RDY A;  4N4U A;  3MUQ A;  5KZT A;  1LFG A;  4UAB A;  3HHG A;  4N07 A;  3SKP A;  2HZL A;  2ONK E;  4NF6 B;  5AE4 A;  3TCH A;  2XXV A;  4KQP A;  3IB2 A;  4KFQ A;  2NWJ A;  5I56 B;  5CI5 A;  4LZ5 A;  1PDA A;  4R9F A;  4OVQ A;  1MXU A;  3VV5 A;  1B52 A;  4RK2 A;  2HCA A;  4OFJ A;  1Q9D A;  1VFE A;  2ZYN A;  2RIN A;  3LUY A;  1B7U A;  4GL0 A;  2OWT A;  2I48 A;  3T9V A;  4EUO A;  3MWB A;  1IIW A;  4NWC A;  5IGA A;  2OBG A;  1WDN A;  3OOA A;  1PBQ A;  4ZEB A;  5JTY A;  3R7X A;  3KSJ A;  2O68 A;  1LBB A;  4H6D A;  4DCX A;  2DWJ A;  4C1U A;  2HAU A;  1AL3 A;  2QRY A;  1IEJ A;  1MQH A;  4N6K A;  5FTI A;  1P1N A;  2PT1 A;  5CBR A;  3EPE A;  1S7Y A;  2ANJ A;  2F6P A;  3K1M A;  4PAF A;  3HHF A;  3B50 A;  1NUY A;  1UIV A;  1N0T A;  5EQ9 A;  1USY H;  3GYY A;  2Y7I A;  1A99 A;  3V83 A;  4E0X A;  4Q8R A;  4YU0 A;  3IL1 B;  3RUM A;  5AA4 B;  4PDH A;  4EXK A;  4OEN A;  4C1T A;  5A5X B;  3C34 A;  1NV1 A;  1FBF A;  2HHM A;  2QSX A;  5F24 A;  2XXK A;  3KOS A;  5TP9 A;  3IOV A;  3DP6 A;  5TPA A;  1IMA A;  3D4C A;  2Q88 A;  1NUX A;  2YPN A;  2Z8E A;  3QUJ A;  4I8C A;  3VDF A;  3NOH A;  5AA2 A;  2IA4 A;  1FQE A;  4TLM B;  4PFU A;  3MQ9 A;  3V89 B;  3C32 A;  1OQH A;  1JW4 A;  3MVX A;  4WEP A;  2V3T A;  2XXR A;  3HFU A;  1MPB A;  3DM0 A;  3M3K A;  3T96 B;  2UVH A;  1FBP A;  2F78 A;  2HXW A;  2G29 A;  4H8I A;  4ELO A;  2AL4 A;  5CRY A;  1H76 A;  3SZP A;  2Z23 A;  2RF1 A;  4F2Q A;  1LLS A; 
#chains in the Genus database with same CATH homology
 3IJX B;  1HSL A;  4R2B A;  3VVF A;  1N76 A;  3L6H A;  5L9M A;  2A5T A;  4QFN A;  2DYX A;  3TYH A;  4G4P A;  3FVK A;  3CG3 A;  4OTE A;  1R6Z A;  4P0I A;  2Y7P A;  4JSD A;  3D4G A;  4NF8 A;  2O84 X;  2UXA A;  3PPP A;  4OMB A;  3S9L C;  4M1V A;  2FNC A;  3GLB A;  3RGY A;  2F6G A;  1A8F A;  4JBZ A;  1LAG E;  4GL8 A;  4F18 A;  3OXN A;  3ONM A;  1LGB C;  4XKN A;  1JET A;  5H8N A;  2H5Y A;  4IY6 A;  2VOZ A;  2QMX A;  5K2Y A;  3Q25 A;  4GF8 A;  3MZ9 A;  4R6Y A;  3MW0 A;  4FED A;  1TWY A;  3DP8 A;  4LON B;  3W9W A;  1XS5 A;  2B3F A;  4YMB A;  1MPC A;  3N5L A;  4IY5 A;  3TKD A;  4HTG A;  1XT8 A;  4WED A;  1B3G A;  2UYE A;  3KZG A;  4YB6 A;  3PUX E;  3I3V A;  2UVJ A;  4I1D A;  1LAH E;  2DVC A;  3FAS A;  4PQJ A;  1FCK A;  1P1W A;  2ALU A;  4AB5 A;  3TEL A;  3VLU A;  2VHA A;  3KN7 A;  4K3F A;  1DMB A;  4Q30 B;  4GVO A;  1USY E;  3U72 A;  1OLA A;  3SET A;  1QKB A;  3R26 A;  3TTL A;  5I59 A;  5I2N A;  2B65 A;  1SBP A;  5ICT A;  1JW5 A;  5L9S A;  2VD3 A;  2A5S A;  4TOZ A;  1FTM A;  5LOM A;  3MZB A;  1WVJ A;  4YZZ A;  4GIZ A;  4IO2 A;  2QS2 A;  4FOR A;  1A7L A;  1UQW A;  4I62 A;  2DE4 A;  3EF7 A;  3VLV A;  4ZEI A;  3M3F A;  1H43 A;  3T9U A;  5M2V A;  4U1O A;  5I57 B;  3H6V A;  1AMF A;  4LVQ A;  5CC2 A;  3S2V A;  4XIG Q;  1MY3 A;  3PD8 A;  4U21 A;  1NH7 A;  5JK4 A;  4R6K A;  2XXW A;  2DE2 A;  4YMA A;  1NH8 A;  3IOU A;  2LAO A;  3CFL A;  3HCQ A;  5F7V A;  4NWD A;  1LCT A;  5I2K B;  3A09 A;  2V93 A;  4Q0C A;  4RPO A;  5I58 B;  4ZE9 A;  2XXQ A;  5I84 A;  3IO6 A;  2I6E A;  4MF3 A;  2GHA A;  4KD5 A;  3SES A;  1IZ1 A;  3K2D A;  1XHY A;  4KI0 E;  3UN6 A;  3W9V A;  4AB6 A;  2V3U A;  2V25 A;  1B1H A;  1ANF A;  4XKP A;  1D4N A;  1MQG A;  4QF9 A;  1RYX A;  1TXF A;  2R9J A;  1MH4 A;  1MQD A;  1URS A;  4NE4 A;  3CIJ A;  2VGQ A;  3O66 A;  4WKM A;  4MBP A;  4U2R A;  1MY2 A;  1OVT A;  3A3U A;  4R72 A;  1SW2 A;  2OWS A;  4Z0I A;  3DLN A;  3TTM A;  3PPO A;  3ZKL A;  2QPQ A;  2OZZ A;  3KN8 A;  2HZK A;  3I6V A;  4QFK A;  2RC7 A;  2GHB A;  1Y20 A;  4RYA A;  3U94 A;  1IQ7 A;  3OEL A;  3HPI A;  4RXL A;  1MRP A;  1YCJ A;  3T9X B;  3MPL A;  4KR5 A;  1PB7 A;  4IO6 A;  1MDP 1;  3G3K A;  4F19 A;  3B7D A;  3KJT A;  4QFL A;  4FEC A;  1LCF A;  2AIX A;  3OO8 A;  4EF1 A;  4ZEC A;  1ZBM A;  5HBC A;  3ZSF A;  1QJM A;  1R9Q A;  3FJ7 A;  3TQW A;  2THI A;  4RJZ A;  1XOC A;  1POY 1;  3THI A;  3T9H B;  3USD A;  3PMV A;  3K00 A;  4U4X A;  3C36 A;  1L5T A;  3FD3 A;  3IO4 A;  1IXC A;  1LB9 A;  4KYD A;  4F3S A;  1LAX A;  2I0B A;  4PFW A;  1MXX A;  4GOT A;  3MPK A;  1IIT A;  1H45 A;  1EZ9 A;  4G68 C;  1SVX B;  2F7C A;  3K6U A;  4TQU Q;  1B2H A;  3MVW A;  1B05 A;  1VFD A;  4ELP A;  1UTH B;  5DYH A;  2B3B A;  1A8E A;  4F3B A;  1B3E A;  1US4 A;  1B32 A;  2QS4 A;  1B0H A;  4DLD A;  4GD5 A;  3OEK A;  1CE2 A;  1SW4 A;  4IO5 A;  4MH5 A;  3MC2 A;  4KYE A;  3TCF A;  1NNP A;  4UA8 A;  1JEV A;  3TOD A;  3MBP A;  4RPN A;  1YPN A;  4FAJ A;  4GQO A;  1MM6 A;  5TU0 A;  4GWO A;  2P2A A;  3BFU A;  1P99 A;  2F7B A;  5HPQ A;  3RLF E;  1SYH A;  1QUL A;  3S9M C;  4DXU A;  2QS3 A;  1Y1Z A;  1UTB A;  1QUI A;  3P7I A;  3FVN A;  4OVJ A;  4QHQ A;  2ZMB A;  3ZS6 A;  3G3F A;  1JNF A;  2V84 A;  1B3H A;  4PET A;  2HQ0 A;  4HCY A;  3ILT B;  2P1S A;  4GLI A;  5AA1 A;  2CMO A;  4ZZE A;  1M5C A;  4H1X A;  1EU8 A;  1MXY A;  3VFJ A;  3Q26 A;  1AIV A;  3B6W A;  1B5I A;  5CMM A;  3UOR A;  2I3W A;  2Y7W A;  1FQA A;  5KCJ A;  4R9G A;  3BBR A;  4R74 A;  4RA1 A;  1R1N A;  1POT A;  3HV1 A;  3A3C A;  3K01 A;  2XXI A;  1MH3 A;  3FAT A;  1N84 A;  2XX8 A;  4YB5 A;  4POW A;  5H8Q B;  3H4Z A;  1IXG A;  3DEL B;  1QKA A;  1S50 A;  1ZTY A;  2PMS A;  1NNF A;  1Y3P A;  3EHT A;  3KBR A;  2O1L A;  1B58 A;  3IK6 B;  4H5G A;  3CSB A;  4F29 A;  1Q35 A;  3AXF A;  2O6A A;  1N7X A;  3F11 A;  4ELQ A;  1EZO A;  3Q29 A;  1N3W A;  4H65 A;  1LB8 A;  4LQ2 A;  3MP8 A;  3SEV A;  3FXR A;  3HN0 A;  4TLL B;  4AQ4 A;  4H0W A;  1PBP A;  1B51 A;  4OZ9 A;  3FV2 A;  3RN8 A;  4LZ8 A;  1UTB B;  3TFL A;  3GBB A;  4G8H A;  4ECF A;  3SER A;  3K1N A;  5FHM A;  2YLN A;  3IJO B;  1LFI A;  1MXV A;  1DTZ A;  2DXR A;  3CRB A;  1P1O A;  2X7Q A;  1F9B A;  3BKI B;  5H8S A;  3FVO A;  4LZ7 A;  4WXJ A;  3TCG A;  1BIY A;  4EQ9 A;  2V3Q A;  5DEX A;  4DZ1 A;  3LR1 A;  4PP0 A;  3S9N C;  2HAV A;  3FGS A;  1B4H A;  5JTY B;  3MP6 A;  3CI8 A;  4IGT A;  4LAT A;  1CB6 A;  3TQL A;  5AA2 D;  4F3P A;  5L8D A;  1SW5 A;  4ZDM A;  3B6Q A;  3UA8 A;  3ILU B;  3WAF A;  2DXY A;  4DXB A;  1N7W A;  1FTO A;  2XHD A;  2KLF A;  3TTK A;  1GR2 A;  3RNN A;  5H8F A;  4XKQ A;  4ZEK A;  3FZV A;  4X1B A;  1NMU A;  3HO7 A;  2Y7R A;  2AYS A;  3UP9 A;  4NF5 A;  5TP9 B;  4RK9 A;  4GXA A;  1A55 A;  1ZIU A;  5TPA B;  4IGR A;  2CZL A;  1ZMG A;  1NKX A;  3RPW A;  5AA2 B;  4QFP A;  1IXH A;  3KFM A;  4EXL A;  3E13 X;  5ITO A;  1B1X A;  1QUK A;  3E3K A;  4OQO A;  1Y1M A;  2D3I A;  3PGF A;  4NED A;  1Q1K A;  3K1P A;  2E0S A;  1WOD A;  3GZG A;  4PFT A;  4BDR A;  3OO7 A;  1M5B A;  4YKJ A;  2DVZ A;  2OK2 A;  1I6A A;  4F2O A;  3CFX A;  3N94 A;  2A5T B;  2NOO A;  3VXC A;  2FA7 A;  1B40 A;  2Q8J A;  1B7Z A;  5DTB A;  3KGC A;  1RKM A;  3TTN A;  3PU5 A;  4OFO A;  2OCU A;  3CG1 A;  3RY3 A;  1SI1 A;  4NF8 B;  3C4M A;  1B6H A;  4XKR A;  1D3K A;  4KCC A;  4HCW A;  2FYI A;  3W15 C;  3O97 A;  3MJN A;  2WKY A;  4JB7 A;  2O51 A;  1SYI A;  4XXU A;  3CR9 A;  2PBW A;  4BDL A;  1A54 A;  5H8N B;  3S9E A;  1H3D A;  2XX7 A;  2DE3 A;  3FXU A;  3WAE A;  1GVC A;  2XXY A;  1MY4 A;  1ZJL A;  3IOT A;  4MLV A;  1BTJ A;  1VE4 A;  1FQD A;  4KCD A;  3UIF A;  3TDJ A;  2O7U A;  3O6I A;  2O1M A;  4IB2 A;  3C33 A;  2XXT A;  2F35 A;  4H67 A;  2H99 A;  1O64 A;  1B4Z A;  3MP1 A;  2O7I A;  5KDT A;  3RTF B;  4YKP A;  1I69 A;  4Z7E A;  3TZA A;  1LBC A;  4R73 A;  3KN3 A;  4ZZA A;  1I6B A;  3LSX A;  3MVY A;  2IEE A;  3K4U A;  3G3H A;  2X26 A;  3G7W A;  4PFY A;  2DOJ A;  1QVS A;  3SEW A;  3EHS A;  4ZS9 A;  1FTJ A;  1SW1 A;  3MAM A;  5I59 B;  5I2N B;  4KYS A;  4G77 A;  3CVG A;  1OQG A;  5H8H A;  1URD A;  1N04 A;  4UAC A;  5DVJ A;  3LSL A;  4G8N A;  3U1O A;  2D21 A;  4YAH X;  1SQY A;  2Y7K A;  2NVU B;  4QFO A;  1NNK A;  3OO6 A;  1P1U A;  2DWH A;  3PV0 E;  1NFT A;  4NF6 A;  3TMG A;  4THI A;  2YJP A;  1DPP A;  3OEM A;  4JWX A;  5I56 A;  2NUV A;  3QSL A;  3EHU A;  3QIM A;  2QJE A;  3Q27 A;  4GXS B;  5CMC A;  4LP2 B;  1II5 A;  3GXA A;  4NMY A;  2RKM A;  4YB7 A;  1XVX A;  2RC9 A;  3TAJ A;  4DDD A;  1TFA A;  2QMW A;  1FQB A;  1B3L A;  1PC3 A;  3VE1 B;  1IXI A;  4RNS A;  2PVU A;  4OER A;  1SD3 A;  3G3G A;  5FTH A;  2BJJ X;  4KPT A;  5DVF A;  4ESW A;  3C9H A;  3H3G A;  3LSW A;  4PE5 B;  3PPQ A;  2I0C A;  2F36 A;  4U1Z A;  2HFB A;  2DP8 A;  5CMK A;  4LA9 A;  4BDN A;  5AA4 A;  5B7D A;  2W7Y A;  1SI0 A;  2Z8F A;  4X1D A;  4FEB A;  1AOV A;  1BP5 A;  3O2A A;  3UGW A;  5A5X A;  1B9J A;  1DSN A;  3SDF A;  1R9L A;  3IAZ A;  2G93 A;  3VVD A;  3OSR A;  4O3A A;  1MS7 A;  3OEN A;  3RT8 A;  3EN3 A;  2Q89 A;  2ABH A;  4QSC A;  3PUZ E;  1TFD A;  5K2X A;  5IKB A;  1B0L A;  4F1U A;  1US5 A;  4GFR A;  1MG1 A;  3N6T A;  2F97 A;  2I58 A;  1GGG A;  1M5F A;  2XXH A;  4E0W A;  4L17 A;  3G3J A;  3KSX A;  3QAX A;  4ONY A;  1NNT A;  2DWI A;  2DS9 A;  3KG2 A;  3H03 A;  4HS7 A;  3JV9 A;  2ZNU A;  4FAT A;  1KWH A;  4QRZ A;  1M5E A;  1JEU A;  4R6H A;  4POX A;  1YTV A;  2PX1 A;  1B7H A;  2XXU A;  4N13 A;  1IUD A;  3QUF A;  1LAF E;  3O29 A;  3E9X A;  3IOR A;  2RC8 A;  5CM6 A;  5AA3 A;  4U4S A;  2NXO A;  1S9T A;  4O3B A;  1YAE A;  1PB9 A;  2ZYM A;  3H6W A;  2Q2A A;  1JQF A;  4H8J A;  4JXI A;  2ONR A;  1MPD A;  5EHM A;  1MXW A;  1XC1 A;  4ZE8 A;  2ZNS A;  3T22 A;  2M8C A;  4EQ7 A;  3UK4 A;  2DSF A;  3FVG A;  4EQB A;  1TT1 A;  2PYY A;  1FQF A;  4P0G A;  4X48 A;  2I4C A;  3E4R A;  1EH3 A;  3TEP A;  4MLQ A;  4YKK A;  3LBS A;  3H6T A;  1MM7 A;  3B6T A;  2VD2 A;  3BFT A;  3V8X B;  4ND9 A;  4JWO A;  4RY1 A;  1JVY A;  4EDP A;  2GRV A;  4OET A;  3FJM A;  4P11 A;  1T0K A;  4ESX A;  1M5D A;  4OYV A;  4ISU A;  3ODB A;  5BUU A;  3MVZ A;  3N6U A;  4GRK A;  5HM4 B;  5CBS A;  3T66 A;  2X7P A;  1ELJ A;  4QSE A;  2O69 A;  5ITP A;  4IO3 A;  3DP4 A;  2Z8D A;  1DTG A;  4XTC Q;  2ONS A;  5KCJ B;  3FJG A;  2ESN A;  1FTL A;  2QL3 A;  2XD3 A;  2Z22 A;  2XX9 A;  5I57 A;  1H44 A;  2F5X A;  3TUS A;  3H06 B;  3OMB A;  1B3F A;  3LSF B;  4JSO A;  1FTK A;  1VSO A;  1Y4T A;  3ECR A;  4JWY A;  1DPE A;  3V5A A;  3IB1 A;  3ZKK A;  5FHN A;  1Y9U A;  2R71 A;  4NF4 A;  4H5F A;  5I2K A;  3O6H A;  2Q2C A;  5I58 A;  4F3G A;  2F7A A;  4FIM A;  1Z7N E;  3FIR A;  4FE8 A;  4BDM A;  2ZNT A;  3JZJ A;  1FQC A;  1NL5 A;  4U22 A;  3C35 A;  3O9P A;  4C0R A;  1DOT A;  2I4B A;  1JVX A;  1VR5 A;  4G68 A;  2H25 A;  4ELR A;  4QSD A;  4OES A;  3U93 A;  3U8Q A;  4F31 B;  2E1S A;  2Y84 A;  2VP1 A;  3U92 A;  2ZYO A;  3KJ7 A;  4EF2 A;  3KEI A;  4IO4 A;  5IAI A;  4JDF A;  3JYR A;  5EHS A;  2XXX A;  1N3X A;  5DEX B;  1P1Q A;  3H7M A;  1Y4C A;  1D9V A;  1URG A;  2D5W A;  1EZP A;  1XVY A;  3QK6 A;  4OHN A;  1O7T A;  3M3L A;  2XXP A;  2RCB A;  1LFH A;  1D9Y A;  1PEB A;  1OIB A;  1HSJ A;  4M4G A;  4BDQ A;  1B5J A;  2GH9 A;  5BWJ A;  3FUZ A;  2RCA A;  5DVI A;  4R2F A;  2F34 A;  2UVI A;  1RYO A;  4OWD A;  5H8F B;  3H6U A;  3VVE A;  4IO7 A;  3QYT A;  2I49 A;  4G2Z A;  3N26 A;  4BDO A;  3M8U A;  4NF5 B;  3RTW B;  3IOW A;  1BKA A;  4NF4 B;  3PUW E;  2OLB A;  2Q9T A;  2H9B A;  3IB0 A;  1MDQ A;  1MQI A;  1B46 A;  4N6P A;  2REJ A;  3SEY A;  2HEU A;  1MQJ A;  4I9D A;  4LQ5 A;  1OVB A;  5CMB A;  4F1Y A;  3PPN A;  2H98 A;  5ISU A;  3PD9 A;  1Z7M E;  5JEI A;  3GBA A;  3SEX A;  4G68 B;  1ZU0 A;  3PMX A;  4OFL A;  2DQV A;  3HST A;  4OXV A;  3Q28 A;  3K6V A;  2REG A;  4DXC A;  1UTH A;  1B5H A;  1MXZ A;  4YIC A;  2H4I A;  3MZ1 A;  3FXQ A;  2I3V A;  3CFZ A;  2DWA A;  3RT6 B;  4ZEF A;  4KHZ E;  1AH5 A;  4F22 A;  5ICQ A;  3IX1 A;  2ZYK A;  4OEV A;  1JW1 A;  1OLC A;  4MFI A;  3OSQ A;  3G3I A;  1I6Q A;  1MY0 A;  5F1Q A;  3OO9 A;  4U23 A;  2F8D A;  2ZXT A;  5J1D A;  4LUB A;  2QS1 A;  3T93 B;  1ZLQ A;  1ATG A;  4HW8 A;  1UIU A;  3PUV E;  1Y3Q A;  3OD7 A;  3I5O A;  3K02 A;  1OMP A;  3PPR A;  1J1N A;  3K6X A;  3TTR A;  2UVG A;  4DCY A;  4G8M A;  3EQ1 A;  4DE8 A;  1FW0 A;  4DIG A;  5FHO A;  3K6W A;  1HSE A;  1GV8 A;  2P0S A;  4X9T A;  2OJT A;  1BLF A;  1SDX A;  2PT2 A;  2XD2 A;  3O28 A;  3KOT A;  1O63 A;  4ZED A;  5KDT B;  4OEU A;  5B70 A;  5H8Q A;  3SEU A;  1Y3N A;  4F39 A;  3RQT A;  1A40 A;  1MY1 A;  1ZKB A;  3VLW A;  2R6G E;  3PMW A;  4YKI A;  5ELV A;  4R75 A;  5EYF A;  5DT6 A;  3S4U A;  1QW0 A;  1GTK A;  1QUJ A;  3FV1 A;  4NTL A;  3IR1 A;  2UYF A;  3O6G A;  3K0V A;  3CSG A;  1LST A;  3TPA A;  5H8H B;  5L9O A;  4Q5T A;  1PB8 A;  3R6U A;  3L6G A;  3VXB A;  3LC8 A;  4F1V A;  3QXM A;  4FJP A;  4BLA A;  3PUY E;  2GFE A;  3C31 A;  4O3C A;  2AL5 A;  5KZT A;  3MUQ A;  1LFG A;  3HHG A;  4N07 A;  3SKP A;  2HZL A;  2ONK E;  4NF6 B;  5AE4 A;  3TCH A;  2XXV A;  4KQP A;  3IB2 A;  4KFQ A;  2NWJ A;  5I56 B;  5CI5 A;  4LZ5 A;  1PDA A;  4R9F A;  1MXU A;  3VV5 A;  1B52 A;  4RK2 A;  2HCA A;  4OFJ A;  1VFE A;  2ZYN A;  2RIN A;  3LUY A;  1B7U A;  4GL0 A;  2OWT A;  2I48 A;  3T9V A;  4EUO A;  3MWB A;  1IIW A;  4NWC A;  2OBG A;  1WDN A;  3OOA A;  1PBQ A;  4ZEB A;  5JTY A;  3R7X A;  3KSJ A;  2O68 A;  1LBB A;  4H6D A;  4DCX A;  2DWJ A;  4C1U A;  2HAU A;  1AL3 A;  2QRY A;  1IEJ A;  1MQH A;  5FTI A;  1P1N A;  2PT1 A;  5CBR A;  3EPE A;  1S7Y A;  2ANJ A;  2F6P A;  3K1M A;  3HHF A;  1UIV A;  1N0T A;  1USY H;  2Y7I A;  1A99 A;  3V83 A;  4E0X A;  4Q8R A;  4YU0 A;  5AA4 B;  3RUM A;  3IL1 B;  4EXK A;  4OEN A;  4C1T A;  5A5X B;  3C34 A;  2QSX A;  3KOS A;  5TP9 A;  3IOV A;  3DP6 A;  5TPA A;  3D4C A;  2Q88 A;  2YPN A;  2Z8E A;  3QUJ A;  4I8C A;  3VDF A;  5AA2 A;  2IA4 A;  1FQE A;  4TLM B;  4PFU A;  3MQ9 A;  3V89 B;  3C32 A;  1OQH A;  1JW4 A;  3MVX A;  4WEP A;  2V3T A;  2XXR A;  1MPB A;  3DM0 A;  3M3K A;  3T96 B;  2UVH A;  2F78 A;  2HXW A;  2G29 A;  4H8I A;  4ELO A;  2AL4 A;  5CRY A;  1H76 A;  2Z23 A;  2RF1 A;  4F2Q A;  1LLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...