3GYYA

The ectoine binding protein of the teaabc trap transporter teaa in the apo-state
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
308
structure length
303
Chain Sequence
DNWRYAHEEYEGDVQDVFAQAFKGYVEDNSDHTVQVYRFGELGIMEQTQNGILQFVNQSPGFTGSLIPSAQIFFIPYLMPTDMDTVLEFFDESKAINEMFPKLYAEHGLELLKMYPEGEMVVTADEPITSPEDFNKKIRTMTNPLLAETYKAFGATPTPLPWGEVYGGLQTGIIDGQENPIFWIESGGLYEVSPNLTFTSHGWFTTAMMANQDFYEGLSEEDQQLVQDAADAAYDHTIEHIKGLSEESLEKIKAASDEVTVTRLNDEQIQAFKERAPQVEEKFIEMTGEQGQELLDQFKADLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Periplasmic substrate binding protein
publication title Evidence for an allosteric mechanism of substrate release from membrane-transporter accessory binding proteins
pubmed doi rcsb
source organism Halomonas elongata
total genus 104
structure length 303
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3gyyA00
3FXBA 4PAKA 5IZZA 4PDHA 5LTCA 2WYKA 4MNCA 4LN5A 4N6DA 5CM6A 4OA4A 2WYPA 4MCOA 4N4UA 4OVSA 2HZLA 4XEQA 4NQ8A 4OVPA 5IGAA 2HPGA 4MHFA 4N15A 2XWKA 4P47A 4PAFA 2VPNA 2V4CA 4MNIA 4NAPA 4PF8A 4MX6A 4NX1A 4PFBA 4PGPA 4PFRA 4P1EA 2WX9A 4MAGA 4P56A 4OVQA 2CEXA 4NF0A 2XA5A 4DI4B 4N17A 2XWIA 4MMPA 5I7IA 4MNPA 2VPOA 2HZKA 4NHBA 4PFIA 4P1LA 2XWVA 4OANA 4OVRA 4N8YA 4PBQA 4P3LA 2XWOA 4O8MA 4N8GA 5IM2A 4YICA 4MIJA 3U65A 2XXKA 4MEVA 4PGNA 4NN3A 2ZZXA 4PC9A 4PE3A 4P9KA 2PFZA 4X8RA 4O94A 5I5PA 4PDDA 2ZZVA 4P8BA 4NG7A 4N91A 4PAIA 4N6KA 4UABA 4PBHA 4XFEA 4X04A 4PCDA 4PETA 4DI3D 4PF6A 4YZZA 4OVTA 4XF5A 2CEYA 2PFYA 4NGUA 3B50A 2ZZWA 4O7MA 3GYYA
chains in the Genus database with same CATH superfamily
2WYKA 2VD3A 1POTA 2HXRA 4RNSA 2ALUA 4DIGA 3KSXA 5EYGA 4MH5A 5KDTA 4IO7A 2FHYA 2XXUA 3KJTA 3T96B 4DCXA 1J1NA 1URSA 1GVCA 3PPRA 3S2VA 1QVSA 3RTFB 4MX6A 4KCDA 3FV2A 3LBSA 4P1EA 1IZ1A 3EHTA 4G68C 1WODA 4EQBA 3Q29A 1TXFA 4F22A 2WKYA 2QVUA 3A09A 1FBCA 3FV1A 2F3DA 4MNPA 1FPKA 2PT1A 1UTHA 1FQDA 2MKZA 1O7TA 4EF1A 2I0BA 3TTLA 2DWHA 1AL3A 4NTLA 3CFXA 1I6BA 4PFYA 1UTBB 2XHDA 5AA2A 3QUJA 1N7XA 5BUUA 4DXCA 4F31B 1FTMA 3W9VA 2F78A 3LUZA 3RTWB 5IKBA 1Q1KA 1MS7A 3RNNA 2UYEA 3TEPA 3B6TA 4ZS9A 4NEDA 2QVVA 4NF8B 3U1OA 5L9SA 3MAMA 5LTCA 1N84A 1D9YA 4OESA 3MSTA 4JWOA 4LZ8A 1IQ7A 4N4UA 2HCAA 5L9OA 3ILUB 3HO7A 4GVOA 2XD3A 3S9MC 5I56A 3FJMA 1MXVA 3KOSA 4FAJA 2V3UA 4PGPA 5KCJB 1DTGA 2H25A 1GGGA 3IAZA 3TAJA 5I2KA 1NUXA 3HHGA 4BDOA 1B7HA 1N04A 2HZKA 2Z22A 1XOCA 1R1NA 1LBZA 1B1XA 4FEDA 1LFGA 3H6UA 5EQAA 3TDJA 3MW0A 4PFWA 4X8RA 1LBXA 2DDKA 4H46A 3PUWE 3FASA 4WEPA 2HAVA 3O6IA 4JVDA 3S9NC 2Z23A 4PETA 2O51A 1P99A 3VVEA 5I58B 2BJIA 3U93A 3S9EA 2YLNA 4IB2A 3FXBA 3O2AA 5AA2B 3SKPA 1JVXA 4MNCA 2QVRA 1A7LA 4N6DA 4BDNA 2X7PA 5AA2D 1B4ZA 2DE3A 3TTMA 4JBZA 4NQ8A 1JNFA 2O7UA 3ECRA 3O28A 3UN6A 1B46A 3CIJA 3C4MA 1MDP1 3FIRA 4LZ7A 2Y7IA 3V5AA 1NNKA 3E79A 3SDFA 3H6VA 3C36A 4PFBA 4MAGA 3G3FA 2P0SA 3S9LC 1I6QA 3MVZA 4FECA 2B4LA 4TLLB 5H8QB 4U1ZA 2F7CA 3PUYE 3W15C 4N17A 5LOMA 4BDLA 2CZLA 2PVUA 1OLCA 1MXWA 3TCFA 3A3CA 4OANA 4G68A 3FJ7A 1O63A 2O69A 1IMCA 3FVOA 3OEMA 3OO8A 5I2KB 1LBCA 1NUZA 4IR8A 4F1YA 4R6KA 4POXA 5DVIA 1Z7ME 4FJPA 5ET5A 4GOTA 4PAIA 4N6KA 1FBGA 1CNQA 4RYAA 3K4UA 1LAHE 3OO9A 3MJNA 4YZZA 3PUZE 5J16A 4FBPA 4EF2A 3LSFB 2XXXA 3RLFE 5TP9B 2OZZA 1ZJLA 4K3FA 4F3SA 1USYE 1US5A 4HTGA 3PMVA 3PMXA 3UP9A 1Y4TA 1N3WA 1MPCA 1RYXA 5IZ1A 5CI5A 2REJA 4O3AA 1URGA 1IMAA 2P2AA 1NV7A 1RDZA 2V93A 4X9TA 4PAFA 2P1SA 4P0IA 1NI9A 1MM6A 2IA4A 4JVCA 4YU0A 3MWBA 5DTBA 4YKKA 4G77A 2O6AA 4GD5A 2UVHA 4DCYA 2OJTA 4QF9A 4H45A 2QMXA 3Q28A 1QUJA 4NMYA 5FHMA 2XXQA 3LSXA 3VDFA 1ZLQA 3TPAA 4HE1A 4LQ5A 4U4XA 4C1TA 2DE4A 5LDZA 4H8JA 5T3JA 2OBGA 2DS9A 4P3LA 5EHSA 1JEVA 2I6EA 2Z8FA 4ZZEA 4GX6A 1I6AA 4QSEA 3U65A 2VOZA 3N94A 2CZHA 4HCYA 4QFKA 1FJ6A 3C32A 2F36A 4OEUA 3G3KA 4KFQA 1QULA 1VR5A 4C1UA 1D9VA 2FA7A 1OVTA 1DCUA 2RCBA 3IJOB 2Y7WA 3UORA 4JWXA 3U94A 3GYYA 5ESYA 3UK4A 3IB1A 3JV9A 1MXUA 4OFLA 3N6UA 4E0XA 1EYIA 5H8NA 2QFLA 1SYIA 4MCOA 3OMBA 2VGQA 1NL5A 5L8DA 1PEBA 3IL1B 2OLBA 4L17A 1SDXA 2E0SA 4F19A 1XI6A 3FVGA 3FVNA 3B8BA 1OLAA 3K6VA 1SW1A 4YB7A 4ZEDA 1QUIA 1IXCA 1HSLA 3W9WA 1FQAA 2A5TA 3MP8A 3GBBA 4U4SA 4R9GA 5IZ3A 1LFHA 3H6TA 1MH4A 4GWSA 4F39A 4IY5A 3SESA 3QIMA 2PT2A 1JQFA 4NF6B 2XWVA 4PBQA 3RY3A 1B5IA 3PD8A 2HQ0A 4N81A 5ITOA 1CB6A 5H8SA 4IGTA 1FBPA 1A54A 1NNFA 4PE3A 1Y3PA 2UYFA 1XC1A 2QS3A 2XX7A 1MY3A 2I49A 5FHOA 3DLNA 1YPNA 1NV6A 2UVIA 3FZVA 4P8BA 3TCHA 1B9JA 3BFTA 4ELOA 4OXVA 4ONYA 3GXAA 3KZGA 4ELRA 2D5WA 4G8NA 3MVYA 4UA8A 1B1HA 4OYVA 3FXRA 3AXFA 2AIXA 4TOZA 4H0WA 3ROJA 4PE5B 2E1SA 2JJKA 3PPPA 1FPBA 4ZDMA 3BFUA 5CM6A 1MG1A 5A5LA 1JEUA 4H5GA 2OK2A 1A8EA 4OVSA 4QXDA 4IGRA 4EQ9A 1POY1 2DXYA 4ZZAA 3MQ9A 2RINA 2VD2A 1TT1A 4MHFA 3RPLB 2Z8DA 1Q35A 2QSXA 3MZ1A 4GX3A 3FXQA 1BTJA 3V83A 1PB9A 1A99A 5CC2A 3OSQA 4Q8RA 3VV5A 5TPAB 2V3TA 5H8NB 1T0KA 4NX1A 3PU5A 3C9HA 2XXYA 5H8HA 2QPQA 5AA1A 3N6TA 4PFTA 3KN8A 1MPDA 2GHAA 2FIEA 4GBWA 2QS2A 4TQUQ 4EXKA 1DPEA 5A5XB 1FQCA 3G7WA 2DYXA 1MQIA 3FGSA 4O7IA 2VPOA 3HHFA 4JB7A 1DMBA 4YKIA 2OWTA 2DWAA 2ANJA 4XIGQ 1GV8A 1FTKA 3MYUA 1M5CA 2F3BA 3THIA 4O94A 5CMCA 1IMEA 3KBRA 3N5LA 5M2VA 3DP6A 4N91A 4YMAA 3A3UA 1H3DA 5FTIA 2QMWA 4PBHA 4R9FA 5AA3A 4BDRA 5JK4A 1OMPA 1YYZA 2CZIA 3K6WA 4ELPA 3O9PA 3MVXA 2ESNA 4NGUA 2Z8EA 4PAKA 2DWJA 3MBPA 4ELQA 3T9HB 2ONRA 4BLAA 3R26A 4JWYA 1JP4A 5AA4B 4OA4A 3N26A 2UVJA 4GWUA 4F3BA 1MPBA 1P1OA 5DEXA 4O3BA 4ZEFA 3VXBA 3MUQA 3RT6B 1OQHA 1FBFA 2B3FA 4OVPA 1GTKA 4XKQA 3EQ1A 2ZXTA 1KA0A 2Q8JA 5AE4A 1SQYA 2P3VA 4H5FA 1IXGA 3HCQA 4H8IA 3KN3A 1FQEA 3OO6A 4R2FA 4GFRA 3MP1A 1Y20A 3QK6A 2RF1A 4JVIA 4GBVA 3PUVE 3KGCA 3IFAA 1SI0A 4JSOA 4GX4A 4LONB 2DSFA 3KN7A 4QRZA 5DYHA 4KYDA 1P1NA 1OVBA 4WKMA 5KDTB 4PFUA 1NNTA 4N13A 3D1RA 2XWOA 4ZEIA 4Q30B 4G61A 2A5SA 3I5OA 3I6VA 1AMFA 4DLDA 3PV0E 2RC9A 3H03A 4EXLA 3VLUA 4XFEA 5I2NA 5CBRA 2DWIA 3IORA 1YXIA 2AL4A 4F2OA 3LUYA 3IJXB 4OVTA 5J1DA 2I0CA 3U72A 3O97A 4ND9A 3RUMA 1URDA 4BDMA 2D21A 1R9QA 1MQHA 1UTHB 1FPEA 1PDAA 3DP4A 1P1UA 2HZLA 4OFJA 1LAXA 3T22A 3CFLA 4HXVA 5B7DA 5ITPA 3IFCA 3SZPA 1VSOA 1BP5A 1ELJA 1FRPA 1SD3A 1ZBMA 1NV0A 4OWDA 1FPJA 3G3JA 4JXIA 3T93B 3LR1A 1EYJA 1SPIA 4X48A 4GF8A 1JETA 4ZE8A 1TWYA 4F1UA 4U23A 4N07A 1B5JA 3K1PA 4F2QA 4MMPA 1B3EA 2OX3A 1B05A 4YAHX 5I7IA 1IIWA 5B70A 3USDA 4N8YA 1FCKA 3CHGA 1NKXA 4OTEA 2I48A 4PC9A 3SEYA 5I56B 4P9KA 1ZTYA 2H9BA 3G3IA 3ZKKA 4PDDA 1H44A 5FTHA 2CZKA 2Q9TA 1FJ9A 1MM7A 2ZNUA 4LZ5A 1BKAA 3EHSA 3VFJA 4U2RA 2Y7KA 3IB0A 4XXUA 4FATA 4PF6A 3H6WA 3TODA 1KZ8A 2CEYA 3B50A 1FQBA 4O7MA 1M5FA 2QS4A 3QUFA 4JSDA 1AH5A 2NWJA 5I2NB 1SVXB 3JZJA 3IB2A 4GWXA 3E9XA 4F1VA 1HSEA 5CMBA 1NH8A 3FUZA 4NF5A 1FTJA 4Z0IA 1B3GA 1Y3QA 2NOOA 1Q9DA 3FVKA 4EQ7A 1FBDA 3IOWA 3LSWA 1LBVA 3TTKA 4P47A 1RKMA 3MVWA 2G93A 4AS5A 4UACA 5IAIA 4I9DA 5F1QA 3E78A 1FPFA 3BIGA 4OVQA 1S9TA 1B3LA 1KWHA 3E3KA 5EYHA 2I4CA 4R6YA 1XVXA 3VVDA 3G3HA 3HV1A 5EQ9A 1NMUA 2DOJA 2ZNTA 2PMSA 3T0JA 4YMBA 4Q0CA 2XX9A 1Y1ZA 3KFMA 4KD5A 2DE2A 4I40A 5ET8A 2D3IA 2ZNSA 3B7DA 3TQWA 3IO6A 2OCUA 1D9QA 5EQ8A 2BJJX 1FTAA 2NVUB 4F3GA 2GRVA 2ZYOA 2ZZXA 1S7YA 3LC8A 4Z7EA 1RYOA 2OWZA 1N3XA 4AS4A 5H8FA 2B4MA 4OETA 4LQ2A 1B5HA 2V84A 4OZ9A 5ICQA 2DVZA 1JVYA 1MRPA 2XXIA 2Y7RA 3M3KA 2DQVA 3SERA 4RA1A 1DK4A 4XF5A 2PFYA 3ONMA 4GWOA 1FSAA 2ZYKA 1B0HA 3SEVA 2Q74A 4KI0E 1DBZA 1FPLA 5DW8A 4G68B 1MQDA 4MLVA 1SW4A 3Q26A 1QKBA 1H76A 1R6ZA 4AB5A 2LAOA 3UIFA 2ONKE 2V25A 5BWJA 1ANFA 5HPQA 1H45A 2HFBA 1Y4CA 2Y5LA 1A40A 1XT8A 4EDPA 4QFNA 2WX9A 4WXJA 3H06B 5I59A 3LV0A 3FD3A 3OXNA 4NF4A 4G8MA 3RGYA 1JW4A 3RT8A 5ET7A 1AWBA 2M8CA 1PBQA 1B40A 3VXCA 3TFLA 2I4BA 4XTCQ 2HHMA 3TMGA 1LBWA 4AQ4A 2H5YA 1LGBC 2FNCA 1PC3A 3CRBA 4GRKA 2WBBA 4QFOA 1KA1A 1LSTA 2PCRA 3O66A 1G0IA 3C34A 1B52A 3EPEA 5F24A 1LLSA 3RYDA 3RN8A 3GZGA 1Z7NE 1NV2A 4DDDA 4I3EA 1M5DA 1NNPA 5L9MA 1DSNA 4R75A 4IO5A 2KR0A 3TELA 3BBRA 3E13X 1DPPA 1A55A 1QGXA 3RPWA 4FE8A 5DVFA 2QJEA 3FATA 4OVJA 4GIZA 3PMWA 3PGFA 4HE2A 5CMMA 4YB5A 1QJMA 3QMFA 4KPTA 3TTRA 5I84A 3QSLA 3OD7A 2GFEA 1LEVA 1LCTA 4XEQA 4WEDA 2O7IA 3K6XA 2PBWA 3ODBA 1NH7A 4KCCA 4O3CA 3IOTA 4ZEBA 5F7VA 3QAXA 4ESWA 2V4CA 1UTBA 3H7MA 3OENA 4MF3A 5FBPA 4G4PA 3IR1A 2QRYA 1B58A 4JDFA 2O1LA 1IMDA 3MZ9A 3U8QA 3CSGA 2F6GA 1P1QA 3TKDA 2NXOA 2ZYMA 3OOAA 2XXPA 2QL3A 4GWZA 1EZOA 3WAEA 4FEBA 5I59B 1FBHA 4OFOA 5ISUA 4PP0A 3TZAA 3WAFA 5IM2A 4QBAA 1IUDA 1SBPA 4KYEA 3LSLA 1SYHA 4GLIA 4KR5A 4RK9A 1XS5A 1FTOA 5CBSA 4NG7A 3DP8A 4HCWA 2THIA 2HXWA 5KCJA 1B51A 4LVQA 4LATA 3I3VA 2A5TB 3OEKA 1VE4A 3JYRA 5IZ3B 3T1BA 4IO2A 3SEUA 1BIYA 4RPNA 5IZZA 3GLBA 1N0TA 2H98A 3K6UA 3TYHA 4C0RA 3D4CA 1IEJA 4DE8A 1AOVA 1H43A 4LUBA 4R73A 5IGAA 3VLWA 2O68A 4DXBA 4H67A 2ABHA 1B0LA 5EYFA 1UIVA 3KC0A 1JW5A 3CG1A 3SEXA 4MNIA 3TUSA 4PF8A 4IO4A 4RPOA 1US4A 3KOTA 4XKNA 4AB6A 4X1BA 3A29A 2VT5A 1INPA 4PTKA 2FVZA 4R72A 4IY6A 3IOUA 3M8UA 5I58A 3ZKLA 4MJOA 2B3BA 1LFIA 1FPIA 2I3VA 1B3HA 4E0WA 5K2XA 2XD2A 2ZYNA 3G3GA 3T66A 4ZE9A 4ISUA 3VVFA 4F3PA 1N76A 3T9VA 1B3FA 1EH3A 3EKIA 4ECFA 2R6GE 2QS1A 1XHYA 1LB9A 1DOTA 1D4NA 2XXKA 4MEVA 4I8CA 5HM4B 3K00A 1TFAA 2PFZA 1QKAA 4BDQA 1LBBA 2I58A 3RQTA 3PUXE 4GL0A 3B6WA 3U92A 2Q8MA 2GQ1A 3FXUA 4UABA 1BLFA 2DXRA 5H8HB 2XX8A 1USYH 1YCJA 4OERA 4P11A 4KYSA 1YZ0A 3K01A 4QFLA 4IO3A 2R9JA 2AYSA 5H8QA 1ZMGA 1MY2A 4EUOA 3ZSFA 1IXHA 2YPNA 4MFIA 1EYKA 4F18A 2WEFA 4NWDA 1MXZA 2XXHA 2PYYA 2I3WA 2IEEA 3L6GA 1UQWA 4KQPA 2HPGA 3CI8A 3PTYA 1VFEA 2XWKA 5CMKA 1LAFE 4I3YA 2CMOA 1O64A 3C31A 1FTLA 4ESXA 3Q27A 3T9UA 2G29A 1TFDA 1LBYA 4H6DA 1I69A 1S50A 2PX1A 3PD9A 2HEUA 1SI1A 3KJ7A 1MDQA 1MY4A 2GH9A 3OSRA 1F9BA 2B65A 1PB8A 4YB6A 4DXUA 2H99A 2F35A 5TP9A 2Q89A 2XWIA 4MBPA 5EHMA 3SEWA 3EF7A 2KQZA 5HBCA 1ZU0A 2GHBA 3IX1A 3BKIB 5DEXB 3M3LA 3MC2A 1ATGA 1MY0A 1FQFA 1XVYA 1GR2A 1ZKBA 4PGNA 3QXMA 4OQOA 4RJZA 2X7QA 4QHQA 3K2DA 2W7YA 3KC1A 3R6UA 4XKPA 1NV4A 2XXWA 2FYIA 2XXRA 4GL8A 1MQJA 4R74A 2NUVA 3HFUA 3TQLA 2Q88A 2R8TA 1QUKA 1Y3NA 4ZEKA 4PDHA 3CFZA 1VDWA 3PPNA 1N7WA 4QFPA 3K02A 3DELB 1B7ZA 4MLQA 3H3GA 3V8XB 3VLVA 1WDNA 2F8DA 3IOVA 1B4HA 4U21A 3O29A 2VPNA 1FPGA 4M1VA 4F29A 3S4UA 3C35A 4HS7A 5I57A 1PB7A 1Y1MA 3PPQA 4R6HA 4P0GA 4Q5TA 3CR9A 3VE1B 3IO4A 4NF0A 4RY1A 4DI4B 3O6HA 2O84X 3TCGA 4PQJA 4IO6A 4KHZE 4N6PA 4YKPA 2KLFA 4R2BA 2O1MA 4G8HA 4N8GA 5DVJA 4YKJA 2Q2AA 4RXLA 4NN3A 2Y84A 2FIXA 4I62A 1LB8A 3L6HA 4H1XA 5I5PA 2L5VA 5KZTA 2ZZVA 3UGWA 2F34A 5JEIA 1IMFA 2RC8A 4X04A 4PCDA 3R7XA 4QSCA 1R9LA 1VFDA 3MPKA 3ISPA 5ELVA 2F6PA 4GXSB 1M5EA 2ZMBA 2F7BA 4H65A 2YJPA 2WYPA 2OWSA 3KEIA 4POWA 4NF6A 3EHUA 3OELA 2VP1A 3FBPA 1K9YA 5K2YA 2FBPA 1FBEA 4QSDA 5EQ7A 3HPIA 2XXTA 3UA8A 1A8FA 1RDXA 4FIMA 1B6HA 1IMBA 1MXXA 3K1MA 4PFRA 4OMBA 4P56A 1CE2A 5I3SA 3ILTB 4X1DA 1Y9UA 1ZIUA 3F11A 2ONSA 1B2HA 5FHNA 1QW0A 5ICTA 5JTYA 2HAUA 3T9XB 5I57B 1II5A 5DT6A 2P3NA 4U1OA 3KBZA 1FW0A 2X26A 1L5TA 1MQGA 4NF5B 4NE4A 2V3QA 4O8MA 4LA9A 1LCFA 4RK2A 1FPDA 1P1WA 3RPLA 3H4ZA 3C33A 1MH3A 4LP2B 1OIBA 2UXAA 5TU0A 3PPOA 1SW2A 1D3KA 3ZS6A 3FJGA 3O6GA 4KXPA 5ET6A 5TPAA 3Q25A 4OHNA 4TLMB 4GXAA 1WVJA 1M5BA 1MXYA 1RDYA 4DI3D 1LAGE 1UIUA 3IK6B 1EZ9A 1NV1A 1G0HA 4GQOA 2R71A 3D4GA 5A5XA 4LN5A 2XXVA 3TTNA 4DZ1A 1BK4A 1SW5A 4NWCA 3KSJA 4THIA 2AL5A 3V89B 1NV3A 2Q2CA 2F7AA 1EU8A 3K0VA 4N15A 3EN3A 1AIVA 1NFTA 5H8FB 1IITA 4FORA 1B7UA 4NAPA 3MPLA 3CVGA 1IXIA 2VHAA 2UVGA 1NUYA 3KG2A 4G2ZA 3HSTA 2H4IA 4ZECA 2Y5KA 1NUWA 2CEXA 4OEVA 2DP8A 2XA5A 4I1DA 1EZPA 3BIHA 2DVCA 3CG3A 1MY1A 2F97A 1JW1A 2Y7PA 2RC7A 3MP6A 3DM0A 1OQGA 4XKRA 1B32A 3SETA 4NHBA 5AA4A 4PFIA 4P1LA 4OVRA 3K1NA 2RCAA 4HE0A 4GWWA 3CSBA 4YICA 4MIJA 5CRYA 2RKMA 2F5XA 3B6QA 4NF8A 3GBAA 5JTYB 1NV5A 1YTVA 4HW8A 1DTZA 4OENA 4GWYA 1PBPA 2WBDA 2REGA 3M3FA 4NF4B 3OO7A 3QYTA 1HSJA 4U22A 3MZBA 3E4RA 3NOHA 4M4GA 1YAEA 3P7IA 2ZZWA 3HN0A 1K9ZA
chains in the Genus database with same CATH topology
5ESYA 1EYKA 4F18A 2WEFA 2WYKA 2HXRA 1EYIA 5EYGA 2QFLA 4GWXA 4MCOA 2FHYA 4F1VA 2HPGA 3PTYA 1Q9DA 1FBDA 2XWKA 1LBVA 4F19A 1XI6A 4P47A 4I3YA 4MX6A 4AS5A 3B8BA 4P1EA 3E78A 1LBYA 1FPFA 3BIGA 4OVQA 3W9WA 5EYHA 5IZ3A 4GWSA 2XWIA 5EQ9A 2QVUA 1FBCA 2KQZA 3T0JA 2F3DA 4MNPA 1FPKA 2XWVA 4PBQA 2DE2A 4I40A 5ET8A 2MKZA 4N81A 1D9QA 5EQ8A 1FBPA 1FTAA 4PGNA 4PE3A 2ZZXA 2OWZA 4P8BA 1NV6A 4AS4A 2B4MA 3KC1A 2DVZA 3W9VA 1NV4A 3LUZA 2QVVA 1DK4A 4XF5A 2PFYA 3HFUA 2R8TA 3ROJA 1FSAA 4PDHA 2JJKA 5LTCA 1VDWA 1FPBA 2Q74A 5CM6A 1DBZA 1FPLA 3MSTA 5DW8A 5A5LA 4OVSA 4N4UA 4QXDA 4MHFA 3RPLB 4GX3A 2VPNA 1FPGA 4M1VA 2Y5LA 4NX1A 4PGPA 2WX9A 2QPQA 3LV0A 4NF0A 2FIEA 1NUXA 5ET7A 4GBWA 1AWBA 4DI4B 2HHMA 4O7IA 1LBWA 2VPOA 2HZKA 1LBZA 2WBBA 1KA1A 2PCRA 1G0IA 4N8GA 3MYUA 5F24A 4NN3A 3RYDA 5EQAA 2FIXA 2F3BA 4X8RA 1LBXA 4O94A 5I5PA 2L5VA 2DDKA 1IMEA 2ZZVA 4H46A 1NV2A 4I3EA 4N91A 4PBHA 2KR0A 4JVDA 1IMFA 5JK4A 4X04A 4PCDA 4PETA 1YYZA 2BJIA 2CZIA 1QGXA 4NGUA 3FXBA 4PAKA 3ISPA 2QVRA 4MNCA 4HE2A 4N6DA 1JP4A 3QMFA 4OA4A 2WYPA 4GWUA 1LEVA 2DE3A 3FBPA 4XEQA 1K9YA 4NQ8A 1FBFA 2FBPA 4OVPA 1KA0A 1FBEA 5EQ7A 2P3VA 1RDXA 2V4CA 5FBPA 3E79A 1IMBA 4PFBA 4PFRA 4MAGA 4P56A 5I3SA 4JVIA 1IMDA 4GBVA 2B4LA 3IFAA 4GWZA 4N17A 4GX4A 2P3NA 4OANA 3KBZA 1FBHA 1IMCA 3D1RA 2V3QA 2XWOA 4O8MA 5IM2A 4QBAA 1FPDA 4G61A 3RPLA 1NUZA 4IR8A 5ET5A 4NG7A 4HCWA 4KXPA 5ET6A 4PAIA 4N6KA 4XFEA 1FBGA 1CNQA 1RDYA 4DI3D 1YXIA 4YZZA 4OVTA 5J16A 4FBPA 5IZ3B 3T1BA 5J1DA 1NV1A 1G0HA 5IZZA 4LN5A 1BK4A 1FPEA 2HZLA 5IZ1A 1NV3A 5IGAA 1IMAA 4HXVA 1NV7A 4N15A 1RDZA 3KC0A 4X9TA 3IFCA 3SZPA 4PAFA 1FRPA 4MNIA 4NAPA 4PF8A 1NV0A 1NI9A 1FPJA 1NUYA 4JVCA 3A29A 2VT5A 2Y5KA 1INPA 1NUWA 4PTKA 2CEXA 1EYJA 1SPIA 2FVZA 2XA5A 4MJOA 3BIHA 4F1UA 1FPIA 4H45A 4MMPA 4HE1A 2OX3A 5I7IA 4NHBA 2DE4A 4P1LA 4PFIA 4OVRA 5LDZA 4N8YA 5T3JA 3EKIA 3CHGA 4HE0A 4GWWA 4P3LA 4GX6A 4YICA 4MIJA 3U65A 2XXKA 4MEVA 2F5XA 4PC9A 4P9KA 2CZHA 4HCYA 2PFZA 1NV5A 1FJ6A 4PDDA 2CZKA 2Q9TA 1FJ9A 4GWYA 2Q8MA 2GQ1A 2WBDA 4UABA 1YZ0A 4PF6A 1DCUA 3NOHA 1KZ8A 2CEYA 3B50A 2ZZWA 4O7MA 3GYYA 1K9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXB A;  4PAK A;  5IZZ A;  4PDH A;  5LTC A;  2WYK A;  4MNC A;  4LN5 A;  4N6D A;  5CM6 A;  4OA4 A;  2WYP A;  4MCO A;  4N4U A;  4OVS A;  2HZL A;  4XEQ A;  4NQ8 A;  4OVP A;  5IGA A;  2HPG A;  4MHF A;  4N15 A;  2XWK A;  4P47 A;  4PAF A;  2VPN A;  2V4C A;  4MNI A;  4NAP A;  4PF8 A;  4MX6 A;  4NX1 A;  4PFB A;  4PGP A;  4PFR A;  4P1E A;  2WX9 A;  4MAG A;  4P56 A;  4OVQ A;  2CEX A;  4NF0 A;  2XA5 A;  4DI4 B;  4N17 A;  2XWI A;  4MMP A;  5I7I A;  4MNP A;  2VPO A;  2HZK A;  4NHB A;  4PFI A;  4P1L A;  2XWV A;  4OAN A;  4OVR A;  4N8Y A;  4PBQ A;  4P3L A;  2XWO A;  4O8M A;  4N8G A;  5IM2 A;  4YIC A;  4MIJ A;  3U65 A;  2XXK A;  4MEV A;  4PGN A;  4NN3 A;  2ZZX A;  4PC9 A;  4PE3 A;  4P9K A;  2PFZ A;  4X8R A;  4O94 A;  5I5P A;  4PDD A;  2ZZV A;  4P8B A;  4NG7 A;  4N91 A;  4PAI A;  4N6K A;  4UAB A;  4PBH A;  4XFE A;  4X04 A;  4PCD A;  4PET A;  4DI3 D;  4PF6 A;  4YZZ A;  4OVT A;  4XF5 A;  2CEY A;  2PFY A;  4NGU A;  3B50 A;  2ZZW A;  4O7M A;  3GYY A; 
#chains in the Genus database with same CATH topology
 2WYK A;  2VD3 A;  1POT A;  2HXR A;  4RNS A;  2ALU A;  4DIG A;  3KSX A;  5EYG A;  4MH5 A;  5KDT A;  4IO7 A;  2FHY A;  2XXU A;  3KJT A;  3T96 B;  4DCX A;  1J1N A;  1URS A;  1GVC A;  3PPR A;  3S2V A;  1QVS A;  3RTF B;  4MX6 A;  4KCD A;  3FV2 A;  3LBS A;  4P1E A;  1IZ1 A;  3EHT A;  4G68 C;  1WOD A;  4EQB A;  3Q29 A;  1TXF A;  4F22 A;  2WKY A;  2QVU A;  3A09 A;  1FBC A;  3FV1 A;  2F3D A;  4MNP A;  1FPK A;  2PT1 A;  1UTH A;  1FQD A;  2MKZ A;  1O7T A;  4EF1 A;  2I0B A;  3TTL A;  2DWH A;  1AL3 A;  4NTL A;  3CFX A;  1I6B A;  4PFY A;  1UTB B;  2XHD A;  5AA2 A;  3QUJ A;  1N7X A;  5BUU A;  4DXC A;  4F31 B;  1FTM A;  3W9V A;  2F78 A;  3LUZ A;  3RTW B;  5IKB A;  1Q1K A;  1MS7 A;  3RNN A;  2UYE A;  3TEP A;  3B6T A;  4ZS9 A;  4NED A;  2QVV A;  4NF8 B;  3U1O A;  5L9S A;  3MAM A;  5LTC A;  1N84 A;  1D9Y A;  4OES A;  3MST A;  4JWO A;  4LZ8 A;  1IQ7 A;  4N4U A;  2HCA A;  5L9O A;  3ILU B;  3HO7 A;  4GVO A;  2XD3 A;  3S9M C;  5I56 A;  3FJM A;  1MXV A;  3KOS A;  4FAJ A;  2V3U A;  4PGP A;  5KCJ B;  1DTG A;  2H25 A;  1GGG A;  3IAZ A;  3TAJ A;  5I2K A;  1NUX A;  3HHG A;  4BDO A;  1B7H A;  1N04 A;  2HZK A;  2Z22 A;  1XOC A;  1R1N A;  1LBZ A;  1B1X A;  4FED A;  1LFG A;  3H6U A;  5EQA A;  3TDJ A;  3MW0 A;  4PFW A;  4X8R A;  1LBX A;  2DDK A;  4H46 A;  3PUW E;  3FAS A;  4WEP A;  2HAV A;  3O6I A;  4JVD A;  3S9N C;  2Z23 A;  4PET A;  2O51 A;  1P99 A;  3VVE A;  5I58 B;  2BJI A;  3U93 A;  3S9E A;  2YLN A;  4IB2 A;  3FXB A;  3O2A A;  5AA2 B;  3SKP A;  1JVX A;  4MNC A;  2QVR A;  1A7L A;  4N6D A;  4BDN A;  2X7P A;  5AA2 D;  1B4Z A;  2DE3 A;  3TTM A;  4JBZ A;  4NQ8 A;  1JNF A;  2O7U A;  3ECR A;  3O28 A;  3UN6 A;  1B46 A;  3CIJ A;  3C4M A;  1MDP 1;  3FIR A;  4LZ7 A;  2Y7I A;  3V5A A;  1NNK A;  3E79 A;  3SDF A;  3H6V A;  3C36 A;  4PFB A;  4MAG A;  3G3F A;  2P0S A;  3S9L C;  1I6Q A;  3MVZ A;  4FEC A;  2B4L A;  4TLL B;  5H8Q B;  4U1Z A;  2F7C A;  3PUY E;  3W15 C;  4N17 A;  5LOM A;  4BDL A;  2CZL A;  2PVU A;  1OLC A;  1MXW A;  3TCF A;  3A3C A;  4OAN A;  4G68 A;  3FJ7 A;  1O63 A;  2O69 A;  1IMC A;  3FVO A;  3OEM A;  3OO8 A;  5I2K B;  1LBC A;  1NUZ A;  4IR8 A;  4F1Y A;  4R6K A;  4POX A;  5DVI A;  1Z7M E;  4FJP A;  5ET5 A;  4GOT A;  4PAI A;  4N6K A;  1FBG A;  1CNQ A;  4RYA A;  3K4U A;  1LAH E;  3OO9 A;  3MJN A;  4YZZ A;  3PUZ E;  5J16 A;  4FBP A;  4EF2 A;  3LSF B;  2XXX A;  3RLF E;  5TP9 B;  2OZZ A;  1ZJL A;  4K3F A;  4F3S A;  1USY E;  1US5 A;  4HTG A;  3PMV A;  3PMX A;  3UP9 A;  1Y4T A;  1N3W A;  1MPC A;  1RYX A;  5IZ1 A;  5CI5 A;  2REJ A;  4O3A A;  1URG A;  1IMA A;  2P2A A;  1NV7 A;  1RDZ A;  2V93 A;  4X9T A;  4PAF A;  2P1S A;  4P0I A;  1NI9 A;  1MM6 A;  2IA4 A;  4JVC A;  4YU0 A;  3MWB A;  5DTB A;  4YKK A;  4G77 A;  2O6A A;  4GD5 A;  2UVH A;  4DCY A;  2OJT A;  4QF9 A;  4H45 A;  2QMX A;  3Q28 A;  1QUJ A;  4NMY A;  5FHM A;  2XXQ A;  3LSX A;  3VDF A;  1ZLQ A;  3TPA A;  4HE1 A;  4LQ5 A;  4U4X A;  4C1T A;  2DE4 A;  5LDZ A;  4H8J A;  5T3J A;  2OBG A;  2DS9 A;  4P3L A;  5EHS A;  1JEV A;  2I6E A;  2Z8F A;  4ZZE A;  4GX6 A;  1I6A A;  4QSE A;  3U65 A;  2VOZ A;  3N94 A;  2CZH A;  4HCY A;  4QFK A;  1FJ6 A;  3C32 A;  2F36 A;  4OEU A;  3G3K A;  4KFQ A;  1QUL A;  1VR5 A;  4C1U A;  1D9V A;  2FA7 A;  1OVT A;  1DCU A;  2RCB A;  3IJO B;  2Y7W A;  3UOR A;  4JWX A;  3U94 A;  3GYY A;  5ESY A;  3UK4 A;  3IB1 A;  3JV9 A;  1MXU A;  4OFL A;  3N6U A;  4E0X A;  1EYI A;  5H8N A;  2QFL A;  1SYI A;  4MCO A;  3OMB A;  2VGQ A;  1NL5 A;  5L8D A;  1PEB A;  3IL1 B;  2OLB A;  4L17 A;  1SDX A;  2E0S A;  4F19 A;  1XI6 A;  3FVG A;  3FVN A;  3B8B A;  1OLA A;  3K6V A;  1SW1 A;  4YB7 A;  4ZED A;  1QUI A;  1IXC A;  1HSL A;  3W9W A;  1FQA A;  2A5T A;  3MP8 A;  3GBB A;  4U4S A;  4R9G A;  5IZ3 A;  1LFH A;  3H6T A;  1MH4 A;  4GWS A;  4F39 A;  4IY5 A;  3SES A;  3QIM A;  2PT2 A;  1JQF A;  4NF6 B;  2XWV A;  4PBQ A;  3RY3 A;  1B5I A;  3PD8 A;  2HQ0 A;  4N81 A;  5ITO A;  1CB6 A;  5H8S A;  4IGT A;  1FBP A;  1A54 A;  1NNF A;  4PE3 A;  1Y3P A;  2UYF A;  1XC1 A;  2QS3 A;  2XX7 A;  1MY3 A;  2I49 A;  5FHO A;  3DLN A;  1YPN A;  1NV6 A;  2UVI A;  3FZV A;  4P8B A;  3TCH A;  1B9J A;  3BFT A;  4ELO A;  4OXV A;  4ONY A;  3GXA A;  3KZG A;  4ELR A;  2D5W A;  4G8N A;  3MVY A;  4UA8 A;  1B1H A;  4OYV A;  3FXR A;  3AXF A;  2AIX A;  4TOZ A;  4H0W A;  3ROJ A;  4PE5 B;  2E1S A;  2JJK A;  3PPP A;  1FPB A;  4ZDM A;  3BFU A;  5CM6 A;  1MG1 A;  5A5L A;  1JEU A;  4H5G A;  2OK2 A;  1A8E A;  4OVS A;  4QXD A;  4IGR A;  4EQ9 A;  1POY 1;  2DXY A;  4ZZA A;  3MQ9 A;  2RIN A;  2VD2 A;  1TT1 A;  4MHF A;  3RPL B;  2Z8D A;  1Q35 A;  2QSX A;  3MZ1 A;  4GX3 A;  3FXQ A;  1BTJ A;  3V83 A;  1PB9 A;  1A99 A;  5CC2 A;  3OSQ A;  4Q8R A;  3VV5 A;  5TPA B;  2V3T A;  5H8N B;  1T0K A;  4NX1 A;  3PU5 A;  3C9H A;  2XXY A;  5H8H A;  2QPQ A;  5AA1 A;  3N6T A;  4PFT A;  3KN8 A;  1MPD A;  2GHA A;  2FIE A;  4GBW A;  2QS2 A;  4TQU Q;  4EXK A;  1DPE A;  5A5X B;  1FQC A;  3G7W A;  2DYX A;  1MQI A;  3FGS A;  4O7I A;  2VPO A;  3HHF A;  4JB7 A;  1DMB A;  4YKI A;  2OWT A;  2DWA A;  2ANJ A;  4XIG Q;  1GV8 A;  1FTK A;  3MYU A;  1M5C A;  2F3B A;  3THI A;  4O94 A;  5CMC A;  1IME A;  3KBR A;  3N5L A;  5M2V A;  3DP6 A;  4N91 A;  4YMA A;  3A3U A;  1H3D A;  5FTI A;  2QMW A;  4PBH A;  4R9F A;  5AA3 A;  4BDR A;  5JK4 A;  1OMP A;  1YYZ A;  2CZI A;  3K6W A;  4ELP A;  3O9P A;  3MVX A;  2ESN A;  4NGU A;  2Z8E A;  4PAK A;  2DWJ A;  3MBP A;  4ELQ A;  3T9H B;  2ONR A;  4BLA A;  3R26 A;  4JWY A;  1JP4 A;  5AA4 B;  4OA4 A;  3N26 A;  2UVJ A;  4GWU A;  4F3B A;  1MPB A;  1P1O A;  5DEX A;  4O3B A;  4ZEF A;  3VXB A;  3MUQ A;  3RT6 B;  1OQH A;  1FBF A;  2B3F A;  4OVP A;  1GTK A;  4XKQ A;  3EQ1 A;  2ZXT A;  1KA0 A;  2Q8J A;  5AE4 A;  1SQY A;  2P3V A;  4H5F A;  1IXG A;  3HCQ A;  4H8I A;  3KN3 A;  1FQE A;  3OO6 A;  4R2F A;  4GFR A;  3MP1 A;  1Y20 A;  3QK6 A;  2RF1 A;  4JVI A;  4GBV A;  3PUV E;  3KGC A;  3IFA A;  1SI0 A;  4JSO A;  4GX4 A;  4LON B;  2DSF A;  3KN7 A;  4QRZ A;  5DYH A;  4KYD A;  1P1N A;  1OVB A;  4WKM A;  5KDT B;  4PFU A;  1NNT A;  4N13 A;  3D1R A;  2XWO A;  4ZEI A;  4Q30 B;  4G61 A;  2A5S A;  3I5O A;  3I6V A;  1AMF A;  4DLD A;  3PV0 E;  2RC9 A;  3H03 A;  4EXL A;  3VLU A;  4XFE A;  5I2N A;  5CBR A;  2DWI A;  3IOR A;  1YXI A;  2AL4 A;  4F2O A;  3LUY A;  3IJX B;  4OVT A;  5J1D A;  2I0C A;  3U72 A;  3O97 A;  4ND9 A;  3RUM A;  1URD A;  4BDM A;  2D21 A;  1R9Q A;  1MQH A;  1UTH B;  1FPE A;  1PDA A;  3DP4 A;  1P1U A;  2HZL A;  4OFJ A;  1LAX A;  3T22 A;  3CFL A;  4HXV A;  5B7D A;  5ITP A;  3IFC A;  3SZP A;  1VSO A;  1BP5 A;  1ELJ A;  1FRP A;  1SD3 A;  1ZBM A;  1NV0 A;  4OWD A;  1FPJ A;  3G3J A;  4JXI A;  3T93 B;  3LR1 A;  1EYJ A;  1SPI A;  4X48 A;  4GF8 A;  1JET A;  4ZE8 A;  1TWY A;  4F1U A;  4U23 A;  4N07 A;  1B5J A;  3K1P A;  4F2Q A;  4MMP A;  1B3E A;  2OX3 A;  1B05 A;  4YAH X;  5I7I A;  1IIW A;  5B70 A;  3USD A;  4N8Y A;  1FCK A;  3CHG A;  1NKX A;  4OTE A;  2I48 A;  4PC9 A;  3SEY A;  5I56 B;  4P9K A;  1ZTY A;  2H9B A;  3G3I A;  3ZKK A;  4PDD A;  1H44 A;  5FTH A;  2CZK A;  2Q9T A;  1FJ9 A;  1MM7 A;  2ZNU A;  4LZ5 A;  1BKA A;  3EHS A;  3VFJ A;  4U2R A;  2Y7K A;  3IB0 A;  4XXU A;  4FAT A;  4PF6 A;  3H6W A;  3TOD A;  1KZ8 A;  2CEY A;  3B50 A;  1FQB A;  4O7M A;  1M5F A;  2QS4 A;  3QUF A;  4JSD A;  1AH5 A;  2NWJ A;  5I2N B;  1SVX B;  3JZJ A;  3IB2 A;  4GWX A;  3E9X A;  4F1V A;  1HSE A;  5CMB A;  1NH8 A;  3FUZ A;  4NF5 A;  1FTJ A;  4Z0I A;  1B3G A;  1Y3Q A;  2NOO A;  1Q9D A;  3FVK A;  4EQ7 A;  1FBD A;  3IOW A;  3LSW A;  1LBV A;  3TTK A;  4P47 A;  1RKM A;  3MVW A;  2G93 A;  4AS5 A;  4UAC A;  5IAI A;  4I9D A;  5F1Q A;  3E78 A;  1FPF A;  3BIG A;  4OVQ A;  1S9T A;  1B3L A;  1KWH A;  3E3K A;  5EYH A;  2I4C A;  4R6Y A;  1XVX A;  3VVD A;  3G3H A;  3HV1 A;  5EQ9 A;  1NMU A;  2DOJ A;  2ZNT A;  2PMS A;  3T0J A;  4YMB A;  4Q0C A;  2XX9 A;  1Y1Z A;  3KFM A;  4KD5 A;  2DE2 A;  4I40 A;  5ET8 A;  2D3I A;  2ZNS A;  3B7D A;  3TQW A;  3IO6 A;  2OCU A;  1D9Q A;  5EQ8 A;  2BJJ X;  1FTA A;  2NVU B;  4F3G A;  2GRV A;  2ZYO A;  2ZZX A;  1S7Y A;  3LC8 A;  4Z7E A;  1RYO A;  2OWZ A;  1N3X A;  4AS4 A;  5H8F A;  2B4M A;  4OET A;  4LQ2 A;  1B5H A;  2V84 A;  4OZ9 A;  5ICQ A;  2DVZ A;  1JVY A;  1MRP A;  2XXI A;  2Y7R A;  3M3K A;  2DQV A;  3SER A;  4RA1 A;  1DK4 A;  4XF5 A;  2PFY A;  3ONM A;  4GWO A;  1FSA A;  2ZYK A;  1B0H A;  3SEV A;  2Q74 A;  4KI0 E;  1DBZ A;  1FPL A;  5DW8 A;  4G68 B;  1MQD A;  4MLV A;  1SW4 A;  3Q26 A;  1QKB A;  1H76 A;  1R6Z A;  4AB5 A;  2LAO A;  3UIF A;  2ONK E;  2V25 A;  5BWJ A;  1ANF A;  5HPQ A;  1H45 A;  2HFB A;  1Y4C A;  2Y5L A;  1A40 A;  1XT8 A;  4EDP A;  4QFN A;  2WX9 A;  4WXJ A;  3H06 B;  5I59 A;  3LV0 A;  3FD3 A;  3OXN A;  4NF4 A;  4G8M A;  3RGY A;  1JW4 A;  3RT8 A;  5ET7 A;  1AWB A;  2M8C A;  1PBQ A;  1B40 A;  3VXC A;  3TFL A;  2I4B A;  4XTC Q;  2HHM A;  3TMG A;  1LBW A;  4AQ4 A;  2H5Y A;  1LGB C;  2FNC A;  1PC3 A;  3CRB A;  4GRK A;  2WBB A;  4QFO A;  1KA1 A;  1LST A;  2PCR A;  3O66 A;  1G0I A;  3C34 A;  1B52 A;  3EPE A;  5F24 A;  1LLS A;  3RYD A;  3RN8 A;  3GZG A;  1Z7N E;  1NV2 A;  4DDD A;  4I3E A;  1M5D A;  1NNP A;  5L9M A;  1DSN A;  4R75 A;  4IO5 A;  2KR0 A;  3TEL A;  3BBR A;  3E13 X;  1DPP A;  1A55 A;  1QGX A;  3RPW A;  4FE8 A;  5DVF A;  2QJE A;  3FAT A;  4OVJ A;  4GIZ A;  3PMW A;  3PGF A;  4HE2 A;  5CMM A;  4YB5 A;  1QJM A;  3QMF A;  4KPT A;  3TTR A;  5I84 A;  3QSL A;  3OD7 A;  2GFE A;  1LEV A;  1LCT A;  4XEQ A;  4WED A;  2O7I A;  3K6X A;  2PBW A;  3ODB A;  1NH7 A;  4KCC A;  4O3C A;  3IOT A;  4ZEB A;  5F7V A;  3QAX A;  4ESW A;  2V4C A;  1UTB A;  3H7M A;  3OEN A;  4MF3 A;  5FBP A;  4G4P A;  3IR1 A;  2QRY A;  1B58 A;  4JDF A;  2O1L A;  1IMD A;  3MZ9 A;  3U8Q A;  3CSG A;  2F6G A;  1P1Q A;  3TKD A;  2NXO A;  2ZYM A;  3OOA A;  2XXP A;  2QL3 A;  4GWZ A;  1EZO A;  3WAE A;  4FEB A;  5I59 B;  1FBH A;  4OFO A;  5ISU A;  4PP0 A;  3TZA A;  3WAF A;  5IM2 A;  4QBA A;  1IUD A;  1SBP A;  4KYE A;  3LSL A;  1SYH A;  4GLI A;  4KR5 A;  4RK9 A;  1XS5 A;  1FTO A;  5CBS A;  4NG7 A;  3DP8 A;  4HCW A;  2THI A;  2HXW A;  5KCJ A;  1B51 A;  4LVQ A;  4LAT A;  3I3V A;  2A5T B;  3OEK A;  1VE4 A;  3JYR A;  5IZ3 B;  3T1B A;  4IO2 A;  3SEU A;  1BIY A;  4RPN A;  5IZZ A;  3GLB A;  1N0T A;  2H98 A;  3K6U A;  3TYH A;  4C0R A;  3D4C A;  1IEJ A;  4DE8 A;  1AOV A;  1H43 A;  4LUB A;  4R73 A;  5IGA A;  3VLW A;  2O68 A;  4DXB A;  4H67 A;  2ABH A;  1B0L A;  5EYF A;  1UIV A;  3KC0 A;  1JW5 A;  3CG1 A;  3SEX A;  4MNI A;  3TUS A;  4PF8 A;  4IO4 A;  4RPO A;  1US4 A;  3KOT A;  4XKN A;  4AB6 A;  4X1B A;  3A29 A;  2VT5 A;  1INP A;  4PTK A;  2FVZ A;  4R72 A;  4IY6 A;  3IOU A;  3M8U A;  5I58 A;  3ZKL A;  4MJO A;  2B3B A;  1LFI A;  1FPI A;  2I3V A;  1B3H A;  4E0W A;  5K2X A;  2XD2 A;  2ZYN A;  3G3G A;  3T66 A;  4ZE9 A;  4ISU A;  3VVF A;  4F3P A;  1N76 A;  3T9V A;  1B3F A;  1EH3 A;  3EKI A;  4ECF A;  2R6G E;  2QS1 A;  1XHY A;  1LB9 A;  1DOT A;  1D4N A;  2XXK A;  4MEV A;  4I8C A;  5HM4 B;  3K00 A;  1TFA A;  2PFZ A;  1QKA A;  4BDQ A;  1LBB A;  2I58 A;  3RQT A;  3PUX E;  4GL0 A;  3B6W A;  3U92 A;  2Q8M A;  2GQ1 A;  3FXU A;  4UAB A;  1BLF A;  2DXR A;  5H8H B;  2XX8 A;  1USY H;  1YCJ A;  4OER A;  4P11 A;  4KYS A;  1YZ0 A;  3K01 A;  4QFL A;  4IO3 A;  2R9J A;  2AYS A;  5H8Q A;  1ZMG A;  1MY2 A;  4EUO A;  3ZSF A;  1IXH A;  2YPN A;  4MFI A;  1EYK A;  4F18 A;  2WEF A;  4NWD A;  1MXZ A;  2XXH A;  2PYY A;  2I3W A;  2IEE A;  3L6G A;  1UQW A;  4KQP A;  2HPG A;  3CI8 A;  3PTY A;  1VFE A;  2XWK A;  5CMK A;  1LAF E;  4I3Y A;  2CMO A;  1O64 A;  3C31 A;  1FTL A;  4ESX A;  3Q27 A;  3T9U A;  2G29 A;  1TFD A;  1LBY A;  4H6D A;  1I69 A;  1S50 A;  2PX1 A;  3PD9 A;  2HEU A;  1SI1 A;  3KJ7 A;  1MDQ A;  1MY4 A;  2GH9 A;  3OSR A;  1F9B A;  2B65 A;  1PB8 A;  4YB6 A;  4DXU A;  2H99 A;  2F35 A;  5TP9 A;  2Q89 A;  2XWI A;  4MBP A;  5EHM A;  3SEW A;  3EF7 A;  2KQZ A;  5HBC A;  1ZU0 A;  2GHB A;  3IX1 A;  3BKI B;  5DEX B;  3M3L A;  3MC2 A;  1ATG A;  1MY0 A;  1FQF A;  1XVY A;  1GR2 A;  1ZKB A;  4PGN A;  3QXM A;  4OQO A;  4RJZ A;  2X7Q A;  4QHQ A;  3K2D A;  2W7Y A;  3KC1 A;  3R6U A;  4XKP A;  1NV4 A;  2XXW A;  2FYI A;  2XXR A;  4GL8 A;  1MQJ A;  4R74 A;  2NUV A;  3HFU A;  3TQL A;  2Q88 A;  2R8T A;  1QUK A;  1Y3N A;  4ZEK A;  4PDH A;  3CFZ A;  1VDW A;  3PPN A;  1N7W A;  4QFP A;  3K02 A;  3DEL B;  1B7Z A;  4MLQ A;  3H3G A;  3V8X B;  3VLV A;  1WDN A;  2F8D A;  3IOV A;  1B4H A;  4U21 A;  3O29 A;  2VPN A;  1FPG A;  4M1V A;  4F29 A;  3S4U A;  3C35 A;  4HS7 A;  5I57 A;  1PB7 A;  1Y1M A;  3PPQ A;  4R6H A;  4P0G A;  4Q5T A;  3CR9 A;  3VE1 B;  3IO4 A;  4NF0 A;  4RY1 A;  4DI4 B;  3O6H A;  2O84 X;  3TCG A;  4PQJ A;  4IO6 A;  4KHZ E;  4N6P A;  4YKP A;  2KLF A;  4R2B A;  2O1M A;  4G8H A;  4N8G A;  5DVJ A;  4YKJ A;  2Q2A A;  4RXL A;  4NN3 A;  2Y84 A;  2FIX A;  4I62 A;  1LB8 A;  3L6H A;  4H1X A;  5I5P A;  2L5V A;  5KZT A;  2ZZV A;  3UGW A;  2F34 A;  5JEI A;  1IMF A;  2RC8 A;  4X04 A;  4PCD A;  3R7X A;  4QSC A;  1R9L A;  1VFD A;  3MPK A;  3ISP A;  5ELV A;  2F6P A;  4GXS B;  1M5E A;  2ZMB A;  2F7B A;  4H65 A;  2YJP A;  2WYP A;  2OWS A;  3KEI A;  4POW A;  4NF6 A;  3EHU A;  3OEL A;  2VP1 A;  3FBP A;  1K9Y A;  5K2Y A;  2FBP A;  1FBE A;  4QSD A;  5EQ7 A;  3HPI A;  2XXT A;  3UA8 A;  1A8F A;  1RDX A;  4FIM A;  1B6H A;  1IMB A;  1MXX A;  3K1M A;  4PFR A;  4OMB A;  4P56 A;  1CE2 A;  5I3S A;  3ILT B;  4X1D A;  1Y9U A;  1ZIU A;  3F11 A;  2ONS A;  1B2H A;  5FHN A;  1QW0 A;  5ICT A;  5JTY A;  2HAU A;  3T9X B;  5I57 B;  1II5 A;  5DT6 A;  2P3N A;  4U1O A;  3KBZ A;  1FW0 A;  2X26 A;  1L5T A;  1MQG A;  4NF5 B;  4NE4 A;  2V3Q A;  4O8M A;  4LA9 A;  1LCF A;  4RK2 A;  1FPD A;  1P1W A;  3RPL A;  3H4Z A;  3C33 A;  1MH3 A;  4LP2 B;  1OIB A;  2UXA A;  5TU0 A;  3PPO A;  1SW2 A;  1D3K A;  3ZS6 A;  3FJG A;  3O6G A;  4KXP A;  5ET6 A;  5TPA A;  3Q25 A;  4OHN A;  4TLM B;  4GXA A;  1WVJ A;  1M5B A;  1MXY A;  1RDY A;  4DI3 D;  1LAG E;  1UIU A;  3IK6 B;  1EZ9 A;  1NV1 A;  1G0H A;  4GQO A;  2R71 A;  3D4G A;  5A5X A;  4LN5 A;  2XXV A;  3TTN A;  4DZ1 A;  1BK4 A;  1SW5 A;  4NWC A;  3KSJ A;  4THI A;  2AL5 A;  3V89 B;  1NV3 A;  2Q2C A;  2F7A A;  1EU8 A;  3K0V A;  4N15 A;  3EN3 A;  1AIV A;  1NFT A;  5H8F B;  1IIT A;  4FOR A;  1B7U A;  4NAP A;  3MPL A;  3CVG A;  1IXI A;  2VHA A;  2UVG A;  1NUY A;  3KG2 A;  4G2Z A;  3HST A;  2H4I A;  4ZEC A;  2Y5K A;  1NUW A;  2CEX A;  4OEV A;  2DP8 A;  2XA5 A;  4I1D A;  1EZP A;  3BIH A;  2DVC A;  3CG3 A;  1MY1 A;  2F97 A;  1JW1 A;  2Y7P A;  2RC7 A;  3MP6 A;  3DM0 A;  1OQG A;  4XKR A;  1B32 A;  3SET A;  4NHB A;  5AA4 A;  4PFI A;  4P1L A;  4OVR A;  3K1N A;  2RCA A;  4HE0 A;  4GWW A;  3CSB A;  4YIC A;  4MIJ A;  5CRY A;  2RKM A;  2F5X A;  3B6Q A;  4NF8 A;  3GBA A;  5JTY B;  1NV5 A;  1YTV A;  4HW8 A;  1DTZ A;  4OEN A;  4GWY A;  1PBP A;  2WBD A;  2REG A;  3M3F A;  4NF4 B;  3OO7 A;  3QYT A;  1HSJ A;  4U22 A;  3MZB A;  3E4R A;  3NOH A;  4M4G A;  1YAE A;  3P7I A;  2ZZW A;  3HN0 A;  1K9Z A; 
#chains in the Genus database with same CATH homology
 5ESY A;  1EYK A;  4F18 A;  2WEF A;  2WYK A;  2HXR A;  1EYI A;  5EYG A;  2QFL A;  4GWX A;  4MCO A;  2FHY A;  4F1V A;  2HPG A;  3PTY A;  1Q9D A;  1FBD A;  2XWK A;  1LBV A;  4F19 A;  1XI6 A;  4P47 A;  4I3Y A;  4MX6 A;  4AS5 A;  3B8B A;  4P1E A;  3E78 A;  1LBY A;  1FPF A;  3BIG A;  4OVQ A;  3W9W A;  5EYH A;  5IZ3 A;  4GWS A;  2XWI A;  5EQ9 A;  2QVU A;  1FBC A;  2KQZ A;  3T0J A;  2F3D A;  4MNP A;  1FPK A;  2XWV A;  4PBQ A;  2DE2 A;  4I40 A;  5ET8 A;  2MKZ A;  4N81 A;  1D9Q A;  5EQ8 A;  1FBP A;  1FTA A;  4PGN A;  4PE3 A;  2ZZX A;  2OWZ A;  4P8B A;  1NV6 A;  4AS4 A;  2B4M A;  3KC1 A;  2DVZ A;  3W9V A;  1NV4 A;  3LUZ A;  2QVV A;  1DK4 A;  4XF5 A;  2PFY A;  3HFU A;  2R8T A;  3ROJ A;  1FSA A;  4PDH A;  2JJK A;  5LTC A;  1VDW A;  1FPB A;  2Q74 A;  5CM6 A;  1DBZ A;  1FPL A;  3MST A;  5DW8 A;  5A5L A;  4OVS A;  4N4U A;  4QXD A;  4MHF A;  3RPL B;  4GX3 A;  2VPN A;  1FPG A;  4M1V A;  2Y5L A;  4NX1 A;  4PGP A;  2WX9 A;  2QPQ A;  3LV0 A;  4NF0 A;  2FIE A;  1NUX A;  5ET7 A;  4GBW A;  1AWB A;  4DI4 B;  2HHM A;  4O7I A;  1LBW A;  2VPO A;  2HZK A;  1LBZ A;  2WBB A;  1KA1 A;  2PCR A;  1G0I A;  4N8G A;  3MYU A;  5F24 A;  4NN3 A;  3RYD A;  5EQA A;  2FIX A;  2F3B A;  4X8R A;  1LBX A;  4O94 A;  5I5P A;  2L5V A;  2DDK A;  1IME A;  2ZZV A;  4H46 A;  1NV2 A;  4I3E A;  4N91 A;  4PBH A;  2KR0 A;  4JVD A;  1IMF A;  5JK4 A;  4X04 A;  4PCD A;  4PET A;  1YYZ A;  2BJI A;  2CZI A;  1QGX A;  4NGU A;  3FXB A;  4PAK A;  3ISP A;  2QVR A;  4MNC A;  4HE2 A;  4N6D A;  1JP4 A;  3QMF A;  4OA4 A;  2WYP A;  4GWU A;  1LEV A;  2DE3 A;  3FBP A;  4XEQ A;  1K9Y A;  4NQ8 A;  1FBF A;  2FBP A;  4OVP A;  1KA0 A;  1FBE A;  5EQ7 A;  2P3V A;  1RDX A;  2V4C A;  5FBP A;  3E79 A;  1IMB A;  4PFB A;  4PFR A;  4MAG A;  4P56 A;  5I3S A;  4JVI A;  1IMD A;  4GBV A;  2B4L A;  3IFA A;  4GWZ A;  4N17 A;  4GX4 A;  2P3N A;  4OAN A;  3KBZ A;  1FBH A;  1IMC A;  3D1R A;  2V3Q A;  2XWO A;  4O8M A;  5IM2 A;  4QBA A;  1FPD A;  4G61 A;  3RPL A;  1NUZ A;  4IR8 A;  5ET5 A;  4NG7 A;  4HCW A;  4KXP A;  5ET6 A;  4PAI A;  4N6K A;  4XFE A;  1FBG A;  1CNQ A;  1RDY A;  4DI3 D;  1YXI A;  4YZZ A;  4OVT A;  5J16 A;  4FBP A;  5IZ3 B;  3T1B A;  5J1D A;  1NV1 A;  1G0H A;  5IZZ A;  4LN5 A;  1BK4 A;  1FPE A;  2HZL A;  5IZ1 A;  1NV3 A;  5IGA A;  1IMA A;  4HXV A;  1NV7 A;  4N15 A;  1RDZ A;  3KC0 A;  4X9T A;  3IFC A;  3SZP A;  4PAF A;  1FRP A;  4MNI A;  4NAP A;  4PF8 A;  1NV0 A;  1NI9 A;  1FPJ A;  1NUY A;  4JVC A;  3A29 A;  2VT5 A;  2Y5K A;  1INP A;  1NUW A;  4PTK A;  2CEX A;  1EYJ A;  1SPI A;  2FVZ A;  2XA5 A;  4MJO A;  3BIH A;  4F1U A;  1FPI A;  4H45 A;  4MMP A;  4HE1 A;  2OX3 A;  5I7I A;  4NHB A;  2DE4 A;  4P1L A;  4PFI A;  4OVR A;  5LDZ A;  4N8Y A;  5T3J A;  3EKI A;  3CHG A;  4HE0 A;  4GWW A;  4P3L A;  4GX6 A;  4YIC A;  4MIJ A;  3U65 A;  2XXK A;  4MEV A;  2F5X A;  4PC9 A;  4P9K A;  2CZH A;  4HCY A;  2PFZ A;  1NV5 A;  1FJ6 A;  4PDD A;  2CZK A;  2Q9T A;  1FJ9 A;  4GWY A;  2Q8M A;  2GQ1 A;  2WBD A;  4UAB A;  1YZ0 A;  4PF6 A;  1DCU A;  3NOH A;  1KZ8 A;  2CEY A;  3B50 A;  2ZZW A;  4O7M A;  3GYY A;  1K9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...