3GYYA

The ectoine binding protein of the teaabc trap transporter teaa in the apo-state
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
308
structure length
303
Chain Sequence
DNWRYAHEEYEGDVQDVFAQAFKGYVEDNSDHTVQVYRFGELGIMEQTQNGILQFVNQSPGFTGSLIPSAQIFFIPYLMPTDMDTVLEFFDESKAINEMFPKLYAEHGLELLKMYPEGEMVVTADEPITSPEDFNKKIRTMTNPLLAETYKAFGATPTPLPWGEVYGGLQTGIIDGQENPIFWIESGGLYEVSPNLTFTSHGWFTTAMMANQDFYEGLSEEDQQLVQDAADAAYDHTIEHIKGLSEESLEKIKAASDEVTVTRLNDEQIQAFKERAPQVEEKFIEMTGEQGQELLDQFKADLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for an allosteric mechanism of substrate release from membrane-transporter accessory binding proteins
pubmed doi rcsb
source organism Halomonas elongata
molecule tags Transport protein
molecule keywords Periplasmic substrate binding protein
total genus 104
structure length 303
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3gyyA00
4XFEA 4O94A 2WYKA 2XWVA 4P9KA 5I5PA 4NGUA 4OANA 4MX6A 4NX1A 4DI4B 4PFRA 4PC9A 4NHBA 2PFYA 4MNIA 2PFZA 5CM6A 2VPOA 4P1EA 3U65A 3GYYA 4PFBA 4X8RA 4PCDA 2XWIA 4P8BA 4PBQA 4PETA 2HPGA 4P47A 4PAKA 4OVSA 4NF0A 4N6KA 4P3LA 2XWKA 2WX9A 2VPNA 3FXBA 4MIJA 4MCOA 4PE3A 4PBHA 4XEQA 2XWOA 4PGNA 4MEVA 4X04A 4O8MA 5IM2A 5IGAA 4PGPA 4PAIA 4MAGA 4UABA 2V4CA 2ZZXA 2ZZWA 2ZZVA 4OVRA 4OA4A 4N91A 4NG7A 5IZZA 4PF6A 4N4UA 5LTCA 5I7IA 2XA5A 4OVTA 2HZLA 4P1LA 4N6DA 4LN5A 2HZKA 4NAPA 4MHFA 4PFIA 4OVPA 4MNPA 4YICA 4PDHA 2CEYA 4N8GA 4PF8A 4N15A 4PAFA 4XF5A 4OVQA 4NN3A 2XXKA 4YZZA 2CEXA 2WYPA 3B50A 4O7MA 4NQ8A 4DI3D 4N17A 4MMPA 4MNCA 4PDDA 4N8YA 4P56A
chains in the Genus database with same CATH superfamily
1LBVA 1BKAA 2BJIA 3VFJA 4DDDA 1AIVA 4LATA 4JDFA 4OERA 4U1ZA 1B5HA 2B3BA 5ET6A 2I48A 1MPBA 4NHBA 3PMVA 2F7CA 3GXAA 4KHZE 5CRYA 4R6YA 3O2AA 5CMBA 1MPDA 1GV8A 1OMPA 2Q89A 2HPGA 4OVSA 3G3IA 3QMFA 1IMCA 4R2BA 3RQTA 3OO8A 1INPA 3ZKLA 1LEVA 5EHSA 2PT1A 4GL0A 1LLSA 2CZLA 2QMWA 1H44A 4K3FA 1LAFE 1NNTA 1QVSA 3EHTA 1R6ZA 3Q29A 4X04A 1B3HA 2DVZA 4GL8A 1S7YA 3IORA 3C36A 1FPBA 1DMBA 3PUXE 3KN7A 5HPQA 5I7IA 2DS9A 1KZ8A 1IMEA 2I58A 3MP8A 3T22A 1LBCA 1DPEA 1Q1KA 2REGA 1LSTA 3CSGA 1JEVA 1N76A 1MQHA 4BDOA 3V83A 2Q9TA 1YAEA 3QK6A 1DBZA 2CEYA 1PEBA 5H8QB 4XF5A 2ZNTA 3VVEA 1VFEA 1LB9A 1FQFA 4YZZA 1Q9DA 3MJNA 1RDZA 1VR5A 4GVOA 3EN3A 4QFOA 1FPEA 3KC1A 3CVGA 4ISUA 4YU0A 5DW8A 1MXWA 3B6TA 2XXIA 4AS4A 5F1QA 3FXRA 1B6HA 3KBZA 3FVNA 5B7DA 1SVXB 2O51A 2WKYA 3O6GA 3RLFE 3TZAA 1DSNA 1MH3A 1Y4CA 3RPLB 1M5FA 2VT5A 5EQ8A 1EYIA 1EU8A 1YYZA 2GH9A 2VPOA 3K1PA 2REJA 1OVTA 4PFBA 3ONMA 4X8RA 4RK9A 4AB6A 4P8BA 1LBYA 1FPFA 2AL4A 1NKXA 2XWKA 5AA2B 1FPKA 1CB6A 3OOAA 3IB2A 3N6TA 5F24A 4IO7A 2XWOA 5T3JA 3LSWA 3QUFA 3LV0A 1KWHA 4IO5A 5EHMA 5EQ9A 4NG7A 4HTGA 1IMDA 1RYXA 1FBGA 4M4GA 4MLVA 4ND9A 4LQ2A 3QYTA 1P1WA 4JVCA 1FBDA 4HXVA 3Q28A 4F3PA 1A8FA 1PB7A 3MZ1A 2THIA 1DPPA 3SZPA 5I57A 2UYFA 5I56A 1TFDA 4RPOA 4FORA 4N6PA 5HBCA 1D3KA 3IL1B 2W7YA 1K9ZA 2H9BA 1UTBB 2UVGA 1AMFA 1PDAA 3LC8A 4R2FA 4P56A 2Y7IA 3MBPA 3C4MA 1GGGA 4EF2A 3H6UA 3DP6A 1D9VA 4U4XA 1NFTA 5TP9B 5ET8A 2PYYA 1QKAA 4R74A 4G8MA 4PP0A 2V3TA 4THIA 1L5TA 3B7DA 4U1OA 3VXBA 1B52A 2QVUA 4ZEIA 1LBZA 3T93B 3C35A 4O8MA 4RXLA 5K2XA 1G0IA 4MAGA 3TDJA 3PD9A 4GWSA 5IZZA 4HW8A 2Y7PA 5J16A 3EKIA 4E0XA 4U21A 1MM7A 1NH7A 4OVPA 3VE1B 1EZ9A 4GBWA 1FPIA 1QJMA 3G3JA 3FUZA 5KDTB 2P0SA 1RDYA 4EQBA 5ICTA 2Z8FA 4KCDA 2X26A 4NQ8A 1IIWA 4OEUA 2KQZA 2YLNA 1UQWA 4BDQA 1SI0A 3TCFA 3R7XA 3OEMA 2HAUA 4O94A 2VHAA 4POXA 4JVDA 4NGUA 3SERA 4FEDA 4OANA 1Y3PA 1URDA 3PUYE 1FQCA 2F3DA 5TPAB 4KFQA 4NF8A 1N7XA 4RPNA 3PPOA 4F1UA 3GYYA 2V3QA 2R9JA 4KQPA 5IZ3B 4P0GA 5H8HB 1JW4A 5CI5A 5FBPA 3V5AA 4FE8A 4OHNA 3ZS6A 5I59A 4F3BA 1QKBA 3R6UA 2ANJA 5CMCA 1NNFA 5TU0A 5L9OA 2UVHA 2RC9A 1LFGA 1P99A 3H6VA 4G68B 2O69A 2O7UA 3L6HA 4N4UA 1B3EA 1USYH 3S2VA 1ZJLA 4NF6B 2H25A 2V3UA 5LDZA 1WVJA 2FBPA 2PX1A 1O63A 3FVOA 2XXWA 4H8JA 1YTVA 4YMAA 1ZMGA 4N8GA 2MKZA 4NN3A 2A5TA 4LZ5A 1OIBA 4QFKA 3RY3A 4GX4A 4BLAA 3A29A 3FVKA 3SEWA 2OLBA 2RCAA 3VVFA 3DP4A 1H3DA 1EYKA 4MX6A 4X48A 2GQ1A 1FTOA 2XXTA 4OYVA 1MXXA 2FVZA 5FHMA 1DTGA 2PFYA 4MNIA 2NUVA 2PFZA 5CM6A 2UXAA 2D5WA 4GWXA 1POY1 5H8NA 2I6EA 4YB6A 1UTHB 2F34A 3IB1A 2HXRA 5CC2A 2H98A 3W15C 1Y3NA 2G29A 4NF5B 4HE0A 3S9EA 1KA0A 2LAOA 2RCBA 1BP5A 4HE2A 3TUSA 3H6WA 5IZ1A 3E13X 1BIYA 4H65A 5H8SA 4GF8A 3AXFA 2F6PA 4JWOA 3B6WA 5I59B 1IXCA 1YZ0A 4QHQA 3RT8A 4ZEFA 4ELOA 4QF9A 3OSRA 3K0VA 4N81A 4N07A 3PV0E 1Q35A 3GZGA 2QMXA 4DXCA 4BDLA 4NAPA 2X7QA 4KCCA 1A54A 4R72A 4MF3A 5I2NA 1ZLQA 2V84A 2I0CA 4MJOA 4PAFA 5LOMA 3GBBA 1MDP1 2XXKA 4G77A 1FJ9A 5K2YA 4QFNA 4PFWA 2FA7A 4WEDA 1RKMA 1OQHA 2Y7KA 4DI3D 5I84A 4PDDA 3KC0A 3MPLA 1VDWA 4I1DA 3SESA 1NV7A 4P0IA 3M3FA 1US4A 2AYSA 1MXYA 4C1TA 1P1OA 4F18A 4KYEA 1OLAA 3VLUA 3MVZA 3T9VA 5ITOA 4GBVA 4OEVA 3MQ9A 4N6KA 1QW0A 1TXFA 4JB7A 3SEYA 3LBSA 2OCUA 1B5IA 1LBBA 4PBHA 3PPNA 3IJOB 3FJGA 3EHSA 4RY1A 1NV3A 3K1NA 1F9BA 4PAIA 3MYUA 4LQ5A 3PUVE 2FNCA 3Q25A 3FASA 2QS1A 1MQJA 3OMBA 3UA8A 5EQAA 4AS5A 4AB5A 4Q30B 4XTCQ 4OVTA 2Q8MA 2QRYA 2XX9A 3P7IA 3DP8A 1UIVA 4UACA 1SYIA 1SW2A 3DELB 1R1NA 3SKPA 4PFIA 1Z7NE 4LONB 4O3BA 3IOUA 1M5EA 4XKQA 3OEKA 1BTJA 3W9WA 5JEIA 1M5BA 4BDMA 3QUJA 2XXVA 3FATA 4NF8B 1JEUA 4O3CA 4DCYA 1B1HA 1FBFA 1H43A 2I4BA 2VGQA 2O7IA 3HPIA 2XD2A 1BK4A 2Q88A 1USYE 3CIJA 1Y9UA 3K02A 5BWJA 4PE5B 3I6VA 2X7PA 3BFUA 3LSLA 4Z0IA 1AWBA 4TQUQ 4PTKA 2ABHA 5KCJA 2VD3A 3DM0A 3GBAA 1QUIA 3E79A 2RC7A 3IOTA 4GWWA 1B40A 4ZZAA 3ILUB 1FBEA 3IOVA 2DE3A 2VOZA 1JETA 2XWIA 4RNSA 2RKMA 3HHGA 4NF0A 1MQGA 1MQDA 2CZHA 5FTIA 3U8QA 3K00A 1Y1ZA 3FXUA 2O84X 1NV4A 4MFIA 1AOVA 1JQFA 4MEVA 5EQ7A 4GD5A 2PT2A 4LVQA 1FTJA 2ZZWA 4ELRA 1FSAA 2FIEA 4F3GA 2RC8A 3JYRA 3HSTA 3FD3A 3HN0A 1D9QA 2QS4A 2XA5A 3OENA 3EPEA 4H0WA 2Q74A 1XVXA 4DXBA 3UP9A 5EYGA 2GHAA 4YB5A 4C1UA 2ONSA 5DTBA 1PBQA 1Y4TA 4H5FA 1XS5A 4FAJA 3SDFA 4JBZA 4MLQA 2PMSA 3USDA 4IB2A 2GFEA 3G3HA 1NV6A 2ZNSA 4TLLB 5DVIA 1MG1A 1T0KA 4MMPA 3QSLA 3TQLA 1UTHA 3KN8A 4KI0E 1A7LA 1N7WA 1NH8A 2VP1A 3CRBA 3VLWA 1H76A 4OVJA 3N6UA 3FJ7A 1ZTYA 1JW5A 1IMAA 3L6GA 1IQ7A 4YKKA 4P1EA 2F6GA 3KBRA 3CFXA 4F3SA 1I6BA 1B1XA 1B0HA 1YXIA 2R6GE 3HO7A 1FPLA 3VVDA 3EHUA 1DK4A 2F7BA 4MIJA 4GXAA 3CG3A 4PE3A 4U4SA 3O6HA 1A8EA 2DXRA 3CG1A 3E9XA 1FRPA 1SPIA 4IO4A 4ESWA 5A5XA 1GVCA 3RTWB 3O97A 3TAJA 4OA4A 2JJKA 2B4MA 2Q8JA 2AIXA 4P11A 4OXVA 5LTCA 1R9QA 4RYAA 2A5SA 3WAFA 4GFRA 1IXHA 3PTYA 4I9DA 4U2RA 2DQVA 3KJTA 2P3NA 2HZKA 3WAEA 2DP8A 1SQYA 3U1OA 2PCRA 4F19A 2Y5KA 2DWJA 3SEXA 3KJ7A 1I6AA 1SYHA 4OVQA 1N3WA 1WDNA 3FJMA 3Q26A 5JK4A 1NNPA 4IO3A 3F11A 2XXRA 1JNFA 2ALUA 3G7WA 3TTKA 3EQ1A 2WYKA 3PPPA 3OD7A 4F22A 1P1QA 1SW1A 4PFTA 5DEXB 5JTYB 5FTHA 4G4PA 4ELPA 3UK4A 3KZGA 4Z7EA 3UN6A 4EQ7A 1NUZA 1ZKBA 3TQWA 3LSXA 4ZE9A 1S9TA 4P3LA 1CE2A 4IY6A 2WX9A 1FPGA 3TPAA 2O6AA 3CR9A 4H8IA 4Q0CA 1A55A 1FQDA 5AA2D 5DT6A 5I58B 3MUQA 1JP4A 5H8FB 5FHOA 3VXCA 4YKJA 5IM2A 2UYEA 4YKPA 3T96B 3FXQA 5IGAA 4PGPA 3BIHA 4NF6A 5TP9A 2ZZXA 5AA2A 2V93A 2VD2A 1AL3A 2E0SA 2FHYA 2Y7WA 4G2ZA 2ZMBA 4R6KA 4OQOA 2H5YA 1JVYA 1MXUA 3NOHA 4OENA 1P1NA 1NV5A 3BBRA 2ZNUA 3CFZA 1N0TA 1XT8A 1GR2A 1MY3A 3S9NC 3KSJA 4YAHX 1B5JA 3Q27A 3R26A 3MW0A 5KCJB 4BDNA 1NV1A 1MM6A 1NUXA 2OBGA 4MNCA 1FQBA 4G8NA 1EYJA 4ZE8A 5IKBA 3H4ZA 1LCFA 1Z7ME 1URGA 1LCTA 5I56B 3FIRA 5ITPA 1NUWA 3UIFA 1MY4A 3KN3A 1XVYA 3H6TA 3PMXA 3RTFB 1NV0A 1I6QA 1FW0A 4PCDA 2QL3A 1NI9A 1B4ZA 1NV2A 2UVIA 5DVJA 1H45A 4Q5TA 3E3KA 5EYHA 1OLCA 2NXOA 4QRZA 5I3SA 4LA9A 3O28A 3K2DA 1GTKA 4H1XA 3H03A 2HCAA 3UGWA 4ZZEA 5KZTA 4UA8A 3SETA 4GX3A 4DLDA 4DXUA 2DE2A 5ET7A 4F39A 4C0RA 4WKMA 1MQIA 3MWBA 2P1SA 1FJ6A 3KG2A 4O3AA 3A3UA 5H8FA 1B0LA 1FBHA 1FPJA 3MP1A 4P1LA 3ECRA 2ZXTA 2DWAA 1XC1A 4GWUA 3TEPA 4F1VA 4JVIA 3RN8A 4PF8A 4PFUA 1A99A 1EZOA 1B3LA 2R8TA 3RPLA 3I3VA 3IO4A 2PBWA 2DXYA 3I5OA 3U72A 3OXNA 4O7MA 3RNNA 2GRVA 3FV2A 4IY5A 3MZ9A 4ECFA 3S4UA 2H99A 4DZ1A 2OX3A 2Q2AA 3N94A 3TTMA 4HCYA 4KYSA 4H67A 4I3EA 3B8BA 4I40A 4P9KA 3PUWE 1IITA 4NX1A 1PB8A 1B46A 2Z23A 1MPCA 1B05A 3HFUA 1B7ZA 2OZZA 2ZYNA 4G68C 4IO2A 2D21A 3TCGA 2OWSA 2B65A 4ESXA 3O9PA 4PBQA 1R9LA 4EQ9A 1B51A 5AA1A 4GOTA 4RA1A 4LP2B 1N3XA 1KA1A 3CSBA 3LUYA 3K6XA 3K1MA 2F78A 1QULA 4GWYA 3PPQA 3UORA 1BLFA 3LSFB 3TYHA 2HAVA 3IOWA 2V4CA 4QBAA 3VDFA 4OVRA 4N91A 4BDRA 3H06B 5IZ3A 5A5LA 4PF6A 3RPWA 2XXPA 2ZYOA 1NNKA 2DWIA 3M3KA 1UIUA 4U22A 4OTEA 2XXQA 3O66A 4TLMB 3FV1A 2IA4A 1IMBA 1Y20A 5I2KA 1TFAA 3PMWA 3TCHA 3PUZE 1URSA 1POTA 4XXUA 2F97A 4NF4A 3IX1A 3ISPA 3TODA 4FIMA 3C9HA 3MVXA 1J1NA 5JTYA 2HQ0A 3OO7A 2B3FA 3TTLA 3KOSA 2OWZA 2P3VA 1I69A 4LZ8A 3OELA 1FBCA 2WBBA 3RT6B 4NEDA 2DYXA 1IEJA 2XWVA 2XX7A 3C31A 2A5TB 2ONKE 2F7AA 1M5DA 4DI4B 4OZ9A 2M8CA 4KYDA 5A5XB 1Y3QA 2I49A 3G3FA 3H3GA 4QFPA 2YJPA 4NWCA 1IUDA 1FTAA 3V8XB 4OFJA 5CBSA 4I62A 4PETA 1MDQA 2RF1A 5AA3A 4XIGQ 2HHMA 1B7UA 2VPNA 2XX8A 3U93A 4NTLA 2OWTA 3C33A 4LUBA 1LBWA 4MCOA 1MY1A 4YMBA 1B4HA 1XOCA 3KOTA 4E0WA 4GRKA 1VSOA 1O7TA 2FYIA 4F31B 3TTRA 4OFLA 2GHBA 5F7VA 3MZBA 4KR5A 2HZLA 1SD3A 1O64A 2Z8DA 2PVUA 2ESNA 4X9TA 4GLIA 4KD5A 1US5A 1FQAA 2QS2A 1ATGA 1B3FA 5DEXA 5M2VA 5IAIA 5TPAA 4TOZA 2CEXA 3IAZA 3D4CA 2QJEA 5DVFA 3G3GA 4H46A 1XHYA 5I2KB 4ELQA 4N17A 3CFLA 3T0JA 2QFLA 1QGXA 2QVRA 3LR1A 2DVCA 4XFEA 3OO6A 3BFTA 5H8HA 3ODBA 4LZ7A 4PC9A 3T66A 5AA4A 1LBXA 4IGTA 1N04A 1HSEA 2UVJA 4FJPA 3U65A 2R71A 3S9MC 4X1DA 4F1YA 4MBPA 2DSFA 1Y1MA 4EF1A 3OO9A 2O1MA 1B58A 2KLFA 4GXSB 4EUOA 2WEFA 4R6HA 2QS3A 4IO6A 2O1LA 4GX6A 4XEQA 1RYOA 4OESA 1EZPA 2OJTA 4QSCA 3N26A 5L8DA 2Y7RA 2I3VA 2ZZVA 2NOOA 1FBPA 1QUJA 1ELJA 1B9JA 3FZVA 4I3YA 5DYHA 3DLNA 5L9SA 1MH4A 5I57B 4IGRA 4GWZA 3IFAA 3TMGA 1OQGA 4GQOA 3FGSA 4N6DA 4DE8A 2NWJA 1NL5A 3IK6B 3ZKKA 4YB7A 2XXYA 1XI6A 3V89B 1LAGE 4JXIA 3D4GA 3SEVA 3PPRA 1DCUA 2XXXA 4QFLA 1NMUA 4ZDMA 3C32A 3TELA 1LFHA 3IB0A 1D9YA 2L5VA 1IZ1A 3W9VA 5ISUA 3RYDA 3MAMA 4ZS9A 1FPDA 3VLVA 1FCKA 2HXWA 2QVVA 4OWDA 3KGCA 2FIXA 3SEUA 2O68A 1VE4A 1IXIA 1ZBMA 4IR8A 3BKIB 3LUZA 3JZJA 3TKDA 3D1RA 4U23A 4DIGA 3A09A 4PFYA 1WODA 5B70A 1SBPA 2DE4A 3JV9A 1UTBA 4OFOA 4POWA 3K6VA 1AH5A 4OETA 4FBPA 2ONRA 4O7IA 1M5CA 2Z8EA 5ELVA 3ROJA 3K6UA 1LGBC 3MVWA 5L9MA 1MRPA 1JW1A 3O6IA 4M1VA 4JSDA 3K01A 3QIMA 2Y5LA 4N13A 3FXBA 2H4IA 4XKPA 3GLBA 3E78A 2DDKA 1QUKA 3H7MA 1HSJA 3C34A 3MSTA 4FEBA 3KFMA 1CNQA 1B3GA 4R9FA 4EDPA 2E1SA 4RK2A 4LN5A 2XHDA 2HEUA 5FHNA 2XXHA 5CBRA 4MNPA 4YICA 2F3BA 3QAXA 1MY2A 4GIZA 1G0HA 3G3KA 4H5GA 5ICQA 2XD3A 1IXGA 4WXJA 1ANFA 1SDXA 3PU5A 5BUUA 3B50A 4RJZA 5J1DA 3S9LC 5ET5A 4G8HA 1PC3A 3E4RA 2RINA 5KDTA 3ZSFA 3HCQA 1MXVA 5I5PA 3T9UA 2P2AA 4HCWA 3CHGA 3KSXA 1OVBA 4PFRA 5H8QA 4YKIA 4OMBA 4EXKA 4R75A 2F36A 3T9XB 3HHFA 1FTKA 3KEIA 4F29A 1B2HA 4H6DA 4G68A 2I0BA 3VV5A 2F5XA 4PGNA 5I2NB 3FVGA 3U94A 4ZEKA 3HV1A 4UABA 3EF7A 5EYFA 3RUMA 2AL5A 2F35A 3T9HB 2HFBA 5AE4A 2YPNA 3A3CA 4F2OA 3IR1A 4MHFA 1SW4A 1FTMA 2V25A 2Z22A 2I4CA 3FBPA 1YPNA 4PDHA 1MXZA 2OK2A 1MS7A 4XKRA 4EXLA 4N15A 2Q2CA 5AA4B 2CMOA 2WYPA 1JVXA 5CMKA 2ZYKA 1IMFA 3K6WA 4I8CA 2KR0A 1N84A 1VFDA 4L17A 4QSEA 5ESYA 3O29A 1SW5A 1PBPA 3RGYA 1LAXA 1YCJA 5H8NB 4HS7A 2G93A 4FATA 1D4NA 3ILTB 1HSLA 2Y84A 1DTZA 3QXMA 4H45A 4X1BA 2QPQA 1B32A 4QSDA 2IEEA 1TT1A 4JWXA 1ZU0A 1DOTA 4NF5A 4DCXA 4PQJA 1A40A 4Q8RA 4ZEBA 2BJJX 2F8DA 4ZEDA 1NUYA 4F2QA 4P47A 4PAKA 1K9YA 3TFLA 3M8UA 3CI8A 4GWOA 5CMMA 1LB8A 1RDXA 3OSQA 1P1UA 2WBDA 1TWYA 1LAHE 2ZYMA 4NE4A 4ZECA 4NWDA 2CZKA 4R9GA 4KXPA 2I3WA 3BIGA 1PB9A 3IO6A 1EH3A 3U92A 4FECA 1MY0A 3PGFA 4ONYA 2DWHA 3IJXB 3MVYA 3M3LA 2NVUB 3MC2A 3K4UA 1LFIA 4NF4B 3THIA 3TTNA 4QXDA 5I58A 4HE1A 1B7HA 5HM4B 3MPKA 4JSOA 4G61A 1SI1A 3T1BA 4XKNA 3MP6A 1FQEA 2D3IA 3N5LA 2B4LA 1ZIUA 2DOJA 3PD8A 4KPTA 4WEPA 1II5A 4NMYA 4JWYA 3B6QA 4AQ4A 4R73A 1S50A 4MH5A 2QSXA 4N8YA 1FTLA 2CZIA 2XXUA 3IFCA
chains in the Genus database with same CATH topology
5ESYA 2FIXA 4AS4A 1LBVA 2OX3A 2QVRA 2BJIA 1VDWA 1FBCA 1NV7A 4HCYA 2WBBA 4IR8A 3KBZA 4XFEA 3LUZA 1NUWA 4O94A 3D1RA 4I3EA 3B8BA 4I40A 1EYKA 2WYKA 2XWVA 4JVDA 4NGUA 4P9KA 5I5PA 5JK4A 4OANA 4MX6A 5ET6A 4HCWA 2GQ1A 3CHGA 2DE4A 4NX1A 4H45A 2FVZA 4PFRA 4DI4B 2QPQA 2F3DA 4NHBA 4PC9A 1LBXA 4PBQA 2PFYA 2VT5A 1AWBA 4MNIA 3RPLB 5EQ8A 4F18A 4PTKA 2PFZA 1EYIA 3HFUA 4FBPA 1IMAA 1YYZA 4PETA 5ET8A 4F1UA 5CM6A 4O7IA 2VPOA 3E79A 1FTAA 4P1EA 3U65A 4GWXA 1NV0A 3GYYA 4GWWA 2V3QA 4PFBA 4X8RA 3ROJA 1FBEA 4GBVA 1NUYA 2DE3A 1LBYA 1NUZA 1YXIA 2XWIA 4PCDA 2HPGA 4P8BA 4P47A 4PAKA 1FPFA 1K9YA 1NI9A 4OVSA 5IZ3B 3QMFA 1IMCA 1NV2A 4NF0A 1FPLA 1INPA 4N6KA 1LEVA 2CZHA 2HXRA 2HHMA 4P3LA 2XWKA 4M1VA 1FPKA 1DK4A 1KA1A 2WX9A 5EYHA 5FBPA 2VPNA 2Y5LA 1FPGA 3FXBA 4HE0A 4MIJA 1RDXA 2QVUA 2WEFA 1LBWA 4MCOA 4PE3A 1KA0A 1LBZA 4PBHA 2WBDA 4GX6A 5F24A 4GWYA 5I3SA 4XEQA 2F5XA 1JP4A 1NV4A 2XWOA 5T3JA 4PGNA 4MEVA 1NV3A 3E78A 2DDKA 5EQ7A 4X04A 4O8MA 4HE2A 1FRPA 1SPIA 4QBAA 5IM2A 2DVZA 4GX3A 5IZ1A 5IGAA 1G0IA 4PGPA 3LV0A 2CZKA 3BIHA 4PAIA 4MAGA 4KXPA 4UABA 2V4CA 5EQ9A 2ZZXA 2ZZWA 2ZZVA 3BIGA 1FBPA 1FSAA 3MYUA 2DE2A 2FIEA 1FPBA 4GWSA 4N91A 2JJKA 2B4MA 4NG7A 4OA4A 5ET7A 5IZZA 5IZ3A 1IMDA 3MSTA 4I3YA 5A5LA 4PF6A 4N4UA 1FBGA 5LTCA 1FJ6A 1YZ0A 5I7IA 2FHYA 1D9QA 5EQAA 4AS5A 1CNQA 3PTYA 5J16A 2XA5A 4GWZA 3IFAA 1KZ8A 1IMEA 1FBHA 2Q74A 1FPJA 3EKIA 4OVTA 4N81A 2Q8MA 4JVCA 1FBDA 2HZLA 4HXVA 4QXDA 4P1LA 4N6DA 4LN5A 2P3NA 2HZKA 5LDZA 3NOHA 2FBPA 5EYGA 1IMBA 4NAPA 1XI6A 4MHFA 4HE1A 4X9TA 4PFIA 4G61A 1NV5A 1DCUA 2PCRA 4OVPA 4MNPA 4YICA 3T1BA 2Q9TA 2F3BA 3FBPA 4GBWA 1FPIA 4PDHA 3SZPA 4GWUA 4F19A 4F1VA 1G0HA 2Y5KA 4JVIA 1DBZA 2B4LA 2CEYA 3W9WA 4N8GA 1RDYA 2MKZA 4N15A 4PF8A 2R8TA 4MJOA 4PAFA 4OVQA 3ISPA 4XF5A 4NN3A 3RPLA 2XXKA 1NV6A 2L5VA 4YZZA 3W9VA 2CEXA 1FJ9A 1Q9DA 1RDZA 2WYPA 1FBFA 3RYDA 3B50A 1FPEA 3KC1A 1FPDA 4GX4A 4H46A 1IMFA 4O7MA 4NQ8A 3A29A 5ET5A 5J1DA 1K9ZA 2KR0A 4DI3D 1NV1A 2QVVA 1NUXA 4MMPA 4MNCA 2KQZA 4N17A 4PDDA 5DW8A 1EYJA 3KC0A 3T0JA 1BK4A 2OWZA 2QFLA 1QGXA 4N8YA 2CZIA 4P56A 2P3VA 4OVRA 3IFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XFE A;  4O94 A;  2WYK A;  2XWV A;  4P9K A;  5I5P A;  4NGU A;  4OAN A;  4MX6 A;  4NX1 A;  4DI4 B;  4PFR A;  4PC9 A;  4NHB A;  2PFY A;  4MNI A;  2PFZ A;  5CM6 A;  2VPO A;  4P1E A;  3U65 A;  3GYY A;  4PFB A;  4X8R A;  4PCD A;  2XWI A;  4P8B A;  4PBQ A;  4PET A;  2HPG A;  4P47 A;  4PAK A;  4OVS A;  4NF0 A;  4N6K A;  4P3L A;  2XWK A;  2WX9 A;  2VPN A;  3FXB A;  4MIJ A;  4MCO A;  4PE3 A;  4PBH A;  4XEQ A;  2XWO A;  4PGN A;  4MEV A;  4X04 A;  4O8M A;  5IM2 A;  5IGA A;  4PGP A;  4PAI A;  4MAG A;  4UAB A;  2V4C A;  2ZZX A;  2ZZW A;  2ZZV A;  4OVR A;  4OA4 A;  4N91 A;  4NG7 A;  5IZZ A;  4PF6 A;  4N4U A;  5LTC A;  5I7I A;  2XA5 A;  4OVT A;  2HZL A;  4P1L A;  4N6D A;  4LN5 A;  2HZK A;  4NAP A;  4MHF A;  4PFI A;  4OVP A;  4MNP A;  4YIC A;  4PDH A;  2CEY A;  4N8G A;  4PF8 A;  4N15 A;  4PAF A;  4XF5 A;  4OVQ A;  4NN3 A;  2XXK A;  4YZZ A;  2CEX A;  2WYP A;  3B50 A;  4O7M A;  4NQ8 A;  4DI3 D;  4N17 A;  4MMP A;  4MNC A;  4PDD A;  4N8Y A;  4P56 A; 
#chains in the Genus database with same CATH topology
 1LBV A;  1BKA A;  2BJI A;  3VFJ A;  4DDD A;  1AIV A;  4LAT A;  4JDF A;  4OER A;  4U1Z A;  1B5H A;  2B3B A;  5ET6 A;  2I48 A;  1MPB A;  4NHB A;  3PMV A;  2F7C A;  3GXA A;  4KHZ E;  5CRY A;  4R6Y A;  3O2A A;  5CMB A;  1MPD A;  1GV8 A;  1OMP A;  2Q89 A;  2HPG A;  4OVS A;  3G3I A;  3QMF A;  1IMC A;  4R2B A;  3RQT A;  3OO8 A;  1INP A;  3ZKL A;  1LEV A;  5EHS A;  2PT1 A;  4GL0 A;  1LLS A;  2CZL A;  2QMW A;  1H44 A;  4K3F A;  1LAF E;  1NNT A;  1QVS A;  3EHT A;  1R6Z A;  3Q29 A;  4X04 A;  1B3H A;  2DVZ A;  4GL8 A;  1S7Y A;  3IOR A;  3C36 A;  1FPB A;  1DMB A;  3PUX E;  3KN7 A;  5HPQ A;  5I7I A;  2DS9 A;  1KZ8 A;  1IME A;  2I58 A;  3MP8 A;  3T22 A;  1LBC A;  1DPE A;  1Q1K A;  2REG A;  1LST A;  3CSG A;  1JEV A;  1N76 A;  1MQH A;  4BDO A;  3V83 A;  2Q9T A;  1YAE A;  3QK6 A;  1DBZ A;  2CEY A;  1PEB A;  5H8Q B;  4XF5 A;  2ZNT A;  3VVE A;  1VFE A;  1LB9 A;  1FQF A;  4YZZ A;  1Q9D A;  3MJN A;  1RDZ A;  1VR5 A;  4GVO A;  3EN3 A;  4QFO A;  1FPE A;  3KC1 A;  3CVG A;  4ISU A;  4YU0 A;  5DW8 A;  1MXW A;  3B6T A;  2XXI A;  4AS4 A;  5F1Q A;  3FXR A;  1B6H A;  3KBZ A;  3FVN A;  5B7D A;  1SVX B;  2O51 A;  2WKY A;  3O6G A;  3RLF E;  3TZA A;  1DSN A;  1MH3 A;  1Y4C A;  3RPL B;  1M5F A;  2VT5 A;  5EQ8 A;  1EYI A;  1EU8 A;  1YYZ A;  2GH9 A;  2VPO A;  3K1P A;  2REJ A;  1OVT A;  4PFB A;  3ONM A;  4X8R A;  4RK9 A;  4AB6 A;  4P8B A;  1LBY A;  1FPF A;  2AL4 A;  1NKX A;  2XWK A;  5AA2 B;  1FPK A;  1CB6 A;  3OOA A;  3IB2 A;  3N6T A;  5F24 A;  4IO7 A;  2XWO A;  5T3J A;  3LSW A;  3QUF A;  3LV0 A;  1KWH A;  4IO5 A;  5EHM A;  5EQ9 A;  4NG7 A;  4HTG A;  1IMD A;  1RYX A;  1FBG A;  4M4G A;  4MLV A;  4ND9 A;  4LQ2 A;  3QYT A;  1P1W A;  4JVC A;  1FBD A;  4HXV A;  3Q28 A;  4F3P A;  1A8F A;  1PB7 A;  3MZ1 A;  2THI A;  1DPP A;  3SZP A;  5I57 A;  2UYF A;  5I56 A;  1TFD A;  4RPO A;  4FOR A;  4N6P A;  5HBC A;  1D3K A;  3IL1 B;  2W7Y A;  1K9Z A;  2H9B A;  1UTB B;  2UVG A;  1AMF A;  1PDA A;  3LC8 A;  4R2F A;  4P56 A;  2Y7I A;  3MBP A;  3C4M A;  1GGG A;  4EF2 A;  3H6U A;  3DP6 A;  1D9V A;  4U4X A;  1NFT A;  5TP9 B;  5ET8 A;  2PYY A;  1QKA A;  4R74 A;  4G8M A;  4PP0 A;  2V3T A;  4THI A;  1L5T A;  3B7D A;  4U1O A;  3VXB A;  1B52 A;  2QVU A;  4ZEI A;  1LBZ A;  3T93 B;  3C35 A;  4O8M A;  4RXL A;  5K2X A;  1G0I A;  4MAG A;  3TDJ A;  3PD9 A;  4GWS A;  5IZZ A;  4HW8 A;  2Y7P A;  5J16 A;  3EKI A;  4E0X A;  4U21 A;  1MM7 A;  1NH7 A;  4OVP A;  3VE1 B;  1EZ9 A;  4GBW A;  1FPI A;  1QJM A;  3G3J A;  3FUZ A;  5KDT B;  2P0S A;  1RDY A;  4EQB A;  5ICT A;  2Z8F A;  4KCD A;  2X26 A;  4NQ8 A;  1IIW A;  4OEU A;  2KQZ A;  2YLN A;  1UQW A;  4BDQ A;  1SI0 A;  3TCF A;  3R7X A;  3OEM A;  2HAU A;  4O94 A;  2VHA A;  4POX A;  4JVD A;  4NGU A;  3SER A;  4FED A;  4OAN A;  1Y3P A;  1URD A;  3PUY E;  1FQC A;  2F3D A;  5TPA B;  4KFQ A;  4NF8 A;  1N7X A;  4RPN A;  3PPO A;  4F1U A;  3GYY A;  2V3Q A;  2R9J A;  4KQP A;  5IZ3 B;  4P0G A;  5H8H B;  1JW4 A;  5CI5 A;  5FBP A;  3V5A A;  4FE8 A;  4OHN A;  3ZS6 A;  5I59 A;  4F3B A;  1QKB A;  3R6U A;  2ANJ A;  5CMC A;  1NNF A;  5TU0 A;  5L9O A;  2UVH A;  2RC9 A;  1LFG A;  1P99 A;  3H6V A;  4G68 B;  2O69 A;  2O7U A;  3L6H A;  4N4U A;  1B3E A;  1USY H;  3S2V A;  1ZJL A;  4NF6 B;  2H25 A;  2V3U A;  5LDZ A;  1WVJ A;  2FBP A;  2PX1 A;  1O63 A;  3FVO A;  2XXW A;  4H8J A;  1YTV A;  4YMA A;  1ZMG A;  4N8G A;  2MKZ A;  4NN3 A;  2A5T A;  4LZ5 A;  1OIB A;  4QFK A;  3RY3 A;  4GX4 A;  4BLA A;  3A29 A;  3FVK A;  3SEW A;  2OLB A;  2RCA A;  3VVF A;  3DP4 A;  1H3D A;  1EYK A;  4MX6 A;  4X48 A;  2GQ1 A;  1FTO A;  2XXT A;  4OYV A;  1MXX A;  2FVZ A;  5FHM A;  1DTG A;  2PFY A;  4MNI A;  2NUV A;  2PFZ A;  5CM6 A;  2UXA A;  2D5W A;  4GWX A;  1POY 1;  5H8N A;  2I6E A;  4YB6 A;  1UTH B;  2F34 A;  3IB1 A;  2HXR A;  5CC2 A;  2H98 A;  3W15 C;  1Y3N A;  2G29 A;  4NF5 B;  4HE0 A;  3S9E A;  1KA0 A;  2LAO A;  2RCB A;  1BP5 A;  4HE2 A;  3TUS A;  3H6W A;  5IZ1 A;  3E13 X;  1BIY A;  4H65 A;  5H8S A;  4GF8 A;  3AXF A;  2F6P A;  4JWO A;  3B6W A;  5I59 B;  1IXC A;  1YZ0 A;  4QHQ A;  3RT8 A;  4ZEF A;  4ELO A;  4QF9 A;  3OSR A;  3K0V A;  4N81 A;  4N07 A;  3PV0 E;  1Q35 A;  3GZG A;  2QMX A;  4DXC A;  4BDL A;  4NAP A;  2X7Q A;  4KCC A;  1A54 A;  4R72 A;  4MF3 A;  5I2N A;  1ZLQ A;  2V84 A;  2I0C A;  4MJO A;  4PAF A;  5LOM A;  3GBB A;  1MDP 1;  2XXK A;  4G77 A;  1FJ9 A;  5K2Y A;  4QFN A;  4PFW A;  2FA7 A;  4WED A;  1RKM A;  1OQH A;  2Y7K A;  4DI3 D;  5I84 A;  4PDD A;  3KC0 A;  3MPL A;  1VDW A;  4I1D A;  3SES A;  1NV7 A;  4P0I A;  3M3F A;  1US4 A;  2AYS A;  1MXY A;  4C1T A;  1P1O A;  4F18 A;  4KYE A;  1OLA A;  3VLU A;  3MVZ A;  3T9V A;  5ITO A;  4GBV A;  4OEV A;  3MQ9 A;  4N6K A;  1QW0 A;  1TXF A;  4JB7 A;  3SEY A;  3LBS A;  2OCU A;  1B5I A;  1LBB A;  4PBH A;  3PPN A;  3IJO B;  3FJG A;  3EHS A;  4RY1 A;  1NV3 A;  3K1N A;  1F9B A;  4PAI A;  3MYU A;  4LQ5 A;  3PUV E;  2FNC A;  3Q25 A;  3FAS A;  2QS1 A;  1MQJ A;  3OMB A;  3UA8 A;  5EQA A;  4AS5 A;  4AB5 A;  4Q30 B;  4XTC Q;  4OVT A;  2Q8M A;  2QRY A;  2XX9 A;  3P7I A;  3DP8 A;  1UIV A;  4UAC A;  1SYI A;  1SW2 A;  3DEL B;  1R1N A;  3SKP A;  4PFI A;  1Z7N E;  4LON B;  4O3B A;  3IOU A;  1M5E A;  4XKQ A;  3OEK A;  1BTJ A;  3W9W A;  5JEI A;  1M5B A;  4BDM A;  3QUJ A;  2XXV A;  3FAT A;  4NF8 B;  1JEU A;  4O3C A;  4DCY A;  1B1H A;  1FBF A;  1H43 A;  2I4B A;  2VGQ A;  2O7I A;  3HPI A;  2XD2 A;  1BK4 A;  2Q88 A;  1USY E;  3CIJ A;  1Y9U A;  3K02 A;  5BWJ A;  4PE5 B;  3I6V A;  2X7P A;  3BFU A;  3LSL A;  4Z0I A;  1AWB A;  4TQU Q;  4PTK A;  2ABH A;  5KCJ A;  2VD3 A;  3DM0 A;  3GBA A;  1QUI A;  3E79 A;  2RC7 A;  3IOT A;  4GWW A;  1B40 A;  4ZZA A;  3ILU B;  1FBE A;  3IOV A;  2DE3 A;  2VOZ A;  1JET A;  2XWI A;  4RNS A;  2RKM A;  3HHG A;  4NF0 A;  1MQG A;  1MQD A;  2CZH A;  5FTI A;  3U8Q A;  3K00 A;  1Y1Z A;  3FXU A;  2O84 X;  1NV4 A;  4MFI A;  1AOV A;  1JQF A;  4MEV A;  5EQ7 A;  4GD5 A;  2PT2 A;  4LVQ A;  1FTJ A;  2ZZW A;  4ELR A;  1FSA A;  2FIE A;  4F3G A;  2RC8 A;  3JYR A;  3HST A;  3FD3 A;  3HN0 A;  1D9Q A;  2QS4 A;  2XA5 A;  3OEN A;  3EPE A;  4H0W A;  2Q74 A;  1XVX A;  4DXB A;  3UP9 A;  5EYG A;  2GHA A;  4YB5 A;  4C1U A;  2ONS A;  5DTB A;  1PBQ A;  1Y4T A;  4H5F A;  1XS5 A;  4FAJ A;  3SDF A;  4JBZ A;  4MLQ A;  2PMS A;  3USD A;  4IB2 A;  2GFE A;  3G3H A;  1NV6 A;  2ZNS A;  4TLL B;  5DVI A;  1MG1 A;  1T0K A;  4MMP A;  3QSL A;  3TQL A;  1UTH A;  3KN8 A;  4KI0 E;  1A7L A;  1N7W A;  1NH8 A;  2VP1 A;  3CRB A;  3VLW A;  1H76 A;  4OVJ A;  3N6U A;  3FJ7 A;  1ZTY A;  1JW5 A;  1IMA A;  3L6G A;  1IQ7 A;  4YKK A;  4P1E A;  2F6G A;  3KBR A;  3CFX A;  4F3S A;  1I6B A;  1B1X A;  1B0H A;  1YXI A;  2R6G E;  3HO7 A;  1FPL A;  3VVD A;  3EHU A;  1DK4 A;  2F7B A;  4MIJ A;  4GXA A;  3CG3 A;  4PE3 A;  4U4S A;  3O6H A;  1A8E A;  2DXR A;  3CG1 A;  3E9X A;  1FRP A;  1SPI A;  4IO4 A;  4ESW A;  5A5X A;  1GVC A;  3RTW B;  3O97 A;  3TAJ A;  4OA4 A;  2JJK A;  2B4M A;  2Q8J A;  2AIX A;  4P11 A;  4OXV A;  5LTC A;  1R9Q A;  4RYA A;  2A5S A;  3WAF A;  4GFR A;  1IXH A;  3PTY A;  4I9D A;  4U2R A;  2DQV A;  3KJT A;  2P3N A;  2HZK A;  3WAE A;  2DP8 A;  1SQY A;  3U1O A;  2PCR A;  4F19 A;  2Y5K A;  2DWJ A;  3SEX A;  3KJ7 A;  1I6A A;  1SYH A;  4OVQ A;  1N3W A;  1WDN A;  3FJM A;  3Q26 A;  5JK4 A;  1NNP A;  4IO3 A;  3F11 A;  2XXR A;  1JNF A;  2ALU A;  3G7W A;  3TTK A;  3EQ1 A;  2WYK A;  3PPP A;  3OD7 A;  4F22 A;  1P1Q A;  1SW1 A;  4PFT A;  5DEX B;  5JTY B;  5FTH A;  4G4P A;  4ELP A;  3UK4 A;  3KZG A;  4Z7E A;  3UN6 A;  4EQ7 A;  1NUZ A;  1ZKB A;  3TQW A;  3LSX A;  4ZE9 A;  1S9T A;  4P3L A;  1CE2 A;  4IY6 A;  2WX9 A;  1FPG A;  3TPA A;  2O6A A;  3CR9 A;  4H8I A;  4Q0C A;  1A55 A;  1FQD A;  5AA2 D;  5DT6 A;  5I58 B;  3MUQ A;  1JP4 A;  5H8F B;  5FHO A;  3VXC A;  4YKJ A;  5IM2 A;  2UYE A;  4YKP A;  3T96 B;  3FXQ A;  5IGA A;  4PGP A;  3BIH A;  4NF6 A;  5TP9 A;  2ZZX A;  5AA2 A;  2V93 A;  2VD2 A;  1AL3 A;  2E0S A;  2FHY A;  2Y7W A;  4G2Z A;  2ZMB A;  4R6K A;  4OQO A;  2H5Y A;  1JVY A;  1MXU A;  3NOH A;  4OEN A;  1P1N A;  1NV5 A;  3BBR A;  2ZNU A;  3CFZ A;  1N0T A;  1XT8 A;  1GR2 A;  1MY3 A;  3S9N C;  3KSJ A;  4YAH X;  1B5J A;  3Q27 A;  3R26 A;  3MW0 A;  5KCJ B;  4BDN A;  1NV1 A;  1MM6 A;  1NUX A;  2OBG A;  4MNC A;  1FQB A;  4G8N A;  1EYJ A;  4ZE8 A;  5IKB A;  3H4Z A;  1LCF A;  1Z7M E;  1URG A;  1LCT A;  5I56 B;  3FIR A;  5ITP A;  1NUW A;  3UIF A;  1MY4 A;  3KN3 A;  1XVY A;  3H6T A;  3PMX A;  3RTF B;  1NV0 A;  1I6Q A;  1FW0 A;  4PCD A;  2QL3 A;  1NI9 A;  1B4Z A;  1NV2 A;  2UVI A;  5DVJ A;  1H45 A;  4Q5T A;  3E3K A;  5EYH A;  1OLC A;  2NXO A;  4QRZ A;  5I3S A;  4LA9 A;  3O28 A;  3K2D A;  1GTK A;  4H1X A;  3H03 A;  2HCA A;  3UGW A;  4ZZE A;  5KZT A;  4UA8 A;  3SET A;  4GX3 A;  4DLD A;  4DXU A;  2DE2 A;  5ET7 A;  4F39 A;  4C0R A;  4WKM A;  1MQI A;  3MWB A;  2P1S A;  1FJ6 A;  3KG2 A;  4O3A A;  3A3U A;  5H8F A;  1B0L A;  1FBH A;  1FPJ A;  3MP1 A;  4P1L A;  3ECR A;  2ZXT A;  2DWA A;  1XC1 A;  4GWU A;  3TEP A;  4F1V A;  4JVI A;  3RN8 A;  4PF8 A;  4PFU A;  1A99 A;  1EZO A;  1B3L A;  2R8T A;  3RPL A;  3I3V A;  3IO4 A;  2PBW A;  2DXY A;  3I5O A;  3U72 A;  3OXN A;  4O7M A;  3RNN A;  2GRV A;  3FV2 A;  4IY5 A;  3MZ9 A;  4ECF A;  3S4U A;  2H99 A;  4DZ1 A;  2OX3 A;  2Q2A A;  3N94 A;  3TTM A;  4HCY A;  4KYS A;  4H67 A;  4I3E A;  3B8B A;  4I40 A;  4P9K A;  3PUW E;  1IIT A;  4NX1 A;  1PB8 A;  1B46 A;  2Z23 A;  1MPC A;  1B05 A;  3HFU A;  1B7Z A;  2OZZ A;  2ZYN A;  4G68 C;  4IO2 A;  2D21 A;  3TCG A;  2OWS A;  2B65 A;  4ESX A;  3O9P A;  4PBQ A;  1R9L A;  4EQ9 A;  1B51 A;  5AA1 A;  4GOT A;  4RA1 A;  4LP2 B;  1N3X A;  1KA1 A;  3CSB A;  3LUY A;  3K6X A;  3K1M A;  2F78 A;  1QUL A;  4GWY A;  3PPQ A;  3UOR A;  1BLF A;  3LSF B;  3TYH A;  2HAV A;  3IOW A;  2V4C A;  4QBA A;  3VDF A;  4OVR A;  4N91 A;  4BDR A;  3H06 B;  5IZ3 A;  5A5L A;  4PF6 A;  3RPW A;  2XXP A;  2ZYO A;  1NNK A;  2DWI A;  3M3K A;  1UIU A;  4U22 A;  4OTE A;  2XXQ A;  3O66 A;  4TLM B;  3FV1 A;  2IA4 A;  1IMB A;  1Y20 A;  5I2K A;  1TFA A;  3PMW A;  3TCH A;  3PUZ E;  1URS A;  1POT A;  4XXU A;  2F97 A;  4NF4 A;  3IX1 A;  3ISP A;  3TOD A;  4FIM A;  3C9H A;  3MVX A;  1J1N A;  5JTY A;  2HQ0 A;  3OO7 A;  2B3F A;  3TTL A;  3KOS A;  2OWZ A;  2P3V A;  1I69 A;  4LZ8 A;  3OEL A;  1FBC A;  2WBB A;  3RT6 B;  4NED A;  2DYX A;  1IEJ A;  2XWV A;  2XX7 A;  3C31 A;  2A5T B;  2ONK E;  2F7A A;  1M5D A;  4DI4 B;  4OZ9 A;  2M8C A;  4KYD A;  5A5X B;  1Y3Q A;  2I49 A;  3G3F A;  3H3G A;  4QFP A;  2YJP A;  4NWC A;  1IUD A;  1FTA A;  3V8X B;  4OFJ A;  5CBS A;  4I62 A;  4PET A;  1MDQ A;  2RF1 A;  5AA3 A;  4XIG Q;  2HHM A;  1B7U A;  2VPN A;  2XX8 A;  3U93 A;  4NTL A;  2OWT A;  3C33 A;  4LUB A;  1LBW A;  4MCO A;  1MY1 A;  4YMB A;  1B4H A;  1XOC A;  3KOT A;  4E0W A;  4GRK A;  1VSO A;  1O7T A;  2FYI A;  4F31 B;  3TTR A;  4OFL A;  2GHB A;  5F7V A;  3MZB A;  4KR5 A;  2HZL A;  1SD3 A;  1O64 A;  2Z8D A;  2PVU A;  2ESN A;  4X9T A;  4GLI A;  4KD5 A;  1US5 A;  1FQA A;  2QS2 A;  1ATG A;  1B3F A;  5DEX A;  5M2V A;  5IAI A;  5TPA A;  4TOZ A;  2CEX A;  3IAZ A;  3D4C A;  2QJE A;  5DVF A;  3G3G A;  4H46 A;  1XHY A;  5I2K B;  4ELQ A;  4N17 A;  3CFL A;  3T0J A;  2QFL A;  1QGX A;  2QVR A;  3LR1 A;  2DVC A;  4XFE A;  3OO6 A;  3BFT A;  5H8H A;  3ODB A;  4LZ7 A;  4PC9 A;  3T66 A;  5AA4 A;  1LBX A;  4IGT A;  1N04 A;  1HSE A;  2UVJ A;  4FJP A;  3U65 A;  2R71 A;  3S9M C;  4X1D A;  4F1Y A;  4MBP A;  2DSF A;  1Y1M A;  4EF1 A;  3OO9 A;  2O1M A;  1B58 A;  2KLF A;  4GXS B;  4EUO A;  2WEF A;  4R6H A;  2QS3 A;  4IO6 A;  2O1L A;  4GX6 A;  4XEQ A;  1RYO A;  4OES A;  1EZP A;  2OJT A;  4QSC A;  3N26 A;  5L8D A;  2Y7R A;  2I3V A;  2ZZV A;  2NOO A;  1FBP A;  1QUJ A;  1ELJ A;  1B9J A;  3FZV A;  4I3Y A;  5DYH A;  3DLN A;  5L9S A;  1MH4 A;  5I57 B;  4IGR A;  4GWZ A;  3IFA A;  3TMG A;  1OQG A;  4GQO A;  3FGS A;  4N6D A;  4DE8 A;  2NWJ A;  1NL5 A;  3IK6 B;  3ZKK A;  4YB7 A;  2XXY A;  1XI6 A;  3V89 B;  1LAG E;  4JXI A;  3D4G A;  3SEV A;  3PPR A;  1DCU A;  2XXX A;  4QFL A;  1NMU A;  4ZDM A;  3C32 A;  3TEL A;  1LFH A;  3IB0 A;  1D9Y A;  2L5V A;  1IZ1 A;  3W9V A;  5ISU A;  3RYD A;  3MAM A;  4ZS9 A;  1FPD A;  3VLV A;  1FCK A;  2HXW A;  2QVV A;  4OWD A;  3KGC A;  2FIX A;  3SEU A;  2O68 A;  1VE4 A;  1IXI A;  1ZBM A;  4IR8 A;  3BKI B;  3LUZ A;  3JZJ A;  3TKD A;  3D1R A;  4U23 A;  4DIG A;  3A09 A;  4PFY A;  1WOD A;  5B70 A;  1SBP A;  2DE4 A;  3JV9 A;  1UTB A;  4OFO A;  4POW A;  3K6V A;  1AH5 A;  4OET A;  4FBP A;  2ONR A;  4O7I A;  1M5C A;  2Z8E A;  5ELV A;  3ROJ A;  3K6U A;  1LGB C;  3MVW A;  5L9M A;  1MRP A;  1JW1 A;  3O6I A;  4M1V A;  4JSD A;  3K01 A;  3QIM A;  2Y5L A;  4N13 A;  3FXB A;  2H4I A;  4XKP A;  3GLB A;  3E78 A;  2DDK A;  1QUK A;  3H7M A;  1HSJ A;  3C34 A;  3MST A;  4FEB A;  3KFM A;  1CNQ A;  1B3G A;  4R9F A;  4EDP A;  2E1S A;  4RK2 A;  4LN5 A;  2XHD A;  2HEU A;  5FHN A;  2XXH A;  5CBR A;  4MNP A;  4YIC A;  2F3B A;  3QAX A;  1MY2 A;  4GIZ A;  1G0H A;  3G3K A;  4H5G A;  5ICQ A;  2XD3 A;  1IXG A;  4WXJ A;  1ANF A;  1SDX A;  3PU5 A;  5BUU A;  3B50 A;  4RJZ A;  5J1D A;  3S9L C;  5ET5 A;  4G8H A;  1PC3 A;  3E4R A;  2RIN A;  5KDT A;  3ZSF A;  3HCQ A;  1MXV A;  5I5P A;  3T9U A;  2P2A A;  4HCW A;  3CHG A;  3KSX A;  1OVB A;  4PFR A;  5H8Q A;  4YKI A;  4OMB A;  4EXK A;  4R75 A;  2F36 A;  3T9X B;  3HHF A;  1FTK A;  3KEI A;  4F29 A;  1B2H A;  4H6D A;  4G68 A;  2I0B A;  3VV5 A;  2F5X A;  4PGN A;  5I2N B;  3FVG A;  3U94 A;  4ZEK A;  3HV1 A;  4UAB A;  3EF7 A;  5EYF A;  3RUM A;  2AL5 A;  2F35 A;  3T9H B;  2HFB A;  5AE4 A;  2YPN A;  3A3C A;  4F2O A;  3IR1 A;  4MHF A;  1SW4 A;  1FTM A;  2V25 A;  2Z22 A;  2I4C A;  3FBP A;  1YPN A;  4PDH A;  1MXZ A;  2OK2 A;  1MS7 A;  4XKR A;  4EXL A;  4N15 A;  2Q2C A;  5AA4 B;  2CMO A;  2WYP A;  1JVX A;  5CMK A;  2ZYK A;  1IMF A;  3K6W A;  4I8C A;  2KR0 A;  1N84 A;  1VFD A;  4L17 A;  4QSE A;  5ESY A;  3O29 A;  1SW5 A;  1PBP A;  3RGY A;  1LAX A;  1YCJ A;  5H8N B;  4HS7 A;  2G93 A;  4FAT A;  1D4N A;  3ILT B;  1HSL A;  2Y84 A;  1DTZ A;  3QXM A;  4H45 A;  4X1B A;  2QPQ A;  1B32 A;  4QSD A;  2IEE A;  1TT1 A;  4JWX A;  1ZU0 A;  1DOT A;  4NF5 A;  4DCX A;  4PQJ A;  1A40 A;  4Q8R A;  4ZEB A;  2BJJ X;  2F8D A;  4ZED A;  1NUY A;  4F2Q A;  4P47 A;  4PAK A;  1K9Y A;  3TFL A;  3M8U A;  3CI8 A;  4GWO A;  5CMM A;  1LB8 A;  1RDX A;  3OSQ A;  1P1U A;  2WBD A;  1TWY A;  1LAH E;  2ZYM A;  4NE4 A;  4ZEC A;  4NWD A;  2CZK A;  4R9G A;  4KXP A;  2I3W A;  3BIG A;  1PB9 A;  3IO6 A;  1EH3 A;  3U92 A;  4FEC A;  1MY0 A;  3PGF A;  4ONY A;  2DWH A;  3IJX B;  3MVY A;  3M3L A;  2NVU B;  3MC2 A;  3K4U A;  1LFI A;  4NF4 B;  3THI A;  3TTN A;  4QXD A;  5I58 A;  4HE1 A;  1B7H A;  5HM4 B;  3MPK A;  4JSO A;  4G61 A;  1SI1 A;  3T1B A;  4XKN A;  3MP6 A;  1FQE A;  2D3I A;  3N5L A;  2B4L A;  1ZIU A;  2DOJ A;  3PD8 A;  4KPT A;  4WEP A;  1II5 A;  4NMY A;  4JWY A;  3B6Q A;  4AQ4 A;  4R73 A;  1S50 A;  4MH5 A;  2QSX A;  4N8Y A;  1FTL A;  2CZI A;  2XXU A;  3IFC A; 
#chains in the Genus database with same CATH homology
 5ESY A;  2FIX A;  4AS4 A;  1LBV A;  2OX3 A;  2QVR A;  2BJI A;  1VDW A;  1FBC A;  1NV7 A;  4HCY A;  2WBB A;  4IR8 A;  3KBZ A;  4XFE A;  3LUZ A;  1NUW A;  4O94 A;  3D1R A;  4I3E A;  3B8B A;  4I40 A;  1EYK A;  2WYK A;  2XWV A;  4JVD A;  4NGU A;  4P9K A;  5I5P A;  5JK4 A;  4OAN A;  4MX6 A;  5ET6 A;  4HCW A;  2GQ1 A;  3CHG A;  2DE4 A;  4NX1 A;  4H45 A;  2FVZ A;  4PFR A;  4DI4 B;  2QPQ A;  2F3D A;  4NHB A;  4PC9 A;  1LBX A;  4PBQ A;  2PFY A;  2VT5 A;  1AWB A;  4MNI A;  3RPL B;  5EQ8 A;  4F18 A;  4PTK A;  2PFZ A;  1EYI A;  3HFU A;  4FBP A;  1IMA A;  1YYZ A;  4PET A;  5ET8 A;  4F1U A;  5CM6 A;  4O7I A;  2VPO A;  3E79 A;  1FTA A;  4P1E A;  3U65 A;  4GWX A;  1NV0 A;  3GYY A;  4GWW A;  2V3Q A;  4PFB A;  4X8R A;  3ROJ A;  1FBE A;  4GBV A;  1NUY A;  2DE3 A;  1LBY A;  1NUZ A;  1YXI A;  2XWI A;  4PCD A;  2HPG A;  4P8B A;  4P47 A;  4PAK A;  1FPF A;  1K9Y A;  1NI9 A;  4OVS A;  5IZ3 B;  3QMF A;  1IMC A;  1NV2 A;  4NF0 A;  1FPL A;  1INP A;  4N6K A;  1LEV A;  2CZH A;  2HXR A;  2HHM A;  4P3L A;  2XWK A;  4M1V A;  1FPK A;  1DK4 A;  1KA1 A;  2WX9 A;  5EYH A;  5FBP A;  2VPN A;  2Y5L A;  1FPG A;  3FXB A;  4HE0 A;  4MIJ A;  1RDX A;  2QVU A;  2WEF A;  1LBW A;  4MCO A;  4PE3 A;  1KA0 A;  1LBZ A;  4PBH A;  2WBD A;  4GX6 A;  5F24 A;  4GWY A;  5I3S A;  4XEQ A;  2F5X A;  1JP4 A;  1NV4 A;  2XWO A;  5T3J A;  4PGN A;  4MEV A;  1NV3 A;  3E78 A;  2DDK A;  5EQ7 A;  4X04 A;  4O8M A;  4HE2 A;  1FRP A;  1SPI A;  4QBA A;  5IM2 A;  2DVZ A;  4GX3 A;  5IZ1 A;  5IGA A;  1G0I A;  4PGP A;  3LV0 A;  2CZK A;  3BIH A;  4PAI A;  4MAG A;  4KXP A;  4UAB A;  2V4C A;  5EQ9 A;  2ZZX A;  2ZZW A;  2ZZV A;  3BIG A;  1FBP A;  1FSA A;  3MYU A;  2DE2 A;  2FIE A;  1FPB A;  4GWS A;  4N91 A;  2JJK A;  2B4M A;  4NG7 A;  4OA4 A;  5ET7 A;  5IZZ A;  5IZ3 A;  1IMD A;  3MST A;  4I3Y A;  5A5L A;  4PF6 A;  4N4U A;  1FBG A;  5LTC A;  1FJ6 A;  1YZ0 A;  5I7I A;  2FHY A;  1D9Q A;  5EQA A;  4AS5 A;  1CNQ A;  3PTY A;  5J16 A;  2XA5 A;  4GWZ A;  3IFA A;  1KZ8 A;  1IME A;  1FBH A;  2Q74 A;  1FPJ A;  3EKI A;  4OVT A;  4N81 A;  2Q8M A;  4JVC A;  1FBD A;  2HZL A;  4HXV A;  4QXD A;  4P1L A;  4N6D A;  4LN5 A;  2P3N A;  2HZK A;  5LDZ A;  3NOH A;  2FBP A;  5EYG A;  1IMB A;  4NAP A;  1XI6 A;  4MHF A;  4HE1 A;  4X9T A;  4PFI A;  4G61 A;  1NV5 A;  1DCU A;  2PCR A;  4OVP A;  4MNP A;  4YIC A;  3T1B A;  2Q9T A;  2F3B A;  3FBP A;  4GBW A;  1FPI A;  4PDH A;  3SZP A;  4GWU A;  4F19 A;  4F1V A;  1G0H A;  2Y5K A;  4JVI A;  1DBZ A;  2B4L A;  2CEY A;  3W9W A;  4N8G A;  1RDY A;  2MKZ A;  4N15 A;  4PF8 A;  2R8T A;  4MJO A;  4PAF A;  4OVQ A;  3ISP A;  4XF5 A;  4NN3 A;  3RPL A;  2XXK A;  1NV6 A;  2L5V A;  4YZZ A;  3W9V A;  2CEX A;  1FJ9 A;  1Q9D A;  1RDZ A;  2WYP A;  1FBF A;  3RYD A;  3B50 A;  1FPE A;  3KC1 A;  1FPD A;  4GX4 A;  4H46 A;  1IMF A;  4O7M A;  4NQ8 A;  3A29 A;  5ET5 A;  5J1D A;  1K9Z A;  2KR0 A;  4DI3 D;  1NV1 A;  2QVV A;  1NUX A;  4MMP A;  4MNC A;  2KQZ A;  4N17 A;  4PDD A;  5DW8 A;  1EYJ A;  3KC0 A;  3T0J A;  1BK4 A;  2OWZ A;  2QFL A;  1QGX A;  4N8Y A;  2CZI A;  4P56 A;  2P3V A;  4OVR A;  3IFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...