3GYYA

The ectoine binding protein of the teaabc trap transporter teaa in the apo-state
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
308
structure length
303
Chain Sequence
DNWRYAHEEYEGDVQDVFAQAFKGYVEDNSDHTVQVYRFGELGIMEQTQNGILQFVNQSPGFTGSLIPSAQIFFIPYLMPTDMDTVLEFFDESKAINEMFPKLYAEHGLELLKMYPEGEMVVTADEPITSPEDFNKKIRTMTNPLLAETYKAFGATPTPLPWGEVYGGLQTGIIDGQENPIFWIESGGLYEVSPNLTFTSHGWFTTAMMANQDFYEGLSEEDQQLVQDAADAAYDHTIEHIKGLSEESLEKIKAASDEVTVTRLNDEQIQAFKERAPQVEEKFIEMTGEQGQELLDQFKADLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic substrate binding protein
publication title Evidence for an allosteric mechanism of substrate release from membrane-transporter accessory binding proteins
pubmed doi rcsb
source organism Halomonas elongata
molecule tags Transport protein
total genus 104
structure length 303
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3gyyA00
5IGAA 2XA5A 4PC9A 4XF5A 2XWKA 4P3LA 2XWOA 2XWIA 2XXKA 4PDHA 4P1EA 5I7IA 4DI4B 4YICA 4MX6A 3FXBA 4OVPA 2XWVA 4PE3A 4NG7A 4PETA 4N17A 2ZZWA 4MNIA 4X8RA 4P47A 2HZKA 4O7MA 4UABA 3U65A 4OANA 4P56A 4N6DA 2V4CA 4PGPA 4DI3D 4N8YA 4OA4A 2HZLA 2PFZA 4NX1A 4LN5A 5IM2A 2CEYA 4OVTA 4PDDA 2ZZXA 4XEQA 4O8MA 4NQ8A 4N4UA 2WYPA 3GYYA 4XFEA 4MNPA 4NGUA 4PAFA 2ZZVA 4PFIA 4OVRA 3B50A 2PFYA 4NHBA 5CM6A 2VPOA 4P8BA 4P1LA 4PCDA 4OVQA 5I5PA 4X04A 4NN3A 4N15A 4NF0A 4PBQA 4PAIA 4O94A 4YZZA 2HPGA 4MEVA 2WYKA 4PBHA 2WX9A 4MCOA 4NAPA 4PF6A 4PFRA 4MMPA 4N6KA 4MNCA 4MIJA 4OVSA 2VPNA 4MAGA 4MHFA 4N91A 4PFBA 4PGNA 4PF8A 5IZZA 5LTCA 2CEXA 4N8GA 4PAKA 4P9KA
chains in the Genus database with same CATH superfamily
1Y1ZA 5AA3A 5J16A 4OTEA 3SESA 2A5TA 2XXKA 1BK4A 4NF4B 1B7UA 5F1QA 5I58A 1R9QA 2F8DA 4EXLA 2G93A 1MQJA 3U72A 3MUQA 3R7XA 5JTYA 1B0HA 4JBZA 2A5TB 4R2FA 2I48A 2XWVA 4C0RA 3VVDA 5A5XA 2P0SA 4NG7A 2THIA 3PGFA 1YPNA 5I58B 5IZ3A 2F5XA 1XS5A 5JTYB 4JVDA 3RQTA 2PX1A 5A5XB 1N7XA 1QGXA 3I6VA 4H45A 5IZ3B 4HW8A 2R9JA 3MPLA 4DDDA 4NX1A 1Q35A 5CRYA 2ZZXA 5HBCA 4FORA 1SW1A 1FPEA 3T9UA 1SD3A 4MLVA 4OMBA 5CMMA 4OVRA 3B50A 1P1UA 2GH9A 2WKYA 3CRBA 3N5LA 3FXQA 3AXFA 4NN3A 1RYXA 4MFIA 2PT2A 1Y3PA 1DPEA 3S9NC 5CMCA 1FRPA 3MP6A 4EQ9A 4KD5A 3FV1A 4LQ2A 2VOZA 1MS7A 5JK4A 1PBPA 1RDZA 3K1NA 1FCKA 3O6IA 2V3UA 4GL0A 1LBZA 4MBPA 1USYE 1B58A 4KQPA 1O63A 4LN5A 4X9TA 5ISUA 1B7HA 4OFLA 3VLUA 4U4XA 3W9WA 5I84A 2V3TA 2WBBA 4PDHA 2Q8JA 1FTJA 4GWXA 4R73A 3LSXA 4RPOA 2F3BA 1UTBA 4ELQA 3OXNA 4F1UA 4EQ7A 4PTKA 4FJPA 3FXUA 5ELVA 5B7DA 2Y7PA 2Y84A 1PB8A 4NTLA 3W15C 3EPEA 3O97A 3C9HA 1UTBB 1IUDA 2F35A 4O7MA 1Z7ME 2DDKA 2ZXTA 5LDZA 1CB6A 3IOTA 3T96B 1ATGA 2RKMA 3ILUB 1FTKA 2F6PA 4I62A 4MLQA 3CVGA 3TQLA 1IITA 3LUZA 4ESXA 1NH7A 2H99A 4E0WA 3TFLA 2ZNSA 4BLAA 3SERA 4YB5A 1II5A 1SI0A 4HXVA 4WXJA 4ELPA 4P8BA 1LBYA 3PTYA 2CZLA 2P3VA 4EF1A 1M5EA 2JJKA 3PPQA 3MPKA 3TUSA 2AL4A 2KQZA 2R71A 3Q28A 1NFTA 3QXMA 2VPNA 4LZ7A 3O9PA 3OEKA 4PF8A 1FPDA 3E4RA 4GXAA 4KHZE 5IGAA 4GWZA 1UQWA 1A40A 3S9EA 3K1MA 4KYEA 1SQYA 1MG1A 1FBCA 2O7IA 2XWIA 4U4SA 3MVXA 1A8FA 1DSNA 2X26A 1SPIA 4YU0A 5KDTA 2FIEA 1NV3A 2QRYA 4OFJA 1CNQA 3EQ1A 4O7IA 2I6EA 4F2QA 1OLCA 1DK4A 4IO6A 3G3FA 1LFHA 1MQDA 3HN0A 3F11A 3C32A 5KDTB 1M5CA 1QW0A 2D5WA 2F7AA 1B32A 1IMEA 2DQVA 5M2VA 2MKZA 4Z7EA 2RCAA 3W9VA 1DMBA 1A99A 4JVIA 4R75A 2WYPA 3M3LA 2QS2A 1USYH 4NHBA 1B5HA 5I2NA 4EQBA 3C35A 3D1RA 1A54A 1RYOA 4KXPA 1QJMA 5K2XA 3CFZA 1NV6A 3MP1A 4PBHA 5I2NB 4PFRA 1OIBA 1SBPA 3D4CA 3MJNA 4OVSA 4HCYA 3FJMA 1JW1A 4R2BA 1I6AA 4WEPA 3SETA 2OLBA 3K2DA 1B7ZA 5ICTA 3C33A 3HHFA 1HSJA 3UK4A 4U1ZA 3MZ9A 4UA8A 1D9VA 4XF5A 1AWBA 4YKPA 1B3LA 1JQFA 1QULA 4NF5A 3H06B 2DWIA 4DI4B 4YICA 4F19A 2O68A 5ET6A 1PB7A 1QKBA 1IMBA 1P1WA 2UVHA 4H8IA 5I57A 2KR0A 2B3FA 3VXCA 1FQBA 5FHNA 4JB7A 4NF5B 1NUXA 3FGSA 1GV8A 5TPAA 1DCUA 5I57B 3HHGA 2LAOA 5K2YA 3IOUA 1PDAA 2FIXA 5HPQA 3OENA 4P11A 4LONB 1FBDA 3H6TA 1LAXA 4GWWA 3EN3A 3KOSA 1YAEA 5TPAB 5EHSA 5ITOA 4OESA 4WKMA 1LFGA 2GHAA 1R1NA 3VE1B 4PFTA 2ANJA 1NV5A 2F3DA 2B4LA 2QL3A 3L6HA 3OO7A 3DP4A 4GXSB 4PCDA 2XXPA 3QYTA 4M1VA 4H46A 1FW0A 1OVTA 3PD8A 2XXRA 3IFCA 2DSFA 2QS1A 4OZ9A 1UTHA 1M5BA 1D9QA 1JP4A 1VR5A 4MIJA 2CZKA 1AL3A 1YYZA 1FJ6A 3CIJA 3L6GA 1GVCA 1SYHA 1H76A 1BTJA 4F18A 3FJGA 3RGYA 3KJ7A 2Y7IA 1Q9DA 1VE4A 4LVQA 1UTHB 2XA5A 4TOZA 1SYIA 3TAJA 1B3GA 1I6QA 1TFDA 2QMXA 3BIGA 1QUIA 4N81A 4GL8A 2Z8DA 2ABHA 2B65A 2RC9A 3EF7A 3ZS6A 1LAFE 1ZIUA 2DWAA 2XXQA 1EH3A 4MNIA 3FASA 1FQAA 3U93A 2F78A 4AS4A 5KZTA 1LBBA 4G8NA 3RUMA 4XKPA 2HXRA 3FVOA 2PMSA 2B4MA 2V4CA 4XTCQ 4RPNA 5ITPA 1F9BA 5AA2D 3VXBA 2BJIA 3UGWA 4PDDA 3CR9A 3IB2A 4MNPA 3Q27A 2ZZVA 4THIA 3PMXA 3LR1A 4QHQA 2CMOA 4P1LA 3TTLA 3MC2A 4ISUA 1JVYA 3IO4A 3DM0A 4NF0A 4G8HA 5DEXA 3KBRA 2PBWA 2UXAA 2QMWA 1FPGA 2NUVA 1AMFA 1IMCA 1OQGA 3MSTA 4BDOA 1NUZA 1TFAA 1NV2A 2HEUA 1FPBA 4GX4A 3NOHA 1VFEA 4PFBA 5DEXB 2Z23A 3GXAA 1LEVA 3KOTA 3ISPA 2FNCA 2P2AA 3BKIB 3PMVA 2Q74A 4FEBA 3P7IA 4RK2A 4MH5A 2QJEA 3ILTB 2G29A 3K02A 2Z8EA 3U94A 3H6WA 4U2RA 2VGQA 4JSDA 4DIGA 3U8QA 3IJOB 3A29A 1SI1A 5FHMA 4EUOA 3OSQA 5EYHA 1MPDA 4R74A 1JW4A 4PETA 3C4MA 1YCJA 4N13A 1KZ8A 1ZKBA 4EF2A 2I58A 3E9XA 2DWHA 3PUZE 4KYDA 3B6WA 4I3EA 4YB6A 2FVZA 4N8YA 4P0IA 2XXWA 4PFYA 4LA9A 3PUYE 3T9VA 2XXTA 4OENA 2OZZA 5IAIA 2F7BA 4ZE8A 3CFXA 3IB1A 3TTMA 3VLVA 3T93B 3PMWA 5DTBA 3BIHA 1LAGE 2CZHA 3OO9A 2VT5A 2VPOA 1MQHA 2H5YA 1FSAA 1H3DA 3KSJA 1NUWA 2UYFA 1B9JA 2FBPA 1NUYA 3IR1A 2HAVA 5IKBA 1RKMA 4FIMA 4N6KA 4YKIA 4DXUA 5I56A 4MAGA 2F36A 2I0BA 3FUZA 1Z7NE 2ZMBA 4JWYA 3SKPA 4MF3A 4C1UA 1B2HA 4NWCA 3TDJA 2ONSA 5I56B 3WAEA 3FVGA 4DXBA 3K6XA 3RT8A 4POWA 2F97A 4Q5TA 4MX6A 3KN8A 3SEYA 3O6HA 4GIZA 1SW2A 3ONMA 1VSOA 1LB9A 3TMGA 1FBPA 1HSEA 1MXWA 2Y7RA 2OWSA 4YB7A 1IXCA 1B6HA 3UP9A 1O64A 3VVEA 1PEBA 1GR2A 1QVSA 3T0JA 3FXRA 3N94A 4HE2A 1SW5A 5EYFA 2I49A 1G0HA 1MPBA 1LLSA 1FQEA 2RCBA 3QUJA 4AB5A 2V3QA 2XD2A 4XEQA 4NQ8A 5EQ7A 4YKKA 1LBCA 2H98A 1CE2A 1IXGA 5I59A 3FBPA 4KPTA 2Z8FA 3KFMA 3C31A 4GBVA 3BFUA 2QSXA 1IMAA 3HO7A 5I59B 4N6PA 5CC2A 2WEFA 1IQ7A 2XXIA 2O69A 1JNFA 1MQGA 3LC8A 4NF8A 5FTHA 5A5LA 2VD3A 3PV0E 3EHUA 4DE8A 4OQOA 1A8EA 1B0LA 4L17A 2Q9TA 4PP0A 4QFLA 3IFAA 4IB2A 4NF8B 3UIFA 2XWKA 4LZ5A 4RNSA 4GWSA 2RC7A 3LBSA 3V8XB 2NWJA 3KN7A 3I3VA 3TPAA 1IIWA 1OMPA 3KJTA 4K3FA 2HFBA 4Q0CA 1N3WA 4OFOA 3PUWE 5BWJA 2Y7WA 3HFUA 4F3SA 3IJXB 1S9TA 4GX3A 3SDFA 4QRZA 4RA1A 3H7MA 4HE1A 1LAHE 1B3HA 2R8TA 1MXYA 1XVYA 4IGRA 4Z0IA 3MAMA 2GRVA 1VFDA 3G3GA 1DTZA 3RT6B 2DVZA 3V83A 4U22A 4C1TA 2OK2A 1TT1A 2HAUA 5CMBA 2XXVA 3QUFA 1K9ZA 4G68A 3JV9A 4OA4A 5HM4B 4AQ4A 1WVJA 3ROJA 1XT8A 4R6HA 2Q89A 2CEYA 2VP1A 4IR8A 4X1BA 4FAJA 4PAFA 4XKNA 4YKJA 2O6AA 5CBSA 2V84A 4HE0A 4ZEIA 1NNFA 4U21A 4X48A 3OD7A 1INPA 1N7WA 4N15A 3RYDA 4MEVA 1URSA 5JEIA 2CZIA 3RTWB 1KA0A 4N91A 5H8SA 4EXKA 5CBRA 1FTOA 3K1PA 1SVXB 1MY0A 4GQOA 1AIVA 4PAKA 3VVFA 3S9MC 1DOTA 1TXFA 1OVBA 2O7UA 4F2OA 1XC1A 3FD3A 4GWOA 3U1OA 3HV1A 1B5IA 1FQCA 3G3IA 4PE5B 1UIUA 1QKAA 3PUXE 4OVPA 2ALUA 4F22A 1NNPA 5DW8A 1ZJLA 5DVFA 5H8QA 4H6DA 3TKDA 1IXIA 4GWYA 1NNKA 1LFIA 3RPLA 3MP8A 2IEEA 2WBDA 3MWBA 4UABA 4R9GA 3C34A 5L8DA 4O3AA 1MM6A 4RJZA 5H8QB 4DI3D 4FATA 4RY1A 2GQ1A 3E13X 3RPLB 1B46A 3M3FA 1N0TA 4OXVA 3HSTA 4KR5A 2W7YA 3GYYA 3IOWA 4RK9A 3H6UA 2H4IA 3Q29A 4ECFA 1B5JA 2RC8A 1B1HA 3MVYA 3D4GA 1NV0A 4XKQA 2HPGA 2WYKA 2XXHA 4KCDA 1Y1MA 2FHYA 4NAPA 3RTFB 2DXYA 4PQJA 1B3EA 3PD9A 2KLFA 3H3GA 3TQWA 3A09A 4MHFA 3DLNA 4AS5A 4IO5A 4YMBA 1NMUA 2OWZA 1FPFA 4N8GA 3OO8A 1MY3A 5ICQA 1RDYA 4QSEA 4NF6A 4P3LA 4I8CA 2X7QA 2XXYA 1OLAA 4DCYA 2I4CA 2D21A 3K00A 3G3KA 1DTGA 1LCTA 1NNTA 4NF6B 2BJJX 5I3SA 4I3YA 4GD5A 2UVGA 2XX9A 2ONRA 4N17A 3T66A 1EYKA 1MXVA 5TP9A 2Q8MA 3FVNA 4KYSA 4F3GA 2XHDA 4QXDA 4PGPA 3EHSA 3SEUA 1LBVA 2HCAA 3SZPA 1FQDA 5TP9B 2F7CA 4ZECA 2YLNA 5AE4A 1LSTA 4ND9A 4DLDA 1M5DA 4GX6A 3GZGA 4ZEBA 4H8JA 4JSOA 3MVZA 3IO6A 3VDFA 1QUJA 1BKAA 2GFEA 2H9BA 3UN6A 4Q30B 2Y7KA 3PPRA 3R6UA 3LUYA 3O66A 3TCFA 5AA1A 3Q26A 4PBQA 4GF8A 4PAIA 4OEVA 4IO3A 3K6WA 4OEUA 4OERA 1MY2A 3I5OA 1YTVA 4OETA 4OWDA 1A7LA 1S7YA 1B4ZA 1NKXA 3QIMA 3OMBA 3DP6A 3THIA 1I69A 1LCFA 3PPNA 3IORA 1EYJA 3OELA 4PC9A 2UYEA 1P1QA 3B6TA 1IZ1A 3KGCA 4LUBA 1L5TA 5L9MA 2VD2A 4OVJA 5F24A 1MH3A 1A55A 3FV2A 1DBZA 1ELJA 4I40A 5CI5A 3IB0A 4GLIA 3JZJA 2A5SA 2I3WA 2RF1A 1MXXA 3G3JA 4ONYA 1P99A 1N84A 2HZKA 1KWHA 5FTIA 4OANA 3B8BA 3KG2A 5EYGA 4JDFA 4F3BA 3E3KA 1MQIA 2HZLA 4O3BA 2Z22A 4IY6A 5B70A 4OVTA 2M8CA 4ELOA 3K6UA 4R6KA 2DWJA 1LBXA 4ZE9A 3TCGA 2QS4A 1MDP1 5AA4A 1N76A 4ZEFA 3TZAA 5H8FA 1MH4A 1B05A 1O7TA 4E0XA 4LQ5A 2NOOA 4GRKA 2V25A 5ESYA 4X04A 3E79A 4GOTA 1US4A 3EKIA 4H1XA 2H25A 3MVWA 5AA4B 5H8FB 1HSLA 2PT1A 1FPJA 4XXUA 2OX3A 4FEDA 4MNCA 2QPQA 1NV1A 4WEDA 1EZPA 1Y9UA 3OEMA 3VV5A 1D4NA 2DE3A 3HPIA 2CEXA 4OYVA 2QFLA 4TLMB 1ZBMA 2XXUA 2DOJA 1N04A 2ZYKA 3OO6A 1IXHA 3T9HB 2O1LA 1JVXA 1MM7A 5I7IA 2P1SA 4BDQA 1FBEA 3K4UA 2OJTA 3VLWA 4P0GA 3G7WA 5FBPA 2ZZWA 1JEVA 3K01A 1BP5A 2YPNA 3QSLA 4FBPA 4R9FA 3U65A 3ODBA 4GFRA 4ESWA 2UVIA 1N3XA 4F29A 1NV4A 2Y5KA 2REJA 4QFOA 1B51A 3OSRA 4U1OA 2E1SA 5H8NA 1URDA 2V93A 3N6TA 4XFEA 2ZYOA 4X1DA 2ONKE 1FBHA 3KN3A 2QVUA 1PB9A 5CM6A 1H43A 4KI0E 1P1OA 4GWUA 1K9YA 3IOVA 1EZ9A 5T3JA 5H8NB 3CHGA 3M8UA 3EHTA 5LOMA 1WDNA 4HCWA 2WX9A 4MCOA 1DPPA 2HHMA 2Q2CA 1LBWA 2DYXA 1M5FA 1FTLA 2REGA 2Q88A 3MYUA 4RXLA 2QVRA 5DVIA 3RLFE 2Y5LA 1D9YA 3K6VA 1B3FA 4F31B 5L9SA 3G3HA 2I0CA 3TEPA 5DYHA 3ZKKA 4TQUQ 4DXCA 3S4UA 2IA4A 4ZEKA 5IZ1A 2DP8A 1FPIA 3IX1A 4G68C 2QVVA 1J1NA 3CG1A 3WAFA 1PBQA 2Q2AA 5CMKA 5L9OA 4KFQA 4F3PA 4Q8RA 4FE8A 4QSDA 4IY5A 4GVOA 1EZOA 2XX8A 4H67A 2RINA 3UA8A 1IMDA 1YZ0A 3IK6B 3USDA 2OBGA 3Q25A 4BDMA 1MY1A 4LP2B 3H03A 1US5A 3B7DA 4OVQA 2AIXA 4AB6A 3KC1A 2NXOA 4PFWA 1NH8A 1GTKA 2B3BA 3N6UA 4G77A 1Y4CA 2UVJA 2PCRA 4O94A 5I2KA 4YAHX 1MXUA 5BUUA 1MY4A 1ANFA 1YXIA 4MMPA 1R9LA 2DXRA 4IO7A 4G68B 3TTNA 1OQHA 3TTRA 5I2KB 5EQAA 1TWYA 2ZNUA 3MW0A 4EDPA 3QK6A 3KSXA 3DP8A 4I1DA 3H4ZA 1Y3NA 1BLFA 4P1EA 3MBPA 5H8HA 4JWXA 1MPCA 2XD3A 4NEDA 3VFJA 3PPOA 4IGTA 3PPPA 1RDXA 3E78A 1FJ9A 4G2ZA 3KC0A 1D3KA 2VHAA 3RNNA 1ZMGA 4G61A 5H8HB 1R6ZA 4P47A 2DE2A 5EQ8A 3O6GA 3FJ7A 4MJOA 2D3IA 1EYIA 1MDQA 1S50A 4H5GA 3S2VA 3KBZA 1XVXA 3R26A 2DE4A 4ZS9A 3ZKLA 3LV0A 5TU0A 4LZ8A 3JYRA 4ELRA 4GBWA 4NE4A 4JWOA 4R72A 5IM2A 3RPWA 4O8MA 1NV7A 4QBAA 5ET8A 5DVJA 3LSLA 1T0KA 4IO4A 4F1VA 1UIVA 1WODA 2FA7A 5J1DA 3H6VA 4JVCA 2ESNA 1ZTYA 3O28A 4G8MA 1Y3QA 5ET7A 1ZU0A 1B40A 2P3NA 2I4BA 4QFPA 2I3VA 2X7PA 3KZGA 4QFKA 4HS7A 3FIRA 4DCXA 3CSGA 5IZZA 4R6YA 4KCCA 2HXWA 4U23A 3QAXA 3C36A 1POTA 2DVCA 2ZYNA 1H44A 3TODA 1FBGA 1I6BA 3CFLA 2DS9A 1GGGA 4JXIA 2O84X 2O1MA 3FXBA 3PUVE 4PE3A 3IAZA 3LSFB 3N26A 4ZDMA 3HCQA 1FPKA 5FHOA 4YMAA 3S9LC 3A3UA 4XIGQ 3SEXA 3GLBA 3UORA 1Y20A 3TELA 4IO2A 4N6DA 1IMFA 3TTKA 3CG3A 1URGA 3ZSFA 1JEUA 4O3CA 1B52A 1JETA 3DELB 3V89B 2PVUA 4N4UA 2L5VA 1LB8A 4F1YA 1P1NA 3T9XB 4FECA 4PFIA 3FVKA 2FYIA 3M3KA 2ZYMA 1NL5A 5I5PA 2E0SA 5AA2A 3TYHA 1EU8A 4QSCA 2AL5A 2XXXA 3FZVA 4YZZA 4H5FA 4ZZAA 1SW4A 1FTMA 3GBBA 1VDWA 3T1BA 1ZLQA 5AA2B 1XOCA 1MRPA 4PFUA 4BDLA 4DZ1A 4P9KA 2F6GA 3RN8A 4I9DA 4UACA 2F34A 2ZNTA 3V5AA 2XWOA 4QFNA 2QS3A 3ECRA 5EHMA 4ZZEA 3FATA 3TCHA 1B4HA 2NVUB 4H65A 3SEWA 5EQ9A 3SEVA 2XX7A 3BFTA 5DT6A 1JW5A 1MXZA 2AYSA 3B6QA 2PYYA 3CI8A 4X8RA 1QUKA 3MZ1A 3PU5A 3CSBA 4OHNA 3IL1B 5KCJA 2YJPA 1FQFA 3RY3A 1FTAA 1AH5A 3K0VA 2O51A 4P56A 4H0WA 4QF9A 1Q1KA 3U92A 4HTGA 1FBFA 4LATA 3T22A 2PFZA 2HQ0A 1IEJA 5KCJB 1G0IA 3MZBA 4NMYA 3QMFA 4M4GA 4POXA 4NWDA 2R6GE 4NGUA 1KA1A 4N07A 1POY1 4G4PA 3MQ9A 5ET5A 2PFYA 3A3CA 3GBAA 2GHBA 1AOVA 2OWTA 1XI6A 1FPLA 1XHYA 3BBRA 4TLLB 4RYAA 1B1XA 4PF6A 4BDRA 1LGBC 2OCUA 1BIYA 4F39A 1SDXA 4ZEDA 4XKRA 4BDNA 1NI9A 5F7VA 3O29A 4PGNA 3KEIA 1Y4TA 4NF4A 3LSWA 1PC3A 3O2AA 1H45A 5LTCA 3OOAA
chains in the Genus database with same CATH topology
2XA5A 5J16A 2XXKA 3BIGA 4N81A 1BK4A 5IZ1A 1FPIA 4OVPA 2XWVA 5DW8A 4NG7A 2QVVA 4MNIA 5IZ3A 2F5XA 4GWYA 3RPLA 4JVDA 2WBDA 4AS4A 4UABA 2HXRA 2B4MA 2V4CA 1QGXA 4DI3D 4H45A 5IZ3B 2GQ1A 1IMDA 4NX1A 1YZ0A 3RPLB 2BJIA 4PDDA 2ZZXA 3GYYA 4MNPA 1FPEA 2ZZVA 4OVRA 3B50A 4P1LA 4OVQA 3KC1A 4NN3A 4NF0A 1NV0A 4O94A 2PCRA 2HPGA 2WYKA 1FPGA 1IMCA 2FHYA 3MSTA 4NAPA 1FRPA 1NUZA 1YXIA 1NV2A 4MMPA 1FPBA 4GX4A 3NOHA 5JK4A 1RDZA 4MHFA 4PFBA 5EQAA 4AS5A 2OWZA 1LEVA 1FPFA 1LBZA 3ISPA 4N8GA 4LN5A 2Q74A 4X9TA 1RDYA 4P3LA 3W9WA 2WBBA 4PDHA 4P1EA 4GWXA 3A29A 2F3BA 4F1UA 5EYHA 5I3SA 4I3YA 1RDXA 3E78A 4PTKA 1FJ9A 4PETA 3KC0A 4N17A 1KZ8A 4G61A 1EYKA 4P47A 2DE2A 5EQ8A 4MJOA 2Q8MA 4O7MA 1EYIA 3KBZA 2DDKA 5LDZA 4QXDA 4PGPA 4I3EA 2DE4A 2FVZA 4N8YA 3LV0A 1LBVA 4GBWA 3SZPA 5IM2A 3LUZA 4O8MA 1NV7A 4GX6A 4QBAA 5ET8A 4F1VA 3BIHA 2CZHA 2VT5A 4HXVA 2VPOA 4P8BA 1LBYA 3PTYA 1FSAA 2P3VA 5J1DA 4JVCA 2JJKA 1NUWA 2FBPA 4PBQA 1NUYA 4PAIA 5ET7A 2KQZA 2P3NA 4N6KA 2VPNA 4MAGA 4PF8A 1FPDA 5IZZA 5IGAA 4GWZA 1EYJA 4PC9A 1FBCA 2XWIA 1FBGA 4MX6A 5F24A 1SPIA 1DBZA 3FXBA 1FBPA 2FIEA 4I40A 1NV3A 4PE3A 1CNQA 4O7IA 1DK4A 1FPKA 3T0JA 2HZKA 4HE2A 4OANA 3B8BA 5EYGA 4N6DA 1IMFA 1G0HA 1IMEA 2MKZA 2HZLA 3W9VA 4JVIA 4OVTA 2V3QA 4XEQA 4NQ8A 4N4UA 5EQ7A 2L5VA 2WYPA 1LBXA 4PFIA 3FBPA 4NHBA 5I5PA 5ESYA 4X04A 4GBVA 3E79A 3D1RA 4YZZA 3EKIA 1IMAA 4KXPA 4PBHA 1NV6A 1VDWA 3T1BA 1FPJA 4PFRA 2WEFA 2OX3A 4MNCA 2QPQA 1NV1A 4OVSA 4HCYA 5A5LA 2DE3A 2CEXA 4P9KA 2Q9TA 2QFLA 3IFAA 4XF5A 2XWKA 1AWBA 2XWOA 4GWSA 5I7IA 4DI4B 4YICA 4F19A 1FBEA 5ET6A 5EQ9A 1IMBA 3HFUA 2KR0A 4GX3A 1NUXA 5FBPA 4HE1A 2ZZWA 2R8TA 4X8RA 1DCUA 4FBPA 2DVZA 2FIXA 1FTAA 3U65A 4P56A 1FBDA 4GWWA 1K9ZA 4OA4A 3ROJA 1FBFA 1NV4A 2Y5KA 2PFZA 2CEYA 1G0IA 3QMFA 4IR8A 4XFEA 4NGUA 1KA1A 1NV5A 2F3DA 4PAFA 2B4LA 1FBHA 2QVUA 5ET5A 2PFYA 5CM6A 4HE0A 4GWUA 4PCDA 1XI6A 1K9YA 5T3JA 1FPLA 4M1VA 1INPA 3CHGA 4H46A 4N15A 3RYDA 3IFCA 4MEVA 4HCWA 2WX9A 4MCOA 2Y5LA 4PF6A 1D9QA 2HHMA 1JP4A 4MIJA 1LBWA 2CZKA 2CZIA 1YYZA 1FJ6A 1KA0A 4N91A 1NI9A 4F18A 4PGNA 3MYUA 2QVRA 1Q9DA 4PAKA 5LTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGA A;  2XA5 A;  4PC9 A;  4XF5 A;  2XWK A;  4P3L A;  2XWO A;  2XWI A;  2XXK A;  4PDH A;  4P1E A;  5I7I A;  4DI4 B;  4YIC A;  4MX6 A;  3FXB A;  4OVP A;  2XWV A;  4PE3 A;  4NG7 A;  4PET A;  4N17 A;  2ZZW A;  4MNI A;  4X8R A;  4P47 A;  2HZK A;  4O7M A;  4UAB A;  3U65 A;  4OAN A;  4P56 A;  4N6D A;  2V4C A;  4PGP A;  4DI3 D;  4N8Y A;  4OA4 A;  2HZL A;  2PFZ A;  4NX1 A;  4LN5 A;  5IM2 A;  2CEY A;  4OVT A;  4PDD A;  2ZZX A;  4XEQ A;  4O8M A;  4NQ8 A;  4N4U A;  2WYP A;  3GYY A;  4XFE A;  4MNP A;  4NGU A;  4PAF A;  2ZZV A;  4PFI A;  4OVR A;  3B50 A;  2PFY A;  4NHB A;  5CM6 A;  2VPO A;  4P8B A;  4P1L A;  4PCD A;  4OVQ A;  5I5P A;  4X04 A;  4NN3 A;  4N15 A;  4NF0 A;  4PBQ A;  4PAI A;  4O94 A;  4YZZ A;  2HPG A;  4MEV A;  2WYK A;  4PBH A;  2WX9 A;  4MCO A;  4NAP A;  4PF6 A;  4PFR A;  4MMP A;  4N6K A;  4MNC A;  4MIJ A;  4OVS A;  2VPN A;  4MAG A;  4MHF A;  4N91 A;  4PFB A;  4PGN A;  4PF8 A;  5IZZ A;  5LTC A;  2CEX A;  4N8G A;  4PAK A;  4P9K A; 
#chains in the Genus database with same CATH topology
 1Y1Z A;  5AA3 A;  5J16 A;  4OTE A;  3SES A;  2A5T A;  2XXK A;  1BK4 A;  4NF4 B;  1B7U A;  5F1Q A;  5I58 A;  1R9Q A;  2F8D A;  4EXL A;  2G93 A;  1MQJ A;  3U72 A;  3MUQ A;  3R7X A;  5JTY A;  1B0H A;  4JBZ A;  2A5T B;  4R2F A;  2I48 A;  2XWV A;  4C0R A;  3VVD A;  5A5X A;  2P0S A;  4NG7 A;  2THI A;  3PGF A;  1YPN A;  5I58 B;  5IZ3 A;  2F5X A;  1XS5 A;  5JTY B;  4JVD A;  3RQT A;  2PX1 A;  5A5X B;  1N7X A;  1QGX A;  3I6V A;  4H45 A;  5IZ3 B;  4HW8 A;  2R9J A;  3MPL A;  4DDD A;  4NX1 A;  1Q35 A;  5CRY A;  2ZZX A;  5HBC A;  4FOR A;  1SW1 A;  1FPE A;  3T9U A;  1SD3 A;  4MLV A;  4OMB A;  5CMM A;  4OVR A;  3B50 A;  1P1U A;  2GH9 A;  2WKY A;  3CRB A;  3N5L A;  3FXQ A;  3AXF A;  4NN3 A;  1RYX A;  4MFI A;  2PT2 A;  1Y3P A;  1DPE A;  3S9N C;  5CMC A;  1FRP A;  3MP6 A;  4EQ9 A;  4KD5 A;  3FV1 A;  4LQ2 A;  2VOZ A;  1MS7 A;  5JK4 A;  1PBP A;  1RDZ A;  3K1N A;  1FCK A;  3O6I A;  2V3U A;  4GL0 A;  1LBZ A;  4MBP A;  1USY E;  1B58 A;  4KQP A;  1O63 A;  4LN5 A;  4X9T A;  5ISU A;  1B7H A;  4OFL A;  3VLU A;  4U4X A;  3W9W A;  5I84 A;  2V3T A;  2WBB A;  4PDH A;  2Q8J A;  1FTJ A;  4GWX A;  4R73 A;  3LSX A;  4RPO A;  2F3B A;  1UTB A;  4ELQ A;  3OXN A;  4F1U A;  4EQ7 A;  4PTK A;  4FJP A;  3FXU A;  5ELV A;  5B7D A;  2Y7P A;  2Y84 A;  1PB8 A;  4NTL A;  3W15 C;  3EPE A;  3O97 A;  3C9H A;  1UTB B;  1IUD A;  2F35 A;  4O7M A;  1Z7M E;  2DDK A;  2ZXT A;  5LDZ A;  1CB6 A;  3IOT A;  3T96 B;  1ATG A;  2RKM A;  3ILU B;  1FTK A;  2F6P A;  4I62 A;  4MLQ A;  3CVG A;  3TQL A;  1IIT A;  3LUZ A;  4ESX A;  1NH7 A;  2H99 A;  4E0W A;  3TFL A;  2ZNS A;  4BLA A;  3SER A;  4YB5 A;  1II5 A;  1SI0 A;  4HXV A;  4WXJ A;  4ELP A;  4P8B A;  1LBY A;  3PTY A;  2CZL A;  2P3V A;  4EF1 A;  1M5E A;  2JJK A;  3PPQ A;  3MPK A;  3TUS A;  2AL4 A;  2KQZ A;  2R71 A;  3Q28 A;  1NFT A;  3QXM A;  2VPN A;  4LZ7 A;  3O9P A;  3OEK A;  4PF8 A;  1FPD A;  3E4R A;  4GXA A;  4KHZ E;  5IGA A;  4GWZ A;  1UQW A;  1A40 A;  3S9E A;  3K1M A;  4KYE A;  1SQY A;  1MG1 A;  1FBC A;  2O7I A;  2XWI A;  4U4S A;  3MVX A;  1A8F A;  1DSN A;  2X26 A;  1SPI A;  4YU0 A;  5KDT A;  2FIE A;  1NV3 A;  2QRY A;  4OFJ A;  1CNQ A;  3EQ1 A;  4O7I A;  2I6E A;  4F2Q A;  1OLC A;  1DK4 A;  4IO6 A;  3G3F A;  1LFH A;  1MQD A;  3HN0 A;  3F11 A;  3C32 A;  5KDT B;  1M5C A;  1QW0 A;  2D5W A;  2F7A A;  1B32 A;  1IME A;  2DQV A;  5M2V A;  2MKZ A;  4Z7E A;  2RCA A;  3W9V A;  1DMB A;  1A99 A;  4JVI A;  4R75 A;  2WYP A;  3M3L A;  2QS2 A;  1USY H;  4NHB A;  1B5H A;  5I2N A;  4EQB A;  3C35 A;  3D1R A;  1A54 A;  1RYO A;  4KXP A;  1QJM A;  5K2X A;  3CFZ A;  1NV6 A;  3MP1 A;  4PBH A;  5I2N B;  4PFR A;  1OIB A;  1SBP A;  3D4C A;  3MJN A;  4OVS A;  4HCY A;  3FJM A;  1JW1 A;  4R2B A;  1I6A A;  4WEP A;  3SET A;  2OLB A;  3K2D A;  1B7Z A;  5ICT A;  3C33 A;  3HHF A;  1HSJ A;  3UK4 A;  4U1Z A;  3MZ9 A;  4UA8 A;  1D9V A;  4XF5 A;  1AWB A;  4YKP A;  1B3L A;  1JQF A;  1QUL A;  4NF5 A;  3H06 B;  2DWI A;  4DI4 B;  4YIC A;  4F19 A;  2O68 A;  5ET6 A;  1PB7 A;  1QKB A;  1IMB A;  1P1W A;  2UVH A;  4H8I A;  5I57 A;  2KR0 A;  2B3F A;  3VXC A;  1FQB A;  5FHN A;  4JB7 A;  4NF5 B;  1NUX A;  3FGS A;  1GV8 A;  5TPA A;  1DCU A;  5I57 B;  3HHG A;  2LAO A;  5K2Y A;  3IOU A;  1PDA A;  2FIX A;  5HPQ A;  3OEN A;  4P11 A;  4LON B;  1FBD A;  3H6T A;  1LAX A;  4GWW A;  3EN3 A;  3KOS A;  1YAE A;  5TPA B;  5EHS A;  5ITO A;  4OES A;  4WKM A;  1LFG A;  2GHA A;  1R1N A;  3VE1 B;  4PFT A;  2ANJ A;  1NV5 A;  2F3D A;  2B4L A;  2QL3 A;  3L6H A;  3OO7 A;  3DP4 A;  4GXS B;  4PCD A;  2XXP A;  3QYT A;  4M1V A;  4H46 A;  1FW0 A;  1OVT A;  3PD8 A;  2XXR A;  3IFC A;  2DSF A;  2QS1 A;  4OZ9 A;  1UTH A;  1M5B A;  1D9Q A;  1JP4 A;  1VR5 A;  4MIJ A;  2CZK A;  1AL3 A;  1YYZ A;  1FJ6 A;  3CIJ A;  3L6G A;  1GVC A;  1SYH A;  1H76 A;  1BTJ A;  4F18 A;  3FJG A;  3RGY A;  3KJ7 A;  2Y7I A;  1Q9D A;  1VE4 A;  4LVQ A;  1UTH B;  2XA5 A;  4TOZ A;  1SYI A;  3TAJ A;  1B3G A;  1I6Q A;  1TFD A;  2QMX A;  3BIG A;  1QUI A;  4N81 A;  4GL8 A;  2Z8D A;  2ABH A;  2B65 A;  2RC9 A;  3EF7 A;  3ZS6 A;  1LAF E;  1ZIU A;  2DWA A;  2XXQ A;  1EH3 A;  4MNI A;  3FAS A;  1FQA A;  3U93 A;  2F78 A;  4AS4 A;  5KZT A;  1LBB A;  4G8N A;  3RUM A;  4XKP A;  2HXR A;  3FVO A;  2PMS A;  2B4M A;  2V4C A;  4XTC Q;  4RPN A;  5ITP A;  1F9B A;  5AA2 D;  3VXB A;  2BJI A;  3UGW A;  4PDD A;  3CR9 A;  3IB2 A;  4MNP A;  3Q27 A;  2ZZV A;  4THI A;  3PMX A;  3LR1 A;  4QHQ A;  2CMO A;  4P1L A;  3TTL A;  3MC2 A;  4ISU A;  1JVY A;  3IO4 A;  3DM0 A;  4NF0 A;  4G8H A;  5DEX A;  3KBR A;  2PBW A;  2UXA A;  2QMW A;  1FPG A;  2NUV A;  1AMF A;  1IMC A;  1OQG A;  3MST A;  4BDO A;  1NUZ A;  1TFA A;  1NV2 A;  2HEU A;  1FPB A;  4GX4 A;  3NOH A;  1VFE A;  4PFB A;  5DEX B;  2Z23 A;  3GXA A;  1LEV A;  3KOT A;  3ISP A;  2FNC A;  2P2A A;  3BKI B;  3PMV A;  2Q74 A;  4FEB A;  3P7I A;  4RK2 A;  4MH5 A;  2QJE A;  3ILT B;  2G29 A;  3K02 A;  2Z8E A;  3U94 A;  3H6W A;  4U2R A;  2VGQ A;  4JSD A;  4DIG A;  3U8Q A;  3IJO B;  3A29 A;  1SI1 A;  5FHM A;  4EUO A;  3OSQ A;  5EYH A;  1MPD A;  4R74 A;  1JW4 A;  4PET A;  3C4M A;  1YCJ A;  4N13 A;  1KZ8 A;  1ZKB A;  4EF2 A;  2I58 A;  3E9X A;  2DWH A;  3PUZ E;  4KYD A;  3B6W A;  4I3E A;  4YB6 A;  2FVZ A;  4N8Y A;  4P0I A;  2XXW A;  4PFY A;  4LA9 A;  3PUY E;  3T9V A;  2XXT A;  4OEN A;  2OZZ A;  5IAI A;  2F7B A;  4ZE8 A;  3CFX A;  3IB1 A;  3TTM A;  3VLV A;  3T93 B;  3PMW A;  5DTB A;  3BIH A;  1LAG E;  2CZH A;  3OO9 A;  2VT5 A;  2VPO A;  1MQH A;  2H5Y A;  1FSA A;  1H3D A;  3KSJ A;  1NUW A;  2UYF A;  1B9J A;  2FBP A;  1NUY A;  3IR1 A;  2HAV A;  5IKB A;  1RKM A;  4FIM A;  4N6K A;  4YKI A;  4DXU A;  5I56 A;  4MAG A;  2F36 A;  2I0B A;  3FUZ A;  1Z7N E;  2ZMB A;  4JWY A;  3SKP A;  4MF3 A;  4C1U A;  1B2H A;  4NWC A;  3TDJ A;  2ONS A;  5I56 B;  3WAE A;  3FVG A;  4DXB A;  3K6X A;  3RT8 A;  4POW A;  2F97 A;  4Q5T A;  4MX6 A;  3KN8 A;  3SEY A;  3O6H A;  4GIZ A;  1SW2 A;  3ONM A;  1VSO A;  1LB9 A;  3TMG A;  1FBP A;  1HSE A;  1MXW A;  2Y7R A;  2OWS A;  4YB7 A;  1IXC A;  1B6H A;  3UP9 A;  1O64 A;  3VVE A;  1PEB A;  1GR2 A;  1QVS A;  3T0J A;  3FXR A;  3N94 A;  4HE2 A;  1SW5 A;  5EYF A;  2I49 A;  1G0H A;  1MPB A;  1LLS A;  1FQE A;  2RCB A;  3QUJ A;  4AB5 A;  2V3Q A;  2XD2 A;  4XEQ A;  4NQ8 A;  5EQ7 A;  4YKK A;  1LBC A;  2H98 A;  1CE2 A;  1IXG A;  5I59 A;  3FBP A;  4KPT A;  2Z8F A;  3KFM A;  3C31 A;  4GBV A;  3BFU A;  2QSX A;  1IMA A;  3HO7 A;  5I59 B;  4N6P A;  5CC2 A;  2WEF A;  1IQ7 A;  2XXI A;  2O69 A;  1JNF A;  1MQG A;  3LC8 A;  4NF8 A;  5FTH A;  5A5L A;  2VD3 A;  3PV0 E;  3EHU A;  4DE8 A;  4OQO A;  1A8E A;  1B0L A;  4L17 A;  2Q9T A;  4PP0 A;  4QFL A;  3IFA A;  4IB2 A;  4NF8 B;  3UIF A;  2XWK A;  4LZ5 A;  4RNS A;  4GWS A;  2RC7 A;  3LBS A;  3V8X B;  2NWJ A;  3KN7 A;  3I3V A;  3TPA A;  1IIW A;  1OMP A;  3KJT A;  4K3F A;  2HFB A;  4Q0C A;  1N3W A;  4OFO A;  3PUW E;  5BWJ A;  2Y7W A;  3HFU A;  4F3S A;  3IJX B;  1S9T A;  4GX3 A;  3SDF A;  4QRZ A;  4RA1 A;  3H7M A;  4HE1 A;  1LAH E;  1B3H A;  2R8T A;  1MXY A;  1XVY A;  4IGR A;  4Z0I A;  3MAM A;  2GRV A;  1VFD A;  3G3G A;  1DTZ A;  3RT6 B;  2DVZ A;  3V83 A;  4U22 A;  4C1T A;  2OK2 A;  1TT1 A;  2HAU A;  5CMB A;  2XXV A;  3QUF A;  1K9Z A;  4G68 A;  3JV9 A;  4OA4 A;  5HM4 B;  4AQ4 A;  1WVJ A;  3ROJ A;  1XT8 A;  4R6H A;  2Q89 A;  2CEY A;  2VP1 A;  4IR8 A;  4X1B A;  4FAJ A;  4PAF A;  4XKN A;  4YKJ A;  2O6A A;  5CBS A;  2V84 A;  4HE0 A;  4ZEI A;  1NNF A;  4U21 A;  4X48 A;  3OD7 A;  1INP A;  1N7W A;  4N15 A;  3RYD A;  4MEV A;  1URS A;  5JEI A;  2CZI A;  3RTW B;  1KA0 A;  4N91 A;  5H8S A;  4EXK A;  5CBR A;  1FTO A;  3K1P A;  1SVX B;  1MY0 A;  4GQO A;  1AIV A;  4PAK A;  3VVF A;  3S9M C;  1DOT A;  1TXF A;  1OVB A;  2O7U A;  4F2O A;  1XC1 A;  3FD3 A;  4GWO A;  3U1O A;  3HV1 A;  1B5I A;  1FQC A;  3G3I A;  4PE5 B;  1UIU A;  1QKA A;  3PUX E;  4OVP A;  2ALU A;  4F22 A;  1NNP A;  5DW8 A;  1ZJL A;  5DVF A;  5H8Q A;  4H6D A;  3TKD A;  1IXI A;  4GWY A;  1NNK A;  1LFI A;  3RPL A;  3MP8 A;  2IEE A;  2WBD A;  3MWB A;  4UAB A;  4R9G A;  3C34 A;  5L8D A;  4O3A A;  1MM6 A;  4RJZ A;  5H8Q B;  4DI3 D;  4FAT A;  4RY1 A;  2GQ1 A;  3E13 X;  3RPL B;  1B46 A;  3M3F A;  1N0T A;  4OXV A;  3HST A;  4KR5 A;  2W7Y A;  3GYY A;  3IOW A;  4RK9 A;  3H6U A;  2H4I A;  3Q29 A;  4ECF A;  1B5J A;  2RC8 A;  1B1H A;  3MVY A;  3D4G A;  1NV0 A;  4XKQ A;  2HPG A;  2WYK A;  2XXH A;  4KCD A;  1Y1M A;  2FHY A;  4NAP A;  3RTF B;  2DXY A;  4PQJ A;  1B3E A;  3PD9 A;  2KLF A;  3H3G A;  3TQW A;  3A09 A;  4MHF A;  3DLN A;  4AS5 A;  4IO5 A;  4YMB A;  1NMU A;  2OWZ A;  1FPF A;  4N8G A;  3OO8 A;  1MY3 A;  5ICQ A;  1RDY A;  4QSE A;  4NF6 A;  4P3L A;  4I8C A;  2X7Q A;  2XXY A;  1OLA A;  4DCY A;  2I4C A;  2D21 A;  3K00 A;  3G3K A;  1DTG A;  1LCT A;  1NNT A;  4NF6 B;  2BJJ X;  5I3S A;  4I3Y A;  4GD5 A;  2UVG A;  2XX9 A;  2ONR A;  4N17 A;  3T66 A;  1EYK A;  1MXV A;  5TP9 A;  2Q8M A;  3FVN A;  4KYS A;  4F3G A;  2XHD A;  4QXD A;  4PGP A;  3EHS A;  3SEU A;  1LBV A;  2HCA A;  3SZP A;  1FQD A;  5TP9 B;  2F7C A;  4ZEC A;  2YLN A;  5AE4 A;  1LST A;  4ND9 A;  4DLD A;  1M5D A;  4GX6 A;  3GZG A;  4ZEB A;  4H8J A;  4JSO A;  3MVZ A;  3IO6 A;  3VDF A;  1QUJ A;  1BKA A;  2GFE A;  2H9B A;  3UN6 A;  4Q30 B;  2Y7K A;  3PPR A;  3R6U A;  3LUY A;  3O66 A;  3TCF A;  5AA1 A;  3Q26 A;  4PBQ A;  4GF8 A;  4PAI A;  4OEV A;  4IO3 A;  3K6W A;  4OEU A;  4OER A;  1MY2 A;  3I5O A;  1YTV A;  4OET A;  4OWD A;  1A7L A;  1S7Y A;  1B4Z A;  1NKX A;  3QIM A;  3OMB A;  3DP6 A;  3THI A;  1I69 A;  1LCF A;  3PPN A;  3IOR A;  1EYJ A;  3OEL A;  4PC9 A;  2UYE A;  1P1Q A;  3B6T A;  1IZ1 A;  3KGC A;  4LUB A;  1L5T A;  5L9M A;  2VD2 A;  4OVJ A;  5F24 A;  1MH3 A;  1A55 A;  3FV2 A;  1DBZ A;  1ELJ A;  4I40 A;  5CI5 A;  3IB0 A;  4GLI A;  3JZJ A;  2A5S A;  2I3W A;  2RF1 A;  1MXX A;  3G3J A;  4ONY A;  1P99 A;  1N84 A;  2HZK A;  1KWH A;  5FTI A;  4OAN A;  3B8B A;  3KG2 A;  5EYG A;  4JDF A;  4F3B A;  3E3K A;  1MQI A;  2HZL A;  4O3B A;  2Z22 A;  4IY6 A;  5B70 A;  4OVT A;  2M8C A;  4ELO A;  3K6U A;  4R6K A;  2DWJ A;  1LBX A;  4ZE9 A;  3TCG A;  2QS4 A;  1MDP 1;  5AA4 A;  1N76 A;  4ZEF A;  3TZA A;  5H8F A;  1MH4 A;  1B05 A;  1O7T A;  4E0X A;  4LQ5 A;  2NOO A;  4GRK A;  2V25 A;  5ESY A;  4X04 A;  3E79 A;  4GOT A;  1US4 A;  3EKI A;  4H1X A;  2H25 A;  3MVW A;  5AA4 B;  5H8F B;  1HSL A;  2PT1 A;  1FPJ A;  4XXU A;  2OX3 A;  4FED A;  4MNC A;  2QPQ A;  1NV1 A;  4WED A;  1EZP A;  1Y9U A;  3OEM A;  3VV5 A;  1D4N A;  2DE3 A;  3HPI A;  2CEX A;  4OYV A;  2QFL A;  4TLM B;  1ZBM A;  2XXU A;  2DOJ A;  1N04 A;  2ZYK A;  3OO6 A;  1IXH A;  3T9H B;  2O1L A;  1JVX A;  1MM7 A;  5I7I A;  2P1S A;  4BDQ A;  1FBE A;  3K4U A;  2OJT A;  3VLW A;  4P0G A;  3G7W A;  5FBP A;  2ZZW A;  1JEV A;  3K01 A;  1BP5 A;  2YPN A;  3QSL A;  4FBP A;  4R9F A;  3U65 A;  3ODB A;  4GFR A;  4ESW A;  2UVI A;  1N3X A;  4F29 A;  1NV4 A;  2Y5K A;  2REJ A;  4QFO A;  1B51 A;  3OSR A;  4U1O A;  2E1S A;  5H8N A;  1URD A;  2V93 A;  3N6T A;  4XFE A;  2ZYO A;  4X1D A;  2ONK E;  1FBH A;  3KN3 A;  2QVU A;  1PB9 A;  5CM6 A;  1H43 A;  4KI0 E;  1P1O A;  4GWU A;  1K9Y A;  3IOV A;  1EZ9 A;  5T3J A;  5H8N B;  3CHG A;  3M8U A;  3EHT A;  5LOM A;  1WDN A;  4HCW A;  2WX9 A;  4MCO A;  1DPP A;  2HHM A;  2Q2C A;  1LBW A;  2DYX A;  1M5F A;  1FTL A;  2REG A;  2Q88 A;  3MYU A;  4RXL A;  2QVR A;  5DVI A;  3RLF E;  2Y5L A;  1D9Y A;  3K6V A;  1B3F A;  4F31 B;  5L9S A;  3G3H A;  2I0C A;  3TEP A;  5DYH A;  3ZKK A;  4TQU Q;  4DXC A;  3S4U A;  2IA4 A;  4ZEK A;  5IZ1 A;  2DP8 A;  1FPI A;  3IX1 A;  4G68 C;  2QVV A;  1J1N A;  3CG1 A;  3WAF A;  1PBQ A;  2Q2A A;  5CMK A;  5L9O A;  4KFQ A;  4F3P A;  4Q8R A;  4FE8 A;  4QSD A;  4IY5 A;  4GVO A;  1EZO A;  2XX8 A;  4H67 A;  2RIN A;  3UA8 A;  1IMD A;  1YZ0 A;  3IK6 B;  3USD A;  2OBG A;  3Q25 A;  4BDM A;  1MY1 A;  4LP2 B;  3H03 A;  1US5 A;  3B7D A;  4OVQ A;  2AIX A;  4AB6 A;  3KC1 A;  2NXO A;  4PFW A;  1NH8 A;  1GTK A;  2B3B A;  3N6U A;  4G77 A;  1Y4C A;  2UVJ A;  2PCR A;  4O94 A;  5I2K A;  4YAH X;  1MXU A;  5BUU A;  1MY4 A;  1ANF A;  1YXI A;  4MMP A;  1R9L A;  2DXR A;  4IO7 A;  4G68 B;  3TTN A;  1OQH A;  3TTR A;  5I2K B;  5EQA A;  1TWY A;  2ZNU A;  3MW0 A;  4EDP A;  3QK6 A;  3KSX A;  3DP8 A;  4I1D A;  3H4Z A;  1Y3N A;  1BLF A;  4P1E A;  3MBP A;  5H8H A;  4JWX A;  1MPC A;  2XD3 A;  4NED A;  3VFJ A;  3PPO A;  4IGT A;  3PPP A;  1RDX A;  3E78 A;  1FJ9 A;  4G2Z A;  3KC0 A;  1D3K A;  2VHA A;  3RNN A;  1ZMG A;  4G61 A;  5H8H B;  1R6Z A;  4P47 A;  2DE2 A;  5EQ8 A;  3O6G A;  3FJ7 A;  4MJO A;  2D3I A;  1EYI A;  1MDQ A;  1S50 A;  4H5G A;  3S2V A;  3KBZ A;  1XVX A;  3R26 A;  2DE4 A;  4ZS9 A;  3ZKL A;  3LV0 A;  5TU0 A;  4LZ8 A;  3JYR A;  4ELR A;  4GBW A;  4NE4 A;  4JWO A;  4R72 A;  5IM2 A;  3RPW A;  4O8M A;  1NV7 A;  4QBA A;  5ET8 A;  5DVJ A;  3LSL A;  1T0K A;  4IO4 A;  4F1V A;  1UIV A;  1WOD A;  2FA7 A;  5J1D A;  3H6V A;  4JVC A;  2ESN A;  1ZTY A;  3O28 A;  4G8M A;  1Y3Q A;  5ET7 A;  1ZU0 A;  1B40 A;  2P3N A;  2I4B A;  4QFP A;  2I3V A;  2X7P A;  3KZG A;  4QFK A;  4HS7 A;  3FIR A;  4DCX A;  3CSG A;  5IZZ A;  4R6Y A;  4KCC A;  2HXW A;  4U23 A;  3QAX A;  3C36 A;  1POT A;  2DVC A;  2ZYN A;  1H44 A;  3TOD A;  1FBG A;  1I6B A;  3CFL A;  2DS9 A;  1GGG A;  4JXI A;  2O84 X;  2O1M A;  3FXB A;  3PUV E;  4PE3 A;  3IAZ A;  3LSF B;  3N26 A;  4ZDM A;  3HCQ A;  1FPK A;  5FHO A;  4YMA A;  3S9L C;  3A3U A;  4XIG Q;  3SEX A;  3GLB A;  3UOR A;  1Y20 A;  3TEL A;  4IO2 A;  4N6D A;  1IMF A;  3TTK A;  3CG3 A;  1URG A;  3ZSF A;  1JEU A;  4O3C A;  1B52 A;  1JET A;  3DEL B;  3V89 B;  2PVU A;  4N4U A;  2L5V A;  1LB8 A;  4F1Y A;  1P1N A;  3T9X B;  4FEC A;  4PFI A;  3FVK A;  2FYI A;  3M3K A;  2ZYM A;  1NL5 A;  5I5P A;  2E0S A;  5AA2 A;  3TYH A;  1EU8 A;  4QSC A;  2AL5 A;  2XXX A;  3FZV A;  4YZZ A;  4H5F A;  4ZZA A;  1SW4 A;  1FTM A;  3GBB A;  1VDW A;  3T1B A;  1ZLQ A;  5AA2 B;  1XOC A;  1MRP A;  4PFU A;  4BDL A;  4DZ1 A;  4P9K A;  2F6G A;  3RN8 A;  4I9D A;  4UAC A;  2F34 A;  2ZNT A;  3V5A A;  2XWO A;  4QFN A;  2QS3 A;  3ECR A;  5EHM A;  4ZZE A;  3FAT A;  3TCH A;  1B4H A;  2NVU B;  4H65 A;  3SEW A;  5EQ9 A;  3SEV A;  2XX7 A;  3BFT A;  5DT6 A;  1JW5 A;  1MXZ A;  2AYS A;  3B6Q A;  2PYY A;  3CI8 A;  4X8R A;  1QUK A;  3MZ1 A;  3PU5 A;  3CSB A;  4OHN A;  3IL1 B;  5KCJ A;  2YJP A;  1FQF A;  3RY3 A;  1FTA A;  1AH5 A;  3K0V A;  2O51 A;  4P56 A;  4H0W A;  4QF9 A;  1Q1K A;  3U92 A;  4HTG A;  1FBF A;  4LAT A;  3T22 A;  2PFZ A;  2HQ0 A;  1IEJ A;  5KCJ B;  1G0I A;  3MZB A;  4NMY A;  3QMF A;  4M4G A;  4POX A;  4NWD A;  2R6G E;  4NGU A;  1KA1 A;  4N07 A;  1POY 1;  4G4P A;  3MQ9 A;  5ET5 A;  2PFY A;  3A3C A;  3GBA A;  2GHB A;  1AOV A;  2OWT A;  1XI6 A;  1FPL A;  1XHY A;  3BBR A;  4TLL B;  4RYA A;  1B1X A;  4PF6 A;  4BDR A;  1LGB C;  2OCU A;  1BIY A;  4F39 A;  1SDX A;  4ZED A;  4XKR A;  4BDN A;  1NI9 A;  5F7V A;  3O29 A;  4PGN A;  3KEI A;  1Y4T A;  4NF4 A;  3LSW A;  1PC3 A;  3O2A A;  1H45 A;  5LTC A;  3OOA A; 
#chains in the Genus database with same CATH homology
 2XA5 A;  5J16 A;  2XXK A;  3BIG A;  4N81 A;  1BK4 A;  5IZ1 A;  1FPI A;  4OVP A;  2XWV A;  5DW8 A;  4NG7 A;  2QVV A;  4MNI A;  5IZ3 A;  2F5X A;  4GWY A;  3RPL A;  4JVD A;  2WBD A;  4AS4 A;  4UAB A;  2HXR A;  2B4M A;  2V4C A;  1QGX A;  4DI3 D;  4H45 A;  5IZ3 B;  2GQ1 A;  1IMD A;  4NX1 A;  1YZ0 A;  3RPL B;  2BJI A;  4PDD A;  2ZZX A;  3GYY A;  4MNP A;  1FPE A;  2ZZV A;  4OVR A;  3B50 A;  4P1L A;  4OVQ A;  3KC1 A;  4NN3 A;  4NF0 A;  1NV0 A;  4O94 A;  2PCR A;  2HPG A;  2WYK A;  1FPG A;  1IMC A;  2FHY A;  3MST A;  4NAP A;  1FRP A;  1NUZ A;  1YXI A;  1NV2 A;  4MMP A;  1FPB A;  4GX4 A;  3NOH A;  5JK4 A;  1RDZ A;  4MHF A;  4PFB A;  5EQA A;  4AS5 A;  2OWZ A;  1LEV A;  1FPF A;  1LBZ A;  3ISP A;  4N8G A;  4LN5 A;  2Q74 A;  4X9T A;  1RDY A;  4P3L A;  3W9W A;  2WBB A;  4PDH A;  4P1E A;  4GWX A;  3A29 A;  2F3B A;  4F1U A;  5EYH A;  5I3S A;  4I3Y A;  1RDX A;  3E78 A;  4PTK A;  1FJ9 A;  4PET A;  3KC0 A;  4N17 A;  1KZ8 A;  4G61 A;  1EYK A;  4P47 A;  2DE2 A;  5EQ8 A;  4MJO A;  2Q8M A;  4O7M A;  1EYI A;  3KBZ A;  2DDK A;  5LDZ A;  4QXD A;  4PGP A;  4I3E A;  2DE4 A;  2FVZ A;  4N8Y A;  3LV0 A;  1LBV A;  4GBW A;  3SZP A;  5IM2 A;  3LUZ A;  4O8M A;  1NV7 A;  4GX6 A;  4QBA A;  5ET8 A;  4F1V A;  3BIH A;  2CZH A;  2VT5 A;  4HXV A;  2VPO A;  4P8B A;  1LBY A;  3PTY A;  1FSA A;  2P3V A;  5J1D A;  4JVC A;  2JJK A;  1NUW A;  2FBP A;  4PBQ A;  1NUY A;  4PAI A;  5ET7 A;  2KQZ A;  2P3N A;  4N6K A;  2VPN A;  4MAG A;  4PF8 A;  1FPD A;  5IZZ A;  5IGA A;  4GWZ A;  1EYJ A;  4PC9 A;  1FBC A;  2XWI A;  1FBG A;  4MX6 A;  5F24 A;  1SPI A;  1DBZ A;  3FXB A;  1FBP A;  2FIE A;  4I40 A;  1NV3 A;  4PE3 A;  1CNQ A;  4O7I A;  1DK4 A;  1FPK A;  3T0J A;  2HZK A;  4HE2 A;  4OAN A;  3B8B A;  5EYG A;  4N6D A;  1IMF A;  1G0H A;  1IME A;  2MKZ A;  2HZL A;  3W9V A;  4JVI A;  4OVT A;  2V3Q A;  4XEQ A;  4NQ8 A;  4N4U A;  5EQ7 A;  2L5V A;  2WYP A;  1LBX A;  4PFI A;  3FBP A;  4NHB A;  5I5P A;  5ESY A;  4X04 A;  4GBV A;  3E79 A;  3D1R A;  4YZZ A;  3EKI A;  1IMA A;  4KXP A;  4PBH A;  1NV6 A;  1VDW A;  3T1B A;  1FPJ A;  4PFR A;  2WEF A;  2OX3 A;  4MNC A;  2QPQ A;  1NV1 A;  4OVS A;  4HCY A;  5A5L A;  2DE3 A;  2CEX A;  4P9K A;  2Q9T A;  2QFL A;  3IFA A;  4XF5 A;  2XWK A;  1AWB A;  2XWO A;  4GWS A;  5I7I A;  4DI4 B;  4YIC A;  4F19 A;  1FBE A;  5ET6 A;  5EQ9 A;  1IMB A;  3HFU A;  2KR0 A;  4GX3 A;  1NUX A;  5FBP A;  4HE1 A;  2ZZW A;  2R8T A;  4X8R A;  1DCU A;  4FBP A;  2DVZ A;  2FIX A;  1FTA A;  3U65 A;  4P56 A;  1FBD A;  4GWW A;  1K9Z A;  4OA4 A;  3ROJ A;  1FBF A;  1NV4 A;  2Y5K A;  2PFZ A;  2CEY A;  1G0I A;  3QMF A;  4IR8 A;  4XFE A;  4NGU A;  1KA1 A;  1NV5 A;  2F3D A;  4PAF A;  2B4L A;  1FBH A;  2QVU A;  5ET5 A;  2PFY A;  5CM6 A;  4HE0 A;  4GWU A;  4PCD A;  1XI6 A;  1K9Y A;  5T3J A;  1FPL A;  4M1V A;  1INP A;  3CHG A;  4H46 A;  4N15 A;  3RYD A;  3IFC A;  4MEV A;  4HCW A;  2WX9 A;  4MCO A;  2Y5L A;  4PF6 A;  1D9Q A;  2HHM A;  1JP4 A;  4MIJ A;  1LBW A;  2CZK A;  2CZI A;  1YYZ A;  1FJ6 A;  1KA0 A;  4N91 A;  1NI9 A;  4F18 A;  4PGN A;  3MYU A;  2QVR A;  1Q9D A;  4PAK A;  5LTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...