3GYYA

The ectoine binding protein of the teaabc trap transporter teaa in the apo-state
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
308
structure length
303
Chain Sequence
DNWRYAHEEYEGDVQDVFAQAFKGYVEDNSDHTVQVYRFGELGIMEQTQNGILQFVNQSPGFTGSLIPSAQIFFIPYLMPTDMDTVLEFFDESKAINEMFPKLYAEHGLELLKMYPEGEMVVTADEPITSPEDFNKKIRTMTNPLLAETYKAFGATPTPLPWGEVYGGLQTGIIDGQENPIFWIESGGLYEVSPNLTFTSHGWFTTAMMANQDFYEGLSEEDQQLVQDAADAAYDHTIEHIKGLSEESLEKIKAASDEVTVTRLNDEQIQAFKERAPQVEEKFIEMTGEQGQELLDQFKADLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic substrate binding protein
publication title Evidence for an allosteric mechanism of substrate release from membrane-transporter accessory binding proteins
pubmed doi rcsb
source organism Halomonas elongata
molecule tags Transport protein
total genus 104
structure length 303
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3gyyA00
4P56A 4OVQA 4OVSA 4NX1A 5IGAA 5I7IA 4PC9A 4PE3A 4PDDA 3GYYA 4NG7A 2HZLA 4PBHA 4NGUA 2ZZWA 4MNIA 4MCOA 4O8MA 4N4UA 4OA4A 2HZKA 4NN3A 4O7MA 4OVRA 4XEQA 4OVPA 4PFRA 2HPGA 2XWVA 4LN5A 4DI4B 3B50A 4N91A 2CEYA 4PF6A 4O94A 4PFBA 4N8GA 4N6DA 2PFYA 2XWIA 4PGPA 4P1LA 4PBQA 4PFIA 3FXBA 4N17A 4PETA 4MNCA 2V4CA 4X04A 4P9KA 2ZZVA 2PFZA 2XXKA 4P3LA 4N15A 4PCDA 4OANA 2VPOA 4PAFA 4MEVA 4XFEA 4NF0A 4P47A 4MAGA 2WYPA 4NHBA 4NAPA 2XWKA 2WX9A 4PAKA 4MX6A 5IZZA 4PF8A 4N8YA 4PDHA 4X8RA 4UABA 2ZZXA 4YICA 2XWOA 4MMPA 4XF5A 5IM2A 4DI3D 2WYKA 4P8BA 4NQ8A 3U65A 4YZZA 2VPNA 5LTCA 4PAIA 4N6KA 2CEXA 4MNPA 4MIJA 4P1EA 5CM6A 5I5PA 4PGNA 4OVTA 2XA5A 4MHFA
chains in the Genus database with same CATH superfamily
1NV5A 3H6TA 5CBRA 5I2NA 2XXTA 3R7XA 3LBSA 3S4UA 4G4PA 4BDNA 3RN8A 4MJOA 3CVGA 5I56B 3QIMA 1EU8A 2XXHA 5IAIA 3FJ7A 2DXRA 2XXWA 1M5BA 4LN5A 4DI4B 2DVCA 4RA1A 4UACA 1D3KA 1LBWA 1EZOA 4OZ9A 3I5OA 3EPEA 4QFOA 4R74A 5DEXA 3H7MA 4R9GA 4N17A 1M5FA 4GX4A 1B4ZA 4ZZAA 4DLDA 4GL8A 1FBHA 1MH3A 1FPIA 5L9OA 3RPLB 1LSTA 3MVWA 4JVDA 5L9MA 3N6TA 1D9YA 2Y7IA 2I3WA 4BDOA 1TT1A 1MQJA 3S2VA 4PDHA 4LATA 2H4IA 1R6ZA 4G2ZA 2R9JA 4UABA 1ZKBA 1DSNA 2G29A 4YICA 5IM2A 4OEVA 4KYSA 1K9YA 1ZLQA 3TKDA 2HFBA 3PPRA 3RYDA 3HFUA 1B46A 2OWTA 1GTKA 2I4CA 4N6KA 3RT6B 1JW4A 1LFHA 3D4GA 5H8NA 5I5PA 1TXFA 1XT8A 1B7HA 1PB9A 3TDJA 3U92A 4JVIA 3IB1A 1IITA 1NV1A 2DWAA 4R75A 2DE3A 4F31B 1O63A 3TPAA 3TMGA 1LBBA 1H43A 4GD5A 1A40A 3GYYA 4MNIA 4DXUA 5I84A 3VLWA 1KWHA 3IR1A 4XEQA 4Q8RA 3S9NC 3R26A 3PUXE 4KYDA 1IMBA 4QBAA 3IJXB 1WODA 1LAHE 1P1QA 2ZXTA 5F1QA 3OMBA 3FXBA 3LSXA 2ZYMA 4IO5A 3FATA 4FE8A 4JBZA 2KQZA 4XKPA 3O28A 2F7BA 5EHMA 3RT8A 1QULA 2QL3A 1CB6A 4PCDA 4QFNA 2OLBA 1P1NA 1N76A 1D9QA 1ZU0A 5FHMA 2PYYA 2WYPA 1NV4A 3FJGA 1YYZA 4N8YA 5L8DA 2Q74A 1NNTA 2Z22A 3O6HA 1NV3A 1XS5A 1FPEA 3HCQA 1MPBA 1FTLA 5ET8A 4NQ8A 3IFAA 3T1BA 4FAJA 1DTZA 3IAZA 2WBDA 1MM6A 4RK9A 4F3SA 4MIJA 2YLNA 5CMBA 4HS7A 1TWYA 3LUYA 3KZGA 4GFRA 1I6BA 4MHFA 3PUZE 3I3VA 1M5CA 4OVQA 3CFZA 4N6PA 3O6IA 3MBPA 1B9JA 3RLFE 5EYGA 2PCRA 1US5A 1PBQA 4K3FA 1Y3QA 5H8HA 4GX6A 2Y5KA 4NF8A 3LSLA 2Z8DA 2RC7A 5CMCA 3RQTA 3ZKLA 2X26A 2HQ0A 2F7CA 5DVJA 3LSFB 3IOWA 4N8GA 4YKKA 2H98A 2CZHA 4EQ7A 3QYTA 3K1MA 2DS9A 1MXYA 4IO6A 2UXAA 2B4LA 4QF9A 4L17A 2V25A 4U4SA 2VHAA 5AA2B 3MZ1A 3LC8A 5M2VA 4JB7A 1US4A 2ZZVA 4QXDA 3QUJA 1ANFA 4TQUQ 3CR9A 4RK2A 1T0KA 2UVIA 1Q9DA 3IOTA 1GGGA 4MAGA 3VXBA 2WX9A 1HSJA 2XXRA 3OELA 2E0SA 1SW1A 2NVUB 4NF6B 4GRKA 5CMKA 4OHNA 3ZKKA 3BIGA 2GRVA 2QJEA 4U1OA 3BIHA 2DSFA 4F3GA 4YB5A 2P3VA 4IO4A 3MQ9A 3UIFA 2I0BA 4LONB 3N94A 2B65A 3THIA 4DZ1A 2VGQA 5ITPA 4NMYA 4PE3A 1CNQA 4Q30B 4QSEA 3C9HA 1EH3A 1RYXA 1DTGA 4I9DA 2L5VA 1D4NA 3EF7A 1LB9A 4F3BA 2KR0A 1O64A 3K00A 3ONMA 4GX3A 2DWJA 5J1DA 4YKIA 3T93B 1SDXA 4GOTA 2QRYA 4NWCA 3B6QA 1R9QA 1FTJA 3V89B 3PUVE 4PETA 4KPTA 5TP9B 1WVJA 1SW2A 2Y5LA 5JK4A 3LR1A 3H6UA 4I3YA 1LAXA 4MBPA 2REJA 3PPPA 3MP6A 4LQ2A 3TQLA 1FTMA 3KC1A 2PMSA 2QVUA 5TPAB 4AB5A 2UYFA 2RCBA 3GBBA 4MFIA 3QK6A 1XVXA 2OX3A 4I1DA 2XHDA 4ELQA 1TFAA 4RXLA 1MQIA 4H5GA 4R6YA 1N0TA 4Q0CA 1FBPA 3TAJA 1B7ZA 4BDLA 3Q27A 1IMAA 4OVJA 1RDZA 4LZ5A 2FYIA 4MMPA 4OENA 4XXUA 3CRBA 1VR5A 4AQ4A 3DELB 2F78A 2DWIA 3E79A 3V8XB 4U1ZA 1M5EA 1URSA 1RDYA 2ONRA 1O7TA 3HHGA 3H6WA 3T66A 4YMBA 3S9EA 1EYIA 4WEPA 3RUMA 5DW8A 1XI6A 1XHYA 4GF8A 3G7WA 4HE1A 2P0SA 1JP4A 4DDDA 4ONYA 5KCJA 2F7AA 1A54A 1XC1A 2HZKA 4DXBA 1KA1A 4RPOA 4NE4A 3TODA 2O1LA 1FPJA 4F2QA 1XVYA 4GQOA 4GIZA 3EHSA 1MH4A 1LLSA 3HN0A 3JV9A 1B05A 1SYIA 3DP6A 3TCHA 1N3WA 4MNCA 1I6AA 5IZ3B 3PMWA 2I3VA 2UYEA 2O1MA 1SPIA 3B6TA 2XXVA 1FPKA 2V93A 5K2YA 3DM0A 1BP5A 1A8EA 1FTOA 1LBXA 4KFQA 3KGCA 3U93A 2M8CA 4G77A 5LDZA 3MJNA 2A5SA 5JTYA 2YPNA 1ZMGA 1B3GA 3WAFA 2DP8A 4NF4A 2AL4A 3PMXA 4OWDA 3MW0A 1ZJLA 3PD8A 4ZS9A 1SI0A 5AE4A 3MPLA 4X8RA 1GR2A 5TU0A 4YMAA 1POTA 3K4UA 3CSBA 4U22A 2VP1A 1QUKA 2REGA 1N7WA 1MQHA 4IY5A 1MXXA 2F8DA 4PAIA 3K6VA 1LGBC 1OVBA 1LCFA 3C31A 3C35A 3VE1B 4ELRA 3FV1A 4AS4A 1EZ9A 4MLVA 2QVVA 3KOTA 1MXWA 2CZLA 4YKPA 5IGAA 1SYHA 3PUYE 4LP2B 4O3AA 3U94A 4IR8A 4EF1A 3E3KA 3CFXA 3ROJA 2B4MA 3OENA 1Z7NE 3MP1A 1UTBA 3Q29A 4OVRA 2ZMBA 4GL0A 3G3KA 4I62A 4KCCA 4FBPA 3UK4A 2E1SA 4PF6A 4IO7A 2NOOA 4NF5B 4Z0IA 1DOTA 5AA4A 4NEDA 3EQ1A 4PTKA 4XTCQ 1FQBA 1SW4A 3H6VA 1K9ZA 3CSGA 1MY0A 3NOHA 4Z7EA 5CC2A 3OO8A 1Y4TA 4R9FA 3CHGA 2X7QA 1IXHA 5AA2D 1I69A 1NNPA 1Y4CA 1NV0A 1YXIA 2DYXA 4PAKA 1IQ7A 2UVJA 2XWKA 2NWJA 4MX6A 4LVQA 2F97A 1FBEA 1IXIA 5IKBA 3M8UA 3OOAA 3RGYA 1B3FA 4UA8A 4KYEA 3SEWA 3A3CA 2OZZA 4X1DA 3FUZA 3QSLA 4GXSB 4ND9A 2XXYA 2P2AA 2FVZA 4IY6A 4P1EA 2RINA 4OVTA 2OCUA 3CFLA 2ABHA 3GXAA 3DP8A 4O7IA 5HBCA 1GV8A 1NV7A 1MY1A 5TP9A 1B6HA 2IA4A 1URGA 4DCYA 3BBRA 3JYRA 4WXJA 3TELA 3HSTA 3FXUA 3K1PA 4OVPA 2HPGA 4HW8A 3VFJA 2XWVA 3CI8A 2KLFA 3QUFA 2CEYA 4G68A 2FIEA 4O3CA 2I0CA 1AMFA 5I59B 1UTHA 1B4HA 2V3TA 1QVSA 4ZEBA 4XIGQ 3D4CA 1H3DA 3FZVA 3VLVA 3C32A 3U1OA 2HCAA 1KA0A 4EQ9A 2XXKA 2O69A 4OYVA 1AH5A 5LOMA 1IXCA 5I58B 4PAFA 1USYE 4HE2A 3MVXA 3K6UA 2A5TB 4U23A 4KI0E 4JXIA 2R6GE 1BTJA 1NL5A 2AIXA 3CG3A 2X7PA 3RTFB 1EYKA 4MH5A 4DE8A 5ELVA 4H0WA 4ZEKA 1PB8A 5A5XB 4P8BA 2FHYA 3DLNA 3U65A 3N26A 3HV1A 2CMOA 4HXVA 4PFTA 4H65A 4NTLA 4U4XA 3IX1A 3ZSFA 1QGXA 3KC0A 1LB8A 3V83A 4E0XA 1FTKA 2RKMA 1IIWA 1QKAA 4P56A 3ECRA 5L9SA 1SW5A 4F3PA 2Z23A 2WKYA 2V3UA 1FPBA 4RJZA 4N4UA 4OA4A 3PPOA 2DOJA 4HE0A 1OLAA 3VVEA 1N04A 3H06B 2WEFA 4LQ5A 3FVOA 3B6WA 2AL5A 2GHBA 3N6UA 3PPNA 4F1UA 4POXA 3IL1B 2V4CA 1II5A 3ODBA 4RY1A 3LUZA 4I40A 2Q9TA 3V5AA 3MP8A 1NUZA 3U72A 2FNCA 4R6HA 3K2DA 4MEVA 1IXGA 3FASA 3T9UA 3G3JA 5AA1A 4X48A 4BDRA 4NAPA 5BUUA 4KXPA 4F19A 3TZAA 1MRPA 3C4MA 3IOVA 5H8QB 3TTKA 4QRZA 3VV5A 3UN6A 2PT2A 1B0LA 1FRPA 1NH7A 4YZZA 2B3FA 2HEUA 1Y1MA 4MNPA 4C1UA 4MLQA 1A55A 4WKMA 5ESYA 2PVUA 3SZPA 3H4ZA 1SBPA 5I2NB 4GWXA 3O2AA 4PDDA 3ISPA 5I56A 4GWOA 3IJOB 4M1VA 4F29A 4DXCA 2RC8A 4HCWA 1P1UA 4ZEDA 3T0JA 2Z8FA 4FEBA 5K2XA 1RDXA 3FVNA 4ISUA 3OO7A 1RKMA 4BLAA 4N6DA 3MWBA 2XXUA 4NWDA 2XWIA 4AS5A 5CBSA 3IO4A 3E13X 4ZECA 4IO3A 3EHUA 4H5FA 2ONKE 3L6GA 5IZ1A 3RPLA 4P9KA 2GFEA 1S7YA 1YTVA 3VDFA 3M3KA 5DTBA 3IOUA 1B5HA 1FJ9A 1JNFA 3OXNA 4JVCA 3PUWE 3EKIA 1JVXA 5JEIA 2I48A 3OEKA 1LBYA 5CRYA 2QVRA 4PFWA 1CE2A 3G3GA 5DVFA 4H8IA 3T9VA 4EQBA 4JSDA 1SD3A 3PD9A 1NMUA 4R2FA 4X9TA 4ZE8A 4XF5A 5H8FB 1IUDA 3AXFA 2WYKA 1MDQA 2O7UA 3TYHA 1AOVA 4RPNA 3UGWA 1N3XA 3GZGA 2CEXA 3TCGA 4PQJA 2XD2A 2BJJX 5CM6A 4POWA 5H8NB 3L6HA 2VD3A 2DXYA 1Y3PA 1LAFE 3VXCA 1MY3A 1NV2A 5CMMA 5DYHA 4TLMB 5ITOA 3KN3A 4G61A 2HXWA 3MAMA 2WBBA 4NGUA 1FBGA 3OO6A 2Q8JA 3VVDA 1P99A 4X1BA 3IK6B 5KZTA 4P0IA 2Q2AA 4QSDA 3IB2A 3GBAA 2GHAA 4PBQA 1NNKA 1Q1KA 1HSEA 2XXIA 1AL3A 4FATA 1F9BA 2ALUA 4ZE9A 4N15A 3LV0A 3MSTA 1LAGE 1Y3NA 2JJKA 3CG1A 2GH9A 4I3EA 4JWXA 4KCDA 2Y7RA 2UVGA 5BWJA 1YPNA 1P1OA 3U8QA 2Q89A 1OLCA 5DVIA 4OETA 3TTNA 2ZNUA 4ZZEA 1OQHA 2PX1A 2AYSA 2H5YA 5FHOA 1R9LA 4M4GA 3B8BA 2CZIA 3FIRA 2QSXA 1ZIUA 3FV2A 5I2KB 4JWYA 4R73A 1OIBA 3SEVA 1YCJA 2Y7PA 5F24A 4R2BA 1JQFA 3KBZA 5I7IA 1QUIA 3IB0A 2XX8A 2OWSA 3UA8A 2DE4A 4GBWA 2I49A 2HZLA 3IO6A 5EYHA 4MCOA 4EDPA 5H8HB 2ZNSA 1Y20A 1LFIA 1FQFA 4GWZA 1EZPA 3B50A 2Z8EA 4N81A 4O94A 3TTLA 2G93A 2O51A 4OTEA 1IMEA 4F1YA 5AA2A 3TUSA 3TQWA 2ONSA 4PFIA 3TFLA 3C36A 1NUYA 4RNSA 5HM4B 1MQGA 1G0IA 1LEVA 3KN7A 1DCUA 1FCKA 2PFZA 2I58A 1B58A 3TEPA 4H6DA 2VPOA 1MG1A 3M3FA 2VD2A 4LZ8A 1QJMA 5I57B 1IEJA 2F5XA 3R6UA 1BKAA 2XX9A 4XFEA 4P47A 3KBRA 5IZZA 1FBFA 1SI1A 4NF6A 4OFJA 2O7IA 2NXOA 5ICTA 1MPDA 2YJPA 4ESWA 2XWOA 3KJTA 3EN3A 4C0RA 4QHQA 1A99A 5EQAA 1DPEA 4G8NA 1AWBA 5FBPA 3KSXA 3OD7A 2QS2A 1DPPA 5LTCA 4E0WA 3TCFA 3E4RA 4H1XA 4OFOA 4I8CA 4G68C 4ZEIA 1B3EA 4XKQA 1URDA 1USYH 4XKNA 4GWWA 3A09A 2HAUA 2QMWA 3F11A 1HSLA 3MZBA 3HHFA 3K02A 4RYAA 3QAXA 3WAEA 5ET5A 2VT5A 1DMBA 1NNFA 3FXRA 1MY4A 3PPQA 2QS1A 1LBVA 4QFPA 1NUXA 1DK4A 3SDFA 4TOZA 1FPGA 3ZS6A 1Y9UA 4ESXA 4KHZE 3Q25A 5FHNA 1KZ8A 3QMFA 1QKBA 4IB2A 4N07A 1XOCA 1BK4A 2DE2A 4FJPA 2XXQA 4YU0A 2F6PA 3KJ7A 5H8FA 2THIA 1B32A 1MS7A 2R8TA 4IGTA 2D21A 3UP9A 1NFTA 5TPAA 3MYUA 4IGRA 4MF3A 3OSQA 4NF0A 2QS3A 2QS4A 4OESA 2UVHA 2RCAA 1FQDA 1LBZA 4LA9A 4GWSA 1MXVA 1VSOA 1B0HA 2ZZXA 2F35A 2V84A 3O97A 1JETA 4ECFA 1VFDA 3BFTA 3SETA 3N5LA 3BFUA 2VPNA 4ZEFA 1IMDA 5AA3A 4PGNA 1OQGA 3W15C 1FQCA 3HO7A 3H03A 5A5LA 1NI9A 3PGFA 1QUJA 4OVSA 4ELPA 4NX1A 3USDA 3O6GA 2D5WA 3Q26A 4NG7A 4QFLA 1FJ6A 3E9XA 4PBHA 2ZZWA 3W9WA 4O8MA 3RPWA 5KCJB 1RYOA 2DWHA 2O6AA 4BDMA 4U2RA 4H8JA 3HPIA 3P7IA 1JW1A 4C1TA 2RF1A 2LAOA 4IO2A 2PFYA 4PGPA 3D1RA 5F7VA 4ZDMA 5IZ3A 2F36A 1A8FA 1B5IA 3FBPA 1ELJA 2OWZA 1IZ1A 4OQOA 2Y84A 3I6VA 2Q88A 1EYJA 1SQYA 5I2KA 2Y7KA 4F39A 3SESA 5JTYB 1TFDA 4NHBA 3CIJA 3MC2A 4NF4B 4QSCA 4AB6A 4EXLA 1H44A 1L5TA 4EF2A 2CZKA 4YAHX 4GWYA 1INPA 4DI3D 2P3NA 2PBWA 4F1VA 2H99A 5EQ7A 4LUBA 3PU5A 3C34A 1IMFA 1B1HA 1D9VA 1DBZA 5B70A 2ESNA 2FIXA 2MKZA 3BKIB 4GVOA 3KOSA 3KN8A 2I6EA 3SEYA 5KDTB 3EHTA 4U21A 2Q2CA 3TTRA 3OO9A 1Y1ZA 2W7YA 4F18A 1S50A 3KG2A 5EYFA 1LFGA 1UIUA 3TTMA 4DIGA 3PTYA 1J1NA 4PFRA 3B7DA 1UTBB 2BJIA 4NF5A 3FVGA 5I57A 1JW5A 2O68A 4N91A 3VLUA 3H3GA 1FBDA 3M3LA 3GLBA 1FQEA 2HAVA 1YZ0A 5AA4B 5ISUA 3MPKA 1JEVA 4EXKA 3KEIA 4F2OA 2DDKA 1B1XA 5EQ8A 2Q8MA 4R6KA 3G3IA 4P3LA 4H67A 1PC3A 1YAEA 4YB7A 2F3DA 2H25A 4PFUA 4OANA 4BDQA 4OERA 3JZJA 4HTGA 2ZYNA 1GVCA 4H45A 1P1WA 3W9VA 3K1NA 2NUVA 1H45A 1UQWA 2R71A 3C33A 4PFYA 4PF8A 4KD5A 5DEXB 3K0VA 5CI5A 1BLFA 4OMBA 4GBVA 2DVZA 4PP0A 1PDAA 1ATGA 4P11A 1FPLA 1AIVA 1N7XA 4OFLA 2GQ1A 3SERA 1VDWA 1Z7ME 3PMVA 1MY2A 4OXVA 1FPFA 2H9BA 1B40A 5FTIA 2ANJA 2IEEA 3SEUA 1B51A 4YB6A 3O9PA 2F3BA 1SVXB 4PC9A 4KQPA 2PT1A 3A29A 3KFMA 4G8HA 3G3HA 4ELOA 3FD3A 1S9TA 1VFEA 4JWOA 5HPQA 3ILUB 2XXPA 3G3FA 1JVYA 4FORA 4O7MA 3T9XB 2DQVA 3SEXA 2XXXA 2P1SA 3VVFA 3T9HB 5I59A 4OEUA 3T96B 3PV0E 3DP4A 1FQAA 3FJMA 4G68B 4YKJA 3T22A 1MDP1 3S9LC 2ZNTA 1IMCA 4G8MA 5T3JA 5J16A 5B7DA 4XKRA 1LBCA 3Q28A 1UTHB 4X04A 2XX7A 1NKXA 3UORA 1I6QA 5EQ9A 1OVTA 1NV6A 1PBPA 5I58A 1UIVA 5ICQA 1FW0A 2A5TA 2ZYOA 5ET7A 3RY3A 2VOZA 1QW0A 1FTAA 3SKPA 4H46A 3MVZA 1MQDA 1WDNA 1FSAA 1ZTYA 4EUOA 3FGSA 4O3BA 5A5XA 1H76A 2Y7WA 3LSWA 3RTWB 1VE4A 4Q5TA 5H8SA 2B3BA 2XD3A 3K6XA 4N13A 1OMPA 1NUWA 2FBPA 4TLLB 2OBGA 2XA5A 2FA7A 4QFKA 4WEDA 3E78A 4FIMA 1LCTA 2HHMA 4JDFA 3MZ9A 1JEUA 3FXQA 2QPQA 3IFCA 2O84X 5FTHA 4GXAA 3O29A 1R1NA 3RNNA 4NN3A 4F22A 1FBCA 3IORA 1PB7A 1POY1 1MXZA 2F34A 1B3LA 4PFBA 4HCYA 2OJTA 2F6GA 1B3HA 4P1LA 5I3SA 1BIYA 1B2HA 2HXRA 2QMXA 1MXUA 3KSJA 3S9MC 3OSRA 1G0HA 3QXMA 1B7UA 4JSOA 1PEBA 1ZBMA 4THIA 4NF8B 3K6WA 3MUQA 1MPCA 5DT6A 3A3UA 4DCXA 2D3IA 2OK2A 5ET6A 1FPDA 3ILTB 4LZ7A 3O66A 5KDTA 4PE5B 1N84A 5H8QA 1Q35A 1A7LA 1M5DA 4P0GA 1B52A 4FECA 1NH8A 4KR5A 3K01A 1MM7A 2ZYKA 2QFLA 2V3QA 4GWUA 4R72A 3FVKA 4FEDA 2RC9A 2I4BA 4GLIA 3OEMA 5EHSA 1B5JA 3MVYA
chains in the Genus database with same CATH topology
3SZPA 1NV5A 1EYIA 1NI9A 5A5LA 4OVSA 5DW8A 1XI6A 4NX1A 4GWXA 4PDDA 4HE1A 3ISPA 4NG7A 1JP4A 1FJ6A 4PBHA 4MJOA 2ZZWA 3W9WA 4O8MA 4M1VA 2HZKA 1KA1A 4HCWA 3T0JA 4LN5A 4DI4B 1FPJA 1LBWA 1RDXA 4N6DA 2PFYA 2XWIA 4PGPA 4AS5A 3D1RA 5IZ3A 4N17A 4GX4A 4MNCA 5IZ3B 3FBPA 5IZ1A 1SPIA 3RPLA 4P9KA 2OWZA 1FPKA 1FBHA 1FPIA 1LBXA 3RPLB 1FJ9A 4JVCA 3EKIA 5LDZA 4JVDA 1EYJA 1LBYA 2QVRA 4NHBA 4PDHA 4X9TA 2CZKA 4X8RA 4UABA 4YICA 4XF5A 4GWYA 5IM2A 1INPA 4DI3D 2WYKA 2P3NA 1K9YA 4F1VA 5EQ7A 3RYDA 3HFUA 1IMFA 4PAIA 4N6KA 2CEXA 1DBZA 2FIXA 2MKZA 4AS4A 5CM6A 5I5PA 2QVVA 4JVIA 5IGAA 1NV1A 2DE3A 1NV2A 3GYYA 4IR8A 4F18A 4G61A 3ROJA 2WBBA 4MNIA 1FBGA 2B4MA 4NGUA 3PTYA 4OVRA 4XEQA 4PFRA 2BJIA 1IMBA 4FBPA 4N91A 4QBAA 4PF6A 1FBDA 1YZ0A 4PBQA 4PTKA 3FXBA 1K9ZA 3NOHA 2KQZA 2DDKA 5EQ8A 2Q8MA 3CHGA 4P3LA 4N15A 2F3DA 4PCDA 4OANA 3LV0A 3MSTA 2JJKA 1D9QA 4H45A 4I3EA 1NV0A 3W9VA 2WYPA 1YXIA 1NV4A 2XWKA 4PAKA 4MX6A 4PF8A 1YYZA 4N8YA 1FBEA 2Q74A 1NV3A 1FPEA 4GBVA 2DVZA 5ET8A 4NQ8A 3IFAA 3T1BA 1FPLA 3B8BA 2WBDA 2CZIA 2GQ1A 2FVZA 4MIJA 1VDWA 4P1EA 4OVTA 1FPFA 4MHFA 4OVQA 5F24A 4O7IA 3KBZA 5I7IA 2F3BA 4PC9A 1NV7A 5EYGA 2PCRA 2DE4A 4GBWA 3A29A 2HZLA 5EYHA 4GX6A 4MCOA 2Y5KA 4O7MA 4OVPA 2HPGA 2XWVA 4GWZA 3B50A 4N81A 2CEYA 4O94A 4N8GA 2FIEA 2CZHA 1IMEA 1IMCA 5T3JA 2B4LA 4PFIA 5J16A 1NUYA 4X04A 1G0IA 1LEVA 5EQ9A 1KA0A 1NV6A 1DCUA 2ZZVA 2PFZA 4QXDA 2XXKA 2VPOA 4PAFA 1Q9DA 5ET7A 2F5XA 4HE2A 4XFEA 1FTAA 4H46A 4P47A 4MAGA 2WX9A 5IZZA 1FSAA 1FBFA 1EYKA 2XWOA 5EQAA 3BIGA 4P8BA 2FHYA 3U65A 1AWBA 5FBPA 3BIHA 5LTCA 4HXVA 2P3VA 1QGXA 3KC0A 1NUWA 2FBPA 4GWWA 2XA5A 4P56A 3E78A 4PE3A 1CNQA 2HHMA 5ET5A 2VT5A 1FPBA 1LBVA 2QPQA 4N4UA 3IFCA 2L5VA 4OA4A 1NUXA 1DK4A 4HE0A 1FPGA 4NN3A 1FBCA 2WEFA 2KR0A 4GX3A 5J1DA 4PFBA 4HCYA 1KZ8A 3QMFA 4P1LA 5I3SA 4F1UA 1BK4A 2HXRA 2DE2A 4PETA 1G0HA 2Y5LA 5JK4A 2V4CA 4I3YA 3LUZA 4I40A 2Q9TA 2R8TA 3MYUA 3KC1A 1NUZA 2QVUA 5ET6A 1FPDA 4MEVA 2OX3A 4NF0A 4NAPA 1LBZA 4KXPA 1FBPA 4F19A 4GWSA 1IMAA 1RDZA 2ZZXA 4MMPA 1FRPA 2QFLA 2V3QA 4GWUA 4YZZA 2VPNA 3E79A 1IMDA 4MNPA 1RDYA 5ESYA 4PGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P56 A;  4OVQ A;  4OVS A;  4NX1 A;  5IGA A;  5I7I A;  4PC9 A;  4PE3 A;  4PDD A;  3GYY A;  4NG7 A;  2HZL A;  4PBH A;  4NGU A;  2ZZW A;  4MNI A;  4MCO A;  4O8M A;  4N4U A;  4OA4 A;  2HZK A;  4NN3 A;  4O7M A;  4OVR A;  4XEQ A;  4OVP A;  4PFR A;  2HPG A;  2XWV A;  4LN5 A;  4DI4 B;  3B50 A;  4N91 A;  2CEY A;  4PF6 A;  4O94 A;  4PFB A;  4N8G A;  4N6D A;  2PFY A;  2XWI A;  4PGP A;  4P1L A;  4PBQ A;  4PFI A;  3FXB A;  4N17 A;  4PET A;  4MNC A;  2V4C A;  4X04 A;  4P9K A;  2ZZV A;  2PFZ A;  2XXK A;  4P3L A;  4N15 A;  4PCD A;  4OAN A;  2VPO A;  4PAF A;  4MEV A;  4XFE A;  4NF0 A;  4P47 A;  4MAG A;  2WYP A;  4NHB A;  4NAP A;  2XWK A;  2WX9 A;  4PAK A;  4MX6 A;  5IZZ A;  4PF8 A;  4N8Y A;  4PDH A;  4X8R A;  4UAB A;  2ZZX A;  4YIC A;  2XWO A;  4MMP A;  4XF5 A;  5IM2 A;  4DI3 D;  2WYK A;  4P8B A;  4NQ8 A;  3U65 A;  4YZZ A;  2VPN A;  5LTC A;  4PAI A;  4N6K A;  2CEX A;  4MNP A;  4MIJ A;  4P1E A;  5CM6 A;  5I5P A;  4PGN A;  4OVT A;  2XA5 A;  4MHF A; 
#chains in the Genus database with same CATH topology
 1NV5 A;  3H6T A;  5CBR A;  5I2N A;  2XXT A;  3R7X A;  3LBS A;  3S4U A;  4G4P A;  4BDN A;  3RN8 A;  4MJO A;  3CVG A;  5I56 B;  3QIM A;  1EU8 A;  2XXH A;  5IAI A;  3FJ7 A;  2DXR A;  2XXW A;  1M5B A;  4LN5 A;  4DI4 B;  2DVC A;  4RA1 A;  4UAC A;  1D3K A;  1LBW A;  1EZO A;  4OZ9 A;  3I5O A;  3EPE A;  4QFO A;  4R74 A;  5DEX A;  3H7M A;  4R9G A;  4N17 A;  1M5F A;  4GX4 A;  1B4Z A;  4ZZA A;  4DLD A;  4GL8 A;  1FBH A;  1MH3 A;  1FPI A;  5L9O A;  3RPL B;  1LST A;  3MVW A;  4JVD A;  5L9M A;  3N6T A;  1D9Y A;  2Y7I A;  2I3W A;  4BDO A;  1TT1 A;  1MQJ A;  3S2V A;  4PDH A;  4LAT A;  2H4I A;  1R6Z A;  4G2Z A;  2R9J A;  4UAB A;  1ZKB A;  1DSN A;  2G29 A;  4YIC A;  5IM2 A;  4OEV A;  4KYS A;  1K9Y A;  1ZLQ A;  3TKD A;  2HFB A;  3PPR A;  3RYD A;  3HFU A;  1B46 A;  2OWT A;  1GTK A;  2I4C A;  4N6K A;  3RT6 B;  1JW4 A;  1LFH A;  3D4G A;  5H8N A;  5I5P A;  1TXF A;  1XT8 A;  1B7H A;  1PB9 A;  3TDJ A;  3U92 A;  4JVI A;  3IB1 A;  1IIT A;  1NV1 A;  2DWA A;  4R75 A;  2DE3 A;  4F31 B;  1O63 A;  3TPA A;  3TMG A;  1LBB A;  1H43 A;  4GD5 A;  1A40 A;  3GYY A;  4MNI A;  4DXU A;  5I84 A;  3VLW A;  1KWH A;  3IR1 A;  4XEQ A;  4Q8R A;  3S9N C;  3R26 A;  3PUX E;  4KYD A;  1IMB A;  4QBA A;  3IJX B;  1WOD A;  1LAH E;  1P1Q A;  2ZXT A;  5F1Q A;  3OMB A;  3FXB A;  3LSX A;  2ZYM A;  4IO5 A;  3FAT A;  4FE8 A;  4JBZ A;  2KQZ A;  4XKP A;  3O28 A;  2F7B A;  5EHM A;  3RT8 A;  1QUL A;  2QL3 A;  1CB6 A;  4PCD A;  4QFN A;  2OLB A;  1P1N A;  1N76 A;  1D9Q A;  1ZU0 A;  5FHM A;  2PYY A;  2WYP A;  1NV4 A;  3FJG A;  1YYZ A;  4N8Y A;  5L8D A;  2Q74 A;  1NNT A;  2Z22 A;  3O6H A;  1NV3 A;  1XS5 A;  1FPE A;  3HCQ A;  1MPB A;  1FTL A;  5ET8 A;  4NQ8 A;  3IFA A;  3T1B A;  4FAJ A;  1DTZ A;  3IAZ A;  2WBD A;  1MM6 A;  4RK9 A;  4F3S A;  4MIJ A;  2YLN A;  5CMB A;  4HS7 A;  1TWY A;  3LUY A;  3KZG A;  4GFR A;  1I6B A;  4MHF A;  3PUZ E;  3I3V A;  1M5C A;  4OVQ A;  3CFZ A;  4N6P A;  3O6I A;  3MBP A;  1B9J A;  3RLF E;  5EYG A;  2PCR A;  1US5 A;  1PBQ A;  4K3F A;  1Y3Q A;  5H8H A;  4GX6 A;  2Y5K A;  4NF8 A;  3LSL A;  2Z8D A;  2RC7 A;  5CMC A;  3RQT A;  3ZKL A;  2X26 A;  2HQ0 A;  2F7C A;  5DVJ A;  3LSF B;  3IOW A;  4N8G A;  4YKK A;  2H98 A;  2CZH A;  4EQ7 A;  3QYT A;  3K1M A;  2DS9 A;  1MXY A;  4IO6 A;  2UXA A;  2B4L A;  4QF9 A;  4L17 A;  2V25 A;  4U4S A;  2VHA A;  5AA2 B;  3MZ1 A;  3LC8 A;  5M2V A;  4JB7 A;  1US4 A;  2ZZV A;  4QXD A;  3QUJ A;  1ANF A;  4TQU Q;  3CR9 A;  4RK2 A;  1T0K A;  2UVI A;  1Q9D A;  3IOT A;  1GGG A;  4MAG A;  3VXB A;  2WX9 A;  1HSJ A;  2XXR A;  3OEL A;  2E0S A;  1SW1 A;  2NVU B;  4NF6 B;  4GRK A;  5CMK A;  4OHN A;  3ZKK A;  3BIG A;  2GRV A;  2QJE A;  4U1O A;  3BIH A;  2DSF A;  4F3G A;  4YB5 A;  2P3V A;  4IO4 A;  3MQ9 A;  3UIF A;  2I0B A;  4LON B;  3N94 A;  2B65 A;  3THI A;  4DZ1 A;  2VGQ A;  5ITP A;  4NMY A;  4PE3 A;  1CNQ A;  4Q30 B;  4QSE A;  3C9H A;  1EH3 A;  1RYX A;  1DTG A;  4I9D A;  2L5V A;  1D4N A;  3EF7 A;  1LB9 A;  4F3B A;  2KR0 A;  1O64 A;  3K00 A;  3ONM A;  4GX3 A;  2DWJ A;  5J1D A;  4YKI A;  3T93 B;  1SDX A;  4GOT A;  2QRY A;  4NWC A;  3B6Q A;  1R9Q A;  1FTJ A;  3V89 B;  3PUV E;  4PET A;  4KPT A;  5TP9 B;  1WVJ A;  1SW2 A;  2Y5L A;  5JK4 A;  3LR1 A;  3H6U A;  4I3Y A;  1LAX A;  4MBP A;  2REJ A;  3PPP A;  3MP6 A;  4LQ2 A;  3TQL A;  1FTM A;  3KC1 A;  2PMS A;  2QVU A;  5TPA B;  4AB5 A;  2UYF A;  2RCB A;  3GBB A;  4MFI A;  3QK6 A;  1XVX A;  2OX3 A;  4I1D A;  2XHD A;  4ELQ A;  1TFA A;  4RXL A;  1MQI A;  4H5G A;  4R6Y A;  1N0T A;  4Q0C A;  1FBP A;  3TAJ A;  1B7Z A;  4BDL A;  3Q27 A;  1IMA A;  4OVJ A;  1RDZ A;  4LZ5 A;  2FYI A;  4MMP A;  4OEN A;  4XXU A;  3CRB A;  1VR5 A;  4AQ4 A;  3DEL B;  2F78 A;  2DWI A;  3E79 A;  3V8X B;  4U1Z A;  1M5E A;  1URS A;  1RDY A;  2ONR A;  1O7T A;  3HHG A;  3H6W A;  3T66 A;  4YMB A;  3S9E A;  1EYI A;  4WEP A;  3RUM A;  5DW8 A;  1XI6 A;  1XHY A;  4GF8 A;  3G7W A;  4HE1 A;  2P0S A;  1JP4 A;  4DDD A;  4ONY A;  5KCJ A;  2F7A A;  1A54 A;  1XC1 A;  2HZK A;  4DXB A;  1KA1 A;  4RPO A;  4NE4 A;  3TOD A;  2O1L A;  1FPJ A;  4F2Q A;  1XVY A;  4GQO A;  4GIZ A;  3EHS A;  1MH4 A;  1LLS A;  3HN0 A;  3JV9 A;  1B05 A;  1SYI A;  3DP6 A;  3TCH A;  1N3W A;  4MNC A;  1I6A A;  5IZ3 B;  3PMW A;  2I3V A;  2UYE A;  2O1M A;  1SPI A;  3B6T A;  2XXV A;  1FPK A;  2V93 A;  5K2Y A;  3DM0 A;  1BP5 A;  1A8E A;  1FTO A;  1LBX A;  4KFQ A;  3KGC A;  3U93 A;  2M8C A;  4G77 A;  5LDZ A;  3MJN A;  2A5S A;  5JTY A;  2YPN A;  1ZMG A;  1B3G A;  3WAF A;  2DP8 A;  4NF4 A;  2AL4 A;  3PMX A;  4OWD A;  3MW0 A;  1ZJL A;  3PD8 A;  4ZS9 A;  1SI0 A;  5AE4 A;  3MPL A;  4X8R A;  1GR2 A;  5TU0 A;  4YMA A;  1POT A;  3K4U A;  3CSB A;  4U22 A;  2VP1 A;  1QUK A;  2REG A;  1N7W A;  1MQH A;  4IY5 A;  1MXX A;  2F8D A;  4PAI A;  3K6V A;  1LGB C;  1OVB A;  1LCF A;  3C31 A;  3C35 A;  3VE1 B;  4ELR A;  3FV1 A;  4AS4 A;  1EZ9 A;  4MLV A;  2QVV A;  3KOT A;  1MXW A;  2CZL A;  4YKP A;  5IGA A;  1SYH A;  3PUY E;  4LP2 B;  4O3A A;  3U94 A;  4IR8 A;  4EF1 A;  3E3K A;  3CFX A;  3ROJ A;  2B4M A;  3OEN A;  1Z7N E;  3MP1 A;  1UTB A;  3Q29 A;  4OVR A;  2ZMB A;  4GL0 A;  3G3K A;  4I62 A;  4KCC A;  4FBP A;  3UK4 A;  2E1S A;  4PF6 A;  4IO7 A;  2NOO A;  4NF5 B;  4Z0I A;  1DOT A;  5AA4 A;  4NED A;  3EQ1 A;  4PTK A;  4XTC Q;  1FQB A;  1SW4 A;  3H6V A;  1K9Z A;  3CSG A;  1MY0 A;  3NOH A;  4Z7E A;  5CC2 A;  3OO8 A;  1Y4T A;  4R9F A;  3CHG A;  2X7Q A;  1IXH A;  5AA2 D;  1I69 A;  1NNP A;  1Y4C A;  1NV0 A;  1YXI A;  2DYX A;  4PAK A;  1IQ7 A;  2UVJ A;  2XWK A;  2NWJ A;  4MX6 A;  4LVQ A;  2F97 A;  1FBE A;  1IXI A;  5IKB A;  3M8U A;  3OOA A;  3RGY A;  1B3F A;  4UA8 A;  4KYE A;  3SEW A;  3A3C A;  2OZZ A;  4X1D A;  3FUZ A;  3QSL A;  4GXS B;  4ND9 A;  2XXY A;  2P2A A;  2FVZ A;  4IY6 A;  4P1E A;  2RIN A;  4OVT A;  2OCU A;  3CFL A;  2ABH A;  3GXA A;  3DP8 A;  4O7I A;  5HBC A;  1GV8 A;  1NV7 A;  1MY1 A;  5TP9 A;  1B6H A;  2IA4 A;  1URG A;  4DCY A;  3BBR A;  3JYR A;  4WXJ A;  3TEL A;  3HST A;  3FXU A;  3K1P A;  4OVP A;  2HPG A;  4HW8 A;  3VFJ A;  2XWV A;  3CI8 A;  2KLF A;  3QUF A;  2CEY A;  4G68 A;  2FIE A;  4O3C A;  2I0C A;  1AMF A;  5I59 B;  1UTH A;  1B4H A;  2V3T A;  1QVS A;  4ZEB A;  4XIG Q;  3D4C A;  1H3D A;  3FZV A;  3VLV A;  3C32 A;  3U1O A;  2HCA A;  1KA0 A;  4EQ9 A;  2XXK A;  2O69 A;  4OYV A;  1AH5 A;  5LOM A;  1IXC A;  5I58 B;  4PAF A;  1USY E;  4HE2 A;  3MVX A;  3K6U A;  2A5T B;  4U23 A;  4KI0 E;  4JXI A;  2R6G E;  1BTJ A;  1NL5 A;  2AIX A;  3CG3 A;  2X7P A;  3RTF B;  1EYK A;  4MH5 A;  4DE8 A;  5ELV A;  4H0W A;  4ZEK A;  1PB8 A;  5A5X B;  4P8B A;  2FHY A;  3DLN A;  3U65 A;  3N26 A;  3HV1 A;  2CMO A;  4HXV A;  4PFT A;  4H65 A;  4NTL A;  4U4X A;  3IX1 A;  3ZSF A;  1QGX A;  3KC0 A;  1LB8 A;  3V83 A;  4E0X A;  1FTK A;  2RKM A;  1IIW A;  1QKA A;  4P56 A;  3ECR A;  5L9S A;  1SW5 A;  4F3P A;  2Z23 A;  2WKY A;  2V3U A;  1FPB A;  4RJZ A;  4N4U A;  4OA4 A;  3PPO A;  2DOJ A;  4HE0 A;  1OLA A;  3VVE A;  1N04 A;  3H06 B;  2WEF A;  4LQ5 A;  3FVO A;  3B6W A;  2AL5 A;  2GHB A;  3N6U A;  3PPN A;  4F1U A;  4POX A;  3IL1 B;  2V4C A;  1II5 A;  3ODB A;  4RY1 A;  3LUZ A;  4I40 A;  2Q9T A;  3V5A A;  3MP8 A;  1NUZ A;  3U72 A;  2FNC A;  4R6H A;  3K2D A;  4MEV A;  1IXG A;  3FAS A;  3T9U A;  3G3J A;  5AA1 A;  4X48 A;  4BDR A;  4NAP A;  5BUU A;  4KXP A;  4F19 A;  3TZA A;  1MRP A;  3C4M A;  3IOV A;  5H8Q B;  3TTK A;  4QRZ A;  3VV5 A;  3UN6 A;  2PT2 A;  1B0L A;  1FRP A;  1NH7 A;  4YZZ A;  2B3F A;  2HEU A;  1Y1M A;  4MNP A;  4C1U A;  4MLQ A;  1A55 A;  4WKM A;  5ESY A;  2PVU A;  3SZP A;  3H4Z A;  1SBP A;  5I2N B;  4GWX A;  3O2A A;  4PDD A;  3ISP A;  5I56 A;  4GWO A;  3IJO B;  4M1V A;  4F29 A;  4DXC A;  2RC8 A;  4HCW A;  1P1U A;  4ZED A;  3T0J A;  2Z8F A;  4FEB A;  5K2X A;  1RDX A;  3FVN A;  4ISU A;  3OO7 A;  1RKM A;  4BLA A;  4N6D A;  3MWB A;  2XXU A;  4NWD A;  2XWI A;  4AS5 A;  5CBS A;  3IO4 A;  3E13 X;  4ZEC A;  4IO3 A;  3EHU A;  4H5F A;  2ONK E;  3L6G A;  5IZ1 A;  3RPL A;  4P9K A;  2GFE A;  1S7Y A;  1YTV A;  3VDF A;  3M3K A;  5DTB A;  3IOU A;  1B5H A;  1FJ9 A;  1JNF A;  3OXN A;  4JVC A;  3PUW E;  3EKI A;  1JVX A;  5JEI A;  2I48 A;  3OEK A;  1LBY A;  5CRY A;  2QVR A;  4PFW A;  1CE2 A;  3G3G A;  5DVF A;  4H8I A;  3T9V A;  4EQB A;  4JSD A;  1SD3 A;  3PD9 A;  1NMU A;  4R2F A;  4X9T A;  4ZE8 A;  4XF5 A;  5H8F B;  1IUD A;  3AXF A;  2WYK A;  1MDQ A;  2O7U A;  3TYH A;  1AOV A;  4RPN A;  3UGW A;  1N3X A;  3GZG A;  2CEX A;  3TCG A;  4PQJ A;  2XD2 A;  2BJJ X;  5CM6 A;  4POW A;  5H8N B;  3L6H A;  2VD3 A;  2DXY A;  1Y3P A;  1LAF E;  3VXC A;  1MY3 A;  1NV2 A;  5CMM A;  5DYH A;  4TLM B;  5ITO A;  3KN3 A;  4G61 A;  2HXW A;  3MAM A;  2WBB A;  4NGU A;  1FBG A;  3OO6 A;  2Q8J A;  3VVD A;  1P99 A;  4X1B A;  3IK6 B;  5KZT A;  4P0I A;  2Q2A A;  4QSD A;  3IB2 A;  3GBA A;  2GHA A;  4PBQ A;  1NNK A;  1Q1K A;  1HSE A;  2XXI A;  1AL3 A;  4FAT A;  1F9B A;  2ALU A;  4ZE9 A;  4N15 A;  3LV0 A;  3MST A;  1LAG E;  1Y3N A;  2JJK A;  3CG1 A;  2GH9 A;  4I3E A;  4JWX A;  4KCD A;  2Y7R A;  2UVG A;  5BWJ A;  1YPN A;  1P1O A;  3U8Q A;  2Q89 A;  1OLC A;  5DVI A;  4OET A;  3TTN A;  2ZNU A;  4ZZE A;  1OQH A;  2PX1 A;  2AYS A;  2H5Y A;  5FHO A;  1R9L A;  4M4G A;  3B8B A;  2CZI A;  3FIR A;  2QSX A;  1ZIU A;  3FV2 A;  5I2K B;  4JWY A;  4R73 A;  1OIB A;  3SEV A;  1YCJ A;  2Y7P A;  5F24 A;  4R2B A;  1JQF A;  3KBZ A;  5I7I A;  1QUI A;  3IB0 A;  2XX8 A;  2OWS A;  3UA8 A;  2DE4 A;  4GBW A;  2I49 A;  2HZL A;  3IO6 A;  5EYH A;  4MCO A;  4EDP A;  5H8H B;  2ZNS A;  1Y20 A;  1LFI A;  1FQF A;  4GWZ A;  1EZP A;  3B50 A;  2Z8E A;  4N81 A;  4O94 A;  3TTL A;  2G93 A;  2O51 A;  4OTE A;  1IME A;  4F1Y A;  5AA2 A;  3TUS A;  3TQW A;  2ONS A;  4PFI A;  3TFL A;  3C36 A;  1NUY A;  4RNS A;  5HM4 B;  1MQG A;  1G0I A;  1LEV A;  3KN7 A;  1DCU A;  1FCK A;  2PFZ A;  2I58 A;  1B58 A;  3TEP A;  4H6D A;  2VPO A;  1MG1 A;  3M3F A;  2VD2 A;  4LZ8 A;  1QJM A;  5I57 B;  1IEJ A;  2F5X A;  3R6U A;  1BKA A;  2XX9 A;  4XFE A;  4P47 A;  3KBR A;  5IZZ A;  1FBF A;  1SI1 A;  4NF6 A;  4OFJ A;  2O7I A;  2NXO A;  5ICT A;  1MPD A;  2YJP A;  4ESW A;  2XWO A;  3KJT A;  3EN3 A;  4C0R A;  4QHQ A;  1A99 A;  5EQA A;  1DPE A;  4G8N A;  1AWB A;  5FBP A;  3KSX A;  3OD7 A;  2QS2 A;  1DPP A;  5LTC A;  4E0W A;  3TCF A;  3E4R A;  4H1X A;  4OFO A;  4I8C A;  4G68 C;  4ZEI A;  1B3E A;  4XKQ A;  1URD A;  1USY H;  4XKN A;  4GWW A;  3A09 A;  2HAU A;  2QMW A;  3F11 A;  1HSL A;  3MZB A;  3HHF A;  3K02 A;  4RYA A;  3QAX A;  3WAE A;  5ET5 A;  2VT5 A;  1DMB A;  1NNF A;  3FXR A;  1MY4 A;  3PPQ A;  2QS1 A;  1LBV A;  4QFP A;  1NUX A;  1DK4 A;  3SDF A;  4TOZ A;  1FPG A;  3ZS6 A;  1Y9U A;  4ESX A;  4KHZ E;  3Q25 A;  5FHN A;  1KZ8 A;  3QMF A;  1QKB A;  4IB2 A;  4N07 A;  1XOC A;  1BK4 A;  2DE2 A;  4FJP A;  2XXQ A;  4YU0 A;  2F6P A;  3KJ7 A;  5H8F A;  2THI A;  1B32 A;  1MS7 A;  2R8T A;  4IGT A;  2D21 A;  3UP9 A;  1NFT A;  5TPA A;  3MYU A;  4IGR A;  4MF3 A;  3OSQ A;  4NF0 A;  2QS3 A;  2QS4 A;  4OES A;  2UVH A;  2RCA A;  1FQD A;  1LBZ A;  4LA9 A;  4GWS A;  1MXV A;  1VSO A;  1B0H A;  2ZZX A;  2F35 A;  2V84 A;  3O97 A;  1JET A;  4ECF A;  1VFD A;  3BFT A;  3SET A;  3N5L A;  3BFU A;  2VPN A;  4ZEF A;  1IMD A;  5AA3 A;  4PGN A;  1OQG A;  3W15 C;  1FQC A;  3HO7 A;  3H03 A;  5A5L A;  1NI9 A;  3PGF A;  1QUJ A;  4OVS A;  4ELP A;  4NX1 A;  3USD A;  3O6G A;  2D5W A;  3Q26 A;  4NG7 A;  4QFL A;  1FJ6 A;  3E9X A;  4PBH A;  2ZZW A;  3W9W A;  4O8M A;  3RPW A;  5KCJ B;  1RYO A;  2DWH A;  2O6A A;  4BDM A;  4U2R A;  4H8J A;  3HPI A;  3P7I A;  1JW1 A;  4C1T A;  2RF1 A;  2LAO A;  4IO2 A;  2PFY A;  4PGP A;  3D1R A;  5F7V A;  4ZDM A;  5IZ3 A;  2F36 A;  1A8F A;  1B5I A;  3FBP A;  1ELJ A;  2OWZ A;  1IZ1 A;  4OQO A;  2Y84 A;  3I6V A;  2Q88 A;  1EYJ A;  1SQY A;  5I2K A;  2Y7K A;  4F39 A;  3SES A;  5JTY B;  1TFD A;  4NHB A;  3CIJ A;  3MC2 A;  4NF4 B;  4QSC A;  4AB6 A;  4EXL A;  1H44 A;  1L5T A;  4EF2 A;  2CZK A;  4YAH X;  4GWY A;  1INP A;  4DI3 D;  2P3N A;  2PBW A;  4F1V A;  2H99 A;  5EQ7 A;  4LUB A;  3PU5 A;  3C34 A;  1IMF A;  1B1H A;  1D9V A;  1DBZ A;  5B70 A;  2ESN A;  2FIX A;  2MKZ A;  3BKI B;  4GVO A;  3KOS A;  3KN8 A;  2I6E A;  3SEY A;  5KDT B;  3EHT A;  4U21 A;  2Q2C A;  3TTR A;  3OO9 A;  1Y1Z A;  2W7Y A;  4F18 A;  1S50 A;  3KG2 A;  5EYF A;  1LFG A;  1UIU A;  3TTM A;  4DIG A;  3PTY A;  1J1N A;  4PFR A;  3B7D A;  1UTB B;  2BJI A;  4NF5 A;  3FVG A;  5I57 A;  1JW5 A;  2O68 A;  4N91 A;  3VLU A;  3H3G A;  1FBD A;  3M3L A;  3GLB A;  1FQE A;  2HAV A;  1YZ0 A;  5AA4 B;  5ISU A;  3MPK A;  1JEV A;  4EXK A;  3KEI A;  4F2O A;  2DDK A;  1B1X A;  5EQ8 A;  2Q8M A;  4R6K A;  3G3I A;  4P3L A;  4H67 A;  1PC3 A;  1YAE A;  4YB7 A;  2F3D A;  2H25 A;  4PFU A;  4OAN A;  4BDQ A;  4OER A;  3JZJ A;  4HTG A;  2ZYN A;  1GVC A;  4H45 A;  1P1W A;  3W9V A;  3K1N A;  2NUV A;  1H45 A;  1UQW A;  2R71 A;  3C33 A;  4PFY A;  4PF8 A;  4KD5 A;  5DEX B;  3K0V A;  5CI5 A;  1BLF A;  4OMB A;  4GBV A;  2DVZ A;  4PP0 A;  1PDA A;  1ATG A;  4P11 A;  1FPL A;  1AIV A;  1N7X A;  4OFL A;  2GQ1 A;  3SER A;  1VDW A;  1Z7M E;  3PMV A;  1MY2 A;  4OXV A;  1FPF A;  2H9B A;  1B40 A;  5FTI A;  2ANJ A;  2IEE A;  3SEU A;  1B51 A;  4YB6 A;  3O9P A;  2F3B A;  1SVX B;  4PC9 A;  4KQP A;  2PT1 A;  3A29 A;  3KFM A;  4G8H A;  3G3H A;  4ELO A;  3FD3 A;  1S9T A;  1VFE A;  4JWO A;  5HPQ A;  3ILU B;  2XXP A;  3G3F A;  1JVY A;  4FOR A;  4O7M A;  3T9X B;  2DQV A;  3SEX A;  2XXX A;  2P1S A;  3VVF A;  3T9H B;  5I59 A;  4OEU A;  3T96 B;  3PV0 E;  3DP4 A;  1FQA A;  3FJM A;  4G68 B;  4YKJ A;  3T22 A;  1MDP 1;  3S9L C;  2ZNT A;  1IMC A;  4G8M A;  5T3J A;  5J16 A;  5B7D A;  4XKR A;  1LBC A;  3Q28 A;  1UTH B;  4X04 A;  2XX7 A;  1NKX A;  3UOR A;  1I6Q A;  5EQ9 A;  1OVT A;  1NV6 A;  1PBP A;  5I58 A;  1UIV A;  5ICQ A;  1FW0 A;  2A5T A;  2ZYO A;  5ET7 A;  3RY3 A;  2VOZ A;  1QW0 A;  1FTA A;  3SKP A;  4H46 A;  3MVZ A;  1MQD A;  1WDN A;  1FSA A;  1ZTY A;  4EUO A;  3FGS A;  4O3B A;  5A5X A;  1H76 A;  2Y7W A;  3LSW A;  3RTW B;  1VE4 A;  4Q5T A;  5H8S A;  2B3B A;  2XD3 A;  3K6X A;  4N13 A;  1OMP A;  1NUW A;  2FBP A;  4TLL B;  2OBG A;  2XA5 A;  2FA7 A;  4QFK A;  4WED A;  3E78 A;  4FIM A;  1LCT A;  2HHM A;  4JDF A;  3MZ9 A;  1JEU A;  3FXQ A;  2QPQ A;  3IFC A;  2O84 X;  5FTH A;  4GXA A;  3O29 A;  1R1N A;  3RNN A;  4NN3 A;  4F22 A;  1FBC A;  3IOR A;  1PB7 A;  1POY 1;  1MXZ A;  2F34 A;  1B3L A;  4PFB A;  4HCY A;  2OJT A;  2F6G A;  1B3H A;  4P1L A;  5I3S A;  1BIY A;  1B2H A;  2HXR A;  2QMX A;  1MXU A;  3KSJ A;  3S9M C;  3OSR A;  1G0H A;  3QXM A;  1B7U A;  4JSO A;  1PEB A;  1ZBM A;  4THI A;  4NF8 B;  3K6W A;  3MUQ A;  1MPC A;  5DT6 A;  3A3U A;  4DCX A;  2D3I A;  2OK2 A;  5ET6 A;  1FPD A;  3ILT B;  4LZ7 A;  3O66 A;  5KDT A;  4PE5 B;  1N84 A;  5H8Q A;  1Q35 A;  1A7L A;  1M5D A;  4P0G A;  1B52 A;  4FEC A;  1NH8 A;  4KR5 A;  3K01 A;  1MM7 A;  2ZYK A;  2QFL A;  2V3Q A;  4GWU A;  4R72 A;  3FVK A;  4FED A;  2RC9 A;  2I4B A;  4GLI A;  3OEM A;  5EHS A;  1B5J A;  3MVY A; 
#chains in the Genus database with same CATH homology
 3SZP A;  1NV5 A;  1EYI A;  1NI9 A;  5A5L A;  4OVS A;  5DW8 A;  1XI6 A;  4NX1 A;  4GWX A;  4PDD A;  4HE1 A;  3ISP A;  4NG7 A;  1JP4 A;  1FJ6 A;  4PBH A;  4MJO A;  2ZZW A;  3W9W A;  4O8M A;  4M1V A;  2HZK A;  1KA1 A;  4HCW A;  3T0J A;  4LN5 A;  4DI4 B;  1FPJ A;  1LBW A;  1RDX A;  4N6D A;  2PFY A;  2XWI A;  4PGP A;  4AS5 A;  3D1R A;  5IZ3 A;  4N17 A;  4GX4 A;  4MNC A;  5IZ3 B;  3FBP A;  5IZ1 A;  1SPI A;  3RPL A;  4P9K A;  2OWZ A;  1FPK A;  1FBH A;  1FPI A;  1LBX A;  3RPL B;  1FJ9 A;  4JVC A;  3EKI A;  5LDZ A;  4JVD A;  1EYJ A;  1LBY A;  2QVR A;  4NHB A;  4PDH A;  4X9T A;  2CZK A;  4X8R A;  4UAB A;  4YIC A;  4XF5 A;  4GWY A;  5IM2 A;  1INP A;  4DI3 D;  2WYK A;  2P3N A;  1K9Y A;  4F1V A;  5EQ7 A;  3RYD A;  3HFU A;  1IMF A;  4PAI A;  4N6K A;  2CEX A;  1DBZ A;  2FIX A;  2MKZ A;  4AS4 A;  5CM6 A;  5I5P A;  2QVV A;  4JVI A;  5IGA A;  1NV1 A;  2DE3 A;  1NV2 A;  3GYY A;  4IR8 A;  4F18 A;  4G61 A;  3ROJ A;  2WBB A;  4MNI A;  1FBG A;  2B4M A;  4NGU A;  3PTY A;  4OVR A;  4XEQ A;  4PFR A;  2BJI A;  1IMB A;  4FBP A;  4N91 A;  4QBA A;  4PF6 A;  1FBD A;  1YZ0 A;  4PBQ A;  4PTK A;  3FXB A;  1K9Z A;  3NOH A;  2KQZ A;  2DDK A;  5EQ8 A;  2Q8M A;  3CHG A;  4P3L A;  4N15 A;  2F3D A;  4PCD A;  4OAN A;  3LV0 A;  3MST A;  2JJK A;  1D9Q A;  4H45 A;  4I3E A;  1NV0 A;  3W9V A;  2WYP A;  1YXI A;  1NV4 A;  2XWK A;  4PAK A;  4MX6 A;  4PF8 A;  1YYZ A;  4N8Y A;  1FBE A;  2Q74 A;  1NV3 A;  1FPE A;  4GBV A;  2DVZ A;  5ET8 A;  4NQ8 A;  3IFA A;  3T1B A;  1FPL A;  3B8B A;  2WBD A;  2CZI A;  2GQ1 A;  2FVZ A;  4MIJ A;  1VDW A;  4P1E A;  4OVT A;  1FPF A;  4MHF A;  4OVQ A;  5F24 A;  4O7I A;  3KBZ A;  5I7I A;  2F3B A;  4PC9 A;  1NV7 A;  5EYG A;  2PCR A;  2DE4 A;  4GBW A;  3A29 A;  2HZL A;  5EYH A;  4GX6 A;  4MCO A;  2Y5K A;  4O7M A;  4OVP A;  2HPG A;  2XWV A;  4GWZ A;  3B50 A;  4N81 A;  2CEY A;  4O94 A;  4N8G A;  2FIE A;  2CZH A;  1IME A;  1IMC A;  5T3J A;  2B4L A;  4PFI A;  5J16 A;  1NUY A;  4X04 A;  1G0I A;  1LEV A;  5EQ9 A;  1KA0 A;  1NV6 A;  1DCU A;  2ZZV A;  2PFZ A;  4QXD A;  2XXK A;  2VPO A;  4PAF A;  1Q9D A;  5ET7 A;  2F5X A;  4HE2 A;  4XFE A;  1FTA A;  4H46 A;  4P47 A;  4MAG A;  2WX9 A;  5IZZ A;  1FSA A;  1FBF A;  1EYK A;  2XWO A;  5EQA A;  3BIG A;  4P8B A;  2FHY A;  3U65 A;  1AWB A;  5FBP A;  3BIH A;  5LTC A;  4HXV A;  2P3V A;  1QGX A;  3KC0 A;  1NUW A;  2FBP A;  4GWW A;  2XA5 A;  4P56 A;  3E78 A;  4PE3 A;  1CNQ A;  2HHM A;  5ET5 A;  2VT5 A;  1FPB A;  1LBV A;  2QPQ A;  4N4U A;  3IFC A;  2L5V A;  4OA4 A;  1NUX A;  1DK4 A;  4HE0 A;  1FPG A;  4NN3 A;  1FBC A;  2WEF A;  2KR0 A;  4GX3 A;  5J1D A;  4PFB A;  4HCY A;  1KZ8 A;  3QMF A;  4P1L A;  5I3S A;  4F1U A;  1BK4 A;  2HXR A;  2DE2 A;  4PET A;  1G0H A;  2Y5L A;  5JK4 A;  2V4C A;  4I3Y A;  3LUZ A;  4I40 A;  2Q9T A;  2R8T A;  3MYU A;  3KC1 A;  1NUZ A;  2QVU A;  5ET6 A;  1FPD A;  4MEV A;  2OX3 A;  4NF0 A;  4NAP A;  1LBZ A;  4KXP A;  1FBP A;  4F19 A;  4GWS A;  1IMA A;  1RDZ A;  2ZZX A;  4MMP A;  1FRP A;  2QFL A;  2V3Q A;  4GWU A;  4YZZ A;  2VPN A;  3E79 A;  1IMD A;  4MNP A;  1RDY A;  5ESY A;  4PGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...