4MAGA

Crystal structure of the periplasmic sialic acid binding protein from vibrio cholerea
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
307
structure length
307
Chain Sequence
ATTLKMGMQASVGSVEYNSAKMLADTLEEMSQGEIKLALYPSAQLGDDRAMLQQLTLGDLDITYAEFGRMGLWIPRAEAVMLPYVAKDFDHLRRMFESDFGQGVRDEMLQKFNWRALDTWYNGTRETTSNRPLNSIEDFKGLKLRVPNAKQNLNYAKLSGASPTPMSFSEVYLALQTNAVDGQENPLPTIKTMKFYEVQKNLAMTHHIVNDQMVIISESTWQKLSDTDKDIIQKAVQKVGDAHTQTVKTQEAELVSFFKSEGINVTYPDLEPFREAMQPLYKEFDSNIGQPIVSKLAAMLQHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Sialic Acid Binding Protein
publication title Bacterial periplasmic sialic acid-binding proteins exhibit a conserved binding site.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 121
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2013-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4magA00
4NQ8A 4YICA 2CEYA 4N15A 5IGAA 5LTCA 2VPOA 4MEVA 2ZZWA 4MAGA 4MIJA 4PGPA 2V4CA 2XWVA 2XWIA 4N6KA 4PAKA 4P1EA 4NAPA 4P9KA 2ZZVA 4PFRA 4P56A 4O7MA 2WYPA 3FXBA 4MHFA 4PDHA 4PC9A 4XFEA 4NG7A 4O94A 4DI3D 4X8RA 4MNPA 4N4UA 2XXKA 4OVTA 2WX9A 4OVQA 5I5PA 4OVRA 4YZZA 4NX1A 4MNIA 4PFBA 3U65A 4MX6A 4O8MA 4P47A 5IZZA 4MNCA 4PE3A 4N8GA 2XWOA 4X04A 4MCOA 4OVSA 2CEXA 2HZLA 4N6DA 4PBHA 4DI4B 4XF5A 2WYKA 4NHBA 2XWKA 4PAFA 4P8BA 4PFIA 2HZKA 4N17A 4PDDA 4UABA 4NF0A 4P3LA 5CM6A 3GYYA 2VPNA 4PAIA 5I7IA 4N8YA 4P1LA 2PFYA 4OA4A 2PFZA 4MMPA 3B50A 4PF8A 4OANA 4PGNA 5IM2A 4LN5A 4NGUA 4PBQA 2XA5A 4XEQA 4PETA 4NN3A 2HPGA 4N91A 4OVPA 2ZZXA 4PF6A 4PCDA
chains in the Genus database with same CATH superfamily
2Y7IA 2PMSA 3SEWA 1JW4A 1NFTA 4DXCA 1INPA 1FPEA 2PT1A 1BKAA 4PGPA 3S9MC 4GWYA 1PB7A 4G4PA 2VOZA 3OO8A 5DEXB 4G77A 4BDMA 2V84A 4ESWA 1A55A 3IOUA 4OETA 1QVSA 3W9VA 1B51A 3FXBA 2RKMA 3CIJA 1MXUA 3RTWB 5DVIA 3P7IA 2XXKA 4X48A 4M1VA 3LBSA 1PEBA 4F3SA 4ZZAA 1PB8A 2PT2A 4R6YA 1IITA 4MNCA 3IR1A 2HEUA 2I4BA 3VDFA 4OXVA 4IR8A 4G68A 1AWBA 5FTHA 4THIA 5DVFA 1IIWA 1P99A 2WYKA 2ESNA 4NHBA 4FECA 4NEDA 2RC7A 3MW0A 3IORA 2H98A 1OIBA 5CC2A 3T66A 4ZDMA 4KXPA 2HZKA 4BDRA 1IMDA 1B6HA 3N6UA 3Q25A 3HCQA 3KC1A 2VPNA 3TODA 1UIVA 2RCBA 4IB2A 4MMPA 4LZ5A 1D4NA 3E3KA 3MAMA 4IO3A 4KI0E 1NV5A 4XIGQ 1B5IA 1BTJA 2XXXA 1AOVA 2HQ0A 1SW4A 3TTNA 3TTRA 4F29A 1FPIA 4F1YA 4G61A 1SW2A 4JWXA 4NE4A 4YMAA 3K02A 3I6VA 4N15A 3VV5A 4PE5B 2ZZWA 1NL5A 3RQTA 3RNNA 3KEIA 3PMVA 2OZZA 3Q29A 4OFOA 1GVCA 3N5LA 3RT6B 3CFLA 2ZXTA 1B4ZA 3ILTB 4GF8A 1IMCA 3FZVA 1S7YA 1ZU0A 3TQLA 4NG7A 1JEUA 3IOVA 2QRYA 1A99A 5H8NA 5JK4A 4G2ZA 3O66A 4IO4A 4H5FA 1MM7A 1YTVA 2OWSA 2ZYNA 1ZTYA 3R26A 3H6VA 4E0WA 2HZLA 4LQ5A 1GV8A 1QUJA 3KBRA 3OOAA 3EHSA 2I3WA 1K9YA 1NNPA 1M5EA 1NV6A 1OQGA 4JSOA 2HAUA 4MLQA 4EUOA 3DP4A 1USYE 1A54A 5I3SA 2XD2A 2Y7KA 4IO7A 4GVOA 3MBPA 1B7UA 2H9BA 4F1VA 1R9QA 4XTCQ 4AB6A 1QGXA 1LFHA 1MY4A 1XT8A 2UVHA 5H8HB 3TMGA 2UYEA 4PGNA 5B70A 4LZ7A 4LN5A 4R6HA 2Y5LA 3TYHA 1MXXA 1P1UA 2PCRA 3K1PA 2YLNA 2DOJA 4MH5A 1P1NA 5IGAA 3U72A 4MEVA 3DM0A 4GFRA 1FQCA 1FJ9A 2V4CA 2WBBA 4N6KA 1HSEA 2O1MA 3FIRA 3UA8A 4HTGA 2ZMBA 4DE8A 3OENA 3K01A 4F3GA 4O94A 2FIEA 5KCJA 1Z7NE 2XXIA 4BDOA 1UTBA 2REGA 1MQHA 5B7DA 1RDYA 3ZSFA 1EH3A 3RYDA 1YCJA 3HSTA 5I2KA 1LAHE 2KQZA 5EHSA 4LQ2A 3IJOB 2F34A 5CMMA 4H67A 3ZKKA 3AXFA 1P1QA 2XWKA 1ATGA 3KG2A 2X7PA 4MF3A 1MM6A 3TKDA 4NF5B 4MFIA 2JJKA 2HXWA 3K00A 3FD3A 4ELRA 5AA2B 2CMOA 2GRVA 3VXCA 5I58B 3FVOA 4QXDA 3VE1B 3PUYE 2QPQA 5EYFA 3CVGA 5IM2A 1OMPA 3HHFA 4MJOA 2F7BA 1MY3A 1DBZA 1DCUA 2HPGA 3TDJA 3T9VA 2V3QA 3QUJA 2DWJA 4OEUA 1B46A 3RLFE 1FPLA 5EYHA 2H99A 4NF8A 2Q74A 4EQ7A 4KFQA 5I56A 1NUYA 4OFJA 4RYAA 4Q8RA 4F2QA 1D9QA 1QKAA 1JEVA 1FTOA 3BKIB 3ODBA 2H5YA 1Q9DA 1KWHA 4P9KA 4RNSA 1XHYA 2AIXA 1ZBMA 2PVUA 4P56A 3MPLA 2Q88A 2VT5A 3FATA 1USYH 4PC9A 4DCXA 3TCHA 4N6PA 5AA4B 3KC0A 1FQBA 4U4XA 2I58A 1B3GA 3R6UA 1TWYA 3KJ7A 3RN8A 4GXSB 2X26A 2GHBA 4DZ1A 4ONYA 1FQEA 1VR5A 2XWOA 1JW5A 3RPLA 3LSXA 1MY0A 1EU8A 1MDQA 4K3FA 4N13A 3OMBA 3ONMA 4R74A 4KHZE 1A40A 3FGSA 1O7TA 4OTEA 2D21A 3IB2A 4R75A 1XI6A 3SEUA 4QSDA 2NWJA 5L9OA 3U1OA 4OA4A 1FJ6A 3RPWA 2Y7RA 2FYIA 1T0KA 4PF8A 4IO5A 1P1OA 4OWDA 1B7HA 1WDNA 3OO7A 1EYKA 2XA5A 4XEQA 3QAXA 3UN6A 5H8FB 4FE8A 4PF6A 1IMEA 2V93A 4PFYA 2O7IA 1MQDA 3HN0A 5EQ7A 3CSBA 2DWAA 1LAFE 1LFIA 3G7WA 3DP6A 3LV0A 1SI0A 1EYIA 2ZNUA 4R72A 4GWSA 4P1EA 4EDPA 1AL3A 4GXAA 4ELOA 4U22A 5TU0A 3U8QA 4XFEA 4Q5TA 3MZBA 4JSDA 4OVTA 1RDXA 2A5TB 2YPNA 3KN8A 2XXTA 5I5PA 2I6EA 3IAZA 3B6TA 2H25A 5JTYB 3UIFA 2XXUA 3S4UA 2DXRA 4POWA 2V3TA 4JB7A 4IO6A 2XXVA 1NV4A 1ZJLA 4RPOA 5EYGA 1FTJA 4MLVA 2Q89A 4HS7A 2P0SA 4FORA 1FBEA 1MY2A 4PAFA 1MXZA 2XX7A 4POXA 1MPBA 3A29A 2PYYA 3CHGA 5AA3A 4H5GA 1LAGE 3EQ1A 3LUYA 2THIA 4P1LA 5ISUA 3B50A 3SEXA 3KOSA 2E0SA 4WXJA 1MQIA 1YPNA 1EZOA 1FSAA 5LOMA 4RXLA 4UA8A 4G68B 1SVXB 1XVYA 4N91A 4ZE9A 4Z7EA 3K0VA 5CBRA 3R7XA 3TFLA 3M8UA 1EZ9A 4I3EA 1MDP1 2F8DA 2ONRA 5CRYA 3V5AA 4QSEA 3TCGA 3O29A 1EYJA 3FJGA 5F1QA 4MHFA 2QL3A 4C1TA 2XX9A 4DI3D 1A7LA 3QSLA 1MQJA 1VDWA 4MNPA 5JTYA 4OVQA 4GWWA 3BFTA 5BUUA 3GBBA 3E78A 4MNIA 1FW0A 3MP6A 1SYIA 4YU0A 1B9JA 2G93A 3IB1A 4DIGA 4F18A 4P0GA 2CZKA 3C35A 1O63A 5ET6A 4G68C 1KZ8A 3IK6B 3C31A 4ZEDA 2AL4A 5DTBA 1H3DA 2R71A 1XVXA 1TT1A 3LC8A 2PX1A 2OX3A 1Y20A 1RDZA 4N17A 5H8NB 4NF0A 3FXQA 4TLMB 3PV0E 1M5CA 3OXNA 1LB9A 3B7DA 4OENA 5K2XA 4QSCA 3RY3A 1LAXA 4U23A 5F24A 4F19A 4PBQA 3RT8A 4N81A 3FJ7A 2O6AA 3ZKLA 2ZNTA 1IEJA 1B2HA 3SEYA 2QSXA 3Q27A 4O7IA 3H06B 2QJEA 1IMFA 4PP0A 3RGYA 4NF6A 3MPKA 4F3BA 3GBAA 4U1ZA 3O2AA 3MZ9A 4KQPA 2Q9TA 5JEIA 5I84A 1M5FA 3KGCA 4EXKA 4YKKA 4ESXA 1S50A 3V83A 3QXMA 1PC3A 5IKBA 2P2AA 2QS2A 5IZ3A 3JV9A 4E0XA 4ZEBA 3A3CA 5AA2D 2WBDA 4PTKA 2Q2AA 4P0IA 2FHYA 3OELA 4P11A 1UQWA 4BDLA 3T93B 5FHNA 1POTA 1VE4A 4DDDA 3KFMA 3CRBA 1LBBA 5DT6A 1FQDA 3MP8A 2Z8DA 2DYXA 5KCJB 3K1NA 1Y1ZA 3CFXA 1UTBB 4IGTA 1MXYA 3EPEA 1H76A 2DE4A 1ZMGA 1B1XA 2RCAA 2RC9A 3GLBA 5TPAA 5I2KB 3MVZA 1J1NA 3KJTA 4KR5A 4GWUA 4PETA 1LBWA 1Z7ME 2F7AA 3T1BA 2QS1A 1EZPA 4PCDA 2F3BA 2V3UA 3MYUA 1MH3A 4YKPA 3A09A 5KZTA 1N3WA 2B3FA 3ZS6A 1LBYA 1A8FA 3SDFA 2NUVA 4RK9A 3H6TA 3H4ZA 1B3EA 1POY1 3LSWA 3S9EA 2R6GE 4EQBA 2P3VA 4DLDA 4RK2A 3ISPA 4LVQA 4HE0A 3VVDA 1SQYA 4RA1A 1OLCA 3T9XB 4IGRA 2VP1A 1H45A 4NF8B 4C1UA 5I56B 4F39A 4JWOA 2ABHA 2OCUA 3E13X 1N7XA 4XKRA 1IMBA 1FTLA 1NH8A 1RKMA 2F35A 3HO7A 2CZHA 3GZGA 2QS4A 2KLFA 2F97A 4WKMA 2REJA 5ET8A 3OEMA 3BIGA 2D5WA 2NVUB 3IJXB 4YAHX 4OZ9A 1JW1A 3KOTA 3EHTA 4PFTA 3RPLB 2RINA 2XXPA 2ALUA 5J1DA 3T96B 4YB7A 3SEVA 4GX4A 2Y84A 4NWCA 5FHOA 4FAJA 3BBRA 2O69A 4F1UA 2Y7WA 2A5SA 4ELPA 1DOTA 1LCFA 4OMBA 3TQWA 1MXVA 1PDAA 5ICQA 2HCAA 3F11A 3H6WA 2CZLA 2VD2A 5KDTA 2XXYA 1NH7A 2E1SA 4F31B 3KSXA 4ZEFA 1Q35A 4GBVA 4KCCA 1WODA 2OLBA 2WX9A 3G3HA 5I59A 1DTGA 4LATA 3LSLA 2F7CA 4GWZA 4O8MA 1QULA 1Y1MA 1N76A 2Q8JA 2DS9A 2IEEA 2Q8MA 4G8HA 5BWJA 1IXHA 4GBWA 1B4HA 3BFUA 2Y7PA 1LB8A 1DPEA 4TQUQ 3ECRA 4AS5A 2GH9A 4Z0IA 3PPOA 3MJNA 3CG1A 2ZYKA 1I6AA 4F3PA 3U94A 3S9LC 4GX6A 4TLLB 1PB9A 4PDDA 2H4IA 1M5BA 1KA0A 4X1BA 1N3XA 3E79A 4OERA 3G3KA 4WEPA 2B4MA 1DMBA 2BJIA 5I57A 4GIZA 1ZLQA 2R8TA 4AQ4A 1OLAA 5M2VA 1VFDA 4RY1A 4NGUA 2QMXA 3HHGA 1YXIA 1MQGA 4TOZA 4GLIA 4GRKA 3ROJA 3V89B 3D1RA 4H0WA 1B05A 1IQ7A 3N94A 4PAKA 3PPPA 1FBDA 2CZIA 2Z22A 3TTMA 4GWOA 2B65A 1GGGA 4R6KA 1FTKA 2I0CA 3EF7A 4R9FA 3IL1B 4X8RA 4QFOA 2F36A 4H8JA 3PMXA 4GWXA 3FV2A 5HPQA 3PUWE 4RJZA 3TTLA 2HHMA 2M8CA 2Q2CA 1BP5A 3W15C 4YMBA 2LAOA 2DWHA 4H8IA 4OVJA 4HE2A 1AMFA 2O68A 2DVZA 2XX8A 5TP9A 1SPIA 3PTYA 4YKJA 4EQ9A 5T3JA 3A3UA 4FBPA 1UTHA 3N6TA 4PFIA 1US4A 1JVYA 1HSLA 2DQVA 4P3LA 4C0RA 1NUZA 3S9NC 5L9SA 4UACA 2RC8A 1FPDA 3QUFA 2PFZA 3FUZA 4HCWA 3JYRA 4OANA 1GR2A 4XXUA 2Y5KA 1R9LA 3I3VA 4PFWA 4QF9A 3H6UA 4NF4A 4NN3A 3WAEA 1MY1A 2FA7A 5CMCA 4OVPA 5AA1A 1LBZA 4OEVA 4KPTA 2QVRA 5DYHA 3EKIA 3E9XA 3IO6A 4EF2A 3H03A 1URGA 1FPFA 3UORA 1G0IA 3U92A 3OSRA 3T9UA 4N07A 2KR0A 2XWIA 1NKXA 2P1SA 1Y9UA 4FATA 1LSTA 5A5XA 4GOTA 2QMWA 1IZ1A 4PFRA 3UGWA 3PUZE 3S2VA 2ONKE 1MRPA 3G3FA 1LBXA 1FTMA 2OJTA 3THIA 1FQAA 5ITOA 4FIMA 2Z8FA 4PFBA 4KD5A 3MZ1A 4NF6B 2X7QA 1A8EA 1N84A 1B40A 2I49A 3K6XA 4N6DA 5HBCA 5ITPA 2F78A 2W7YA 3FV1A 1Y3QA 5ESYA 2ANJA 4XKQA 1LCTA 4I40A 3IX1A 1I6BA 5CMKA 2D3IA 4ZS9A 5L9MA 4ZEIA 4I62A 3CI8A 3M3FA 5IZ3B 1PBPA 1H43A 1B5HA 3GYYA 4OESA 4QFNA 4QHQA 2IA4A 3L6HA 4BLAA 2I3VA 1FTAA 2O7UA 4KYEA 5H8QA 1NV1A 1SW5A 3Q28A 4ZECA 3OEKA 2OK2A 2ZZXA 1LLSA 1IXIA 3SZPA 1B3HA 3K2DA 2DE2A 1ZKBA 1YYZA 3B6WA 1IXCA 3SESA 1FBGA 2XXRA 1L5TA 1YZ0A 4JVIA 4NAPA 2ZZVA 3VLWA 4HCYA 4U2RA 3KBZA 5TPAB 4OQOA 2FNCA 4EXLA 1ZIUA 1FPJA 1NV3A 1QUIA 3UK4A 2XHDA 5CMBA 4OVRA 4YZZA 4AS4A 3FVGA 4MX6A 5H8SA 3RUMA 2VHAA 3TAJA 4FEBA 1NNTA 4IY6A 4X04A 1I69A 2CEXA 3OD7A 1ELJA 4DXBA 3MC2A 4M4GA 1B58A 1FQFA 4O3AA 4PBHA 2GQ1A 5DVJA 1KA1A 1FBFA 4JBZA 2HFBA 3C32A 1B0HA 3IFCA 2OWTA 1CE2A 1URDA 1R6ZA 4BDQA 1LBVA 4MBPA 2F3DA 4FEDA 4ND9A 5DEXA 4PAIA 2V25A 1IMAA 1MH4A 1TFDA 1DSNA 1D9VA 5ICTA 3O6IA 3FJMA 1IUDA 1FBPA 2ZNSA 5EQAA 4X9TA 1CNQA 3CSGA 3O28A 3JZJA 4NMYA 3OO6A 1NUXA 4F2OA 5CBSA 2P3NA 2VPOA 5K2YA 5I2NB 2F6GA 1I6QA 5ELVA 1N04A 1BK4A 2UXAA 4LA9A 1XS5A 1SW1A 4I3YA 1B3FA 1MG1A 3H7MA 1D9YA 4R2FA 3HFUA 4FJPA 4JVDA 3DELB 4ELQA 1F9BA 1NV2A 1S9TA 3SETA 1UIUA 3USDA 1SYHA 3C34A 3T9HB 4RPNA 1FCKA 2WKYA 3VVFA 4NX1A 3GXAA 2ZYMA 4PE3A 1Q1KA 1Y3NA 4OVSA 4R73A 1MS7A 1K9ZA 4DXUA 2DE3A 2ONSA 2B4LA 1SI1A 1M5DA 3QMFA 1CB6A 1SD3A 2PBWA 1TFAA 2VGQA 3C4MA 1QUKA 4GL8A 1N0TA 2I4CA 3BIHA 2QVVA 2UVIA 5KDTB 3K6VA 1R1NA 2DVCA 3G3GA 1N7WA 4NWDA 3MWBA 1FPGA 3VLUA 4LONB 5CM6A 3LR1A 5HM4B 2DDKA 1LEVA 1URSA 3DP8A 5I59B 5I7IA 1SDXA 4N8YA 5CI5A 2R9JA 2PFYA 3FBPA 1B52A 2DXYA 2ZYOA 5DW8A 3O97A 2NXOA 4U1OA 2QVUA 4ZE8A 4GX3A 3IFAA 3OO9A 4GD5A 5I2NA 1B7ZA 4PFUA 4ECFA 3HPIA 3TELA 5EQ9A 2CEYA 2XXQA 4YKIA 1VFEA 4O3BA 4MIJA 1II5A 2XD3A 4U21A 3K4UA 1WVJA 5AE4A 3I5OA 3PD9A 3EN3A 2FBPA 4JXIA 1FBCA 3MUQA 2OWZA 3H3GA 5LDZA 2FVZA 3FVNA 1LGBC 5I57B 1B3LA 1JQFA 3TTKA 4O3CA 4G8NA 3ILUB 4N4UA 4I1DA 1PBQA 2F6PA 1XOCA 1QJMA 2HAVA 1DTZA 2L5VA 3MVXA 1B5JA 4P47A 3PU5A 4LZ8A 1O64A 4N8GA 5H8HA 4MCOA 5J16A 4F22A 3QIMA 1OVBA 2I0BA 3V8XB 1FBHA 1MPDA 3PGFA 1DPPA 2DWIA 3K1MA 1NV0A 1NNFA 4H46A 1RYOA 1GTKA 3DLNA 1HSJA 3SKPA 2F5XA 1B1HA 3D4CA 2NOOA 4U4SA 4H6DA 5ET5A 3FVKA 1TXFA 3C36A 3MSTA 2OBGA 1B0LA 3T0JA 4H1XA 3TUSA 2HXRA 3MVYA 5IZ1A 3UP9A 3PPRA 3PPNA 4QFLA 1AIVA 3IOWA 4YB6A 1G0HA 4Q30B 5EHMA 2DP8A 2G29A 3FXUA 3U93A 2I48A 3HV1A 1Y4TA 3NOHA 3KN7A 3D4GA 5FHMA 4ZEKA 2XXWA 5TP9B 1OVTA 4NQ8A 3VXBA 3M3KA 4YICA 2AL5A 3IO4A 1UTHB 4R2BA 3O6HA 5LTCA 3B6QA 4MAGA 2Z23A 2XWVA 3G3JA 3KSJA 4JWYA 1D3KA 4QRZA 3K6WA 1LFGA 4O7MA 2WYPA 1FPBA 1FRPA 3OSQA 4QFPA 3QYTA 4L17A 4JDFA 4NF5A 4NF4B 4WEDA 4ISUA 1AH5A 2MKZA 5AA2A 4BDNA 5I58A 3CFZA 1ANFA 4OHNA 2WEFA 2O1LA 3CG3A 4HE1A 4H65A 4X1DA 5A5XB 1QKBA 3FASA 4DI4B 3LSFB 2B3BA 3KN3A 4XF5A 1Y3PA 1NI9A 2QFLA 3PD8A 4JVCA 1B32A 3M3LA 4IY5A 3EHUA 4NTLA 3FXRA 4P8BA 4DCYA 4KCDA 1DK4A 3IB0A 2BJJX 1JETA 2FIXA 4PQJA 1H44A 4HW8A 1XC1A 3C9HA 3C33A 2QS3A 3LUZA 1NMUA 1OQHA 3TPAA 4I9DA 4I8CA 5AA4A 3PPQA 3IOTA 3CR9A 1YAEA 3RTFB 5L8DA 4OYVA 1LBCA 5EQ8A 1QW0A 2UVGA 3PUVE 2UYFA 3B8BA 3L6GA 3MQ9A 4R9GA 2GFEA 4AB5A 1JVXA 1JP4A 3PUXE 3WAFA 1VSOA 2O84X 3N26A 3MVWA 2DSFA 5H8QB 4KYSA 4PDHA 1IXGA 3KZGA 4H45A 3Q26A 5A5LA 3T22A 1FPKA 2UVJA 2GHAA 1P1WA 3TEPA 3TCFA 2AYSA 2RF1A 5F7VA 3U65A 5IZZA 3MP1A 2YJPA 4ZZEA 4QBAA 5FBPA 2Z8EA 4KYDA 3W9WA 1RYXA 3O9PA 5ET7A 5H8FA 1MXWA 4GQOA 4OFLA 2XXHA 4Q0CA 4LUBA 1SBPA 3E4RA 3VVEA 2VD3A 2O51A 1NV7A 1Y4CA 4EF1A 1BLFA 3VLVA 4UABA 4QFKA 4IO2A 4YB5A 4GL0A 3TZAA 3VFJA 5IAIA 1NUWA 3SERA 1JNFA 3G3IA 1MPCA 1US5A 5FTIA 3PMWA 1BIYA 4LP2B 3O6GA 1NNKA 3QK6A 3K6UA 4HXVA 4XKNA 2A5TA 4G8MA 4XKPA
chains in the Genus database with same CATH topology
5EQ7A 4F1UA 1INPA 2P3NA 2VPOA 1FPEA 3LV0A 4PGPA 1EYIA 4GWYA 4GWSA 4P1EA 1BK4A 4I3YA 3HFUA 3W9VA 3FXBA 4JVDA 4XFEA 1NV2A 4GBVA 2XXKA 4OVTA 4M1VA 2WX9A 1RDXA 5I5PA 4NX1A 4GWZA 4O8MA 4MNCA 4PE3A 4OVSA 1K9ZA 2DE3A 2Q8MA 2B4LA 3QMFA 4IR8A 4GBWA 1AWBA 1NV4A 5EYGA 2WYKA 4NHBA 4AS5A 3BIHA 2QVVA 1FBEA 4PAFA 4KXPA 1FPGA 2HZKA 4GX6A 4PDDA 1IMDA 1KA0A 3A29A 3CHGA 5CM6A 2DDKA 3E79A 1LEVA 3KC1A 2B4MA 2VPNA 5I7IA 4N8YA 4P1LA 2PFYA 3FBPA 2BJIA 4MMPA 3B50A 2R8TA 5DW8A 2QVUA 4NGUA 1NV5A 1FSAA 4GX3A 1YXIA 1FPIA 3IFAA 4N91A 4G61A 3ROJA 5EQ9A 3D1RA 2CEYA 4N15A 4I3EA 2ZZWA 4MIJA 4PAKA 2FBPA 1FBCA 1FBDA 2CZIA 2OWZA 5LDZA 2FVZA 1EYJA 1IMCA 4MHFA 4NG7A 4DI3D 4X8RA 4MNPA 4N4UA 1VDWA 4OVQA 5JK4A 4GWWA 4GWXA 3E78A 4MNIA 2L5VA 4P47A 4N8GA 2HHMA 4MCOA 4F18A 5J16A 2CZKA 2HZLA 1FBHA 5ET6A 1KZ8A 4HE2A 1NV0A 4H46A 2DVZA 1K9YA 1SPIA 3PTYA 5T3JA 2F5XA 1NV6A 4FBPA 4PFIA 5ET5A 5I3SA 2OX3A 1RDZA 4N17A 3MSTA 4NF0A 4P3LA 3T0JA 1NUZA 4F1VA 2HXRA 5IZ1A 1FPDA 2PFZA 1QGXA 1G0HA 4HCWA 4OANA 4PGNA 4LN5A 5F24A 2Y5LA 4F19A 2Y5KA 4PBQA 3NOHA 4N81A 2PCRA 4NN3A 4OVPA 1LBZA 4O7IA 1IMFA 2QVRA 4NQ8A 4YICA 3EKIA 5IGAA 5LTCA 1FPFA 4MEVA 1G0IA 4MAGA 2KR0A 1FJ9A 2V4CA 2WBBA 2XWVA 2XWIA 4N6KA 2Q9TA 4PFRA 4O7MA 2WYPA 1FPBA 1FRPA 4O94A 2FIEA 5IZ3A 2MKZA 1LBXA 2WBDA 1RDYA 4PFBA 4PTKA 3RYDA 2WEFA 2FHYA 4HE1A 4N6DA 2KQZA 4DI4B 4XF5A 5ESYA 1NI9A 2QFLA 4JVCA 4I40A 2XWKA 4P8BA 1DK4A 5IZ3B 2JJKA 2FIXA 3GYYA 2DE4A 4QXDA 1FTAA 2QPQA 3LUZA 5IM2A 4MJOA 1NV1A 4GWUA 1DBZA 1DCUA 4PETA 1LBWA 2HPGA 2ZZXA 2V3QA 3T1BA 4PCDA 2F3BA 5EQ8A 1FPLA 3SZPA 3MYUA 2DE2A 5EYHA 2Q74A 1YYZA 1NUYA 3B8BA 1D9QA 1FBGA 1YZ0A 1Q9DA 4JVIA 4NAPA 1LBYA 4P9KA 2ZZVA 1JP4A 4HCYA 4P56A 3KBZA 2VT5A 4PDHA 4PC9A 2P3VA 4H45A 5A5LA 3ISPA 1FPKA 3KC0A 1FPJA 1NV3A 4HE0A 4OVRA 4YZZA 4AS4A 3U65A 4MX6A 5IZZA 2XWOA 4X04A 3RPLA 4QBAA 5FBPA 2CEXA 3W9WA 5ET7A 1IMBA 4PBHA 2GQ1A 1KA1A 1FBFA 2CZHA 3IFCA 1NV7A 1LBVA 2F3DA 4UABA 1XI6A 5ET8A 3BIGA 4PAIA 1IMAA 1NUWA 4OA4A 1FJ6A 4PF8A 3RPLB 1FBPA 5J1DA 5EQAA 1EYKA 2XA5A 4XEQA 4X9TA 1CNQA 4HXVA 4GX4A 4PF6A 1IMEA 1NUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQ8 A;  4YIC A;  2CEY A;  4N15 A;  5IGA A;  5LTC A;  2VPO A;  4MEV A;  2ZZW A;  4MAG A;  4MIJ A;  4PGP A;  2V4C A;  2XWV A;  2XWI A;  4N6K A;  4PAK A;  4P1E A;  4NAP A;  4P9K A;  2ZZV A;  4PFR A;  4P56 A;  4O7M A;  2WYP A;  3FXB A;  4MHF A;  4PDH A;  4PC9 A;  4XFE A;  4NG7 A;  4O94 A;  4DI3 D;  4X8R A;  4MNP A;  4N4U A;  2XXK A;  4OVT A;  2WX9 A;  4OVQ A;  5I5P A;  4OVR A;  4YZZ A;  4NX1 A;  4MNI A;  4PFB A;  3U65 A;  4MX6 A;  4O8M A;  4P47 A;  5IZZ A;  4MNC A;  4PE3 A;  4N8G A;  2XWO A;  4X04 A;  4MCO A;  4OVS A;  2CEX A;  2HZL A;  4N6D A;  4PBH A;  4DI4 B;  4XF5 A;  2WYK A;  4NHB A;  2XWK A;  4PAF A;  4P8B A;  4PFI A;  2HZK A;  4N17 A;  4PDD A;  4UAB A;  4NF0 A;  4P3L A;  5CM6 A;  3GYY A;  2VPN A;  4PAI A;  5I7I A;  4N8Y A;  4P1L A;  2PFY A;  4OA4 A;  2PFZ A;  4MMP A;  3B50 A;  4PF8 A;  4OAN A;  4PGN A;  5IM2 A;  4LN5 A;  4NGU A;  4PBQ A;  2XA5 A;  4XEQ A;  4PET A;  4NN3 A;  2HPG A;  4N91 A;  4OVP A;  2ZZX A;  4PF6 A;  4PCD A; 
#chains in the Genus database with same CATH topology
 2Y7I A;  2PMS A;  3SEW A;  1JW4 A;  1NFT A;  4DXC A;  1INP A;  1FPE A;  2PT1 A;  1BKA A;  4PGP A;  3S9M C;  4GWY A;  1PB7 A;  4G4P A;  2VOZ A;  3OO8 A;  5DEX B;  4G77 A;  4BDM A;  2V84 A;  4ESW A;  1A55 A;  3IOU A;  4OET A;  1QVS A;  3W9V A;  1B51 A;  3FXB A;  2RKM A;  3CIJ A;  1MXU A;  3RTW B;  5DVI A;  3P7I A;  2XXK A;  4X48 A;  4M1V A;  3LBS A;  1PEB A;  4F3S A;  4ZZA A;  1PB8 A;  2PT2 A;  4R6Y A;  1IIT A;  4MNC A;  3IR1 A;  2HEU A;  2I4B A;  3VDF A;  4OXV A;  4IR8 A;  4G68 A;  1AWB A;  5FTH A;  4THI A;  5DVF A;  1IIW A;  1P99 A;  2WYK A;  2ESN A;  4NHB A;  4FEC A;  4NED A;  2RC7 A;  3MW0 A;  3IOR A;  2H98 A;  1OIB A;  5CC2 A;  3T66 A;  4ZDM A;  4KXP A;  2HZK A;  4BDR A;  1IMD A;  1B6H A;  3N6U A;  3Q25 A;  3HCQ A;  3KC1 A;  2VPN A;  3TOD A;  1UIV A;  2RCB A;  4IB2 A;  4MMP A;  4LZ5 A;  1D4N A;  3E3K A;  3MAM A;  4IO3 A;  4KI0 E;  1NV5 A;  4XIG Q;  1B5I A;  1BTJ A;  2XXX A;  1AOV A;  2HQ0 A;  1SW4 A;  3TTN A;  3TTR A;  4F29 A;  1FPI A;  4F1Y A;  4G61 A;  1SW2 A;  4JWX A;  4NE4 A;  4YMA A;  3K02 A;  3I6V A;  4N15 A;  3VV5 A;  4PE5 B;  2ZZW A;  1NL5 A;  3RQT A;  3RNN A;  3KEI A;  3PMV A;  2OZZ A;  3Q29 A;  4OFO A;  1GVC A;  3N5L A;  3RT6 B;  3CFL A;  2ZXT A;  1B4Z A;  3ILT B;  4GF8 A;  1IMC A;  3FZV A;  1S7Y A;  1ZU0 A;  3TQL A;  4NG7 A;  1JEU A;  3IOV A;  2QRY A;  1A99 A;  5H8N A;  5JK4 A;  4G2Z A;  3O66 A;  4IO4 A;  4H5F A;  1MM7 A;  1YTV A;  2OWS A;  2ZYN A;  1ZTY A;  3R26 A;  3H6V A;  4E0W A;  2HZL A;  4LQ5 A;  1GV8 A;  1QUJ A;  3KBR A;  3OOA A;  3EHS A;  2I3W A;  1K9Y A;  1NNP A;  1M5E A;  1NV6 A;  1OQG A;  4JSO A;  2HAU A;  4MLQ A;  4EUO A;  3DP4 A;  1USY E;  1A54 A;  5I3S A;  2XD2 A;  2Y7K A;  4IO7 A;  4GVO A;  3MBP A;  1B7U A;  2H9B A;  4F1V A;  1R9Q A;  4XTC Q;  4AB6 A;  1QGX A;  1LFH A;  1MY4 A;  1XT8 A;  2UVH A;  5H8H B;  3TMG A;  2UYE A;  4PGN A;  5B70 A;  4LZ7 A;  4LN5 A;  4R6H A;  2Y5L A;  3TYH A;  1MXX A;  1P1U A;  2PCR A;  3K1P A;  2YLN A;  2DOJ A;  4MH5 A;  1P1N A;  5IGA A;  3U72 A;  4MEV A;  3DM0 A;  4GFR A;  1FQC A;  1FJ9 A;  2V4C A;  2WBB A;  4N6K A;  1HSE A;  2O1M A;  3FIR A;  3UA8 A;  4HTG A;  2ZMB A;  4DE8 A;  3OEN A;  3K01 A;  4F3G A;  4O94 A;  2FIE A;  5KCJ A;  1Z7N E;  2XXI A;  4BDO A;  1UTB A;  2REG A;  1MQH A;  5B7D A;  1RDY A;  3ZSF A;  1EH3 A;  3RYD A;  1YCJ A;  3HST A;  5I2K A;  1LAH E;  2KQZ A;  5EHS A;  4LQ2 A;  3IJO B;  2F34 A;  5CMM A;  4H67 A;  3ZKK A;  3AXF A;  1P1Q A;  2XWK A;  1ATG A;  3KG2 A;  2X7P A;  4MF3 A;  1MM6 A;  3TKD A;  4NF5 B;  4MFI A;  2JJK A;  2HXW A;  3K00 A;  3FD3 A;  4ELR A;  5AA2 B;  2CMO A;  2GRV A;  3VXC A;  5I58 B;  3FVO A;  4QXD A;  3VE1 B;  3PUY E;  2QPQ A;  5EYF A;  3CVG A;  5IM2 A;  1OMP A;  3HHF A;  4MJO A;  2F7B A;  1MY3 A;  1DBZ A;  1DCU A;  2HPG A;  3TDJ A;  3T9V A;  2V3Q A;  3QUJ A;  2DWJ A;  4OEU A;  1B46 A;  3RLF E;  1FPL A;  5EYH A;  2H99 A;  4NF8 A;  2Q74 A;  4EQ7 A;  4KFQ A;  5I56 A;  1NUY A;  4OFJ A;  4RYA A;  4Q8R A;  4F2Q A;  1D9Q A;  1QKA A;  1JEV A;  1FTO A;  3BKI B;  3ODB A;  2H5Y A;  1Q9D A;  1KWH A;  4P9K A;  4RNS A;  1XHY A;  2AIX A;  1ZBM A;  2PVU A;  4P56 A;  3MPL A;  2Q88 A;  2VT5 A;  3FAT A;  1USY H;  4PC9 A;  4DCX A;  3TCH A;  4N6P A;  5AA4 B;  3KC0 A;  1FQB A;  4U4X A;  2I58 A;  1B3G A;  3R6U A;  1TWY A;  3KJ7 A;  3RN8 A;  4GXS B;  2X26 A;  2GHB A;  4DZ1 A;  4ONY A;  1FQE A;  1VR5 A;  2XWO A;  1JW5 A;  3RPL A;  3LSX A;  1MY0 A;  1EU8 A;  1MDQ A;  4K3F A;  4N13 A;  3OMB A;  3ONM A;  4R74 A;  4KHZ E;  1A40 A;  3FGS A;  1O7T A;  4OTE A;  2D21 A;  3IB2 A;  4R75 A;  1XI6 A;  3SEU A;  4QSD A;  2NWJ A;  5L9O A;  3U1O A;  4OA4 A;  1FJ6 A;  3RPW A;  2Y7R A;  2FYI A;  1T0K A;  4PF8 A;  4IO5 A;  1P1O A;  4OWD A;  1B7H A;  1WDN A;  3OO7 A;  1EYK A;  2XA5 A;  4XEQ A;  3QAX A;  3UN6 A;  5H8F B;  4FE8 A;  4PF6 A;  1IME A;  2V93 A;  4PFY A;  2O7I A;  1MQD A;  3HN0 A;  5EQ7 A;  3CSB A;  2DWA A;  1LAF E;  1LFI A;  3G7W A;  3DP6 A;  3LV0 A;  1SI0 A;  1EYI A;  2ZNU A;  4R72 A;  4GWS A;  4P1E A;  4EDP A;  1AL3 A;  4GXA A;  4ELO A;  4U22 A;  5TU0 A;  3U8Q A;  4XFE A;  4Q5T A;  3MZB A;  4JSD A;  4OVT A;  1RDX A;  2A5T B;  2YPN A;  3KN8 A;  2XXT A;  5I5P A;  2I6E A;  3IAZ A;  3B6T A;  2H25 A;  5JTY B;  3UIF A;  2XXU A;  3S4U A;  2DXR A;  4POW A;  2V3T A;  4JB7 A;  4IO6 A;  2XXV A;  1NV4 A;  1ZJL A;  4RPO A;  5EYG A;  1FTJ A;  4MLV A;  2Q89 A;  4HS7 A;  2P0S A;  4FOR A;  1FBE A;  1MY2 A;  4PAF A;  1MXZ A;  2XX7 A;  4POX A;  1MPB A;  3A29 A;  2PYY A;  3CHG A;  5AA3 A;  4H5G A;  1LAG E;  3EQ1 A;  3LUY A;  2THI A;  4P1L A;  5ISU A;  3B50 A;  3SEX A;  3KOS A;  2E0S A;  4WXJ A;  1MQI A;  1YPN A;  1EZO A;  1FSA A;  5LOM A;  4RXL A;  4UA8 A;  4G68 B;  1SVX B;  1XVY A;  4N91 A;  4ZE9 A;  4Z7E A;  3K0V A;  5CBR A;  3R7X A;  3TFL A;  3M8U A;  1EZ9 A;  4I3E A;  1MDP 1;  2F8D A;  2ONR A;  5CRY A;  3V5A A;  4QSE A;  3TCG A;  3O29 A;  1EYJ A;  3FJG A;  5F1Q A;  4MHF A;  2QL3 A;  4C1T A;  2XX9 A;  4DI3 D;  1A7L A;  3QSL A;  1MQJ A;  1VDW A;  4MNP A;  5JTY A;  4OVQ A;  4GWW A;  3BFT A;  5BUU A;  3GBB A;  3E78 A;  4MNI A;  1FW0 A;  3MP6 A;  1SYI A;  4YU0 A;  1B9J A;  2G93 A;  3IB1 A;  4DIG A;  4F18 A;  4P0G A;  2CZK A;  3C35 A;  1O63 A;  5ET6 A;  4G68 C;  1KZ8 A;  3IK6 B;  3C31 A;  4ZED A;  2AL4 A;  5DTB A;  1H3D A;  2R71 A;  1XVX A;  1TT1 A;  3LC8 A;  2PX1 A;  2OX3 A;  1Y20 A;  1RDZ A;  4N17 A;  5H8N B;  4NF0 A;  3FXQ A;  4TLM B;  3PV0 E;  1M5C A;  3OXN A;  1LB9 A;  3B7D A;  4OEN A;  5K2X A;  4QSC A;  3RY3 A;  1LAX A;  4U23 A;  5F24 A;  4F19 A;  4PBQ A;  3RT8 A;  4N81 A;  3FJ7 A;  2O6A A;  3ZKL A;  2ZNT A;  1IEJ A;  1B2H A;  3SEY A;  2QSX A;  3Q27 A;  4O7I A;  3H06 B;  2QJE A;  1IMF A;  4PP0 A;  3RGY A;  4NF6 A;  3MPK A;  4F3B A;  3GBA A;  4U1Z A;  3O2A A;  3MZ9 A;  4KQP A;  2Q9T A;  5JEI A;  5I84 A;  1M5F A;  3KGC A;  4EXK A;  4YKK A;  4ESX A;  1S50 A;  3V83 A;  3QXM A;  1PC3 A;  5IKB A;  2P2A A;  2QS2 A;  5IZ3 A;  3JV9 A;  4E0X A;  4ZEB A;  3A3C A;  5AA2 D;  2WBD A;  4PTK A;  2Q2A A;  4P0I A;  2FHY A;  3OEL A;  4P11 A;  1UQW A;  4BDL A;  3T93 B;  5FHN A;  1POT A;  1VE4 A;  4DDD A;  3KFM A;  3CRB A;  1LBB A;  5DT6 A;  1FQD A;  3MP8 A;  2Z8D A;  2DYX A;  5KCJ B;  3K1N A;  1Y1Z A;  3CFX A;  1UTB B;  4IGT A;  1MXY A;  3EPE A;  1H76 A;  2DE4 A;  1ZMG A;  1B1X A;  2RCA A;  2RC9 A;  3GLB A;  5TPA A;  5I2K B;  3MVZ A;  1J1N A;  3KJT A;  4KR5 A;  4GWU A;  4PET A;  1LBW A;  1Z7M E;  2F7A A;  3T1B A;  2QS1 A;  1EZP A;  4PCD A;  2F3B A;  2V3U A;  3MYU A;  1MH3 A;  4YKP A;  3A09 A;  5KZT A;  1N3W A;  2B3F A;  3ZS6 A;  1LBY A;  1A8F A;  3SDF A;  2NUV A;  4RK9 A;  3H6T A;  3H4Z A;  1B3E A;  1POY 1;  3LSW A;  3S9E A;  2R6G E;  4EQB A;  2P3V A;  4DLD A;  4RK2 A;  3ISP A;  4LVQ A;  4HE0 A;  3VVD A;  1SQY A;  4RA1 A;  1OLC A;  3T9X B;  4IGR A;  2VP1 A;  1H45 A;  4NF8 B;  4C1U A;  5I56 B;  4F39 A;  4JWO A;  2ABH A;  2OCU A;  3E13 X;  1N7X A;  4XKR A;  1IMB A;  1FTL A;  1NH8 A;  1RKM A;  2F35 A;  3HO7 A;  2CZH A;  3GZG A;  2QS4 A;  2KLF A;  2F97 A;  4WKM A;  2REJ A;  5ET8 A;  3OEM A;  3BIG A;  2D5W A;  2NVU B;  3IJX B;  4YAH X;  4OZ9 A;  1JW1 A;  3KOT A;  3EHT A;  4PFT A;  3RPL B;  2RIN A;  2XXP A;  2ALU A;  5J1D A;  3T96 B;  4YB7 A;  3SEV A;  4GX4 A;  2Y84 A;  4NWC A;  5FHO A;  4FAJ A;  3BBR A;  2O69 A;  4F1U A;  2Y7W A;  2A5S A;  4ELP A;  1DOT A;  1LCF A;  4OMB A;  3TQW A;  1MXV A;  1PDA A;  5ICQ A;  2HCA A;  3F11 A;  3H6W A;  2CZL A;  2VD2 A;  5KDT A;  2XXY A;  1NH7 A;  2E1S A;  4F31 B;  3KSX A;  4ZEF A;  1Q35 A;  4GBV A;  4KCC A;  1WOD A;  2OLB A;  2WX9 A;  3G3H A;  5I59 A;  1DTG A;  4LAT A;  3LSL A;  2F7C A;  4GWZ A;  4O8M A;  1QUL A;  1Y1M A;  1N76 A;  2Q8J A;  2DS9 A;  2IEE A;  2Q8M A;  4G8H A;  5BWJ A;  1IXH A;  4GBW A;  1B4H A;  3BFU A;  2Y7P A;  1LB8 A;  1DPE A;  4TQU Q;  3ECR A;  4AS5 A;  2GH9 A;  4Z0I A;  3PPO A;  3MJN A;  3CG1 A;  2ZYK A;  1I6A A;  4F3P A;  3U94 A;  3S9L C;  4GX6 A;  4TLL B;  1PB9 A;  4PDD A;  2H4I A;  1M5B A;  1KA0 A;  4X1B A;  1N3X A;  3E79 A;  4OER A;  3G3K A;  4WEP A;  2B4M A;  1DMB A;  2BJI A;  5I57 A;  4GIZ A;  1ZLQ A;  2R8T A;  4AQ4 A;  1OLA A;  5M2V A;  1VFD A;  4RY1 A;  4NGU A;  2QMX A;  3HHG A;  1YXI A;  1MQG A;  4TOZ A;  4GLI A;  4GRK A;  3ROJ A;  3V89 B;  3D1R A;  4H0W A;  1B05 A;  1IQ7 A;  3N94 A;  4PAK A;  3PPP A;  1FBD A;  2CZI A;  2Z22 A;  3TTM A;  4GWO A;  2B65 A;  1GGG A;  4R6K A;  1FTK A;  2I0C A;  3EF7 A;  4R9F A;  3IL1 B;  4X8R A;  4QFO A;  2F36 A;  4H8J A;  3PMX A;  4GWX A;  3FV2 A;  5HPQ A;  3PUW E;  4RJZ A;  3TTL A;  2HHM A;  2M8C A;  2Q2C A;  1BP5 A;  3W15 C;  4YMB A;  2LAO A;  2DWH A;  4H8I A;  4OVJ A;  4HE2 A;  1AMF A;  2O68 A;  2DVZ A;  2XX8 A;  5TP9 A;  1SPI A;  3PTY A;  4YKJ A;  4EQ9 A;  5T3J A;  3A3U A;  4FBP A;  1UTH A;  3N6T A;  4PFI A;  1US4 A;  1JVY A;  1HSL A;  2DQV A;  4P3L A;  4C0R A;  1NUZ A;  3S9N C;  5L9S A;  4UAC A;  2RC8 A;  1FPD A;  3QUF A;  2PFZ A;  3FUZ A;  4HCW A;  3JYR A;  4OAN A;  1GR2 A;  4XXU A;  2Y5K A;  1R9L A;  3I3V A;  4PFW A;  4QF9 A;  3H6U A;  4NF4 A;  4NN3 A;  3WAE A;  1MY1 A;  2FA7 A;  5CMC A;  4OVP A;  5AA1 A;  1LBZ A;  4OEV A;  4KPT A;  2QVR A;  5DYH A;  3EKI A;  3E9X A;  3IO6 A;  4EF2 A;  3H03 A;  1URG A;  1FPF A;  3UOR A;  1G0I A;  3U92 A;  3OSR A;  3T9U A;  4N07 A;  2KR0 A;  2XWI A;  1NKX A;  2P1S A;  1Y9U A;  4FAT A;  1LST A;  5A5X A;  4GOT A;  2QMW A;  1IZ1 A;  4PFR A;  3UGW A;  3PUZ E;  3S2V A;  2ONK E;  1MRP A;  3G3F A;  1LBX A;  1FTM A;  2OJT A;  3THI A;  1FQA A;  5ITO A;  4FIM A;  2Z8F A;  4PFB A;  4KD5 A;  3MZ1 A;  4NF6 B;  2X7Q A;  1A8E A;  1N84 A;  1B40 A;  2I49 A;  3K6X A;  4N6D A;  5HBC A;  5ITP A;  2F78 A;  2W7Y A;  3FV1 A;  1Y3Q A;  5ESY A;  2ANJ A;  4XKQ A;  1LCT A;  4I40 A;  3IX1 A;  1I6B A;  5CMK A;  2D3I A;  4ZS9 A;  5L9M A;  4ZEI A;  4I62 A;  3CI8 A;  3M3F A;  5IZ3 B;  1PBP A;  1H43 A;  1B5H A;  3GYY A;  4OES A;  4QFN A;  4QHQ A;  2IA4 A;  3L6H A;  4BLA A;  2I3V A;  1FTA A;  2O7U A;  4KYE A;  5H8Q A;  1NV1 A;  1SW5 A;  3Q28 A;  4ZEC A;  3OEK A;  2OK2 A;  2ZZX A;  1LLS A;  1IXI A;  3SZP A;  1B3H A;  3K2D A;  2DE2 A;  1ZKB A;  1YYZ A;  3B6W A;  1IXC A;  3SES A;  1FBG A;  2XXR A;  1L5T A;  1YZ0 A;  4JVI A;  4NAP A;  2ZZV A;  3VLW A;  4HCY A;  4U2R A;  3KBZ A;  5TPA B;  4OQO A;  2FNC A;  4EXL A;  1ZIU A;  1FPJ A;  1NV3 A;  1QUI A;  3UK4 A;  2XHD A;  5CMB A;  4OVR A;  4YZZ A;  4AS4 A;  3FVG A;  4MX6 A;  5H8S A;  3RUM A;  2VHA A;  3TAJ A;  4FEB A;  1NNT A;  4IY6 A;  4X04 A;  1I69 A;  2CEX A;  3OD7 A;  1ELJ A;  4DXB A;  3MC2 A;  4M4G A;  1B58 A;  1FQF A;  4O3A A;  4PBH A;  2GQ1 A;  5DVJ A;  1KA1 A;  1FBF A;  4JBZ A;  2HFB A;  3C32 A;  1B0H A;  3IFC A;  2OWT A;  1CE2 A;  1URD A;  1R6Z A;  4BDQ A;  1LBV A;  4MBP A;  2F3D A;  4FED A;  4ND9 A;  5DEX A;  4PAI A;  2V25 A;  1IMA A;  1MH4 A;  1TFD A;  1DSN A;  1D9V A;  5ICT A;  3O6I A;  3FJM A;  1IUD A;  1FBP A;  2ZNS A;  5EQA A;  4X9T A;  1CNQ A;  3CSG A;  3O28 A;  3JZJ A;  4NMY A;  3OO6 A;  1NUX A;  4F2O A;  5CBS A;  2P3N A;  2VPO A;  5K2Y A;  5I2N B;  2F6G A;  1I6Q A;  5ELV A;  1N04 A;  1BK4 A;  2UXA A;  4LA9 A;  1XS5 A;  1SW1 A;  4I3Y A;  1B3F A;  1MG1 A;  3H7M A;  1D9Y A;  4R2F A;  3HFU A;  4FJP A;  4JVD A;  3DEL B;  4ELQ A;  1F9B A;  1NV2 A;  1S9T A;  3SET A;  1UIU A;  3USD A;  1SYH A;  3C34 A;  3T9H B;  4RPN A;  1FCK A;  2WKY A;  3VVF A;  4NX1 A;  3GXA A;  2ZYM A;  4PE3 A;  1Q1K A;  1Y3N A;  4OVS A;  4R73 A;  1MS7 A;  1K9Z A;  4DXU A;  2DE3 A;  2ONS A;  2B4L A;  1SI1 A;  1M5D A;  3QMF A;  1CB6 A;  1SD3 A;  2PBW A;  1TFA A;  2VGQ A;  3C4M A;  1QUK A;  4GL8 A;  1N0T A;  2I4C A;  3BIH A;  2QVV A;  2UVI A;  5KDT B;  3K6V A;  1R1N A;  2DVC A;  3G3G A;  1N7W A;  4NWD A;  3MWB A;  1FPG A;  3VLU A;  4LON B;  5CM6 A;  3LR1 A;  5HM4 B;  2DDK A;  1LEV A;  1URS A;  3DP8 A;  5I59 B;  5I7I A;  1SDX A;  4N8Y A;  5CI5 A;  2R9J A;  2PFY A;  3FBP A;  1B52 A;  2DXY A;  2ZYO A;  5DW8 A;  3O97 A;  2NXO A;  4U1O A;  2QVU A;  4ZE8 A;  4GX3 A;  3IFA A;  3OO9 A;  4GD5 A;  5I2N A;  1B7Z A;  4PFU A;  4ECF A;  3HPI A;  3TEL A;  5EQ9 A;  2CEY A;  2XXQ A;  4YKI A;  1VFE A;  4O3B A;  4MIJ A;  1II5 A;  2XD3 A;  4U21 A;  3K4U A;  1WVJ A;  5AE4 A;  3I5O A;  3PD9 A;  3EN3 A;  2FBP A;  4JXI A;  1FBC A;  3MUQ A;  2OWZ A;  3H3G A;  5LDZ A;  2FVZ A;  3FVN A;  1LGB C;  5I57 B;  1B3L A;  1JQF A;  3TTK A;  4O3C A;  4G8N A;  3ILU B;  4N4U A;  4I1D A;  1PBQ A;  2F6P A;  1XOC A;  1QJM A;  2HAV A;  1DTZ A;  2L5V A;  3MVX A;  1B5J A;  4P47 A;  3PU5 A;  4LZ8 A;  1O64 A;  4N8G A;  5H8H A;  4MCO A;  5J16 A;  4F22 A;  3QIM A;  1OVB A;  2I0B A;  3V8X B;  1FBH A;  1MPD A;  3PGF A;  1DPP A;  2DWI A;  3K1M A;  1NV0 A;  1NNF A;  4H46 A;  1RYO A;  1GTK A;  3DLN A;  1HSJ A;  3SKP A;  2F5X A;  1B1H A;  3D4C A;  2NOO A;  4U4S A;  4H6D A;  5ET5 A;  3FVK A;  1TXF A;  3C36 A;  3MST A;  2OBG A;  1B0L A;  3T0J A;  4H1X A;  3TUS A;  2HXR A;  3MVY A;  5IZ1 A;  3UP9 A;  3PPR A;  3PPN A;  4QFL A;  1AIV A;  3IOW A;  4YB6 A;  1G0H A;  4Q30 B;  5EHM A;  2DP8 A;  2G29 A;  3FXU A;  3U93 A;  2I48 A;  3HV1 A;  1Y4T A;  3NOH A;  3KN7 A;  3D4G A;  5FHM A;  4ZEK A;  2XXW A;  5TP9 B;  1OVT A;  4NQ8 A;  3VXB A;  3M3K A;  4YIC A;  2AL5 A;  3IO4 A;  1UTH B;  4R2B A;  3O6H A;  5LTC A;  3B6Q A;  4MAG A;  2Z23 A;  2XWV A;  3G3J A;  3KSJ A;  4JWY A;  1D3K A;  4QRZ A;  3K6W A;  1LFG A;  4O7M A;  2WYP A;  1FPB A;  1FRP A;  3OSQ A;  4QFP A;  3QYT A;  4L17 A;  4JDF A;  4NF5 A;  4NF4 B;  4WED A;  4ISU A;  1AH5 A;  2MKZ A;  5AA2 A;  4BDN A;  5I58 A;  3CFZ A;  1ANF A;  4OHN A;  2WEF A;  2O1L A;  3CG3 A;  4HE1 A;  4H65 A;  4X1D A;  5A5X B;  1QKB A;  3FAS A;  4DI4 B;  3LSF B;  2B3B A;  3KN3 A;  4XF5 A;  1Y3P A;  1NI9 A;  2QFL A;  3PD8 A;  4JVC A;  1B32 A;  3M3L A;  4IY5 A;  3EHU A;  4NTL A;  3FXR A;  4P8B A;  4DCY A;  4KCD A;  1DK4 A;  3IB0 A;  2BJJ X;  1JET A;  2FIX A;  4PQJ A;  1H44 A;  4HW8 A;  1XC1 A;  3C9H A;  3C33 A;  2QS3 A;  3LUZ A;  1NMU A;  1OQH A;  3TPA A;  4I9D A;  4I8C A;  5AA4 A;  3PPQ A;  3IOT A;  3CR9 A;  1YAE A;  3RTF B;  5L8D A;  4OYV A;  1LBC A;  5EQ8 A;  1QW0 A;  2UVG A;  3PUV E;  2UYF A;  3B8B A;  3L6G A;  3MQ9 A;  4R9G A;  2GFE A;  4AB5 A;  1JVX A;  1JP4 A;  3PUX E;  3WAF A;  1VSO A;  2O84 X;  3N26 A;  3MVW A;  2DSF A;  5H8Q B;  4KYS A;  4PDH A;  1IXG A;  3KZG A;  4H45 A;  3Q26 A;  5A5L A;  3T22 A;  1FPK A;  2UVJ A;  2GHA A;  1P1W A;  3TEP A;  3TCF A;  2AYS A;  2RF1 A;  5F7V A;  3U65 A;  5IZZ A;  3MP1 A;  2YJP A;  4ZZE A;  4QBA A;  5FBP A;  2Z8E A;  4KYD A;  3W9W A;  1RYX A;  3O9P A;  5ET7 A;  5H8F A;  1MXW A;  4GQO A;  4OFL A;  2XXH A;  4Q0C A;  4LUB A;  1SBP A;  3E4R A;  3VVE A;  2VD3 A;  2O51 A;  1NV7 A;  1Y4C A;  4EF1 A;  1BLF A;  3VLV A;  4UAB A;  4QFK A;  4IO2 A;  4YB5 A;  4GL0 A;  3TZA A;  3VFJ A;  5IAI A;  1NUW A;  3SER A;  1JNF A;  3G3I A;  1MPC A;  1US5 A;  5FTI A;  3PMW A;  1BIY A;  4LP2 B;  3O6G A;  1NNK A;  3QK6 A;  3K6U A;  4HXV A;  4XKN A;  2A5T A;  4G8M A;  4XKP A; 
#chains in the Genus database with same CATH homology
 5EQ7 A;  4F1U A;  1INP A;  2P3N A;  2VPO A;  1FPE A;  3LV0 A;  4PGP A;  1EYI A;  4GWY A;  4GWS A;  4P1E A;  1BK4 A;  4I3Y A;  3HFU A;  3W9V A;  3FXB A;  4JVD A;  4XFE A;  1NV2 A;  4GBV A;  2XXK A;  4OVT A;  4M1V A;  2WX9 A;  1RDX A;  5I5P A;  4NX1 A;  4GWZ A;  4O8M A;  4MNC A;  4PE3 A;  4OVS A;  1K9Z A;  2DE3 A;  2Q8M A;  2B4L A;  3QMF A;  4IR8 A;  4GBW A;  1AWB A;  1NV4 A;  5EYG A;  2WYK A;  4NHB A;  4AS5 A;  3BIH A;  2QVV A;  1FBE A;  4PAF A;  4KXP A;  1FPG A;  2HZK A;  4GX6 A;  4PDD A;  1IMD A;  1KA0 A;  3A29 A;  3CHG A;  5CM6 A;  2DDK A;  3E79 A;  1LEV A;  3KC1 A;  2B4M A;  2VPN A;  5I7I A;  4N8Y A;  4P1L A;  2PFY A;  3FBP A;  2BJI A;  4MMP A;  3B50 A;  2R8T A;  5DW8 A;  2QVU A;  4NGU A;  1NV5 A;  1FSA A;  4GX3 A;  1YXI A;  1FPI A;  3IFA A;  4N91 A;  4G61 A;  3ROJ A;  5EQ9 A;  3D1R A;  2CEY A;  4N15 A;  4I3E A;  2ZZW A;  4MIJ A;  4PAK A;  2FBP A;  1FBC A;  1FBD A;  2CZI A;  2OWZ A;  5LDZ A;  2FVZ A;  1EYJ A;  1IMC A;  4MHF A;  4NG7 A;  4DI3 D;  4X8R A;  4MNP A;  4N4U A;  1VDW A;  4OVQ A;  5JK4 A;  4GWW A;  4GWX A;  3E78 A;  4MNI A;  2L5V A;  4P47 A;  4N8G A;  2HHM A;  4MCO A;  4F18 A;  5J16 A;  2CZK A;  2HZL A;  1FBH A;  5ET6 A;  1KZ8 A;  4HE2 A;  1NV0 A;  4H46 A;  2DVZ A;  1K9Y A;  1SPI A;  3PTY A;  5T3J A;  2F5X A;  1NV6 A;  4FBP A;  4PFI A;  5ET5 A;  5I3S A;  2OX3 A;  1RDZ A;  4N17 A;  3MST A;  4NF0 A;  4P3L A;  3T0J A;  1NUZ A;  4F1V A;  2HXR A;  5IZ1 A;  1FPD A;  2PFZ A;  1QGX A;  1G0H A;  4HCW A;  4OAN A;  4PGN A;  4LN5 A;  5F24 A;  2Y5L A;  4F19 A;  2Y5K A;  4PBQ A;  3NOH A;  4N81 A;  2PCR A;  4NN3 A;  4OVP A;  1LBZ A;  4O7I A;  1IMF A;  2QVR A;  4NQ8 A;  4YIC A;  3EKI A;  5IGA A;  5LTC A;  1FPF A;  4MEV A;  1G0I A;  4MAG A;  2KR0 A;  1FJ9 A;  2V4C A;  2WBB A;  2XWV A;  2XWI A;  4N6K A;  2Q9T A;  4PFR A;  4O7M A;  2WYP A;  1FPB A;  1FRP A;  4O94 A;  2FIE A;  5IZ3 A;  2MKZ A;  1LBX A;  2WBD A;  1RDY A;  4PFB A;  4PTK A;  3RYD A;  2WEF A;  2FHY A;  4HE1 A;  4N6D A;  2KQZ A;  4DI4 B;  4XF5 A;  5ESY A;  1NI9 A;  2QFL A;  4JVC A;  4I40 A;  2XWK A;  4P8B A;  1DK4 A;  5IZ3 B;  2JJK A;  2FIX A;  3GYY A;  2DE4 A;  4QXD A;  1FTA A;  2QPQ A;  3LUZ A;  5IM2 A;  4MJO A;  1NV1 A;  4GWU A;  1DBZ A;  1DCU A;  4PET A;  1LBW A;  2HPG A;  2ZZX A;  2V3Q A;  3T1B A;  4PCD A;  2F3B A;  5EQ8 A;  1FPL A;  3SZP A;  3MYU A;  2DE2 A;  5EYH A;  2Q74 A;  1YYZ A;  1NUY A;  3B8B A;  1D9Q A;  1FBG A;  1YZ0 A;  1Q9D A;  4JVI A;  4NAP A;  1LBY A;  4P9K A;  2ZZV A;  1JP4 A;  4HCY A;  4P56 A;  3KBZ A;  2VT5 A;  4PDH A;  4PC9 A;  2P3V A;  4H45 A;  5A5L A;  3ISP A;  1FPK A;  3KC0 A;  1FPJ A;  1NV3 A;  4HE0 A;  4OVR A;  4YZZ A;  4AS4 A;  3U65 A;  4MX6 A;  5IZZ A;  2XWO A;  4X04 A;  3RPL A;  4QBA A;  5FBP A;  2CEX A;  3W9W A;  5ET7 A;  1IMB A;  4PBH A;  2GQ1 A;  1KA1 A;  1FBF A;  2CZH A;  3IFC A;  1NV7 A;  1LBV A;  2F3D A;  4UAB A;  1XI6 A;  5ET8 A;  3BIG A;  4PAI A;  1IMA A;  1NUW A;  4OA4 A;  1FJ6 A;  4PF8 A;  3RPL B;  1FBP A;  5J1D A;  5EQA A;  1EYK A;  2XA5 A;  4XEQ A;  4X9T A;  1CNQ A;  4HXV A;  4GX4 A;  4PF6 A;  1IME A;  1NUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...