4MAGA

Crystal structure of the periplasmic sialic acid binding protein from vibrio cholerea
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
307
structure length
307
Chain Sequence
ATTLKMGMQASVGSVEYNSAKMLADTLEEMSQGEIKLALYPSAQLGDDRAMLQQLTLGDLDITYAEFGRMGLWIPRAEAVMLPYVAKDFDHLRRMFESDFGQGVRDEMLQKFNWRALDTWYNGTRETTSNRPLNSIEDFKGLKLRVPNAKQNLNYAKLSGASPTPMSFSEVYLALQTNAVDGQENPLPTIKTMKFYEVQKNLAMTHHIVNDQMVIISESTWQKLSDTDKDIIQKAVQKVGDAHTQTVKTQEAELVSFFKSEGINVTYPDLEPFREAMQPLYKEFDSNIGQPIVSKLAAMLQHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacterial periplasmic sialic acid-binding proteins exhibit a conserved binding site.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Sugar binding protein
molecule keywords Sialic Acid Binding Protein
total genus 121
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2013-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4magA00
5IM2A 4N6DA 4OVSA 2WYKA 2XWIA 4NF0A 4MEVA 2XXKA 4LN5A 4N8YA 2HPGA 5IZZA 2ZZXA 4MX6A 4NGUA 4PDHA 4NN3A 2VPOA 4YZZA 4N17A 4YICA 4PETA 2WYPA 4N8GA 4PF6A 2PFZA 2VPNA 4NG7A 2CEXA 4PCDA 4PGNA 4N4UA 4MIJA 4XFEA 3B50A 4MCOA 4P56A 4MAGA 3U65A 4P8BA 4N6KA 4NHBA 4DI4B 4PF8A 4PFIA 2PFYA 4O8MA 2CEYA 4NQ8A 2WX9A 2HZLA 4MNPA 4OVTA 2HZKA 4MNIA 4PFBA 2XA5A 2V4CA 4PE3A 4PAFA 4PGPA 4MMPA 4PBQA 2XWVA 4P1EA 4X04A 4N91A 4OA4A 4OANA 4DI3D 4NAPA 4PAIA 4PBHA 4P9KA 4P47A 4MHFA 4MNCA 4X8RA 4XF5A 5I5PA 4O7MA 4N15A 4OVRA 5LTCA 2XWOA 3GYYA 4OVQA 5I7IA 4XEQA 2ZZWA 3FXBA 4PC9A 4NX1A 4PFRA 4OVPA 4P1LA 4P3LA 2ZZVA 5CM6A 4UABA 4PAKA 2XWKA 4O94A 4PDDA 5IGAA
chains in the Genus database with same CATH superfamily
4R9FA 3CFXA 4N6DA 1ZMGA 2D3IA 5L9OA 5I59B 4U1ZA 1LFGA 2ABHA 4F1UA 2XXQA 4GWZA 3FJ7A 1QKBA 2F3BA 4F31B 5A5LA 2H4IA 5I2NA 1NH7A 1MG1A 1N04A 3ZKKA 1SYHA 4MLQA 5H8SA 2QPQA 4ESXA 5JEIA 3C9HA 2F6GA 4MAGA 3U92A 1CNQA 4ZEIA 1H44A 4O8MA 1ZBMA 1EZPA 1ZJLA 1JETA 3OSQA 2FNCA 2V4CA 1YXIA 3NOHA 3VFJA 3UP9A 3PD8A 3U1OA 3MUQA 3K01A 3PMWA 4GLIA 3A29A 4G8MA 4H6DA 2XHDA 3FD3A 2O68A 4Z0IA 3KC0A 5EYFA 2DS9A 2Y5LA 5I5PA 1LB8A 4ZEDA 4DDDA 2XXRA 4ZEKA 3IB1A 1MY3A 5KZTA 1JEVA 3H6WA 2ANJA 1PB9A 1J1NA 1OLCA 1FQEA 2VD2A 3A3CA 4GWYA 3MAMA 1O64A 1URDA 4O94A 3C32A 3PUVE 3HV1A 4OFJA 1MXVA 3SEXA 3MP8A 3OEKA 5I57A 4QFKA 1UTHA 1FTKA 1B0LA 4JB7A 1Y3PA 4IY6A 4DZ1A 5J16A 2ESNA 1XVXA 3Q28A 1ZU0A 4OWDA 5H8NB 4GL8A 4GBVA 4P0IA 5I56B 3B50A 1H76A 1QJMA 2I3WA 3T1BA 5EYGA 3KN7A 3DP6A 3N6UA 4I40A 2Y5KA 3SETA 1NKXA 1LEVA 4RXLA 1N3WA 1PC3A 4PFBA 2XA5A 3QSLA 5CMKA 3HN0A 1B46A 4OZ9A 3CFZA 1OQHA 1DCUA 3TQLA 3KN3A 1D9QA 1BIYA 3FUZA 2QS4A 2ZYMA 4OFLA 1CB6A 2LAOA 3RTFB 3PPOA 2Z22A 1RDXA 4DE8A 3G7WA 2O7IA 4FEDA 2PCRA 1DOTA 3LV0A 4RYAA 1KWHA 1OQGA 1GGGA 2UYEA 1JQFA 4JSOA 2RF1A 2CZLA 2YJPA 3LSXA 3CVGA 3RTWB 3EHSA 3DP8A 3R6UA 3IB0A 3N5LA 3VVDA 1ZTYA 1JVXA 1B51A 2Q8JA 4NF6B 1MM6A 1B9JA 1B32A 3FJMA 2ZZXA 2GFEA 2VPOA 2ALUA 3KN8A 2PT1A 3LR1A 2PX1A 3ECRA 1KA0A 1I6AA 2WYPA 3TPAA 3E4RA 3K0VA 1IMBA 1FQFA 2DWIA 2CZIA 2F8DA 2Z8EA 1FW0A 4OEVA 4OENA 3T9XB 4EUOA 4OQOA 3O28A 4KYSA 2RC9A 4YKPA 1HSJA 1LSTA 1FBCA 1O7TA 3FASA 4H5GA 1Y9UA 4GX6A 2XXXA 3LSWA 5H8QB 1F9BA 4KD5A 4ZZEA 4X04A 2DXYA 4MFIA 3T93B 1FPEA 2XXUA 2H9BA 4KR5A 3T22A 2PBWA 4BDQA 4PAIA 3CHGA 1IMEA 1NV1A 3LSLA 1A40A 3SESA 3PPQA 2XX7A 3M8UA 2AYSA 5EHMA 2REGA 1JEUA 2G93A 2CMOA 1URSA 2OK2A 1LAHE 4DIGA 4GX3A 1Y3QA 1ATGA 4FBPA 5ELVA 4P3LA 1FBGA 2OJTA 2XXVA 4ELRA 3ROJA 2XWKA 1LBCA 4OXVA 1TT1A 3LC8A 4OHNA 1VR5A 3KFMA 2OZZA 3TELA 4X1DA 1B7ZA 2WYKA 2HAUA 4MEVA 2V3QA 2XXKA 4LQ5A 2NOOA 1IXIA 5TP9A 1B0HA 1B2HA 4NN3A 3Q25A 4F22A 3TTKA 2DYXA 1PBPA 2RKMA 4YICA 3V5AA 4ESWA 4EDPA 1VFDA 2PFZA 3TYHA 1I6BA 4NG7A 4XKQA 2XXYA 1MXYA 5DVIA 2QSXA 4QFOA 1NUYA 3KBRA 3U65A 1POY1 3IOWA 3EN3A 2H5YA 3H06B 4PQJA 2F7CA 5B70A 1AL3A 1XVYA 1NV4A 3VLVA 2QMWA 4MNIA 4H67A 2XWVA 3FXUA 5I57B 4N91A 4R6KA 1LBVA 4C0RA 3JV9A 1MPCA 1GVCA 4BLAA 1FTOA 1GTKA 3OXNA 3QXMA 2Q2AA 4EXLA 4MF3A 2AIXA 4LZ5A 1H43A 2PVUA 1NV6A 3LUYA 1P1WA 2GQ1A 2HQ0A 4Z7EA 1JP4A 1NMUA 4IO7A 2XX8A 4DCXA 1YTVA 4TQUQ 2DWAA 1EZOA 2RC8A 4RK9A 3KSXA 1M5DA 1MPDA 4YB5A 3IX1A 4EQBA 1VDWA 1FRPA 4OTEA 4AS5A 5IZZA 4DLDA 5CBRA 4EXKA 3QK6A 3C31A 3TZAA 4JSDA 2I0BA 4TLMB 4YZZA 1FBDA 5AA2B 2I58A 2Y7PA 2Z8DA 4OYVA 1IQ7A 4QBAA 3MYUA 1Q35A 5H8NA 3OO8A 2V93A 5KDTA 2F3DA 3G3JA 4I3EA 2Q2CA 4U2RA 1SDXA 4WKMA 3PMVA 4ZDMA 1NV2A 3HPIA 3WAEA 1LB9A 2QL3A 3CSGA 4HCYA 4OVTA 1LBYA 2Z23A 1DMBA 3OEMA 1B5JA 2V25A 4X1BA 1JVYA 2ONSA 3HCQA 3CG1A 4PFWA 1N3XA 3N6TA 1QUKA 4MHFA 2H99A 1YYZA 2HEUA 1NV7A 3MC2A 1XC1A 4IO3A 4YB6A 3I5OA 2DQVA 1LBBA 1XHYA 1JNFA 4N15A 4BDLA 4POWA 3IFCA 4M1VA 2Y84A 5I7IA 4OEUA 2ZZWA 3FXBA 3S2VA 4GFRA 1B1XA 1PB7A 4TLLB 2XD2A 4ZECA 1I69A 1MQDA 1NNPA 4U4XA 3CFLA 1AWBA 3TAJA 4OVSA 5L9SA 2UVJA 2XXIA 3CI8A 1NL5A 4NF0A 4G68A 4Q8RA 4H1XA 4KCDA 2CZKA 4YKIA 2Y7KA 2Y7IA 1B3LA 3CR9A 3IL1B 1ELJA 4H0WA 3V83A 2HXRA 1BK4A 1QGXA 5BUUA 2V3UA 4BDMA 1FQBA 1ZKBA 4R6HA 5H8FB 4FEBA 3TCFA 4QSEA 3K2DA 3K6WA 3N26A 4C1UA 3ZSFA 3W9VA 1B58A 2UVHA 3IFAA 1FPDA 3MP1A 1UTBB 2XXTA 1LAXA 2QS3A 2F7BA 5TPAB 5JTYA 4DI3D 2HHMA 2Y7RA 4HTGA 1SVXB 4JVCA 4QFPA 3HSTA 3H6VA 2A5TB 4I1DA 4AB6A 3FXRA 3O6GA 4MNCA 1UIUA 5KCJB 1BP5A 2B65A 4F39A 1FPFA 2QVRA 2I4CA 5CC2A 1YPNA 1DSNA 3TMGA 3TCGA 1LBXA 4DXUA 5I58A 3IAZA 3EF7A 2XWOA 2ZNUA 2VGQA 4XTCQ 4XEQA 5CMMA 4H65A 4NX1A 4NF8A 5IKBA 4QSCA 1LBZA 2UVGA 1N84A 2VOZA 1AMFA 1JW1A 3BFTA 3K1MA 1N7XA 5CMCA 4GBWA 5EQ8A 4JWYA 1FPKA 3VV5A 2XXHA 1L5TA 5ISUA 5AA2A 5AA4A 5CMBA 1K9ZA 1S9TA 5I84A 3K6VA 5AA1A 4I3YA 3UA8A 4O3BA 3TODA 4EQ9A 2VHAA 1PB8A 3W9WA 1B4HA 4TOZA 4GVOA 5ET5A 1Q9DA 4RPOA 1AH5A 1NI9A 2Q88A 2VPNA 2O6AA 3ZKLA 3KG2A 1B3GA 3ONMA 4N6KA 3FVNA 4HCWA 1IIWA 3TTNA 2CEYA 1SI0A 3KOTA 1MPBA 1MXUA 1MXZA 1A8EA 1LCTA 4I8CA 4PFTA 4OANA 1YAEA 4EF1A 2KQZA 4GIZA 1IXCA 3TQWA 4R9GA 4G8NA 4P9KA 4R72A 2OX3A 5BWJA 3TFLA 2Q89A 2P3NA 1MQIA 1JW5A 2F6PA 1FPJA 3QYTA 5LTCA 4YKKA 1MM7A 5IZ3B 4KYEA 2B4LA 3C33A 4PC9A 1IXGA 3KGCA 4HE2A 3H3GA 3SEVA 1FBFA 1MQHA 1LFHA 3LSFB 5KCJA 4QF9A 3U93A 4E0WA 3RLFE 1R9QA 1I6QA 5F24A 1A55A 4Q0CA 1INPA 3RPWA 3OELA 1NNTA 1NFTA 4NGUA 3A09A 4E0XA 2B3BA 1IMDA 5H8HA 3GXAA 3PUYE 4IY5A 2FVZA 3IORA 3MJNA 1QVSA 3QAXA 1PDAA 1D9YA 3K6XA 1FQDA 3MQ9A 4P56A 4F3BA 3FATA 1XT8A 2GH9A 4U1OA 3FIRA 5K2YA 3THIA 3PUWE 1IITA 3MW0A 5I56A 3RUMA 4NF5A 3E13X 1NNKA 2Q9TA 3V89B 4F3GA 4GXSB 1MY0A 2YPNA 4WEPA 5ITPA 1FJ9A 3ZS6A 3U72A 4PE5B 3RQTA 4F3PA 2O51A 1IXHA 3MZBA 5I2KB 3MBPA 1DK4A 2DE3A 3RPLA 1B3FA 4NWDA 2YLNA 2F78A 4G77A 4FIMA 1SW1A 2WBDA 4PAKA 2PMSA 4L17A 4U23A 4LVQA 2I3VA 3RN8A 4Q30B 1II5A 2P0SA 2FIEA 3D4GA 5I59A 4F2QA 4H45A 1RDZA 2QMXA 3KC1A 3KZGA 4G68C 4NE4A 4PDHA 5HPQA 3FJGA 4ECFA 4O7IA 4N17A 5ICTA 1DPEA 1H3DA 4PFUA 4N8GA 4RA1A 3PPPA 2DVCA 3BBRA 3VVEA 4EQ7A 4PCDA 1O63A 4WEDA 3FXQA 1FPBA 1FTLA 5L8DA 3CSBA 5I2KA 1B5IA 3I3VA 3TDJA 2V84A 1TFAA 4GF8A 5L9MA 3BIGA 1KA1A 3JYRA 1SQYA 4NQ8A 3ILTB 1B5HA 3C35A 3IO6A 1LAFE 4H46A 1XI6A 4YKJA 4LZ7A 4N07A 1FQAA 3RT8A 3S9LC 4X48A 3TUSA 3H4ZA 4LP2B 3PMXA 1SW5A 1RYXA 1T0KA 4GRKA 4P47A 3KOSA 1N76A 3EPEA 3C34A 4HW8A 3IB2A 1DBZA 4O7MA 1IEJA 4EF2A 2JJKA 3MZ9A 2I0CA 3GYYA 4GWWA 2FA7A 4OVQA 1FJ6A 1POTA 4OVPA 1BLFA 4C1TA 4IB2A 5I2NB 1EH3A 4UABA 2ZYOA 2H25A 3CIJA 4G8HA 3IOVA 3T0JA 1QUIA 4P11A 1QW0A 1P1OA 1EYKA 3OO9A 4IGTA 2XWIA 3G3FA 3E9XA 3FVKA 1NUWA 4YAHX 3V8XB 2HAVA 5AA4B 3ODBA 1IZ1A 4O3CA 2DE4A 1NH8A 3S9MC 3FGSA 2F35A 3G3IA 1SPIA 3K00A 2Q8MA 2CEXA 5JTYB 4XFEA 3PGFA 2AL4A 1MDQA 3QUJA 5DT6A 1S50A 4NF4B 5CBSA 3MSTA 2E0SA 1P1QA 2P2AA 4OVJA 4KCCA 5I58B 2ZXTA 3IJOB 3H6TA 1BKAA 4ELPA 2ZMBA 2L5VA 2WKYA 1P1NA 3G3HA 2OLBA 1LBWA 4OESA 1SBPA 4ELQA 2Q74A 2DWJA 2F97A 3OMBA 3IR1A 3K1NA 5J1DA 3UGWA 2I6EA 3BFUA 1HSEA 3O66A 3RY3A 1Y3NA 1Z7ME 1P99A 4XF5A 4KPTA 1WODA 4BDRA 3O9PA 1UQWA 4AQ4A 1G0HA 2ZZVA 1LGBC 1B52A 1SI1A 1NUXA 1USYH 2UYFA 3MPKA 5DW8A 4ZE9A 3RGYA 3VE1B 3O29A 4ZE8A 4PP0A 2ZNTA 2KLFA 3IK6B 1Y1ZA 4F2OA 1MH4A 1MY1A 4MX6A 5EHSA 4ZZAA 1FBHA 4FATA 2O69A 4N81A 3GBAA 4UACA 3DP4A 4MJOA 4GD5A 1A7LA 3BIHA 1VFEA 4THIA 4KHZE 3PPNA 1AIVA 1OMPA 2R8TA 1HSLA 2I49A 1M5EA 4NHBA 3TKDA 3HHGA 4JVIA 2GRVA 1M5CA 2HZLA 3W15C 2V3TA 2DE2A 2UXAA 2RCBA 3MP6A 4PE3A 3H6UA 2DXRA 4H8JA 2ZNSA 4PGPA 1B7HA 4R74A 1FBPA 1FPGA 4AS4A 3VDFA 3OOAA 3Q27A 1K9YA 4XXUA 4NAPA 2QVVA 4JWOA 1FTAA 2I4BA 5EQ7A 3QMFA 4NF6A 3TCHA 1NV0A 1R9LA 1NV3A 4FE8A 1TWYA 1RKMA 1SYIA 3TEPA 3IOUA 1RYOA 2VT5A 2F34A 1JW4A 4QXDA 3B6QA 4FJPA 3EKIA 4H8IA 4BDOA 4JDFA 5H8FA 2OWZA 2NXOA 3N94A 4F1YA 2X7QA 3O2AA 3RNNA 1GV8A 1YZ0A 4R6YA 4LN5A 4N8YA 2HPGA 4QRZA 4OFOA 1N7WA 1MH3A 2KR0A 3SEYA 4YMAA 3FVGA 4QFNA 2DOJA 5LDZA 3OO7A 5ET8A 2F5XA 5AE4A 4NWCA 1Z7NE 1QULA 4P0GA 3AXFA 4BDNA 1R1NA 2FBPA 2REJA 5DTBA 1MY4A 2DVZA 4HS7A 2XXPA 4G61A 3T9UA 2OWTA 5EQAA 1DTZA 4FORA 1QUJA 1XS5A 4JWXA 4IO5A 2FYIA 2XD3A 4IO2A 4AB5A 5M2VA 4RK2A 4F3SA 2NWJA 1H45A 4F1VA 3USDA 1D9VA 5LOMA 3T9VA 1BTJA 1FCKA 3K6UA 3MPLA 4WXJA 4IO4A 3E79A 1YCJA 3RT6B 3HFUA 3PUZE 2DDKA 5H8QA 4G2ZA 3U94A 3IOTA 4F19A 1FQCA 4GWXA 3GBBA 3R26A 4KQPA 4PFRA 3Q29A 1OLAA 5FBPA 3MVYA 2B4MA 2UVIA 1XOCA 3M3KA 1RDYA 1ANFA 4XIGQ 2QFLA 1A99A 5EYHA 4PDDA 2VP1A 4U21A 4NMYA 3T66A 4GL0A 3PTYA 1A54A 2X26A 3D1RA 4Q5TA 3MVWA 5A5XA 1USYE 4MLVA 3TTRA 1TXFA 1B05A 1Q1KA 3QIMA 2DP8A 1LCFA 4ELOA 4ZS9A 1US5A 2OCUA 3SERA 3SZPA 3Q26A 1FTMA 3K02A 1MDP1 3A3UA 2NVUB 1MQJA 5TP9B 5CRYA 2RCAA 2RC7A 1NUZA 1MQGA 5IAIA 1URGA 4OERA 4KYDA 4NF4A 3S9EA 4R75A 3C36A 1EZ9A 4YU0A 5TU0A 3IJXB 1MXXA 3FV2A 5FTIA 2Z8FA 1TFDA 2WEFA 3B6WA 3D4CA 4NF8B 3FZVA 1R6ZA 4XKPA 1EU8A 3CRBA 5IZ1A 4FAJA 3S9NC 3LBSA 2Y7WA 1MS7A 1D4NA 3I6VA 4PFYA 3WAFA 4POXA 4LONB 3TTLA 2O84X 1UTHB 4DXBA 3UK4A 4O3AA 1QKAA 3RYDA 3MZ1A 3M3FA 5ET7A 5DVFA 4P1LA 4FECA 5CM6A 3SKPA 1IUDA 2MKZA 4N6PA 1B1HA 3FVOA 4GWOA 3DM0A 5KDTB 4JBZA 5F1QA 5IZ3A 3T96B 3T9HB 3KSJA 1Y4CA 1MXWA 4U22A 5IM2A 3VLUA 3P7IA 3VXBA 2GHBA 3UIFA 4IR8A 4G68B 3OD7A 1UIVA 4IGRA 2IEEA 1Y4TA 2F7AA 3FV1A 1FSAA 3GLBA 3M3LA 4OETA 4JVDA 4NEDA 4N13A 1DTGA 3VXCA 3B6TA 3K4UA 4LZ8A 2AL5A 3MWBA 4GWUA 2QRYA 1A8FA 4RY1A 4XKRA 5FHNA 5A5XB 2DWHA 2W7YA 2XX9A 4DI4B 4PF8A 2FHYA 2PFYA 2ONKE 2HZKA 4H5FA 4R2FA 1LLSA 4PAFA 1IMFA 4P1EA 2DSFA 3O6IA 2O7UA 5I3SA 5DEXB 1FPLA 3ILUB 1WDNA 4PBHA 5AA2D 3B8BA 3G3GA 4DXCA 1SW4A 3EHUA 2D5WA 1OVBA 5HBCA 4RNSA 1SW2A 3JZJA 2BJJX 2ONRA 3MVZA 4F29A 3SEWA 1MY2A 4GWSA 5AA3A 5K2XA 1P1UA 3ISPA 3BKIB 5H8HB 4G4PA 5DVJA 3QUFA 4R73A 4ISUA 3R7XA 1US4A 5B7DA 5FTHA 3UN6A 1CE2A 5TPAA 2HCAA 3EQ1A 4PETA 3S4UA 4M4GA 3CG3A 5FHMA 3B7DA 5JK4A 2ZYNA 4HE1A 4N4UA 4MIJA 1B6HA 2CZHA 4KFQA 2A5SA 4MCOA 3KEIA 1AOVA 3LUZA 2QVUA 5DYHA 3VLWA 4ND9A 2HFBA 1M5FA 3O97A 4P8BA 4QFLA 5ET6A 2PYYA 2B3FA 2WX9A 1OIBA 4MNPA 3H7MA 1IMCA 3SEUA 5HM4B 4MMPA 4PBQA 1FBEA 4OA4A 4RJZA 2NUVA 1EYJA 2M8CA 4GQOA 4GXAA 3L6GA 2P3VA 3EHTA 4QSDA 4HXVA 2H98A 4QHQA 5F7VA 4ZEFA 1EYIA 2FIXA 4RPNA 2GHAA 1PEBA 1Y20A 2THIA 5ICQA 4OVRA 1M5BA 5ESYA 1GR2A 3E3KA 3PU5A 4K3FA 4GX4A 1ZIUA 2X7PA 4NTLA 3DELB 4I9DA 2A5TA 4XKNA 1D3KA 2ZYKA 2WBBA 3G3KA 1LAGE 4PTKA 5EQ9A 3TTMA 3FBPA 1FTJA 5IGAA 4LUBA 1Y1MA 1B7UA 3SDFA 2O1MA 2F36A 1NV5A 1MRPA 1S7YA 3OO6A 1KZ8A 2G29A 4HE0A 2E1SA 1G0IA 2R9JA 3O6HA 3OENA 4JXIA 1NNFA 1PBQA 3MVXA 1SD3A 4OMBA 2HXWA 3RPLB 4PF6A 3IO4A 2R6GE 4UA8A 3PUXE 4X9TA 4MH5A 1B3EA 5T3JA 3HO7A 4PGNA 5FHOA 3KJ7A 3PV0E 4U4SA 1IMAA 4ZEBA 1B4ZA 4YB7A 2O1LA 1UTBA 5CI5A 3KJTA 4KI0E 5DEXA 4PFIA 3F11A 2OWSA 4LA9A 2QS2A 4MBPA 4YMBA 4NF5B 3VVFA 4IO6A 2I48A 1WVJA 2OBGA 1ZLQA 5ITOA 3K1PA 3C4MA 2PT2A 3L6HA 4LQ2A 1B40A 4DCYA 4F18A 1FPIA 3E78A 2D21A 1DPPA 2QS1A 4X8RA 2XXWA 4R2BA 1VE4A 2VD3A 3KBZA 2P1SA 3PD9A 1OVTA 2QJEA 3U8QA 3HHFA 3GZGA 2BJIA 4GOTA 1LFIA 4LATA 3DLNA 4ONYA 2RINA 3OSRA 3PPRA 2R71A 1N0TA 3H03A 2IA4A 1B3HA 4KXPA 1VSOA 3UORA 4I62A
chains in the Genus database with same CATH topology
3T0JA 5IM2A 5F24A 5T3JA 1FPKA 5DW8A 4N6DA 2FIEA 4OVSA 1NV5A 1YZ0A 1EYKA 1INPA 4IR8A 2WYKA 2XWIA 4NF0A 3PTYA 4MEVA 1VDWA 2V3QA 1FRPA 2XXKA 4LN5A 4N8YA 2HPGA 4AS5A 1KZ8A 4HE0A 4H45A 1RDZA 5IZZA 1K9ZA 3D1RA 3KC1A 1G0IA 1NUWA 2CZKA 2ZZXA 1FSAA 4MX6A 4NGUA 2KR0A 4GWZA 4PDHA 4F1UA 5J16A 4I3YA 4NN3A 2VPOA 4JVDA 1FBHA 2DE4A 4YZZA 4O7IA 1IMDA 1FBDA 4N17A 3RPLB 1KA0A 4PFIA 4N81A 2F3BA 4PETA 2FVZA 2WYPA 4N8GA 4YICA 3W9WA 5A5LA 4PF6A 1IMBA 5LDZA 5ET8A 5ET5A 1Q9DA 2F5XA 2PFZA 1SPIA 4X9TA 4QBAA 3MYUA 4MJOA 2Q8MA 5JK4A 1NI9A 3SZPA 2VPNA 4NG7A 2CEXA 2CZIA 4HE1A 4PCDA 4GBVA 3BIHA 4MIJA 4N4UA 2HXRA 2CZHA 4PGNA 2FBPA 4GWUA 4XFEA 1BK4A 1FPBA 1QGXA 3B50A 1IMAA 2DVZA 2QPQA 2F3DA 4MCOA 4P56A 4I3EA 3LUZA 4G61A 2QVUA 1NUYA 4MAGA 2R8TA 5EQAA 3U65A 3T1BA 5EYGA 4P8BA 1NUZA 4N6KA 4NHBA 5ET6A 1CNQA 1NV2A 4HCWA 2Y5KA 4I40A 3MSTA 4PF8A 2FHYA 2PFYA 1FBCA 1KA1A 2CEYA 3BIGA 1LEVA 4JVIA 4NQ8A 4O8MA 2WX9A 2HZLA 1NV4A 4GX6A 4MNPA 4OVTA 4HCYA 1LBYA 2HZKA 2DE2A 4H46A 4MNIA 4PFBA 1IMCA 2XA5A 3W9VA 1XI6A 2V4CA 4PE3A 4PAFA 3IFAA 1FPDA 1YXIA 2L5VA 4PGPA 3NOHA 4MMPA 1FBEA 1IMFA 2Q9TA 4PBQA 1FBPA 2XWVA 4P1EA 4X04A 1DCUA 1LBWA 4N91A 1FPGA 4OA4A 1EYJA 1FPEA 4OANA 5I3SA 4AS4A 4F1VA 2KQZA 2Q74A 1LBVA 1FPLA 1D9QA 1K9YA 3A29A 4DI3D 2P3VA 4NAPA 2WEFA 2HHMA 2QVVA 4F18A 4PAIA 4PBHA 4DI4B 4P9KA 1FPIA 3CHGA 1IMEA 4JVCA 1NV1A 2OX3A 4HXVA 3E78A 5J1DA 1FTAA 3KC0A 4P47A 1FJ9A 3B8BA 3E79A 4MHFA 3QMFA 5EQ7A 4MNCA 2P3NA 5IZ1A 1YYZA 2Y5LA 1EYIA 1FPFA 1NV7A 1NV0A 2FIXA 2QVRA 3HFUA 4X8RA 4XF5A 5I5PA 1DBZA 1NV3A 3KBZA 4O7MA 1FPJA 2DDKA 1RDXA 4N15A 4OVRA 1LBXA 5LTCA 2JJKA 1DK4A 2VT5A 2DE3A 2XWOA 2PCRA 3IFCA 4GWWA 2BJIA 3GYYA 5ESYA 5IZ3B 4F19A 1NV6A 2B4LA 4GWXA 4M1VA 4OVQA 3LV0A 4GX4A 1FJ6A 3RPLA 4QXDA 4XEQA 3RYDA 2ZZWA 3EKIA 3FXBA 5I7IA 4PC9A 4GX3A 5ET7A 4GWSA 4NX1A 4PFRA 4OVPA 4HE2A 4FBPA 4P1LA 1G0HA 2ZZVA 4P3LA 1LBZA 5FBPA 1FBGA 5CM6A 2WBBA 4UABA 2WBDA 1FBFA 2OWZA 2B4MA 4PAKA 2GQ1A 2MKZA 1RDYA 2XWKA 4GWYA 3ROJA 4PTKA 3ISPA 5EQ9A 5IGAA 1JP4A 4KXPA 3FBPA 1NUXA 2QFLA 4O94A 1AWBA 5IZ3A 5EYHA 4PDDA 4GBWA 5EQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IM2 A;  4N6D A;  4OVS A;  2WYK A;  2XWI A;  4NF0 A;  4MEV A;  2XXK A;  4LN5 A;  4N8Y A;  2HPG A;  5IZZ A;  2ZZX A;  4MX6 A;  4NGU A;  4PDH A;  4NN3 A;  2VPO A;  4YZZ A;  4N17 A;  4YIC A;  4PET A;  2WYP A;  4N8G A;  4PF6 A;  2PFZ A;  2VPN A;  4NG7 A;  2CEX A;  4PCD A;  4PGN A;  4N4U A;  4MIJ A;  4XFE A;  3B50 A;  4MCO A;  4P56 A;  4MAG A;  3U65 A;  4P8B A;  4N6K A;  4NHB A;  4DI4 B;  4PF8 A;  4PFI A;  2PFY A;  4O8M A;  2CEY A;  4NQ8 A;  2WX9 A;  2HZL A;  4MNP A;  4OVT A;  2HZK A;  4MNI A;  4PFB A;  2XA5 A;  2V4C A;  4PE3 A;  4PAF A;  4PGP A;  4MMP A;  4PBQ A;  2XWV A;  4P1E A;  4X04 A;  4N91 A;  4OA4 A;  4OAN A;  4DI3 D;  4NAP A;  4PAI A;  4PBH A;  4P9K A;  4P47 A;  4MHF A;  4MNC A;  4X8R A;  4XF5 A;  5I5P A;  4O7M A;  4N15 A;  4OVR A;  5LTC A;  2XWO A;  3GYY A;  4OVQ A;  5I7I A;  4XEQ A;  2ZZW A;  3FXB A;  4PC9 A;  4NX1 A;  4PFR A;  4OVP A;  4P1L A;  4P3L A;  2ZZV A;  5CM6 A;  4UAB A;  4PAK A;  2XWK A;  4O94 A;  4PDD A;  5IGA A; 
#chains in the Genus database with same CATH topology
 4R9F A;  3CFX A;  4N6D A;  1ZMG A;  2D3I A;  5L9O A;  5I59 B;  4U1Z A;  1LFG A;  2ABH A;  4F1U A;  2XXQ A;  4GWZ A;  3FJ7 A;  1QKB A;  2F3B A;  4F31 B;  5A5L A;  2H4I A;  5I2N A;  1NH7 A;  1MG1 A;  1N04 A;  3ZKK A;  1SYH A;  4MLQ A;  5H8S A;  2QPQ A;  4ESX A;  5JEI A;  3C9H A;  2F6G A;  4MAG A;  3U92 A;  1CNQ A;  4ZEI A;  1H44 A;  4O8M A;  1ZBM A;  1EZP A;  1ZJL A;  1JET A;  3OSQ A;  2FNC A;  2V4C A;  1YXI A;  3NOH A;  3VFJ A;  3UP9 A;  3PD8 A;  3U1O A;  3MUQ A;  3K01 A;  3PMW A;  4GLI A;  3A29 A;  4G8M A;  4H6D A;  2XHD A;  3FD3 A;  2O68 A;  4Z0I A;  3KC0 A;  5EYF A;  2DS9 A;  2Y5L A;  5I5P A;  1LB8 A;  4ZED A;  4DDD A;  2XXR A;  4ZEK A;  3IB1 A;  1MY3 A;  5KZT A;  1JEV A;  3H6W A;  2ANJ A;  1PB9 A;  1J1N A;  1OLC A;  1FQE A;  2VD2 A;  3A3C A;  4GWY A;  3MAM A;  1O64 A;  1URD A;  4O94 A;  3C32 A;  3PUV E;  3HV1 A;  4OFJ A;  1MXV A;  3SEX A;  3MP8 A;  3OEK A;  5I57 A;  4QFK A;  1UTH A;  1FTK A;  1B0L A;  4JB7 A;  1Y3P A;  4IY6 A;  4DZ1 A;  5J16 A;  2ESN A;  1XVX A;  3Q28 A;  1ZU0 A;  4OWD A;  5H8N B;  4GL8 A;  4GBV A;  4P0I A;  5I56 B;  3B50 A;  1H76 A;  1QJM A;  2I3W A;  3T1B A;  5EYG A;  3KN7 A;  3DP6 A;  3N6U A;  4I40 A;  2Y5K A;  3SET A;  1NKX A;  1LEV A;  4RXL A;  1N3W A;  1PC3 A;  4PFB A;  2XA5 A;  3QSL A;  5CMK A;  3HN0 A;  1B46 A;  4OZ9 A;  3CFZ A;  1OQH A;  1DCU A;  3TQL A;  3KN3 A;  1D9Q A;  1BIY A;  3FUZ A;  2QS4 A;  2ZYM A;  4OFL A;  1CB6 A;  2LAO A;  3RTF B;  3PPO A;  2Z22 A;  1RDX A;  4DE8 A;  3G7W A;  2O7I A;  4FED A;  2PCR A;  1DOT A;  3LV0 A;  4RYA A;  1KWH A;  1OQG A;  1GGG A;  2UYE A;  1JQF A;  4JSO A;  2RF1 A;  2CZL A;  2YJP A;  3LSX A;  3CVG A;  3RTW B;  3EHS A;  3DP8 A;  3R6U A;  3IB0 A;  3N5L A;  3VVD A;  1ZTY A;  1JVX A;  1B51 A;  2Q8J A;  4NF6 B;  1MM6 A;  1B9J A;  1B32 A;  3FJM A;  2ZZX A;  2GFE A;  2VPO A;  2ALU A;  3KN8 A;  2PT1 A;  3LR1 A;  2PX1 A;  3ECR A;  1KA0 A;  1I6A A;  2WYP A;  3TPA A;  3E4R A;  3K0V A;  1IMB A;  1FQF A;  2DWI A;  2CZI A;  2F8D A;  2Z8E A;  1FW0 A;  4OEV A;  4OEN A;  3T9X B;  4EUO A;  4OQO A;  3O28 A;  4KYS A;  2RC9 A;  4YKP A;  1HSJ A;  1LST A;  1FBC A;  1O7T A;  3FAS A;  4H5G A;  1Y9U A;  4GX6 A;  2XXX A;  3LSW A;  5H8Q B;  1F9B A;  4KD5 A;  4ZZE A;  4X04 A;  2DXY A;  4MFI A;  3T93 B;  1FPE A;  2XXU A;  2H9B A;  4KR5 A;  3T22 A;  2PBW A;  4BDQ A;  4PAI A;  3CHG A;  1IME A;  1NV1 A;  3LSL A;  1A40 A;  3SES A;  3PPQ A;  2XX7 A;  3M8U A;  2AYS A;  5EHM A;  2REG A;  1JEU A;  2G93 A;  2CMO A;  1URS A;  2OK2 A;  1LAH E;  4DIG A;  4GX3 A;  1Y3Q A;  1ATG A;  4FBP A;  5ELV A;  4P3L A;  1FBG A;  2OJT A;  2XXV A;  4ELR A;  3ROJ A;  2XWK A;  1LBC A;  4OXV A;  1TT1 A;  3LC8 A;  4OHN A;  1VR5 A;  3KFM A;  2OZZ A;  3TEL A;  4X1D A;  1B7Z A;  2WYK A;  2HAU A;  4MEV A;  2V3Q A;  2XXK A;  4LQ5 A;  2NOO A;  1IXI A;  5TP9 A;  1B0H A;  1B2H A;  4NN3 A;  3Q25 A;  4F22 A;  3TTK A;  2DYX A;  1PBP A;  2RKM A;  4YIC A;  3V5A A;  4ESW A;  4EDP A;  1VFD A;  2PFZ A;  3TYH A;  1I6B A;  4NG7 A;  4XKQ A;  2XXY A;  1MXY A;  5DVI A;  2QSX A;  4QFO A;  1NUY A;  3KBR A;  3U65 A;  1POY 1;  3IOW A;  3EN3 A;  2H5Y A;  3H06 B;  4PQJ A;  2F7C A;  5B70 A;  1AL3 A;  1XVY A;  1NV4 A;  3VLV A;  2QMW A;  4MNI A;  4H67 A;  2XWV A;  3FXU A;  5I57 B;  4N91 A;  4R6K A;  1LBV A;  4C0R A;  3JV9 A;  1MPC A;  1GVC A;  4BLA A;  1FTO A;  1GTK A;  3OXN A;  3QXM A;  2Q2A A;  4EXL A;  4MF3 A;  2AIX A;  4LZ5 A;  1H43 A;  2PVU A;  1NV6 A;  3LUY A;  1P1W A;  2GQ1 A;  2HQ0 A;  4Z7E A;  1JP4 A;  1NMU A;  4IO7 A;  2XX8 A;  4DCX A;  1YTV A;  4TQU Q;  2DWA A;  1EZO A;  2RC8 A;  4RK9 A;  3KSX A;  1M5D A;  1MPD A;  4YB5 A;  3IX1 A;  4EQB A;  1VDW A;  1FRP A;  4OTE A;  4AS5 A;  5IZZ A;  4DLD A;  5CBR A;  4EXK A;  3QK6 A;  3C31 A;  3TZA A;  4JSD A;  2I0B A;  4TLM B;  4YZZ A;  1FBD A;  5AA2 B;  2I58 A;  2Y7P A;  2Z8D A;  4OYV A;  1IQ7 A;  4QBA A;  3MYU A;  1Q35 A;  5H8N A;  3OO8 A;  2V93 A;  5KDT A;  2F3D A;  3G3J A;  4I3E A;  2Q2C A;  4U2R A;  1SDX A;  4WKM A;  3PMV A;  4ZDM A;  1NV2 A;  3HPI A;  3WAE A;  1LB9 A;  2QL3 A;  3CSG A;  4HCY A;  4OVT A;  1LBY A;  2Z23 A;  1DMB A;  3OEM A;  1B5J A;  2V25 A;  4X1B A;  1JVY A;  2ONS A;  3HCQ A;  3CG1 A;  4PFW A;  1N3X A;  3N6T A;  1QUK A;  4MHF A;  2H99 A;  1YYZ A;  2HEU A;  1NV7 A;  3MC2 A;  1XC1 A;  4IO3 A;  4YB6 A;  3I5O A;  2DQV A;  1LBB A;  1XHY A;  1JNF A;  4N15 A;  4BDL A;  4POW A;  3IFC A;  4M1V A;  2Y84 A;  5I7I A;  4OEU A;  2ZZW A;  3FXB A;  3S2V A;  4GFR A;  1B1X A;  1PB7 A;  4TLL B;  2XD2 A;  4ZEC A;  1I69 A;  1MQD A;  1NNP A;  4U4X A;  3CFL A;  1AWB A;  3TAJ A;  4OVS A;  5L9S A;  2UVJ A;  2XXI A;  3CI8 A;  1NL5 A;  4NF0 A;  4G68 A;  4Q8R A;  4H1X A;  4KCD A;  2CZK A;  4YKI A;  2Y7K A;  2Y7I A;  1B3L A;  3CR9 A;  3IL1 B;  1ELJ A;  4H0W A;  3V83 A;  2HXR A;  1BK4 A;  1QGX A;  5BUU A;  2V3U A;  4BDM A;  1FQB A;  1ZKB A;  4R6H A;  5H8F B;  4FEB A;  3TCF A;  4QSE A;  3K2D A;  3K6W A;  3N26 A;  4C1U A;  3ZSF A;  3W9V A;  1B58 A;  2UVH A;  3IFA A;  1FPD A;  3MP1 A;  1UTB B;  2XXT A;  1LAX A;  2QS3 A;  2F7B A;  5TPA B;  5JTY A;  4DI3 D;  2HHM A;  2Y7R A;  4HTG A;  1SVX B;  4JVC A;  4QFP A;  3HST A;  3H6V A;  2A5T B;  4I1D A;  4AB6 A;  3FXR A;  3O6G A;  4MNC A;  1UIU A;  5KCJ B;  1BP5 A;  2B65 A;  4F39 A;  1FPF A;  2QVR A;  2I4C A;  5CC2 A;  1YPN A;  1DSN A;  3TMG A;  3TCG A;  1LBX A;  4DXU A;  5I58 A;  3IAZ A;  3EF7 A;  2XWO A;  2ZNU A;  2VGQ A;  4XTC Q;  4XEQ A;  5CMM A;  4H65 A;  4NX1 A;  4NF8 A;  5IKB A;  4QSC A;  1LBZ A;  2UVG A;  1N84 A;  2VOZ A;  1AMF A;  1JW1 A;  3BFT A;  3K1M A;  1N7X A;  5CMC A;  4GBW A;  5EQ8 A;  4JWY A;  1FPK A;  3VV5 A;  2XXH A;  1L5T A;  5ISU A;  5AA2 A;  5AA4 A;  5CMB A;  1K9Z A;  1S9T A;  5I84 A;  3K6V A;  5AA1 A;  4I3Y A;  3UA8 A;  4O3B A;  3TOD A;  4EQ9 A;  2VHA A;  1PB8 A;  3W9W A;  1B4H A;  4TOZ A;  4GVO A;  5ET5 A;  1Q9D A;  4RPO A;  1AH5 A;  1NI9 A;  2Q88 A;  2VPN A;  2O6A A;  3ZKL A;  3KG2 A;  1B3G A;  3ONM A;  4N6K A;  3FVN A;  4HCW A;  1IIW A;  3TTN A;  2CEY A;  1SI0 A;  3KOT A;  1MPB A;  1MXU A;  1MXZ A;  1A8E A;  1LCT A;  4I8C A;  4PFT A;  4OAN A;  1YAE A;  4EF1 A;  2KQZ A;  4GIZ A;  1IXC A;  3TQW A;  4R9G A;  4G8N A;  4P9K A;  4R72 A;  2OX3 A;  5BWJ A;  3TFL A;  2Q89 A;  2P3N A;  1MQI A;  1JW5 A;  2F6P A;  1FPJ A;  3QYT A;  5LTC A;  4YKK A;  1MM7 A;  5IZ3 B;  4KYE A;  2B4L A;  3C33 A;  4PC9 A;  1IXG A;  3KGC A;  4HE2 A;  3H3G A;  3SEV A;  1FBF A;  1MQH A;  1LFH A;  3LSF B;  5KCJ A;  4QF9 A;  3U93 A;  4E0W A;  3RLF E;  1R9Q A;  1I6Q A;  5F24 A;  1A55 A;  4Q0C A;  1INP A;  3RPW A;  3OEL A;  1NNT A;  1NFT A;  4NGU A;  3A09 A;  4E0X A;  2B3B A;  1IMD A;  5H8H A;  3GXA A;  3PUY E;  4IY5 A;  2FVZ A;  3IOR A;  3MJN A;  1QVS A;  3QAX A;  1PDA A;  1D9Y A;  3K6X A;  1FQD A;  3MQ9 A;  4P56 A;  4F3B A;  3FAT A;  1XT8 A;  2GH9 A;  4U1O A;  3FIR A;  5K2Y A;  3THI A;  3PUW E;  1IIT A;  3MW0 A;  5I56 A;  3RUM A;  4NF5 A;  3E13 X;  1NNK A;  2Q9T A;  3V89 B;  4F3G A;  4GXS B;  1MY0 A;  2YPN A;  4WEP A;  5ITP A;  1FJ9 A;  3ZS6 A;  3U72 A;  4PE5 B;  3RQT A;  4F3P A;  2O51 A;  1IXH A;  3MZB A;  5I2K B;  3MBP A;  1DK4 A;  2DE3 A;  3RPL A;  1B3F A;  4NWD A;  2YLN A;  2F78 A;  4G77 A;  4FIM A;  1SW1 A;  2WBD A;  4PAK A;  2PMS A;  4L17 A;  4U23 A;  4LVQ A;  2I3V A;  3RN8 A;  4Q30 B;  1II5 A;  2P0S A;  2FIE A;  3D4G A;  5I59 A;  4F2Q A;  4H45 A;  1RDZ A;  2QMX A;  3KC1 A;  3KZG A;  4G68 C;  4NE4 A;  4PDH A;  5HPQ A;  3FJG A;  4ECF A;  4O7I A;  4N17 A;  5ICT A;  1DPE A;  1H3D A;  4PFU A;  4N8G A;  4RA1 A;  3PPP A;  2DVC A;  3BBR A;  3VVE A;  4EQ7 A;  4PCD A;  1O63 A;  4WED A;  3FXQ A;  1FPB A;  1FTL A;  5L8D A;  3CSB A;  5I2K A;  1B5I A;  3I3V A;  3TDJ A;  2V84 A;  1TFA A;  4GF8 A;  5L9M A;  3BIG A;  1KA1 A;  3JYR A;  1SQY A;  4NQ8 A;  3ILT B;  1B5H A;  3C35 A;  3IO6 A;  1LAF E;  4H46 A;  1XI6 A;  4YKJ A;  4LZ7 A;  4N07 A;  1FQA A;  3RT8 A;  3S9L C;  4X48 A;  3TUS A;  3H4Z A;  4LP2 B;  3PMX A;  1SW5 A;  1RYX A;  1T0K A;  4GRK A;  4P47 A;  3KOS A;  1N76 A;  3EPE A;  3C34 A;  4HW8 A;  3IB2 A;  1DBZ A;  4O7M A;  1IEJ A;  4EF2 A;  2JJK A;  3MZ9 A;  2I0C A;  3GYY A;  4GWW A;  2FA7 A;  4OVQ A;  1FJ6 A;  1POT A;  4OVP A;  1BLF A;  4C1T A;  4IB2 A;  5I2N B;  1EH3 A;  4UAB A;  2ZYO A;  2H25 A;  3CIJ A;  4G8H A;  3IOV A;  3T0J A;  1QUI A;  4P11 A;  1QW0 A;  1P1O A;  1EYK A;  3OO9 A;  4IGT A;  2XWI A;  3G3F A;  3E9X A;  3FVK A;  1NUW A;  4YAH X;  3V8X B;  2HAV A;  5AA4 B;  3ODB A;  1IZ1 A;  4O3C A;  2DE4 A;  1NH8 A;  3S9M C;  3FGS A;  2F35 A;  3G3I A;  1SPI A;  3K00 A;  2Q8M A;  2CEX A;  5JTY B;  4XFE A;  3PGF A;  2AL4 A;  1MDQ A;  3QUJ A;  5DT6 A;  1S50 A;  4NF4 B;  5CBS A;  3MST A;  2E0S A;  1P1Q A;  2P2A A;  4OVJ A;  4KCC A;  5I58 B;  2ZXT A;  3IJO B;  3H6T A;  1BKA A;  4ELP A;  2ZMB A;  2L5V A;  2WKY A;  1P1N A;  3G3H A;  2OLB A;  1LBW A;  4OES A;  1SBP A;  4ELQ A;  2Q74 A;  2DWJ A;  2F97 A;  3OMB A;  3IR1 A;  3K1N A;  5J1D A;  3UGW A;  2I6E A;  3BFU A;  1HSE A;  3O66 A;  3RY3 A;  1Y3N A;  1Z7M E;  1P99 A;  4XF5 A;  4KPT A;  1WOD A;  4BDR A;  3O9P A;  1UQW A;  4AQ4 A;  1G0H A;  2ZZV A;  1LGB C;  1B52 A;  1SI1 A;  1NUX A;  1USY H;  2UYF A;  3MPK A;  5DW8 A;  4ZE9 A;  3RGY A;  3VE1 B;  3O29 A;  4ZE8 A;  4PP0 A;  2ZNT A;  2KLF A;  3IK6 B;  1Y1Z A;  4F2O A;  1MH4 A;  1MY1 A;  4MX6 A;  5EHS A;  4ZZA A;  1FBH A;  4FAT A;  2O69 A;  4N81 A;  3GBA A;  4UAC A;  3DP4 A;  4MJO A;  4GD5 A;  1A7L A;  3BIH A;  1VFE A;  4THI A;  4KHZ E;  3PPN A;  1AIV A;  1OMP A;  2R8T A;  1HSL A;  2I49 A;  1M5E A;  4NHB A;  3TKD A;  3HHG A;  4JVI A;  2GRV A;  1M5C A;  2HZL A;  3W15 C;  2V3T A;  2DE2 A;  2UXA A;  2RCB A;  3MP6 A;  4PE3 A;  3H6U A;  2DXR A;  4H8J A;  2ZNS A;  4PGP A;  1B7H A;  4R74 A;  1FBP A;  1FPG A;  4AS4 A;  3VDF A;  3OOA A;  3Q27 A;  1K9Y A;  4XXU A;  4NAP A;  2QVV A;  4JWO A;  1FTA A;  2I4B A;  5EQ7 A;  3QMF A;  4NF6 A;  3TCH A;  1NV0 A;  1R9L A;  1NV3 A;  4FE8 A;  1TWY A;  1RKM A;  1SYI A;  3TEP A;  3IOU A;  1RYO A;  2VT5 A;  2F34 A;  1JW4 A;  4QXD A;  3B6Q A;  4FJP A;  3EKI A;  4H8I A;  4BDO A;  4JDF A;  5H8F A;  2OWZ A;  2NXO A;  3N94 A;  4F1Y A;  2X7Q A;  3O2A A;  3RNN A;  1GV8 A;  1YZ0 A;  4R6Y A;  4LN5 A;  4N8Y A;  2HPG A;  4QRZ A;  4OFO A;  1N7W A;  1MH3 A;  2KR0 A;  3SEY A;  4YMA A;  3FVG A;  4QFN A;  2DOJ A;  5LDZ A;  3OO7 A;  5ET8 A;  2F5X A;  5AE4 A;  4NWC A;  1Z7N E;  1QUL A;  4P0G A;  3AXF A;  4BDN A;  1R1N A;  2FBP A;  2REJ A;  5DTB A;  1MY4 A;  2DVZ A;  4HS7 A;  2XXP A;  4G61 A;  3T9U A;  2OWT A;  5EQA A;  1DTZ A;  4FOR A;  1QUJ A;  1XS5 A;  4JWX A;  4IO5 A;  2FYI A;  2XD3 A;  4IO2 A;  4AB5 A;  5M2V A;  4RK2 A;  4F3S A;  2NWJ A;  1H45 A;  4F1V A;  3USD A;  1D9V A;  5LOM A;  3T9V A;  1BTJ A;  1FCK A;  3K6U A;  3MPL A;  4WXJ A;  4IO4 A;  3E79 A;  1YCJ A;  3RT6 B;  3HFU A;  3PUZ E;  2DDK A;  5H8Q A;  4G2Z A;  3U94 A;  3IOT A;  4F19 A;  1FQC A;  4GWX A;  3GBB A;  3R26 A;  4KQP A;  4PFR A;  3Q29 A;  1OLA A;  5FBP A;  3MVY A;  2B4M A;  2UVI A;  1XOC A;  3M3K A;  1RDY A;  1ANF A;  4XIG Q;  2QFL A;  1A99 A;  5EYH A;  4PDD A;  2VP1 A;  4U21 A;  4NMY A;  3T66 A;  4GL0 A;  3PTY A;  1A54 A;  2X26 A;  3D1R A;  4Q5T A;  3MVW A;  5A5X A;  1USY E;  4MLV A;  3TTR A;  1TXF A;  1B05 A;  1Q1K A;  3QIM A;  2DP8 A;  1LCF A;  4ELO A;  4ZS9 A;  1US5 A;  2OCU A;  3SER A;  3SZP A;  3Q26 A;  1FTM A;  3K02 A;  1MDP 1;  3A3U A;  2NVU B;  1MQJ A;  5TP9 B;  5CRY A;  2RCA A;  2RC7 A;  1NUZ A;  1MQG A;  5IAI A;  1URG A;  4OER A;  4KYD A;  4NF4 A;  3S9E A;  4R75 A;  3C36 A;  1EZ9 A;  4YU0 A;  5TU0 A;  3IJX B;  1MXX A;  3FV2 A;  5FTI A;  2Z8F A;  1TFD A;  2WEF A;  3B6W A;  3D4C A;  4NF8 B;  3FZV A;  1R6Z A;  4XKP A;  1EU8 A;  3CRB A;  5IZ1 A;  4FAJ A;  3S9N C;  3LBS A;  2Y7W A;  1MS7 A;  1D4N A;  3I6V A;  4PFY A;  3WAF A;  4POX A;  4LON B;  3TTL A;  2O84 X;  1UTH B;  4DXB A;  3UK4 A;  4O3A A;  1QKA A;  3RYD A;  3MZ1 A;  3M3F A;  5ET7 A;  5DVF A;  4P1L A;  4FEC A;  5CM6 A;  3SKP A;  1IUD A;  2MKZ A;  4N6P A;  1B1H A;  3FVO A;  4GWO A;  3DM0 A;  5KDT B;  4JBZ A;  5F1Q A;  5IZ3 A;  3T96 B;  3T9H B;  3KSJ A;  1Y4C A;  1MXW A;  4U22 A;  5IM2 A;  3VLU A;  3P7I A;  3VXB A;  2GHB A;  3UIF A;  4IR8 A;  4G68 B;  3OD7 A;  1UIV A;  4IGR A;  2IEE A;  1Y4T A;  2F7A A;  3FV1 A;  1FSA A;  3GLB A;  3M3L A;  4OET A;  4JVD A;  4NED A;  4N13 A;  1DTG A;  3VXC A;  3B6T A;  3K4U A;  4LZ8 A;  2AL5 A;  3MWB A;  4GWU A;  2QRY A;  1A8F A;  4RY1 A;  4XKR A;  5FHN A;  5A5X B;  2DWH A;  2W7Y A;  2XX9 A;  4DI4 B;  4PF8 A;  2FHY A;  2PFY A;  2ONK E;  2HZK A;  4H5F A;  4R2F A;  1LLS A;  4PAF A;  1IMF A;  4P1E A;  2DSF A;  3O6I A;  2O7U A;  5I3S A;  5DEX B;  1FPL A;  3ILU B;  1WDN A;  4PBH A;  5AA2 D;  3B8B A;  3G3G A;  4DXC A;  1SW4 A;  3EHU A;  2D5W A;  1OVB A;  5HBC A;  4RNS A;  1SW2 A;  3JZJ A;  2BJJ X;  2ONR A;  3MVZ A;  4F29 A;  3SEW A;  1MY2 A;  4GWS A;  5AA3 A;  5K2X A;  1P1U A;  3ISP A;  3BKI B;  5H8H B;  4G4P A;  5DVJ A;  3QUF A;  4R73 A;  4ISU A;  3R7X A;  1US4 A;  5B7D A;  5FTH A;  3UN6 A;  1CE2 A;  5TPA A;  2HCA A;  3EQ1 A;  4PET A;  3S4U A;  4M4G A;  3CG3 A;  5FHM A;  3B7D A;  5JK4 A;  2ZYN A;  4HE1 A;  4N4U A;  4MIJ A;  1B6H A;  2CZH A;  4KFQ A;  2A5S A;  4MCO A;  3KEI A;  1AOV A;  3LUZ A;  2QVU A;  5DYH A;  3VLW A;  4ND9 A;  2HFB A;  1M5F A;  3O97 A;  4P8B A;  4QFL A;  5ET6 A;  2PYY A;  2B3F A;  2WX9 A;  1OIB A;  4MNP A;  3H7M A;  1IMC A;  3SEU A;  5HM4 B;  4MMP A;  4PBQ A;  1FBE A;  4OA4 A;  4RJZ A;  2NUV A;  1EYJ A;  2M8C A;  4GQO A;  4GXA A;  3L6G A;  2P3V A;  3EHT A;  4QSD A;  4HXV A;  2H98 A;  4QHQ A;  5F7V A;  4ZEF A;  1EYI A;  2FIX A;  4RPN A;  2GHA A;  1PEB A;  1Y20 A;  2THI A;  5ICQ A;  4OVR A;  1M5B A;  5ESY A;  1GR2 A;  3E3K A;  3PU5 A;  4K3F A;  4GX4 A;  1ZIU A;  2X7P A;  4NTL A;  3DEL B;  4I9D A;  2A5T A;  4XKN A;  1D3K A;  2ZYK A;  2WBB A;  3G3K A;  1LAG E;  4PTK A;  5EQ9 A;  3TTM A;  3FBP A;  1FTJ A;  5IGA A;  4LUB A;  1Y1M A;  1B7U A;  3SDF A;  2O1M A;  2F36 A;  1NV5 A;  1MRP A;  1S7Y A;  3OO6 A;  1KZ8 A;  2G29 A;  4HE0 A;  2E1S A;  1G0I A;  2R9J A;  3O6H A;  3OEN A;  4JXI A;  1NNF A;  1PBQ A;  3MVX A;  1SD3 A;  4OMB A;  2HXW A;  3RPL B;  4PF6 A;  3IO4 A;  2R6G E;  4UA8 A;  3PUX E;  4X9T A;  4MH5 A;  1B3E A;  5T3J A;  3HO7 A;  4PGN A;  5FHO A;  3KJ7 A;  3PV0 E;  4U4S A;  1IMA A;  4ZEB A;  1B4Z A;  4YB7 A;  2O1L A;  1UTB A;  5CI5 A;  3KJT A;  4KI0 E;  5DEX A;  4PFI A;  3F11 A;  2OWS A;  4LA9 A;  2QS2 A;  4MBP A;  4YMB A;  4NF5 B;  3VVF A;  4IO6 A;  2I48 A;  1WVJ A;  2OBG A;  1ZLQ A;  5ITO A;  3K1P A;  3C4M A;  2PT2 A;  3L6H A;  4LQ2 A;  1B40 A;  4DCY A;  4F18 A;  1FPI A;  3E78 A;  2D21 A;  1DPP A;  2QS1 A;  4X8R A;  2XXW A;  4R2B A;  1VE4 A;  2VD3 A;  3KBZ A;  2P1S A;  3PD9 A;  1OVT A;  2QJE A;  3U8Q A;  3HHF A;  3GZG A;  2BJI A;  4GOT A;  1LFI A;  4LAT A;  3DLN A;  4ONY A;  2RIN A;  3OSR A;  3PPR A;  2R71 A;  1N0T A;  3H03 A;  2IA4 A;  1B3H A;  4KXP A;  1VSO A;  3UOR A;  4I62 A; 
#chains in the Genus database with same CATH homology
 3T0J A;  5IM2 A;  5F24 A;  5T3J A;  1FPK A;  5DW8 A;  4N6D A;  2FIE A;  4OVS A;  1NV5 A;  1YZ0 A;  1EYK A;  1INP A;  4IR8 A;  2WYK A;  2XWI A;  4NF0 A;  3PTY A;  4MEV A;  1VDW A;  2V3Q A;  1FRP A;  2XXK A;  4LN5 A;  4N8Y A;  2HPG A;  4AS5 A;  1KZ8 A;  4HE0 A;  4H45 A;  1RDZ A;  5IZZ A;  1K9Z A;  3D1R A;  3KC1 A;  1G0I A;  1NUW A;  2CZK A;  2ZZX A;  1FSA A;  4MX6 A;  4NGU A;  2KR0 A;  4GWZ A;  4PDH A;  4F1U A;  5J16 A;  4I3Y A;  4NN3 A;  2VPO A;  4JVD A;  1FBH A;  2DE4 A;  4YZZ A;  4O7I A;  1IMD A;  1FBD A;  4N17 A;  3RPL B;  1KA0 A;  4PFI A;  4N81 A;  2F3B A;  4PET A;  2FVZ A;  2WYP A;  4N8G A;  4YIC A;  3W9W A;  5A5L A;  4PF6 A;  1IMB A;  5LDZ A;  5ET8 A;  5ET5 A;  1Q9D A;  2F5X A;  2PFZ A;  1SPI A;  4X9T A;  4QBA A;  3MYU A;  4MJO A;  2Q8M A;  5JK4 A;  1NI9 A;  3SZP A;  2VPN A;  4NG7 A;  2CEX A;  2CZI A;  4HE1 A;  4PCD A;  4GBV A;  3BIH A;  4MIJ A;  4N4U A;  2HXR A;  2CZH A;  4PGN A;  2FBP A;  4GWU A;  4XFE A;  1BK4 A;  1FPB A;  1QGX A;  3B50 A;  1IMA A;  2DVZ A;  2QPQ A;  2F3D A;  4MCO A;  4P56 A;  4I3E A;  3LUZ A;  4G61 A;  2QVU A;  1NUY A;  4MAG A;  2R8T A;  5EQA A;  3U65 A;  3T1B A;  5EYG A;  4P8B A;  1NUZ A;  4N6K A;  4NHB A;  5ET6 A;  1CNQ A;  1NV2 A;  4HCW A;  2Y5K A;  4I40 A;  3MST A;  4PF8 A;  2FHY A;  2PFY A;  1FBC A;  1KA1 A;  2CEY A;  3BIG A;  1LEV A;  4JVI A;  4NQ8 A;  4O8M A;  2WX9 A;  2HZL A;  1NV4 A;  4GX6 A;  4MNP A;  4OVT A;  4HCY A;  1LBY A;  2HZK A;  2DE2 A;  4H46 A;  4MNI A;  4PFB A;  1IMC A;  2XA5 A;  3W9V A;  1XI6 A;  2V4C A;  4PE3 A;  4PAF A;  3IFA A;  1FPD A;  1YXI A;  2L5V A;  4PGP A;  3NOH A;  4MMP A;  1FBE A;  1IMF A;  2Q9T A;  4PBQ A;  1FBP A;  2XWV A;  4P1E A;  4X04 A;  1DCU A;  1LBW A;  4N91 A;  1FPG A;  4OA4 A;  1EYJ A;  1FPE A;  4OAN A;  5I3S A;  4AS4 A;  4F1V A;  2KQZ A;  2Q74 A;  1LBV A;  1FPL A;  1D9Q A;  1K9Y A;  3A29 A;  4DI3 D;  2P3V A;  4NAP A;  2WEF A;  2HHM A;  2QVV A;  4F18 A;  4PAI A;  4PBH A;  4DI4 B;  4P9K A;  1FPI A;  3CHG A;  1IME A;  4JVC A;  1NV1 A;  2OX3 A;  4HXV A;  3E78 A;  5J1D A;  1FTA A;  3KC0 A;  4P47 A;  1FJ9 A;  3B8B A;  3E79 A;  4MHF A;  3QMF A;  5EQ7 A;  4MNC A;  2P3N A;  5IZ1 A;  1YYZ A;  2Y5L A;  1EYI A;  1FPF A;  1NV7 A;  1NV0 A;  2FIX A;  2QVR A;  3HFU A;  4X8R A;  4XF5 A;  5I5P A;  1DBZ A;  1NV3 A;  3KBZ A;  4O7M A;  1FPJ A;  2DDK A;  1RDX A;  4N15 A;  4OVR A;  1LBX A;  5LTC A;  2JJK A;  1DK4 A;  2VT5 A;  2DE3 A;  2XWO A;  2PCR A;  3IFC A;  4GWW A;  2BJI A;  3GYY A;  5ESY A;  5IZ3 B;  4F19 A;  1NV6 A;  2B4L A;  4GWX A;  4M1V A;  4OVQ A;  3LV0 A;  4GX4 A;  1FJ6 A;  3RPL A;  4QXD A;  4XEQ A;  3RYD A;  2ZZW A;  3EKI A;  3FXB A;  5I7I A;  4PC9 A;  4GX3 A;  5ET7 A;  4GWS A;  4NX1 A;  4PFR A;  4OVP A;  4HE2 A;  4FBP A;  4P1L A;  1G0H A;  2ZZV A;  4P3L A;  1LBZ A;  5FBP A;  1FBG A;  5CM6 A;  2WBB A;  4UAB A;  2WBD A;  1FBF A;  2OWZ A;  2B4M A;  4PAK A;  2GQ1 A;  2MKZ A;  1RDY A;  2XWK A;  4GWY A;  3ROJ A;  4PTK A;  3ISP A;  5EQ9 A;  5IGA A;  1JP4 A;  4KXP A;  3FBP A;  1NUX A;  2QFL A;  4O94 A;  1AWB A;  5IZ3 A;  5EYH A;  4PDD A;  4GBW A;  5EQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...