5K2XA

Crystal structure of m. tuberculosis uspc (tetragonal crystal form)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
414
structure length
414
Chain Sequence
PRGGKIVVTVRLWDEPIAAAYRQSFAAFTRSHPDIEVRTNLVAYSTYFETLRTDVAGGSADDIFWLSNAYFAAYADSGRLMKIQTDAADWEPAVVDQFTRSGVLWGVPQLTDAGIAVFYNADLLAAAGVDPTQVDNLRWSRGDDDTLRPMLARLTVDADGRTANTPGFDARRVRQWGYNAANDPQAIYLNYIGSAGGVFQRDGKFAFDNPGAIEAFRYLVGLINDDHVAPPASDTNDNGDFSRNQFLAGKMALFQSGTYSLAPVARDALFHWGVAMLPAGPAGRVSVTNGIAAAGNSASKHPDAVRQVLAWMGSTEGNSYLGRHGAAIPAVLSAQPVYFDYWSARGVDVTPFFAVLNGPRIAAPGGAGFAAGQQALEPYFDEMFLGRGDVTTTLRQAQAAANAATQRKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Sugar ABC transporter permease
publication title Structural and functional analysis of the solute-binding protein UspC from Mycobacterium tuberculosis that is specific for amino sugars.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 141
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5k2xA00
2Z23A 1OVBA 1H43A 4F3GA 4U23A 3CFLA 5DTBA 4FE8A 3W9VA 2E0SA 3C33A 4GD5A 4XTCQ 5DT6A 4RPOA 1GGGA 4Q8RA 1OIBA 2XXTA 2OCUA 3MPKA 3G3FA 4NWCA 3C35A 4I1DA 3UIFA 5A5XA 1OLCA 2HAVA 4POWA 4G77A 2V3TA 1F9BA 4IGTA 2GHBA 4F18A 1NKXA 3OXNA 4P11A 4RXLA 1JQFA 1Y1MA 5I59A 1EZOA 3H03A 4GLIA 5I2NB 1MRPA 3OO6A 2A5TA 1CB6A 3N26A 4I9DA 4IO5A 1N04A 1B46A 2DE2A 3IOWA 2DP8A 4IO6A 4F1VA 2ALUA 3D4CA 1PC3A 1DPEA 3RPWA 1JW1A 1A8FA 5J1DA 4TLMB 4OZ9A 4MH5A 4F39A 1SW2A 4OTEA 4PFWA 4ZEBA 3B6TA 2HZKA 3K6VA 2VP1A 2DSFA 2Y7IA 1QVSA 4PFYA 5DVFA 3MP6A 4UA8A 1NNTA 1L5TA 4IGRA 5H8NB 3LUYA 4ELPA 4GXSB 2ZYKA 4X1DA 5EYFA 4GFRA 3H3GA 3BKIB 3MP1A 5H8FB 1WVJA 3MBPA 4RK2A 2QL3A 4OQOA 4NF8B 3L6HA 1MH4A 1H3DA 2QSXA 3TUSA 4RA1A 2RC9A 3LR1A 1B7ZA 2UYFA 4ZS9A 3PUVE 4K3FA 3PV0E 1SYIA 4P0GA 3MP8A 3TTRA 3BFTA 1BP5A 1YAEA 1NNFA 5F1QA 2F7AA 3LSWA 2QPQA 1TFAA 4EQBA 1POTA 4BDRA 4WKMA 5FTHA 1R9LA 5I56A 4F19A 5BUUA 4YAHX 1FQBA 1P1NA 3FV1A 1VFEA 3VVFA 1H44A 3MVWA 1IITA 1II5A 1SI1A 1IXHA 1Z7NE 3KOSA 4EXKA 3F11A 4MFIA 3EQ1A 4ZZAA 1DSNA 5CRYA 4JBZA 2DS9A 3N6TA 4YB7A 1MM7A 1JEVA 1ATGA 4EF2A 2RINA 4QF9A 2B3FA 3B6WA 4GF8A 1I6QA 1AIVA 2ZYMA 3KGCA 3OEKA 5DVJA 3EHUA 4R9FA 2V3QA 4QRZA 4EDPA 4KYEA 3TFLA 3C9HA 5KCJB 4NWDA 2F78A 4KQPA 3DELB 2Q89A 2XXRA 1QKAA 1VR5A 4C1UA 1M5EA 4QFKA 4PP0A 2VOZA 1B52A 4NF4B 3BBRA 1B3HA 3U1OA 1NNPA 1MY4A 4P0IA 2VGQA 2H5YA 2DVCA 4GXAA 3MZ1A 4KI0E 1DTGA 3KZGA 1ANFA 4HTGA 2F6PA 3H4ZA 3O6HA 5CC2A 5HM4B 1XC1A 4ZE9A 3IAZA 2XXWA 3MC2A 1SD3A 3IR1A 4JSDA 2Y7WA 2NUVA 1MQJA 1EH3A 4O3BA 3M3FA 3IB2A 1FQAA 4ZDMA 4M1VA 3IL1B 1LFGA 1LAHE 1S7YA 3LSXA 1LAFE 3IOUA 4DXBA 4YB5A 2PYYA 3RQTA 3KSXA 3V89B 4UACA 2OK2A 4PFTA 4H67A 5AA4B 3KG2A 4OMBA 1MPCA 3KN7A 3PPQA 4I62A 2XXVA 5DVIA 4ELRA 4R6KA 2F8DA 5ITOA 2UVGA 3K2DA 3KSJA 3T66A 3KJ7A 1QUKA 5H8QA 1LCTA 1SQYA 4G68A 4OXVA 4GL8A 4OYVA 4U1ZA 5I2KA 2XX7A 3IB1A 3IO6A 5EHSA 4OESA 4G68C 1MXVA 1UQWA 4QSCA 2UVHA 2DE3A 1IZ1A 4AQ4A 2RF1A 5TP9B 1MPBA 2PT1A 1PB9A 3L6GA 1R1NA 2DQVA 3SEUA 3MVYA 1POY1 3CG3A 3SEYA 3T96B 3R26A 1HSEA 2UYEA 4IO2A 3IJXB 3O6GA 2Z22A 1A54A 1ELJA 3IK6B 1OVTA 1O63A 3OEMA 2HAUA 3PPNA 3K00A 1FQDA 3K1PA 2HZLA 1MY2A 3K01A 4JWOA 4E0WA 4WXJA 4IO7A 4LZ7A 3FUZA 4QSEA 4DCXA 2DXYA 2Q88A 1I6BA 3PMXA 1OLAA 1B1HA 2Y7PA 4JXIA 5KZTA 2ONSA 2OWTA 3FV2A 4U2RA 4EXLA 4PE5B 4NF6A 3KN3A 3QK6A 3MPLA 2QS4A 4FJPA 3U92A 5B70A 5FTIA 5KDTB 4GWOA 1MY0A 2O68A 4THIA 3KFMA 3CSBA 4LONB 3RUMA 1MM6A 3LBSA 4YU0A 4ELOA 1YPNA 3M3KA 4QFPA 2DWHA 1PDAA 2P0SA 2Q2CA 3VVEA 1S50A 3ZKKA 2A5TB 3JZJA 2Y7RA 2I3VA 4WEDA 3OMBA 4GVOA 3HHGA 5AA2B 3Q26A 4ZEKA 3K6UA 1FW0A 2I0CA 2VD3A 1DTZA 5K2XA 1UTBB 2DWIA 3PPPA 3G3HA 2ZMBA 3N6UA 2PX1A 2XXYA 1YCJA 3MZBA 2LAOA 4DIGA 3T9VA 4PQJA 1HSJA 5TPAA 3M3LA 1MQHA 3V5AA 1MQIA 1N3XA 1HSLA 3FGSA 2PBWA 5JTYB 4KD5A 2FYIA 3R6UA 4XKRA 4EUOA 2D3IA 2F6GA 3W9WA 3DP6A 3TYHA 1Y3QA 4F1UA 3K4UA 5CMMA 4F2OA 3V83A 3K02A 1QULA 4NMYA 1N76A 3O29A 3I5OA 4RYAA 1B5HA 4FORA 1QUJA 2A5SA 3SETA 2O69A 3SEXA 3UORA 4U4SA 3TDJA 3RTFB 1JNFA 3THIA 1P99A 3FJ7A 3S9EA 4R9GA 1Y9UA 5ISUA 1EZPA 4MLVA 4ZZEA 1UTHA 3VXBA 3FJGA 2W7YA 4NF5A 2THIA 3IJOB 2FNCA 3ILUB 1T0KA 2RCAA 3O9PA 2HXWA 3GBBA 4F31B 1LCFA 1Q35A 4FECA 4FEDA 2NOOA 4HW8A 3U8QA 3OOAA 4RNSA 3OO8A 2REGA 5DYHA 3GZGA 4DLDA 4KCDA 2F7CA 4LQ5A 3S4UA 2M8CA 3LSFB 3WAFA 1A7LA 3QUJA 2V25A 3T22A 1LAGE 1URSA 2H99A 3A3UA 3H6VA 4FATA 3QYTA 1OMPA 5L9SA 2OZZA 1R9QA 4LQ2A 1OQHA 4IY5A 3G3GA 4FIMA 5H8SA 4RY1A 1GVCA 1H76A 1PBQA 4H5GA 4U21A 4Z0IA 4C1TA 2QS3A 2Q9TA 1B32A 2KLFA 2OBGA 1SYHA 4H8IA 2ANJA 1MY3A 4MF3A 2DOJA 1PBPA 4YKKA 1B7HA 1XVXA 5H8HA 5I58A 3RN8A 3PUWE 1B5IA 1LB8A 3TTLA 2I49A 3CFXA 3JYRA 3MWBA 3DM0A 3CFZA 4HCYA 5I57B 1FCKA 3KBRA 4QSDA 1A55A 3ODBA 3RNNA 3HSTA 1MXWA 4U1OA 4QFOA 5H8FA 2FA7A 4ZEIA 3ZS6A 5L9MA 3UN6A 4GOTA 4MLQA 4DZ1A 3TQWA 1US5A 4NF8A 1IXGA 3CR9A 4L17A 5FHOA 4H5FA 4KPTA 3SEWA 1IQ7A 1SI0A 2Z8FA 1B3EA 3OSRA 1O64A 3EN3A 1R6ZA 3O28A 5B7DA 3B7DA 1NL5A 1B4HA 4KYSA 2ONKE 1M5CA 4I8CA 3TTKA 2OLBA 4LZ5A 2YJPA 1I69A 4KFQA 2DXRA 2DE4A 3SERA 3OENA 2QS2A 1N7WA 5H8QB 1USYH 1B1XA 1VFDA 2Q2AA 3Q27A 4KCCA 3MJNA 2XXUA 1OQGA 2P1SA 3G3IA 3Q25A 4ELQA 3S9NC 4R6HA 3KEIA 2O1MA 2I4BA 1TWYA 4M4GA 4BLAA 4OWDA 1IEJA 3CG1A 4H0WA 3VLUA 1B3GA 1VSOA 3SKPA 3FZVA 1FTJA 4BDLA 1EU8A 1B0HA 3O66A 3KN8A 3T9UA 3OSQA 3TMGA 3K6XA 5DEXB 2F35A 2NXOA 3QIMA 2DWJA 3VXCA 2I6EA 4BDNA 5KCJA 3HN0A 3TPAA 4DDDA 3PUXE 3K1NA 3R7XA 4IO3A 4N07A 1FTOA 5AE4A 4XXUA 2DVZA 3Q28A 3O97A 3OELA 5AA3A 1Y4CA 1B7UA 1FTKA 1LBCA 2I4CA 4F3SA 2CZLA 1IIWA 2QMWA 3UGWA 1LBBA 4R2BA 5FHMA 2H98A 4O3AA 3PD8A 2I58A 3FJMA 1JW4A 5F7VA 1PEBA 1MQDA 4DXCA 3PMVA 3EPEA 2B65A 4F3BA 2Z8EA 4LP2B 4GL0A 5IKBA 3FVKA 1MDQA 4NF6B 2XXQA 1XT8A 1GTKA 3G7WA 3PU5A 5CMKA 4IB2A 1SBPA 4XIGQ 1B40A 4FEBA 4YZZA 2BJJX 1MDP1 4Q0CA 3PPRA 1MQGA 3A09A 4LATA 4OFJA 2ZYNA 3PUZE 3M8UA 1NH8A 5AA4A 4OEUA 2NWJA 3FATA 3KJTA 5JEIA 3DLNA 5LOMA 3HHFA 4RPNA 1WDNA 3CSGA 1B05A 4RK9A 4TOZA 4JB7A 4U4XA 1FTLA 3O2AA 3PUYE 1GR2A 3C32A 1DPPA 3T93B 2E1SA 2HFBA 3QAXA 1USYE 3VDFA 5TPAB 2OJTA 2R71A 4QHQA 3RLFE 3S9MC 1SDXA 1Y3NA 4JDFA 3LC8A 4GQOA 1J1NA 4QFNA 3IX1A 3H06B 5A5XB 5AA2D 1AL3A 3MUQA 4GRKA 2ZXTA 1D4NA 2F7BA 3RTWB 1MXUA 2GRVA 5I59B 2HCAA 4ECFA 5IAIA 4YICA 3CRBA 4X48A 4TLLB 3SESA 1P1UA 3GBAA 4DXUA 2V3UA 2RKMA 3I3VA 4EF1A 3TEPA 3QUFA 1ZU0A 3TTNA 3MVXA 3OO9A 4NF5B 1N3WA 1ZKBA 3ZSFA 3T9XB 1MPDA 1BKAA 2AIXA 4LUBA 3SDFA 4TQUQ 1PB8A 3RT6B 3E4RA 2Y84A 4Z7EA 2X7PA 2QS1A 1Z7ME 1XHYA 1SVXB 3IOVA 2ESNA 3USDA 2XD2A 4YKIA 3TZAA 5KDTA 3DP4A 4NTLA 4OFLA 5CI5A 4F3PA 1RKMA 3PGFA 2ABHA 1URGA 1XS5A 1SW1A 3EHSA 1LFHA 4G4PA 1P1OA 3CI8A 1B9JA 1M5FA 4NEDA 2O6AA 4F29A 2F5XA 1MXZA 5JK4A 1MS7A 2UVJA 2ONRA 3KOTA 3VLWA 5AA2A 2UXAA 3ILTB 4R73A 4AB5A 1UTBA 2XD3A 1BIYA 5K2YA 3FD3A 2DWAA 1M5DA 4OETA 3G3JA 1FQCA 2F36A 2ZNSA 1AMFA 3OO7A 5I56B 1LFIA 3VE1B 3RT8A 5JTYA 2O7IA 3H6TA 1VE4A 4BDMA 4OVJA 1JETA 2QMXA 5H8HB 5I58B 4WEPA 2O1LA 1A40A 2F97A 1ZLQA 3MZ9A 2F34A 2R6GE 3TELA 3GXAA 3CIJA 3FXRA 3GLBA 4F1YA 2X7QA 5I2NA 3MW0A 3MQ9A 1JVXA 4H6DA 5ITPA 2AYSA 1BLFA 2XHDA 4ONYA 2D21A 3C34A 2XXIA 2IEEA 1B6HA 2X26A 4E0XA 2G29A 4R75A 3B6QA 4R74A 1O7TA 2H4IA 1H45A 2V93A 5I84A 3P7IA 1JW5A 3FVNA 3H6UA 3HPIA 1S9TA 2XX9A 1LGBC 3IORA 3DP8A 5L9OA 1QKBA 4IO4A 3A3CA 1UIVA 1IUDA 1NNKA 3EF7A 1URDA 3H6WA 3ONMA 3IOTA 2XXPA 5HPQA 3U72A 2IA4A 1A99A 1TT1A 3TCGA 2AL5A 3AXFA 3CVGA 4ZEFA 2H25A 1ZIUA 1QJMA 5H8NA 2VD2A 4R6YA 2GFEA 4JSOA 1GV8A 4HS7A 3W15C 3EHTA 3FVGA 1MH3A 5ELVA 3I6VA 1CE2A 2P2AA 4DE8A 5CM6A 4G8NA 4EQ7A 5EHMA 3O6IA 4Q30B 1LLSA 2D5WA 4KHZE 5CMCA 2G93A 4EQ9A 3MAMA 4YMBA 3K1MA 2PVUA 3MVZA 3RGYA 1NMUA 1NFTA 3IO4A 4OENA 1P1QA 1UIUA 3U93A 3LSLA 4N6PA 4KR5A 1N84A 1KWHA 1Y3PA 3TAJA 1M5BA 5FHNA 3WAEA 4ESXA 3TODA 1IXIA 2O51A 4AB6A 4G68B 1LSTA 4MBPA 5I2KB 2O7UA 1QW0A 1MY1A 1DOTA 3TQLA 2Z8DA 1RYOA 5CBSA 3JV9A 5I57A 1B58A 3QSLA 4ZE8A 2RCBA 4YB6A 4GIZA 5BWJA 1LAXA 1NH7A 4XKNA 1SW5A 5AA1A 2O84X 3UP9A 1D9YA 4DCYA 3S9LC 3QXMA 2XXXA 1Y4TA 2YLNA 4PETA 2ZNTA 2H9BA 2ZYOA 3UK4A 2GH9A 1Y20A 1SW4A 3PPOA 4LA9A 3TCHA 2UVIA 3FVOA 3G3KA 1P1WA 4ISUA 1WODA 1IXCA 4RJZA 1FQEA 3PD9A 3ECRA 1TFDA 3FXQA 1ZTYA 3VVDA 2I0BA 3TTMA 2DYXA 4JWYA 3E9XA 4XKQA 1AOVA 2I3WA 4NF4A 1B0LA 3C4MA 3FXUA 3D4GA 4IY6A 4PFUA 4POXA 1RYXA 5CMBA 2RC8A 4FAJA 3TKDA 3S2VA 4Q5TA 4OHNA 2OWSA 4G8MA 2XX8A 4G2ZA 3H7MA 3T9HB 4OEVA 4C0RA 2PMSA 3VV5A 1JVYA 4XKPA 4R72A 2NVUB 4F22A 3U94A 1TXFA 1Q1KA 1QUIA 5DEXA 2CMOA 4YKJA 4YMAA 2REJA 1BTJA 1B3LA 2HQ0A 1US4A 1B51A 3UA8A 5ICTA 1MXXA 3K6WA 3VLVA 1B2HA 3HV1A 3K0VA 4G8HA 2ZNUA 3BFUA 2QRYA 1EZ9A 5CBRA 1B4ZA 2R9JA 2HEUA 3E3KA 1D3KA 4JWXA 3C36A 3HCQA 4H8JA 2Q8JA 5ICQA 3N5LA 3Q29A 4OERA 3ZKLA 1Y1ZA 5M2VA 1MG1A 4QFLA 2V84A 1N7XA 4KYDA 3OD7A 4ND9A 4HCWA 1ZBMA 2WKYA 3N94A 1FQFA 2Y7KA 3VFJA 1N0TA 1LB9A 2B3BA 1ZJLA 4F2QA 3PMWA 2AL4A 1JEUA 5TU0A 2YPNA 5L8DA 3IB0A 5TP9A 4O3CA 3C31A 4LZ8A 1FTMA 1D9VA 3FIRA 1B5JA 1XOCA 4X1BA 1B3FA 3V8XB 1AH5A 1A8EA 2PT2A 3RY3A 2QJEA 4YKPA 3TCFA 1I6AA 2GHAA 1ZMGA 4X9TA 3HO7A 4N13A 2I48A 4H65A 4U22A 4ZEDA 4LVQA 1MXYA 3FASA 1XVYA 1PB7A 5HBCA 4OFOA 4BDOA 4NE4A 4R2FA 1YTVA 4ESWA 1UTHB 4BDQA 2VHAA 2RC7A 2XXHA 3SEVA 4ZECA 4H1XA 3E13X 1DMBA
chains in the Genus database with same CATH superfamily
2Z23A 1OVBA 1H43A 2OWZA 4F3GA 4U23A 3CFLA 2B4MA 5DTBA 4FE8A 3W9VA 2E0SA 2WYKA 3C33A 4OVTA 4GD5A 4XTCQ 5DT6A 5FBPA 4RPOA 5IZ1A 1GGGA 4Q8RA 1OIBA 2XXTA 2OCUA 3MPKA 3G3FA 4NWCA 3C35A 2HXRA 4I1DA 3UIFA 5A5XA 1OLCA 2HAVA 4POWA 4G77A 2V3TA 1BK4A 1F9BA 4IGTA 2QVRA 2GHBA 4F18A 1NKXA 3OXNA 4P11A 4RXLA 1JQFA 1Y1MA 5I59A 1EZOA 3H03A 4GLIA 5I2NB 1MRPA 3OO6A 2A5TA 1CB6A 3N26A 4I9DA 4IO5A 1N04A 1B46A 2DE2A 3IOWA 2CEYA 1FPFA 4DI3D 2DP8A 2XWOA 1VDWA 1G0HA 4IO6A 4F1VA 2ALUA 3D4CA 4P9KA 1PC3A 1DPEA 3RPWA 1JW1A 1A8FA 2VPNA 5J1DA 3BIHA 4TLMB 4AS5A 4OZ9A 2HHMA 4MH5A 4F39A 1SW2A 2Y5LA 4OTEA 2P3NA 4PFWA 4ZEBA 3B6TA 2HZKA 3K6VA 2VP1A 2DSFA 2Y7IA 1QVSA 2KR0A 4PFYA 5DVFA 3MP6A 4UA8A 1NNTA 1L5TA 4IGRA 5H8NB 3LUYA 4ELPA 4GXSB 2ZYKA 2XWIA 4X1DA 5EYFA 4GFRA 3H3GA 3BKIB 3MP1A 5H8FB 1WVJA 3MBPA 4RK2A 1FRPA 2QL3A 4OQOA 4NF8B 2FIXA 1NV3A 3L6HA 1MH4A 1H3DA 2QSXA 3TUSA 4RA1A 2RC9A 3LR1A 1B7ZA 2UYFA 4ZS9A 3PUVE 4K3FA 3PV0E 1SYIA 4P0GA 3MP8A 3TTRA 3BFTA 1BP5A 1YAEA 1RDZA 4GWXA 1NNFA 5F1QA 2F7AA 3LSWA 2QPQA 1TFAA 4EQBA 1POTA 4BDRA 4WKMA 5FTHA 1R9LA 5I56A 4F19A 5BUUA 4MEVA 4YAHX 1FQBA 1P1NA 3FV1A 1VFEA 3VVFA 1H44A 2WX9A 3MVWA 1IITA 1II5A 1SI1A 1IXHA 1Z7NE 3KOSA 1NV2A 4PCDA 4EXKA 3F11A 4MFIA 3EQ1A 4ZZAA 1DSNA 3IFCA 5CRYA 4MNPA 5IZZA 4JBZA 2DS9A 1KA1A 3N6TA 3BIGA 1MM7A 4YB7A 1JEVA 1ATGA 4EF2A 2RINA 4QF9A 5EYGA 2B3FA 3B6WA 3T0JA 4GF8A 1I6QA 1FTAA 1AIVA 4MJOA 2ZYMA 3KGCA 3OEKA 5DVJA 3EHUA 3GYYA 4R9FA 2V3QA 4QRZA 2R8TA 4EDPA 4KYEA 3TFLA 5ET7A 3C9HA 5KCJB 4NWDA 2F78A 1K9ZA 4KQPA 3DELB 2Q89A 2XXRA 4QBAA 1QKAA 1VR5A 4LN5A 4C1UA 1M5EA 4QFKA 4PP0A 2VOZA 4QXDA 1B52A 4N8YA 4NF4B 3BBRA 4GBVA 1B3HA 3IFAA 3U1OA 1NNPA 5IZ3B 1MY4A 4P0IA 1DCUA 2VGQA 2H5YA 4XEQA 2DVCA 1K9YA 4GXAA 3MZ1A 4KI0E 2FHYA 1DTGA 1EYKA 3KZGA 1ANFA 4HTGA 2F6PA 3H4ZA 2XWVA 3O6HA 5CC2A 5HM4B 1XC1A 4ZE9A 4N91A 3IAZA 2XXWA 3MC2A 1SD3A 3IR1A 4JSDA 2Y7WA 2NUVA 1MQJA 1EH3A 4O3BA 3M3FA 3IB2A 1FQAA 4ZDMA 1SPIA 1XI6A 4M1VA 3IL1B 2BJIA 1LFGA 1LAHE 1S7YA 3LSXA 1LAFE 3U65A 3IOUA 4DXBA 4YB5A 2PYYA 4FBPA 3RQTA 3KSXA 3V89B 4PAKA 2OK2A 4UACA 4PFTA 4H67A 5AA4B 3KG2A 4OMBA 1MPCA 3KN7A 3PPQA 4I62A 2XXVA 5DVIA 4ELRA 4R6KA 2F8DA 5ITOA 2UVGA 3K2DA 3KSJA 3T66A 3KJ7A 1QUKA 2WYPA 5H8QA 1LCTA 4XFEA 1SQYA 4G68A 4MAGA 4OXVA 4GL8A 4OA4A 4OYVA 4U1ZA 5I2KA 2XX7A 5LTCA 3IB1A 3IO6A 4PTKA 4N17A 5EHSA 4PBHA 4OESA 4G68C 1MXVA 1UQWA 4QSCA 2UVHA 2DE3A 1IZ1A 4AQ4A 1FSAA 4PFRA 2RF1A 5TP9B 2KQZA 1MPBA 2PT1A 1PB9A 3L6GA 3RPLA 1R1NA 2DQVA 3SEUA 3MVYA 1POY1 3CG3A 3SEYA 3T96B 3R26A 1HSEA 5IM2A 2UYEA 4IO2A 3IJXB 3O6GA 2Z22A 2QVUA 1INPA 1A54A 1ELJA 3IK6B 1OVTA 1O63A 1FPBA 3OEMA 2HAUA 3PPNA 3K00A 1FQDA 3K1PA 4G61A 2HZLA 1MY2A 3K01A 4JWOA 4E0WA 4WXJA 4IO7A 4LZ7A 3FUZA 4QSEA 3HFUA 4DCXA 2DXYA 2CEXA 2Q88A 1I6BA 3PMXA 1OLAA 1B1HA 2Y7PA 4JXIA 4PBQA 5KZTA 5EQ8A 1FBFA 2ONSA 4O94A 2OWTA 3QMFA 3FV2A 3D1RA 4U2RA 4EXLA 4P3LA 4PE5B 4NF6A 3KN3A 3QK6A 3MPLA 2QS4A 1FBCA 4FJPA 1LBZA 3U92A 5B70A 5FTIA 5KDTB 4GWOA 1MY0A 2O68A 4THIA 1CNQA 3KFMA 3CSBA 4LONB 2WEFA 3RUMA 1MM6A 3LBSA 2WBDA 4YU0A 4ELOA 1YPNA 3M3KA 4GX4A 4QFPA 2DWHA 1PDAA 2P0SA 2Q2CA 2QFLA 5I3SA 3VVEA 5EQAA 1S50A 3ZKKA 2A5TB 1DBZA 3JZJA 1EYIA 1LBWA 2Y7RA 4NG7A 2GQ1A 2I3VA 4WEDA 3OMBA 4GVOA 2JJKA 3FXBA 4PDHA 3HHGA 5AA2B 4I3YA 3Q26A 4ZEKA 3K6UA 1FW0A 2I0CA 2VD3A 2PFYA 1DTZA 5K2XA 1UTBB 2DWIA 3PPPA 3G3HA 2ZMBA 3N6UA 2PX1A 2XXYA 1YCJA 3MZBA 2LAOA 4DIGA 3T9VA 4PQJA 1HSJA 5TPAA 2OX3A 3M3LA 1MQHA 3V5AA 1MQIA 1N3XA 1RDYA 1HSLA 3FGSA 2PBWA 4I40A 1YZ0A 5JTYB 4KD5A 2FYIA 3R6UA 4XKRA 4EUOA 2D3IA 2F6GA 3W9WA 3DP6A 2CZIA 3TYHA 1Y3QA 1FPGA 4F1UA 3K4UA 5CMMA 1Q9DA 4F2OA 3V83A 3K02A 1QULA 4NMYA 1N76A 3O29A 3I5OA 1FJ6A 4RYAA 4NHBA 1B5HA 4FORA 1QUJA 2A5SA 3SETA 2O69A 3SEXA 3UORA 4U4SA 3TDJA 4N8GA 3RTFB 1JNFA 3THIA 1P99A 3FJ7A 3S9EA 4R9GA 1Y9UA 5ISUA 1EZPA 4MLVA 4ZZEA 1UTHA 3VXBA 3FJGA 2F3BA 2W7YA 4NF5A 2THIA 3IJOB 2FNCA 4P8BA 3ILUB 1T0KA 2RCAA 3O9PA 4I3EA 2HXWA 3GBBA 4F31B 1LCFA 1Q35A 4FECA 4FEDA 4N6DA 2NOOA 4HW8A 3U8QA 3OOAA 4RNSA 3OO8A 2REGA 1NUZA 2DDKA 5DYHA 4MX6A 1NV0A 3GZGA 4DLDA 4KCDA 2F7CA 4PAIA 4LQ5A 3S4UA 2M8CA 3LSFB 4X8RA 3WAFA 1A7LA 3KBZA 3NOHA 3QUJA 2V25A 3T22A 1LAGE 1URSA 1FPEA 2H99A 3A3UA 1LBVA 3H6VA 4FATA 4GWYA 3QYTA 1OMPA 5L9SA 2OZZA 1R9QA 4LQ2A 1OQHA 4GWUA 4IY5A 3G3GA 4FIMA 5H8SA 4RY1A 1GVCA 2CZHA 1H76A 1PBQA 4H5GA 4U21A 4PC9A 4Z0IA 4C1TA 2QS3A 2Q9TA 1B32A 2KLFA 2OBGA 1SYHA 3MYUA 4JVDA 4H8IA 2Q8MA 2ANJA 1MY3A 4MF3A 2DOJA 1PBPA 4YKKA 1AWBA 1B7HA 1XVXA 4MHFA 5H8HA 1FBDA 5I58A 3RN8A 2VT5A 3PUWE 1DK4A 1B5IA 1LB8A 3TTLA 2I49A 3CFXA 3JYRA 3MWBA 3DM0A 3CFZA 4HCYA 5I57B 1FCKA 3KBRA 4QSDA 1A55A 3ODBA 3RNNA 3HSTA 1MXWA 4U1OA 4QFOA 5H8FA 2FA7A 4ZEIA 3ZS6A 5L9MA 3UN6A 4GOTA 4MLQA 4DZ1A 3TQWA 1US5A 4NF8A 1IXGA 3CR9A 4L17A 5FHOA 4H5FA 4KPTA 3SEWA 1LEVA 5J16A 1IQ7A 1SI0A 2Z8FA 1B3EA 3OSRA 1O64A 3EN3A 1R6ZA 1D9QA 3O28A 5B7DA 3B7DA 5ESYA 1NL5A 1B4HA 4KYSA 2ONKE 1M5CA 4I8CA 3TTKA 2OLBA 4LZ5A 2YJPA 3RYDA 1I69A 4KFQA 2DXRA 2DE4A 5I7IA 3SERA 3OENA 2QS2A 1N7WA 5H8QB 1KA0A 2FIEA 1USYH 1B1XA 1VFDA 2Q2AA 3Q27A 4KCCA 3MJNA 2XXUA 1OQGA 2P1SA 3G3IA 3Q25A 4ELQA 3S9NC 4R6HA 3KEIA 2O1MA 1FPIA 2I4BA 1TWYA 4M4GA 4BLAA 4OWDA 1IEJA 3CG1A 4H0WA 3VLUA 1B3GA 5EYHA 1VSOA 3ROJA 3SKPA 3FZVA 1QGXA 1FTJA 4BDLA 1EU8A 3RPLB 1B0HA 3O66A 3KN8A 3T9UA 3OSQA 3TMGA 3K6XA 5DEXB 2F35A 2NXOA 1JP4A 4N4UA 1EYJA 3QIMA 2DWJA 3VXCA 2I6EA 4BDNA 5KCJA 3HN0A 3B50A 3TPAA 4DDDA 3PUXE 3K1NA 3R7XA 4IO3A 4N07A 1FTOA 5AE4A 4XXUA 2DVZA 3Q28A 3O97A 3OELA 5AA3A 1Y4CA 4PE3A 1NUYA 1B7UA 4N15A 1FTKA 1LBCA 2I4CA 4F3SA 2CZLA 1IIWA 2QMWA 4JVIA 4NGUA 3UGWA 1FJ9A 1LBBA 4MNIA 4R2BA 5FHMA 3ISPA 2H98A 4O3AA 3PD8A 2I58A 3FJMA 4GWSA 4N6KA 1JW4A 5F7VA 1PEBA 1MQDA 4DXCA 3PMVA 3EPEA 2B65A 4F3BA 2Z8EA 4H45A 4LP2B 4GL0A 5IKBA 3FVKA 4O8MA 1MDQA 4NF6B 4GWWA 2XXQA 1XT8A 1GTKA 3G7WA 3PU5A 5CMKA 4IB2A 1SBPA 1NV6A 3MSTA 4XIGQ 1B40A 4FEBA 5DW8A 4YZZA 2BJJX 1NV1A 1MDP1 4MCOA 4Q0CA 3PPRA 3LUZA 1MQGA 3A09A 4LATA 4OFJA 2ZYNA 3PUZE 3M8UA 1NH8A 5AA4A 4OEUA 2NWJA 3FATA 3KJTA 4GWZA 5JEIA 3DLNA 5LOMA 4PF8A 2ZZXA 4JVCA 3HHFA 4RPNA 1FBGA 2V4CA 1WDNA 3CSGA 1B05A 4RK9A 4TOZA 4JB7A 4U4XA 1FTLA 3O2AA 3PUYE 1GR2A 1NI9A 1LBYA 3C32A 1DPPA 3T93B 2E1SA 2HFBA 3QAXA 1USYE 2FVZA 3VDFA 5TPAB 4IR8A 2OJTA 2R71A 4H46A 4QHQA 3RLFE 3S9MC 1SDXA 1Y3NA 3A29A 4JDFA 3LC8A 4GQOA 1J1NA 4QFNA 3IX1A 4PDDA 3H06B 5A5XB 5AA2D 1AL3A 3MUQA 4GRKA 2ZXTA 1D4NA 2F7BA 3RTWB 1IMAA 1MXUA 2GRVA 5I59B 2HCAA 4ECFA 5IAIA 4YICA 4OVRA 3CRBA 2XXKA 4X48A 4TLLB 3SESA 1P1UA 3GBAA 4DXUA 2V3UA 2RKMA 2PFZA 3I3VA 4EF1A 3TEPA 4XF5A 3QUFA 1ZU0A 4NQ8A 3TTNA 3MVXA 3OO9A 4PF6A 4NF5B 5EQ7A 1N3WA 1ZKBA 3ZSFA 3T9XB 1MPDA 1BKAA 4P47A 2AIXA 4LUBA 3SDFA 4TQUQ 4NF0A 1PB8A 3RT6B 3E4RA 2Y84A 4Z7EA 2X7PA 4MNCA 2QS1A 1Z7ME 1XHYA 1SVXB 3IOVA 2ESNA 1FBEA 3USDA 1IMCA 2XD2A 1RDXA 4YKIA 3TZAA 5KDTA 3DP4A 4NTLA 5EQ9A 4OFLA 5CI5A 4F3PA 1RKMA 4OANA 3PGFA 2ABHA 2CZKA 1URGA 1NUXA 4O7IA 1XS5A 4PGPA 1SW1A 3EHSA 1IMBA 1LFHA 4G4PA 1P1OA 3CI8A 4O7MA 1B9JA 1M5FA 4NEDA 4PGNA 1LBXA 2O6AA 4F29A 2F5XA 1IMFA 1MXZA 4HE1A 5JK4A 4GX3A 1MS7A 2UVJA 2ONRA 4OVPA 1NV7A 3KOTA 3VLWA 5AA2A 1NV4A 2UXAA 2F3DA 3ILTB 4R73A 4AB5A 5F24A 1UTBA 2XD3A 1FPLA 1BIYA 5K2YA 3FD3A 2DWAA 4P56A 1M5DA 4OETA 3G3JA 4HE0A 1FQCA 2F36A 5A5LA 2ZNSA 1FPJA 1AMFA 3OO7A 5I56B 1LFIA 3VE1B 3RT8A 4NN3A 5JTYA 4GX6A 2O7IA 3H6TA 1VE4A 4BDMA 2FBPA 2P3VA 4HXVA 1IMEA 4OVJA 4DI4B 2Q74A 1JETA 2QMXA 5H8HB 5I58B 4WEPA 2O1LA 1A40A 1YYZA 2F97A 1ZLQA 3MZ9A 2F34A 2R6GE 3TELA 3GXAA 3CIJA 3FXRA 3GLBA 4F1YA 2X7QA 5I2NA 3MW0A 3MQ9A 3KC0A 1JVXA 4H6DA 5LDZA 5ITPA 2AYSA 1BLFA 2XHDA 4ONYA 2D21A 3C34A 4N81A 2XXIA 2IEEA 1B6HA 2X26A 4E0XA 2B4LA 2G29A 4R75A 3B6QA 4R74A 1O7TA 2H4IA 1H45A 2V93A 5I84A 3P7IA 1JW5A 3FVNA 3H6UA 1NV5A 3HPIA 1S9TA 2XX9A 1LGBC 3IORA 3DP8A 5L9OA 1QKBA 4IO4A 3A3CA 1UIVA 1IUDA 1NNKA 3EF7A 1URDA 3H6WA 4MMPA 3ONMA 3IOTA 2XXPA 5HPQA 3U72A 2IA4A 5I5PA 1A99A 1TT1A 3TCGA 2AL5A 3AXFA 3CVGA 4ZEFA 2H25A 3SZPA 1ZIUA 3T1BA 1QJMA 5H8NA 2VD2A 4UABA 4R6YA 2GFEA 4JSOA 5ET6A 1GV8A 4HS7A 2XWKA 3W15C 3EHTA 3FVGA 1MH3A 5ELVA 4NX1A 3I6VA 1CE2A 2P2AA 4DE8A 1FBHA 1FPKA 5CM6A 4G8NA 4EQ7A 5EHMA 3O6IA 4Q30B 1LLSA 2D5WA 4KHZE 5CMCA 2G93A 4EQ9A 3FBPA 3MAMA 4YMBA 3K1MA 2PVUA 3MVZA 3RGYA 1NMUA 1NFTA 3IO4A 4OENA 1P1QA 1UIUA 3U93A 3LSLA 4N6PA 4KR5A 2QVVA 2XA5A 1N84A 1KWHA 1Y3PA 3TAJA 2VPOA 1M5BA 5FHNA 3WAEA 4ESXA 2MKZA 3EKIA 3TODA 1IXIA 2O51A 3PTYA 4AB6A 4G68B 1LSTA 4MBPA 5I2KB 2O7UA 1QW0A 1MY1A 2ZZWA 1DOTA 3TQLA 2Z8DA 1RYOA 5CBSA 3JV9A 4PAFA 5I57A 1B58A 5ET8A 3QSLA 4ZE8A 2RCBA 4YB6A 4GIZA 5BWJA 1LAXA 1NH7A 4XKNA 1SW5A 5AA1A 4MIJA 2O84X 3UP9A 1D9YA 4DCYA 3S9LC 3QXMA 2XXXA 1Y4TA 2YLNA 4PETA 2ZNTA 2H9BA 2HPGA 2ZYOA 3UK4A 2GH9A 1Y20A 1SW4A 3PPOA 4LA9A 3TCHA 2UVIA 3FVOA 3G3KA 1P1WA 4ISUA 1WODA 1IXCA 2WBBA 4RJZA 1FQEA 3PD9A 3ECRA 4PFBA 1TFDA 3FXQA 1ZTYA 3VVDA 2I0BA 4KXPA 2Y5KA 3TTMA 2DYXA 4JWYA 3E9XA 4XKQA 1AOVA 2I3WA 3LV0A 4NF4A 1B0LA 3C4MA 3FXUA 3D4GA 4NAPA 4IY6A 4PFUA 4POXA 5IZ3A 1RYXA 5CMBA 2RC8A 4FAJA 3TKDA 3S2VA 4GBWA 4Q5TA 5T3JA 4OHNA 4PFIA 2OWSA 4G8MA 2XX8A 4G2ZA 3H7MA 3T9HB 4OEVA 4C0RA 1FBPA 2PMSA 3VV5A 1JVYA 4XKPA 4R72A 2NVUB 4F22A 3U94A 1TXFA 3B8BA 1Q1KA 2L5VA 1QUIA 5DEXA 2CMOA 4YKJA 4YMAA 1NUWA 1BTJA 1B3LA 2REJA 2HQ0A 1US4A 1B51A 3UA8A 5ICTA 1MXXA 3K6WA 3VLVA 1B2HA 3HV1A 3K0VA 1YXIA 4G8HA 2ZNUA 3BFUA 2QRYA 1EZ9A 5CBRA 1B4ZA 2R9JA 4HE2A 3E79A 2HEUA 3E3KA 1D3KA 4JWXA 3C36A 3HCQA 4H8JA 2Q8JA 5ICQA 3N5LA 3Q29A 2ZZVA 4OERA 1Y1ZA 3ZKLA 5M2VA 1MG1A 4QFLA 5ET5A 2V84A 1N7XA 4KYDA 3OD7A 4ND9A 4HCWA 1ZBMA 3CHGA 2WKYA 3N94A 1FQFA 2Y7KA 3VFJA 1G0IA 1LB9A 1N0TA 2B3BA 1ZJLA 4F2QA 3PMWA 1IMDA 4OVQA 2AL4A 1JEUA 5TU0A 2YPNA 5L8DA 2PCRA 3IB0A 5TP9A 4O3CA 3C31A 4LZ8A 1FTMA 1D9VA 3FIRA 4P1LA 1B5JA 5IGAA 1XOCA 4X1BA 1B3FA 3V8XB 1AH5A 1A8EA 4P1EA 1KZ8A 2PT2A 4AS4A 3RY3A 2QJEA 4YKPA 3TCFA 1I6AA 2GHAA 1FPDA 1ZMGA 4X9TA 3HO7A 4N13A 2I48A 4H65A 4U22A 4X04A 4ZEDA 4LVQA 1MXYA 3FASA 1XVYA 1PB7A 5HBCA 3KC1A 4OFOA 4BDOA 4NE4A 4R2FA 1YTVA 4ESWA 1UTHB 4BDQA 2VHAA 3E78A 2RC7A 2XXHA 3SEVA 4ZECA 4H1XA 3E13X 4OVSA 1DMBA
chains in the Genus database with same CATH topology
2Z23A 1OVBA 1H43A 4F3GA 4U23A 3CFLA 5DTBA 4FE8A 3W9VA 2E0SA 3C33A 4GD5A 4XTCQ 5DT6A 4RPOA 1GGGA 4Q8RA 1OIBA 2XXTA 2OCUA 3MPKA 3G3FA 4NWCA 3C35A 4I1DA 3UIFA 5A5XA 1OLCA 2HAVA 4POWA 4G77A 2V3TA 1F9BA 4IGTA 2GHBA 4F18A 1NKXA 3OXNA 4P11A 4RXLA 1JQFA 1Y1MA 5I59A 1EZOA 3H03A 4GLIA 5I2NB 1MRPA 3OO6A 2A5TA 1CB6A 3N26A 4I9DA 4IO5A 1N04A 1B46A 2DE2A 3IOWA 2DP8A 4IO6A 4F1VA 2ALUA 3D4CA 1PC3A 1DPEA 3RPWA 1JW1A 1A8FA 5J1DA 4TLMB 4OZ9A 4MH5A 4F39A 1SW2A 4OTEA 4PFWA 4ZEBA 3B6TA 2HZKA 3K6VA 2VP1A 2DSFA 2Y7IA 1QVSA 4PFYA 5DVFA 3MP6A 4UA8A 1NNTA 1L5TA 4IGRA 5H8NB 3LUYA 4ELPA 4GXSB 2ZYKA 4X1DA 5EYFA 4GFRA 3H3GA 3BKIB 3MP1A 5H8FB 1WVJA 3MBPA 4RK2A 2QL3A 4OQOA 4NF8B 3L6HA 1MH4A 1H3DA 2QSXA 3TUSA 4RA1A 2RC9A 3LR1A 1B7ZA 2UYFA 4ZS9A 3PUVE 4K3FA 3PV0E 1SYIA 4P0GA 3MP8A 3TTRA 3BFTA 1BP5A 1YAEA 1NNFA 5F1QA 2F7AA 3LSWA 2QPQA 1TFAA 4EQBA 1POTA 4BDRA 4WKMA 5FTHA 1R9LA 5I56A 4F19A 5BUUA 4YAHX 1FQBA 1P1NA 3FV1A 1VFEA 3VVFA 1H44A 3MVWA 1IITA 1II5A 1SI1A 1IXHA 1Z7NE 3KOSA 4EXKA 3F11A 4MFIA 3EQ1A 4ZZAA 1DSNA 5CRYA 4JBZA 2DS9A 3N6TA 4YB7A 1MM7A 1JEVA 1ATGA 4EF2A 2RINA 4QF9A 2B3FA 3B6WA 4GF8A 1I6QA 1AIVA 2ZYMA 3KGCA 3OEKA 5DVJA 3EHUA 4R9FA 2V3QA 4QRZA 4EDPA 4KYEA 3TFLA 3C9HA 5KCJB 4NWDA 2F78A 4KQPA 3DELB 2Q89A 2XXRA 1QKAA 1VR5A 4C1UA 1M5EA 4QFKA 4PP0A 2VOZA 1B52A 4NF4B 3BBRA 1B3HA 3U1OA 1NNPA 1MY4A 4P0IA 2VGQA 2H5YA 2DVCA 4GXAA 3MZ1A 4KI0E 1DTGA 3KZGA 1ANFA 4HTGA 2F6PA 3H4ZA 3O6HA 5CC2A 5HM4B 1XC1A 4ZE9A 3IAZA 2XXWA 3MC2A 1SD3A 3IR1A 4JSDA 2Y7WA 2NUVA 1MQJA 1EH3A 4O3BA 3M3FA 3IB2A 1FQAA 4ZDMA 4M1VA 3IL1B 1LFGA 1LAHE 1S7YA 3LSXA 1LAFE 3IOUA 4DXBA 4YB5A 2PYYA 3RQTA 3KSXA 3V89B 4UACA 2OK2A 4PFTA 4H67A 5AA4B 3KG2A 4OMBA 1MPCA 3KN7A 3PPQA 4I62A 2XXVA 5DVIA 4ELRA 4R6KA 2F8DA 5ITOA 2UVGA 3K2DA 3KSJA 3T66A 3KJ7A 1QUKA 5H8QA 1LCTA 1SQYA 4G68A 4OXVA 4GL8A 4OYVA 4U1ZA 5I2KA 2XX7A 3IB1A 3IO6A 5EHSA 4OESA 4G68C 1MXVA 1UQWA 4QSCA 2UVHA 2DE3A 1IZ1A 4AQ4A 2RF1A 5TP9B 1MPBA 2PT1A 1PB9A 3L6GA 1R1NA 2DQVA 3SEUA 3MVYA 1POY1 3CG3A 3SEYA 3T96B 3R26A 1HSEA 2UYEA 4IO2A 3IJXB 3O6GA 2Z22A 1A54A 1ELJA 3IK6B 1OVTA 1O63A 3OEMA 2HAUA 3PPNA 3K00A 1FQDA 3K1PA 2HZLA 1MY2A 3K01A 4JWOA 4E0WA 4WXJA 4IO7A 4LZ7A 3FUZA 4QSEA 4DCXA 2DXYA 2Q88A 1I6BA 3PMXA 1OLAA 1B1HA 2Y7PA 4JXIA 5KZTA 2ONSA 2OWTA 3FV2A 4U2RA 4EXLA 4PE5B 4NF6A 3KN3A 3QK6A 3MPLA 2QS4A 4FJPA 3U92A 5B70A 5FTIA 5KDTB 4GWOA 1MY0A 2O68A 4THIA 3KFMA 3CSBA 4LONB 3RUMA 1MM6A 3LBSA 4YU0A 4ELOA 1YPNA 3M3KA 4QFPA 2DWHA 1PDAA 2P0SA 2Q2CA 3VVEA 1S50A 3ZKKA 2A5TB 3JZJA 2Y7RA 2I3VA 4WEDA 3OMBA 4GVOA 3HHGA 5AA2B 3Q26A 4ZEKA 3K6UA 1FW0A 2I0CA 2VD3A 1DTZA 5K2XA 1UTBB 2DWIA 3PPPA 3G3HA 2ZMBA 3N6UA 2PX1A 2XXYA 1YCJA 3MZBA 2LAOA 4DIGA 3T9VA 4PQJA 1HSJA 5TPAA 3M3LA 1MQHA 3V5AA 1MQIA 1N3XA 1HSLA 3FGSA 2PBWA 5JTYB 4KD5A 2FYIA 3R6UA 4XKRA 4EUOA 2D3IA 2F6GA 3W9WA 3DP6A 3TYHA 1Y3QA 4F1UA 3K4UA 5CMMA 4F2OA 3V83A 3K02A 1QULA 4NMYA 1N76A 3O29A 3I5OA 4RYAA 1B5HA 4FORA 1QUJA 2A5SA 3SETA 2O69A 3SEXA 3UORA 4U4SA 3TDJA 3RTFB 1JNFA 3THIA 1P99A 3FJ7A 3S9EA 4R9GA 1Y9UA 5ISUA 1EZPA 4MLVA 4ZZEA 1UTHA 3VXBA 3FJGA 2W7YA 4NF5A 2THIA 3IJOB 2FNCA 3ILUB 1T0KA 2RCAA 3O9PA 2HXWA 3GBBA 4F31B 1LCFA 1Q35A 4FECA 4FEDA 2NOOA 4HW8A 3U8QA 3OOAA 4RNSA 3OO8A 2REGA 5DYHA 3GZGA 4DLDA 4KCDA 2F7CA 4LQ5A 3S4UA 2M8CA 3LSFB 3WAFA 1A7LA 3QUJA 2V25A 3T22A 1LAGE 1URSA 2H99A 3A3UA 3H6VA 4FATA 3QYTA 1OMPA 5L9SA 2OZZA 1R9QA 4LQ2A 1OQHA 4IY5A 3G3GA 4FIMA 5H8SA 4RY1A 1GVCA 1H76A 1PBQA 4H5GA 4U21A 4Z0IA 4C1TA 2QS3A 2Q9TA 1B32A 2KLFA 2OBGA 1SYHA 4H8IA 2ANJA 1MY3A 4MF3A 2DOJA 1PBPA 4YKKA 1B7HA 1XVXA 5H8HA 5I58A 3RN8A 3PUWE 1B5IA 1LB8A 3TTLA 2I49A 3CFXA 3JYRA 3MWBA 3DM0A 3CFZA 4HCYA 5I57B 1FCKA 3KBRA 4QSDA 1A55A 3ODBA 3RNNA 3HSTA 1MXWA 4U1OA 4QFOA 5H8FA 2FA7A 4ZEIA 3ZS6A 5L9MA 3UN6A 4GOTA 4MLQA 4DZ1A 3TQWA 1US5A 4NF8A 1IXGA 3CR9A 4L17A 5FHOA 4H5FA 4KPTA 3SEWA 1IQ7A 1SI0A 2Z8FA 1B3EA 3OSRA 1O64A 3EN3A 1R6ZA 3O28A 5B7DA 3B7DA 1NL5A 1B4HA 4KYSA 2ONKE 1M5CA 4I8CA 3TTKA 2OLBA 4LZ5A 2YJPA 1I69A 4KFQA 2DXRA 2DE4A 3SERA 3OENA 2QS2A 1N7WA 5H8QB 1USYH 1B1XA 1VFDA 2Q2AA 3Q27A 4KCCA 3MJNA 2XXUA 1OQGA 2P1SA 3G3IA 3Q25A 4ELQA 3S9NC 4R6HA 3KEIA 2O1MA 2I4BA 1TWYA 4M4GA 4BLAA 4OWDA 1IEJA 3CG1A 4H0WA 3VLUA 1B3GA 1VSOA 3SKPA 3FZVA 1FTJA 4BDLA 1EU8A 1B0HA 3O66A 3KN8A 3T9UA 3OSQA 3TMGA 3K6XA 5DEXB 2F35A 2NXOA 3QIMA 2DWJA 3VXCA 2I6EA 4BDNA 5KCJA 3HN0A 3TPAA 4DDDA 3PUXE 3K1NA 3R7XA 4IO3A 4N07A 1FTOA 5AE4A 4XXUA 2DVZA 3Q28A 3O97A 3OELA 5AA3A 1Y4CA 1B7UA 1FTKA 1LBCA 2I4CA 4F3SA 2CZLA 1IIWA 2QMWA 3UGWA 1LBBA 4R2BA 5FHMA 2H98A 4O3AA 3PD8A 2I58A 3FJMA 1JW4A 5F7VA 1PEBA 1MQDA 4DXCA 3PMVA 3EPEA 2B65A 4F3BA 2Z8EA 4LP2B 4GL0A 5IKBA 3FVKA 1MDQA 4NF6B 2XXQA 1XT8A 1GTKA 3G7WA 3PU5A 5CMKA 4IB2A 1SBPA 4XIGQ 1B40A 4FEBA 4YZZA 2BJJX 1MDP1 4Q0CA 3PPRA 1MQGA 3A09A 4LATA 4OFJA 2ZYNA 3PUZE 3M8UA 1NH8A 5AA4A 4OEUA 2NWJA 3FATA 3KJTA 5JEIA 3DLNA 5LOMA 3HHFA 4RPNA 1WDNA 3CSGA 1B05A 4RK9A 4TOZA 4JB7A 4U4XA 1FTLA 3O2AA 3PUYE 1GR2A 3C32A 1DPPA 3T93B 2E1SA 2HFBA 3QAXA 1USYE 3VDFA 5TPAB 2OJTA 2R71A 4QHQA 3RLFE 3S9MC 1SDXA 1Y3NA 4JDFA 3LC8A 4GQOA 1J1NA 4QFNA 3IX1A 3H06B 5A5XB 5AA2D 1AL3A 3MUQA 4GRKA 2ZXTA 1D4NA 2F7BA 3RTWB 1MXUA 2GRVA 5I59B 2HCAA 4ECFA 5IAIA 4YICA 3CRBA 4X48A 4TLLB 3SESA 1P1UA 3GBAA 4DXUA 2V3UA 2RKMA 3I3VA 4EF1A 3TEPA 3QUFA 1ZU0A 3TTNA 3MVXA 3OO9A 4NF5B 1N3WA 1ZKBA 3ZSFA 3T9XB 1MPDA 1BKAA 2AIXA 4LUBA 3SDFA 4TQUQ 1PB8A 3RT6B 3E4RA 2Y84A 4Z7EA 2X7PA 2QS1A 1Z7ME 1XHYA 1SVXB 3IOVA 2ESNA 3USDA 2XD2A 4YKIA 3TZAA 5KDTA 3DP4A 4NTLA 4OFLA 5CI5A 4F3PA 1RKMA 3PGFA 2ABHA 1URGA 1XS5A 1SW1A 3EHSA 1LFHA 4G4PA 1P1OA 3CI8A 1B9JA 1M5FA 4NEDA 2O6AA 4F29A 2F5XA 1MXZA 5JK4A 1MS7A 2UVJA 2ONRA 3KOTA 3VLWA 5AA2A 2UXAA 3ILTB 4R73A 4AB5A 1UTBA 2XD3A 1BIYA 5K2YA 3FD3A 2DWAA 1M5DA 4OETA 3G3JA 1FQCA 2F36A 2ZNSA 1AMFA 3OO7A 5I56B 1LFIA 3VE1B 3RT8A 5JTYA 2O7IA 3H6TA 1VE4A 4BDMA 4OVJA 1JETA 2QMXA 5H8HB 5I58B 4WEPA 2O1LA 1A40A 2F97A 1ZLQA 3MZ9A 2F34A 2R6GE 3TELA 3GXAA 3CIJA 3FXRA 3GLBA 4F1YA 2X7QA 5I2NA 3MW0A 3MQ9A 1JVXA 4H6DA 5ITPA 2AYSA 1BLFA 2XHDA 4ONYA 2D21A 3C34A 2XXIA 2IEEA 1B6HA 2X26A 4E0XA 2G29A 4R75A 3B6QA 4R74A 1O7TA 2H4IA 1H45A 2V93A 5I84A 3P7IA 1JW5A 3FVNA 3H6UA 3HPIA 1S9TA 2XX9A 1LGBC 3IORA 3DP8A 5L9OA 1QKBA 4IO4A 3A3CA 1UIVA 1IUDA 1NNKA 3EF7A 1URDA 3H6WA 3ONMA 3IOTA 2XXPA 5HPQA 3U72A 2IA4A 1A99A 1TT1A 3TCGA 2AL5A 3AXFA 3CVGA 4ZEFA 2H25A 1ZIUA 1QJMA 5H8NA 2VD2A 4R6YA 2GFEA 4JSOA 1GV8A 4HS7A 3W15C 3EHTA 3FVGA 1MH3A 5ELVA 3I6VA 1CE2A 2P2AA 4DE8A 5CM6A 4G8NA 4EQ7A 5EHMA 3O6IA 4Q30B 1LLSA 2D5WA 4KHZE 5CMCA 2G93A 4EQ9A 3MAMA 4YMBA 3K1MA 2PVUA 3MVZA 3RGYA 1NMUA 1NFTA 3IO4A 4OENA 1P1QA 1UIUA 3U93A 3LSLA 4N6PA 4KR5A 1N84A 1KWHA 1Y3PA 3TAJA 1M5BA 5FHNA 3WAEA 4ESXA 3TODA 1IXIA 2O51A 4AB6A 4G68B 1LSTA 4MBPA 5I2KB 2O7UA 1QW0A 1MY1A 1DOTA 3TQLA 2Z8DA 1RYOA 5CBSA 3JV9A 5I57A 1B58A 3QSLA 4ZE8A 2RCBA 4YB6A 4GIZA 5BWJA 1LAXA 1NH7A 4XKNA 1SW5A 5AA1A 2O84X 3UP9A 1D9YA 4DCYA 3S9LC 3QXMA 2XXXA 1Y4TA 2YLNA 4PETA 2ZNTA 2H9BA 2ZYOA 3UK4A 2GH9A 1Y20A 1SW4A 3PPOA 4LA9A 3TCHA 2UVIA 3FVOA 3G3KA 1P1WA 4ISUA 1WODA 1IXCA 4RJZA 1FQEA 3PD9A 3ECRA 1TFDA 3FXQA 1ZTYA 3VVDA 2I0BA 3TTMA 2DYXA 4JWYA 3E9XA 4XKQA 1AOVA 2I3WA 4NF4A 1B0LA 3C4MA 3FXUA 3D4GA 4IY6A 4PFUA 4POXA 1RYXA 5CMBA 2RC8A 4FAJA 3TKDA 3S2VA 4Q5TA 4OHNA 2OWSA 4G8MA 2XX8A 4G2ZA 3H7MA 3T9HB 4OEVA 4C0RA 2PMSA 3VV5A 1JVYA 4XKPA 4R72A 2NVUB 4F22A 3U94A 1TXFA 1Q1KA 1QUIA 5DEXA 2CMOA 4YKJA 4YMAA 2REJA 1BTJA 1B3LA 2HQ0A 1US4A 1B51A 3UA8A 5ICTA 1MXXA 3K6WA 3VLVA 1B2HA 3HV1A 3K0VA 4G8HA 2ZNUA 3BFUA 2QRYA 1EZ9A 5CBRA 1B4ZA 2R9JA 2HEUA 3E3KA 1D3KA 4JWXA 3C36A 3HCQA 4H8JA 2Q8JA 5ICQA 3N5LA 3Q29A 4OERA 3ZKLA 1Y1ZA 5M2VA 1MG1A 4QFLA 2V84A 1N7XA 4KYDA 3OD7A 4ND9A 4HCWA 1ZBMA 2WKYA 3N94A 1FQFA 2Y7KA 3VFJA 1N0TA 1LB9A 2B3BA 1ZJLA 4F2QA 3PMWA 2AL4A 1JEUA 5TU0A 2YPNA 5L8DA 3IB0A 5TP9A 4O3CA 3C31A 4LZ8A 1FTMA 1D9VA 3FIRA 1B5JA 1XOCA 4X1BA 1B3FA 3V8XB 1AH5A 1A8EA 2PT2A 3RY3A 2QJEA 4YKPA 3TCFA 1I6AA 2GHAA 1ZMGA 4X9TA 3HO7A 4N13A 2I48A 4H65A 4U22A 4ZEDA 4LVQA 1MXYA 3FASA 1XVYA 1PB7A 5HBCA 4OFOA 4BDOA 4NE4A 4R2FA 1YTVA 4ESWA 1UTHB 4BDQA 2VHAA 2RC7A 2XXHA 3SEVA 4ZECA 4H1XA 3E13X 1DMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z23 A;  1OVB A;  1H43 A;  4F3G A;  4U23 A;  3CFL A;  5DTB A;  4FE8 A;  3W9V A;  2E0S A;  3C33 A;  4GD5 A;  4XTC Q;  5DT6 A;  4RPO A;  1GGG A;  4Q8R A;  1OIB A;  2XXT A;  2OCU A;  3MPK A;  3G3F A;  4NWC A;  3C35 A;  4I1D A;  3UIF A;  5A5X A;  1OLC A;  2HAV A;  4POW A;  4G77 A;  2V3T A;  1F9B A;  4IGT A;  2GHB A;  4F18 A;  1NKX A;  3OXN A;  4P11 A;  4RXL A;  1JQF A;  1Y1M A;  5I59 A;  1EZO A;  3H03 A;  4GLI A;  5I2N B;  1MRP A;  3OO6 A;  2A5T A;  1CB6 A;  3N26 A;  4I9D A;  4IO5 A;  1N04 A;  1B46 A;  2DE2 A;  3IOW A;  2DP8 A;  4IO6 A;  4F1V A;  2ALU A;  3D4C A;  1PC3 A;  1DPE A;  3RPW A;  1JW1 A;  1A8F A;  5J1D A;  4TLM B;  4OZ9 A;  4MH5 A;  4F39 A;  1SW2 A;  4OTE A;  4PFW A;  4ZEB A;  3B6T A;  2HZK A;  3K6V A;  2VP1 A;  2DSF A;  2Y7I A;  1QVS A;  4PFY A;  5DVF A;  3MP6 A;  4UA8 A;  1NNT A;  1L5T A;  4IGR A;  5H8N B;  3LUY A;  4ELP A;  4GXS B;  2ZYK A;  4X1D A;  5EYF A;  4GFR A;  3H3G A;  3BKI B;  3MP1 A;  5H8F B;  1WVJ A;  3MBP A;  4RK2 A;  2QL3 A;  4OQO A;  4NF8 B;  3L6H A;  1MH4 A;  1H3D A;  2QSX A;  3TUS A;  4RA1 A;  2RC9 A;  3LR1 A;  1B7Z A;  2UYF A;  4ZS9 A;  3PUV E;  4K3F A;  3PV0 E;  1SYI A;  4P0G A;  3MP8 A;  3TTR A;  3BFT A;  1BP5 A;  1YAE A;  1NNF A;  5F1Q A;  2F7A A;  3LSW A;  2QPQ A;  1TFA A;  4EQB A;  1POT A;  4BDR A;  4WKM A;  5FTH A;  1R9L A;  5I56 A;  4F19 A;  5BUU A;  4YAH X;  1FQB A;  1P1N A;  3FV1 A;  1VFE A;  3VVF A;  1H44 A;  3MVW A;  1IIT A;  1II5 A;  1SI1 A;  1IXH A;  1Z7N E;  3KOS A;  4EXK A;  3F11 A;  4MFI A;  3EQ1 A;  4ZZA A;  1DSN A;  5CRY A;  4JBZ A;  2DS9 A;  3N6T A;  4YB7 A;  1MM7 A;  1JEV A;  1ATG A;  4EF2 A;  2RIN A;  4QF9 A;  2B3F A;  3B6W A;  4GF8 A;  1I6Q A;  1AIV A;  2ZYM A;  3KGC A;  3OEK A;  5DVJ A;  3EHU A;  4R9F A;  2V3Q A;  4QRZ A;  4EDP A;  4KYE A;  3TFL A;  3C9H A;  5KCJ B;  4NWD A;  2F78 A;  4KQP A;  3DEL B;  2Q89 A;  2XXR A;  1QKA A;  1VR5 A;  4C1U A;  1M5E A;  4QFK A;  4PP0 A;  2VOZ A;  1B52 A;  4NF4 B;  3BBR A;  1B3H A;  3U1O A;  1NNP A;  1MY4 A;  4P0I A;  2VGQ A;  2H5Y A;  2DVC A;  4GXA A;  3MZ1 A;  4KI0 E;  1DTG A;  3KZG A;  1ANF A;  4HTG A;  2F6P A;  3H4Z A;  3O6H A;  5CC2 A;  5HM4 B;  1XC1 A;  4ZE9 A;  3IAZ A;  2XXW A;  3MC2 A;  1SD3 A;  3IR1 A;  4JSD A;  2Y7W A;  2NUV A;  1MQJ A;  1EH3 A;  4O3B A;  3M3F A;  3IB2 A;  1FQA A;  4ZDM A;  4M1V A;  3IL1 B;  1LFG A;  1LAH E;  1S7Y A;  3LSX A;  1LAF E;  3IOU A;  4DXB A;  4YB5 A;  2PYY A;  3RQT A;  3KSX A;  3V89 B;  4UAC A;  2OK2 A;  4PFT A;  4H67 A;  5AA4 B;  3KG2 A;  4OMB A;  1MPC A;  3KN7 A;  3PPQ A;  4I62 A;  2XXV A;  5DVI A;  4ELR A;  4R6K A;  2F8D A;  5ITO A;  2UVG A;  3K2D A;  3KSJ A;  3T66 A;  3KJ7 A;  1QUK A;  5H8Q A;  1LCT A;  1SQY A;  4G68 A;  4OXV A;  4GL8 A;  4OYV A;  4U1Z A;  5I2K A;  2XX7 A;  3IB1 A;  3IO6 A;  5EHS A;  4OES A;  4G68 C;  1MXV A;  1UQW A;  4QSC A;  2UVH A;  2DE3 A;  1IZ1 A;  4AQ4 A;  2RF1 A;  5TP9 B;  1MPB A;  2PT1 A;  1PB9 A;  3L6G A;  1R1N A;  2DQV A;  3SEU A;  3MVY A;  1POY 1;  3CG3 A;  3SEY A;  3T96 B;  3R26 A;  1HSE A;  2UYE A;  4IO2 A;  3IJX B;  3O6G A;  2Z22 A;  1A54 A;  1ELJ A;  3IK6 B;  1OVT A;  1O63 A;  3OEM A;  2HAU A;  3PPN A;  3K00 A;  1FQD A;  3K1P A;  2HZL A;  1MY2 A;  3K01 A;  4JWO A;  4E0W A;  4WXJ A;  4IO7 A;  4LZ7 A;  3FUZ A;  4QSE A;  4DCX A;  2DXY A;  2Q88 A;  1I6B A;  3PMX A;  1OLA A;  1B1H A;  2Y7P A;  4JXI A;  5KZT A;  2ONS A;  2OWT A;  3FV2 A;  4U2R A;  4EXL A;  4PE5 B;  4NF6 A;  3KN3 A;  3QK6 A;  3MPL A;  2QS4 A;  4FJP A;  3U92 A;  5B70 A;  5FTI A;  5KDT B;  4GWO A;  1MY0 A;  2O68 A;  4THI A;  3KFM A;  3CSB A;  4LON B;  3RUM A;  1MM6 A;  3LBS A;  4YU0 A;  4ELO A;  1YPN A;  3M3K A;  4QFP A;  2DWH A;  1PDA A;  2P0S A;  2Q2C A;  3VVE A;  1S50 A;  3ZKK A;  2A5T B;  3JZJ A;  2Y7R A;  2I3V A;  4WED A;  3OMB A;  4GVO A;  3HHG A;  5AA2 B;  3Q26 A;  4ZEK A;  3K6U A;  1FW0 A;  2I0C A;  2VD3 A;  1DTZ A;  5K2X A;  1UTB B;  2DWI A;  3PPP A;  3G3H A;  2ZMB A;  3N6U A;  2PX1 A;  2XXY A;  1YCJ A;  3MZB A;  2LAO A;  4DIG A;  3T9V A;  4PQJ A;  1HSJ A;  5TPA A;  3M3L A;  1MQH A;  3V5A A;  1MQI A;  1N3X A;  1HSL A;  3FGS A;  2PBW A;  5JTY B;  4KD5 A;  2FYI A;  3R6U A;  4XKR A;  4EUO A;  2D3I A;  2F6G A;  3W9W A;  3DP6 A;  3TYH A;  1Y3Q A;  4F1U A;  3K4U A;  5CMM A;  4F2O A;  3V83 A;  3K02 A;  1QUL A;  4NMY A;  1N76 A;  3O29 A;  3I5O A;  4RYA A;  1B5H A;  4FOR A;  1QUJ A;  2A5S A;  3SET A;  2O69 A;  3SEX A;  3UOR A;  4U4S A;  3TDJ A;  3RTF B;  1JNF A;  3THI A;  1P99 A;  3FJ7 A;  3S9E A;  4R9G A;  1Y9U A;  5ISU A;  1EZP A;  4MLV A;  4ZZE A;  1UTH A;  3VXB A;  3FJG A;  2W7Y A;  4NF5 A;  2THI A;  3IJO B;  2FNC A;  3ILU B;  1T0K A;  2RCA A;  3O9P A;  2HXW A;  3GBB A;  4F31 B;  1LCF A;  1Q35 A;  4FEC A;  4FED A;  2NOO A;  4HW8 A;  3U8Q A;  3OOA A;  4RNS A;  3OO8 A;  2REG A;  5DYH A;  3GZG A;  4DLD A;  4KCD A;  2F7C A;  4LQ5 A;  3S4U A;  2M8C A;  3LSF B;  3WAF A;  1A7L A;  3QUJ A;  2V25 A;  3T22 A;  1LAG E;  1URS A;  2H99 A;  3A3U A;  3H6V A;  4FAT A;  3QYT A;  1OMP A;  5L9S A;  2OZZ A;  1R9Q A;  4LQ2 A;  1OQH A;  4IY5 A;  3G3G A;  4FIM A;  5H8S A;  4RY1 A;  1GVC A;  1H76 A;  1PBQ A;  4H5G A;  4U21 A;  4Z0I A;  4C1T A;  2QS3 A;  2Q9T A;  1B32 A;  2KLF A;  2OBG A;  1SYH A;  4H8I A;  2ANJ A;  1MY3 A;  4MF3 A;  2DOJ A;  1PBP A;  4YKK A;  1B7H A;  1XVX A;  5H8H A;  5I58 A;  3RN8 A;  3PUW E;  1B5I A;  1LB8 A;  3TTL A;  2I49 A;  3CFX A;  3JYR A;  3MWB A;  3DM0 A;  3CFZ A;  4HCY A;  5I57 B;  1FCK A;  3KBR A;  4QSD A;  1A55 A;  3ODB A;  3RNN A;  3HST A;  1MXW A;  4U1O A;  4QFO A;  5H8F A;  2FA7 A;  4ZEI A;  3ZS6 A;  5L9M A;  3UN6 A;  4GOT A;  4MLQ A;  4DZ1 A;  3TQW A;  1US5 A;  4NF8 A;  1IXG A;  3CR9 A;  4L17 A;  5FHO A;  4H5F A;  4KPT A;  3SEW A;  1IQ7 A;  1SI0 A;  2Z8F A;  1B3E A;  3OSR A;  1O64 A;  3EN3 A;  1R6Z A;  3O28 A;  5B7D A;  3B7D A;  1NL5 A;  1B4H A;  4KYS A;  2ONK E;  1M5C A;  4I8C A;  3TTK A;  2OLB A;  4LZ5 A;  2YJP A;  1I69 A;  4KFQ A;  2DXR A;  2DE4 A;  3SER A;  3OEN A;  2QS2 A;  1N7W A;  5H8Q B;  1USY H;  1B1X A;  1VFD A;  2Q2A A;  3Q27 A;  4KCC A;  3MJN A;  2XXU A;  1OQG A;  2P1S A;  3G3I A;  3Q25 A;  4ELQ A;  3S9N C;  4R6H A;  3KEI A;  2O1M A;  2I4B A;  1TWY A;  4M4G A;  4BLA A;  4OWD A;  1IEJ A;  3CG1 A;  4H0W A;  3VLU A;  1B3G A;  1VSO A;  3SKP A;  3FZV A;  1FTJ A;  4BDL A;  1EU8 A;  1B0H A;  3O66 A;  3KN8 A;  3T9U A;  3OSQ A;  3TMG A;  3K6X A;  5DEX B;  2F35 A;  2NXO A;  3QIM A;  2DWJ A;  3VXC A;  2I6E A;  4BDN A;  5KCJ A;  3HN0 A;  3TPA A;  4DDD A;  3PUX E;  3K1N A;  3R7X A;  4IO3 A;  4N07 A;  1FTO A;  5AE4 A;  4XXU A;  2DVZ A;  3Q28 A;  3O97 A;  3OEL A;  5AA3 A;  1Y4C A;  1B7U A;  1FTK A;  1LBC A;  2I4C A;  4F3S A;  2CZL A;  1IIW A;  2QMW A;  3UGW A;  1LBB A;  4R2B A;  5FHM A;  2H98 A;  4O3A A;  3PD8 A;  2I58 A;  3FJM A;  1JW4 A;  5F7V A;  1PEB A;  1MQD A;  4DXC A;  3PMV A;  3EPE A;  2B65 A;  4F3B A;  2Z8E A;  4LP2 B;  4GL0 A;  5IKB A;  3FVK A;  1MDQ A;  4NF6 B;  2XXQ A;  1XT8 A;  1GTK A;  3G7W A;  3PU5 A;  5CMK A;  4IB2 A;  1SBP A;  4XIG Q;  1B40 A;  4FEB A;  4YZZ A;  2BJJ X;  1MDP 1;  4Q0C A;  3PPR A;  1MQG A;  3A09 A;  4LAT A;  4OFJ A;  2ZYN A;  3PUZ E;  3M8U A;  1NH8 A;  5AA4 A;  4OEU A;  2NWJ A;  3FAT A;  3KJT A;  5JEI A;  3DLN A;  5LOM A;  3HHF A;  4RPN A;  1WDN A;  3CSG A;  1B05 A;  4RK9 A;  4TOZ A;  4JB7 A;  4U4X A;  1FTL A;  3O2A A;  3PUY E;  1GR2 A;  3C32 A;  1DPP A;  3T93 B;  2E1S A;  2HFB A;  3QAX A;  1USY E;  3VDF A;  5TPA B;  2OJT A;  2R71 A;  4QHQ A;  3RLF E;  3S9M C;  1SDX A;  1Y3N A;  4JDF A;  3LC8 A;  4GQO A;  1J1N A;  4QFN A;  3IX1 A;  3H06 B;  5A5X B;  5AA2 D;  1AL3 A;  3MUQ A;  4GRK A;  2ZXT A;  1D4N A;  2F7B A;  3RTW B;  1MXU A;  2GRV A;  5I59 B;  2HCA A;  4ECF A;  5IAI A;  4YIC A;  3CRB A;  4X48 A;  4TLL B;  3SES A;  1P1U A;  3GBA A;  4DXU A;  2V3U A;  2RKM A;  3I3V A;  4EF1 A;  3TEP A;  3QUF A;  1ZU0 A;  3TTN A;  3MVX A;  3OO9 A;  4NF5 B;  1N3W A;  1ZKB A;  3ZSF A;  3T9X B;  1MPD A;  1BKA A;  2AIX A;  4LUB A;  3SDF A;  4TQU Q;  1PB8 A;  3RT6 B;  3E4R A;  2Y84 A;  4Z7E A;  2X7P A;  2QS1 A;  1Z7M E;  1XHY A;  1SVX B;  3IOV A;  2ESN A;  3USD A;  2XD2 A;  4YKI A;  3TZA A;  5KDT A;  3DP4 A;  4NTL A;  4OFL A;  5CI5 A;  4F3P A;  1RKM A;  3PGF A;  2ABH A;  1URG A;  1XS5 A;  1SW1 A;  3EHS A;  1LFH A;  4G4P A;  1P1O A;  3CI8 A;  1B9J A;  1M5F A;  4NED A;  2O6A A;  4F29 A;  2F5X A;  1MXZ A;  5JK4 A;  1MS7 A;  2UVJ A;  2ONR A;  3KOT A;  3VLW A;  5AA2 A;  2UXA A;  3ILT B;  4R73 A;  4AB5 A;  1UTB A;  2XD3 A;  1BIY A;  5K2Y A;  3FD3 A;  2DWA A;  1M5D A;  4OET A;  3G3J A;  1FQC A;  2F36 A;  2ZNS A;  1AMF A;  3OO7 A;  5I56 B;  1LFI A;  3VE1 B;  3RT8 A;  5JTY A;  2O7I A;  3H6T A;  1VE4 A;  4BDM A;  4OVJ A;  1JET A;  2QMX A;  5H8H B;  5I58 B;  4WEP A;  2O1L A;  1A40 A;  2F97 A;  1ZLQ A;  3MZ9 A;  2F34 A;  2R6G E;  3TEL A;  3GXA A;  3CIJ A;  3FXR A;  3GLB A;  4F1Y A;  2X7Q A;  5I2N A;  3MW0 A;  3MQ9 A;  1JVX A;  4H6D A;  5ITP A;  2AYS A;  1BLF A;  2XHD A;  4ONY A;  2D21 A;  3C34 A;  2XXI A;  2IEE A;  1B6H A;  2X26 A;  4E0X A;  2G29 A;  4R75 A;  3B6Q A;  4R74 A;  1O7T A;  2H4I A;  1H45 A;  2V93 A;  5I84 A;  3P7I A;  1JW5 A;  3FVN A;  3H6U A;  3HPI A;  1S9T A;  2XX9 A;  1LGB C;  3IOR A;  3DP8 A;  5L9O A;  1QKB A;  4IO4 A;  3A3C A;  1UIV A;  1IUD A;  1NNK A;  3EF7 A;  1URD A;  3H6W A;  3ONM A;  3IOT A;  2XXP A;  5HPQ A;  3U72 A;  2IA4 A;  1A99 A;  1TT1 A;  3TCG A;  2AL5 A;  3AXF A;  3CVG A;  4ZEF A;  2H25 A;  1ZIU A;  1QJM A;  5H8N A;  2VD2 A;  4R6Y A;  2GFE A;  4JSO A;  1GV8 A;  4HS7 A;  3W15 C;  3EHT A;  3FVG A;  1MH3 A;  5ELV A;  3I6V A;  1CE2 A;  2P2A A;  4DE8 A;  5CM6 A;  4G8N A;  4EQ7 A;  5EHM A;  3O6I A;  4Q30 B;  1LLS A;  2D5W A;  4KHZ E;  5CMC A;  2G93 A;  4EQ9 A;  3MAM A;  4YMB A;  3K1M A;  2PVU A;  3MVZ A;  3RGY A;  1NMU A;  1NFT A;  3IO4 A;  4OEN A;  1P1Q A;  1UIU A;  3U93 A;  3LSL A;  4N6P A;  4KR5 A;  1N84 A;  1KWH A;  1Y3P A;  3TAJ A;  1M5B A;  5FHN A;  3WAE A;  4ESX A;  3TOD A;  1IXI A;  2O51 A;  4AB6 A;  4G68 B;  1LST A;  4MBP A;  5I2K B;  2O7U A;  1QW0 A;  1MY1 A;  1DOT A;  3TQL A;  2Z8D A;  1RYO A;  5CBS A;  3JV9 A;  5I57 A;  1B58 A;  3QSL A;  4ZE8 A;  2RCB A;  4YB6 A;  4GIZ A;  5BWJ A;  1LAX A;  1NH7 A;  4XKN A;  1SW5 A;  5AA1 A;  2O84 X;  3UP9 A;  1D9Y A;  4DCY A;  3S9L C;  3QXM A;  2XXX A;  1Y4T A;  2YLN A;  4PET A;  2ZNT A;  2H9B A;  2ZYO A;  3UK4 A;  2GH9 A;  1Y20 A;  1SW4 A;  3PPO A;  4LA9 A;  3TCH A;  2UVI A;  3FVO A;  3G3K A;  1P1W A;  4ISU A;  1WOD A;  1IXC A;  4RJZ A;  1FQE A;  3PD9 A;  3ECR A;  1TFD A;  3FXQ A;  1ZTY A;  3VVD A;  2I0B A;  3TTM A;  2DYX A;  4JWY A;  3E9X A;  4XKQ A;  1AOV A;  2I3W A;  4NF4 A;  1B0L A;  3C4M A;  3FXU A;  3D4G A;  4IY6 A;  4PFU A;  4POX A;  1RYX A;  5CMB A;  2RC8 A;  4FAJ A;  3TKD A;  3S2V A;  4Q5T A;  4OHN A;  2OWS A;  4G8M A;  2XX8 A;  4G2Z A;  3H7M A;  3T9H B;  4OEV A;  4C0R A;  2PMS A;  3VV5 A;  1JVY A;  4XKP A;  4R72 A;  2NVU B;  4F22 A;  3U94 A;  1TXF A;  1Q1K A;  1QUI A;  5DEX A;  2CMO A;  4YKJ A;  4YMA A;  2REJ A;  1BTJ A;  1B3L A;  2HQ0 A;  1US4 A;  1B51 A;  3UA8 A;  5ICT A;  1MXX A;  3K6W A;  3VLV A;  1B2H A;  3HV1 A;  3K0V A;  4G8H A;  2ZNU A;  3BFU A;  2QRY A;  1EZ9 A;  5CBR A;  1B4Z A;  2R9J A;  2HEU A;  3E3K A;  1D3K A;  4JWX A;  3C36 A;  3HCQ A;  4H8J A;  2Q8J A;  5ICQ A;  3N5L A;  3Q29 A;  4OER A;  3ZKL A;  1Y1Z A;  5M2V A;  1MG1 A;  4QFL A;  2V84 A;  1N7X A;  4KYD A;  3OD7 A;  4ND9 A;  4HCW A;  1ZBM A;  2WKY A;  3N94 A;  1FQF A;  2Y7K A;  3VFJ A;  1N0T A;  1LB9 A;  2B3B A;  1ZJL A;  4F2Q A;  3PMW A;  2AL4 A;  1JEU A;  5TU0 A;  2YPN A;  5L8D A;  3IB0 A;  5TP9 A;  4O3C A;  3C31 A;  4LZ8 A;  1FTM A;  1D9V A;  3FIR A;  1B5J A;  1XOC A;  4X1B A;  1B3F A;  3V8X B;  1AH5 A;  1A8E A;  2PT2 A;  3RY3 A;  2QJE A;  4YKP A;  3TCF A;  1I6A A;  2GHA A;  1ZMG A;  4X9T A;  3HO7 A;  4N13 A;  2I48 A;  4H65 A;  4U22 A;  4ZED A;  4LVQ A;  1MXY A;  3FAS A;  1XVY A;  1PB7 A;  5HBC A;  4OFO A;  4BDO A;  4NE4 A;  4R2F A;  1YTV A;  4ESW A;  1UTH B;  4BDQ A;  2VHA A;  2RC7 A;  2XXH A;  3SEV A;  4ZEC A;  4H1X A;  3E13 X;  1DMB A; 
#chains in the Genus database with same CATH topology
 2Z23 A;  1OVB A;  1H43 A;  2OWZ A;  4F3G A;  4U23 A;  3CFL A;  2B4M A;  5DTB A;  4FE8 A;  3W9V A;  2E0S A;  2WYK A;  3C33 A;  4OVT A;  4GD5 A;  4XTC Q;  5DT6 A;  5FBP A;  4RPO A;  5IZ1 A;  1GGG A;  4Q8R A;  1OIB A;  2XXT A;  2OCU A;  3MPK A;  3G3F A;  4NWC A;  3C35 A;  2HXR A;  4I1D A;  3UIF A;  5A5X A;  1OLC A;  2HAV A;  4POW A;  4G77 A;  2V3T A;  1BK4 A;  1F9B A;  4IGT A;  2QVR A;  2GHB A;  4F18 A;  1NKX A;  3OXN A;  4P11 A;  4RXL A;  1JQF A;  1Y1M A;  5I59 A;  1EZO A;  3H03 A;  4GLI A;  5I2N B;  1MRP A;  3OO6 A;  2A5T A;  1CB6 A;  3N26 A;  4I9D A;  4IO5 A;  1N04 A;  1B46 A;  2DE2 A;  3IOW A;  2CEY A;  1FPF A;  4DI3 D;  2DP8 A;  2XWO A;  1VDW A;  1G0H A;  4IO6 A;  4F1V A;  2ALU A;  3D4C A;  4P9K A;  1PC3 A;  1DPE A;  3RPW A;  1JW1 A;  1A8F A;  2VPN A;  5J1D A;  3BIH A;  4TLM B;  4AS5 A;  4OZ9 A;  2HHM A;  4MH5 A;  4F39 A;  1SW2 A;  2Y5L A;  4OTE A;  2P3N A;  4PFW A;  4ZEB A;  3B6T A;  2HZK A;  3K6V A;  2VP1 A;  2DSF A;  2Y7I A;  1QVS A;  2KR0 A;  4PFY A;  5DVF A;  3MP6 A;  4UA8 A;  1NNT A;  1L5T A;  4IGR A;  5H8N B;  3LUY A;  4ELP A;  4GXS B;  2ZYK A;  2XWI A;  4X1D A;  5EYF A;  4GFR A;  3H3G A;  3BKI B;  3MP1 A;  5H8F B;  1WVJ A;  3MBP A;  4RK2 A;  1FRP A;  2QL3 A;  4OQO A;  4NF8 B;  2FIX A;  1NV3 A;  3L6H A;  1MH4 A;  1H3D A;  2QSX A;  3TUS A;  4RA1 A;  2RC9 A;  3LR1 A;  1B7Z A;  2UYF A;  4ZS9 A;  3PUV E;  4K3F A;  3PV0 E;  1SYI A;  4P0G A;  3MP8 A;  3TTR A;  3BFT A;  1BP5 A;  1YAE A;  1RDZ A;  4GWX A;  1NNF A;  5F1Q A;  2F7A A;  3LSW A;  2QPQ A;  1TFA A;  4EQB A;  1POT A;  4BDR A;  4WKM A;  5FTH A;  1R9L A;  5I56 A;  4F19 A;  5BUU A;  4MEV A;  4YAH X;  1FQB A;  1P1N A;  3FV1 A;  1VFE A;  3VVF A;  1H44 A;  2WX9 A;  3MVW A;  1IIT A;  1II5 A;  1SI1 A;  1IXH A;  1Z7N E;  3KOS A;  1NV2 A;  4PCD A;  4EXK A;  3F11 A;  4MFI A;  3EQ1 A;  4ZZA A;  1DSN A;  3IFC A;  5CRY A;  4MNP A;  5IZZ A;  4JBZ A;  2DS9 A;  1KA1 A;  3N6T A;  3BIG A;  1MM7 A;  4YB7 A;  1JEV A;  1ATG A;  4EF2 A;  2RIN A;  4QF9 A;  5EYG A;  2B3F A;  3B6W A;  3T0J A;  4GF8 A;  1I6Q A;  1FTA A;  1AIV A;  4MJO A;  2ZYM A;  3KGC A;  3OEK A;  5DVJ A;  3EHU A;  3GYY A;  4R9F A;  2V3Q A;  4QRZ A;  2R8T A;  4EDP A;  4KYE A;  3TFL A;  5ET7 A;  3C9H A;  5KCJ B;  4NWD A;  2F78 A;  1K9Z A;  4KQP A;  3DEL B;  2Q89 A;  2XXR A;  4QBA A;  1QKA A;  1VR5 A;  4LN5 A;  4C1U A;  1M5E A;  4QFK A;  4PP0 A;  2VOZ A;  4QXD A;  1B52 A;  4N8Y A;  4NF4 B;  3BBR A;  4GBV A;  1B3H A;  3IFA A;  3U1O A;  1NNP A;  5IZ3 B;  1MY4 A;  4P0I A;  1DCU A;  2VGQ A;  2H5Y A;  4XEQ A;  2DVC A;  1K9Y A;  4GXA A;  3MZ1 A;  4KI0 E;  2FHY A;  1DTG A;  1EYK A;  3KZG A;  1ANF A;  4HTG A;  2F6P A;  3H4Z A;  2XWV A;  3O6H A;  5CC2 A;  5HM4 B;  1XC1 A;  4ZE9 A;  4N91 A;  3IAZ A;  2XXW A;  3MC2 A;  1SD3 A;  3IR1 A;  4JSD A;  2Y7W A;  2NUV A;  1MQJ A;  1EH3 A;  4O3B A;  3M3F A;  3IB2 A;  1FQA A;  4ZDM A;  1SPI A;  1XI6 A;  4M1V A;  3IL1 B;  2BJI A;  1LFG A;  1LAH E;  1S7Y A;  3LSX A;  1LAF E;  3U65 A;  3IOU A;  4DXB A;  4YB5 A;  2PYY A;  4FBP A;  3RQT A;  3KSX A;  3V89 B;  4PAK A;  2OK2 A;  4UAC A;  4PFT A;  4H67 A;  5AA4 B;  3KG2 A;  4OMB A;  1MPC A;  3KN7 A;  3PPQ A;  4I62 A;  2XXV A;  5DVI A;  4ELR A;  4R6K A;  2F8D A;  5ITO A;  2UVG A;  3K2D A;  3KSJ A;  3T66 A;  3KJ7 A;  1QUK A;  2WYP A;  5H8Q A;  1LCT A;  4XFE A;  1SQY A;  4G68 A;  4MAG A;  4OXV A;  4GL8 A;  4OA4 A;  4OYV A;  4U1Z A;  5I2K A;  2XX7 A;  5LTC A;  3IB1 A;  3IO6 A;  4PTK A;  4N17 A;  5EHS A;  4PBH A;  4OES A;  4G68 C;  1MXV A;  1UQW A;  4QSC A;  2UVH A;  2DE3 A;  1IZ1 A;  4AQ4 A;  1FSA A;  4PFR A;  2RF1 A;  5TP9 B;  2KQZ A;  1MPB A;  2PT1 A;  1PB9 A;  3L6G A;  3RPL A;  1R1N A;  2DQV A;  3SEU A;  3MVY A;  1POY 1;  3CG3 A;  3SEY A;  3T96 B;  3R26 A;  1HSE A;  5IM2 A;  2UYE A;  4IO2 A;  3IJX B;  3O6G A;  2Z22 A;  2QVU A;  1INP A;  1A54 A;  1ELJ A;  3IK6 B;  1OVT A;  1O63 A;  1FPB A;  3OEM A;  2HAU A;  3PPN A;  3K00 A;  1FQD A;  3K1P A;  4G61 A;  2HZL A;  1MY2 A;  3K01 A;  4JWO A;  4E0W A;  4WXJ A;  4IO7 A;  4LZ7 A;  3FUZ A;  4QSE A;  3HFU A;  4DCX A;  2DXY A;  2CEX A;  2Q88 A;  1I6B A;  3PMX A;  1OLA A;  1B1H A;  2Y7P A;  4JXI A;  4PBQ A;  5KZT A;  5EQ8 A;  1FBF A;  2ONS A;  4O94 A;  2OWT A;  3QMF A;  3FV2 A;  3D1R A;  4U2R A;  4EXL A;  4P3L A;  4PE5 B;  4NF6 A;  3KN3 A;  3QK6 A;  3MPL A;  2QS4 A;  1FBC A;  4FJP A;  1LBZ A;  3U92 A;  5B70 A;  5FTI A;  5KDT B;  4GWO A;  1MY0 A;  2O68 A;  4THI A;  1CNQ A;  3KFM A;  3CSB A;  4LON B;  2WEF A;  3RUM A;  1MM6 A;  3LBS A;  2WBD A;  4YU0 A;  4ELO A;  1YPN A;  3M3K A;  4GX4 A;  4QFP A;  2DWH A;  1PDA A;  2P0S A;  2Q2C A;  2QFL A;  5I3S A;  3VVE A;  5EQA A;  1S50 A;  3ZKK A;  2A5T B;  1DBZ A;  3JZJ A;  1EYI A;  1LBW A;  2Y7R A;  4NG7 A;  2GQ1 A;  2I3V A;  4WED A;  3OMB A;  4GVO A;  2JJK A;  3FXB A;  4PDH A;  3HHG A;  5AA2 B;  4I3Y A;  3Q26 A;  4ZEK A;  3K6U A;  1FW0 A;  2I0C A;  2VD3 A;  2PFY A;  1DTZ A;  5K2X A;  1UTB B;  2DWI A;  3PPP A;  3G3H A;  2ZMB A;  3N6U A;  2PX1 A;  2XXY A;  1YCJ A;  3MZB A;  2LAO A;  4DIG A;  3T9V A;  4PQJ A;  1HSJ A;  5TPA A;  2OX3 A;  3M3L A;  1MQH A;  3V5A A;  1MQI A;  1N3X A;  1RDY A;  1HSL A;  3FGS A;  2PBW A;  4I40 A;  1YZ0 A;  5JTY B;  4KD5 A;  2FYI A;  3R6U A;  4XKR A;  4EUO A;  2D3I A;  2F6G A;  3W9W A;  3DP6 A;  2CZI A;  3TYH A;  1Y3Q A;  1FPG A;  4F1U A;  3K4U A;  5CMM A;  1Q9D A;  4F2O A;  3V83 A;  3K02 A;  1QUL A;  4NMY A;  1N76 A;  3O29 A;  3I5O A;  1FJ6 A;  4RYA A;  4NHB A;  1B5H A;  4FOR A;  1QUJ A;  2A5S A;  3SET A;  2O69 A;  3SEX A;  3UOR A;  4U4S A;  3TDJ A;  4N8G A;  3RTF B;  1JNF A;  3THI A;  1P99 A;  3FJ7 A;  3S9E A;  4R9G A;  1Y9U A;  5ISU A;  1EZP A;  4MLV A;  4ZZE A;  1UTH A;  3VXB A;  3FJG A;  2F3B A;  2W7Y A;  4NF5 A;  2THI A;  3IJO B;  2FNC A;  4P8B A;  3ILU B;  1T0K A;  2RCA A;  3O9P A;  4I3E A;  2HXW A;  3GBB A;  4F31 B;  1LCF A;  1Q35 A;  4FEC A;  4FED A;  4N6D A;  2NOO A;  4HW8 A;  3U8Q A;  3OOA A;  4RNS A;  3OO8 A;  2REG A;  1NUZ A;  2DDK A;  5DYH A;  4MX6 A;  1NV0 A;  3GZG A;  4DLD A;  4KCD A;  2F7C A;  4PAI A;  4LQ5 A;  3S4U A;  2M8C A;  3LSF B;  4X8R A;  3WAF A;  1A7L A;  3KBZ A;  3NOH A;  3QUJ A;  2V25 A;  3T22 A;  1LAG E;  1URS A;  1FPE A;  2H99 A;  3A3U A;  1LBV A;  3H6V A;  4FAT A;  4GWY A;  3QYT A;  1OMP A;  5L9S A;  2OZZ A;  1R9Q A;  4LQ2 A;  1OQH A;  4GWU A;  4IY5 A;  3G3G A;  4FIM A;  5H8S A;  4RY1 A;  1GVC A;  2CZH A;  1H76 A;  1PBQ A;  4H5G A;  4U21 A;  4PC9 A;  4Z0I A;  4C1T A;  2QS3 A;  2Q9T A;  1B32 A;  2KLF A;  2OBG A;  1SYH A;  3MYU A;  4JVD A;  4H8I A;  2Q8M A;  2ANJ A;  1MY3 A;  4MF3 A;  2DOJ A;  1PBP A;  4YKK A;  1AWB A;  1B7H A;  1XVX A;  4MHF A;  5H8H A;  1FBD A;  5I58 A;  3RN8 A;  2VT5 A;  3PUW E;  1DK4 A;  1B5I A;  1LB8 A;  3TTL A;  2I49 A;  3CFX A;  3JYR A;  3MWB A;  3DM0 A;  3CFZ A;  4HCY A;  5I57 B;  1FCK A;  3KBR A;  4QSD A;  1A55 A;  3ODB A;  3RNN A;  3HST A;  1MXW A;  4U1O A;  4QFO A;  5H8F A;  2FA7 A;  4ZEI A;  3ZS6 A;  5L9M A;  3UN6 A;  4GOT A;  4MLQ A;  4DZ1 A;  3TQW A;  1US5 A;  4NF8 A;  1IXG A;  3CR9 A;  4L17 A;  5FHO A;  4H5F A;  4KPT A;  3SEW A;  1LEV A;  5J16 A;  1IQ7 A;  1SI0 A;  2Z8F A;  1B3E A;  3OSR A;  1O64 A;  3EN3 A;  1R6Z A;  1D9Q A;  3O28 A;  5B7D A;  3B7D A;  5ESY A;  1NL5 A;  1B4H A;  4KYS A;  2ONK E;  1M5C A;  4I8C A;  3TTK A;  2OLB A;  4LZ5 A;  2YJP A;  3RYD A;  1I69 A;  4KFQ A;  2DXR A;  2DE4 A;  5I7I A;  3SER A;  3OEN A;  2QS2 A;  1N7W A;  5H8Q B;  1KA0 A;  2FIE A;  1USY H;  1B1X A;  1VFD A;  2Q2A A;  3Q27 A;  4KCC A;  3MJN A;  2XXU A;  1OQG A;  2P1S A;  3G3I A;  3Q25 A;  4ELQ A;  3S9N C;  4R6H A;  3KEI A;  2O1M A;  1FPI A;  2I4B A;  1TWY A;  4M4G A;  4BLA A;  4OWD A;  1IEJ A;  3CG1 A;  4H0W A;  3VLU A;  1B3G A;  5EYH A;  1VSO A;  3ROJ A;  3SKP A;  3FZV A;  1QGX A;  1FTJ A;  4BDL A;  1EU8 A;  3RPL B;  1B0H A;  3O66 A;  3KN8 A;  3T9U A;  3OSQ A;  3TMG A;  3K6X A;  5DEX B;  2F35 A;  2NXO A;  1JP4 A;  4N4U A;  1EYJ A;  3QIM A;  2DWJ A;  3VXC A;  2I6E A;  4BDN A;  5KCJ A;  3HN0 A;  3B50 A;  3TPA A;  4DDD A;  3PUX E;  3K1N A;  3R7X A;  4IO3 A;  4N07 A;  1FTO A;  5AE4 A;  4XXU A;  2DVZ A;  3Q28 A;  3O97 A;  3OEL A;  5AA3 A;  1Y4C A;  4PE3 A;  1NUY A;  1B7U A;  4N15 A;  1FTK A;  1LBC A;  2I4C A;  4F3S A;  2CZL A;  1IIW A;  2QMW A;  4JVI A;  4NGU A;  3UGW A;  1FJ9 A;  1LBB A;  4MNI A;  4R2B A;  5FHM A;  3ISP A;  2H98 A;  4O3A A;  3PD8 A;  2I58 A;  3FJM A;  4GWS A;  4N6K A;  1JW4 A;  5F7V A;  1PEB A;  1MQD A;  4DXC A;  3PMV A;  3EPE A;  2B65 A;  4F3B A;  2Z8E A;  4H45 A;  4LP2 B;  4GL0 A;  5IKB A;  3FVK A;  4O8M A;  1MDQ A;  4NF6 B;  4GWW A;  2XXQ A;  1XT8 A;  1GTK A;  3G7W A;  3PU5 A;  5CMK A;  4IB2 A;  1SBP A;  1NV6 A;  3MST A;  4XIG Q;  1B40 A;  4FEB A;  5DW8 A;  4YZZ A;  2BJJ X;  1NV1 A;  1MDP 1;  4MCO A;  4Q0C A;  3PPR A;  3LUZ A;  1MQG A;  3A09 A;  4LAT A;  4OFJ A;  2ZYN A;  3PUZ E;  3M8U A;  1NH8 A;  5AA4 A;  4OEU A;  2NWJ A;  3FAT A;  3KJT A;  4GWZ A;  5JEI A;  3DLN A;  5LOM A;  4PF8 A;  2ZZX A;  4JVC A;  3HHF A;  4RPN A;  1FBG A;  2V4C A;  1WDN A;  3CSG A;  1B05 A;  4RK9 A;  4TOZ A;  4JB7 A;  4U4X A;  1FTL A;  3O2A A;  3PUY E;  1GR2 A;  1NI9 A;  1LBY A;  3C32 A;  1DPP A;  3T93 B;  2E1S A;  2HFB A;  3QAX A;  1USY E;  2FVZ A;  3VDF A;  5TPA B;  4IR8 A;  2OJT A;  2R71 A;  4H46 A;  4QHQ A;  3RLF E;  3S9M C;  1SDX A;  1Y3N A;  3A29 A;  4JDF A;  3LC8 A;  4GQO A;  1J1N A;  4QFN A;  3IX1 A;  4PDD A;  3H06 B;  5A5X B;  5AA2 D;  1AL3 A;  3MUQ A;  4GRK A;  2ZXT A;  1D4N A;  2F7B A;  3RTW B;  1IMA A;  1MXU A;  2GRV A;  5I59 B;  2HCA A;  4ECF A;  5IAI A;  4YIC A;  4OVR A;  3CRB A;  2XXK A;  4X48 A;  4TLL B;  3SES A;  1P1U A;  3GBA A;  4DXU A;  2V3U A;  2RKM A;  2PFZ A;  3I3V A;  4EF1 A;  3TEP A;  4XF5 A;  3QUF A;  1ZU0 A;  4NQ8 A;  3TTN A;  3MVX A;  3OO9 A;  4PF6 A;  4NF5 B;  5EQ7 A;  1N3W A;  1ZKB A;  3ZSF A;  3T9X B;  1MPD A;  1BKA A;  4P47 A;  2AIX A;  4LUB A;  3SDF A;  4TQU Q;  4NF0 A;  1PB8 A;  3RT6 B;  3E4R A;  2Y84 A;  4Z7E A;  2X7P A;  4MNC A;  2QS1 A;  1Z7M E;  1XHY A;  1SVX B;  3IOV A;  2ESN A;  1FBE A;  3USD A;  1IMC A;  2XD2 A;  1RDX A;  4YKI A;  3TZA A;  5KDT A;  3DP4 A;  4NTL A;  5EQ9 A;  4OFL A;  5CI5 A;  4F3P A;  1RKM A;  4OAN A;  3PGF A;  2ABH A;  2CZK A;  1URG A;  1NUX A;  4O7I A;  1XS5 A;  4PGP A;  1SW1 A;  3EHS A;  1IMB A;  1LFH A;  4G4P A;  1P1O A;  3CI8 A;  4O7M A;  1B9J A;  1M5F A;  4NED A;  4PGN A;  1LBX A;  2O6A A;  4F29 A;  2F5X A;  1IMF A;  1MXZ A;  4HE1 A;  5JK4 A;  4GX3 A;  1MS7 A;  2UVJ A;  2ONR A;  4OVP A;  1NV7 A;  3KOT A;  3VLW A;  5AA2 A;  1NV4 A;  2UXA A;  2F3D A;  3ILT B;  4R73 A;  4AB5 A;  5F24 A;  1UTB A;  2XD3 A;  1FPL A;  1BIY A;  5K2Y A;  3FD3 A;  2DWA A;  4P56 A;  1M5D A;  4OET A;  3G3J A;  4HE0 A;  1FQC A;  2F36 A;  5A5L A;  2ZNS A;  1FPJ A;  1AMF A;  3OO7 A;  5I56 B;  1LFI A;  3VE1 B;  3RT8 A;  4NN3 A;  5JTY A;  4GX6 A;  2O7I A;  3H6T A;  1VE4 A;  4BDM A;  2FBP A;  2P3V A;  4HXV A;  1IME A;  4OVJ A;  4DI4 B;  2Q74 A;  1JET A;  2QMX A;  5H8H B;  5I58 B;  4WEP A;  2O1L A;  1A40 A;  1YYZ A;  2F97 A;  1ZLQ A;  3MZ9 A;  2F34 A;  2R6G E;  3TEL A;  3GXA A;  3CIJ A;  3FXR A;  3GLB A;  4F1Y A;  2X7Q A;  5I2N A;  3MW0 A;  3MQ9 A;  3KC0 A;  1JVX A;  4H6D A;  5LDZ A;  5ITP A;  2AYS A;  1BLF A;  2XHD A;  4ONY A;  2D21 A;  3C34 A;  4N81 A;  2XXI A;  2IEE A;  1B6H A;  2X26 A;  4E0X A;  2B4L A;  2G29 A;  4R75 A;  3B6Q A;  4R74 A;  1O7T A;  2H4I A;  1H45 A;  2V93 A;  5I84 A;  3P7I A;  1JW5 A;  3FVN A;  3H6U A;  1NV5 A;  3HPI A;  1S9T A;  2XX9 A;  1LGB C;  3IOR A;  3DP8 A;  5L9O A;  1QKB A;  4IO4 A;  3A3C A;  1UIV A;  1IUD A;  1NNK A;  3EF7 A;  1URD A;  3H6W A;  4MMP A;  3ONM A;  3IOT A;  2XXP A;  5HPQ A;  3U72 A;  2IA4 A;  5I5P A;  1A99 A;  1TT1 A;  3TCG A;  2AL5 A;  3AXF A;  3CVG A;  4ZEF A;  2H25 A;  3SZP A;  1ZIU A;  3T1B A;  1QJM A;  5H8N A;  2VD2 A;  4UAB A;  4R6Y A;  2GFE A;  4JSO A;  5ET6 A;  1GV8 A;  4HS7 A;  2XWK A;  3W15 C;  3EHT A;  3FVG A;  1MH3 A;  5ELV A;  4NX1 A;  3I6V A;  1CE2 A;  2P2A A;  4DE8 A;  1FBH A;  1FPK A;  5CM6 A;  4G8N A;  4EQ7 A;  5EHM A;  3O6I A;  4Q30 B;  1LLS A;  2D5W A;  4KHZ E;  5CMC A;  2G93 A;  4EQ9 A;  3FBP A;  3MAM A;  4YMB A;  3K1M A;  2PVU A;  3MVZ A;  3RGY A;  1NMU A;  1NFT A;  3IO4 A;  4OEN A;  1P1Q A;  1UIU A;  3U93 A;  3LSL A;  4N6P A;  4KR5 A;  2QVV A;  2XA5 A;  1N84 A;  1KWH A;  1Y3P A;  3TAJ A;  2VPO A;  1M5B A;  5FHN A;  3WAE A;  4ESX A;  2MKZ A;  3EKI A;  3TOD A;  1IXI A;  2O51 A;  3PTY A;  4AB6 A;  4G68 B;  1LST A;  4MBP A;  5I2K B;  2O7U A;  1QW0 A;  1MY1 A;  2ZZW A;  1DOT A;  3TQL A;  2Z8D A;  1RYO A;  5CBS A;  3JV9 A;  4PAF A;  5I57 A;  1B58 A;  5ET8 A;  3QSL A;  4ZE8 A;  2RCB A;  4YB6 A;  4GIZ A;  5BWJ A;  1LAX A;  1NH7 A;  4XKN A;  1SW5 A;  5AA1 A;  4MIJ A;  2O84 X;  3UP9 A;  1D9Y A;  4DCY A;  3S9L C;  3QXM A;  2XXX A;  1Y4T A;  2YLN A;  4PET A;  2ZNT A;  2H9B A;  2HPG A;  2ZYO A;  3UK4 A;  2GH9 A;  1Y20 A;  1SW4 A;  3PPO A;  4LA9 A;  3TCH A;  2UVI A;  3FVO A;  3G3K A;  1P1W A;  4ISU A;  1WOD A;  1IXC A;  2WBB A;  4RJZ A;  1FQE A;  3PD9 A;  3ECR A;  4PFB A;  1TFD A;  3FXQ A;  1ZTY A;  3VVD A;  2I0B A;  4KXP A;  2Y5K A;  3TTM A;  2DYX A;  4JWY A;  3E9X A;  4XKQ A;  1AOV A;  2I3W A;  3LV0 A;  4NF4 A;  1B0L A;  3C4M A;  3FXU A;  3D4G A;  4NAP A;  4IY6 A;  4PFU A;  4POX A;  5IZ3 A;  1RYX A;  5CMB A;  2RC8 A;  4FAJ A;  3TKD A;  3S2V A;  4GBW A;  4Q5T A;  5T3J A;  4OHN A;  4PFI A;  2OWS A;  4G8M A;  2XX8 A;  4G2Z A;  3H7M A;  3T9H B;  4OEV A;  4C0R A;  1FBP A;  2PMS A;  3VV5 A;  1JVY A;  4XKP A;  4R72 A;  2NVU B;  4F22 A;  3U94 A;  1TXF A;  3B8B A;  1Q1K A;  2L5V A;  1QUI A;  5DEX A;  2CMO A;  4YKJ A;  4YMA A;  1NUW A;  1BTJ A;  1B3L A;  2REJ A;  2HQ0 A;  1US4 A;  1B51 A;  3UA8 A;  5ICT A;  1MXX A;  3K6W A;  3VLV A;  1B2H A;  3HV1 A;  3K0V A;  1YXI A;  4G8H A;  2ZNU A;  3BFU A;  2QRY A;  1EZ9 A;  5CBR A;  1B4Z A;  2R9J A;  4HE2 A;  3E79 A;  2HEU A;  3E3K A;  1D3K A;  4JWX A;  3C36 A;  3HCQ A;  4H8J A;  2Q8J A;  5ICQ A;  3N5L A;  3Q29 A;  2ZZV A;  4OER A;  1Y1Z A;  3ZKL A;  5M2V A;  1MG1 A;  4QFL A;  5ET5 A;  2V84 A;  1N7X A;  4KYD A;  3OD7 A;  4ND9 A;  4HCW A;  1ZBM A;  3CHG A;  2WKY A;  3N94 A;  1FQF A;  2Y7K A;  3VFJ A;  1G0I A;  1LB9 A;  1N0T A;  2B3B A;  1ZJL A;  4F2Q A;  3PMW A;  1IMD A;  4OVQ A;  2AL4 A;  1JEU A;  5TU0 A;  2YPN A;  5L8D A;  2PCR A;  3IB0 A;  5TP9 A;  4O3C A;  3C31 A;  4LZ8 A;  1FTM A;  1D9V A;  3FIR A;  4P1L A;  1B5J A;  5IGA A;  1XOC A;  4X1B A;  1B3F A;  3V8X B;  1AH5 A;  1A8E A;  4P1E A;  1KZ8 A;  2PT2 A;  4AS4 A;  3RY3 A;  2QJE A;  4YKP A;  3TCF A;  1I6A A;  2GHA A;  1FPD A;  1ZMG A;  4X9T A;  3HO7 A;  4N13 A;  2I48 A;  4H65 A;  4U22 A;  4X04 A;  4ZED A;  4LVQ A;  1MXY A;  3FAS A;  1XVY A;  1PB7 A;  5HBC A;  3KC1 A;  4OFO A;  4BDO A;  4NE4 A;  4R2F A;  1YTV A;  4ESW A;  1UTH B;  4BDQ A;  2VHA A;  3E78 A;  2RC7 A;  2XXH A;  3SEV A;  4ZEC A;  4H1X A;  3E13 X;  4OVS A;  1DMB A; 
#chains in the Genus database with same CATH homology
 2Z23 A;  1OVB A;  1H43 A;  4F3G A;  4U23 A;  3CFL A;  5DTB A;  4FE8 A;  3W9V A;  2E0S A;  3C33 A;  4GD5 A;  4XTC Q;  5DT6 A;  4RPO A;  1GGG A;  4Q8R A;  1OIB A;  2XXT A;  2OCU A;  3MPK A;  3G3F A;  4NWC A;  3C35 A;  4I1D A;  3UIF A;  5A5X A;  1OLC A;  2HAV A;  4POW A;  4G77 A;  2V3T A;  1F9B A;  4IGT A;  2GHB A;  4F18 A;  1NKX A;  3OXN A;  4P11 A;  4RXL A;  1JQF A;  1Y1M A;  5I59 A;  1EZO A;  3H03 A;  4GLI A;  5I2N B;  1MRP A;  3OO6 A;  2A5T A;  1CB6 A;  3N26 A;  4I9D A;  4IO5 A;  1N04 A;  1B46 A;  2DE2 A;  3IOW A;  2DP8 A;  4IO6 A;  4F1V A;  2ALU A;  3D4C A;  1PC3 A;  1DPE A;  3RPW A;  1JW1 A;  1A8F A;  5J1D A;  4TLM B;  4OZ9 A;  4MH5 A;  4F39 A;  1SW2 A;  4OTE A;  4PFW A;  4ZEB A;  3B6T A;  2HZK A;  3K6V A;  2VP1 A;  2DSF A;  2Y7I A;  1QVS A;  4PFY A;  5DVF A;  3MP6 A;  4UA8 A;  1NNT A;  1L5T A;  4IGR A;  5H8N B;  3LUY A;  4ELP A;  4GXS B;  2ZYK A;  4X1D A;  5EYF A;  4GFR A;  3H3G A;  3BKI B;  3MP1 A;  5H8F B;  1WVJ A;  3MBP A;  4RK2 A;  2QL3 A;  4OQO A;  4NF8 B;  3L6H A;  1MH4 A;  1H3D A;  2QSX A;  3TUS A;  4RA1 A;  2RC9 A;  3LR1 A;  1B7Z A;  2UYF A;  4ZS9 A;  3PUV E;  4K3F A;  3PV0 E;  1SYI A;  4P0G A;  3MP8 A;  3TTR A;  3BFT A;  1BP5 A;  1YAE A;  1NNF A;  5F1Q A;  2F7A A;  3LSW A;  2QPQ A;  1TFA A;  4EQB A;  1POT A;  4BDR A;  4WKM A;  5FTH A;  1R9L A;  5I56 A;  4F19 A;  5BUU A;  4YAH X;  1FQB A;  1P1N A;  3FV1 A;  1VFE A;  3VVF A;  1H44 A;  3MVW A;  1IIT A;  1II5 A;  1SI1 A;  1IXH A;  1Z7N E;  3KOS A;  4EXK A;  3F11 A;  4MFI A;  3EQ1 A;  4ZZA A;  1DSN A;  5CRY A;  4JBZ A;  2DS9 A;  3N6T A;  4YB7 A;  1MM7 A;  1JEV A;  1ATG A;  4EF2 A;  2RIN A;  4QF9 A;  2B3F A;  3B6W A;  4GF8 A;  1I6Q A;  1AIV A;  2ZYM A;  3KGC A;  3OEK A;  5DVJ A;  3EHU A;  4R9F A;  2V3Q A;  4QRZ A;  4EDP A;  4KYE A;  3TFL A;  3C9H A;  5KCJ B;  4NWD A;  2F78 A;  4KQP A;  3DEL B;  2Q89 A;  2XXR A;  1QKA A;  1VR5 A;  4C1U A;  1M5E A;  4QFK A;  4PP0 A;  2VOZ A;  1B52 A;  4NF4 B;  3BBR A;  1B3H A;  3U1O A;  1NNP A;  1MY4 A;  4P0I A;  2VGQ A;  2H5Y A;  2DVC A;  4GXA A;  3MZ1 A;  4KI0 E;  1DTG A;  3KZG A;  1ANF A;  4HTG A;  2F6P A;  3H4Z A;  3O6H A;  5CC2 A;  5HM4 B;  1XC1 A;  4ZE9 A;  3IAZ A;  2XXW A;  3MC2 A;  1SD3 A;  3IR1 A;  4JSD A;  2Y7W A;  2NUV A;  1MQJ A;  1EH3 A;  4O3B A;  3M3F A;  3IB2 A;  1FQA A;  4ZDM A;  4M1V A;  3IL1 B;  1LFG A;  1LAH E;  1S7Y A;  3LSX A;  1LAF E;  3IOU A;  4DXB A;  4YB5 A;  2PYY A;  3RQT A;  3KSX A;  3V89 B;  4UAC A;  2OK2 A;  4PFT A;  4H67 A;  5AA4 B;  3KG2 A;  4OMB A;  1MPC A;  3KN7 A;  3PPQ A;  4I62 A;  2XXV A;  5DVI A;  4ELR A;  4R6K A;  2F8D A;  5ITO A;  2UVG A;  3K2D A;  3KSJ A;  3T66 A;  3KJ7 A;  1QUK A;  5H8Q A;  1LCT A;  1SQY A;  4G68 A;  4OXV A;  4GL8 A;  4OYV A;  4U1Z A;  5I2K A;  2XX7 A;  3IB1 A;  3IO6 A;  5EHS A;  4OES A;  4G68 C;  1MXV A;  1UQW A;  4QSC A;  2UVH A;  2DE3 A;  1IZ1 A;  4AQ4 A;  2RF1 A;  5TP9 B;  1MPB A;  2PT1 A;  1PB9 A;  3L6G A;  1R1N A;  2DQV A;  3SEU A;  3MVY A;  1POY 1;  3CG3 A;  3SEY A;  3T96 B;  3R26 A;  1HSE A;  2UYE A;  4IO2 A;  3IJX B;  3O6G A;  2Z22 A;  1A54 A;  1ELJ A;  3IK6 B;  1OVT A;  1O63 A;  3OEM A;  2HAU A;  3PPN A;  3K00 A;  1FQD A;  3K1P A;  2HZL A;  1MY2 A;  3K01 A;  4JWO A;  4E0W A;  4WXJ A;  4IO7 A;  4LZ7 A;  3FUZ A;  4QSE A;  4DCX A;  2DXY A;  2Q88 A;  1I6B A;  3PMX A;  1OLA A;  1B1H A;  2Y7P A;  4JXI A;  5KZT A;  2ONS A;  2OWT A;  3FV2 A;  4U2R A;  4EXL A;  4PE5 B;  4NF6 A;  3KN3 A;  3QK6 A;  3MPL A;  2QS4 A;  4FJP A;  3U92 A;  5B70 A;  5FTI A;  5KDT B;  4GWO A;  1MY0 A;  2O68 A;  4THI A;  3KFM A;  3CSB A;  4LON B;  3RUM A;  1MM6 A;  3LBS A;  4YU0 A;  4ELO A;  1YPN A;  3M3K A;  4QFP A;  2DWH A;  1PDA A;  2P0S A;  2Q2C A;  3VVE A;  1S50 A;  3ZKK A;  2A5T B;  3JZJ A;  2Y7R A;  2I3V A;  4WED A;  3OMB A;  4GVO A;  3HHG A;  5AA2 B;  3Q26 A;  4ZEK A;  3K6U A;  1FW0 A;  2I0C A;  2VD3 A;  1DTZ A;  5K2X A;  1UTB B;  2DWI A;  3PPP A;  3G3H A;  2ZMB A;  3N6U A;  2PX1 A;  2XXY A;  1YCJ A;  3MZB A;  2LAO A;  4DIG A;  3T9V A;  4PQJ A;  1HSJ A;  5TPA A;  3M3L A;  1MQH A;  3V5A A;  1MQI A;  1N3X A;  1HSL A;  3FGS A;  2PBW A;  5JTY B;  4KD5 A;  2FYI A;  3R6U A;  4XKR A;  4EUO A;  2D3I A;  2F6G A;  3W9W A;  3DP6 A;  3TYH A;  1Y3Q A;  4F1U A;  3K4U A;  5CMM A;  4F2O A;  3V83 A;  3K02 A;  1QUL A;  4NMY A;  1N76 A;  3O29 A;  3I5O A;  4RYA A;  1B5H A;  4FOR A;  1QUJ A;  2A5S A;  3SET A;  2O69 A;  3SEX A;  3UOR A;  4U4S A;  3TDJ A;  3RTF B;  1JNF A;  3THI A;  1P99 A;  3FJ7 A;  3S9E A;  4R9G A;  1Y9U A;  5ISU A;  1EZP A;  4MLV A;  4ZZE A;  1UTH A;  3VXB A;  3FJG A;  2W7Y A;  4NF5 A;  2THI A;  3IJO B;  2FNC A;  3ILU B;  1T0K A;  2RCA A;  3O9P A;  2HXW A;  3GBB A;  4F31 B;  1LCF A;  1Q35 A;  4FEC A;  4FED A;  2NOO A;  4HW8 A;  3U8Q A;  3OOA A;  4RNS A;  3OO8 A;  2REG A;  5DYH A;  3GZG A;  4DLD A;  4KCD A;  2F7C A;  4LQ5 A;  3S4U A;  2M8C A;  3LSF B;  3WAF A;  1A7L A;  3QUJ A;  2V25 A;  3T22 A;  1LAG E;  1URS A;  2H99 A;  3A3U A;  3H6V A;  4FAT A;  3QYT A;  1OMP A;  5L9S A;  2OZZ A;  1R9Q A;  4LQ2 A;  1OQH A;  4IY5 A;  3G3G A;  4FIM A;  5H8S A;  4RY1 A;  1GVC A;  1H76 A;  1PBQ A;  4H5G A;  4U21 A;  4Z0I A;  4C1T A;  2QS3 A;  2Q9T A;  1B32 A;  2KLF A;  2OBG A;  1SYH A;  4H8I A;  2ANJ A;  1MY3 A;  4MF3 A;  2DOJ A;  1PBP A;  4YKK A;  1B7H A;  1XVX A;  5H8H A;  5I58 A;  3RN8 A;  3PUW E;  1B5I A;  1LB8 A;  3TTL A;  2I49 A;  3CFX A;  3JYR A;  3MWB A;  3DM0 A;  3CFZ A;  4HCY A;  5I57 B;  1FCK A;  3KBR A;  4QSD A;  1A55 A;  3ODB A;  3RNN A;  3HST A;  1MXW A;  4U1O A;  4QFO A;  5H8F A;  2FA7 A;  4ZEI A;  3ZS6 A;  5L9M A;  3UN6 A;  4GOT A;  4MLQ A;  4DZ1 A;  3TQW A;  1US5 A;  4NF8 A;  1IXG A;  3CR9 A;  4L17 A;  5FHO A;  4H5F A;  4KPT A;  3SEW A;  1IQ7 A;  1SI0 A;  2Z8F A;  1B3E A;  3OSR A;  1O64 A;  3EN3 A;  1R6Z A;  3O28 A;  5B7D A;  3B7D A;  1NL5 A;  1B4H A;  4KYS A;  2ONK E;  1M5C A;  4I8C A;  3TTK A;  2OLB A;  4LZ5 A;  2YJP A;  1I69 A;  4KFQ A;  2DXR A;  2DE4 A;  3SER A;  3OEN A;  2QS2 A;  1N7W A;  5H8Q B;  1USY H;  1B1X A;  1VFD A;  2Q2A A;  3Q27 A;  4KCC A;  3MJN A;  2XXU A;  1OQG A;  2P1S A;  3G3I A;  3Q25 A;  4ELQ A;  3S9N C;  4R6H A;  3KEI A;  2O1M A;  2I4B A;  1TWY A;  4M4G A;  4BLA A;  4OWD A;  1IEJ A;  3CG1 A;  4H0W A;  3VLU A;  1B3G A;  1VSO A;  3SKP A;  3FZV A;  1FTJ A;  4BDL A;  1EU8 A;  1B0H A;  3O66 A;  3KN8 A;  3T9U A;  3OSQ A;  3TMG A;  3K6X A;  5DEX B;  2F35 A;  2NXO A;  3QIM A;  2DWJ A;  3VXC A;  2I6E A;  4BDN A;  5KCJ A;  3HN0 A;  3TPA A;  4DDD A;  3PUX E;  3K1N A;  3R7X A;  4IO3 A;  4N07 A;  1FTO A;  5AE4 A;  4XXU A;  2DVZ A;  3Q28 A;  3O97 A;  3OEL A;  5AA3 A;  1Y4C A;  1B7U A;  1FTK A;  1LBC A;  2I4C A;  4F3S A;  2CZL A;  1IIW A;  2QMW A;  3UGW A;  1LBB A;  4R2B A;  5FHM A;  2H98 A;  4O3A A;  3PD8 A;  2I58 A;  3FJM A;  1JW4 A;  5F7V A;  1PEB A;  1MQD A;  4DXC A;  3PMV A;  3EPE A;  2B65 A;  4F3B A;  2Z8E A;  4LP2 B;  4GL0 A;  5IKB A;  3FVK A;  1MDQ A;  4NF6 B;  2XXQ A;  1XT8 A;  1GTK A;  3G7W A;  3PU5 A;  5CMK A;  4IB2 A;  1SBP A;  4XIG Q;  1B40 A;  4FEB A;  4YZZ A;  2BJJ X;  1MDP 1;  4Q0C A;  3PPR A;  1MQG A;  3A09 A;  4LAT A;  4OFJ A;  2ZYN A;  3PUZ E;  3M8U A;  1NH8 A;  5AA4 A;  4OEU A;  2NWJ A;  3FAT A;  3KJT A;  5JEI A;  3DLN A;  5LOM A;  3HHF A;  4RPN A;  1WDN A;  3CSG A;  1B05 A;  4RK9 A;  4TOZ A;  4JB7 A;  4U4X A;  1FTL A;  3O2A A;  3PUY E;  1GR2 A;  3C32 A;  1DPP A;  3T93 B;  2E1S A;  2HFB A;  3QAX A;  1USY E;  3VDF A;  5TPA B;  2OJT A;  2R71 A;  4QHQ A;  3RLF E;  3S9M C;  1SDX A;  1Y3N A;  4JDF A;  3LC8 A;  4GQO A;  1J1N A;  4QFN A;  3IX1 A;  3H06 B;  5A5X B;  5AA2 D;  1AL3 A;  3MUQ A;  4GRK A;  2ZXT A;  1D4N A;  2F7B A;  3RTW B;  1MXU A;  2GRV A;  5I59 B;  2HCA A;  4ECF A;  5IAI A;  4YIC A;  3CRB A;  4X48 A;  4TLL B;  3SES A;  1P1U A;  3GBA A;  4DXU A;  2V3U A;  2RKM A;  3I3V A;  4EF1 A;  3TEP A;  3QUF A;  1ZU0 A;  3TTN A;  3MVX A;  3OO9 A;  4NF5 B;  1N3W A;  1ZKB A;  3ZSF A;  3T9X B;  1MPD A;  1BKA A;  2AIX A;  4LUB A;  3SDF A;  4TQU Q;  1PB8 A;  3RT6 B;  3E4R A;  2Y84 A;  4Z7E A;  2X7P A;  2QS1 A;  1Z7M E;  1XHY A;  1SVX B;  3IOV A;  2ESN A;  3USD A;  2XD2 A;  4YKI A;  3TZA A;  5KDT A;  3DP4 A;  4NTL A;  4OFL A;  5CI5 A;  4F3P A;  1RKM A;  3PGF A;  2ABH A;  1URG A;  1XS5 A;  1SW1 A;  3EHS A;  1LFH A;  4G4P A;  1P1O A;  3CI8 A;  1B9J A;  1M5F A;  4NED A;  2O6A A;  4F29 A;  2F5X A;  1MXZ A;  5JK4 A;  1MS7 A;  2UVJ A;  2ONR A;  3KOT A;  3VLW A;  5AA2 A;  2UXA A;  3ILT B;  4R73 A;  4AB5 A;  1UTB A;  2XD3 A;  1BIY A;  5K2Y A;  3FD3 A;  2DWA A;  1M5D A;  4OET A;  3G3J A;  1FQC A;  2F36 A;  2ZNS A;  1AMF A;  3OO7 A;  5I56 B;  1LFI A;  3VE1 B;  3RT8 A;  5JTY A;  2O7I A;  3H6T A;  1VE4 A;  4BDM A;  4OVJ A;  1JET A;  2QMX A;  5H8H B;  5I58 B;  4WEP A;  2O1L A;  1A40 A;  2F97 A;  1ZLQ A;  3MZ9 A;  2F34 A;  2R6G E;  3TEL A;  3GXA A;  3CIJ A;  3FXR A;  3GLB A;  4F1Y A;  2X7Q A;  5I2N A;  3MW0 A;  3MQ9 A;  1JVX A;  4H6D A;  5ITP A;  2AYS A;  1BLF A;  2XHD A;  4ONY A;  2D21 A;  3C34 A;  2XXI A;  2IEE A;  1B6H A;  2X26 A;  4E0X A;  2G29 A;  4R75 A;  3B6Q A;  4R74 A;  1O7T A;  2H4I A;  1H45 A;  2V93 A;  5I84 A;  3P7I A;  1JW5 A;  3FVN A;  3H6U A;  3HPI A;  1S9T A;  2XX9 A;  1LGB C;  3IOR A;  3DP8 A;  5L9O A;  1QKB A;  4IO4 A;  3A3C A;  1UIV A;  1IUD A;  1NNK A;  3EF7 A;  1URD A;  3H6W A;  3ONM A;  3IOT A;  2XXP A;  5HPQ A;  3U72 A;  2IA4 A;  1A99 A;  1TT1 A;  3TCG A;  2AL5 A;  3AXF A;  3CVG A;  4ZEF A;  2H25 A;  1ZIU A;  1QJM A;  5H8N A;  2VD2 A;  4R6Y A;  2GFE A;  4JSO A;  1GV8 A;  4HS7 A;  3W15 C;  3EHT A;  3FVG A;  1MH3 A;  5ELV A;  3I6V A;  1CE2 A;  2P2A A;  4DE8 A;  5CM6 A;  4G8N A;  4EQ7 A;  5EHM A;  3O6I A;  4Q30 B;  1LLS A;  2D5W A;  4KHZ E;  5CMC A;  2G93 A;  4EQ9 A;  3MAM A;  4YMB A;  3K1M A;  2PVU A;  3MVZ A;  3RGY A;  1NMU A;  1NFT A;  3IO4 A;  4OEN A;  1P1Q A;  1UIU A;  3U93 A;  3LSL A;  4N6P A;  4KR5 A;  1N84 A;  1KWH A;  1Y3P A;  3TAJ A;  1M5B A;  5FHN A;  3WAE A;  4ESX A;  3TOD A;  1IXI A;  2O51 A;  4AB6 A;  4G68 B;  1LST A;  4MBP A;  5I2K B;  2O7U A;  1QW0 A;  1MY1 A;  1DOT A;  3TQL A;  2Z8D A;  1RYO A;  5CBS A;  3JV9 A;  5I57 A;  1B58 A;  3QSL A;  4ZE8 A;  2RCB A;  4YB6 A;  4GIZ A;  5BWJ A;  1LAX A;  1NH7 A;  4XKN A;  1SW5 A;  5AA1 A;  2O84 X;  3UP9 A;  1D9Y A;  4DCY A;  3S9L C;  3QXM A;  2XXX A;  1Y4T A;  2YLN A;  4PET A;  2ZNT A;  2H9B A;  2ZYO A;  3UK4 A;  2GH9 A;  1Y20 A;  1SW4 A;  3PPO A;  4LA9 A;  3TCH A;  2UVI A;  3FVO A;  3G3K A;  1P1W A;  4ISU A;  1WOD A;  1IXC A;  4RJZ A;  1FQE A;  3PD9 A;  3ECR A;  1TFD A;  3FXQ A;  1ZTY A;  3VVD A;  2I0B A;  3TTM A;  2DYX A;  4JWY A;  3E9X A;  4XKQ A;  1AOV A;  2I3W A;  4NF4 A;  1B0L A;  3C4M A;  3FXU A;  3D4G A;  4IY6 A;  4PFU A;  4POX A;  1RYX A;  5CMB A;  2RC8 A;  4FAJ A;  3TKD A;  3S2V A;  4Q5T A;  4OHN A;  2OWS A;  4G8M A;  2XX8 A;  4G2Z A;  3H7M A;  3T9H B;  4OEV A;  4C0R A;  2PMS A;  3VV5 A;  1JVY A;  4XKP A;  4R72 A;  2NVU B;  4F22 A;  3U94 A;  1TXF A;  1Q1K A;  1QUI A;  5DEX A;  2CMO A;  4YKJ A;  4YMA A;  2REJ A;  1BTJ A;  1B3L A;  2HQ0 A;  1US4 A;  1B51 A;  3UA8 A;  5ICT A;  1MXX A;  3K6W A;  3VLV A;  1B2H A;  3HV1 A;  3K0V A;  4G8H A;  2ZNU A;  3BFU A;  2QRY A;  1EZ9 A;  5CBR A;  1B4Z A;  2R9J A;  2HEU A;  3E3K A;  1D3K A;  4JWX A;  3C36 A;  3HCQ A;  4H8J A;  2Q8J A;  5ICQ A;  3N5L A;  3Q29 A;  4OER A;  3ZKL A;  1Y1Z A;  5M2V A;  1MG1 A;  4QFL A;  2V84 A;  1N7X A;  4KYD A;  3OD7 A;  4ND9 A;  4HCW A;  1ZBM A;  2WKY A;  3N94 A;  1FQF A;  2Y7K A;  3VFJ A;  1N0T A;  1LB9 A;  2B3B A;  1ZJL A;  4F2Q A;  3PMW A;  2AL4 A;  1JEU A;  5TU0 A;  2YPN A;  5L8D A;  3IB0 A;  5TP9 A;  4O3C A;  3C31 A;  4LZ8 A;  1FTM A;  1D9V A;  3FIR A;  1B5J A;  1XOC A;  4X1B A;  1B3F A;  3V8X B;  1AH5 A;  1A8E A;  2PT2 A;  3RY3 A;  2QJE A;  4YKP A;  3TCF A;  1I6A A;  2GHA A;  1ZMG A;  4X9T A;  3HO7 A;  4N13 A;  2I48 A;  4H65 A;  4U22 A;  4ZED A;  4LVQ A;  1MXY A;  3FAS A;  1XVY A;  1PB7 A;  5HBC A;  4OFO A;  4BDO A;  4NE4 A;  4R2F A;  1YTV A;  4ESW A;  1UTH B;  4BDQ A;  2VHA A;  2RC7 A;  2XXH A;  3SEV A;  4ZEC A;  4H1X A;  3E13 X;  1DMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...