5K2XA

Crystal structure of m. tuberculosis uspc (tetragonal crystal form)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
414
structure length
414
Chain Sequence
PRGGKIVVTVRLWDEPIAAAYRQSFAAFTRSHPDIEVRTNLVAYSTYFETLRTDVAGGSADDIFWLSNAYFAAYADSGRLMKIQTDAADWEPAVVDQFTRSGVLWGVPQLTDAGIAVFYNADLLAAAGVDPTQVDNLRWSRGDDDTLRPMLARLTVDADGRTANTPGFDARRVRQWGYNAANDPQAIYLNYIGSAGGVFQRDGKFAFDNPGAIEAFRYLVGLINDDHVAPPASDTNDNGDFSRNQFLAGKMALFQSGTYSLAPVARDALFHWGVAMLPAGPAGRVSVTNGIAAAGNSASKHPDAVRQVLAWMGSTEGNSYLGRHGAAIPAVLSAQPVYFDYWSARGVDVTPFFAVLNGPRIAAPGGAGFAAGQQALEPYFDEMFLGRGDVTTTLRQAQAAANAATQRKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sugar ABC transporter permease
publication title Structural and functional analysis of the solute-binding protein UspC from Mycobacterium tuberculosis that is specific for amino sugars.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transport protein
total genus 141
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5k2xA00
2Z8FA 3PUZE 2Q8JA 2I3WA 2F34A 2RC7A 2O7IA 2QL3A 2ZYNA 4IO7A 2DVCA 4KHZE 2FNCA 1LFHA 4AB6A 2M8CA 2HAVA 3RTWB 3SEXA 1SVXB 3MP1A 1H43A 2E0SA 3GXAA 4PETA 3K6VA 1OLAA 1MQGA 1M5EA 3FJMA 5LOMA 3LSFB 3VE1B 3MP6A 1PBPA 4OXVA 1P1UA 1ELJA 1I6BA 3CIJA 2AL5A 1UQWA 4KYDA 3CR9A 5L9SA 1B5IA 3MJNA 4GL0A 1FQDA 4G68B 3GZGA 4BDOA 4KQPA 3U8QA 3Q29A 2I6EA 5JEIA 1POY1 4ZEKA 3FXUA 3OO6A 5TU0A 4F19A 3K4UA 3WAEA 4N07A 4QFOA 4YB6A 1B1HA 5DEXA 3KZGA 1OVTA 3RPWA 3IOTA 3HHGA 1SD3A 2GHBA 4NMYA 2F97A 1NH8A 3TFLA 5I84A 4PP0A 3H6UA 3IORA 3Q26A 1SI1A 1B40A 2O1MA 3CG1A 2ONKE 5H8QA 3AXFA 4YICA 3IO6A 4XXUA 1DTGA 5FHNA 1PB9A 4KD5A 1O64A 3EF7A 4JWYA 2I48A 2H5YA 5TPAA 5A5XA 5EHSA 3CVGA 5KCJB 1TWYA 2OWTA 4WEPA 2V25A 2PX1A 3OEMA 3K6WA 2O69A 1Z7NE 1EZ9A 1ZTYA 4H5GA 3IOWA 4IO6A 4FJPA 1IXGA 2Z23A 3IB0A 1D4NA 2UYEA 3TMGA 4NF5B 4YMAA 3C33A 1S9TA 4I9DA 1MXYA 1B4ZA 4R72A 3O28A 3FATA 3RTFB 3SESA 2O7UA 1WODA 1MXZA 1GGGA 2XD3A 5ELVA 3FXRA 3QAXA 2P0SA 5H8NB 1JQFA 3E13X 1GR2A 3H3GA 3O9PA 3KG2A 4JSOA 1Y4CA 1QKAA 4OEVA 3U94A 1B1XA 3U72A 3H7MA 1FQBA 1QUIA 1ZMGA 4H6DA 3BKIB 2RCAA 3M3LA 3N6UA 1MY3A 5FTHA 1YCJA 3RN8A 3W15C 3T9XB 4THIA 1TXFA 1S50A 4LQ5A 1RYXA 2O84X 1OIBA 4NWCA 3H4ZA 1NNTA 4DCXA 2HAUA 3S2VA 3VFJA 4G68C 4IO5A 1B51A 2HQ0A 3TPAA 1L5TA 1JEUA 2I0CA 3PPRA 4IO2A 3H6VA 1HSLA 1OQGA 4QF9A 4O3CA 1JW5A 2YPNA 5ISUA 3PMXA 3OMBA 3UA8A 4F2QA 1A8FA 2B3FA 1P1NA 3VXBA 1R1NA 1M5BA 5ICQA 3CFZA 1B7UA 2VD2A 1Z7ME 4FEBA 3JYRA 2O68A 4KCCA 1WDNA 3IX1A 2V3TA 2RC8A 2CMOA 3MVWA 4JDFA 1URDA 3SEUA 1QULA 3QSLA 4Q30B 1P1OA 3C31A 2F78A 1ANFA 4C1UA 4ZEBA 3ECRA 4FORA 2ANJA 2ZYMA 2QRYA 3FJ7A 3P7IA 3SEYA 3OSQA 3ZKKA 4NF6B 1H76A 1M5DA 4K3FA 4NTLA 3L6HA 1GVCA 3O29A 5KDTB 3C9HA 4TLLB 3SDFA 3FJGA 5L9OA 4O3BA 5DVFA 4Q8RA 2GH9A 5H8HA 4ELOA 3MBPA 3PPNA 3G3IA 2UVHA 1Y3PA 3CG3A 3O97A 1B3FA 3QK6A 2H98A 2XXTA 4XKQA 1A54A 1Y9UA 1OVBA 3UP9A 1XT8A 2OBGA 4F39A 4OYVA 5JK4A 2F5XA 4QFLA 1H3DA 3LSXA 1QVSA 5AA3A 3KSJA 1N84A 4G77A 4KYSA 1JVYA 3G3KA 4GF8A 4ECFA 5H8SA 2Z8EA 2BJJX 2ZNTA 2XD2A 3DP6A 2QMWA 1A8EA 2XX7A 1OQHA 1BKAA 1Q35A 2G29A 2XXYA 4ND9A 4I62A 3FV1A 2RINA 3MC2A 3ZS6A 3GBAA 2PBWA 3PUWE 3VVFA 3N5LA 5BUUA 1DPPA 3LBSA 1B6HA 3HPIA 1R9QA 5H8FA 2OCUA 4XKPA 1MXUA 5AA2A 4O3AA 3SEWA 1NNPA 1TFAA 2RCBA 4ZDMA 4ZZEA 2AL4A 3KN8A 3KJ7A 2XXWA 3SERA 3MZ9A 3N94A 3RNNA 2F6PA 3VLVA 1QKBA 4MLVA 3FVNA 1B7ZA 1LCFA 1XHYA 3S9EA 3TCHA 2WKYA 3U93A 3TCFA 1SW1A 3SKPA 5EHMA 4OZ9A 1AOVA 4P11A 4JB7A 4U23A 4YB5A 4ONYA 1UTHA 2VOZA 3IK6B 1NNFA 3T9UA 2DWJA 2DXYA 1LFGA 4ZZAA 4R9GA 4OHNA 1SW5A 3EHUA 5I2KB 2Y7WA 3BFUA 1URGA 1AMFA 1CB6A 1JEVA 3S9LC 3FV2A 1FTKA 3D4GA 3OEKA 4BDRA 1WVJA 3KGCA 3TAJA 2Q88A 2YJPA 4RY1A 3BFTA 2V93A 4MBPA 1VR5A 2X7QA 2AYSA 4DE8A 2F35A 1BTJA 1H44A 2DE3A 5ITOA 4GVOA 4NF8B 5F7VA 1ZLQA 1A40A 3PUYE 1MPCA 2I4CA 3Q27A 4RK2A 4X1DA 3CFLA 2DWAA 1POTA 5K2YA 3K02A 3ILTB 1O63A 2DE4A 4LATA 4U2RA 2ZMBA 5IKBA 1US4A 3PD8A 1MM7A 4KI0E 3O66A 5I56B 1LCTA 1DPEA 4RK9A 3IJOB 3ILUB 3CSBA 2A5SA 5CMMA 3H06B 3T9VA 4RPNA 2I4BA 4LA9A 5B7DA 4F1UA 1FQCA 4RA1A 1MPDA 2F8DA 3QUFA 2PT2A 4Z0IA 1ZJLA 1N04A 1MRPA 4ZE9A 1OMPA 4H65A 3IB2A 2NVUB 3HO7A 5CMCA 4DCYA 1SYHA 3DP8A 3MPKA 4G68A 4EQBA 4KCDA 3UN6A 1N3XA 3R6UA 3RQTA 2Y7RA 5H8QB 5CMKA 3CFXA 3FVKA 1B58A 2R71A 1LAFE 4EF1A 3UGWA 3QUJA 5DTBA 3TTLA 3IJXB 3UIFA 5HM4B 4R75A 2ONRA 4IO4A 3RT8A 3TTRA 5AE4A 4GL8A 4U4XA 1AL3A 3HN0A 3E3KA 4OENA 4AQ4A 4FE8A 2VD3A 2RF1A 1TT1A 3OD7A 3CRBA 3TTMA 1US5A 3M8UA 3T93B 2O6AA 1Y3QA 5B70A 3TZAA 3FIRA 3N6TA 4IB2A 3RY3A 3T22A 2QSXA 2Q9TA 3T9HB 1D9VA 1PEBA 5KCJA 1B5JA 3HV1A 2DWIA 4F3SA 3FUZA 5FHOA 3R7XA 2VP1A 4F3PA 1YAEA 1B3EA 4R73A 2THIA 3PGFA 5CMBA 4BDQA 3KBRA 1MQJA 4NF5A 4POXA 1UIVA 2X7PA 5CM6A 4MH5A 2XXXA 1UTBB 4DXCA 1B46A 2XXUA 3TUSA 4POWA 4H0WA 2V3QA 5FTIA 4LP2B 4QFKA 2KLFA 3R26A 4X1BA 1FTOA 1PB7A 3K1MA 4YKJA 3K00A 1QW0A 4EQ9A 5I2NB 5H8NA 4HTGA 4M1VA 4PFYA 4ZS9A 3VDFA 4LZ5A 1MQHA 3IR1A 4XKNA 5I57B 5I58A 2NUVA 3FGSA 4DDDA 1LAHE 4YKKA 2QS1A 3I5OA 1B32A 1AH5A 4HCYA 3EN3A 1N7XA 4EXKA 3W9WA 3IOVA 4FAJA 4OMBA 2AIXA 3W9VA 1NKXA 1SW2A 2NOOA 2XXVA 1MXVA 2A5TB 4GOTA 4BDNA 3K0VA 4F1VA 2H25A 4G2ZA 4FIMA 5KZTA 1IXCA 4PFUA 2PT1A 1B3HA 1XVYA 2YLNA 3ODBA 4GFRA 1QJMA 5JTYB 3MVYA 5K2XA 4IO3A 1MPBA 2DSFA 4OERA 4HW8A 3C34A 3JZJA 3B7DA 4LVQA 4JWOA 5I59B 2DYXA 3QYTA 2DP8A 4RYAA 1QUKA 4ELRA 1F9BA 2ZXTA 4XTCQ 4TQUQ 4LQ2A 1Y1ZA 1HSEA 4H1XA 2OWSA 3Q25A 2E1SA 2NXOA 2ZYOA 4XKRA 2OLBA 4QSDA 4EQ7A 5TP9B 5FHMA 4ELQA 3RT6B 4RXLA 1JW1A 2O1LA 4QFNA 3IOUA 1T0KA 1LB9A 3A3CA 3M3FA 3FVOA 1XVXA 1S7YA 4F3GA 4R6HA 1SI0A 1XOCA 3EQ1A 4JBZA 4NF6A 2QMXA 1QUJA 2OJTA 4OFOA 5KDTA 3PPQA 4BDMA 2ESNA 1B2HA 2NWJA 2IEEA 5EYFA 3OELA 2Z22A 3MZBA 3G3GA 3QIMA 3PV0E 2FYIA 2P1SA 1JNFA 4HS7A 4KR5A 3S4UA 1B5HA 1XC1A 4IY5A 2RC9A 2QS4A 4XIGQ 3C36A 4G8MA 4MLQA 3VXCA 2VHAA 2R9JA 4NEDA 3Q28A 1DOTA 3V8XB 3B6QA 4DXBA 3OENA 2ABHA 2QS3A 4YAHX 3MW0A 1LAXA 3UORA 1ZBMA 1B05A 3OXNA 2CZLA 4F18A 4L17A 4GRKA 4NF4A 3K2DA 4Z7EA 2HEUA 3MQ9A 3PMWA 4F22A 1MG1A 3TYHA 2G93A 3KOTA 3TDJA 4F3BA 2W7YA 3ZSFA 4OWDA 4JWXA 3FZVA 2OZZA 2XHDA 5AA4B 2PVUA 3H6TA 2R6GE 4F1YA 1DSNA 3KN3A 1B7HA 4QSCA 1N0TA 1Y20A 2RKMA 4GQOA 2XXIA 4DXUA 1BIYA 3BBRA 1TFDA 4X9TA 1CE2A 3RGYA 1A7LA 3TQWA 5CBRA 4FECA 3IL1B 5DT6A 2P2AA 1NL5A 3PMVA 2ZYKA 4E0XA 2REJA 4Q5TA 3EHSA 4YMBA 1JVXA 1II5A 1LGBC 4ZEIA 3E9XA 3FD3A 1D3KA 1A55A 3OO7A 4U22A 3DLNA 2DQVA 3E4RA 2I49A 4PFWA 5I2KA 1LBBA 3A3UA 1GV8A 4ESWA 5CI5A 2OK2A 3O6HA 1FTJA 3LC8A 1HSJA 4M4GA 5AA2D 1BP5A 1GTKA 3K01A 4YZZA 4C0RA 3TTKA 3VV5A 4KPTA 1SQYA 4GLIA 1AIVA 5M2VA 1Y4TA 4NF8A 1O7TA 1SW4A 4H67A 1NMUA 4R6YA 2H9BA 1VSOA 2B65A 3T96B 1IIWA 3F11A 4KFQA 5IAIA 1H45A 4BDLA 5L8DA 1R6ZA 4F31B 2Z8DA 4WKMA 4U1OA 4FATA 4U1ZA 2LAOA 4GIZA 3B6WA 3MVZA 5I56A 1SBPA 1XS5A 3OO8A 2Y7PA 4F29A 4OFJA 5HPQA 1DTZA 3PU5A 3HSTA 5DEXB 4YKIA 2Q2AA 4QFPA 2HFBA 4FEDA 3VLUA 4F2OA 3WAFA 3TTNA 3VVDA 3H6WA 1LFIA 1R9LA 1FCKA 4G8NA 1I69A 2O51A 3KN7A 4ISUA 4PQJA 1IXIA 2HZLA 1IUDA 3UK4A 1P1QA 3HHFA 1D9YA 2F7AA 4G4PA 2DVZA 1EZPA 1MS7A 3K1NA 4IGRA 4JSDA 1FQAA 1NNKA 3TCGA 1ZKBA 5L9MA 4OVJA 2Y84A 5TPAB 2Y7KA 4UA8A 4OFLA 2IA4A 5A5XB 1MDP1 3I6VA 1MQIA 1IXHA 3PPPA 3T66A 3MPLA 4DZ1A 4TOZA 3S9NC 4NE4A 1PDAA 1MH3A 2GFEA 2B3BA 4EDPA 1M5FA 1P1WA 1VFDA 4EXLA 1MH4A 4H5FA 4GWOA 3TODA 1Y1MA 3V5AA 1IZ1A 5DYHA 3PD9A 3DELB 4PE5B 2D5WA 3G3JA 3K6UA 3JV9A 3OOAA 2HXWA 1SDXA 1Y3NA 4G8HA 1NH7A 3VLWA 3IAZA 1USYH 2V3UA 3FVGA 3MWBA 1NFTA 4H8JA 4HCWA 2HZKA 3PUXE 2XXHA 3O6GA 4LZ8A 3LUYA 1M5CA 1B3LA 1IEJA 3V83A 2I0BA 2ZNUA 4EUOA 4ZEDA 4P0GA 4U21A 4ZEFA 2Q2CA 2F7BA 5F1QA 1BLFA 3I3VA 3O6IA 1UTBA 5I58B 1LLSA 3MP8A 2XX9A 2DS9A 4LONB 3KFMA 4X48A 2UYFA 5J1DA 3RLFE 2F36A 1MY0A 2D3IA 2ONSA 1EZOA 2PYYA 5I2NA 1SYIA 4TLMB 4R2FA 2D21A 3N26A 1FQFA 4DLDA 4YB7A 1RYOA 4JXIA 4OESA 1PBQA 5I57A 3L6GA 1IITA 3USDA 2HCAA 3KSXA 2X26A 4P0IA 4NWDA 3B6TA 4R6KA 3PUVE 2F6GA 2A5TA 2QS2A 2XXPA 4OETA 1URSA 2UVGA 4I8CA 3K1PA 4WEDA 1B0HA 5JTYA 3A09A 1I6QA 2H4IA 3LSLA 2GRVA 3M3KA 4GXAA 4Q0CA 4R2BA 4H8IA 2PMSA 1Q1KA 4LZ7A 4EF2A 1FQEA 2XXQA 3KOSA 3G7WA 5I59A 4YKPA 4ZECA 3LR1A 3FXQA 2F7CA 3HCQA 3CI8A 3IO4A 2VGQA 4IY6A 2ZNSA 2V84A 3DP4A 4WXJA 5ICTA 3OSRA 4GXSB 5AA1A 1JW4A 1ATGA 1IQ7A 1MM6A 4N13A 4GD5A 4UACA 4U4SA 5H8HB 3OO9A 3PPOA 1P99A 4PFTA 3V89B 1MY2A 3CSGA 4RNSA 4RPOA 2DE2A 1LB8A 5TP9A 3EHTA 1EH3A 3IB1A 1MY1A 4LUBA 5ITPA 3VVEA 3LSWA 1MQDA 2DOJA 2XXRA 4AB5A 4I1DA 1LAGE 1MXXA 5HBCA 3MUQA 3K6XA 3C35A 4OQOA 3D4CA 3S9MC 3U1OA 2XX8A 1FW0A 1MDQA 2Y7IA 3GLBA 2I3VA 4DIGA 2FA7A 4KYEA 5CRYA 5CBSA 1B9JA 1B4HA 2UVJA 1ZIUA 3U92A 1EU8A 1FTMA 1UIUA 4BLAA 4QHQA 3DM0A 1YTVA 4ELPA 2Q89A 5DVJA 4NF4B 1N7WA 2QJEA 1A99A 4R9FA 3TEPA 5H8FB 3EPEA 4N6PA 5AA2B 1ZU0A 4C1TA 5BWJA 2I58A 3G3HA 2GHAA 2ALUA 1J1NA 1LBCA 1VFEA 4ESXA 1USYE 2QPQA 4YU0A 4E0WA 4OEUA 3H03A 3TELA 2REGA 3RUMA 3QXMA 4IGTA 1PC3A 1YPNA 3GBBA 1RKMA 1B52A 1FTLA 2UXAA 1N76A 1DMBA 1N3WA 4R74A 1B0LA 4ZE8A 5DVIA 5AA4A 3O2AA 3FASA 1MXWA 1UTHB 4OTEA 4MF3A 3C32A 3TKDA 2DWHA 4QRZA 2UVIA 5CC2A 1OLCA 3TQLA 1I6AA 3KEIA 3MZ1A 3C4MA 1VE4A 1KWHA 3ONMA 3SEVA 4QSEA 2DXRA 3KJTA 1PB8A 3MVXA 3MAMA 4MFIA 3THIA 1LSTA 1B3GA 3SETA 3ZKLA 3G3FA 2H99A 1JETA 1MY4A 4RJZA
chains in the Genus database with same CATH superfamily
3FXBA 2Z8FA 3PUZE 2HHMA 2Q8JA 2I3WA 2F34A 2FIXA 2RC7A 2O7IA 1NV1A 4N15A 2QL3A 2ZYNA 4IO7A 2DVCA 4KHZE 2Q74A 2FNCA 1LFHA 4AB6A 3T1BA 1RDZA 2M8CA 2HAVA 3RTWB 3SEXA 1NUWA 1SVXB 3MP1A 1H43A 2E0SA 3GXAA 4PETA 3K6VA 1OLAA 1MQGA 3RYDA 1M5EA 3FJMA 5LOMA 3LSFB 4GWWA 3VE1B 3MP6A 1PBPA 4OXVA 5EYHA 3LUZA 1P1UA 1FTAA 1ELJA 1I6BA 3CIJA 2QFLA 2AL5A 1UQWA 4KYDA 1G0IA 5F24A 3CR9A 5L9SA 1B5IA 1NI9A 3MJNA 3D1RA 4GL0A 1FQDA 4G68B 3GZGA 4BDOA 4KQPA 3U8QA 3Q29A 2FIEA 2I6EA 5JEIA 1POY1 4ZEKA 3FXUA 3BIGA 3OO6A 5TU0A 4F19A 3K4UA 4LN5A 3WAEA 4GX6A 4N07A 4QFOA 4HE0A 4YB6A 1B1HA 5DEXA 3KZGA 1OVTA 3RPWA 3IOTA 3HHGA 1SD3A 2GHBA 4NMYA 2F97A 1NH8A 3TFLA 5I84A 4PP0A 3H6UA 3IORA 3Q26A 1SI1A 1B40A 2O1MA 3CG1A 2ONKE 4MNPA 2WEFA 4MNIA 5H8QA 3AXFA 4YICA 3IO6A 4XXUA 1DTGA 5FHNA 1PB9A 4KD5A 1O64A 3EF7A 4JWYA 2I48A 2H5YA 4QXDA 5TPAA 5A5XA 5EHSA 3CVGA 5KCJB 1LBZA 1TWYA 4PE3A 2WBBA 2OWTA 4WEPA 2V25A 1IMEA 1EYJA 2PX1A 5A5LA 3OEMA 3K6WA 2O69A 1Z7NE 1EZ9A 4N8YA 1ZTYA 4H5GA 3IOWA 4IO6A 4FJPA 1IXGA 2WYPA 2Z23A 3IB0A 1D4NA 2UYEA 4G61A 3TMGA 4NF5B 4YMAA 3C33A 1S9TA 4I9DA 1MXYA 1IMBA 1B4ZA 4R72A 5I5PA 4N4UA 3O28A 3FATA 5IZZA 3RTFB 3SESA 2O7UA 1LBWA 1WODA 1MXZA 1GGGA 2XD3A 5ELVA 2B4MA 1FJ6A 3FXRA 3QAXA 2P0SA 5H8NB 1JQFA 3E13X 1GR2A 4GWYA 3H3GA 3O9PA 3KG2A 4JSOA 1Y4CA 1QKAA 4OEVA 3U94A 1B1XA 3U72A 3H7MA 5T3JA 4O7IA 1NV2A 1FQBA 1KA0A 1QUIA 1ZMGA 4H6DA 3BKIB 2RCAA 3M3LA 4GX4A 3N6UA 1MY3A 5FTHA 1YCJA 3RN8A 3W15C 3T9XB 4THIA 1TXFA 1S50A 5LTCA 4LQ5A 1RYXA 2O84X 1OIBA 4NWCA 3H4ZA 1NNTA 4DCXA 2HAUA 3S2VA 3VFJA 4G68C 4N6KA 4IO5A 1B51A 2QVVA 2HQ0A 3TPAA 1L5TA 1XI6A 1JEUA 2XWIA 2I0CA 3PPRA 4IO2A 3H6VA 1HSLA 4P8BA 1OQGA 4QF9A 4O3CA 1JW5A 2YPNA 5ISUA 3PMXA 3OMBA 4NGUA 1D9QA 3MSTA 3UA8A 4F2QA 1KZ8A 1A8FA 2B3FA 1P1NA 3VXBA 1R1NA 1M5BA 5ICQA 3CFZA 1FPKA 1DBZA 1B7UA 2VD2A 1Z7ME 4FEBA 3JYRA 4HE1A 2O68A 4KCCA 1WDNA 3IX1A 2V3TA 2RC8A 2CMOA 3MVWA 4JDFA 1URDA 3SEUA 4NAPA 1QULA 3QSLA 1FPFA 4Q30B 1P1OA 1QGXA 3C31A 2F78A 1ANFA 4C1UA 4ZEBA 3ECRA 4FORA 2WBDA 4IR8A 2ANJA 2ZYMA 2QRYA 3GYYA 3FJ7A 3P7IA 3SEYA 3OSQA 5EQ9A 3ZKKA 4NF6B 1H76A 1M5DA 4K3FA 4NTLA 1FRPA 3L6HA 1GVCA 3O29A 5KDTB 4PF6A 3C9HA 4TLLB 2XA5A 3SDFA 3FJGA 4OVSA 5L9OA 4O3BA 1LBYA 5DVFA 4Q8RA 2GH9A 5H8HA 4ELOA 3MBPA 3PPNA 3G3IA 2ZZWA 2UVHA 1Y3PA 3CG3A 3O97A 1B3FA 3QK6A 4PAIA 2H98A 2XXTA 4XKQA 1A54A 1Y9UA 1G0HA 1OVBA 3UP9A 1XT8A 2OBGA 4F39A 4OYVA 5JK4A 1FPDA 2F5XA 4QFLA 1H3DA 3LSXA 1QVSA 5AA3A 3KSJA 1SPIA 1N84A 4G77A 4KYSA 4NN3A 1JVYA 3G3KA 4GF8A 4ECFA 5H8SA 2Z8EA 5IM2A 4FBPA 2BJJX 2ZNTA 2XD2A 4JVIA 1FBEA 1NV0A 3DP6A 2XWOA 2QMWA 4PDDA 4X8RA 1A8EA 2XX7A 4PFBA 1OQHA 1BKAA 1Q35A 2G29A 2Q8MA 2XXYA 4ND9A 4I62A 3FV1A 2RINA 3MC2A 3ZS6A 3GBAA 2PBWA 3PUWE 3VVFA 3N5LA 5BUUA 1DPPA 3LBSA 1B6HA 3HPIA 1R9QA 5H8FA 2OCUA 4XKPA 1MXUA 5AA2A 1AWBA 1Q9DA 4O3AA 3SEWA 4I3EA 1NV3A 1NNPA 1TFAA 2RCBA 4ZDMA 4ZZEA 2AL4A 3KN8A 3KJ7A 2XXWA 4JVCA 3SERA 3MZ9A 3N94A 3RNNA 2F6PA 3VLVA 1QKBA 4MLVA 3FVNA 1B7ZA 1K9YA 1LCFA 1XHYA 3S9EA 3TCHA 5ET5A 2WKYA 3U93A 3TCFA 1SW1A 3SKPA 5EHMA 4OZ9A 1AOVA 4P11A 4JB7A 4U23A 2F3DA 4YB5A 4ONYA 1UTHA 2VOZA 3IK6B 1NNFA 4PBQA 4HE2A 3T9UA 2DWJA 2DXYA 1LFGA 4ZZAA 4R9GA 4OHNA 1SW5A 3A29A 3EHUA 5I2KB 2Y7WA 3BFUA 1URGA 1AMFA 1CB6A 1JEVA 3S9LC 3FV2A 1FTKA 3D4GA 3OEKA 4BDRA 1WVJA 3KGCA 3TAJA 4PGPA 2Q88A 2YJPA 4RY1A 3BFTA 4PAKA 2V93A 4MBPA 1VR5A 2X7QA 2AYSA 4DE8A 2F35A 1BTJA 1H44A 2DE3A 4HXVA 1FPEA 5ITOA 2QVUA 1FBFA 4P1EA 4GVOA 4NF8B 5F7VA 1ZLQA 1A40A 3PUYE 1MPCA 4NG7A 2I4CA 3Q27A 4RK2A 4X1DA 3CFLA 2DWAA 1POTA 5K2YA 3K02A 3ILTB 1O63A 2DE4A 4LATA 4U2RA 2DDKA 2ZMBA 4OVQA 5IKBA 1US4A 3PD8A 1MM7A 4KI0E 3O66A 5I56B 1LCTA 1DPEA 4RK9A 3IJOB 3ILUB 5ET8A 3CSBA 2A5SA 5CMMA 3H06B 1FPGA 3T9VA 2MKZA 4RPNA 1YZ0A 2I4BA 4LA9A 3FBPA 5B7DA 4F1UA 1FQCA 1LEVA 4RA1A 1MPDA 2F8DA 3QUFA 2PT2A 4Z0IA 1ZJLA 1N04A 1MRPA 3B50A 4ZE9A 1OMPA 4H65A 3IB2A 2NVUB 3HO7A 5CMCA 4DCYA 2ZZVA 1RDYA 1SYHA 3DP8A 3MPKA 4G68A 4MAGA 4EQBA 4KCDA 3UN6A 3BIHA 1N3XA 3R6UA 3RQTA 2Y7RA 5H8QB 5CMKA 1YYZA 3CFXA 1FBGA 3FVKA 1B58A 4PC9A 2R71A 1LAFE 4EF1A 3UGWA 3QUJA 5DTBA 3TTLA 3IJXB 3UIFA 5HM4B 4R75A 2ONRA 4IO4A 3RT8A 3TTRA 5AE4A 4H46A 4JVDA 4GL8A 4U4XA 3B8BA 1AL3A 3HN0A 3E3KA 4OENA 4FE8A 4AQ4A 2VD3A 2RF1A 1TT1A 3OD7A 3CRBA 3TTMA 1US5A 5EYGA 3M8UA 3T93B 2O6AA 1Y3QA 5B70A 3TZAA 3FIRA 4N81A 1CNQA 3N6TA 4IB2A 3RY3A 4MNCA 3T22A 2QSXA 2Q9TA 3T9HB 1D9VA 1PEBA 5KCJA 1B5JA 3HV1A 2DWIA 4F3SA 3FUZA 3E78A 5FHOA 3R7XA 2VP1A 4F3PA 1YAEA 1B3EA 4R73A 2THIA 3PGFA 5CMBA 3IFCA 3LV0A 5IZ1A 4BDQA 4MX6A 3KBRA 1MQJA 4PTKA 4NF5A 4POXA 5FBPA 1UIVA 2X7PA 3NOHA 1IMAA 5CM6A 1FBHA 4MH5A 2XXXA 1UTBB 4DXCA 1B46A 2XXUA 3TUSA 4POWA 4H0WA 2V3QA 5FTIA 4LP2B 4QFKA 1FPIA 2KLFA 3R26A 4X1BA 1FTOA 1PB7A 3K1MA 4YKJA 3K00A 1QW0A 4EQ9A 5I2NB 5H8NA 4HTGA 4M1VA 4PFYA 4ZS9A 3HFUA 3VDFA 4LZ5A 1MQHA 3IR1A 4XKNA 5I57B 5I58A 2NUVA 3FGSA 4DDDA 1LAHE 4YKKA 2QS1A 3I5OA 1B32A 1AH5A 4PBHA 4HCYA 3EN3A 1N7XA 4EXKA 3W9WA 3IOVA 4GBVA 4OMBA 2AIXA 4FAJA 3W9VA 1NKXA 1SW2A 2NOOA 2XXVA 1MXVA 2A5TB 4GOTA 4BDNA 3K0VA 4F1VA 4I40A 2H25A 4G2ZA 4FIMA 5KZTA 1IXCA 4PFUA 3KC0A 2PT1A 1FSAA 1B3HA 1XVYA 4OVTA 2YLNA 3ODBA 4GFRA 1QJMA 5JTYB 3MVYA 2FHYA 5K2XA 4IO3A 4GX3A 1MPBA 2DSFA 4OERA 4HW8A 3C34A 3JZJA 4NX1A 3B7DA 4LVQA 4JWOA 3RPLB 5I59B 2DYXA 3QYTA 2HPGA 4GWSA 2DP8A 4RYAA 1QUKA 4O8MA 4ELRA 1F9BA 2ZXTA 4XTCQ 4TQUQ 4LQ2A 1Y1ZA 1HSEA 4H1XA 2OWSA 3Q25A 2E1SA 2NXOA 2ZYOA 4XKRA 2OLBA 1FPLA 4QSDA 1FPJA 4EQ7A 5TP9B 5FHMA 4ELQA 3RT6B 4RXLA 1JW1A 2O1LA 4QFNA 3IOUA 1T0KA 1LB9A 3A3CA 3M3FA 3FVOA 1XVXA 1S7YA 4F3GA 4R6HA 1SI0A 1XOCA 3EQ1A 4JBZA 4NF6A 5EQAA 2QMXA 1QUJA 2OJTA 4OFOA 5KDTA 3PPQA 4BDMA 2ESNA 2KR0A 1B2HA 2NWJA 2IEEA 5EYFA 3OELA 4AS5A 2Z22A 3MZBA 3G3GA 3QIMA 3PV0E 2FYIA 2P1SA 1FBDA 1JNFA 4HS7A 4KR5A 3S4UA 2GQ1A 5EQ7A 2CZIA 1B5HA 2B4LA 1XC1A 4MHFA 1K9ZA 4IY5A 2RC9A 2QS4A 4XIGQ 3C36A 4G8MA 4MLQA 3VXCA 2VHAA 1EYIA 2R9JA 4NEDA 3Q28A 1DOTA 3V8XB 3B6QA 4DXBA 4GWUA 3OENA 2ABHA 2QS3A 4NF0A 4YAHX 3MW0A 5I3SA 1LAXA 1ZBMA 1B05A 3OXNA 3UORA 2CZLA 4DI3D 4F18A 4L17A 2PFZA 4GRKA 4NF4A 3K2DA 4Z7EA 2HEUA 2KQZA 3MQ9A 1IMFA 3PMWA 4F22A 1MG1A 5IGAA 3TYHA 2G93A 3KOTA 3TDJA 4F3BA 2XWVA 2W7YA 3ZSFA 4OWDA 4JWXA 3FZVA 2OZZA 2XHDA 5AA4B 2PVUA 4O7MA 1LBXA 3H6TA 2R6GE 4F1YA 1DSNA 3KN3A 2FVZA 1B7HA 4PDHA 4QSCA 4DI4B 1N0TA 1Y20A 2RKMA 4GQOA 2XXIA 4DXUA 1BIYA 3BBRA 1FPBA 1TFDA 4X9TA 1CE2A 3RGYA 1A7LA 4N8GA 5IZ3B 3TQWA 4OANA 4X04A 2QVRA 5CBRA 4FECA 3IL1B 5DT6A 1DCUA 2P2AA 1NL5A 2JJKA 3PMVA 2ZYKA 2P3NA 5ESYA 3KBZA 4E0XA 2REJA 2CZHA 4Q5TA 3EHSA 5EQ8A 4YMBA 2CEXA 1JVXA 1II5A 1LGBC 4ZEIA 3E9XA 3FD3A 1D3KA 1A55A 1NUYA 3OO7A 1NV5A 4U22A 3DLNA 2DQVA 3E4RA 5I7IA 2I49A 4PFWA 5I2KA 1LBBA 3A3UA 1GV8A 4ESWA 5CI5A 4I3YA 2OK2A 3O6HA 1FTJA 3LC8A 1HSJA 4M4GA 5AA2D 1BP5A 1GTKA 3K01A 4NHBA 4YZZA 4C0RA 3TTKA 3VV5A 4XEQA 4KPTA 1SQYA 4GLIA 1AIVA 1NUXA 5M2VA 1RDXA 1Y4TA 4NF8A 1O7TA 1SW4A 4H67A 4NQ8A 1NMUA 4R6YA 2H9BA 1VSOA 2B65A 3T96B 1IIWA 3F11A 4KFQA 5IAIA 1H45A 4BDLA 5L8DA 1R6ZA 4F31B 2Z8DA 4WKMA 4U1OA 1FJ9A 4FATA 2VPOA 4U1ZA 2OX3A 2LAOA 4GIZA 4PCDA 3B6WA 3MVZA 5I56A 1SBPA 1XS5A 3OO8A 2Y7PA 4F29A 4OFJA 5HPQA 1DTZA 3PU5A 3HSTA 5DEXB 4YKIA 2Q2AA 4QFPA 2HFBA 4FEDA 3VLUA 1NV4A 2P3VA 4QBAA 4F2OA 3WAFA 4N17A 3TTNA 4OVPA 3VVDA 3H6WA 1LFIA 1R9LA 1FCKA 4G8NA 1I69A 2O51A 4GWXA 3KN7A 3PTYA 4ISUA 4PQJA 1IXIA 2HZLA 1IUDA 3UK4A 1INPA 1P1QA 3HHFA 1D9YA 2F7AA 4G4PA 2DVZA 1EZPA 1MS7A 3K1NA 1KA1A 4IGRA 4JSDA 1FQAA 1NNKA 3EKIA 3CHGA 3TCGA 1FBPA 1ZKBA 5L9MA 4OVJA 2Y84A 5TPAB 2Y7KA 4UA8A 4OFLA 2IA4A 5A5XB 1MDP1 2WYKA 3I6VA 1MQIA 1IXHA 4P9KA 3SZPA 3PPPA 3T66A 3MPLA 4DZ1A 4XF5A 4MIJA 4TOZA 3S9NC 4NE4A 1PDAA 4MJOA 1MH3A 2GFEA 2B3BA 4EDPA 1M5FA 3ROJA 4N6DA 1P1WA 1VFDA 4EXLA 3E79A 1MH4A 1IMDA 4H5FA 4AS4A 4GWOA 3TODA 1Y1MA 4P47A 3V5AA 1IZ1A 2L5VA 5DYHA 3PD9A 3DELB 4PE5B 2D5WA 3G3JA 5DW8A 3K6UA 3JV9A 3OOAA 2HXWA 1SDXA 1Y3NA 4G8HA 1NH7A 3VLWA 3IAZA 1USYH 2V3UA 3FVGA 3MWBA 1NFTA 4H8JA 4HCWA 2HZKA 3PUXE 2F3BA 2XXHA 3O6GA 4LZ8A 3LUYA 1M5CA 1B3LA 1IEJA 3V83A 2I0BA 2ZNUA 4EUOA 4H45A 4ZEDA 4P3LA 4P0GA 4U21A 4ZEFA 2Q2CA 2F7BA 3IFAA 5F1QA 1BLFA 3I3VA 1IMCA 3O6IA 1UTBA 5I58B 1LLSA 3MP8A 4OVRA 2XX9A 2DS9A 4LONB 3KFMA 4PF8A 4X48A 5ET7A 2UYFA 2XWKA 5J1DA 3RLFE 2F36A 1MY0A 2D3IA 2ONSA 1EZOA 2PYYA 4N91A 5I2NA 1SYIA 2CEYA 4TLMB 4MMPA 4R2FA 2D21A 3N26A 1FQFA 4DLDA 4YB7A 1RYOA 4JXIA 4OESA 1PBQA 2VT5A 5I57A 3L6GA 1IITA 3USDA 2HCAA 3KSXA 4GWZA 2X26A 4P0IA 4NWDA 3B6TA 4R6KA 5LDZA 3PUVE 3MYUA 2F6GA 2A5TA 2QS2A 2XXPA 4OETA 2WX9A 4KXPA 1URSA 2UVGA 4I8CA 3K1PA 4WEDA 1B0HA 4PFIA 5JTYA 3A09A 1I6QA 2H4IA 2BJIA 2GRVA 3LSLA 3M3KA 4GXAA 4Q0CA 4R2BA 4H8IA 2PMSA 1Q1KA 4LZ7A 4EF2A 1FQEA 4MEVA 2XXQA 2Y5KA 3RPLA 3KOSA 3G7WA 5I59A 4YKPA 4ZECA 3LR1A 2R8TA 3FXQA 2F7CA 3HCQA 3CI8A 3IO4A 2VGQA 4IY6A 2ZNSA 1EYKA 2V84A 3DP4A 4WXJA 5ICTA 3OSRA 4GXSB 5AA1A 4P1LA 1JW4A 1ATGA 1IQ7A 1NV6A 1MM6A 1VDWA 4N13A 4GD5A 4UACA 4U4SA 5H8HB 3OO9A 3PPOA 1P99A 4PFTA 3V89B 1MY2A 3CSGA 4RNSA 4RPOA 2DE2A 1LB8A 4UABA 5TP9A 3EHTA 1EH3A 4OA4A 3IB1A 1MY1A 4LUBA 2ZZXA 5ITPA 3VVEA 2Y5LA 3LSWA 1MQDA 2DOJA 4MCOA 1FBCA 2XXRA 4PAFA 1NV7A 4AB5A 4I1DA 1LAGE 1MXXA 5HBCA 3MUQA 3K6XA 3C35A 2OWZA 4OQOA 2VPNA 5J16A 3D4CA 1JP4A 3S9MC 3U1OA 2XX8A 1FW0A 1MDQA 2HXRA 2Y7IA 3GLBA 4PFRA 2I3VA 4DIGA 2FA7A 4KYEA 5CRYA 5CBSA 1NUZA 1B9JA 1B4HA 2UVJA 1ZIUA 3U92A 1EU8A 1FTMA 1UIUA 4BLAA 4QHQA 3DM0A 3T0JA 1YTVA 4ELPA 2Q89A 5DVJA 4NF4B 1N7WA 2QJEA 1LBVA 1A99A 4R9FA 3TEPA 5H8FB 3EPEA 4N6PA 5AA2B 1ZU0A 4C1TA 5BWJA 2I58A 1BK4A 3G3HA 2GHAA 4P56A 2ALUA 1J1NA 1LBCA 1VFEA 4ESXA 1USYE 2QPQA 4YU0A 4E0WA 4OEUA 3H03A 3TELA 2REGA 3RUMA 3QXMA 2PCRA 4IGTA 1PC3A 1YPNA 3GBBA 1RKMA 1B52A 2CZKA 1FTLA 2UXAA 1N76A 1DMBA 1N3WA 4R74A 1B0LA 4ZE8A 5DVIA 5AA4A 2XXKA 3O2AA 3FASA 3ISPA 1MXWA 1UTHB 4OTEA 4MF3A 3QMFA 4GBWA 3C32A 3TKDA 2V4CA 2FBPA 4O94A 2DWHA 4QRZA 2UVIA 5CC2A 1OLCA 4PGNA 3TQLA 5IZ3A 1I6AA 3KEIA 3MZ1A 1YXIA 3C4MA 1VE4A 1KWHA 3ONMA 3SEVA 5ET6A 4QSEA 2DXRA 3KJTA 1PB8A 3KC1A 3MVXA 3MAMA 4MFIA 3THIA 4XFEA 2PFYA 1LSTA 3U65A 1B3GA 3SETA 3ZKLA 1DK4A 3G3FA 2H99A 1JETA 1MY4A 4RJZA
chains in the Genus database with same CATH topology
2Z8FA 3PUZE 2Q8JA 2I3WA 2F34A 2RC7A 2O7IA 2QL3A 2ZYNA 4IO7A 2DVCA 4KHZE 2FNCA 1LFHA 4AB6A 2M8CA 2HAVA 3RTWB 3SEXA 1SVXB 3MP1A 1H43A 2E0SA 3GXAA 4PETA 3K6VA 1OLAA 1MQGA 1M5EA 3FJMA 5LOMA 3LSFB 3VE1B 3MP6A 1PBPA 4OXVA 1P1UA 1ELJA 1I6BA 3CIJA 2AL5A 1UQWA 4KYDA 3CR9A 5L9SA 1B5IA 3MJNA 4GL0A 1FQDA 4G68B 3GZGA 4BDOA 4KQPA 3U8QA 3Q29A 2I6EA 5JEIA 1POY1 4ZEKA 3FXUA 3OO6A 5TU0A 4F19A 3K4UA 3WAEA 4N07A 4QFOA 4YB6A 1B1HA 5DEXA 3KZGA 1OVTA 3RPWA 3IOTA 3HHGA 1SD3A 2GHBA 4NMYA 2F97A 1NH8A 3TFLA 5I84A 4PP0A 3H6UA 3IORA 3Q26A 1SI1A 1B40A 2O1MA 3CG1A 2ONKE 5H8QA 3AXFA 4YICA 3IO6A 4XXUA 1DTGA 5FHNA 1PB9A 4KD5A 1O64A 3EF7A 4JWYA 2I48A 2H5YA 5TPAA 5A5XA 5EHSA 3CVGA 5KCJB 1TWYA 2OWTA 4WEPA 2V25A 2PX1A 3OEMA 3K6WA 2O69A 1Z7NE 1EZ9A 1ZTYA 4H5GA 3IOWA 4IO6A 4FJPA 1IXGA 2Z23A 3IB0A 1D4NA 2UYEA 3TMGA 4NF5B 4YMAA 3C33A 1S9TA 4I9DA 1MXYA 1B4ZA 4R72A 3O28A 3FATA 3RTFB 3SESA 2O7UA 1WODA 1MXZA 1GGGA 2XD3A 5ELVA 3FXRA 3QAXA 2P0SA 5H8NB 1JQFA 3E13X 1GR2A 3H3GA 3O9PA 3KG2A 4JSOA 1Y4CA 1QKAA 4OEVA 3U94A 1B1XA 3U72A 3H7MA 1FQBA 1QUIA 1ZMGA 4H6DA 3BKIB 2RCAA 3M3LA 3N6UA 1MY3A 5FTHA 1YCJA 3RN8A 3W15C 3T9XB 4THIA 1TXFA 1S50A 4LQ5A 1RYXA 2O84X 1OIBA 4NWCA 3H4ZA 1NNTA 4DCXA 2HAUA 3S2VA 3VFJA 4G68C 4IO5A 1B51A 2HQ0A 3TPAA 1L5TA 1JEUA 2I0CA 3PPRA 4IO2A 3H6VA 1HSLA 1OQGA 4QF9A 4O3CA 1JW5A 2YPNA 5ISUA 3PMXA 3OMBA 3UA8A 4F2QA 1A8FA 2B3FA 1P1NA 3VXBA 1R1NA 1M5BA 5ICQA 3CFZA 1B7UA 2VD2A 1Z7ME 4FEBA 3JYRA 2O68A 4KCCA 1WDNA 3IX1A 2V3TA 2RC8A 2CMOA 3MVWA 4JDFA 1URDA 3SEUA 1QULA 3QSLA 4Q30B 1P1OA 3C31A 2F78A 1ANFA 4C1UA 4ZEBA 3ECRA 4FORA 2ANJA 2ZYMA 2QRYA 3FJ7A 3P7IA 3SEYA 3OSQA 3ZKKA 4NF6B 1H76A 1M5DA 4K3FA 4NTLA 3L6HA 1GVCA 3O29A 5KDTB 3C9HA 4TLLB 3SDFA 3FJGA 5L9OA 4O3BA 5DVFA 4Q8RA 2GH9A 5H8HA 4ELOA 3MBPA 3PPNA 3G3IA 2UVHA 1Y3PA 3CG3A 3O97A 1B3FA 3QK6A 2H98A 2XXTA 4XKQA 1A54A 1Y9UA 1OVBA 3UP9A 1XT8A 2OBGA 4F39A 4OYVA 5JK4A 2F5XA 4QFLA 1H3DA 3LSXA 1QVSA 5AA3A 3KSJA 1N84A 4G77A 4KYSA 1JVYA 3G3KA 4GF8A 4ECFA 5H8SA 2Z8EA 2BJJX 2ZNTA 2XD2A 3DP6A 2QMWA 1A8EA 2XX7A 1OQHA 1BKAA 1Q35A 2G29A 2XXYA 4ND9A 4I62A 3FV1A 2RINA 3MC2A 3ZS6A 3GBAA 2PBWA 3PUWE 3VVFA 3N5LA 5BUUA 1DPPA 3LBSA 1B6HA 3HPIA 1R9QA 5H8FA 2OCUA 4XKPA 1MXUA 5AA2A 4O3AA 3SEWA 1NNPA 1TFAA 2RCBA 4ZDMA 4ZZEA 2AL4A 3KN8A 3KJ7A 2XXWA 3SERA 3MZ9A 3N94A 3RNNA 2F6PA 3VLVA 1QKBA 4MLVA 3FVNA 1B7ZA 1LCFA 1XHYA 3S9EA 3TCHA 2WKYA 3U93A 3TCFA 1SW1A 3SKPA 5EHMA 4OZ9A 1AOVA 4P11A 4JB7A 4U23A 4YB5A 4ONYA 1UTHA 2VOZA 3IK6B 1NNFA 3T9UA 2DWJA 2DXYA 1LFGA 4ZZAA 4R9GA 4OHNA 1SW5A 3EHUA 5I2KB 2Y7WA 3BFUA 1URGA 1AMFA 1CB6A 1JEVA 3S9LC 3FV2A 1FTKA 3D4GA 3OEKA 4BDRA 1WVJA 3KGCA 3TAJA 2Q88A 2YJPA 4RY1A 3BFTA 2V93A 4MBPA 1VR5A 2X7QA 2AYSA 4DE8A 2F35A 1BTJA 1H44A 2DE3A 5ITOA 4GVOA 4NF8B 5F7VA 1ZLQA 1A40A 3PUYE 1MPCA 2I4CA 3Q27A 4RK2A 4X1DA 3CFLA 2DWAA 1POTA 5K2YA 3K02A 3ILTB 1O63A 2DE4A 4LATA 4U2RA 2ZMBA 5IKBA 1US4A 3PD8A 1MM7A 4KI0E 3O66A 5I56B 1LCTA 1DPEA 4RK9A 3IJOB 3ILUB 3CSBA 2A5SA 5CMMA 3H06B 3T9VA 4RPNA 2I4BA 4LA9A 5B7DA 4F1UA 1FQCA 4RA1A 1MPDA 2F8DA 3QUFA 2PT2A 4Z0IA 1ZJLA 1N04A 1MRPA 4ZE9A 1OMPA 4H65A 3IB2A 2NVUB 3HO7A 5CMCA 4DCYA 1SYHA 3DP8A 3MPKA 4G68A 4EQBA 4KCDA 3UN6A 1N3XA 3R6UA 3RQTA 2Y7RA 5H8QB 5CMKA 3CFXA 3FVKA 1B58A 2R71A 1LAFE 4EF1A 3UGWA 3QUJA 5DTBA 3TTLA 3IJXB 3UIFA 5HM4B 4R75A 2ONRA 4IO4A 3RT8A 3TTRA 5AE4A 4GL8A 4U4XA 1AL3A 3HN0A 3E3KA 4OENA 4AQ4A 4FE8A 2VD3A 2RF1A 1TT1A 3OD7A 3CRBA 3TTMA 1US5A 3M8UA 3T93B 2O6AA 1Y3QA 5B70A 3TZAA 3FIRA 3N6TA 4IB2A 3RY3A 3T22A 2QSXA 2Q9TA 3T9HB 1D9VA 1PEBA 5KCJA 1B5JA 3HV1A 2DWIA 4F3SA 3FUZA 5FHOA 3R7XA 2VP1A 4F3PA 1YAEA 1B3EA 4R73A 2THIA 3PGFA 5CMBA 4BDQA 3KBRA 1MQJA 4NF5A 4POXA 1UIVA 2X7PA 5CM6A 4MH5A 2XXXA 1UTBB 4DXCA 1B46A 2XXUA 3TUSA 4POWA 4H0WA 2V3QA 5FTIA 4LP2B 4QFKA 2KLFA 3R26A 4X1BA 1FTOA 1PB7A 3K1MA 4YKJA 3K00A 1QW0A 4EQ9A 5I2NB 5H8NA 4HTGA 4M1VA 4PFYA 4ZS9A 3VDFA 4LZ5A 1MQHA 3IR1A 4XKNA 5I57B 5I58A 2NUVA 3FGSA 4DDDA 1LAHE 4YKKA 2QS1A 3I5OA 1B32A 1AH5A 4HCYA 3EN3A 1N7XA 4EXKA 3W9WA 3IOVA 4FAJA 4OMBA 2AIXA 3W9VA 1NKXA 1SW2A 2NOOA 2XXVA 1MXVA 2A5TB 4GOTA 4BDNA 3K0VA 4F1VA 2H25A 4G2ZA 4FIMA 5KZTA 1IXCA 4PFUA 2PT1A 1B3HA 1XVYA 2YLNA 3ODBA 4GFRA 1QJMA 5JTYB 3MVYA 5K2XA 4IO3A 1MPBA 2DSFA 4OERA 4HW8A 3C34A 3JZJA 3B7DA 4LVQA 4JWOA 5I59B 2DYXA 3QYTA 2DP8A 4RYAA 1QUKA 4ELRA 1F9BA 2ZXTA 4XTCQ 4TQUQ 4LQ2A 1Y1ZA 1HSEA 4H1XA 2OWSA 3Q25A 2E1SA 2NXOA 2ZYOA 4XKRA 2OLBA 4QSDA 4EQ7A 5TP9B 5FHMA 4ELQA 3RT6B 4RXLA 1JW1A 2O1LA 4QFNA 3IOUA 1T0KA 1LB9A 3A3CA 3M3FA 3FVOA 1XVXA 1S7YA 4F3GA 4R6HA 1SI0A 1XOCA 3EQ1A 4JBZA 4NF6A 2QMXA 1QUJA 2OJTA 4OFOA 5KDTA 3PPQA 4BDMA 2ESNA 1B2HA 2NWJA 2IEEA 5EYFA 3OELA 2Z22A 3MZBA 3G3GA 3QIMA 3PV0E 2FYIA 2P1SA 1JNFA 4HS7A 4KR5A 3S4UA 1B5HA 1XC1A 4IY5A 2RC9A 2QS4A 4XIGQ 3C36A 4G8MA 4MLQA 3VXCA 2VHAA 2R9JA 4NEDA 3Q28A 1DOTA 3V8XB 3B6QA 4DXBA 3OENA 2ABHA 2QS3A 4YAHX 3MW0A 1LAXA 3UORA 1ZBMA 1B05A 3OXNA 2CZLA 4F18A 4L17A 4GRKA 4NF4A 3K2DA 4Z7EA 2HEUA 3MQ9A 3PMWA 4F22A 1MG1A 3TYHA 2G93A 3KOTA 3TDJA 4F3BA 2W7YA 3ZSFA 4OWDA 4JWXA 3FZVA 2OZZA 2XHDA 5AA4B 2PVUA 3H6TA 2R6GE 4F1YA 1DSNA 3KN3A 1B7HA 4QSCA 1N0TA 1Y20A 2RKMA 4GQOA 2XXIA 4DXUA 1BIYA 3BBRA 1TFDA 4X9TA 1CE2A 3RGYA 1A7LA 3TQWA 5CBRA 4FECA 3IL1B 5DT6A 2P2AA 1NL5A 3PMVA 2ZYKA 4E0XA 2REJA 4Q5TA 3EHSA 4YMBA 1JVXA 1II5A 1LGBC 4ZEIA 3E9XA 3FD3A 1D3KA 1A55A 3OO7A 4U22A 3DLNA 2DQVA 3E4RA 2I49A 4PFWA 5I2KA 1LBBA 3A3UA 1GV8A 4ESWA 5CI5A 2OK2A 3O6HA 1FTJA 3LC8A 1HSJA 4M4GA 5AA2D 1BP5A 1GTKA 3K01A 4YZZA 4C0RA 3TTKA 3VV5A 4KPTA 1SQYA 4GLIA 1AIVA 5M2VA 1Y4TA 4NF8A 1O7TA 1SW4A 4H67A 1NMUA 4R6YA 2H9BA 1VSOA 2B65A 3T96B 1IIWA 3F11A 4KFQA 5IAIA 1H45A 4BDLA 5L8DA 1R6ZA 4F31B 2Z8DA 4WKMA 4U1OA 4FATA 4U1ZA 2LAOA 4GIZA 3B6WA 3MVZA 5I56A 1SBPA 1XS5A 3OO8A 2Y7PA 4F29A 4OFJA 5HPQA 1DTZA 3PU5A 3HSTA 5DEXB 4YKIA 2Q2AA 4QFPA 2HFBA 4FEDA 3VLUA 4F2OA 3WAFA 3TTNA 3VVDA 3H6WA 1LFIA 1R9LA 1FCKA 4G8NA 1I69A 2O51A 3KN7A 4ISUA 4PQJA 1IXIA 2HZLA 1IUDA 3UK4A 1P1QA 3HHFA 1D9YA 2F7AA 4G4PA 2DVZA 1EZPA 1MS7A 3K1NA 4IGRA 4JSDA 1FQAA 1NNKA 3TCGA 1ZKBA 5L9MA 4OVJA 2Y84A 5TPAB 2Y7KA 4UA8A 4OFLA 2IA4A 5A5XB 1MDP1 3I6VA 1MQIA 1IXHA 3PPPA 3T66A 3MPLA 4DZ1A 4TOZA 3S9NC 4NE4A 1PDAA 1MH3A 2GFEA 2B3BA 4EDPA 1M5FA 1P1WA 1VFDA 4EXLA 1MH4A 4H5FA 4GWOA 3TODA 1Y1MA 3V5AA 1IZ1A 5DYHA 3PD9A 3DELB 4PE5B 2D5WA 3G3JA 3K6UA 3JV9A 3OOAA 2HXWA 1SDXA 1Y3NA 4G8HA 1NH7A 3VLWA 3IAZA 1USYH 2V3UA 3FVGA 3MWBA 1NFTA 4H8JA 4HCWA 2HZKA 3PUXE 2XXHA 3O6GA 4LZ8A 3LUYA 1M5CA 1B3LA 1IEJA 3V83A 2I0BA 2ZNUA 4EUOA 4ZEDA 4P0GA 4U21A 4ZEFA 2Q2CA 2F7BA 5F1QA 1BLFA 3I3VA 3O6IA 1UTBA 5I58B 1LLSA 3MP8A 2XX9A 2DS9A 4LONB 3KFMA 4X48A 2UYFA 5J1DA 3RLFE 2F36A 1MY0A 2D3IA 2ONSA 1EZOA 2PYYA 5I2NA 1SYIA 4TLMB 4R2FA 2D21A 3N26A 1FQFA 4DLDA 4YB7A 1RYOA 4JXIA 4OESA 1PBQA 5I57A 3L6GA 1IITA 3USDA 2HCAA 3KSXA 2X26A 4P0IA 4NWDA 3B6TA 4R6KA 3PUVE 2F6GA 2A5TA 2QS2A 2XXPA 4OETA 1URSA 2UVGA 4I8CA 3K1PA 4WEDA 1B0HA 5JTYA 3A09A 1I6QA 2H4IA 3LSLA 2GRVA 3M3KA 4GXAA 4Q0CA 4R2BA 4H8IA 2PMSA 1Q1KA 4LZ7A 4EF2A 1FQEA 2XXQA 3KOSA 3G7WA 5I59A 4YKPA 4ZECA 3LR1A 3FXQA 2F7CA 3HCQA 3CI8A 3IO4A 2VGQA 4IY6A 2ZNSA 2V84A 3DP4A 4WXJA 5ICTA 3OSRA 4GXSB 5AA1A 1JW4A 1ATGA 1IQ7A 1MM6A 4N13A 4GD5A 4UACA 4U4SA 5H8HB 3OO9A 3PPOA 1P99A 4PFTA 3V89B 1MY2A 3CSGA 4RNSA 4RPOA 2DE2A 1LB8A 5TP9A 3EHTA 1EH3A 3IB1A 1MY1A 4LUBA 5ITPA 3VVEA 3LSWA 1MQDA 2DOJA 2XXRA 4AB5A 4I1DA 1LAGE 1MXXA 5HBCA 3MUQA 3K6XA 3C35A 4OQOA 3D4CA 3S9MC 3U1OA 2XX8A 1FW0A 1MDQA 2Y7IA 3GLBA 2I3VA 4DIGA 2FA7A 4KYEA 5CRYA 5CBSA 1B9JA 1B4HA 2UVJA 1ZIUA 3U92A 1EU8A 1FTMA 1UIUA 4BLAA 4QHQA 3DM0A 1YTVA 4ELPA 2Q89A 5DVJA 4NF4B 1N7WA 2QJEA 1A99A 4R9FA 3TEPA 5H8FB 3EPEA 4N6PA 5AA2B 1ZU0A 4C1TA 5BWJA 2I58A 3G3HA 2GHAA 2ALUA 1J1NA 1LBCA 1VFEA 4ESXA 1USYE 2QPQA 4YU0A 4E0WA 4OEUA 3H03A 3TELA 2REGA 3RUMA 3QXMA 4IGTA 1PC3A 1YPNA 3GBBA 1RKMA 1B52A 1FTLA 2UXAA 1N76A 1DMBA 1N3WA 4R74A 1B0LA 4ZE8A 5DVIA 5AA4A 3O2AA 3FASA 1MXWA 1UTHB 4OTEA 4MF3A 3C32A 3TKDA 2DWHA 4QRZA 2UVIA 5CC2A 1OLCA 3TQLA 1I6AA 3KEIA 3MZ1A 3C4MA 1VE4A 1KWHA 3ONMA 3SEVA 4QSEA 2DXRA 3KJTA 1PB8A 3MVXA 3MAMA 4MFIA 3THIA 1LSTA 1B3GA 3SETA 3ZKLA 3G3FA 2H99A 1JETA 1MY4A 4RJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z8F A;  3PUZ E;  2Q8J A;  2I3W A;  2F34 A;  2RC7 A;  2O7I A;  2QL3 A;  2ZYN A;  4IO7 A;  2DVC A;  4KHZ E;  2FNC A;  1LFH A;  4AB6 A;  2M8C A;  2HAV A;  3RTW B;  3SEX A;  1SVX B;  3MP1 A;  1H43 A;  2E0S A;  3GXA A;  4PET A;  3K6V A;  1OLA A;  1MQG A;  1M5E A;  3FJM A;  5LOM A;  3LSF B;  3VE1 B;  3MP6 A;  1PBP A;  4OXV A;  1P1U A;  1ELJ A;  1I6B A;  3CIJ A;  2AL5 A;  1UQW A;  4KYD A;  3CR9 A;  5L9S A;  1B5I A;  3MJN A;  4GL0 A;  1FQD A;  4G68 B;  3GZG A;  4BDO A;  4KQP A;  3U8Q A;  3Q29 A;  2I6E A;  5JEI A;  1POY 1;  4ZEK A;  3FXU A;  3OO6 A;  5TU0 A;  4F19 A;  3K4U A;  3WAE A;  4N07 A;  4QFO A;  4YB6 A;  1B1H A;  5DEX A;  3KZG A;  1OVT A;  3RPW A;  3IOT A;  3HHG A;  1SD3 A;  2GHB A;  4NMY A;  2F97 A;  1NH8 A;  3TFL A;  5I84 A;  4PP0 A;  3H6U A;  3IOR A;  3Q26 A;  1SI1 A;  1B40 A;  2O1M A;  3CG1 A;  2ONK E;  5H8Q A;  3AXF A;  4YIC A;  3IO6 A;  4XXU A;  1DTG A;  5FHN A;  1PB9 A;  4KD5 A;  1O64 A;  3EF7 A;  4JWY A;  2I48 A;  2H5Y A;  5TPA A;  5A5X A;  5EHS A;  3CVG A;  5KCJ B;  1TWY A;  2OWT A;  4WEP A;  2V25 A;  2PX1 A;  3OEM A;  3K6W A;  2O69 A;  1Z7N E;  1EZ9 A;  1ZTY A;  4H5G A;  3IOW A;  4IO6 A;  4FJP A;  1IXG A;  2Z23 A;  3IB0 A;  1D4N A;  2UYE A;  3TMG A;  4NF5 B;  4YMA A;  3C33 A;  1S9T A;  4I9D A;  1MXY A;  1B4Z A;  4R72 A;  3O28 A;  3FAT A;  3RTF B;  3SES A;  2O7U A;  1WOD A;  1MXZ A;  1GGG A;  2XD3 A;  5ELV A;  3FXR A;  3QAX A;  2P0S A;  5H8N B;  1JQF A;  3E13 X;  1GR2 A;  3H3G A;  3O9P A;  3KG2 A;  4JSO A;  1Y4C A;  1QKA A;  4OEV A;  3U94 A;  1B1X A;  3U72 A;  3H7M A;  1FQB A;  1QUI A;  1ZMG A;  4H6D A;  3BKI B;  2RCA A;  3M3L A;  3N6U A;  1MY3 A;  5FTH A;  1YCJ A;  3RN8 A;  3W15 C;  3T9X B;  4THI A;  1TXF A;  1S50 A;  4LQ5 A;  1RYX A;  2O84 X;  1OIB A;  4NWC A;  3H4Z A;  1NNT A;  4DCX A;  2HAU A;  3S2V A;  3VFJ A;  4G68 C;  4IO5 A;  1B51 A;  2HQ0 A;  3TPA A;  1L5T A;  1JEU A;  2I0C A;  3PPR A;  4IO2 A;  3H6V A;  1HSL A;  1OQG A;  4QF9 A;  4O3C A;  1JW5 A;  2YPN A;  5ISU A;  3PMX A;  3OMB A;  3UA8 A;  4F2Q A;  1A8F A;  2B3F A;  1P1N A;  3VXB A;  1R1N A;  1M5B A;  5ICQ A;  3CFZ A;  1B7U A;  2VD2 A;  1Z7M E;  4FEB A;  3JYR A;  2O68 A;  4KCC A;  1WDN A;  3IX1 A;  2V3T A;  2RC8 A;  2CMO A;  3MVW A;  4JDF A;  1URD A;  3SEU A;  1QUL A;  3QSL A;  4Q30 B;  1P1O A;  3C31 A;  2F78 A;  1ANF A;  4C1U A;  4ZEB A;  3ECR A;  4FOR A;  2ANJ A;  2ZYM A;  2QRY A;  3FJ7 A;  3P7I A;  3SEY A;  3OSQ A;  3ZKK A;  4NF6 B;  1H76 A;  1M5D A;  4K3F A;  4NTL A;  3L6H A;  1GVC A;  3O29 A;  5KDT B;  3C9H A;  4TLL B;  3SDF A;  3FJG A;  5L9O A;  4O3B A;  5DVF A;  4Q8R A;  2GH9 A;  5H8H A;  4ELO A;  3MBP A;  3PPN A;  3G3I A;  2UVH A;  1Y3P A;  3CG3 A;  3O97 A;  1B3F A;  3QK6 A;  2H98 A;  2XXT A;  4XKQ A;  1A54 A;  1Y9U A;  1OVB A;  3UP9 A;  1XT8 A;  2OBG A;  4F39 A;  4OYV A;  5JK4 A;  2F5X A;  4QFL A;  1H3D A;  3LSX A;  1QVS A;  5AA3 A;  3KSJ A;  1N84 A;  4G77 A;  4KYS A;  1JVY A;  3G3K A;  4GF8 A;  4ECF A;  5H8S A;  2Z8E A;  2BJJ X;  2ZNT A;  2XD2 A;  3DP6 A;  2QMW A;  1A8E A;  2XX7 A;  1OQH A;  1BKA A;  1Q35 A;  2G29 A;  2XXY A;  4ND9 A;  4I62 A;  3FV1 A;  2RIN A;  3MC2 A;  3ZS6 A;  3GBA A;  2PBW A;  3PUW E;  3VVF A;  3N5L A;  5BUU A;  1DPP A;  3LBS A;  1B6H A;  3HPI A;  1R9Q A;  5H8F A;  2OCU A;  4XKP A;  1MXU A;  5AA2 A;  4O3A A;  3SEW A;  1NNP A;  1TFA A;  2RCB A;  4ZDM A;  4ZZE A;  2AL4 A;  3KN8 A;  3KJ7 A;  2XXW A;  3SER A;  3MZ9 A;  3N94 A;  3RNN A;  2F6P A;  3VLV A;  1QKB A;  4MLV A;  3FVN A;  1B7Z A;  1LCF A;  1XHY A;  3S9E A;  3TCH A;  2WKY A;  3U93 A;  3TCF A;  1SW1 A;  3SKP A;  5EHM A;  4OZ9 A;  1AOV A;  4P11 A;  4JB7 A;  4U23 A;  4YB5 A;  4ONY A;  1UTH A;  2VOZ A;  3IK6 B;  1NNF A;  3T9U A;  2DWJ A;  2DXY A;  1LFG A;  4ZZA A;  4R9G A;  4OHN A;  1SW5 A;  3EHU A;  5I2K B;  2Y7W A;  3BFU A;  1URG A;  1AMF A;  1CB6 A;  1JEV A;  3S9L C;  3FV2 A;  1FTK A;  3D4G A;  3OEK A;  4BDR A;  1WVJ A;  3KGC A;  3TAJ A;  2Q88 A;  2YJP A;  4RY1 A;  3BFT A;  2V93 A;  4MBP A;  1VR5 A;  2X7Q A;  2AYS A;  4DE8 A;  2F35 A;  1BTJ A;  1H44 A;  2DE3 A;  5ITO A;  4GVO A;  4NF8 B;  5F7V A;  1ZLQ A;  1A40 A;  3PUY E;  1MPC A;  2I4C A;  3Q27 A;  4RK2 A;  4X1D A;  3CFL A;  2DWA A;  1POT A;  5K2Y A;  3K02 A;  3ILT B;  1O63 A;  2DE4 A;  4LAT A;  4U2R A;  2ZMB A;  5IKB A;  1US4 A;  3PD8 A;  1MM7 A;  4KI0 E;  3O66 A;  5I56 B;  1LCT A;  1DPE A;  4RK9 A;  3IJO B;  3ILU B;  3CSB A;  2A5S A;  5CMM A;  3H06 B;  3T9V A;  4RPN A;  2I4B A;  4LA9 A;  5B7D A;  4F1U A;  1FQC A;  4RA1 A;  1MPD A;  2F8D A;  3QUF A;  2PT2 A;  4Z0I A;  1ZJL A;  1N04 A;  1MRP A;  4ZE9 A;  1OMP A;  4H65 A;  3IB2 A;  2NVU B;  3HO7 A;  5CMC A;  4DCY A;  1SYH A;  3DP8 A;  3MPK A;  4G68 A;  4EQB A;  4KCD A;  3UN6 A;  1N3X A;  3R6U A;  3RQT A;  2Y7R A;  5H8Q B;  5CMK A;  3CFX A;  3FVK A;  1B58 A;  2R71 A;  1LAF E;  4EF1 A;  3UGW A;  3QUJ A;  5DTB A;  3TTL A;  3IJX B;  3UIF A;  5HM4 B;  4R75 A;  2ONR A;  4IO4 A;  3RT8 A;  3TTR A;  5AE4 A;  4GL8 A;  4U4X A;  1AL3 A;  3HN0 A;  3E3K A;  4OEN A;  4AQ4 A;  4FE8 A;  2VD3 A;  2RF1 A;  1TT1 A;  3OD7 A;  3CRB A;  3TTM A;  1US5 A;  3M8U A;  3T93 B;  2O6A A;  1Y3Q A;  5B70 A;  3TZA A;  3FIR A;  3N6T A;  4IB2 A;  3RY3 A;  3T22 A;  2QSX A;  2Q9T A;  3T9H B;  1D9V A;  1PEB A;  5KCJ A;  1B5J A;  3HV1 A;  2DWI A;  4F3S A;  3FUZ A;  5FHO A;  3R7X A;  2VP1 A;  4F3P A;  1YAE A;  1B3E A;  4R73 A;  2THI A;  3PGF A;  5CMB A;  4BDQ A;  3KBR A;  1MQJ A;  4NF5 A;  4POX A;  1UIV A;  2X7P A;  5CM6 A;  4MH5 A;  2XXX A;  1UTB B;  4DXC A;  1B46 A;  2XXU A;  3TUS A;  4POW A;  4H0W A;  2V3Q A;  5FTI A;  4LP2 B;  4QFK A;  2KLF A;  3R26 A;  4X1B A;  1FTO A;  1PB7 A;  3K1M A;  4YKJ A;  3K00 A;  1QW0 A;  4EQ9 A;  5I2N B;  5H8N A;  4HTG A;  4M1V A;  4PFY A;  4ZS9 A;  3VDF A;  4LZ5 A;  1MQH A;  3IR1 A;  4XKN A;  5I57 B;  5I58 A;  2NUV A;  3FGS A;  4DDD A;  1LAH E;  4YKK A;  2QS1 A;  3I5O A;  1B32 A;  1AH5 A;  4HCY A;  3EN3 A;  1N7X A;  4EXK A;  3W9W A;  3IOV A;  4FAJ A;  4OMB A;  2AIX A;  3W9V A;  1NKX A;  1SW2 A;  2NOO A;  2XXV A;  1MXV A;  2A5T B;  4GOT A;  4BDN A;  3K0V A;  4F1V A;  2H25 A;  4G2Z A;  4FIM A;  5KZT A;  1IXC A;  4PFU A;  2PT1 A;  1B3H A;  1XVY A;  2YLN A;  3ODB A;  4GFR A;  1QJM A;  5JTY B;  3MVY A;  5K2X A;  4IO3 A;  1MPB A;  2DSF A;  4OER A;  4HW8 A;  3C34 A;  3JZJ A;  3B7D A;  4LVQ A;  4JWO A;  5I59 B;  2DYX A;  3QYT A;  2DP8 A;  4RYA A;  1QUK A;  4ELR A;  1F9B A;  2ZXT A;  4XTC Q;  4TQU Q;  4LQ2 A;  1Y1Z A;  1HSE A;  4H1X A;  2OWS A;  3Q25 A;  2E1S A;  2NXO A;  2ZYO A;  4XKR A;  2OLB A;  4QSD A;  4EQ7 A;  5TP9 B;  5FHM A;  4ELQ A;  3RT6 B;  4RXL A;  1JW1 A;  2O1L A;  4QFN A;  3IOU A;  1T0K A;  1LB9 A;  3A3C A;  3M3F A;  3FVO A;  1XVX A;  1S7Y A;  4F3G A;  4R6H A;  1SI0 A;  1XOC A;  3EQ1 A;  4JBZ A;  4NF6 A;  2QMX A;  1QUJ A;  2OJT A;  4OFO A;  5KDT A;  3PPQ A;  4BDM A;  2ESN A;  1B2H A;  2NWJ A;  2IEE A;  5EYF A;  3OEL A;  2Z22 A;  3MZB A;  3G3G A;  3QIM A;  3PV0 E;  2FYI A;  2P1S A;  1JNF A;  4HS7 A;  4KR5 A;  3S4U A;  1B5H A;  1XC1 A;  4IY5 A;  2RC9 A;  2QS4 A;  4XIG Q;  3C36 A;  4G8M A;  4MLQ A;  3VXC A;  2VHA A;  2R9J A;  4NED A;  3Q28 A;  1DOT A;  3V8X B;  3B6Q A;  4DXB A;  3OEN A;  2ABH A;  2QS3 A;  4YAH X;  3MW0 A;  1LAX A;  3UOR A;  1ZBM A;  1B05 A;  3OXN A;  2CZL A;  4F18 A;  4L17 A;  4GRK A;  4NF4 A;  3K2D A;  4Z7E A;  2HEU A;  3MQ9 A;  3PMW A;  4F22 A;  1MG1 A;  3TYH A;  2G93 A;  3KOT A;  3TDJ A;  4F3B A;  2W7Y A;  3ZSF A;  4OWD A;  4JWX A;  3FZV A;  2OZZ A;  2XHD A;  5AA4 B;  2PVU A;  3H6T A;  2R6G E;  4F1Y A;  1DSN A;  3KN3 A;  1B7H A;  4QSC A;  1N0T A;  1Y20 A;  2RKM A;  4GQO A;  2XXI A;  4DXU A;  1BIY A;  3BBR A;  1TFD A;  4X9T A;  1CE2 A;  3RGY A;  1A7L A;  3TQW A;  5CBR A;  4FEC A;  3IL1 B;  5DT6 A;  2P2A A;  1NL5 A;  3PMV A;  2ZYK A;  4E0X A;  2REJ A;  4Q5T A;  3EHS A;  4YMB A;  1JVX A;  1II5 A;  1LGB C;  4ZEI A;  3E9X A;  3FD3 A;  1D3K A;  1A55 A;  3OO7 A;  4U22 A;  3DLN A;  2DQV A;  3E4R A;  2I49 A;  4PFW A;  5I2K A;  1LBB A;  3A3U A;  1GV8 A;  4ESW A;  5CI5 A;  2OK2 A;  3O6H A;  1FTJ A;  3LC8 A;  1HSJ A;  4M4G A;  5AA2 D;  1BP5 A;  1GTK A;  3K01 A;  4YZZ A;  4C0R A;  3TTK A;  3VV5 A;  4KPT A;  1SQY A;  4GLI A;  1AIV A;  5M2V A;  1Y4T A;  4NF8 A;  1O7T A;  1SW4 A;  4H67 A;  1NMU A;  4R6Y A;  2H9B A;  1VSO A;  2B65 A;  3T96 B;  1IIW A;  3F11 A;  4KFQ A;  5IAI A;  1H45 A;  4BDL A;  5L8D A;  1R6Z A;  4F31 B;  2Z8D A;  4WKM A;  4U1O A;  4FAT A;  4U1Z A;  2LAO A;  4GIZ A;  3B6W A;  3MVZ A;  5I56 A;  1SBP A;  1XS5 A;  3OO8 A;  2Y7P A;  4F29 A;  4OFJ A;  5HPQ A;  1DTZ A;  3PU5 A;  3HST A;  5DEX B;  4YKI A;  2Q2A A;  4QFP A;  2HFB A;  4FED A;  3VLU A;  4F2O A;  3WAF A;  3TTN A;  3VVD A;  3H6W A;  1LFI A;  1R9L A;  1FCK A;  4G8N A;  1I69 A;  2O51 A;  3KN7 A;  4ISU A;  4PQJ A;  1IXI A;  2HZL A;  1IUD A;  3UK4 A;  1P1Q A;  3HHF A;  1D9Y A;  2F7A A;  4G4P A;  2DVZ A;  1EZP A;  1MS7 A;  3K1N A;  4IGR A;  4JSD A;  1FQA A;  1NNK A;  3TCG A;  1ZKB A;  5L9M A;  4OVJ A;  2Y84 A;  5TPA B;  2Y7K A;  4UA8 A;  4OFL A;  2IA4 A;  5A5X B;  1MDP 1;  3I6V A;  1MQI A;  1IXH A;  3PPP A;  3T66 A;  3MPL A;  4DZ1 A;  4TOZ A;  3S9N C;  4NE4 A;  1PDA A;  1MH3 A;  2GFE A;  2B3B A;  4EDP A;  1M5F A;  1P1W A;  1VFD A;  4EXL A;  1MH4 A;  4H5F A;  4GWO A;  3TOD A;  1Y1M A;  3V5A A;  1IZ1 A;  5DYH A;  3PD9 A;  3DEL B;  4PE5 B;  2D5W A;  3G3J A;  3K6U A;  3JV9 A;  3OOA A;  2HXW A;  1SDX A;  1Y3N A;  4G8H A;  1NH7 A;  3VLW A;  3IAZ A;  1USY H;  2V3U A;  3FVG A;  3MWB A;  1NFT A;  4H8J A;  4HCW A;  2HZK A;  3PUX E;  2XXH A;  3O6G A;  4LZ8 A;  3LUY A;  1M5C A;  1B3L A;  1IEJ A;  3V83 A;  2I0B A;  2ZNU A;  4EUO A;  4ZED A;  4P0G A;  4U21 A;  4ZEF A;  2Q2C A;  2F7B A;  5F1Q A;  1BLF A;  3I3V A;  3O6I A;  1UTB A;  5I58 B;  1LLS A;  3MP8 A;  2XX9 A;  2DS9 A;  4LON B;  3KFM A;  4X48 A;  2UYF A;  5J1D A;  3RLF E;  2F36 A;  1MY0 A;  2D3I A;  2ONS A;  1EZO A;  2PYY A;  5I2N A;  1SYI A;  4TLM B;  4R2F A;  2D21 A;  3N26 A;  1FQF A;  4DLD A;  4YB7 A;  1RYO A;  4JXI A;  4OES A;  1PBQ A;  5I57 A;  3L6G A;  1IIT A;  3USD A;  2HCA A;  3KSX A;  2X26 A;  4P0I A;  4NWD A;  3B6T A;  4R6K A;  3PUV E;  2F6G A;  2A5T A;  2QS2 A;  2XXP A;  4OET A;  1URS A;  2UVG A;  4I8C A;  3K1P A;  4WED A;  1B0H A;  5JTY A;  3A09 A;  1I6Q A;  2H4I A;  3LSL A;  2GRV A;  3M3K A;  4GXA A;  4Q0C A;  4R2B A;  4H8I A;  2PMS A;  1Q1K A;  4LZ7 A;  4EF2 A;  1FQE A;  2XXQ A;  3KOS A;  3G7W A;  5I59 A;  4YKP A;  4ZEC A;  3LR1 A;  3FXQ A;  2F7C A;  3HCQ A;  3CI8 A;  3IO4 A;  2VGQ A;  4IY6 A;  2ZNS A;  2V84 A;  3DP4 A;  4WXJ A;  5ICT A;  3OSR A;  4GXS B;  5AA1 A;  1JW4 A;  1ATG A;  1IQ7 A;  1MM6 A;  4N13 A;  4GD5 A;  4UAC A;  4U4S A;  5H8H B;  3OO9 A;  3PPO A;  1P99 A;  4PFT A;  3V89 B;  1MY2 A;  3CSG A;  4RNS A;  4RPO A;  2DE2 A;  1LB8 A;  5TP9 A;  3EHT A;  1EH3 A;  3IB1 A;  1MY1 A;  4LUB A;  5ITP A;  3VVE A;  3LSW A;  1MQD A;  2DOJ A;  2XXR A;  4AB5 A;  4I1D A;  1LAG E;  1MXX A;  5HBC A;  3MUQ A;  3K6X A;  3C35 A;  4OQO A;  3D4C A;  3S9M C;  3U1O A;  2XX8 A;  1FW0 A;  1MDQ A;  2Y7I A;  3GLB A;  2I3V A;  4DIG A;  2FA7 A;  4KYE A;  5CRY A;  5CBS A;  1B9J A;  1B4H A;  2UVJ A;  1ZIU A;  3U92 A;  1EU8 A;  1FTM A;  1UIU A;  4BLA A;  4QHQ A;  3DM0 A;  1YTV A;  4ELP A;  2Q89 A;  5DVJ A;  4NF4 B;  1N7W A;  2QJE A;  1A99 A;  4R9F A;  3TEP A;  5H8F B;  3EPE A;  4N6P A;  5AA2 B;  1ZU0 A;  4C1T A;  5BWJ A;  2I58 A;  3G3H A;  2GHA A;  2ALU A;  1J1N A;  1LBC A;  1VFE A;  4ESX A;  1USY E;  2QPQ A;  4YU0 A;  4E0W A;  4OEU A;  3H03 A;  3TEL A;  2REG A;  3RUM A;  3QXM A;  4IGT A;  1PC3 A;  1YPN A;  3GBB A;  1RKM A;  1B52 A;  1FTL A;  2UXA A;  1N76 A;  1DMB A;  1N3W A;  4R74 A;  1B0L A;  4ZE8 A;  5DVI A;  5AA4 A;  3O2A A;  3FAS A;  1MXW A;  1UTH B;  4OTE A;  4MF3 A;  3C32 A;  3TKD A;  2DWH A;  4QRZ A;  2UVI A;  5CC2 A;  1OLC A;  3TQL A;  1I6A A;  3KEI A;  3MZ1 A;  3C4M A;  1VE4 A;  1KWH A;  3ONM A;  3SEV A;  4QSE A;  2DXR A;  3KJT A;  1PB8 A;  3MVX A;  3MAM A;  4MFI A;  3THI A;  1LST A;  1B3G A;  3SET A;  3ZKL A;  3G3F A;  2H99 A;  1JET A;  1MY4 A;  4RJZ A; 
#chains in the Genus database with same CATH topology
 3FXB A;  2Z8F A;  3PUZ E;  2HHM A;  2Q8J A;  2I3W A;  2F34 A;  2FIX A;  2RC7 A;  2O7I A;  1NV1 A;  4N15 A;  2QL3 A;  2ZYN A;  4IO7 A;  2DVC A;  4KHZ E;  2Q74 A;  2FNC A;  1LFH A;  4AB6 A;  3T1B A;  1RDZ A;  2M8C A;  2HAV A;  3RTW B;  3SEX A;  1NUW A;  1SVX B;  3MP1 A;  1H43 A;  2E0S A;  3GXA A;  4PET A;  3K6V A;  1OLA A;  1MQG A;  3RYD A;  1M5E A;  3FJM A;  5LOM A;  3LSF B;  4GWW A;  3VE1 B;  3MP6 A;  1PBP A;  4OXV A;  5EYH A;  3LUZ A;  1P1U A;  1FTA A;  1ELJ A;  1I6B A;  3CIJ A;  2QFL A;  2AL5 A;  1UQW A;  4KYD A;  1G0I A;  5F24 A;  3CR9 A;  5L9S A;  1B5I A;  1NI9 A;  3MJN A;  3D1R A;  4GL0 A;  1FQD A;  4G68 B;  3GZG A;  4BDO A;  4KQP A;  3U8Q A;  3Q29 A;  2FIE A;  2I6E A;  5JEI A;  1POY 1;  4ZEK A;  3FXU A;  3BIG A;  3OO6 A;  5TU0 A;  4F19 A;  3K4U A;  4LN5 A;  3WAE A;  4GX6 A;  4N07 A;  4QFO A;  4HE0 A;  4YB6 A;  1B1H A;  5DEX A;  3KZG A;  1OVT A;  3RPW A;  3IOT A;  3HHG A;  1SD3 A;  2GHB A;  4NMY A;  2F97 A;  1NH8 A;  3TFL A;  5I84 A;  4PP0 A;  3H6U A;  3IOR A;  3Q26 A;  1SI1 A;  1B40 A;  2O1M A;  3CG1 A;  2ONK E;  4MNP A;  2WEF A;  4MNI A;  5H8Q A;  3AXF A;  4YIC A;  3IO6 A;  4XXU A;  1DTG A;  5FHN A;  1PB9 A;  4KD5 A;  1O64 A;  3EF7 A;  4JWY A;  2I48 A;  2H5Y A;  4QXD A;  5TPA A;  5A5X A;  5EHS A;  3CVG A;  5KCJ B;  1LBZ A;  1TWY A;  4PE3 A;  2WBB A;  2OWT A;  4WEP A;  2V25 A;  1IME A;  1EYJ A;  2PX1 A;  5A5L A;  3OEM A;  3K6W A;  2O69 A;  1Z7N E;  1EZ9 A;  4N8Y A;  1ZTY A;  4H5G A;  3IOW A;  4IO6 A;  4FJP A;  1IXG A;  2WYP A;  2Z23 A;  3IB0 A;  1D4N A;  2UYE A;  4G61 A;  3TMG A;  4NF5 B;  4YMA A;  3C33 A;  1S9T A;  4I9D A;  1MXY A;  1IMB A;  1B4Z A;  4R72 A;  5I5P A;  4N4U A;  3O28 A;  3FAT A;  5IZZ A;  3RTF B;  3SES A;  2O7U A;  1LBW A;  1WOD A;  1MXZ A;  1GGG A;  2XD3 A;  5ELV A;  2B4M A;  1FJ6 A;  3FXR A;  3QAX A;  2P0S A;  5H8N B;  1JQF A;  3E13 X;  1GR2 A;  4GWY A;  3H3G A;  3O9P A;  3KG2 A;  4JSO A;  1Y4C A;  1QKA A;  4OEV A;  3U94 A;  1B1X A;  3U72 A;  3H7M A;  5T3J A;  4O7I A;  1NV2 A;  1FQB A;  1KA0 A;  1QUI A;  1ZMG A;  4H6D A;  3BKI B;  2RCA A;  3M3L A;  4GX4 A;  3N6U A;  1MY3 A;  5FTH A;  1YCJ A;  3RN8 A;  3W15 C;  3T9X B;  4THI A;  1TXF A;  1S50 A;  5LTC A;  4LQ5 A;  1RYX A;  2O84 X;  1OIB A;  4NWC A;  3H4Z A;  1NNT A;  4DCX A;  2HAU A;  3S2V A;  3VFJ A;  4G68 C;  4N6K A;  4IO5 A;  1B51 A;  2QVV A;  2HQ0 A;  3TPA A;  1L5T A;  1XI6 A;  1JEU A;  2XWI A;  2I0C A;  3PPR A;  4IO2 A;  3H6V A;  1HSL A;  4P8B A;  1OQG A;  4QF9 A;  4O3C A;  1JW5 A;  2YPN A;  5ISU A;  3PMX A;  3OMB A;  4NGU A;  1D9Q A;  3MST A;  3UA8 A;  4F2Q A;  1KZ8 A;  1A8F A;  2B3F A;  1P1N A;  3VXB A;  1R1N A;  1M5B A;  5ICQ A;  3CFZ A;  1FPK A;  1DBZ A;  1B7U A;  2VD2 A;  1Z7M E;  4FEB A;  3JYR A;  4HE1 A;  2O68 A;  4KCC A;  1WDN A;  3IX1 A;  2V3T A;  2RC8 A;  2CMO A;  3MVW A;  4JDF A;  1URD A;  3SEU A;  4NAP A;  1QUL A;  3QSL A;  1FPF A;  4Q30 B;  1P1O A;  1QGX A;  3C31 A;  2F78 A;  1ANF A;  4C1U A;  4ZEB A;  3ECR A;  4FOR A;  2WBD A;  4IR8 A;  2ANJ A;  2ZYM A;  2QRY A;  3GYY A;  3FJ7 A;  3P7I A;  3SEY A;  3OSQ A;  5EQ9 A;  3ZKK A;  4NF6 B;  1H76 A;  1M5D A;  4K3F A;  4NTL A;  1FRP A;  3L6H A;  1GVC A;  3O29 A;  5KDT B;  4PF6 A;  3C9H A;  4TLL B;  2XA5 A;  3SDF A;  3FJG A;  4OVS A;  5L9O A;  4O3B A;  1LBY A;  5DVF A;  4Q8R A;  2GH9 A;  5H8H A;  4ELO A;  3MBP A;  3PPN A;  3G3I A;  2ZZW A;  2UVH A;  1Y3P A;  3CG3 A;  3O97 A;  1B3F A;  3QK6 A;  4PAI A;  2H98 A;  2XXT A;  4XKQ A;  1A54 A;  1Y9U A;  1G0H A;  1OVB A;  3UP9 A;  1XT8 A;  2OBG A;  4F39 A;  4OYV A;  5JK4 A;  1FPD A;  2F5X A;  4QFL A;  1H3D A;  3LSX A;  1QVS A;  5AA3 A;  3KSJ A;  1SPI A;  1N84 A;  4G77 A;  4KYS A;  4NN3 A;  1JVY A;  3G3K A;  4GF8 A;  4ECF A;  5H8S A;  2Z8E A;  5IM2 A;  4FBP A;  2BJJ X;  2ZNT A;  2XD2 A;  4JVI A;  1FBE A;  1NV0 A;  3DP6 A;  2XWO A;  2QMW A;  4PDD A;  4X8R A;  1A8E A;  2XX7 A;  4PFB A;  1OQH A;  1BKA A;  1Q35 A;  2G29 A;  2Q8M A;  2XXY A;  4ND9 A;  4I62 A;  3FV1 A;  2RIN A;  3MC2 A;  3ZS6 A;  3GBA A;  2PBW A;  3PUW E;  3VVF A;  3N5L A;  5BUU A;  1DPP A;  3LBS A;  1B6H A;  3HPI A;  1R9Q A;  5H8F A;  2OCU A;  4XKP A;  1MXU A;  5AA2 A;  1AWB A;  1Q9D A;  4O3A A;  3SEW A;  4I3E A;  1NV3 A;  1NNP A;  1TFA A;  2RCB A;  4ZDM A;  4ZZE A;  2AL4 A;  3KN8 A;  3KJ7 A;  2XXW A;  4JVC A;  3SER A;  3MZ9 A;  3N94 A;  3RNN A;  2F6P A;  3VLV A;  1QKB A;  4MLV A;  3FVN A;  1B7Z A;  1K9Y A;  1LCF A;  1XHY A;  3S9E A;  3TCH A;  5ET5 A;  2WKY A;  3U93 A;  3TCF A;  1SW1 A;  3SKP A;  5EHM A;  4OZ9 A;  1AOV A;  4P11 A;  4JB7 A;  4U23 A;  2F3D A;  4YB5 A;  4ONY A;  1UTH A;  2VOZ A;  3IK6 B;  1NNF A;  4PBQ A;  4HE2 A;  3T9U A;  2DWJ A;  2DXY A;  1LFG A;  4ZZA A;  4R9G A;  4OHN A;  1SW5 A;  3A29 A;  3EHU A;  5I2K B;  2Y7W A;  3BFU A;  1URG A;  1AMF A;  1CB6 A;  1JEV A;  3S9L C;  3FV2 A;  1FTK A;  3D4G A;  3OEK A;  4BDR A;  1WVJ A;  3KGC A;  3TAJ A;  4PGP A;  2Q88 A;  2YJP A;  4RY1 A;  3BFT A;  4PAK A;  2V93 A;  4MBP A;  1VR5 A;  2X7Q A;  2AYS A;  4DE8 A;  2F35 A;  1BTJ A;  1H44 A;  2DE3 A;  4HXV A;  1FPE A;  5ITO A;  2QVU A;  1FBF A;  4P1E A;  4GVO A;  4NF8 B;  5F7V A;  1ZLQ A;  1A40 A;  3PUY E;  1MPC A;  4NG7 A;  2I4C A;  3Q27 A;  4RK2 A;  4X1D A;  3CFL A;  2DWA A;  1POT A;  5K2Y A;  3K02 A;  3ILT B;  1O63 A;  2DE4 A;  4LAT A;  4U2R A;  2DDK A;  2ZMB A;  4OVQ A;  5IKB A;  1US4 A;  3PD8 A;  1MM7 A;  4KI0 E;  3O66 A;  5I56 B;  1LCT A;  1DPE A;  4RK9 A;  3IJO B;  3ILU B;  5ET8 A;  3CSB A;  2A5S A;  5CMM A;  3H06 B;  1FPG A;  3T9V A;  2MKZ A;  4RPN A;  1YZ0 A;  2I4B A;  4LA9 A;  3FBP A;  5B7D A;  4F1U A;  1FQC A;  1LEV A;  4RA1 A;  1MPD A;  2F8D A;  3QUF A;  2PT2 A;  4Z0I A;  1ZJL A;  1N04 A;  1MRP A;  3B50 A;  4ZE9 A;  1OMP A;  4H65 A;  3IB2 A;  2NVU B;  3HO7 A;  5CMC A;  4DCY A;  2ZZV A;  1RDY A;  1SYH A;  3DP8 A;  3MPK A;  4G68 A;  4MAG A;  4EQB A;  4KCD A;  3UN6 A;  3BIH A;  1N3X A;  3R6U A;  3RQT A;  2Y7R A;  5H8Q B;  5CMK A;  1YYZ A;  3CFX A;  1FBG A;  3FVK A;  1B58 A;  4PC9 A;  2R71 A;  1LAF E;  4EF1 A;  3UGW A;  3QUJ A;  5DTB A;  3TTL A;  3IJX B;  3UIF A;  5HM4 B;  4R75 A;  2ONR A;  4IO4 A;  3RT8 A;  3TTR A;  5AE4 A;  4H46 A;  4JVD A;  4GL8 A;  4U4X A;  3B8B A;  1AL3 A;  3HN0 A;  3E3K A;  4OEN A;  4FE8 A;  4AQ4 A;  2VD3 A;  2RF1 A;  1TT1 A;  3OD7 A;  3CRB A;  3TTM A;  1US5 A;  5EYG A;  3M8U A;  3T93 B;  2O6A A;  1Y3Q A;  5B70 A;  3TZA A;  3FIR A;  4N81 A;  1CNQ A;  3N6T A;  4IB2 A;  3RY3 A;  4MNC A;  3T22 A;  2QSX A;  2Q9T A;  3T9H B;  1D9V A;  1PEB A;  5KCJ A;  1B5J A;  3HV1 A;  2DWI A;  4F3S A;  3FUZ A;  3E78 A;  5FHO A;  3R7X A;  2VP1 A;  4F3P A;  1YAE A;  1B3E A;  4R73 A;  2THI A;  3PGF A;  5CMB A;  3IFC A;  3LV0 A;  5IZ1 A;  4BDQ A;  4MX6 A;  3KBR A;  1MQJ A;  4PTK A;  4NF5 A;  4POX A;  5FBP A;  1UIV A;  2X7P A;  3NOH A;  1IMA A;  5CM6 A;  1FBH A;  4MH5 A;  2XXX A;  1UTB B;  4DXC A;  1B46 A;  2XXU A;  3TUS A;  4POW A;  4H0W A;  2V3Q A;  5FTI A;  4LP2 B;  4QFK A;  1FPI A;  2KLF A;  3R26 A;  4X1B A;  1FTO A;  1PB7 A;  3K1M A;  4YKJ A;  3K00 A;  1QW0 A;  4EQ9 A;  5I2N B;  5H8N A;  4HTG A;  4M1V A;  4PFY A;  4ZS9 A;  3HFU A;  3VDF A;  4LZ5 A;  1MQH A;  3IR1 A;  4XKN A;  5I57 B;  5I58 A;  2NUV A;  3FGS A;  4DDD A;  1LAH E;  4YKK A;  2QS1 A;  3I5O A;  1B32 A;  1AH5 A;  4PBH A;  4HCY A;  3EN3 A;  1N7X A;  4EXK A;  3W9W A;  3IOV A;  4GBV A;  4OMB A;  2AIX A;  4FAJ A;  3W9V A;  1NKX A;  1SW2 A;  2NOO A;  2XXV A;  1MXV A;  2A5T B;  4GOT A;  4BDN A;  3K0V A;  4F1V A;  4I40 A;  2H25 A;  4G2Z A;  4FIM A;  5KZT A;  1IXC A;  4PFU A;  3KC0 A;  2PT1 A;  1FSA A;  1B3H A;  1XVY A;  4OVT A;  2YLN A;  3ODB A;  4GFR A;  1QJM A;  5JTY B;  3MVY A;  2FHY A;  5K2X A;  4IO3 A;  4GX3 A;  1MPB A;  2DSF A;  4OER A;  4HW8 A;  3C34 A;  3JZJ A;  4NX1 A;  3B7D A;  4LVQ A;  4JWO A;  3RPL B;  5I59 B;  2DYX A;  3QYT A;  2HPG A;  4GWS A;  2DP8 A;  4RYA A;  1QUK A;  4O8M A;  4ELR A;  1F9B A;  2ZXT A;  4XTC Q;  4TQU Q;  4LQ2 A;  1Y1Z A;  1HSE A;  4H1X A;  2OWS A;  3Q25 A;  2E1S A;  2NXO A;  2ZYO A;  4XKR A;  2OLB A;  1FPL A;  4QSD A;  1FPJ A;  4EQ7 A;  5TP9 B;  5FHM A;  4ELQ A;  3RT6 B;  4RXL A;  1JW1 A;  2O1L A;  4QFN A;  3IOU A;  1T0K A;  1LB9 A;  3A3C A;  3M3F A;  3FVO A;  1XVX A;  1S7Y A;  4F3G A;  4R6H A;  1SI0 A;  1XOC A;  3EQ1 A;  4JBZ A;  4NF6 A;  5EQA A;  2QMX A;  1QUJ A;  2OJT A;  4OFO A;  5KDT A;  3PPQ A;  4BDM A;  2ESN A;  2KR0 A;  1B2H A;  2NWJ A;  2IEE A;  5EYF A;  3OEL A;  4AS5 A;  2Z22 A;  3MZB A;  3G3G A;  3QIM A;  3PV0 E;  2FYI A;  2P1S A;  1FBD A;  1JNF A;  4HS7 A;  4KR5 A;  3S4U A;  2GQ1 A;  5EQ7 A;  2CZI A;  1B5H A;  2B4L A;  1XC1 A;  4MHF A;  1K9Z A;  4IY5 A;  2RC9 A;  2QS4 A;  4XIG Q;  3C36 A;  4G8M A;  4MLQ A;  3VXC A;  2VHA A;  1EYI A;  2R9J A;  4NED A;  3Q28 A;  1DOT A;  3V8X B;  3B6Q A;  4DXB A;  4GWU A;  3OEN A;  2ABH A;  2QS3 A;  4NF0 A;  4YAH X;  3MW0 A;  5I3S A;  1LAX A;  1ZBM A;  1B05 A;  3OXN A;  3UOR A;  2CZL A;  4DI3 D;  4F18 A;  4L17 A;  2PFZ A;  4GRK A;  4NF4 A;  3K2D A;  4Z7E A;  2HEU A;  2KQZ A;  3MQ9 A;  1IMF A;  3PMW A;  4F22 A;  1MG1 A;  5IGA A;  3TYH A;  2G93 A;  3KOT A;  3TDJ A;  4F3B A;  2XWV A;  2W7Y A;  3ZSF A;  4OWD A;  4JWX A;  3FZV A;  2OZZ A;  2XHD A;  5AA4 B;  2PVU A;  4O7M A;  1LBX A;  3H6T A;  2R6G E;  4F1Y A;  1DSN A;  3KN3 A;  2FVZ A;  1B7H A;  4PDH A;  4QSC A;  4DI4 B;  1N0T A;  1Y20 A;  2RKM A;  4GQO A;  2XXI A;  4DXU A;  1BIY A;  3BBR A;  1FPB A;  1TFD A;  4X9T A;  1CE2 A;  3RGY A;  1A7L A;  4N8G A;  5IZ3 B;  3TQW A;  4OAN A;  4X04 A;  2QVR A;  5CBR A;  4FEC A;  3IL1 B;  5DT6 A;  1DCU A;  2P2A A;  1NL5 A;  2JJK A;  3PMV A;  2ZYK A;  2P3N A;  5ESY A;  3KBZ A;  4E0X A;  2REJ A;  2CZH A;  4Q5T A;  3EHS A;  5EQ8 A;  4YMB A;  2CEX A;  1JVX A;  1II5 A;  1LGB C;  4ZEI A;  3E9X A;  3FD3 A;  1D3K A;  1A55 A;  1NUY A;  3OO7 A;  1NV5 A;  4U22 A;  3DLN A;  2DQV A;  3E4R A;  5I7I A;  2I49 A;  4PFW A;  5I2K A;  1LBB A;  3A3U A;  1GV8 A;  4ESW A;  5CI5 A;  4I3Y A;  2OK2 A;  3O6H A;  1FTJ A;  3LC8 A;  1HSJ A;  4M4G A;  5AA2 D;  1BP5 A;  1GTK A;  3K01 A;  4NHB A;  4YZZ A;  4C0R A;  3TTK A;  3VV5 A;  4XEQ A;  4KPT A;  1SQY A;  4GLI A;  1AIV A;  1NUX A;  5M2V A;  1RDX A;  1Y4T A;  4NF8 A;  1O7T A;  1SW4 A;  4H67 A;  4NQ8 A;  1NMU A;  4R6Y A;  2H9B A;  1VSO A;  2B65 A;  3T96 B;  1IIW A;  3F11 A;  4KFQ A;  5IAI A;  1H45 A;  4BDL A;  5L8D A;  1R6Z A;  4F31 B;  2Z8D A;  4WKM A;  4U1O A;  1FJ9 A;  4FAT A;  2VPO A;  4U1Z A;  2OX3 A;  2LAO A;  4GIZ A;  4PCD A;  3B6W A;  3MVZ A;  5I56 A;  1SBP A;  1XS5 A;  3OO8 A;  2Y7P A;  4F29 A;  4OFJ A;  5HPQ A;  1DTZ A;  3PU5 A;  3HST A;  5DEX B;  4YKI A;  2Q2A A;  4QFP A;  2HFB A;  4FED A;  3VLU A;  1NV4 A;  2P3V A;  4QBA A;  4F2O A;  3WAF A;  4N17 A;  3TTN A;  4OVP A;  3VVD A;  3H6W A;  1LFI A;  1R9L A;  1FCK A;  4G8N A;  1I69 A;  2O51 A;  4GWX A;  3KN7 A;  3PTY A;  4ISU A;  4PQJ A;  1IXI A;  2HZL A;  1IUD A;  3UK4 A;  1INP A;  1P1Q A;  3HHF A;  1D9Y A;  2F7A A;  4G4P A;  2DVZ A;  1EZP A;  1MS7 A;  3K1N A;  1KA1 A;  4IGR A;  4JSD A;  1FQA A;  1NNK A;  3EKI A;  3CHG A;  3TCG A;  1FBP A;  1ZKB A;  5L9M A;  4OVJ A;  2Y84 A;  5TPA B;  2Y7K A;  4UA8 A;  4OFL A;  2IA4 A;  5A5X B;  1MDP 1;  2WYK A;  3I6V A;  1MQI A;  1IXH A;  4P9K A;  3SZP A;  3PPP A;  3T66 A;  3MPL A;  4DZ1 A;  4XF5 A;  4MIJ A;  4TOZ A;  3S9N C;  4NE4 A;  1PDA A;  4MJO A;  1MH3 A;  2GFE A;  2B3B A;  4EDP A;  1M5F A;  3ROJ A;  4N6D A;  1P1W A;  1VFD A;  4EXL A;  3E79 A;  1MH4 A;  1IMD A;  4H5F A;  4AS4 A;  4GWO A;  3TOD A;  1Y1M A;  4P47 A;  3V5A A;  1IZ1 A;  2L5V A;  5DYH A;  3PD9 A;  3DEL B;  4PE5 B;  2D5W A;  3G3J A;  5DW8 A;  3K6U A;  3JV9 A;  3OOA A;  2HXW A;  1SDX A;  1Y3N A;  4G8H A;  1NH7 A;  3VLW A;  3IAZ A;  1USY H;  2V3U A;  3FVG A;  3MWB A;  1NFT A;  4H8J A;  4HCW A;  2HZK A;  3PUX E;  2F3B A;  2XXH A;  3O6G A;  4LZ8 A;  3LUY A;  1M5C A;  1B3L A;  1IEJ A;  3V83 A;  2I0B A;  2ZNU A;  4EUO A;  4H45 A;  4ZED A;  4P3L A;  4P0G A;  4U21 A;  4ZEF A;  2Q2C A;  2F7B A;  3IFA A;  5F1Q A;  1BLF A;  3I3V A;  1IMC A;  3O6I A;  1UTB A;  5I58 B;  1LLS A;  3MP8 A;  4OVR A;  2XX9 A;  2DS9 A;  4LON B;  3KFM A;  4PF8 A;  4X48 A;  5ET7 A;  2UYF A;  2XWK A;  5J1D A;  3RLF E;  2F36 A;  1MY0 A;  2D3I A;  2ONS A;  1EZO A;  2PYY A;  4N91 A;  5I2N A;  1SYI A;  2CEY A;  4TLM B;  4MMP A;  4R2F A;  2D21 A;  3N26 A;  1FQF A;  4DLD A;  4YB7 A;  1RYO A;  4JXI A;  4OES A;  1PBQ A;  2VT5 A;  5I57 A;  3L6G A;  1IIT A;  3USD A;  2HCA A;  3KSX A;  4GWZ A;  2X26 A;  4P0I A;  4NWD A;  3B6T A;  4R6K A;  5LDZ A;  3PUV E;  3MYU A;  2F6G A;  2A5T A;  2QS2 A;  2XXP A;  4OET A;  2WX9 A;  4KXP A;  1URS A;  2UVG A;  4I8C A;  3K1P A;  4WED A;  1B0H A;  4PFI A;  5JTY A;  3A09 A;  1I6Q A;  2H4I A;  2BJI A;  2GRV A;  3LSL A;  3M3K A;  4GXA A;  4Q0C A;  4R2B A;  4H8I A;  2PMS A;  1Q1K A;  4LZ7 A;  4EF2 A;  1FQE A;  4MEV A;  2XXQ A;  2Y5K A;  3RPL A;  3KOS A;  3G7W A;  5I59 A;  4YKP A;  4ZEC A;  3LR1 A;  2R8T A;  3FXQ A;  2F7C A;  3HCQ A;  3CI8 A;  3IO4 A;  2VGQ A;  4IY6 A;  2ZNS A;  1EYK A;  2V84 A;  3DP4 A;  4WXJ A;  5ICT A;  3OSR A;  4GXS B;  5AA1 A;  4P1L A;  1JW4 A;  1ATG A;  1IQ7 A;  1NV6 A;  1MM6 A;  1VDW A;  4N13 A;  4GD5 A;  4UAC A;  4U4S A;  5H8H B;  3OO9 A;  3PPO A;  1P99 A;  4PFT A;  3V89 B;  1MY2 A;  3CSG A;  4RNS A;  4RPO A;  2DE2 A;  1LB8 A;  4UAB A;  5TP9 A;  3EHT A;  1EH3 A;  4OA4 A;  3IB1 A;  1MY1 A;  4LUB A;  2ZZX A;  5ITP A;  3VVE A;  2Y5L A;  3LSW A;  1MQD A;  2DOJ A;  4MCO A;  1FBC A;  2XXR A;  4PAF A;  1NV7 A;  4AB5 A;  4I1D A;  1LAG E;  1MXX A;  5HBC A;  3MUQ A;  3K6X A;  3C35 A;  2OWZ A;  4OQO A;  2VPN A;  5J16 A;  3D4C A;  1JP4 A;  3S9M C;  3U1O A;  2XX8 A;  1FW0 A;  1MDQ A;  2HXR A;  2Y7I A;  3GLB A;  4PFR A;  2I3V A;  4DIG A;  2FA7 A;  4KYE A;  5CRY A;  5CBS A;  1NUZ A;  1B9J A;  1B4H A;  2UVJ A;  1ZIU A;  3U92 A;  1EU8 A;  1FTM A;  1UIU A;  4BLA A;  4QHQ A;  3DM0 A;  3T0J A;  1YTV A;  4ELP A;  2Q89 A;  5DVJ A;  4NF4 B;  1N7W A;  2QJE A;  1LBV A;  1A99 A;  4R9F A;  3TEP A;  5H8F B;  3EPE A;  4N6P A;  5AA2 B;  1ZU0 A;  4C1T A;  5BWJ A;  2I58 A;  1BK4 A;  3G3H A;  2GHA A;  4P56 A;  2ALU A;  1J1N A;  1LBC A;  1VFE A;  4ESX A;  1USY E;  2QPQ A;  4YU0 A;  4E0W A;  4OEU A;  3H03 A;  3TEL A;  2REG A;  3RUM A;  3QXM A;  2PCR A;  4IGT A;  1PC3 A;  1YPN A;  3GBB A;  1RKM A;  1B52 A;  2CZK A;  1FTL A;  2UXA A;  1N76 A;  1DMB A;  1N3W A;  4R74 A;  1B0L A;  4ZE8 A;  5DVI A;  5AA4 A;  2XXK A;  3O2A A;  3FAS A;  3ISP A;  1MXW A;  1UTH B;  4OTE A;  4MF3 A;  3QMF A;  4GBW A;  3C32 A;  3TKD A;  2V4C A;  2FBP A;  4O94 A;  2DWH A;  4QRZ A;  2UVI A;  5CC2 A;  1OLC A;  4PGN A;  3TQL A;  5IZ3 A;  1I6A A;  3KEI A;  3MZ1 A;  1YXI A;  3C4M A;  1VE4 A;  1KWH A;  3ONM A;  3SEV A;  5ET6 A;  4QSE A;  2DXR A;  3KJT A;  1PB8 A;  3KC1 A;  3MVX A;  3MAM A;  4MFI A;  3THI A;  4XFE A;  2PFY A;  1LST A;  3U65 A;  1B3G A;  3SET A;  3ZKL A;  1DK4 A;  3G3F A;  2H99 A;  1JET A;  1MY4 A;  4RJZ A; 
#chains in the Genus database with same CATH homology
 2Z8F A;  3PUZ E;  2Q8J A;  2I3W A;  2F34 A;  2RC7 A;  2O7I A;  2QL3 A;  2ZYN A;  4IO7 A;  2DVC A;  4KHZ E;  2FNC A;  1LFH A;  4AB6 A;  2M8C A;  2HAV A;  3RTW B;  3SEX A;  1SVX B;  3MP1 A;  1H43 A;  2E0S A;  3GXA A;  4PET A;  3K6V A;  1OLA A;  1MQG A;  1M5E A;  3FJM A;  5LOM A;  3LSF B;  3VE1 B;  3MP6 A;  1PBP A;  4OXV A;  1P1U A;  1ELJ A;  1I6B A;  3CIJ A;  2AL5 A;  1UQW A;  4KYD A;  3CR9 A;  5L9S A;  1B5I A;  3MJN A;  4GL0 A;  1FQD A;  4G68 B;  3GZG A;  4BDO A;  4KQP A;  3U8Q A;  3Q29 A;  2I6E A;  5JEI A;  1POY 1;  4ZEK A;  3FXU A;  3OO6 A;  5TU0 A;  4F19 A;  3K4U A;  3WAE A;  4N07 A;  4QFO A;  4YB6 A;  1B1H A;  5DEX A;  3KZG A;  1OVT A;  3RPW A;  3IOT A;  3HHG A;  1SD3 A;  2GHB A;  4NMY A;  2F97 A;  1NH8 A;  3TFL A;  5I84 A;  4PP0 A;  3H6U A;  3IOR A;  3Q26 A;  1SI1 A;  1B40 A;  2O1M A;  3CG1 A;  2ONK E;  5H8Q A;  3AXF A;  4YIC A;  3IO6 A;  4XXU A;  1DTG A;  5FHN A;  1PB9 A;  4KD5 A;  1O64 A;  3EF7 A;  4JWY A;  2I48 A;  2H5Y A;  5TPA A;  5A5X A;  5EHS A;  3CVG A;  5KCJ B;  1TWY A;  2OWT A;  4WEP A;  2V25 A;  2PX1 A;  3OEM A;  3K6W A;  2O69 A;  1Z7N E;  1EZ9 A;  1ZTY A;  4H5G A;  3IOW A;  4IO6 A;  4FJP A;  1IXG A;  2Z23 A;  3IB0 A;  1D4N A;  2UYE A;  3TMG A;  4NF5 B;  4YMA A;  3C33 A;  1S9T A;  4I9D A;  1MXY A;  1B4Z A;  4R72 A;  3O28 A;  3FAT A;  3RTF B;  3SES A;  2O7U A;  1WOD A;  1MXZ A;  1GGG A;  2XD3 A;  5ELV A;  3FXR A;  3QAX A;  2P0S A;  5H8N B;  1JQF A;  3E13 X;  1GR2 A;  3H3G A;  3O9P A;  3KG2 A;  4JSO A;  1Y4C A;  1QKA A;  4OEV A;  3U94 A;  1B1X A;  3U72 A;  3H7M A;  1FQB A;  1QUI A;  1ZMG A;  4H6D A;  3BKI B;  2RCA A;  3M3L A;  3N6U A;  1MY3 A;  5FTH A;  1YCJ A;  3RN8 A;  3W15 C;  3T9X B;  4THI A;  1TXF A;  1S50 A;  4LQ5 A;  1RYX A;  2O84 X;  1OIB A;  4NWC A;  3H4Z A;  1NNT A;  4DCX A;  2HAU A;  3S2V A;  3VFJ A;  4G68 C;  4IO5 A;  1B51 A;  2HQ0 A;  3TPA A;  1L5T A;  1JEU A;  2I0C A;  3PPR A;  4IO2 A;  3H6V A;  1HSL A;  1OQG A;  4QF9 A;  4O3C A;  1JW5 A;  2YPN A;  5ISU A;  3PMX A;  3OMB A;  3UA8 A;  4F2Q A;  1A8F A;  2B3F A;  1P1N A;  3VXB A;  1R1N A;  1M5B A;  5ICQ A;  3CFZ A;  1B7U A;  2VD2 A;  1Z7M E;  4FEB A;  3JYR A;  2O68 A;  4KCC A;  1WDN A;  3IX1 A;  2V3T A;  2RC8 A;  2CMO A;  3MVW A;  4JDF A;  1URD A;  3SEU A;  1QUL A;  3QSL A;  4Q30 B;  1P1O A;  3C31 A;  2F78 A;  1ANF A;  4C1U A;  4ZEB A;  3ECR A;  4FOR A;  2ANJ A;  2ZYM A;  2QRY A;  3FJ7 A;  3P7I A;  3SEY A;  3OSQ A;  3ZKK A;  4NF6 B;  1H76 A;  1M5D A;  4K3F A;  4NTL A;  3L6H A;  1GVC A;  3O29 A;  5KDT B;  3C9H A;  4TLL B;  3SDF A;  3FJG A;  5L9O A;  4O3B A;  5DVF A;  4Q8R A;  2GH9 A;  5H8H A;  4ELO A;  3MBP A;  3PPN A;  3G3I A;  2UVH A;  1Y3P A;  3CG3 A;  3O97 A;  1B3F A;  3QK6 A;  2H98 A;  2XXT A;  4XKQ A;  1A54 A;  1Y9U A;  1OVB A;  3UP9 A;  1XT8 A;  2OBG A;  4F39 A;  4OYV A;  5JK4 A;  2F5X A;  4QFL A;  1H3D A;  3LSX A;  1QVS A;  5AA3 A;  3KSJ A;  1N84 A;  4G77 A;  4KYS A;  1JVY A;  3G3K A;  4GF8 A;  4ECF A;  5H8S A;  2Z8E A;  2BJJ X;  2ZNT A;  2XD2 A;  3DP6 A;  2QMW A;  1A8E A;  2XX7 A;  1OQH A;  1BKA A;  1Q35 A;  2G29 A;  2XXY A;  4ND9 A;  4I62 A;  3FV1 A;  2RIN A;  3MC2 A;  3ZS6 A;  3GBA A;  2PBW A;  3PUW E;  3VVF A;  3N5L A;  5BUU A;  1DPP A;  3LBS A;  1B6H A;  3HPI A;  1R9Q A;  5H8F A;  2OCU A;  4XKP A;  1MXU A;  5AA2 A;  4O3A A;  3SEW A;  1NNP A;  1TFA A;  2RCB A;  4ZDM A;  4ZZE A;  2AL4 A;  3KN8 A;  3KJ7 A;  2XXW A;  3SER A;  3MZ9 A;  3N94 A;  3RNN A;  2F6P A;  3VLV A;  1QKB A;  4MLV A;  3FVN A;  1B7Z A;  1LCF A;  1XHY A;  3S9E A;  3TCH A;  2WKY A;  3U93 A;  3TCF A;  1SW1 A;  3SKP A;  5EHM A;  4OZ9 A;  1AOV A;  4P11 A;  4JB7 A;  4U23 A;  4YB5 A;  4ONY A;  1UTH A;  2VOZ A;  3IK6 B;  1NNF A;  3T9U A;  2DWJ A;  2DXY A;  1LFG A;  4ZZA A;  4R9G A;  4OHN A;  1SW5 A;  3EHU A;  5I2K B;  2Y7W A;  3BFU A;  1URG A;  1AMF A;  1CB6 A;  1JEV A;  3S9L C;  3FV2 A;  1FTK A;  3D4G A;  3OEK A;  4BDR A;  1WVJ A;  3KGC A;  3TAJ A;  2Q88 A;  2YJP A;  4RY1 A;  3BFT A;  2V93 A;  4MBP A;  1VR5 A;  2X7Q A;  2AYS A;  4DE8 A;  2F35 A;  1BTJ A;  1H44 A;  2DE3 A;  5ITO A;  4GVO A;  4NF8 B;  5F7V A;  1ZLQ A;  1A40 A;  3PUY E;  1MPC A;  2I4C A;  3Q27 A;  4RK2 A;  4X1D A;  3CFL A;  2DWA A;  1POT A;  5K2Y A;  3K02 A;  3ILT B;  1O63 A;  2DE4 A;  4LAT A;  4U2R A;  2ZMB A;  5IKB A;  1US4 A;  3PD8 A;  1MM7 A;  4KI0 E;  3O66 A;  5I56 B;  1LCT A;  1DPE A;  4RK9 A;  3IJO B;  3ILU B;  3CSB A;  2A5S A;  5CMM A;  3H06 B;  3T9V A;  4RPN A;  2I4B A;  4LA9 A;  5B7D A;  4F1U A;  1FQC A;  4RA1 A;  1MPD A;  2F8D A;  3QUF A;  2PT2 A;  4Z0I A;  1ZJL A;  1N04 A;  1MRP A;  4ZE9 A;  1OMP A;  4H65 A;  3IB2 A;  2NVU B;  3HO7 A;  5CMC A;  4DCY A;  1SYH A;  3DP8 A;  3MPK A;  4G68 A;  4EQB A;  4KCD A;  3UN6 A;  1N3X A;  3R6U A;  3RQT A;  2Y7R A;  5H8Q B;  5CMK A;  3CFX A;  3FVK A;  1B58 A;  2R71 A;  1LAF E;  4EF1 A;  3UGW A;  3QUJ A;  5DTB A;  3TTL A;  3IJX B;  3UIF A;  5HM4 B;  4R75 A;  2ONR A;  4IO4 A;  3RT8 A;  3TTR A;  5AE4 A;  4GL8 A;  4U4X A;  1AL3 A;  3HN0 A;  3E3K A;  4OEN A;  4AQ4 A;  4FE8 A;  2VD3 A;  2RF1 A;  1TT1 A;  3OD7 A;  3CRB A;  3TTM A;  1US5 A;  3M8U A;  3T93 B;  2O6A A;  1Y3Q A;  5B70 A;  3TZA A;  3FIR A;  3N6T A;  4IB2 A;  3RY3 A;  3T22 A;  2QSX A;  2Q9T A;  3T9H B;  1D9V A;  1PEB A;  5KCJ A;  1B5J A;  3HV1 A;  2DWI A;  4F3S A;  3FUZ A;  5FHO A;  3R7X A;  2VP1 A;  4F3P A;  1YAE A;  1B3E A;  4R73 A;  2THI A;  3PGF A;  5CMB A;  4BDQ A;  3KBR A;  1MQJ A;  4NF5 A;  4POX A;  1UIV A;  2X7P A;  5CM6 A;  4MH5 A;  2XXX A;  1UTB B;  4DXC A;  1B46 A;  2XXU A;  3TUS A;  4POW A;  4H0W A;  2V3Q A;  5FTI A;  4LP2 B;  4QFK A;  2KLF A;  3R26 A;  4X1B A;  1FTO A;  1PB7 A;  3K1M A;  4YKJ A;  3K00 A;  1QW0 A;  4EQ9 A;  5I2N B;  5H8N A;  4HTG A;  4M1V A;  4PFY A;  4ZS9 A;  3VDF A;  4LZ5 A;  1MQH A;  3IR1 A;  4XKN A;  5I57 B;  5I58 A;  2NUV A;  3FGS A;  4DDD A;  1LAH E;  4YKK A;  2QS1 A;  3I5O A;  1B32 A;  1AH5 A;  4HCY A;  3EN3 A;  1N7X A;  4EXK A;  3W9W A;  3IOV A;  4FAJ A;  4OMB A;  2AIX A;  3W9V A;  1NKX A;  1SW2 A;  2NOO A;  2XXV A;  1MXV A;  2A5T B;  4GOT A;  4BDN A;  3K0V A;  4F1V A;  2H25 A;  4G2Z A;  4FIM A;  5KZT A;  1IXC A;  4PFU A;  2PT1 A;  1B3H A;  1XVY A;  2YLN A;  3ODB A;  4GFR A;  1QJM A;  5JTY B;  3MVY A;  5K2X A;  4IO3 A;  1MPB A;  2DSF A;  4OER A;  4HW8 A;  3C34 A;  3JZJ A;  3B7D A;  4LVQ A;  4JWO A;  5I59 B;  2DYX A;  3QYT A;  2DP8 A;  4RYA A;  1QUK A;  4ELR A;  1F9B A;  2ZXT A;  4XTC Q;  4TQU Q;  4LQ2 A;  1Y1Z A;  1HSE A;  4H1X A;  2OWS A;  3Q25 A;  2E1S A;  2NXO A;  2ZYO A;  4XKR A;  2OLB A;  4QSD A;  4EQ7 A;  5TP9 B;  5FHM A;  4ELQ A;  3RT6 B;  4RXL A;  1JW1 A;  2O1L A;  4QFN A;  3IOU A;  1T0K A;  1LB9 A;  3A3C A;  3M3F A;  3FVO A;  1XVX A;  1S7Y A;  4F3G A;  4R6H A;  1SI0 A;  1XOC A;  3EQ1 A;  4JBZ A;  4NF6 A;  2QMX A;  1QUJ A;  2OJT A;  4OFO A;  5KDT A;  3PPQ A;  4BDM A;  2ESN A;  1B2H A;  2NWJ A;  2IEE A;  5EYF A;  3OEL A;  2Z22 A;  3MZB A;  3G3G A;  3QIM A;  3PV0 E;  2FYI A;  2P1S A;  1JNF A;  4HS7 A;  4KR5 A;  3S4U A;  1B5H A;  1XC1 A;  4IY5 A;  2RC9 A;  2QS4 A;  4XIG Q;  3C36 A;  4G8M A;  4MLQ A;  3VXC A;  2VHA A;  2R9J A;  4NED A;  3Q28 A;  1DOT A;  3V8X B;  3B6Q A;  4DXB A;  3OEN A;  2ABH A;  2QS3 A;  4YAH X;  3MW0 A;  1LAX A;  3UOR A;  1ZBM A;  1B05 A;  3OXN A;  2CZL A;  4F18 A;  4L17 A;  4GRK A;  4NF4 A;  3K2D A;  4Z7E A;  2HEU A;  3MQ9 A;  3PMW A;  4F22 A;  1MG1 A;  3TYH A;  2G93 A;  3KOT A;  3TDJ A;  4F3B A;  2W7Y A;  3ZSF A;  4OWD A;  4JWX A;  3FZV A;  2OZZ A;  2XHD A;  5AA4 B;  2PVU A;  3H6T A;  2R6G E;  4F1Y A;  1DSN A;  3KN3 A;  1B7H A;  4QSC A;  1N0T A;  1Y20 A;  2RKM A;  4GQO A;  2XXI A;  4DXU A;  1BIY A;  3BBR A;  1TFD A;  4X9T A;  1CE2 A;  3RGY A;  1A7L A;  3TQW A;  5CBR A;  4FEC A;  3IL1 B;  5DT6 A;  2P2A A;  1NL5 A;  3PMV A;  2ZYK A;  4E0X A;  2REJ A;  4Q5T A;  3EHS A;  4YMB A;  1JVX A;  1II5 A;  1LGB C;  4ZEI A;  3E9X A;  3FD3 A;  1D3K A;  1A55 A;  3OO7 A;  4U22 A;  3DLN A;  2DQV A;  3E4R A;  2I49 A;  4PFW A;  5I2K A;  1LBB A;  3A3U A;  1GV8 A;  4ESW A;  5CI5 A;  2OK2 A;  3O6H A;  1FTJ A;  3LC8 A;  1HSJ A;  4M4G A;  5AA2 D;  1BP5 A;  1GTK A;  3K01 A;  4YZZ A;  4C0R A;  3TTK A;  3VV5 A;  4KPT A;  1SQY A;  4GLI A;  1AIV A;  5M2V A;  1Y4T A;  4NF8 A;  1O7T A;  1SW4 A;  4H67 A;  1NMU A;  4R6Y A;  2H9B A;  1VSO A;  2B65 A;  3T96 B;  1IIW A;  3F11 A;  4KFQ A;  5IAI A;  1H45 A;  4BDL A;  5L8D A;  1R6Z A;  4F31 B;  2Z8D A;  4WKM A;  4U1O A;  4FAT A;  4U1Z A;  2LAO A;  4GIZ A;  3B6W A;  3MVZ A;  5I56 A;  1SBP A;  1XS5 A;  3OO8 A;  2Y7P A;  4F29 A;  4OFJ A;  5HPQ A;  1DTZ A;  3PU5 A;  3HST A;  5DEX B;  4YKI A;  2Q2A A;  4QFP A;  2HFB A;  4FED A;  3VLU A;  4F2O A;  3WAF A;  3TTN A;  3VVD A;  3H6W A;  1LFI A;  1R9L A;  1FCK A;  4G8N A;  1I69 A;  2O51 A;  3KN7 A;  4ISU A;  4PQJ A;  1IXI A;  2HZL A;  1IUD A;  3UK4 A;  1P1Q A;  3HHF A;  1D9Y A;  2F7A A;  4G4P A;  2DVZ A;  1EZP A;  1MS7 A;  3K1N A;  4IGR A;  4JSD A;  1FQA A;  1NNK A;  3TCG A;  1ZKB A;  5L9M A;  4OVJ A;  2Y84 A;  5TPA B;  2Y7K A;  4UA8 A;  4OFL A;  2IA4 A;  5A5X B;  1MDP 1;  3I6V A;  1MQI A;  1IXH A;  3PPP A;  3T66 A;  3MPL A;  4DZ1 A;  4TOZ A;  3S9N C;  4NE4 A;  1PDA A;  1MH3 A;  2GFE A;  2B3B A;  4EDP A;  1M5F A;  1P1W A;  1VFD A;  4EXL A;  1MH4 A;  4H5F A;  4GWO A;  3TOD A;  1Y1M A;  3V5A A;  1IZ1 A;  5DYH A;  3PD9 A;  3DEL B;  4PE5 B;  2D5W A;  3G3J A;  3K6U A;  3JV9 A;  3OOA A;  2HXW A;  1SDX A;  1Y3N A;  4G8H A;  1NH7 A;  3VLW A;  3IAZ A;  1USY H;  2V3U A;  3FVG A;  3MWB A;  1NFT A;  4H8J A;  4HCW A;  2HZK A;  3PUX E;  2XXH A;  3O6G A;  4LZ8 A;  3LUY A;  1M5C A;  1B3L A;  1IEJ A;  3V83 A;  2I0B A;  2ZNU A;  4EUO A;  4ZED A;  4P0G A;  4U21 A;  4ZEF A;  2Q2C A;  2F7B A;  5F1Q A;  1BLF A;  3I3V A;  3O6I A;  1UTB A;  5I58 B;  1LLS A;  3MP8 A;  2XX9 A;  2DS9 A;  4LON B;  3KFM A;  4X48 A;  2UYF A;  5J1D A;  3RLF E;  2F36 A;  1MY0 A;  2D3I A;  2ONS A;  1EZO A;  2PYY A;  5I2N A;  1SYI A;  4TLM B;  4R2F A;  2D21 A;  3N26 A;  1FQF A;  4DLD A;  4YB7 A;  1RYO A;  4JXI A;  4OES A;  1PBQ A;  5I57 A;  3L6G A;  1IIT A;  3USD A;  2HCA A;  3KSX A;  2X26 A;  4P0I A;  4NWD A;  3B6T A;  4R6K A;  3PUV E;  2F6G A;  2A5T A;  2QS2 A;  2XXP A;  4OET A;  1URS A;  2UVG A;  4I8C A;  3K1P A;  4WED A;  1B0H A;  5JTY A;  3A09 A;  1I6Q A;  2H4I A;  3LSL A;  2GRV A;  3M3K A;  4GXA A;  4Q0C A;  4R2B A;  4H8I A;  2PMS A;  1Q1K A;  4LZ7 A;  4EF2 A;  1FQE A;  2XXQ A;  3KOS A;  3G7W A;  5I59 A;  4YKP A;  4ZEC A;  3LR1 A;  3FXQ A;  2F7C A;  3HCQ A;  3CI8 A;  3IO4 A;  2VGQ A;  4IY6 A;  2ZNS A;  2V84 A;  3DP4 A;  4WXJ A;  5ICT A;  3OSR A;  4GXS B;  5AA1 A;  1JW4 A;  1ATG A;  1IQ7 A;  1MM6 A;  4N13 A;  4GD5 A;  4UAC A;  4U4S A;  5H8H B;  3OO9 A;  3PPO A;  1P99 A;  4PFT A;  3V89 B;  1MY2 A;  3CSG A;  4RNS A;  4RPO A;  2DE2 A;  1LB8 A;  5TP9 A;  3EHT A;  1EH3 A;  3IB1 A;  1MY1 A;  4LUB A;  5ITP A;  3VVE A;  3LSW A;  1MQD A;  2DOJ A;  2XXR A;  4AB5 A;  4I1D A;  1LAG E;  1MXX A;  5HBC A;  3MUQ A;  3K6X A;  3C35 A;  4OQO A;  3D4C A;  3S9M C;  3U1O A;  2XX8 A;  1FW0 A;  1MDQ A;  2Y7I A;  3GLB A;  2I3V A;  4DIG A;  2FA7 A;  4KYE A;  5CRY A;  5CBS A;  1B9J A;  1B4H A;  2UVJ A;  1ZIU A;  3U92 A;  1EU8 A;  1FTM A;  1UIU A;  4BLA A;  4QHQ A;  3DM0 A;  1YTV A;  4ELP A;  2Q89 A;  5DVJ A;  4NF4 B;  1N7W A;  2QJE A;  1A99 A;  4R9F A;  3TEP A;  5H8F B;  3EPE A;  4N6P A;  5AA2 B;  1ZU0 A;  4C1T A;  5BWJ A;  2I58 A;  3G3H A;  2GHA A;  2ALU A;  1J1N A;  1LBC A;  1VFE A;  4ESX A;  1USY E;  2QPQ A;  4YU0 A;  4E0W A;  4OEU A;  3H03 A;  3TEL A;  2REG A;  3RUM A;  3QXM A;  4IGT A;  1PC3 A;  1YPN A;  3GBB A;  1RKM A;  1B52 A;  1FTL A;  2UXA A;  1N76 A;  1DMB A;  1N3W A;  4R74 A;  1B0L A;  4ZE8 A;  5DVI A;  5AA4 A;  3O2A A;  3FAS A;  1MXW A;  1UTH B;  4OTE A;  4MF3 A;  3C32 A;  3TKD A;  2DWH A;  4QRZ A;  2UVI A;  5CC2 A;  1OLC A;  3TQL A;  1I6A A;  3KEI A;  3MZ1 A;  3C4M A;  1VE4 A;  1KWH A;  3ONM A;  3SEV A;  4QSE A;  2DXR A;  3KJT A;  1PB8 A;  3MVX A;  3MAM A;  4MFI A;  3THI A;  1LST A;  1B3G A;  3SET A;  3ZKL A;  3G3F A;  2H99 A;  1JET A;  1MY4 A;  4RJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...