2XXRA

Crystal structure of the gluk2 (glur6) wild-type lbd dimer in complex with glutamate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
248
structure length
248
Chain Sequence
SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
publication title Conformational Flexibility of the Ligand-Binding Domain Dimer in Kainate Receptor Gating and Desensitization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 86
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxrA02
3MBPA 2UVJA 3H6WA 3TMGA 4I1DA 4ZEKA 4IO4A 3VLWA 3PPOA 3N5LA 2Q88A 2XX9A 3VV5A 2E0SA 1USYH 3H6VA 2F97A 2DE3A 4QSCA 1IXHA 3I6VA 2Y7RA 2QMXA 4O3BA 2F36A 2DWIA 4RXLA 3FGSA 2PYYA 1EH3A 1URGA 5I2KB 3G3GA 2OLBA 1NL5A 3HCQA 5CMBA 4ELOA 1GTKA 2O1MA 4NWCA 4XKRA 5ITOA 5I57A 2UXAA 3V5AA 1PEBA 3RN8A 1A40A 1ANFA 2RCAA 4Q0CA 3PPQA 2M8CA 3HHGA 4R6KA 3RGYA 3O6HA 2QS4A 3CSBA 1XOCA 3RT6B 3FUZA 4JWXA 1IZ1A 4YICA 2Q8JA 3T9HB 3C33A 1MH3A 3BFTA 3VXBA 4OESA 4DIGA 1Y4TA 5CBSA 4EF1A 4JDFA 3AXFA 3EPEA 2HAUA 1B3EA 1MY1A 1Y3NA 1MQGA 1B3FA 1JQFA 4FJPA 1LFGA 1NNFA 1TT1A 3KSJA 2H98A 3PUYE 1SW5A 4NF4A 1NH7A 4YU0A 4DXCA 2H4IA 5JTYB 4F1YA 4X1DA 3O66A 3G7WA 4H65A 3VVFA 2V25A 4G77A 3SDFA 2Z8FA 4ZZEA 3HPIA 5EHSA 1B7UA 5I59B 4G4PA 3PUWE 5DTBA 3IAZA 3GXAA 3FVOA 5I58A 5JK4A 1MXYA 2V84A 1JW5A 3OSRA 2I3WA 1A99A 2F7BA 4PETA 3V89B 2O7UA 3W9VA 3IB1A 4U22A 4NF6A 1H43A 1XVXA 3TCFA 1NNPA 3LSLA 3FXRA 3TELA 4LP2B 4EF2A 2QPQA 1DOTA 2H99A 1UQWA 2OCUA 1LB9A 3VVEA 4GOTA 2YPNA 3PPPA 3PUXE 4I9DA 1M5DA 5I2NB 3KSXA 3ZSFA 1N3XA 3THIA 1SD3A 2D3IA 3MZ9A 2UVGA 4RK9A 2ESNA 3MZ1A 2A5SA 4X1BA 4EUOA 1US4A 4GVOA 4PP0A 2O51A 2RF1A 2Z8DA 2XHDA 4RJZA 1QVSA 4PFWA 2HXWA 2OZZA 4OZ9A 4H8IA 4U4XA 1EZ9A 2ZYNA 3O29A 1IIWA 4LZ5A 1QUIA 4JXIA 3VE1B 2XXWA 1MDP1 3DP4A 4LATA 3QAXA 3SEYA 3KN7A 3K6WA 3QUJA 3ECRA 3SEWA 4F2OA 3L6GA 1US5A 5FTIA 1MDQA 1P1WA 2Y7IA 2XXRA 3ILUB 4WXJA 1MXXA 1LBCA 3OO7A 3OENA 3QUFA 2RC8A 1N76A 3QK6A 3TTNA 4IY6A 1MM7A 3N6UA 2NVUB 4U2RA 4NF5B 3UN6A 3U93A 2F7AA 4QSDA 1LCTA 1LAGE 4FEBA 3TFLA 3LSXA 3SKPA 1A54A 3OEKA 4F18A 4R73A 4LZ8A 1I69A 3IOTA 4LUBA 2V3UA 4DXBA 2O68A 2VD2A 1MY4A 4NE4A 1B46A 1URSA 2F6PA 3N94A 4GRKA 1B6HA 4NF5A 4G2ZA 1ZKBA 1B9JA 4F3SA 2DXYA 4EQ9A 1MPBA 1UIUA 1Z7ME 3O9PA 5H8FA 1D9VA 3CIJA 4LZ7A 5AA2B 2P2AA 1OVTA 4UA8A 3EHSA 3Q28A 1ZU0A 1LAXA 4E0XA 1H44A 2O6AA 2PBWA 2F78A 2D5WA 2B3BA 1YAEA 4OXVA 1PDAA 3G3JA 3FD3A 4ZE8A 1WODA 1DMBA 2AYSA 1B0HA 1VR5A 4PQJA 5AA2A 1BP5A 3U94A 4ZEDA 4F22A 1Y3PA 3MP1A 3SEVA 5FTHA 1FQBA 4F3BA 1I6QA 3R7XA 4GFRA 4KPTA 2O7IA 3M8UA 1B58A 3B7DA 4GD5A 1Y1ZA 2B65A 4QFOA 3DP8A 1POY1 2GHBA 3S2VA 1LBBA 1POTA 2LAOA 1OVBA 1AL3A 2ZNUA 4P0IA 3CSGA 4QFNA 4FEDA 3K01A 2XXHA 3SERA 1URDA 2BJJX 2ANJA 5HPQA 1BIYA 3HHFA 3FJ7A 4GIZA 4ECFA 3K1NA 3FJMA 1IUDA 3H4ZA 2VHAA 1Y1MA 4JWOA 4YB6A 3ODBA 4YMAA 3WAFA 5DEXA 2DE2A 3LUYA 2RKMA 3BKIB 2FNCA 4OWDA 5H8SA 4PFYA 2F6GA 4H0WA 3DELB 3IJXB 4EXKA 1M5CA 3O6GA 4QFLA 1YTVA 4MH5A 2RINA 4WEPA 5ELVA 2REJA 4MF3A 2UVIA 1I6BA 3H06B 1FTJA 2NUVA 5TPAA 4RPNA 4X9TA 4AQ4A 4EDPA 2H25A 1MPDA 3KBRA 4IO5A 4G8NA 3IOVA 1Z7NE 1Y9UA 3VLUA 4G68A 2DWJA 2DP8A 5L8DA 5I57B 3PUZE 4IO7A 4H6DA 4EXLA 3OOAA 2XXTA 1B5HA 3PPNA 4P11A 3IOUA 2UYFA 2QJEA 3UK4A 4F1VA 1MXWA 4R2BA 2NWJA 3K1PA 3OD7A 5AE4A 4H5GA 1MRPA 1P1OA 1R6ZA 4OFJA 1P1NA 2OJTA 4QRZA 4ZE9A 3PUVE 4Z0IA 1N84A 3QYTA 4OETA 2QRYA 4Q30B 3IB2A 1OQHA 4RY1A 2FYIA 5KDTA 3IL1B 2ZYKA 3FJGA 3A09A 1IXCA 2OBGA 3TCGA 4NF4B 1ZBMA 3T22A 4OVJA 2A5TA 1B3GA 4O3AA 1NFTA 4N13A 4KQPA 2ZMBA 4FAJA 3LBSA 1LAHE 2F34A 2NXOA 4KYEA 3H6UA 1FTMA 5I84A 3VFJA 3HN0A 3OXNA 4F1UA 3PV0E 2I49A 3T9XB 3UA8A 3F11A 3Q25A 3PPRA 4BDOA 1ZTYA 3K6UA 2DVZA 3FIRA 1FTKA 1QUKA 2I48A 2Q2CA 1QKAA 4ESWA 3TDJA 3UGWA 3TAJA 3ZKKA 1CB6A 5I58B 3HSTA 2XXVA 3OEMA 2UVHA 2QS3A 3GZGA 2I6EA 3CVGA 1MXUA 3RTWB 1B51A 1B7ZA 1DPEA 2Y7WA 4NF6B 4Q8RA 4BDQA 3IK6B 5BUUA 2X7PA 4KHZE 1F9BA 2VOZA 3RLFE 1LGBC 4H1XA 5EYFA 3PU5A 1SYHA 1B3HA 4NEDA 3K1MA 1T0KA 3KJTA 2HZKA 2CMOA 1LCFA 4I8CA 4WEDA 3EF7A 4RYAA 2XX8A 3QSLA 2THIA 5L9OA 4ELPA 2YJPA 4R74A 4YAHX 3TPAA 4U4SA 4G68C 4HCYA 4ELQA 4PFTA 2Z23A 1DPPA 3MQ9A 3TZAA 3W15C 1Q1KA 2KLFA 4XIGQ 1A7LA 4JB7A 3TODA 3RY3A 4L17A 1MG1A 4DXUA 3GBAA 4KYDA 1P1QA 2HAVA 2I58A 5L9SA 1D3KA 3T66A 1DSNA 4R9GA 3FXUA 4AB6A 5AA4B 1JEUA 4ZDMA 3MW0A 1MPCA 1ATGA 3S4UA 1IEJA 1YPNA 5DVJA 2QS2A 2ONRA 1I6AA 2PT2A 4YKJA 1FQAA 1ELJA 1SBPA 3HO7A 3OO9A 2DYXA 3MPLA 4ND9A 2DE4A 4E0WA 2ZNTA 1PC3A 2O1LA 1ZMGA 1FTOA 1TXFA 5AA4A 2P0SA 4XKQA 5CRYA 2ALUA 3VLVA 3G3KA 2F5XA 3OO6A 5J1DA 1B5JA 1PB9A 4IB2A 4YZZA 3TEPA 1B4ZA 3CI8A 5DVIA 3K6VA 5I56B 2XXPA 1O64A 3UORA 2F7CA 5HBCA 3CFLA 3T96B 5HM4B 2FA7A 1MXVA 3EHUA 4YB7A 1LAFE 4FE8A 3MZBA 3IR1A 2QMWA 3B6TA 3C9HA 2ONKE 3GLBA 3LSFB 4IGRA 3C35A 1B7HA 3CFXA 3LSWA 5I56A 4BLAA 1N7WA 3IB0A 1Y3QA 3ILTB 5CMMA 1NMUA 5KCJB 3MP6A 4MLVA 5F7VA 1XC1A 1FCKA 4I62A 4DLDA 5H8FB 3M3KA 4MBPA 1H76A 1AMFA 4LVQA 1B2HA 4BDLA 1BKAA 5K2XA 3C31A 3U72A 2Y7KA 1XS5A 2IEEA 1FQEA 3TUSA 4RK2A 3U1OA 1MQDA 4BDRA 4KYSA 1VFEA 5KCJA 2GHAA 4R75A 4JSOA 1OIBA 2DOJA 1MH4A 1GV8A 3TTMA 1JW4A 1SVXB 2DSFA 3JZJA 2QSXA 4TLMB 2I4BA 4OENA 1N7XA 3H3GA 2Q2AA 2XD3A 1NNTA 2DQVA 5TP9A 4DDDA 1ZIUA 2ZNSA 3G3IA 2VD3A 3QXMA 1FW0A 5CMCA 5DT6A 3RQTA 2OWSA 2HEUA 4HW8A 4XKNA 3R6UA 4YKIA 5F1QA 3VDFA 2QL3A 3H7MA 5CI5A 1RYOA 1DTZA 2RC9A 3CRBA 1A8FA 1AIVA 4HCWA 1MY0A 1R1NA 2V3TA 1OLCA 2D21A 4NTLA 1AH5A 1P99A 5K2YA 2PT1A 4KI0E 1MS7A 4C1UA 3CG1A 5BWJA 2UYEA 1JEVA 1QULA 2R6GE 1NH8A 4IY5A 4IO3A 1DTGA 2V3QA 4QHQA 4DCYA 4C0RA 5ICTA 1EZPA 3PGFA 4GXAA 4OFOA 2X7QA 3MUQA 3BBRA 1CE2A 2O69A 5DEXB 3I5OA 4KCCA 3QIMA 3O2AA 4GXSB 3KEIA 3L6HA 1QUJA 3FASA 4R6HA 1QKBA 4XKPA 5AA2D 4OEVA 3RPWA 4H67A 3FATA 2Y84A 2DWHA 1S9TA 2VGQA 1ZLQA 3E4RA 3MJNA 3MVYA 3N26A 4U21A 5TPAB 3FXQA 1SW1A 4R2FA 4RPOA 3EHTA 4KD5A 1UTBA 3LR1A 4TQUQ 4DCXA 4G68B 2F8DA 1FQDA 3IJOB 2Y7PA 3PD8A 5ISUA 3IO4A 1S7YA 2I3VA 1IXGA 1B0LA 1B1HA 2F35A 4FECA 3Q29A 3MVXA 2OWTA 4EQBA 5CMKA 4PFUA 3A3UA 4ZZAA 2W7YA 4UACA 4QSEA 4KR5A 4MLQA 2Q89A 4U1OA 2I4CA 2ONSA 3EN3A 4XTCQ 4OERA 4NF8A 2IA4A 1PBPA 3SESA 3CG3A 5DVFA 3EQ1A 3M3FA 1HSEA 5KDTB 4WKMA 5H8HB 2XD2A 3DP6A 1GR2A 4ELRA 2A5TB 2H9BA 2HFBA 5A5XB 5FHNA 3PMXA 2DWAA 4JSDA 3DLNA 4U23A 4TOZA 3O28A 2XX7A 4F3GA 3FVKA 4LONB 5B70A 2CZLA 3T93B 1LSTA 4ZEFA 3V83A 5H8HA 4GQOA 4QFKA 5DYHA 4ONYA 4YMBA 4HTGA 5A5XA 3S9EA 3O97A 3I3VA 5I2KA 4OQOA 3M3LA 4RA1A 4H8JA 3V8XB 4JWYA 4FATA 1RKMA 2G93A 1HSJA 1NNKA 3KZGA 3SEXA 3S9LC 1GVCA 2ZYMA 3A3CA 3B6QA 3H03A 4ESXA 1B4HA 1TFDA 4PE5B 2I0CA 3H6TA 3C4MA 4KFQA 3U8QA 4DZ1A 3PMWA 3W9WA 4F29A 1MQJA 5JEIA 4OFLA 2AL5A 4OYVA 4G8HA 1UIVA 5M2VA 4TLLB 4FIMA 1SI0A 1PBQA 1LFHA 2AIXA 3IX1A 3E13X 1VSOA 1JNFA 3FVGA 1YCJA 4AB5A 5H8QB 1B40A 2HZLA 4NWDA 4O3CA 2AL4A 1VFDA 4ZEBA 2X26A 3K4UA 3E9XA 5JTYA 2R9JA 2HQ0A 2GFEA 4BDNA 4GF8A 3K2DA 3D4CA 3HV1A 3C34A 3RTFB 4KCDA 3U92A 2Z22A 1TWYA 2ABHA 1QJMA 4GLIA 3OELA 4U1ZA 5H8QA 1SW2A 3TYHA 1MQIA 4OEUA 5CBRA 5I59A 1WVJA 2XXXA 3PD9A 1TFAA 3SEUA 2DS9A 1B1XA 1M5BA 1S50A 3KJ7A 3KFMA 1MXZA 4XXUA 1PB8A 4K3FA 3KG2A 2R71A 2PX1A 1D9YA 1XVYA 1MY2A 3IO6A 3MVWA 4ZEIA 3K02A 3B6WA 3KOTA 3RUMA 1HSLA 4LQ2A 1ZJLA 1OLAA 3JYRA 4THIA 4H5FA 1KWHA 5EHMA 3K0VA 3SETA 1OQGA 1PB7A 1RYXA 3RT8A 3UP9A 4IGTA 2RCBA 2I0BA 1FQCA 5L9MA 5I2NA 1D4NA 4IO6A 2YLNA 4R72A 4QF9A 3T9VA 2PVUA 4EQ7A 3FV2A 5AA1A 1MM6A 5ICQA 2ZXTA 3C32A 1LLSA 1FTLA 1SI1A 3TQWA 2GH9A 5AA3A 3CFZA 2VP1A 1FQFA 5LOMA 1VE4A 1Y20A 2XXUA 1H45A 4OHNA 4YKPA 1USYE 1AOVA 1EU8A 4F39A 4N6PA 3PMVA 2G29A 1R9QA 1BLFA 1LB8A 3GBBA 3FV1A 3OSQA 1M5FA 2ZYOA 3S9NC 2XXQA 1O63A 4GL8A 4R9FA 2DXRA 3JV9A 3TCHA 3D4GA 3MWBA 1IXIA 1IITA 2P1SA 1UTHB 4F3PA 4LQ5A 3UIFA 5TP9B 1N04A 4Z7EA 2B3FA 2XXYA 2HCAA 3TKDA 3P7IA 4G8MA 1OMPA 3FVNA 3K00A 3CR9A 1A55A 1R9LA 4BDMA 2DVCA 3MVZA 3T9UA 1BTJA 5CM6A 3S9MC 2RC7A 3USDA 1J1NA 3Q27A 1UTHA 3VXCA 2H5YA 3IORA 3ZS6A 1EZOA 4DE8A 2O84X 4GL0A 3TTKA 1B3LA 3WAEA 1B05A 2REGA 4R6YA 3MC2A 1A8EA 3Q26A 1Q35A 2XXIA 4F2QA 3VVDA 1N0TA 2E1SA 3BFUA 4YB5A 4POWA 5CC2A 1B52A 3IOWA 3N6TA 3OMBA 1NKXA 4FORA 5ITPA 1M5EA 5FHOA 3KN3A 2QS1A 3KGCA 3O6IA 3R26A 4Q5TA 1MQHA 4P0GA 3OO8A 3G3FA 4LA9A 4M4GA 1N3WA 3E3KA 1JETA 1SYIA 3MP8A 1H3DA 3K6XA 4ZS9A 2GRVA 3C36A 5KZTA 1XT8A 1JVXA 1B32A 1L5TA 1UTBB 4POXA 3G3HA 1SW4A 1WDNA 3TTRA 1LFIA 1MY3A 2Z8EA 2WKYA 1JVYA 5H8NB 3ZKLA 4YKKA 3TTLA 4C1TA 4M1VA 4RNSA 3KOSA 2OK2A 4NMYA 3FZVA 1Y4CA 1O7TA 2V93A 4X48A 3KN8A 1SQYA 1II5A 4QFPA 2NOOA 4OTEA 2PMSA 3MAMA 1B5IA 1SDXA 3DM0A 4F19A 5H8NA 5FHMA 5IAIA 4GWOA 4ISUA 5B7DA 1QW0A 4OMBA 4NF8B 1GGGA 3TQLA 4F31B 4JBZA 4N07A 4ZECA 4HS7A 1P1UA 3LC8A 1XHYA 4MFIA 1JW1A 4IO2A 3ONMA 5TU0A 3RNNA 1IQ7A 3MPKA 2Q9TA 5IKBA
chains in the Genus database with same CATH superfamily
3MBPA 2UVJA 3H6WA 3TMGA 4I1DA 4ZEKA 4IO4A 3VLWA 3PPOA 3N5LA 1K9ZA 2Q88A 2XX9A 5IGAA 3VV5A 2E0SA 1USYH 3H6VA 2F97A 1FJ9A 2DE3A 4QSCA 1FBHA 1IXHA 3I6VA 2Y7RA 5IZZA 2QMXA 4O3BA 2F36A 2DWIA 4RXLA 3FGSA 2PYYA 4I40A 4MMPA 1EH3A 1URGA 5I2KB 4DI3D 3G3GA 2OLBA 1NL5A 3HCQA 5CMBA 2CZIA 4ELOA 1GTKA 1FTAA 2O1MA 4NWCA 1DCUA 4XKRA 5ITOA 5I57A 2UXAA 3V5AA 1PEBA 3RN8A 1A40A 1ANFA 2RCAA 2FBPA 4Q0CA 3PPQA 2M8CA 3HHGA 4R6KA 3RGYA 3O6HA 4PF6A 2QS4A 5J16A 4HE0A 3CSBA 1XOCA 3RT6B 3FUZA 4JWXA 5EQ9A 1IZ1A 4YICA 2XA5A 2Q8JA 3T9HB 3C33A 1MH3A 3BFTA 3VXBA 4OESA 4DIGA 1Y4TA 5CBSA 4EF1A 4JDFA 3AXFA 3EPEA 2HAUA 1B3EA 1MY1A 1Y3NA 1MQGA 1B3FA 1JQFA 4FJPA 1LFGA 1NNFA 1TT1A 2XWIA 3KSJA 1FPDA 5ET7A 2H98A 3PUYE 1SW5A 4NF4A 1NH7A 2KR0A 4YU0A 4DXCA 2H4IA 5JTYB 4F1YA 4X1DA 3O66A 3G7WA 4GBWA 4H65A 4GWYA 4N81A 3VVFA 4GWUA 3EKIA 2V25A 4G77A 3SDFA 2Z8FA 4ZZEA 3HPIA 1FPGA 5EHSA 1B7UA 5I59B 1NV4A 4G4PA 3RPLB 3PUWE 5DTBA 3IAZA 3GXAA 3LUZA 4MAGA 1FRPA 1YXIA 3FVOA 5I58A 5JK4A 1MXYA 2V84A 1JW5A 3OSRA 4AS4A 2I3WA 1A99A 2XWVA 2F7BA 1FBEA 4PETA 3V89B 2O7UA 3W9VA 5ET8A 3IB1A 4U22A 4NF6A 1H43A 3RPLA 1XVXA 3TCFA 1NNPA 3LSLA 3FXRA 3TELA 4LP2B 4EF2A 1IMDA 2QPQA 1DOTA 2H99A 1UQWA 4OVTA 2OCUA 1LB9A 5EYGA 3VVEA 1FBDA 4GOTA 2YPNA 3PPPA 3PUXE 4I9DA 1M5DA 5I2NB 4OVQA 3KSXA 3ZSFA 1N3XA 1JP4A 3THIA 1SD3A 2D3IA 3MZ9A 2UVGA 4RK9A 2ESNA 3MZ1A 2A5SA 4X1BA 4MJOA 4EUOA 1IMEA 1US4A 4GVOA 4PP0A 4NAPA 2O51A 2RF1A 2Z8DA 2XHDA 2F3BA 4RJZA 1QVSA 4PFWA 2HXWA 2OZZA 4OZ9A 4H8IA 1K9YA 4U4XA 1EZ9A 2ZYNA 3O29A 1IIWA 4LZ5A 1QUIA 4JXIA 3VE1B 2XXWA 1MDP1 3DP4A 4LATA 3QAXA 3SEYA 4PAKA 3KN7A 2Q8MA 3K6WA 3QUJA 3ECRA 3SEWA 4F2OA 1NUZA 3L6GA 1US5A 5FTIA 1MDQA 1P1WA 2Y7IA 2XXRA 3ILUB 4WXJA 1MXXA 4GX3A 1LBCA 3OO7A 3IFCA 3OENA 3QUFA 1BK4A 5DW8A 2RC8A 1N76A 1NV7A 3QK6A 4GWZA 3TTNA 1YZ0A 4IY6A 1MM7A 3GYYA 3N6UA 1FBPA 2NVUB 4U2RA 4NF5B 4NX1A 3UN6A 3U93A 2F7AA 4QSDA 1LCTA 1LAGE 4FEBA 3TFLA 3LSXA 5FBPA 1A54A 3SKPA 3OEKA 4F18A 4R73A 4PDHA 1NUXA 4LZ8A 1I69A 3IOTA 4LUBA 4XEQA 2V3UA 4DXBA 2O68A 2VD2A 1MY4A 4NE4A 1B46A 1URSA 5EQ7A 2F6PA 3N94A 4GRKA 1D9QA 1B6HA 4NF5A 2WEFA 4G2ZA 1ZKBA 1B9JA 4F3SA 2DXYA 4EQ9A 1MPBA 1UIUA 1Z7ME 3O9PA 5H8FA 1D9VA 3CIJA 4LZ7A 5AA2B 2P2AA 1OVTA 4GBVA 4UA8A 3EHSA 3Q28A 1ZU0A 1XI6A 1LAXA 4E0XA 1H44A 2O6AA 2PBWA 2F78A 1KA0A 2D5WA 4MHFA 2B3BA 2OWZA 1YAEA 4OXVA 5EYHA 1PDAA 4O7MA 4MNPA 3G3JA 3FD3A 4ZE8A 1WODA 1DMBA 1NI9A 2AYSA 4KXPA 1B0HA 1VR5A 4PQJA 5AA2A 1BP5A 3U94A 2QVUA 4ZEDA 4F22A 1Y3PA 3MP1A 1FPLA 3SEVA 5FTHA 5IZ3A 1FQBA 4F3BA 1I6QA 1NV6A 3R7XA 4GFRA 4KPTA 2O7IA 3M8UA 1B58A 3B7DA 1FJ6A 2ZZWA 2WBDA 4GD5A 4MNCA 1Y1ZA 2B65A 4I3YA 4QFOA 3DP8A 1POY1 2GHBA 3S2VA 1LBBA 1POTA 2V4CA 2LAOA 1OVBA 1AL3A 2ZNUA 4P0IA 3CSGA 4QFNA 4FEDA 3BIHA 1G0HA 3K01A 2WBBA 2XXHA 3SERA 1URDA 2BJJX 4OANA 2R8TA 2ANJA 5HPQA 1BIYA 3HHFA 3FJ7A 4GIZA 4ECFA 3K1NA 3FJMA 1IUDA 3H4ZA 1NV3A 2VHAA 5ET6A 1Y1MA 4JWOA 4YB6A 3ODBA 4YMAA 3WAFA 5DEXA 2FVZA 2DE2A 3LUYA 2RKMA 3BKIB 2FNCA 4OWDA 5H8SA 4PFYA 2F6GA 4H0WA 3DELB 3IJXB 4EXKA 1M5CA 3O6GA 4QFLA 1YTVA 4MH5A 2RINA 4WEPA 5ELVA 2REJA 4MF3A 4P1EA 2UVIA 5ET5A 1I6BA 3H06B 1FTJA 2NUVA 5TPAA 4RPNA 4X9TA 4AQ4A 1FBCA 4EDPA 2H25A 1MPDA 2WX9A 3KBRA 4IO5A 4PBHA 4G8NA 3IOVA 1Z7NE 1Y9UA 3VLUA 4G68A 2DWJA 2DP8A 3B50A 5L8DA 5I57B 3PUZE 4IO7A 4H6DA 1VDWA 4EXLA 3OOAA 2XXTA 1B5HA 3PPNA 4P11A 3IOUA 2UYFA 4MX6A 2L5VA 2QJEA 3UK4A 4F1VA 1MXWA 4R2BA 2XWOA 2NWJA 3K1PA 3OD7A 5AE4A 4H5GA 1MRPA 1P1OA 1R6ZA 4OFJA 5EQ8A 1P1NA 2OJTA 4PF8A 4QRZA 4ZE9A 4JVDA 3PUVE 4Z0IA 4O7IA 1N84A 3QYTA 2HHMA 4OETA 2QRYA 4Q30B 3IB2A 4GX4A 1OQHA 4RY1A 2FYIA 5KDTA 3IL1B 2ZYKA 3FJGA 1INPA 3A09A 1IXCA 2OBGA 3TCGA 3U65A 4NF4B 1ZBMA 3T22A 4OVJA 2A5TA 1B3GA 4O3AA 4PCDA 1NFTA 4N13A 4KQPA 2ZMBA 4FAJA 3LBSA 2VT5A 1LAHE 4P9KA 2F34A 2NXOA 4KYEA 3H6UA 1FTMA 4FBPA 5I84A 3VFJA 3HN0A 3OXNA 4F1UA 3PV0E 2I49A 3T9XB 3UA8A 3F11A 3Q25A 3PPRA 4BDOA 1ZTYA 3K6UA 3FIRA 2DVZA 1FTKA 1QUKA 2I48A 2Q2CA 1QKAA 4ESWA 3TDJA 4N91A 3UGWA 3TAJA 3ZKKA 1CB6A 5I58B 4N8GA 3HSTA 2XXVA 3OEMA 2UVHA 2QS3A 3GZGA 4NHBA 2I6EA 3CVGA 4P56A 1LEVA 3A29A 1MXUA 1DBZA 4PFRA 3RTWB 1B51A 1B7ZA 1DPEA 2Y7WA 3HFUA 4NF6B 4Q8RA 4BDQA 3IK6B 5BUUA 2X7PA 4KHZE 1F9BA 2VOZA 3RLFE 4P47A 1LGBC 4H1XA 5EYFA 3PU5A 1SYHA 1B3HA 3PTYA 2HXRA 4NEDA 3K1MA 1T0KA 3KJTA 2HZKA 1QGXA 2CMOA 1NV5A 1LCFA 4PBQA 1FPIA 4I8CA 1G0IA 4WEDA 3EF7A 3KC1A 3ISPA 5ESYA 4RYAA 2XX8A 3QSLA 2THIA 5L9OA 2YJPA 4R74A 4YAHX 4ELPA 3TPAA 4U4SA 4G68C 4HCYA 4ELQA 1IMFA 4HE2A 4PFTA 2Z23A 1DPPA 3MQ9A 3TZAA 3W15C 1Q1KA 2KLFA 2PCRA 4XIGQ 4QXDA 1A7LA 4JB7A 3TODA 2WYKA 3RY3A 4L17A 1MG1A 4DXUA 5A5LA 3GBAA 4KYDA 1P1QA 2HAVA 2I58A 5L9SA 1D3KA 3T66A 1DSNA 4R9GA 3FXUA 4AB6A 3NOHA 5AA4B 4PE3A 1JEUA 4ZDMA 3MW0A 1MPCA 1ATGA 3S4UA 1IEJA 1YPNA 5DVJA 2CEYA 2QS2A 2ONRA 1I6AA 1IMAA 2PT2A 4YKJA 1FQAA 4GWSA 1ELJA 1SBPA 3HO7A 3OO9A 2DYXA 3MPLA 2FIEA 4ND9A 2DE4A 2KQZA 4E0WA 2ZNTA 1PC3A 2O1LA 1ZMGA 1FTOA 1TXFA 5AA4A 2P0SA 4XKQA 5CRYA 2ALUA 3VLVA 3G3KA 2F5XA 3OO6A 5J1DA 1B5JA 1PB9A 4OA4A 4IB2A 4YZZA 3TEPA 4AS5A 2P3NA 1B4ZA 3CI8A 5DVIA 3K6VA 5I56B 4P8BA 1FPEA 2XXPA 1O64A 3UORA 4GX6A 2F7CA 1KZ8A 5HBCA 3CFLA 3T96B 4PFBA 5HM4B 2FA7A 1MXVA 3EHUA 4YB7A 1LAFE 4FE8A 3MZBA 3T0JA 3IR1A 2QMWA 3B6TA 3C9HA 2ONKE 3GLBA 3LSFB 4IGRA 3C35A 4DI4B 1B7HA 3CFXA 3LSWA 5I56A 4BLAA 1N7WA 3IB0A 1Y3QA 4OVPA 3ILTB 4XFEA 4PGPA 5CMMA 1NMUA 5KCJB 3MP6A 4MLVA 5F7VA 1XC1A 1FCKA 4I62A 3SZPA 3KC0A 4DLDA 5H8FB 3M3KA 4MBPA 1H76A 1AMFA 2JJKA 4LVQA 1B2HA 4BDLA 1BKAA 5K2XA 3C31A 3U72A 4MIJA 3IFAA 2Y7KA 1XS5A 2IEEA 1FQEA 3TUSA 4RK2A 3U1OA 1MQDA 4BDRA 4KYSA 1VFEA 1YYZA 5KCJA 2GHAA 2Q74A 4R75A 4JSOA 4PAIA 4JVIA 4OVRA 1OIBA 4UABA 2DOJA 1MH4A 1GV8A 3TTMA 1JW4A 1SVXB 2DSFA 3JZJA 2QSXA 4TLMB 2I4BA 4MNIA 4OENA 1N7XA 3H3GA 5I5PA 2Q2AA 2XD3A 4NG7A 1NNTA 2DQVA 5TP9A 4DDDA 1ZIUA 2ZNSA 3G3IA 2VD3A 3QXMA 5IZ3B 1FPKA 1FW0A 5CMCA 5DT6A 5I7IA 3RQTA 2OWSA 2HEUA 4HW8A 4XKNA 5T3JA 3R6UA 4YKIA 5F1QA 3VDFA 2QL3A 3H7MA 2CZKA 5CI5A 1RYOA 1DTZA 2RC9A 3CRBA 1A8FA 1AIVA 1RDXA 4HCWA 1LBVA 1MY0A 1FPBA 1R1NA 2V3TA 1OLCA 2D21A 4NTLA 1AH5A 1P99A 5K2YA 2PT1A 4KI0E 1MS7A 4C1UA 3CG1A 5BWJA 2UYEA 1JEVA 1QULA 2R6GE 1NH8A 4IY5A 3FXBA 4P1LA 4IO3A 5IZ1A 1DTGA 2V3QA 4QHQA 4DCYA 4C0RA 5ICTA 1EZPA 3PGFA 4GXAA 4OFOA 2X7QA 3MUQA 3BBRA 1CE2A 1NV2A 3RYDA 2O69A 5DEXB 3I5OA 4KCCA 3QIMA 1NUWA 3O2AA 4GXSB 3KEIA 3L6HA 1QUJA 3FASA 4R6HA 1QKBA 4XKPA 5AA2D 4OEVA 4NQ8A 3RPWA 4H67A 3FATA 2Y84A 2DWHA 1S9TA 2VGQA 1ZLQA 2ZZXA 2QFLA 3E4RA 4GWXA 4H46A 3MJNA 3MVYA 2XXKA 1FPJA 3N26A 3BIGA 4U21A 5TPAB 3FXQA 1SW1A 5F24A 4R2FA 4RPOA 1EYIA 3EHTA 4KD5A 1UTBA 3LR1A 4HE1A 4TQUQ 4DCXA 4G68B 2F8DA 3MYUA 1FQDA 3IJOB 2Y7PA 3B8BA 3PD8A 5ISUA 1LBYA 3IO4A 2Y5LA 1S7YA 2I3VA 1IXGA 1B0LA 1B1HA 2F35A 4FECA 2QVRA 1CNQA 3Q29A 5I3SA 3MVXA 2OWTA 4EQBA 2F3DA 5CMKA 5LDZA 4PFUA 3A3UA 4ZZAA 2W7YA 4UACA 4QSEA 4KR5A 4MLQA 4U1OA 2Q89A 2I4CA 2ONSA 3EN3A 4XTCQ 2B4LA 4OERA 4NF8A 2IA4A 1PBPA 3SESA 3CG3A 5DVFA 3EQ1A 3M3FA 1HSEA 5KDTB 4X04A 1NUYA 4WKMA 2PFYA 2PFZA 2XD2A 3DP6A 5H8HB 1GR2A 4OVSA 4ELRA 2A5TB 2H9BA 2HFBA 5A5XB 5FHNA 2WYPA 3PMXA 2DWAA 4JSDA 3DLNA 4U23A 4TOZA 3O28A 2XX7A 4F3GA 4QBAA 3FVKA 4LONB 5B70A 5IM2A 2CZLA 3T93B 1LSTA 4ZEFA 3V83A 5H8HA 4GQOA 4QFKA 4N6DA 5DYHA 2VPOA 3QMFA 4ONYA 4YMBA 3E79A 4HTGA 5A5XA 3S9EA 3O97A 3I3VA 5I2KA 4OQOA 5LTCA 3M3LA 4RA1A 4H8JA 3V8XB 4JWYA 4JVCA 4FATA 1RKMA 2G93A 1HSJA 1NNKA 2CZHA 3KZGA 3SEXA 4P3LA 3S9LC 1GVCA 2ZYMA 3A3CA 3B6QA 3H03A 4ESXA 1B4HA 1TFDA 4PE5B 3E78A 2I0CA 3H6TA 3C4MA 4N4UA 4KFQA 3U8QA 4DZ1A 3PMWA 3W9WA 4F29A 1AWBA 1MQJA 5JEIA 4OFLA 2AL5A 4OYVA 4G8HA 1UIVA 5M2VA 1LBZA 4TLLB 4FIMA 1SI0A 1PBQA 1LFHA 2AIXA 4IR8A 3IX1A 3E13X 1VSOA 1JNFA 3FVGA 1YCJA 4AB5A 5H8QB 1B40A 2HZLA 4NWDA 4O3CA 2AL4A 1VFDA 4ZEBA 2VPNA 2X26A 3K4UA 3E9XA 5JTYA 2R9JA 2HQ0A 2GFEA 4BDNA 3ROJA 2ZZVA 4GF8A 3K2DA 3D4CA 3HV1A 3C34A 3RTFB 4KCDA 3U92A 2Z22A 4N15A 1TWYA 2ABHA 1QJMA 4GLIA 4PFIA 4X8RA 1RDYA 3OELA 4U1ZA 5H8QA 1SW2A 2P3VA 3CHGA 3TYHA 1MQIA 3KBZA 4OEUA 5CBRA 5I59A 1WVJA 2XXXA 3PD9A 1TFAA 3SEUA 2DS9A 1B1XA 1M5BA 1S50A 1RDZA 3KJ7A 3KFMA 1MXZA 4XXUA 1PB8A 4K3FA 3KG2A 2R71A 2PX1A 1D9YA 4PTKA 1XVYA 1MY2A 3IO6A 2MKZA 3MVWA 4ZEIA 3FBPA 3K02A 3B6WA 3KOTA 1FBGA 3RUMA 1HSLA 4LQ2A 1ZJLA 1OLAA 3JYRA 4THIA 4H5FA 1KWHA 5EHMA 1LBXA 3K0VA 3SETA 1OQGA 1EYKA 4PDDA 1PB7A 1RYXA 3RT8A 3UP9A 4IGTA 2RCBA 2I0BA 1FQCA 5L9MA 5I2NA 1D4NA 4IO6A 2YLNA 4R72A 4QF9A 4NN3A 1LBWA 3T9VA 3T1BA 2PVUA 4EQ7A 3FV2A 5AA1A 1MM6A 5ICQA 2ZXTA 3C32A 1LLSA 1FTLA 1SI1A 3TQWA 4O94A 2GH9A 5AA3A 3CFZA 2VP1A 1FQFA 2FIXA 5LOMA 1VE4A 1Y20A 2DDKA 4N8YA 2XXUA 1H45A 4OHNA 4YKPA 2CEXA 4MCOA 1USYE 1AOVA 1EU8A 4F39A 4N6PA 4O8MA 3PMVA 2G29A 4I3EA 1R9QA 1BLFA 1LB8A 3GBBA 3FV1A 3OSQA 1M5FA 4PC9A 2ZYOA 3S9NC 2Y5KA 2XXQA 1O63A 4GL8A 4R9FA 2GQ1A 2DXRA 3JV9A 3TCHA 3D4GA 3MWBA 4N17A 1IXIA 1IITA 2P1SA 1UTHB 4F3PA 4LQ5A 3UIFA 5TP9B 1N04A 4Z7EA 2B3FA 2XXYA 2HCAA 3TKDA 3P7IA 4G8MA 1IMCA 1OMPA 3FVNA 3K00A 2BJIA 3CR9A 1A55A 1R9LA 4MEVA 4BDMA 2DVCA 3MVZA 3T9UA 1BTJA 5CM6A 3S9MC 4HXVA 2RC7A 3USDA 1J1NA 4G61A 2FHYA 3Q27A 1UTHA 3VXCA 2H5YA 3IORA 3ZS6A 1EZOA 4DE8A 2O84X 4GL0A 3TTKA 1B3LA 3WAEA 1FBFA 1B05A 2REGA 4R6YA 3MC2A 1A8EA 3Q26A 1Q35A 2XXIA 4F2QA 3VVDA 1N0TA 2E1SA 3BFUA 4YB5A 2XWKA 3D1RA 4POWA 5CC2A 1B52A 3IOWA 4NGUA 1NV0A 3N6TA 3OMBA 1NKXA 4H45A 4FORA 5ITPA 1M5EA 1IMBA 5FHOA 3KN3A 2QS1A 3KGCA 3O6IA 3R26A 4Q5TA 1MQHA 1NV1A 4P0GA 3OO8A 3MSTA 3G3FA 2OX3A 4LA9A 4M4GA 1N3WA 1Q9DA 3E3KA 1JETA 1SYIA 3MP8A 2HPGA 1H3DA 3K6XA 4ZS9A 2QVVA 2GRVA 3C36A 5KZTA 3LV0A 1XT8A 1JVXA 1B32A 1L5TA 1UTBB 4POXA 3G3HA 1SW4A 1WDNA 1FSAA 1DK4A 1EYJA 3TTRA 1LFIA 1MY3A 1SPIA 2Z8EA 2WKYA 1JVYA 5H8NB 3ZKLA 4YKKA 3TTLA 4C1TA 4M1VA 4RNSA 3KOSA 2OK2A 4NMYA 4PAFA 3FZVA 1Y4CA 1O7TA 2V93A 4XF5A 4GWWA 4X48A 3KN8A 4N6KA 4LN5A 1SQYA 1II5A 1FPFA 4QFPA 2NOOA 4OTEA 2PMSA 3MAMA 1B5IA 1SDXA 3DM0A 2B4MA 4PGNA 4F19A 5H8NA 5FHMA 5IAIA 4GWOA 4ISUA 5B7DA 1QW0A 4OMBA 4NF8B 4NF0A 1GGGA 3TQLA 4F31B 4JBZA 4N07A 4ZECA 4HS7A 1P1UA 3LC8A 1XHYA 4MFIA 1JW1A 4IO2A 5EQAA 3ONMA 5TU0A 3RNNA 1IQ7A 3MPKA 2Q9TA 5IKBA 1KA1A
chains in the Genus database with same CATH topology
3MBPA 2UVJA 3H6WA 3TMGA 4I1DA 4ZEKA 4IO4A 3VLWA 3PPOA 3N5LA 2Q88A 2XX9A 3VV5A 2E0SA 1USYH 3H6VA 2F97A 2DE3A 4QSCA 1IXHA 3I6VA 2Y7RA 2QMXA 4O3BA 2F36A 2DWIA 4RXLA 3FGSA 2PYYA 1EH3A 1URGA 5I2KB 3G3GA 2OLBA 1NL5A 3HCQA 5CMBA 4ELOA 1GTKA 2O1MA 4NWCA 4XKRA 5ITOA 5I57A 2UXAA 3V5AA 1PEBA 3RN8A 1A40A 1ANFA 2RCAA 4Q0CA 3PPQA 2M8CA 3HHGA 4R6KA 3RGYA 3O6HA 2QS4A 3CSBA 1XOCA 3RT6B 3FUZA 4JWXA 1IZ1A 4YICA 2Q8JA 3T9HB 3C33A 1MH3A 3BFTA 3VXBA 4OESA 4DIGA 1Y4TA 5CBSA 4EF1A 4JDFA 3AXFA 3EPEA 2HAUA 1B3EA 1MY1A 1Y3NA 1MQGA 1B3FA 1JQFA 4FJPA 1LFGA 1NNFA 1TT1A 3KSJA 2H98A 3PUYE 1SW5A 4NF4A 1NH7A 4YU0A 4DXCA 2H4IA 5JTYB 4F1YA 4X1DA 3O66A 3G7WA 4H65A 3VVFA 2V25A 4G77A 3SDFA 2Z8FA 4ZZEA 3HPIA 5EHSA 1B7UA 5I59B 4G4PA 3PUWE 5DTBA 3IAZA 3GXAA 3FVOA 5I58A 5JK4A 1MXYA 2V84A 1JW5A 3OSRA 2I3WA 1A99A 2F7BA 4PETA 3V89B 2O7UA 3W9VA 3IB1A 4U22A 4NF6A 1H43A 1XVXA 3TCFA 1NNPA 3LSLA 3FXRA 3TELA 4LP2B 4EF2A 2QPQA 1DOTA 2H99A 1UQWA 2OCUA 1LB9A 3VVEA 4GOTA 2YPNA 3PPPA 3PUXE 4I9DA 1M5DA 5I2NB 3KSXA 3ZSFA 1N3XA 3THIA 1SD3A 2D3IA 3MZ9A 2UVGA 4RK9A 2ESNA 3MZ1A 2A5SA 4X1BA 4EUOA 1US4A 4GVOA 4PP0A 2O51A 2RF1A 2Z8DA 2XHDA 4RJZA 1QVSA 4PFWA 2HXWA 2OZZA 4OZ9A 4H8IA 4U4XA 1EZ9A 2ZYNA 3O29A 1IIWA 4LZ5A 1QUIA 4JXIA 3VE1B 2XXWA 1MDP1 3DP4A 4LATA 3QAXA 3SEYA 3KN7A 3K6WA 3QUJA 3ECRA 3SEWA 4F2OA 3L6GA 1US5A 5FTIA 1MDQA 1P1WA 2Y7IA 2XXRA 3ILUB 4WXJA 1MXXA 1LBCA 3OO7A 3OENA 3QUFA 2RC8A 1N76A 3QK6A 3TTNA 4IY6A 1MM7A 3N6UA 2NVUB 4U2RA 4NF5B 3UN6A 3U93A 2F7AA 4QSDA 1LCTA 1LAGE 4FEBA 3TFLA 3LSXA 3SKPA 1A54A 3OEKA 4F18A 4R73A 4LZ8A 1I69A 3IOTA 4LUBA 2V3UA 4DXBA 2O68A 2VD2A 1MY4A 4NE4A 1B46A 1URSA 2F6PA 3N94A 4GRKA 1B6HA 4NF5A 4G2ZA 1ZKBA 1B9JA 4F3SA 2DXYA 4EQ9A 1MPBA 1UIUA 1Z7ME 3O9PA 5H8FA 1D9VA 3CIJA 4LZ7A 5AA2B 2P2AA 1OVTA 4UA8A 3EHSA 3Q28A 1ZU0A 1LAXA 4E0XA 1H44A 2O6AA 2PBWA 2F78A 2D5WA 2B3BA 1YAEA 4OXVA 1PDAA 3G3JA 3FD3A 4ZE8A 1WODA 1DMBA 2AYSA 1B0HA 1VR5A 4PQJA 5AA2A 1BP5A 3U94A 4ZEDA 4F22A 1Y3PA 3MP1A 3SEVA 5FTHA 1FQBA 4F3BA 1I6QA 3R7XA 4GFRA 4KPTA 2O7IA 3M8UA 1B58A 3B7DA 4GD5A 1Y1ZA 2B65A 4QFOA 3DP8A 1POY1 2GHBA 3S2VA 1LBBA 1POTA 2LAOA 1OVBA 1AL3A 2ZNUA 4P0IA 3CSGA 4QFNA 4FEDA 3K01A 2XXHA 3SERA 1URDA 2BJJX 2ANJA 5HPQA 1BIYA 3HHFA 3FJ7A 4GIZA 4ECFA 3K1NA 3FJMA 1IUDA 3H4ZA 2VHAA 1Y1MA 4JWOA 4YB6A 3ODBA 4YMAA 3WAFA 5DEXA 2DE2A 3LUYA 2RKMA 3BKIB 2FNCA 4OWDA 5H8SA 4PFYA 2F6GA 4H0WA 3DELB 3IJXB 4EXKA 1M5CA 3O6GA 4QFLA 1YTVA 4MH5A 2RINA 4WEPA 5ELVA 2REJA 4MF3A 2UVIA 1I6BA 3H06B 1FTJA 2NUVA 5TPAA 4RPNA 4X9TA 4AQ4A 4EDPA 2H25A 1MPDA 3KBRA 4IO5A 4G8NA 3IOVA 1Z7NE 1Y9UA 3VLUA 4G68A 2DWJA 2DP8A 5L8DA 5I57B 3PUZE 4IO7A 4H6DA 4EXLA 3OOAA 2XXTA 1B5HA 3PPNA 4P11A 3IOUA 2UYFA 2QJEA 3UK4A 4F1VA 1MXWA 4R2BA 2NWJA 3K1PA 3OD7A 5AE4A 4H5GA 1MRPA 1P1OA 1R6ZA 4OFJA 1P1NA 2OJTA 4QRZA 4ZE9A 3PUVE 4Z0IA 1N84A 3QYTA 4OETA 2QRYA 4Q30B 3IB2A 1OQHA 4RY1A 2FYIA 5KDTA 3IL1B 2ZYKA 3FJGA 3A09A 1IXCA 2OBGA 3TCGA 4NF4B 1ZBMA 3T22A 4OVJA 2A5TA 1B3GA 4O3AA 1NFTA 4N13A 4KQPA 2ZMBA 4FAJA 3LBSA 1LAHE 2F34A 2NXOA 4KYEA 3H6UA 1FTMA 5I84A 3VFJA 3HN0A 3OXNA 4F1UA 3PV0E 2I49A 3T9XB 3UA8A 3F11A 3Q25A 3PPRA 4BDOA 1ZTYA 3K6UA 2DVZA 3FIRA 1FTKA 1QUKA 2I48A 2Q2CA 1QKAA 4ESWA 3TDJA 3UGWA 3TAJA 3ZKKA 1CB6A 5I58B 3HSTA 2XXVA 3OEMA 2UVHA 2QS3A 3GZGA 2I6EA 3CVGA 1MXUA 3RTWB 1B51A 1B7ZA 1DPEA 2Y7WA 4NF6B 4Q8RA 4BDQA 3IK6B 5BUUA 2X7PA 4KHZE 1F9BA 2VOZA 3RLFE 1LGBC 4H1XA 5EYFA 3PU5A 1SYHA 1B3HA 4NEDA 3K1MA 1T0KA 3KJTA 2HZKA 2CMOA 1LCFA 4I8CA 4WEDA 3EF7A 4RYAA 2XX8A 3QSLA 2THIA 5L9OA 4ELPA 2YJPA 4R74A 4YAHX 3TPAA 4U4SA 4G68C 4HCYA 4ELQA 4PFTA 2Z23A 1DPPA 3MQ9A 3TZAA 3W15C 1Q1KA 2KLFA 4XIGQ 1A7LA 4JB7A 3TODA 3RY3A 4L17A 1MG1A 4DXUA 3GBAA 4KYDA 1P1QA 2HAVA 2I58A 5L9SA 1D3KA 3T66A 1DSNA 4R9GA 3FXUA 4AB6A 5AA4B 1JEUA 4ZDMA 3MW0A 1MPCA 1ATGA 3S4UA 1IEJA 1YPNA 5DVJA 2QS2A 2ONRA 1I6AA 2PT2A 4YKJA 1FQAA 1ELJA 1SBPA 3HO7A 3OO9A 2DYXA 3MPLA 4ND9A 2DE4A 4E0WA 2ZNTA 1PC3A 2O1LA 1ZMGA 1FTOA 1TXFA 5AA4A 2P0SA 4XKQA 5CRYA 2ALUA 3VLVA 3G3KA 2F5XA 3OO6A 5J1DA 1B5JA 1PB9A 4IB2A 4YZZA 3TEPA 1B4ZA 3CI8A 5DVIA 3K6VA 5I56B 2XXPA 1O64A 3UORA 2F7CA 5HBCA 3CFLA 3T96B 5HM4B 2FA7A 1MXVA 3EHUA 4YB7A 1LAFE 4FE8A 3MZBA 3IR1A 2QMWA 3B6TA 3C9HA 2ONKE 3GLBA 3LSFB 4IGRA 3C35A 1B7HA 3CFXA 3LSWA 5I56A 4BLAA 1N7WA 3IB0A 1Y3QA 3ILTB 5CMMA 1NMUA 5KCJB 3MP6A 4MLVA 5F7VA 1XC1A 1FCKA 4I62A 4DLDA 5H8FB 3M3KA 4MBPA 1H76A 1AMFA 4LVQA 1B2HA 4BDLA 1BKAA 5K2XA 3C31A 3U72A 2Y7KA 1XS5A 2IEEA 1FQEA 3TUSA 4RK2A 3U1OA 1MQDA 4BDRA 4KYSA 1VFEA 5KCJA 2GHAA 4R75A 4JSOA 1OIBA 2DOJA 1MH4A 1GV8A 3TTMA 1JW4A 1SVXB 2DSFA 3JZJA 2QSXA 4TLMB 2I4BA 4OENA 1N7XA 3H3GA 2Q2AA 2XD3A 1NNTA 2DQVA 5TP9A 4DDDA 1ZIUA 2ZNSA 3G3IA 2VD3A 3QXMA 1FW0A 5CMCA 5DT6A 3RQTA 2OWSA 2HEUA 4HW8A 4XKNA 3R6UA 4YKIA 5F1QA 3VDFA 2QL3A 3H7MA 5CI5A 1RYOA 1DTZA 2RC9A 3CRBA 1A8FA 1AIVA 4HCWA 1MY0A 1R1NA 2V3TA 1OLCA 2D21A 4NTLA 1AH5A 1P99A 5K2YA 2PT1A 4KI0E 1MS7A 4C1UA 3CG1A 5BWJA 2UYEA 1JEVA 1QULA 2R6GE 1NH8A 4IY5A 4IO3A 1DTGA 2V3QA 4QHQA 4DCYA 4C0RA 5ICTA 1EZPA 3PGFA 4GXAA 4OFOA 2X7QA 3MUQA 3BBRA 1CE2A 2O69A 5DEXB 3I5OA 4KCCA 3QIMA 3O2AA 4GXSB 3KEIA 3L6HA 1QUJA 3FASA 4R6HA 1QKBA 4XKPA 5AA2D 4OEVA 3RPWA 4H67A 3FATA 2Y84A 2DWHA 1S9TA 2VGQA 1ZLQA 3E4RA 3MJNA 3MVYA 3N26A 4U21A 5TPAB 3FXQA 1SW1A 4R2FA 4RPOA 3EHTA 4KD5A 1UTBA 3LR1A 4TQUQ 4DCXA 4G68B 2F8DA 1FQDA 3IJOB 2Y7PA 3PD8A 5ISUA 3IO4A 1S7YA 2I3VA 1IXGA 1B0LA 1B1HA 2F35A 4FECA 3Q29A 3MVXA 2OWTA 4EQBA 5CMKA 4PFUA 3A3UA 4ZZAA 2W7YA 4UACA 4QSEA 4KR5A 4MLQA 2Q89A 4U1OA 2I4CA 2ONSA 3EN3A 4XTCQ 4OERA 4NF8A 2IA4A 1PBPA 3SESA 3CG3A 5DVFA 3EQ1A 3M3FA 1HSEA 5KDTB 4WKMA 5H8HB 2XD2A 3DP6A 1GR2A 4ELRA 2A5TB 2H9BA 2HFBA 5A5XB 5FHNA 3PMXA 2DWAA 4JSDA 3DLNA 4U23A 4TOZA 3O28A 2XX7A 4F3GA 3FVKA 4LONB 5B70A 2CZLA 3T93B 1LSTA 4ZEFA 3V83A 5H8HA 4GQOA 4QFKA 5DYHA 4ONYA 4YMBA 4HTGA 5A5XA 3S9EA 3O97A 3I3VA 5I2KA 4OQOA 3M3LA 4RA1A 4H8JA 3V8XB 4JWYA 4FATA 1RKMA 2G93A 1HSJA 1NNKA 3KZGA 3SEXA 3S9LC 1GVCA 2ZYMA 3A3CA 3B6QA 3H03A 4ESXA 1B4HA 1TFDA 4PE5B 2I0CA 3H6TA 3C4MA 4KFQA 3U8QA 4DZ1A 3PMWA 3W9WA 4F29A 1MQJA 5JEIA 4OFLA 2AL5A 4OYVA 4G8HA 1UIVA 5M2VA 4TLLB 4FIMA 1SI0A 1PBQA 1LFHA 2AIXA 3IX1A 3E13X 1VSOA 1JNFA 3FVGA 1YCJA 4AB5A 5H8QB 1B40A 2HZLA 4NWDA 4O3CA 2AL4A 1VFDA 4ZEBA 2X26A 3K4UA 3E9XA 5JTYA 2R9JA 2HQ0A 2GFEA 4BDNA 4GF8A 3K2DA 3D4CA 3HV1A 3C34A 3RTFB 4KCDA 3U92A 2Z22A 1TWYA 2ABHA 1QJMA 4GLIA 3OELA 4U1ZA 5H8QA 1SW2A 3TYHA 1MQIA 4OEUA 5CBRA 5I59A 1WVJA 2XXXA 3PD9A 1TFAA 3SEUA 2DS9A 1B1XA 1M5BA 1S50A 3KJ7A 3KFMA 1MXZA 4XXUA 1PB8A 4K3FA 3KG2A 2R71A 2PX1A 1D9YA 1XVYA 1MY2A 3IO6A 3MVWA 4ZEIA 3K02A 3B6WA 3KOTA 3RUMA 1HSLA 4LQ2A 1ZJLA 1OLAA 3JYRA 4THIA 4H5FA 1KWHA 5EHMA 3K0VA 3SETA 1OQGA 1PB7A 1RYXA 3RT8A 3UP9A 4IGTA 2RCBA 2I0BA 1FQCA 5L9MA 5I2NA 1D4NA 4IO6A 2YLNA 4R72A 4QF9A 3T9VA 2PVUA 4EQ7A 3FV2A 5AA1A 1MM6A 5ICQA 2ZXTA 3C32A 1LLSA 1FTLA 1SI1A 3TQWA 2GH9A 5AA3A 3CFZA 2VP1A 1FQFA 5LOMA 1VE4A 1Y20A 2XXUA 1H45A 4OHNA 4YKPA 1USYE 1AOVA 1EU8A 4F39A 4N6PA 3PMVA 2G29A 1R9QA 1BLFA 1LB8A 3GBBA 3FV1A 3OSQA 1M5FA 2ZYOA 3S9NC 2XXQA 1O63A 4GL8A 4R9FA 2DXRA 3JV9A 3TCHA 3D4GA 3MWBA 1IXIA 1IITA 2P1SA 1UTHB 4F3PA 4LQ5A 3UIFA 5TP9B 1N04A 4Z7EA 2B3FA 2XXYA 2HCAA 3TKDA 3P7IA 4G8MA 1OMPA 3FVNA 3K00A 3CR9A 1A55A 1R9LA 4BDMA 2DVCA 3MVZA 3T9UA 1BTJA 5CM6A 3S9MC 2RC7A 3USDA 1J1NA 3Q27A 1UTHA 3VXCA 2H5YA 3IORA 3ZS6A 1EZOA 4DE8A 2O84X 4GL0A 3TTKA 1B3LA 3WAEA 1B05A 2REGA 4R6YA 3MC2A 1A8EA 3Q26A 1Q35A 2XXIA 4F2QA 3VVDA 1N0TA 2E1SA 3BFUA 4YB5A 4POWA 5CC2A 1B52A 3IOWA 3N6TA 3OMBA 1NKXA 4FORA 5ITPA 1M5EA 5FHOA 3KN3A 2QS1A 3KGCA 3O6IA 3R26A 4Q5TA 1MQHA 4P0GA 3OO8A 3G3FA 4LA9A 4M4GA 1N3WA 3E3KA 1JETA 1SYIA 3MP8A 1H3DA 3K6XA 4ZS9A 2GRVA 3C36A 5KZTA 1XT8A 1JVXA 1B32A 1L5TA 1UTBB 4POXA 3G3HA 1SW4A 1WDNA 3TTRA 1LFIA 1MY3A 2Z8EA 2WKYA 1JVYA 5H8NB 3ZKLA 4YKKA 3TTLA 4C1TA 4M1VA 4RNSA 3KOSA 2OK2A 4NMYA 3FZVA 1Y4CA 1O7TA 2V93A 4X48A 3KN8A 1SQYA 1II5A 4QFPA 2NOOA 4OTEA 2PMSA 3MAMA 1B5IA 1SDXA 3DM0A 4F19A 5H8NA 5FHMA 5IAIA 4GWOA 4ISUA 5B7DA 1QW0A 4OMBA 4NF8B 1GGGA 3TQLA 4F31B 4JBZA 4N07A 4ZECA 4HS7A 1P1UA 3LC8A 1XHYA 4MFIA 1JW1A 4IO2A 3ONMA 5TU0A 3RNNA 1IQ7A 3MPKA 2Q9TA 5IKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MBP A;  2UVJ A;  3H6W A;  3TMG A;  4I1D A;  4ZEK A;  4IO4 A;  3VLW A;  3PPO A;  3N5L A;  2Q88 A;  2XX9 A;  3VV5 A;  2E0S A;  1USY H;  3H6V A;  2F97 A;  2DE3 A;  4QSC A;  1IXH A;  3I6V A;  2Y7R A;  2QMX A;  4O3B A;  2F36 A;  2DWI A;  4RXL A;  3FGS A;  2PYY A;  1EH3 A;  1URG A;  5I2K B;  3G3G A;  2OLB A;  1NL5 A;  3HCQ A;  5CMB A;  4ELO A;  1GTK A;  2O1M A;  4NWC A;  4XKR A;  5ITO A;  5I57 A;  2UXA A;  3V5A A;  1PEB A;  3RN8 A;  1A40 A;  1ANF A;  2RCA A;  4Q0C A;  3PPQ A;  2M8C A;  3HHG A;  4R6K A;  3RGY A;  3O6H A;  2QS4 A;  3CSB A;  1XOC A;  3RT6 B;  3FUZ A;  4JWX A;  1IZ1 A;  4YIC A;  2Q8J A;  3T9H B;  3C33 A;  1MH3 A;  3BFT A;  3VXB A;  4OES A;  4DIG A;  1Y4T A;  5CBS A;  4EF1 A;  4JDF A;  3AXF A;  3EPE A;  2HAU A;  1B3E A;  1MY1 A;  1Y3N A;  1MQG A;  1B3F A;  1JQF A;  4FJP A;  1LFG A;  1NNF A;  1TT1 A;  3KSJ A;  2H98 A;  3PUY E;  1SW5 A;  4NF4 A;  1NH7 A;  4YU0 A;  4DXC A;  2H4I A;  5JTY B;  4F1Y A;  4X1D A;  3O66 A;  3G7W A;  4H65 A;  3VVF A;  2V25 A;  4G77 A;  3SDF A;  2Z8F A;  4ZZE A;  3HPI A;  5EHS A;  1B7U A;  5I59 B;  4G4P A;  3PUW E;  5DTB A;  3IAZ A;  3GXA A;  3FVO A;  5I58 A;  5JK4 A;  1MXY A;  2V84 A;  1JW5 A;  3OSR A;  2I3W A;  1A99 A;  2F7B A;  4PET A;  3V89 B;  2O7U A;  3W9V A;  3IB1 A;  4U22 A;  4NF6 A;  1H43 A;  1XVX A;  3TCF A;  1NNP A;  3LSL A;  3FXR A;  3TEL A;  4LP2 B;  4EF2 A;  2QPQ A;  1DOT A;  2H99 A;  1UQW A;  2OCU A;  1LB9 A;  3VVE A;  4GOT A;  2YPN A;  3PPP A;  3PUX E;  4I9D A;  1M5D A;  5I2N B;  3KSX A;  3ZSF A;  1N3X A;  3THI A;  1SD3 A;  2D3I A;  3MZ9 A;  2UVG A;  4RK9 A;  2ESN A;  3MZ1 A;  2A5S A;  4X1B A;  4EUO A;  1US4 A;  4GVO A;  4PP0 A;  2O51 A;  2RF1 A;  2Z8D A;  2XHD A;  4RJZ A;  1QVS A;  4PFW A;  2HXW A;  2OZZ A;  4OZ9 A;  4H8I A;  4U4X A;  1EZ9 A;  2ZYN A;  3O29 A;  1IIW A;  4LZ5 A;  1QUI A;  4JXI A;  3VE1 B;  2XXW A;  1MDP 1;  3DP4 A;  4LAT A;  3QAX A;  3SEY A;  3KN7 A;  3K6W A;  3QUJ A;  3ECR A;  3SEW A;  4F2O A;  3L6G A;  1US5 A;  5FTI A;  1MDQ A;  1P1W A;  2Y7I A;  2XXR A;  3ILU B;  4WXJ A;  1MXX A;  1LBC A;  3OO7 A;  3OEN A;  3QUF A;  2RC8 A;  1N76 A;  3QK6 A;  3TTN A;  4IY6 A;  1MM7 A;  3N6U A;  2NVU B;  4U2R A;  4NF5 B;  3UN6 A;  3U93 A;  2F7A A;  4QSD A;  1LCT A;  1LAG E;  4FEB A;  3TFL A;  3LSX A;  3SKP A;  1A54 A;  3OEK A;  4F18 A;  4R73 A;  4LZ8 A;  1I69 A;  3IOT A;  4LUB A;  2V3U A;  4DXB A;  2O68 A;  2VD2 A;  1MY4 A;  4NE4 A;  1B46 A;  1URS A;  2F6P A;  3N94 A;  4GRK A;  1B6H A;  4NF5 A;  4G2Z A;  1ZKB A;  1B9J A;  4F3S A;  2DXY A;  4EQ9 A;  1MPB A;  1UIU A;  1Z7M E;  3O9P A;  5H8F A;  1D9V A;  3CIJ A;  4LZ7 A;  5AA2 B;  2P2A A;  1OVT A;  4UA8 A;  3EHS A;  3Q28 A;  1ZU0 A;  1LAX A;  4E0X A;  1H44 A;  2O6A A;  2PBW A;  2F78 A;  2D5W A;  2B3B A;  1YAE A;  4OXV A;  1PDA A;  3G3J A;  3FD3 A;  4ZE8 A;  1WOD A;  1DMB A;  2AYS A;  1B0H A;  1VR5 A;  4PQJ A;  5AA2 A;  1BP5 A;  3U94 A;  4ZED A;  4F22 A;  1Y3P A;  3MP1 A;  3SEV A;  5FTH A;  1FQB A;  4F3B A;  1I6Q A;  3R7X A;  4GFR A;  4KPT A;  2O7I A;  3M8U A;  1B58 A;  3B7D A;  4GD5 A;  1Y1Z A;  2B65 A;  4QFO A;  3DP8 A;  1POY 1;  2GHB A;  3S2V A;  1LBB A;  1POT A;  2LAO A;  1OVB A;  1AL3 A;  2ZNU A;  4P0I A;  3CSG A;  4QFN A;  4FED A;  3K01 A;  2XXH A;  3SER A;  1URD A;  2BJJ X;  2ANJ A;  5HPQ A;  1BIY A;  3HHF A;  3FJ7 A;  4GIZ A;  4ECF A;  3K1N A;  3FJM A;  1IUD A;  3H4Z A;  2VHA A;  1Y1M A;  4JWO A;  4YB6 A;  3ODB A;  4YMA A;  3WAF A;  5DEX A;  2DE2 A;  3LUY A;  2RKM A;  3BKI B;  2FNC A;  4OWD A;  5H8S A;  4PFY A;  2F6G A;  4H0W A;  3DEL B;  3IJX B;  4EXK A;  1M5C A;  3O6G A;  4QFL A;  1YTV A;  4MH5 A;  2RIN A;  4WEP A;  5ELV A;  2REJ A;  4MF3 A;  2UVI A;  1I6B A;  3H06 B;  1FTJ A;  2NUV A;  5TPA A;  4RPN A;  4X9T A;  4AQ4 A;  4EDP A;  2H25 A;  1MPD A;  3KBR A;  4IO5 A;  4G8N A;  3IOV A;  1Z7N E;  1Y9U A;  3VLU A;  4G68 A;  2DWJ A;  2DP8 A;  5L8D A;  5I57 B;  3PUZ E;  4IO7 A;  4H6D A;  4EXL A;  3OOA A;  2XXT A;  1B5H A;  3PPN A;  4P11 A;  3IOU A;  2UYF A;  2QJE A;  3UK4 A;  4F1V A;  1MXW A;  4R2B A;  2NWJ A;  3K1P A;  3OD7 A;  5AE4 A;  4H5G A;  1MRP A;  1P1O A;  1R6Z A;  4OFJ A;  1P1N A;  2OJT A;  4QRZ A;  4ZE9 A;  3PUV E;  4Z0I A;  1N84 A;  3QYT A;  4OET A;  2QRY A;  4Q30 B;  3IB2 A;  1OQH A;  4RY1 A;  2FYI A;  5KDT A;  3IL1 B;  2ZYK A;  3FJG A;  3A09 A;  1IXC A;  2OBG A;  3TCG A;  4NF4 B;  1ZBM A;  3T22 A;  4OVJ A;  2A5T A;  1B3G A;  4O3A A;  1NFT A;  4N13 A;  4KQP A;  2ZMB A;  4FAJ A;  3LBS A;  1LAH E;  2F34 A;  2NXO A;  4KYE A;  3H6U A;  1FTM A;  5I84 A;  3VFJ A;  3HN0 A;  3OXN A;  4F1U A;  3PV0 E;  2I49 A;  3T9X B;  3UA8 A;  3F11 A;  3Q25 A;  3PPR A;  4BDO A;  1ZTY A;  3K6U A;  2DVZ A;  3FIR A;  1FTK A;  1QUK A;  2I48 A;  2Q2C A;  1QKA A;  4ESW A;  3TDJ A;  3UGW A;  3TAJ A;  3ZKK A;  1CB6 A;  5I58 B;  3HST A;  2XXV A;  3OEM A;  2UVH A;  2QS3 A;  3GZG A;  2I6E A;  3CVG A;  1MXU A;  3RTW B;  1B51 A;  1B7Z A;  1DPE A;  2Y7W A;  4NF6 B;  4Q8R A;  4BDQ A;  3IK6 B;  5BUU A;  2X7P A;  4KHZ E;  1F9B A;  2VOZ A;  3RLF E;  1LGB C;  4H1X A;  5EYF A;  3PU5 A;  1SYH A;  1B3H A;  4NED A;  3K1M A;  1T0K A;  3KJT A;  2HZK A;  2CMO A;  1LCF A;  4I8C A;  4WED A;  3EF7 A;  4RYA A;  2XX8 A;  3QSL A;  2THI A;  5L9O A;  4ELP A;  2YJP A;  4R74 A;  4YAH X;  3TPA A;  4U4S A;  4G68 C;  4HCY A;  4ELQ A;  4PFT A;  2Z23 A;  1DPP A;  3MQ9 A;  3TZA A;  3W15 C;  1Q1K A;  2KLF A;  4XIG Q;  1A7L A;  4JB7 A;  3TOD A;  3RY3 A;  4L17 A;  1MG1 A;  4DXU A;  3GBA A;  4KYD A;  1P1Q A;  2HAV A;  2I58 A;  5L9S A;  1D3K A;  3T66 A;  1DSN A;  4R9G A;  3FXU A;  4AB6 A;  5AA4 B;  1JEU A;  4ZDM A;  3MW0 A;  1MPC A;  1ATG A;  3S4U A;  1IEJ A;  1YPN A;  5DVJ A;  2QS2 A;  2ONR A;  1I6A A;  2PT2 A;  4YKJ A;  1FQA A;  1ELJ A;  1SBP A;  3HO7 A;  3OO9 A;  2DYX A;  3MPL A;  4ND9 A;  2DE4 A;  4E0W A;  2ZNT A;  1PC3 A;  2O1L A;  1ZMG A;  1FTO A;  1TXF A;  5AA4 A;  2P0S A;  4XKQ A;  5CRY A;  2ALU A;  3VLV A;  3G3K A;  2F5X A;  3OO6 A;  5J1D A;  1B5J A;  1PB9 A;  4IB2 A;  4YZZ A;  3TEP A;  1B4Z A;  3CI8 A;  5DVI A;  3K6V A;  5I56 B;  2XXP A;  1O64 A;  3UOR A;  2F7C A;  5HBC A;  3CFL A;  3T96 B;  5HM4 B;  2FA7 A;  1MXV A;  3EHU A;  4YB7 A;  1LAF E;  4FE8 A;  3MZB A;  3IR1 A;  2QMW A;  3B6T A;  3C9H A;  2ONK E;  3GLB A;  3LSF B;  4IGR A;  3C35 A;  1B7H A;  3CFX A;  3LSW A;  5I56 A;  4BLA A;  1N7W A;  3IB0 A;  1Y3Q A;  3ILT B;  5CMM A;  1NMU A;  5KCJ B;  3MP6 A;  4MLV A;  5F7V A;  1XC1 A;  1FCK A;  4I62 A;  4DLD A;  5H8F B;  3M3K A;  4MBP A;  1H76 A;  1AMF A;  4LVQ A;  1B2H A;  4BDL A;  1BKA A;  5K2X A;  3C31 A;  3U72 A;  2Y7K A;  1XS5 A;  2IEE A;  1FQE A;  3TUS A;  4RK2 A;  3U1O A;  1MQD A;  4BDR A;  4KYS A;  1VFE A;  5KCJ A;  2GHA A;  4R75 A;  4JSO A;  1OIB A;  2DOJ A;  1MH4 A;  1GV8 A;  3TTM A;  1JW4 A;  1SVX B;  2DSF A;  3JZJ A;  2QSX A;  4TLM B;  2I4B A;  4OEN A;  1N7X A;  3H3G A;  2Q2A A;  2XD3 A;  1NNT A;  2DQV A;  5TP9 A;  4DDD A;  1ZIU A;  2ZNS A;  3G3I A;  2VD3 A;  3QXM A;  1FW0 A;  5CMC A;  5DT6 A;  3RQT A;  2OWS A;  2HEU A;  4HW8 A;  4XKN A;  3R6U A;  4YKI A;  5F1Q A;  3VDF A;  2QL3 A;  3H7M A;  5CI5 A;  1RYO A;  1DTZ A;  2RC9 A;  3CRB A;  1A8F A;  1AIV A;  4HCW A;  1MY0 A;  1R1N A;  2V3T A;  1OLC A;  2D21 A;  4NTL A;  1AH5 A;  1P99 A;  5K2Y A;  2PT1 A;  4KI0 E;  1MS7 A;  4C1U A;  3CG1 A;  5BWJ A;  2UYE A;  1JEV A;  1QUL A;  2R6G E;  1NH8 A;  4IY5 A;  4IO3 A;  1DTG A;  2V3Q A;  4QHQ A;  4DCY A;  4C0R A;  5ICT A;  1EZP A;  3PGF A;  4GXA A;  4OFO A;  2X7Q A;  3MUQ A;  3BBR A;  1CE2 A;  2O69 A;  5DEX B;  3I5O A;  4KCC A;  3QIM A;  3O2A A;  4GXS B;  3KEI A;  3L6H A;  1QUJ A;  3FAS A;  4R6H A;  1QKB A;  4XKP A;  5AA2 D;  4OEV A;  3RPW A;  4H67 A;  3FAT A;  2Y84 A;  2DWH A;  1S9T A;  2VGQ A;  1ZLQ A;  3E4R A;  3MJN A;  3MVY A;  3N26 A;  4U21 A;  5TPA B;  3FXQ A;  1SW1 A;  4R2F A;  4RPO A;  3EHT A;  4KD5 A;  1UTB A;  3LR1 A;  4TQU Q;  4DCX A;  4G68 B;  2F8D A;  1FQD A;  3IJO B;  2Y7P A;  3PD8 A;  5ISU A;  3IO4 A;  1S7Y A;  2I3V A;  1IXG A;  1B0L A;  1B1H A;  2F35 A;  4FEC A;  3Q29 A;  3MVX A;  2OWT A;  4EQB A;  5CMK A;  4PFU A;  3A3U A;  4ZZA A;  2W7Y A;  4UAC A;  4QSE A;  4KR5 A;  4MLQ A;  2Q89 A;  4U1O A;  2I4C A;  2ONS A;  3EN3 A;  4XTC Q;  4OER A;  4NF8 A;  2IA4 A;  1PBP A;  3SES A;  3CG3 A;  5DVF A;  3EQ1 A;  3M3F A;  1HSE A;  5KDT B;  4WKM A;  5H8H B;  2XD2 A;  3DP6 A;  1GR2 A;  4ELR A;  2A5T B;  2H9B A;  2HFB A;  5A5X B;  5FHN A;  3PMX A;  2DWA A;  4JSD A;  3DLN A;  4U23 A;  4TOZ A;  3O28 A;  2XX7 A;  4F3G A;  3FVK A;  4LON B;  5B70 A;  2CZL A;  3T93 B;  1LST A;  4ZEF A;  3V83 A;  5H8H A;  4GQO A;  4QFK A;  5DYH A;  4ONY A;  4YMB A;  4HTG A;  5A5X A;  3S9E A;  3O97 A;  3I3V A;  5I2K A;  4OQO A;  3M3L A;  4RA1 A;  4H8J A;  3V8X B;  4JWY A;  4FAT A;  1RKM A;  2G93 A;  1HSJ A;  1NNK A;  3KZG A;  3SEX A;  3S9L C;  1GVC A;  2ZYM A;  3A3C A;  3B6Q A;  3H03 A;  4ESX A;  1B4H A;  1TFD A;  4PE5 B;  2I0C A;  3H6T A;  3C4M A;  4KFQ A;  3U8Q A;  4DZ1 A;  3PMW A;  3W9W A;  4F29 A;  1MQJ A;  5JEI A;  4OFL A;  2AL5 A;  4OYV A;  4G8H A;  1UIV A;  5M2V A;  4TLL B;  4FIM A;  1SI0 A;  1PBQ A;  1LFH A;  2AIX A;  3IX1 A;  3E13 X;  1VSO A;  1JNF A;  3FVG A;  1YCJ A;  4AB5 A;  5H8Q B;  1B40 A;  2HZL A;  4NWD A;  4O3C A;  2AL4 A;  1VFD A;  4ZEB A;  2X26 A;  3K4U A;  3E9X A;  5JTY A;  2R9J A;  2HQ0 A;  2GFE A;  4BDN A;  4GF8 A;  3K2D A;  3D4C A;  3HV1 A;  3C34 A;  3RTF B;  4KCD A;  3U92 A;  2Z22 A;  1TWY A;  2ABH A;  1QJM A;  4GLI A;  3OEL A;  4U1Z A;  5H8Q A;  1SW2 A;  3TYH A;  1MQI A;  4OEU A;  5CBR A;  5I59 A;  1WVJ A;  2XXX A;  3PD9 A;  1TFA A;  3SEU A;  2DS9 A;  1B1X A;  1M5B A;  1S50 A;  3KJ7 A;  3KFM A;  1MXZ A;  4XXU A;  1PB8 A;  4K3F A;  3KG2 A;  2R71 A;  2PX1 A;  1D9Y A;  1XVY A;  1MY2 A;  3IO6 A;  3MVW A;  4ZEI A;  3K02 A;  3B6W A;  3KOT A;  3RUM A;  1HSL A;  4LQ2 A;  1ZJL A;  1OLA A;  3JYR A;  4THI A;  4H5F A;  1KWH A;  5EHM A;  3K0V A;  3SET A;  1OQG A;  1PB7 A;  1RYX A;  3RT8 A;  3UP9 A;  4IGT A;  2RCB A;  2I0B A;  1FQC A;  5L9M A;  5I2N A;  1D4N A;  4IO6 A;  2YLN A;  4R72 A;  4QF9 A;  3T9V A;  2PVU A;  4EQ7 A;  3FV2 A;  5AA1 A;  1MM6 A;  5ICQ A;  2ZXT A;  3C32 A;  1LLS A;  1FTL A;  1SI1 A;  3TQW A;  2GH9 A;  5AA3 A;  3CFZ A;  2VP1 A;  1FQF A;  5LOM A;  1VE4 A;  1Y20 A;  2XXU A;  1H45 A;  4OHN A;  4YKP A;  1USY E;  1AOV A;  1EU8 A;  4F39 A;  4N6P A;  3PMV A;  2G29 A;  1R9Q A;  1BLF A;  1LB8 A;  3GBB A;  3FV1 A;  3OSQ A;  1M5F A;  2ZYO A;  3S9N C;  2XXQ A;  1O63 A;  4GL8 A;  4R9F A;  2DXR A;  3JV9 A;  3TCH A;  3D4G A;  3MWB A;  1IXI A;  1IIT A;  2P1S A;  1UTH B;  4F3P A;  4LQ5 A;  3UIF A;  5TP9 B;  1N04 A;  4Z7E A;  2B3F A;  2XXY A;  2HCA A;  3TKD A;  3P7I A;  4G8M A;  1OMP A;  3FVN A;  3K00 A;  3CR9 A;  1A55 A;  1R9L A;  4BDM A;  2DVC A;  3MVZ A;  3T9U A;  1BTJ A;  5CM6 A;  3S9M C;  2RC7 A;  3USD A;  1J1N A;  3Q27 A;  1UTH A;  3VXC A;  2H5Y A;  3IOR A;  3ZS6 A;  1EZO A;  4DE8 A;  2O84 X;  4GL0 A;  3TTK A;  1B3L A;  3WAE A;  1B05 A;  2REG A;  4R6Y A;  3MC2 A;  1A8E A;  3Q26 A;  1Q35 A;  2XXI A;  4F2Q A;  3VVD A;  1N0T A;  2E1S A;  3BFU A;  4YB5 A;  4POW A;  5CC2 A;  1B52 A;  3IOW A;  3N6T A;  3OMB A;  1NKX A;  4FOR A;  5ITP A;  1M5E A;  5FHO A;  3KN3 A;  2QS1 A;  3KGC A;  3O6I A;  3R26 A;  4Q5T A;  1MQH A;  4P0G A;  3OO8 A;  3G3F A;  4LA9 A;  4M4G A;  1N3W A;  3E3K A;  1JET A;  1SYI A;  3MP8 A;  1H3D A;  3K6X A;  4ZS9 A;  2GRV A;  3C36 A;  5KZT A;  1XT8 A;  1JVX A;  1B32 A;  1L5T A;  1UTB B;  4POX A;  3G3H A;  1SW4 A;  1WDN A;  3TTR A;  1LFI A;  1MY3 A;  2Z8E A;  2WKY A;  1JVY A;  5H8N B;  3ZKL A;  4YKK A;  3TTL A;  4C1T A;  4M1V A;  4RNS A;  3KOS A;  2OK2 A;  4NMY A;  3FZV A;  1Y4C A;  1O7T A;  2V93 A;  4X48 A;  3KN8 A;  1SQY A;  1II5 A;  4QFP A;  2NOO A;  4OTE A;  2PMS A;  3MAM A;  1B5I A;  1SDX A;  3DM0 A;  4F19 A;  5H8N A;  5FHM A;  5IAI A;  4GWO A;  4ISU A;  5B7D A;  1QW0 A;  4OMB A;  4NF8 B;  1GGG A;  3TQL A;  4F31 B;  4JBZ A;  4N07 A;  4ZEC A;  4HS7 A;  1P1U A;  3LC8 A;  1XHY A;  4MFI A;  1JW1 A;  4IO2 A;  3ONM A;  5TU0 A;  3RNN A;  1IQ7 A;  3MPK A;  2Q9T A;  5IKB A; 
#chains in the Genus database with same CATH topology
 3MBP A;  2UVJ A;  3H6W A;  3TMG A;  4I1D A;  4ZEK A;  4IO4 A;  3VLW A;  3PPO A;  3N5L A;  1K9Z A;  2Q88 A;  2XX9 A;  5IGA A;  3VV5 A;  2E0S A;  1USY H;  3H6V A;  2F97 A;  1FJ9 A;  2DE3 A;  4QSC A;  1FBH A;  1IXH A;  3I6V A;  2Y7R A;  5IZZ A;  2QMX A;  4O3B A;  2F36 A;  2DWI A;  4RXL A;  3FGS A;  2PYY A;  4I40 A;  4MMP A;  1EH3 A;  1URG A;  5I2K B;  4DI3 D;  3G3G A;  2OLB A;  1NL5 A;  3HCQ A;  5CMB A;  2CZI A;  4ELO A;  1GTK A;  1FTA A;  2O1M A;  4NWC A;  1DCU A;  4XKR A;  5ITO A;  5I57 A;  2UXA A;  3V5A A;  1PEB A;  3RN8 A;  1A40 A;  1ANF A;  2RCA A;  2FBP A;  4Q0C A;  3PPQ A;  2M8C A;  3HHG A;  4R6K A;  3RGY A;  3O6H A;  4PF6 A;  2QS4 A;  5J16 A;  4HE0 A;  3CSB A;  1XOC A;  3RT6 B;  3FUZ A;  4JWX A;  5EQ9 A;  1IZ1 A;  4YIC A;  2XA5 A;  2Q8J A;  3T9H B;  3C33 A;  1MH3 A;  3BFT A;  3VXB A;  4OES A;  4DIG A;  1Y4T A;  5CBS A;  4EF1 A;  4JDF A;  3AXF A;  3EPE A;  2HAU A;  1B3E A;  1MY1 A;  1Y3N A;  1MQG A;  1B3F A;  1JQF A;  4FJP A;  1LFG A;  1NNF A;  1TT1 A;  2XWI A;  3KSJ A;  1FPD A;  5ET7 A;  2H98 A;  3PUY E;  1SW5 A;  4NF4 A;  1NH7 A;  2KR0 A;  4YU0 A;  4DXC A;  2H4I A;  5JTY B;  4F1Y A;  4X1D A;  3O66 A;  3G7W A;  4GBW A;  4H65 A;  4GWY A;  4N81 A;  3VVF A;  4GWU A;  3EKI A;  2V25 A;  4G77 A;  3SDF A;  2Z8F A;  4ZZE A;  3HPI A;  1FPG A;  5EHS A;  1B7U A;  5I59 B;  1NV4 A;  4G4P A;  3RPL B;  3PUW E;  5DTB A;  3IAZ A;  3GXA A;  3LUZ A;  4MAG A;  1FRP A;  1YXI A;  3FVO A;  5I58 A;  5JK4 A;  1MXY A;  2V84 A;  1JW5 A;  3OSR A;  4AS4 A;  2I3W A;  1A99 A;  2XWV A;  2F7B A;  1FBE A;  4PET A;  3V89 B;  2O7U A;  3W9V A;  5ET8 A;  3IB1 A;  4U22 A;  4NF6 A;  1H43 A;  3RPL A;  1XVX A;  3TCF A;  1NNP A;  3LSL A;  3FXR A;  3TEL A;  4LP2 B;  4EF2 A;  1IMD A;  2QPQ A;  1DOT A;  2H99 A;  1UQW A;  4OVT A;  2OCU A;  1LB9 A;  5EYG A;  3VVE A;  1FBD A;  4GOT A;  2YPN A;  3PPP A;  3PUX E;  4I9D A;  1M5D A;  5I2N B;  4OVQ A;  3KSX A;  3ZSF A;  1N3X A;  1JP4 A;  3THI A;  1SD3 A;  2D3I A;  3MZ9 A;  2UVG A;  4RK9 A;  2ESN A;  3MZ1 A;  2A5S A;  4X1B A;  4MJO A;  4EUO A;  1IME A;  1US4 A;  4GVO A;  4PP0 A;  4NAP A;  2O51 A;  2RF1 A;  2Z8D A;  2XHD A;  2F3B A;  4RJZ A;  1QVS A;  4PFW A;  2HXW A;  2OZZ A;  4OZ9 A;  4H8I A;  1K9Y A;  4U4X A;  1EZ9 A;  2ZYN A;  3O29 A;  1IIW A;  4LZ5 A;  1QUI A;  4JXI A;  3VE1 B;  2XXW A;  1MDP 1;  3DP4 A;  4LAT A;  3QAX A;  3SEY A;  4PAK A;  3KN7 A;  2Q8M A;  3K6W A;  3QUJ A;  3ECR A;  3SEW A;  4F2O A;  1NUZ A;  3L6G A;  1US5 A;  5FTI A;  1MDQ A;  1P1W A;  2Y7I A;  2XXR A;  3ILU B;  4WXJ A;  1MXX A;  4GX3 A;  1LBC A;  3OO7 A;  3IFC A;  3OEN A;  3QUF A;  1BK4 A;  5DW8 A;  2RC8 A;  1N76 A;  1NV7 A;  3QK6 A;  4GWZ A;  3TTN A;  1YZ0 A;  4IY6 A;  1MM7 A;  3GYY A;  3N6U A;  1FBP A;  2NVU B;  4U2R A;  4NF5 B;  4NX1 A;  3UN6 A;  3U93 A;  2F7A A;  4QSD A;  1LCT A;  1LAG E;  4FEB A;  3TFL A;  3LSX A;  5FBP A;  1A54 A;  3SKP A;  3OEK A;  4F18 A;  4R73 A;  4PDH A;  1NUX A;  4LZ8 A;  1I69 A;  3IOT A;  4LUB A;  4XEQ A;  2V3U A;  4DXB A;  2O68 A;  2VD2 A;  1MY4 A;  4NE4 A;  1B46 A;  1URS A;  5EQ7 A;  2F6P A;  3N94 A;  4GRK A;  1D9Q A;  1B6H A;  4NF5 A;  2WEF A;  4G2Z A;  1ZKB A;  1B9J A;  4F3S A;  2DXY A;  4EQ9 A;  1MPB A;  1UIU A;  1Z7M E;  3O9P A;  5H8F A;  1D9V A;  3CIJ A;  4LZ7 A;  5AA2 B;  2P2A A;  1OVT A;  4GBV A;  4UA8 A;  3EHS A;  3Q28 A;  1ZU0 A;  1XI6 A;  1LAX A;  4E0X A;  1H44 A;  2O6A A;  2PBW A;  2F78 A;  1KA0 A;  2D5W A;  4MHF A;  2B3B A;  2OWZ A;  1YAE A;  4OXV A;  5EYH A;  1PDA A;  4O7M A;  4MNP A;  3G3J A;  3FD3 A;  4ZE8 A;  1WOD A;  1DMB A;  1NI9 A;  2AYS A;  4KXP A;  1B0H A;  1VR5 A;  4PQJ A;  5AA2 A;  1BP5 A;  3U94 A;  2QVU A;  4ZED A;  4F22 A;  1Y3P A;  3MP1 A;  1FPL A;  3SEV A;  5FTH A;  5IZ3 A;  1FQB A;  4F3B A;  1I6Q A;  1NV6 A;  3R7X A;  4GFR A;  4KPT A;  2O7I A;  3M8U A;  1B58 A;  3B7D A;  1FJ6 A;  2ZZW A;  2WBD A;  4GD5 A;  4MNC A;  1Y1Z A;  2B65 A;  4I3Y A;  4QFO A;  3DP8 A;  1POY 1;  2GHB A;  3S2V A;  1LBB A;  1POT A;  2V4C A;  2LAO A;  1OVB A;  1AL3 A;  2ZNU A;  4P0I A;  3CSG A;  4QFN A;  4FED A;  3BIH A;  1G0H A;  3K01 A;  2WBB A;  2XXH A;  3SER A;  1URD A;  2BJJ X;  4OAN A;  2R8T A;  2ANJ A;  5HPQ A;  1BIY A;  3HHF A;  3FJ7 A;  4GIZ A;  4ECF A;  3K1N A;  3FJM A;  1IUD A;  3H4Z A;  1NV3 A;  2VHA A;  5ET6 A;  1Y1M A;  4JWO A;  4YB6 A;  3ODB A;  4YMA A;  3WAF A;  5DEX A;  2FVZ A;  2DE2 A;  3LUY A;  2RKM A;  3BKI B;  2FNC A;  4OWD A;  5H8S A;  4PFY A;  2F6G A;  4H0W A;  3DEL B;  3IJX B;  4EXK A;  1M5C A;  3O6G A;  4QFL A;  1YTV A;  4MH5 A;  2RIN A;  4WEP A;  5ELV A;  2REJ A;  4MF3 A;  4P1E A;  2UVI A;  5ET5 A;  1I6B A;  3H06 B;  1FTJ A;  2NUV A;  5TPA A;  4RPN A;  4X9T A;  4AQ4 A;  1FBC A;  4EDP A;  2H25 A;  1MPD A;  2WX9 A;  3KBR A;  4IO5 A;  4PBH A;  4G8N A;  3IOV A;  1Z7N E;  1Y9U A;  3VLU A;  4G68 A;  2DWJ A;  2DP8 A;  3B50 A;  5L8D A;  5I57 B;  3PUZ E;  4IO7 A;  4H6D A;  1VDW A;  4EXL A;  3OOA A;  2XXT A;  1B5H A;  3PPN A;  4P11 A;  3IOU A;  2UYF A;  4MX6 A;  2L5V A;  2QJE A;  3UK4 A;  4F1V A;  1MXW A;  4R2B A;  2XWO A;  2NWJ A;  3K1P A;  3OD7 A;  5AE4 A;  4H5G A;  1MRP A;  1P1O A;  1R6Z A;  4OFJ A;  5EQ8 A;  1P1N A;  2OJT A;  4PF8 A;  4QRZ A;  4ZE9 A;  4JVD A;  3PUV E;  4Z0I A;  4O7I A;  1N84 A;  3QYT A;  2HHM A;  4OET A;  2QRY A;  4Q30 B;  3IB2 A;  4GX4 A;  1OQH A;  4RY1 A;  2FYI A;  5KDT A;  3IL1 B;  2ZYK A;  3FJG A;  1INP A;  3A09 A;  1IXC A;  2OBG A;  3TCG A;  3U65 A;  4NF4 B;  1ZBM A;  3T22 A;  4OVJ A;  2A5T A;  1B3G A;  4O3A A;  4PCD A;  1NFT A;  4N13 A;  4KQP A;  2ZMB A;  4FAJ A;  3LBS A;  2VT5 A;  1LAH E;  4P9K A;  2F34 A;  2NXO A;  4KYE A;  3H6U A;  1FTM A;  4FBP A;  5I84 A;  3VFJ A;  3HN0 A;  3OXN A;  4F1U A;  3PV0 E;  2I49 A;  3T9X B;  3UA8 A;  3F11 A;  3Q25 A;  3PPR A;  4BDO A;  1ZTY A;  3K6U A;  3FIR A;  2DVZ A;  1FTK A;  1QUK A;  2I48 A;  2Q2C A;  1QKA A;  4ESW A;  3TDJ A;  4N91 A;  3UGW A;  3TAJ A;  3ZKK A;  1CB6 A;  5I58 B;  4N8G A;  3HST A;  2XXV A;  3OEM A;  2UVH A;  2QS3 A;  3GZG A;  4NHB A;  2I6E A;  3CVG A;  4P56 A;  1LEV A;  3A29 A;  1MXU A;  1DBZ A;  4PFR A;  3RTW B;  1B51 A;  1B7Z A;  1DPE A;  2Y7W A;  3HFU A;  4NF6 B;  4Q8R A;  4BDQ A;  3IK6 B;  5BUU A;  2X7P A;  4KHZ E;  1F9B A;  2VOZ A;  3RLF E;  4P47 A;  1LGB C;  4H1X A;  5EYF A;  3PU5 A;  1SYH A;  1B3H A;  3PTY A;  2HXR A;  4NED A;  3K1M A;  1T0K A;  3KJT A;  2HZK A;  1QGX A;  2CMO A;  1NV5 A;  1LCF A;  4PBQ A;  1FPI A;  4I8C A;  1G0I A;  4WED A;  3EF7 A;  3KC1 A;  3ISP A;  5ESY A;  4RYA A;  2XX8 A;  3QSL A;  2THI A;  5L9O A;  2YJP A;  4R74 A;  4YAH X;  4ELP A;  3TPA A;  4U4S A;  4G68 C;  4HCY A;  4ELQ A;  1IMF A;  4HE2 A;  4PFT A;  2Z23 A;  1DPP A;  3MQ9 A;  3TZA A;  3W15 C;  1Q1K A;  2KLF A;  2PCR A;  4XIG Q;  4QXD A;  1A7L A;  4JB7 A;  3TOD A;  2WYK A;  3RY3 A;  4L17 A;  1MG1 A;  4DXU A;  5A5L A;  3GBA A;  4KYD A;  1P1Q A;  2HAV A;  2I58 A;  5L9S A;  1D3K A;  3T66 A;  1DSN A;  4R9G A;  3FXU A;  4AB6 A;  3NOH A;  5AA4 B;  4PE3 A;  1JEU A;  4ZDM A;  3MW0 A;  1MPC A;  1ATG A;  3S4U A;  1IEJ A;  1YPN A;  5DVJ A;  2CEY A;  2QS2 A;  2ONR A;  1I6A A;  1IMA A;  2PT2 A;  4YKJ A;  1FQA A;  4GWS A;  1ELJ A;  1SBP A;  3HO7 A;  3OO9 A;  2DYX A;  3MPL A;  2FIE A;  4ND9 A;  2DE4 A;  2KQZ A;  4E0W A;  2ZNT A;  1PC3 A;  2O1L A;  1ZMG A;  1FTO A;  1TXF A;  5AA4 A;  2P0S A;  4XKQ A;  5CRY A;  2ALU A;  3VLV A;  3G3K A;  2F5X A;  3OO6 A;  5J1D A;  1B5J A;  1PB9 A;  4OA4 A;  4IB2 A;  4YZZ A;  3TEP A;  4AS5 A;  2P3N A;  1B4Z A;  3CI8 A;  5DVI A;  3K6V A;  5I56 B;  4P8B A;  1FPE A;  2XXP A;  1O64 A;  3UOR A;  4GX6 A;  2F7C A;  1KZ8 A;  5HBC A;  3CFL A;  3T96 B;  4PFB A;  5HM4 B;  2FA7 A;  1MXV A;  3EHU A;  4YB7 A;  1LAF E;  4FE8 A;  3MZB A;  3T0J A;  3IR1 A;  2QMW A;  3B6T A;  3C9H A;  2ONK E;  3GLB A;  3LSF B;  4IGR A;  3C35 A;  4DI4 B;  1B7H A;  3CFX A;  3LSW A;  5I56 A;  4BLA A;  1N7W A;  3IB0 A;  1Y3Q A;  4OVP A;  3ILT B;  4XFE A;  4PGP A;  5CMM A;  1NMU A;  5KCJ B;  3MP6 A;  4MLV A;  5F7V A;  1XC1 A;  1FCK A;  4I62 A;  3SZP A;  3KC0 A;  4DLD A;  5H8F B;  3M3K A;  4MBP A;  1H76 A;  1AMF A;  2JJK A;  4LVQ A;  1B2H A;  4BDL A;  1BKA A;  5K2X A;  3C31 A;  3U72 A;  4MIJ A;  3IFA A;  2Y7K A;  1XS5 A;  2IEE A;  1FQE A;  3TUS A;  4RK2 A;  3U1O A;  1MQD A;  4BDR A;  4KYS A;  1VFE A;  1YYZ A;  5KCJ A;  2GHA A;  2Q74 A;  4R75 A;  4JSO A;  4PAI A;  4JVI A;  4OVR A;  1OIB A;  4UAB A;  2DOJ A;  1MH4 A;  1GV8 A;  3TTM A;  1JW4 A;  1SVX B;  2DSF A;  3JZJ A;  2QSX A;  4TLM B;  2I4B A;  4MNI A;  4OEN A;  1N7X A;  3H3G A;  5I5P A;  2Q2A A;  2XD3 A;  4NG7 A;  1NNT A;  2DQV A;  5TP9 A;  4DDD A;  1ZIU A;  2ZNS A;  3G3I A;  2VD3 A;  3QXM A;  5IZ3 B;  1FPK A;  1FW0 A;  5CMC A;  5DT6 A;  5I7I A;  3RQT A;  2OWS A;  2HEU A;  4HW8 A;  4XKN A;  5T3J A;  3R6U A;  4YKI A;  5F1Q A;  3VDF A;  2QL3 A;  3H7M A;  2CZK A;  5CI5 A;  1RYO A;  1DTZ A;  2RC9 A;  3CRB A;  1A8F A;  1AIV A;  1RDX A;  4HCW A;  1LBV A;  1MY0 A;  1FPB A;  1R1N A;  2V3T A;  1OLC A;  2D21 A;  4NTL A;  1AH5 A;  1P99 A;  5K2Y A;  2PT1 A;  4KI0 E;  1MS7 A;  4C1U A;  3CG1 A;  5BWJ A;  2UYE A;  1JEV A;  1QUL A;  2R6G E;  1NH8 A;  4IY5 A;  3FXB A;  4P1L A;  4IO3 A;  5IZ1 A;  1DTG A;  2V3Q A;  4QHQ A;  4DCY A;  4C0R A;  5ICT A;  1EZP A;  3PGF A;  4GXA A;  4OFO A;  2X7Q A;  3MUQ A;  3BBR A;  1CE2 A;  1NV2 A;  3RYD A;  2O69 A;  5DEX B;  3I5O A;  4KCC A;  3QIM A;  1NUW A;  3O2A A;  4GXS B;  3KEI A;  3L6H A;  1QUJ A;  3FAS A;  4R6H A;  1QKB A;  4XKP A;  5AA2 D;  4OEV A;  4NQ8 A;  3RPW A;  4H67 A;  3FAT A;  2Y84 A;  2DWH A;  1S9T A;  2VGQ A;  1ZLQ A;  2ZZX A;  2QFL A;  3E4R A;  4GWX A;  4H46 A;  3MJN A;  3MVY A;  2XXK A;  1FPJ A;  3N26 A;  3BIG A;  4U21 A;  5TPA B;  3FXQ A;  1SW1 A;  5F24 A;  4R2F A;  4RPO A;  1EYI A;  3EHT A;  4KD5 A;  1UTB A;  3LR1 A;  4HE1 A;  4TQU Q;  4DCX A;  4G68 B;  2F8D A;  3MYU A;  1FQD A;  3IJO B;  2Y7P A;  3B8B A;  3PD8 A;  5ISU A;  1LBY A;  3IO4 A;  2Y5L A;  1S7Y A;  2I3V A;  1IXG A;  1B0L A;  1B1H A;  2F35 A;  4FEC A;  2QVR A;  1CNQ A;  3Q29 A;  5I3S A;  3MVX A;  2OWT A;  4EQB A;  2F3D A;  5CMK A;  5LDZ A;  4PFU A;  3A3U A;  4ZZA A;  2W7Y A;  4UAC A;  4QSE A;  4KR5 A;  4MLQ A;  4U1O A;  2Q89 A;  2I4C A;  2ONS A;  3EN3 A;  4XTC Q;  2B4L A;  4OER A;  4NF8 A;  2IA4 A;  1PBP A;  3SES A;  3CG3 A;  5DVF A;  3EQ1 A;  3M3F A;  1HSE A;  5KDT B;  4X04 A;  1NUY A;  4WKM A;  2PFY A;  2PFZ A;  2XD2 A;  3DP6 A;  5H8H B;  1GR2 A;  4OVS A;  4ELR A;  2A5T B;  2H9B A;  2HFB A;  5A5X B;  5FHN A;  2WYP A;  3PMX A;  2DWA A;  4JSD A;  3DLN A;  4U23 A;  4TOZ A;  3O28 A;  2XX7 A;  4F3G A;  4QBA A;  3FVK A;  4LON B;  5B70 A;  5IM2 A;  2CZL A;  3T93 B;  1LST A;  4ZEF A;  3V83 A;  5H8H A;  4GQO A;  4QFK A;  4N6D A;  5DYH A;  2VPO A;  3QMF A;  4ONY A;  4YMB A;  3E79 A;  4HTG A;  5A5X A;  3S9E A;  3O97 A;  3I3V A;  5I2K A;  4OQO A;  5LTC A;  3M3L A;  4RA1 A;  4H8J A;  3V8X B;  4JWY A;  4JVC A;  4FAT A;  1RKM A;  2G93 A;  1HSJ A;  1NNK A;  2CZH A;  3KZG A;  3SEX A;  4P3L A;  3S9L C;  1GVC A;  2ZYM A;  3A3C A;  3B6Q A;  3H03 A;  4ESX A;  1B4H A;  1TFD A;  4PE5 B;  3E78 A;  2I0C A;  3H6T A;  3C4M A;  4N4U A;  4KFQ A;  3U8Q A;  4DZ1 A;  3PMW A;  3W9W A;  4F29 A;  1AWB A;  1MQJ A;  5JEI A;  4OFL A;  2AL5 A;  4OYV A;  4G8H A;  1UIV A;  5M2V A;  1LBZ A;  4TLL B;  4FIM A;  1SI0 A;  1PBQ A;  1LFH A;  2AIX A;  4IR8 A;  3IX1 A;  3E13 X;  1VSO A;  1JNF A;  3FVG A;  1YCJ A;  4AB5 A;  5H8Q B;  1B40 A;  2HZL A;  4NWD A;  4O3C A;  2AL4 A;  1VFD A;  4ZEB A;  2VPN A;  2X26 A;  3K4U A;  3E9X A;  5JTY A;  2R9J A;  2HQ0 A;  2GFE A;  4BDN A;  3ROJ A;  2ZZV A;  4GF8 A;  3K2D A;  3D4C A;  3HV1 A;  3C34 A;  3RTF B;  4KCD A;  3U92 A;  2Z22 A;  4N15 A;  1TWY A;  2ABH A;  1QJM A;  4GLI A;  4PFI A;  4X8R A;  1RDY A;  3OEL A;  4U1Z A;  5H8Q A;  1SW2 A;  2P3V A;  3CHG A;  3TYH A;  1MQI A;  3KBZ A;  4OEU A;  5CBR A;  5I59 A;  1WVJ A;  2XXX A;  3PD9 A;  1TFA A;  3SEU A;  2DS9 A;  1B1X A;  1M5B A;  1S50 A;  1RDZ A;  3KJ7 A;  3KFM A;  1MXZ A;  4XXU A;  1PB8 A;  4K3F A;  3KG2 A;  2R71 A;  2PX1 A;  1D9Y A;  4PTK A;  1XVY A;  1MY2 A;  3IO6 A;  2MKZ A;  3MVW A;  4ZEI A;  3FBP A;  3K02 A;  3B6W A;  3KOT A;  1FBG A;  3RUM A;  1HSL A;  4LQ2 A;  1ZJL A;  1OLA A;  3JYR A;  4THI A;  4H5F A;  1KWH A;  5EHM A;  1LBX A;  3K0V A;  3SET A;  1OQG A;  1EYK A;  4PDD A;  1PB7 A;  1RYX A;  3RT8 A;  3UP9 A;  4IGT A;  2RCB A;  2I0B A;  1FQC A;  5L9M A;  5I2N A;  1D4N A;  4IO6 A;  2YLN A;  4R72 A;  4QF9 A;  4NN3 A;  1LBW A;  3T9V A;  3T1B A;  2PVU A;  4EQ7 A;  3FV2 A;  5AA1 A;  1MM6 A;  5ICQ A;  2ZXT A;  3C32 A;  1LLS A;  1FTL A;  1SI1 A;  3TQW A;  4O94 A;  2GH9 A;  5AA3 A;  3CFZ A;  2VP1 A;  1FQF A;  2FIX A;  5LOM A;  1VE4 A;  1Y20 A;  2DDK A;  4N8Y A;  2XXU A;  1H45 A;  4OHN A;  4YKP A;  2CEX A;  4MCO A;  1USY E;  1AOV A;  1EU8 A;  4F39 A;  4N6P A;  4O8M A;  3PMV A;  2G29 A;  4I3E A;  1R9Q A;  1BLF A;  1LB8 A;  3GBB A;  3FV1 A;  3OSQ A;  1M5F A;  4PC9 A;  2ZYO A;  3S9N C;  2Y5K A;  2XXQ A;  1O63 A;  4GL8 A;  4R9F A;  2GQ1 A;  2DXR A;  3JV9 A;  3TCH A;  3D4G A;  3MWB A;  4N17 A;  1IXI A;  1IIT A;  2P1S A;  1UTH B;  4F3P A;  4LQ5 A;  3UIF A;  5TP9 B;  1N04 A;  4Z7E A;  2B3F A;  2XXY A;  2HCA A;  3TKD A;  3P7I A;  4G8M A;  1IMC A;  1OMP A;  3FVN A;  3K00 A;  2BJI A;  3CR9 A;  1A55 A;  1R9L A;  4MEV A;  4BDM A;  2DVC A;  3MVZ A;  3T9U A;  1BTJ A;  5CM6 A;  3S9M C;  4HXV A;  2RC7 A;  3USD A;  1J1N A;  4G61 A;  2FHY A;  3Q27 A;  1UTH A;  3VXC A;  2H5Y A;  3IOR A;  3ZS6 A;  1EZO A;  4DE8 A;  2O84 X;  4GL0 A;  3TTK A;  1B3L A;  3WAE A;  1FBF A;  1B05 A;  2REG A;  4R6Y A;  3MC2 A;  1A8E A;  3Q26 A;  1Q35 A;  2XXI A;  4F2Q A;  3VVD A;  1N0T A;  2E1S A;  3BFU A;  4YB5 A;  2XWK A;  3D1R A;  4POW A;  5CC2 A;  1B52 A;  3IOW A;  4NGU A;  1NV0 A;  3N6T A;  3OMB A;  1NKX A;  4H45 A;  4FOR A;  5ITP A;  1M5E A;  1IMB A;  5FHO A;  3KN3 A;  2QS1 A;  3KGC A;  3O6I A;  3R26 A;  4Q5T A;  1MQH A;  1NV1 A;  4P0G A;  3OO8 A;  3MST A;  3G3F A;  2OX3 A;  4LA9 A;  4M4G A;  1N3W A;  1Q9D A;  3E3K A;  1JET A;  1SYI A;  3MP8 A;  2HPG A;  1H3D A;  3K6X A;  4ZS9 A;  2QVV A;  2GRV A;  3C36 A;  5KZT A;  3LV0 A;  1XT8 A;  1JVX A;  1B32 A;  1L5T A;  1UTB B;  4POX A;  3G3H A;  1SW4 A;  1WDN A;  1FSA A;  1DK4 A;  1EYJ A;  3TTR A;  1LFI A;  1MY3 A;  1SPI A;  2Z8E A;  2WKY A;  1JVY A;  5H8N B;  3ZKL A;  4YKK A;  3TTL A;  4C1T A;  4M1V A;  4RNS A;  3KOS A;  2OK2 A;  4NMY A;  4PAF A;  3FZV A;  1Y4C A;  1O7T A;  2V93 A;  4XF5 A;  4GWW A;  4X48 A;  3KN8 A;  4N6K A;  4LN5 A;  1SQY A;  1II5 A;  1FPF A;  4QFP A;  2NOO A;  4OTE A;  2PMS A;  3MAM A;  1B5I A;  1SDX A;  3DM0 A;  2B4M A;  4PGN A;  4F19 A;  5H8N A;  5FHM A;  5IAI A;  4GWO A;  4ISU A;  5B7D A;  1QW0 A;  4OMB A;  4NF8 B;  4NF0 A;  1GGG A;  3TQL A;  4F31 B;  4JBZ A;  4N07 A;  4ZEC A;  4HS7 A;  1P1U A;  3LC8 A;  1XHY A;  4MFI A;  1JW1 A;  4IO2 A;  5EQA A;  3ONM A;  5TU0 A;  3RNN A;  1IQ7 A;  3MPK A;  2Q9T A;  5IKB A;  1KA1 A; 
#chains in the Genus database with same CATH homology
 3MBP A;  2UVJ A;  3H6W A;  3TMG A;  4I1D A;  4ZEK A;  4IO4 A;  3VLW A;  3PPO A;  3N5L A;  2Q88 A;  2XX9 A;  3VV5 A;  2E0S A;  1USY H;  3H6V A;  2F97 A;  2DE3 A;  4QSC A;  1IXH A;  3I6V A;  2Y7R A;  2QMX A;  4O3B A;  2F36 A;  2DWI A;  4RXL A;  3FGS A;  2PYY A;  1EH3 A;  1URG A;  5I2K B;  3G3G A;  2OLB A;  1NL5 A;  3HCQ A;  5CMB A;  4ELO A;  1GTK A;  2O1M A;  4NWC A;  4XKR A;  5ITO A;  5I57 A;  2UXA A;  3V5A A;  1PEB A;  3RN8 A;  1A40 A;  1ANF A;  2RCA A;  4Q0C A;  3PPQ A;  2M8C A;  3HHG A;  4R6K A;  3RGY A;  3O6H A;  2QS4 A;  3CSB A;  1XOC A;  3RT6 B;  3FUZ A;  4JWX A;  1IZ1 A;  4YIC A;  2Q8J A;  3T9H B;  3C33 A;  1MH3 A;  3BFT A;  3VXB A;  4OES A;  4DIG A;  1Y4T A;  5CBS A;  4EF1 A;  4JDF A;  3AXF A;  3EPE A;  2HAU A;  1B3E A;  1MY1 A;  1Y3N A;  1MQG A;  1B3F A;  1JQF A;  4FJP A;  1LFG A;  1NNF A;  1TT1 A;  3KSJ A;  2H98 A;  3PUY E;  1SW5 A;  4NF4 A;  1NH7 A;  4YU0 A;  4DXC A;  2H4I A;  5JTY B;  4F1Y A;  4X1D A;  3O66 A;  3G7W A;  4H65 A;  3VVF A;  2V25 A;  4G77 A;  3SDF A;  2Z8F A;  4ZZE A;  3HPI A;  5EHS A;  1B7U A;  5I59 B;  4G4P A;  3PUW E;  5DTB A;  3IAZ A;  3GXA A;  3FVO A;  5I58 A;  5JK4 A;  1MXY A;  2V84 A;  1JW5 A;  3OSR A;  2I3W A;  1A99 A;  2F7B A;  4PET A;  3V89 B;  2O7U A;  3W9V A;  3IB1 A;  4U22 A;  4NF6 A;  1H43 A;  1XVX A;  3TCF A;  1NNP A;  3LSL A;  3FXR A;  3TEL A;  4LP2 B;  4EF2 A;  2QPQ A;  1DOT A;  2H99 A;  1UQW A;  2OCU A;  1LB9 A;  3VVE A;  4GOT A;  2YPN A;  3PPP A;  3PUX E;  4I9D A;  1M5D A;  5I2N B;  3KSX A;  3ZSF A;  1N3X A;  3THI A;  1SD3 A;  2D3I A;  3MZ9 A;  2UVG A;  4RK9 A;  2ESN A;  3MZ1 A;  2A5S A;  4X1B A;  4EUO A;  1US4 A;  4GVO A;  4PP0 A;  2O51 A;  2RF1 A;  2Z8D A;  2XHD A;  4RJZ A;  1QVS A;  4PFW A;  2HXW A;  2OZZ A;  4OZ9 A;  4H8I A;  4U4X A;  1EZ9 A;  2ZYN A;  3O29 A;  1IIW A;  4LZ5 A;  1QUI A;  4JXI A;  3VE1 B;  2XXW A;  1MDP 1;  3DP4 A;  4LAT A;  3QAX A;  3SEY A;  3KN7 A;  3K6W A;  3QUJ A;  3ECR A;  3SEW A;  4F2O A;  3L6G A;  1US5 A;  5FTI A;  1MDQ A;  1P1W A;  2Y7I A;  2XXR A;  3ILU B;  4WXJ A;  1MXX A;  1LBC A;  3OO7 A;  3OEN A;  3QUF A;  2RC8 A;  1N76 A;  3QK6 A;  3TTN A;  4IY6 A;  1MM7 A;  3N6U A;  2NVU B;  4U2R A;  4NF5 B;  3UN6 A;  3U93 A;  2F7A A;  4QSD A;  1LCT A;  1LAG E;  4FEB A;  3TFL A;  3LSX A;  3SKP A;  1A54 A;  3OEK A;  4F18 A;  4R73 A;  4LZ8 A;  1I69 A;  3IOT A;  4LUB A;  2V3U A;  4DXB A;  2O68 A;  2VD2 A;  1MY4 A;  4NE4 A;  1B46 A;  1URS A;  2F6P A;  3N94 A;  4GRK A;  1B6H A;  4NF5 A;  4G2Z A;  1ZKB A;  1B9J A;  4F3S A;  2DXY A;  4EQ9 A;  1MPB A;  1UIU A;  1Z7M E;  3O9P A;  5H8F A;  1D9V A;  3CIJ A;  4LZ7 A;  5AA2 B;  2P2A A;  1OVT A;  4UA8 A;  3EHS A;  3Q28 A;  1ZU0 A;  1LAX A;  4E0X A;  1H44 A;  2O6A A;  2PBW A;  2F78 A;  2D5W A;  2B3B A;  1YAE A;  4OXV A;  1PDA A;  3G3J A;  3FD3 A;  4ZE8 A;  1WOD A;  1DMB A;  2AYS A;  1B0H A;  1VR5 A;  4PQJ A;  5AA2 A;  1BP5 A;  3U94 A;  4ZED A;  4F22 A;  1Y3P A;  3MP1 A;  3SEV A;  5FTH A;  1FQB A;  4F3B A;  1I6Q A;  3R7X A;  4GFR A;  4KPT A;  2O7I A;  3M8U A;  1B58 A;  3B7D A;  4GD5 A;  1Y1Z A;  2B65 A;  4QFO A;  3DP8 A;  1POY 1;  2GHB A;  3S2V A;  1LBB A;  1POT A;  2LAO A;  1OVB A;  1AL3 A;  2ZNU A;  4P0I A;  3CSG A;  4QFN A;  4FED A;  3K01 A;  2XXH A;  3SER A;  1URD A;  2BJJ X;  2ANJ A;  5HPQ A;  1BIY A;  3HHF A;  3FJ7 A;  4GIZ A;  4ECF A;  3K1N A;  3FJM A;  1IUD A;  3H4Z A;  2VHA A;  1Y1M A;  4JWO A;  4YB6 A;  3ODB A;  4YMA A;  3WAF A;  5DEX A;  2DE2 A;  3LUY A;  2RKM A;  3BKI B;  2FNC A;  4OWD A;  5H8S A;  4PFY A;  2F6G A;  4H0W A;  3DEL B;  3IJX B;  4EXK A;  1M5C A;  3O6G A;  4QFL A;  1YTV A;  4MH5 A;  2RIN A;  4WEP A;  5ELV A;  2REJ A;  4MF3 A;  2UVI A;  1I6B A;  3H06 B;  1FTJ A;  2NUV A;  5TPA A;  4RPN A;  4X9T A;  4AQ4 A;  4EDP A;  2H25 A;  1MPD A;  3KBR A;  4IO5 A;  4G8N A;  3IOV A;  1Z7N E;  1Y9U A;  3VLU A;  4G68 A;  2DWJ A;  2DP8 A;  5L8D A;  5I57 B;  3PUZ E;  4IO7 A;  4H6D A;  4EXL A;  3OOA A;  2XXT A;  1B5H A;  3PPN A;  4P11 A;  3IOU A;  2UYF A;  2QJE A;  3UK4 A;  4F1V A;  1MXW A;  4R2B A;  2NWJ A;  3K1P A;  3OD7 A;  5AE4 A;  4H5G A;  1MRP A;  1P1O A;  1R6Z A;  4OFJ A;  1P1N A;  2OJT A;  4QRZ A;  4ZE9 A;  3PUV E;  4Z0I A;  1N84 A;  3QYT A;  4OET A;  2QRY A;  4Q30 B;  3IB2 A;  1OQH A;  4RY1 A;  2FYI A;  5KDT A;  3IL1 B;  2ZYK A;  3FJG A;  3A09 A;  1IXC A;  2OBG A;  3TCG A;  4NF4 B;  1ZBM A;  3T22 A;  4OVJ A;  2A5T A;  1B3G A;  4O3A A;  1NFT A;  4N13 A;  4KQP A;  2ZMB A;  4FAJ A;  3LBS A;  1LAH E;  2F34 A;  2NXO A;  4KYE A;  3H6U A;  1FTM A;  5I84 A;  3VFJ A;  3HN0 A;  3OXN A;  4F1U A;  3PV0 E;  2I49 A;  3T9X B;  3UA8 A;  3F11 A;  3Q25 A;  3PPR A;  4BDO A;  1ZTY A;  3K6U A;  2DVZ A;  3FIR A;  1FTK A;  1QUK A;  2I48 A;  2Q2C A;  1QKA A;  4ESW A;  3TDJ A;  3UGW A;  3TAJ A;  3ZKK A;  1CB6 A;  5I58 B;  3HST A;  2XXV A;  3OEM A;  2UVH A;  2QS3 A;  3GZG A;  2I6E A;  3CVG A;  1MXU A;  3RTW B;  1B51 A;  1B7Z A;  1DPE A;  2Y7W A;  4NF6 B;  4Q8R A;  4BDQ A;  3IK6 B;  5BUU A;  2X7P A;  4KHZ E;  1F9B A;  2VOZ A;  3RLF E;  1LGB C;  4H1X A;  5EYF A;  3PU5 A;  1SYH A;  1B3H A;  4NED A;  3K1M A;  1T0K A;  3KJT A;  2HZK A;  2CMO A;  1LCF A;  4I8C A;  4WED A;  3EF7 A;  4RYA A;  2XX8 A;  3QSL A;  2THI A;  5L9O A;  4ELP A;  2YJP A;  4R74 A;  4YAH X;  3TPA A;  4U4S A;  4G68 C;  4HCY A;  4ELQ A;  4PFT A;  2Z23 A;  1DPP A;  3MQ9 A;  3TZA A;  3W15 C;  1Q1K A;  2KLF A;  4XIG Q;  1A7L A;  4JB7 A;  3TOD A;  3RY3 A;  4L17 A;  1MG1 A;  4DXU A;  3GBA A;  4KYD A;  1P1Q A;  2HAV A;  2I58 A;  5L9S A;  1D3K A;  3T66 A;  1DSN A;  4R9G A;  3FXU A;  4AB6 A;  5AA4 B;  1JEU A;  4ZDM A;  3MW0 A;  1MPC A;  1ATG A;  3S4U A;  1IEJ A;  1YPN A;  5DVJ A;  2QS2 A;  2ONR A;  1I6A A;  2PT2 A;  4YKJ A;  1FQA A;  1ELJ A;  1SBP A;  3HO7 A;  3OO9 A;  2DYX A;  3MPL A;  4ND9 A;  2DE4 A;  4E0W A;  2ZNT A;  1PC3 A;  2O1L A;  1ZMG A;  1FTO A;  1TXF A;  5AA4 A;  2P0S A;  4XKQ A;  5CRY A;  2ALU A;  3VLV A;  3G3K A;  2F5X A;  3OO6 A;  5J1D A;  1B5J A;  1PB9 A;  4IB2 A;  4YZZ A;  3TEP A;  1B4Z A;  3CI8 A;  5DVI A;  3K6V A;  5I56 B;  2XXP A;  1O64 A;  3UOR A;  2F7C A;  5HBC A;  3CFL A;  3T96 B;  5HM4 B;  2FA7 A;  1MXV A;  3EHU A;  4YB7 A;  1LAF E;  4FE8 A;  3MZB A;  3IR1 A;  2QMW A;  3B6T A;  3C9H A;  2ONK E;  3GLB A;  3LSF B;  4IGR A;  3C35 A;  1B7H A;  3CFX A;  3LSW A;  5I56 A;  4BLA A;  1N7W A;  3IB0 A;  1Y3Q A;  3ILT B;  5CMM A;  1NMU A;  5KCJ B;  3MP6 A;  4MLV A;  5F7V A;  1XC1 A;  1FCK A;  4I62 A;  4DLD A;  5H8F B;  3M3K A;  4MBP A;  1H76 A;  1AMF A;  4LVQ A;  1B2H A;  4BDL A;  1BKA A;  5K2X A;  3C31 A;  3U72 A;  2Y7K A;  1XS5 A;  2IEE A;  1FQE A;  3TUS A;  4RK2 A;  3U1O A;  1MQD A;  4BDR A;  4KYS A;  1VFE A;  5KCJ A;  2GHA A;  4R75 A;  4JSO A;  1OIB A;  2DOJ A;  1MH4 A;  1GV8 A;  3TTM A;  1JW4 A;  1SVX B;  2DSF A;  3JZJ A;  2QSX A;  4TLM B;  2I4B A;  4OEN A;  1N7X A;  3H3G A;  2Q2A A;  2XD3 A;  1NNT A;  2DQV A;  5TP9 A;  4DDD A;  1ZIU A;  2ZNS A;  3G3I A;  2VD3 A;  3QXM A;  1FW0 A;  5CMC A;  5DT6 A;  3RQT A;  2OWS A;  2HEU A;  4HW8 A;  4XKN A;  3R6U A;  4YKI A;  5F1Q A;  3VDF A;  2QL3 A;  3H7M A;  5CI5 A;  1RYO A;  1DTZ A;  2RC9 A;  3CRB A;  1A8F A;  1AIV A;  4HCW A;  1MY0 A;  1R1N A;  2V3T A;  1OLC A;  2D21 A;  4NTL A;  1AH5 A;  1P99 A;  5K2Y A;  2PT1 A;  4KI0 E;  1MS7 A;  4C1U A;  3CG1 A;  5BWJ A;  2UYE A;  1JEV A;  1QUL A;  2R6G E;  1NH8 A;  4IY5 A;  4IO3 A;  1DTG A;  2V3Q A;  4QHQ A;  4DCY A;  4C0R A;  5ICT A;  1EZP A;  3PGF A;  4GXA A;  4OFO A;  2X7Q A;  3MUQ A;  3BBR A;  1CE2 A;  2O69 A;  5DEX B;  3I5O A;  4KCC A;  3QIM A;  3O2A A;  4GXS B;  3KEI A;  3L6H A;  1QUJ A;  3FAS A;  4R6H A;  1QKB A;  4XKP A;  5AA2 D;  4OEV A;  3RPW A;  4H67 A;  3FAT A;  2Y84 A;  2DWH A;  1S9T A;  2VGQ A;  1ZLQ A;  3E4R A;  3MJN A;  3MVY A;  3N26 A;  4U21 A;  5TPA B;  3FXQ A;  1SW1 A;  4R2F A;  4RPO A;  3EHT A;  4KD5 A;  1UTB A;  3LR1 A;  4TQU Q;  4DCX A;  4G68 B;  2F8D A;  1FQD A;  3IJO B;  2Y7P A;  3PD8 A;  5ISU A;  3IO4 A;  1S7Y A;  2I3V A;  1IXG A;  1B0L A;  1B1H A;  2F35 A;  4FEC A;  3Q29 A;  3MVX A;  2OWT A;  4EQB A;  5CMK A;  4PFU A;  3A3U A;  4ZZA A;  2W7Y A;  4UAC A;  4QSE A;  4KR5 A;  4MLQ A;  2Q89 A;  4U1O A;  2I4C A;  2ONS A;  3EN3 A;  4XTC Q;  4OER A;  4NF8 A;  2IA4 A;  1PBP A;  3SES A;  3CG3 A;  5DVF A;  3EQ1 A;  3M3F A;  1HSE A;  5KDT B;  4WKM A;  5H8H B;  2XD2 A;  3DP6 A;  1GR2 A;  4ELR A;  2A5T B;  2H9B A;  2HFB A;  5A5X B;  5FHN A;  3PMX A;  2DWA A;  4JSD A;  3DLN A;  4U23 A;  4TOZ A;  3O28 A;  2XX7 A;  4F3G A;  3FVK A;  4LON B;  5B70 A;  2CZL A;  3T93 B;  1LST A;  4ZEF A;  3V83 A;  5H8H A;  4GQO A;  4QFK A;  5DYH A;  4ONY A;  4YMB A;  4HTG A;  5A5X A;  3S9E A;  3O97 A;  3I3V A;  5I2K A;  4OQO A;  3M3L A;  4RA1 A;  4H8J A;  3V8X B;  4JWY A;  4FAT A;  1RKM A;  2G93 A;  1HSJ A;  1NNK A;  3KZG A;  3SEX A;  3S9L C;  1GVC A;  2ZYM A;  3A3C A;  3B6Q A;  3H03 A;  4ESX A;  1B4H A;  1TFD A;  4PE5 B;  2I0C A;  3H6T A;  3C4M A;  4KFQ A;  3U8Q A;  4DZ1 A;  3PMW A;  3W9W A;  4F29 A;  1MQJ A;  5JEI A;  4OFL A;  2AL5 A;  4OYV A;  4G8H A;  1UIV A;  5M2V A;  4TLL B;  4FIM A;  1SI0 A;  1PBQ A;  1LFH A;  2AIX A;  3IX1 A;  3E13 X;  1VSO A;  1JNF A;  3FVG A;  1YCJ A;  4AB5 A;  5H8Q B;  1B40 A;  2HZL A;  4NWD A;  4O3C A;  2AL4 A;  1VFD A;  4ZEB A;  2X26 A;  3K4U A;  3E9X A;  5JTY A;  2R9J A;  2HQ0 A;  2GFE A;  4BDN A;  4GF8 A;  3K2D A;  3D4C A;  3HV1 A;  3C34 A;  3RTF B;  4KCD A;  3U92 A;  2Z22 A;  1TWY A;  2ABH A;  1QJM A;  4GLI A;  3OEL A;  4U1Z A;  5H8Q A;  1SW2 A;  3TYH A;  1MQI A;  4OEU A;  5CBR A;  5I59 A;  1WVJ A;  2XXX A;  3PD9 A;  1TFA A;  3SEU A;  2DS9 A;  1B1X A;  1M5B A;  1S50 A;  3KJ7 A;  3KFM A;  1MXZ A;  4XXU A;  1PB8 A;  4K3F A;  3KG2 A;  2R71 A;  2PX1 A;  1D9Y A;  1XVY A;  1MY2 A;  3IO6 A;  3MVW A;  4ZEI A;  3K02 A;  3B6W A;  3KOT A;  3RUM A;  1HSL A;  4LQ2 A;  1ZJL A;  1OLA A;  3JYR A;  4THI A;  4H5F A;  1KWH A;  5EHM A;  3K0V A;  3SET A;  1OQG A;  1PB7 A;  1RYX A;  3RT8 A;  3UP9 A;  4IGT A;  2RCB A;  2I0B A;  1FQC A;  5L9M A;  5I2N A;  1D4N A;  4IO6 A;  2YLN A;  4R72 A;  4QF9 A;  3T9V A;  2PVU A;  4EQ7 A;  3FV2 A;  5AA1 A;  1MM6 A;  5ICQ A;  2ZXT A;  3C32 A;  1LLS A;  1FTL A;  1SI1 A;  3TQW A;  2GH9 A;  5AA3 A;  3CFZ A;  2VP1 A;  1FQF A;  5LOM A;  1VE4 A;  1Y20 A;  2XXU A;  1H45 A;  4OHN A;  4YKP A;  1USY E;  1AOV A;  1EU8 A;  4F39 A;  4N6P A;  3PMV A;  2G29 A;  1R9Q A;  1BLF A;  1LB8 A;  3GBB A;  3FV1 A;  3OSQ A;  1M5F A;  2ZYO A;  3S9N C;  2XXQ A;  1O63 A;  4GL8 A;  4R9F A;  2DXR A;  3JV9 A;  3TCH A;  3D4G A;  3MWB A;  1IXI A;  1IIT A;  2P1S A;  1UTH B;  4F3P A;  4LQ5 A;  3UIF A;  5TP9 B;  1N04 A;  4Z7E A;  2B3F A;  2XXY A;  2HCA A;  3TKD A;  3P7I A;  4G8M A;  1OMP A;  3FVN A;  3K00 A;  3CR9 A;  1A55 A;  1R9L A;  4BDM A;  2DVC A;  3MVZ A;  3T9U A;  1BTJ A;  5CM6 A;  3S9M C;  2RC7 A;  3USD A;  1J1N A;  3Q27 A;  1UTH A;  3VXC A;  2H5Y A;  3IOR A;  3ZS6 A;  1EZO A;  4DE8 A;  2O84 X;  4GL0 A;  3TTK A;  1B3L A;  3WAE A;  1B05 A;  2REG A;  4R6Y A;  3MC2 A;  1A8E A;  3Q26 A;  1Q35 A;  2XXI A;  4F2Q A;  3VVD A;  1N0T A;  2E1S A;  3BFU A;  4YB5 A;  4POW A;  5CC2 A;  1B52 A;  3IOW A;  3N6T A;  3OMB A;  1NKX A;  4FOR A;  5ITP A;  1M5E A;  5FHO A;  3KN3 A;  2QS1 A;  3KGC A;  3O6I A;  3R26 A;  4Q5T A;  1MQH A;  4P0G A;  3OO8 A;  3G3F A;  4LA9 A;  4M4G A;  1N3W A;  3E3K A;  1JET A;  1SYI A;  3MP8 A;  1H3D A;  3K6X A;  4ZS9 A;  2GRV A;  3C36 A;  5KZT A;  1XT8 A;  1JVX A;  1B32 A;  1L5T A;  1UTB B;  4POX A;  3G3H A;  1SW4 A;  1WDN A;  3TTR A;  1LFI A;  1MY3 A;  2Z8E A;  2WKY A;  1JVY A;  5H8N B;  3ZKL A;  4YKK A;  3TTL A;  4C1T A;  4M1V A;  4RNS A;  3KOS A;  2OK2 A;  4NMY A;  3FZV A;  1Y4C A;  1O7T A;  2V93 A;  4X48 A;  3KN8 A;  1SQY A;  1II5 A;  4QFP A;  2NOO A;  4OTE A;  2PMS A;  3MAM A;  1B5I A;  1SDX A;  3DM0 A;  4F19 A;  5H8N A;  5FHM A;  5IAI A;  4GWO A;  4ISU A;  5B7D A;  1QW0 A;  4OMB A;  4NF8 B;  1GGG A;  3TQL A;  4F31 B;  4JBZ A;  4N07 A;  4ZEC A;  4HS7 A;  1P1U A;  3LC8 A;  1XHY A;  4MFI A;  1JW1 A;  4IO2 A;  3ONM A;  5TU0 A;  3RNN A;  1IQ7 A;  3MPK A;  2Q9T A;  5IKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...