2XXRA

Crystal structure of the gluk2 (glur6) wild-type lbd dimer in complex with glutamate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
248
structure length
248
Chain Sequence
SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
publication title Conformational Flexibility of the Ligand-Binding Domain Dimer in Kainate Receptor Gating and Desensitization
pubmed doi rcsb
source organism Rattus norvegicus
total genus 86
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxrA02
4KYEA 2F7AA 3LR1A 5H8HB 4ZE8A 1N04A 4DDDA 3EN3A 3FVGA 2O68A 1JQFA 5I56A 5H8HA 3TYHA 3KZGA 3PPNA 1R1NA 3MZ9A 2R9JA 2V93A 4JSDA 4OFJA 3KG2A 4PETA 2QL3A 3V8XB 2QRYA 4IGTA 1I6BA 3K6UA 3K6VA 4U21A 3O29A 3H06B 4YU0A 3UGWA 1QUIA 3KSXA 4RXLA 3FJMA 2XX9A 4GXSB 3CSGA 4RPNA 5K2XA 4F1UA 4LONB 5F7VA 3TPAA 4YKJA 5J1DA 3KJTA 1ZMGA 3H6UA 3T96B 3KN3A 4R9GA 5LOMA 5BWJA 4LUBA 4R74A 1CB6A 3SETA 5I59B 3QUFA 4NF6B 4X9TA 2UVHA 1ZBMA 2M8CA 5DTBA 1PBPA 5I59A 2UVGA 4NF6A 3IO6A 3FVNA 4OMBA 4IO6A 1B5JA 3K00A 4DCYA 5JTYB 4JWOA 1P1QA 3PU5A 4RA1A 4QHQA 5JTYA 1IXHA 1UTBA 3TUSA 3SEUA 2Q2AA 1SI1A 5HPQA 1PEBA 4YB5A 2FA7A 2P0SA 4DXUA 1DSNA 2PX1A 2D5WA 3I6VA 2XD2A 4R2BA 3TTRA 3QIMA 3IOTA 4ZZAA 3LSWA 2WKYA 3DELB 1SW5A 2PVUA 2O7UA 3CFZA 3OD7A 4QF9A 5DVJA 2E0SA 3E9XA 4IO7A 1DOTA 3PPRA 1Z7ME 1US4A 2OWSA 3PUWE 3S9EA 2H9BA 4P0IA 3FV1A 4LZ8A 2HXWA 1N7XA 3R26A 4FECA 4MH5A 4Q5TA 4YMBA 1HSJA 3FJGA 1MDQA 2DE2A 4G68C 2DYXA 2OK2A 2F36A 4ESWA 3PPQA 2ZNSA 3EHTA 3TTMA 3PUVE 1O7TA 3FD3A 4GFRA 2RINA 1BKAA 3MUQA 4BDLA 2XXYA 3BFUA 4R6HA 2DXRA 1Y1MA 2VGQA 3E13X 3VXBA 2PMSA 5CBRA 1XS5A 4FE8A 4ZDMA 3Q29A 1MQGA 2O1MA 2VP1A 2A5TB 4BDNA 2ZYNA 4R6KA 1JW4A 1JETA 2A5TA 4YICA 3H4ZA 4JWYA 2ZXTA 1P1OA 2GFEA 1SI0A 2CMOA 3JYRA 4EF1A 5FHMA 2I48A 5TP9B 2D21A 1M5FA 1FQCA 3TTKA 1MY1A 5TP9A 2H99A 4YKIA 3H6WA 3EHSA 3MVYA 4TLMB 3DM0A 1SBPA 4N6PA 4R6YA 1J1NA 1XC1A 3OEMA 3C9HA 1B0HA 1QVSA 4PFYA 3L6HA 4UA8A 3ILUB 3MBPA 3MAMA 2PT1A 2F7CA 1LBCA 4EQ9A 5CM6A 3TCGA 4R9FA 2O6AA 1LB9A 4G8HA 2QS2A 4G8MA 3CRBA 1H45A 1B3HA 5DT6A 3KN7A 1LLSA 3WAEA 3TTLA 3IX1A 4DE8A 1LAGE 1MPBA 2NVUB 3SEYA 2AL4A 3D4GA 1M5BA 3O6GA 2V25A 4OESA 4YKPA 4KD5A 3F11A 3IJXB 3OO9A 4IY5A 2XXXA 3MPLA 1FQBA 4OERA 1MY0A 3JZJA 2QS4A 5HBCA 4H65A 1A8FA 3CSBA 3LC8A 1AOVA 3GLBA 2DE3A 3OEKA 1FQFA 4IO2A 3SESA 2F6PA 5AA1A 5AA4B 1T0KA 4NWDA 4LZ5A 2Y7KA 4KR5A 4C1TA 4HW8A 5AA4A 1B46A 3W9WA 2PBWA 3M3LA 3QAXA 3S9LC 1B7ZA 2ONKE 3PMVA 5I84A 3FZVA 1P1WA 3M8UA 2RC7A 4ZEIA 4U1ZA 4IB2A 1DMBA 4RY1A 3K01A 3DLNA 1B40A 1YAEA 3H6VA 4Z0IA 1N84A 4NE4A 3USDA 3K1MA 3MP1A 1S9TA 3OOAA 3UN6A 1D4NA 3MPKA 2OBGA 3CR9A 4BDQA 2UVJA 1JNFA 4QRZA 5CC2A 4K3FA 3HHGA 2THIA 3KJ7A 1MY3A 1MQHA 3PD8A 3TCFA 4BLAA 1B3LA 1FW0A 2I0CA 4U4SA 3MZ1A 3C34A 1AIVA 4OWDA 3OO8A 4PE5B 1D9VA 1B51A 3TQWA 4R2FA 1ZU0A 2ONRA 3RQTA 1DTGA 3TTNA 3TELA 2Y7WA 3S4UA 1ZKBA 4AB6A 1AL3A 1RYOA 3DP8A 4BDMA 3AXFA 3MC2A 4LVQA 4F18A 3OO6A 4F19A 4F3PA 3PPOA 2QMXA 3C36A 3RT8A 3C33A 3RGYA 5L9SA 3O66A 1WODA 4YKKA 1SW1A 3IJOB 4M4GA 2XX8A 4PFWA 5I2NB 3TODA 3N26A 1AH5A 3IR1A 1LFHA 4G68B 3FGSA 5I2NA 3VDFA 2DSFA 4KFQA 1YCJA 5KCJB 1JVXA 4G68A 3TKDA 4GD5A 2OCUA 4ZZEA 5KCJA 1Y1ZA 1LCFA 4F22A 4WEPA 2YPNA 1VFEA 4O3AA 3IB1A 3FJ7A 5IKBA 3N94A 4OENA 1BP5A 2R6GE 1MPCA 3PGFA 5H8NB 1MPDA 4IGRA 1ZLQA 1A8EA 2I3VA 1B1HA 4GIZA 4H8IA 2ANJA 4NF5B 5H8NA 3MVXA 1EZPA 1XVXA 3L6GA 3FASA 4OXVA 1QUJA 4NF5A 2DOJA 1NKXA 1F9BA 4N13A 1M5EA 3CFXA 3LBSA 3QYTA 2O1LA 2E1SA 2G93A 2RCBA 2B3BA 3QUJA 2XXWA 4YZZA 3T66A 1Y4CA 1SQYA 2V84A 5AE4A 3SEXA 4XXUA 1POTA 1US5A 5H8FB 3E3KA 4F29A 2HZKA 4H6DA 5CBSA 2XXQA 5H8FA 1II5A 2QMWA 1H43A 1CE2A 1GV8A 1MQIA 1SYIA 1WDNA 2RF1A 1N3XA 3EPEA 2R71A 1OMPA 4MFIA 1EH3A 1AMFA 2NOOA 1EZOA 2GH9A 3EF7A 3G3HA 4GL0A 2F78A 5L8DA 2XXVA 3OENA 4GXAA 4DXCA 1SYHA 3LSXA 1KWHA 1O64A 3IOWA 2HEUA 1ANFA 3FVOA 4RPOA 3B6WA 3Q27A 3HSTA 2UXAA 2ZNUA 4JXIA 5I56B 2O51A 3QXMA 2DQVA 1OVTA 4F2OA 1USYH 3RUMA 1NL5A 3PUYE 1OVBA 1OIBA 4NWCA 1MXXA 4U4XA 5DEXB 3ODBA 4LA9A 1Q1KA 4JSOA 4PP0A 3S2VA 3ZSFA 1IXCA 5L9MA 5DEXA 3T93B 2HQ0A 1M5CA 4IO5A 3TMGA 1NFTA 3CI8A 3TFLA 3C31A 3IAZA 3O28A 1FQAA 1MY2A 3O6IA 3B6QA 3W15C 1LFGA 3SDFA 1LBBA 4H67A 5I58B 5ICQA 4L17A 1VR5A 3WAFA 3HPIA 2H98A 5I58A 1L5TA 3R7XA 1LSTA 3W9VA 3A09A 4Q0CA 4F2QA 1Q35A 2O69A 3V83A 1BTJA 1R9QA 1SDXA 2REGA 4E0XA 2V3UA 3PMXA 2OLBA 2XXTA 1NNKA 3VLVA 4ONYA 1B9JA 3M3FA 3ONMA 1URSA 2AL5A 1IXGA 3RLFE 5AA3A 1LAFE 2VHAA 5I57B 2H5YA 3UA8A 1NNPA 3H3GA 3A3UA 3OELA 4PQJA 2NXOA 4GF8A 5I57A 1B5HA 5L9OA 2Y84A 4QFLA 3RPWA 5A5XB 1B5IA 1UTHB 1ATGA 1MRPA 2F6GA 1LB8A 3MWBA 4XIGQ 5A5XA 1RKMA 4GOTA 1URGA 1TWYA 1UTHA 3FVKA 4QFKA 3T22A 3BFTA 4KYSA 2Q8JA 5ISUA 2DVZA 1SD3A 2YJPA 1JEVA 5HM4B 4F3SA 1MQDA 2ZYOA 3TQLA 2XX7A 1O63A 3RTWB 1PBQA 3PPPA 1MM7A 4U1OA 1B3GA 3K02A 4LATA 4PFUA 5EYFA 4X48A 4RNSA 2O84X 4FEDA 3HN0A 3U72A 2Z8EA 3MVZA 4GLIA 3KOSA 1P99A 1GGGA 3O97A 2YLNA 3DP6A 1LAHE 4GRKA 1B0LA 3H7MA 2DWHA 3VLUA 3K2DA 4THIA 4BDOA 4KCDA 1D3KA 4OZ9A 1B4HA 3S9MC 4Z7EA 1GVCA 1A40A 3E4RA 2ZYMA 1IEJA 1P1NA 4R73A 3KSJA 5DYHA 4LQ5A 3C32A 4KCCA 1P1UA 2DWAA 4G8NA 3BKIB 4P11A 3G3IA 4I9DA 1DPEA 2DWJA 2P1SA 3G3JA 1DPPA 3CG3A 1MXYA 1MXUA 3GZGA 2V3TA 2HZLA 4XKRA 1VE4A 3C4MA 3TZAA 3TEPA 3HHFA 1TFDA 4R72A 3U93A 1EU8A 1Y3NA 3G3GA 4G77A 2X7QA 1XVYA 3PMWA 4G2ZA 1UQWA 3BBRA 4ZEKA 2FYIA 2IA4A 4RK9A 1Y3PA 3N5LA 4POWA 1MDP1 1MH3A 4HS7A 4LP2B 4HCWA 2DXYA 4H0WA 5JK4A 4ZE9A 3SERA 2DP8A 4O3CA 4RJZA 1VSOA 2F5XA 2ONSA 4PFTA 3IORA 2B65A 4EXKA 2I0BA 1A99A 4ESXA 1GR2A 5B7DA 2I58A 1FTJA 4ZEDA 2Z22A 1I6QA 1PB7A 4F3GA 1POY1 2D3IA 2G29A 2XXUA 4F31B 4OHNA 5FTHA 1I6AA 4LQ2A 3MW0A 3A3CA 1FCKA 3KBRA 1B3EA 5ICTA 3O2AA 4RK2A 1JW5A 2FNCA 5BUUA 2XXPA 2X7PA 1TXFA 4ELOA 1IUDA 3KOTA 2Q9TA 4XKPA 4NEDA 1HSEA 1LAXA 5CMMA 2Y7IA 1OQGA 2DE4A 3B6TA 3KEIA 1FTKA 3T9VA 4LZ7A 4JWXA 3FATA 3SKPA 4ISUA 2LAOA 4FATA 2KLFA 2Q88A 4XKNA 3I5OA 4QSEA 4RYAA 3N6UA 1IQ7A 4NTLA 4X1BA 1NH7A 2REJA 3QSLA 2HAUA 2XHDA 1IITA 3FIRA 1IIWA 5FHOA 1R6ZA 3OSQA 1LFIA 3VXCA 1XOCA 2W7YA 1B7UA 3UP9A 2VOZA 4JB7A 1B7HA 3K0VA 3GXAA 1PB9A 4HTGA 4C1UA 3MP6A 1Y20A 3GBAA 5EHMA 3R6UA 2QSXA 1N3WA 1MXWA 2RCAA 3I3VA 3P7IA 1QKAA 1MY4A 4AQ4A 2ZYKA 4GL8A 2RKMA 2I3WA 4Q30B 2I49A 2OZZA 3RNNA 3V89B 2XXRA 3UORA 4WXJA 3IL1B 3H6TA 2DWIA 2IEEA 1SW4A 1IXIA 3THIA 1Y4TA 4IO4A 4P0GA 1LCTA 3MZBA 4ZECA 1NH8A 2ZMBA 4F1YA 4OFLA 3VVEA 1NNFA 3RN8A 3U8QA 1OQHA 3U92A 1MXZA 1VFDA 4ELPA 4YB7A 5I2KB 3FV2A 3IB0A 3H03A 5I2KA 3B7DA 4JDFA 4F3BA 3T9HB 4U22A 3SEWA 2ESNA 1B2HA 5CMCA 1B6HA 1NNTA 4M1VA 1UIVA 1UTBB 1QKBA 1PDAA 3TAJA 3KN8A 1FTOA 3U94A 3UIFA 4U23A 5FTIA 1JEUA 3V5AA 4F1VA 2AYSA 2RC8A 3O6HA 4I1DA 4H1XA 3VV5A 1MQJA 5CMBA 3KGCA 2P2AA 3VFJA 1B4ZA 1ELJA 1MH4A 2F97A 3M3KA 3OXNA 3S9NC 3ECRA 2RC9A 3Q26A 2GHAA 2QPQA 2CZLA 5M2VA 4FEBA 1B3FA 4QFPA 1ZIUA 4MBPA 1FTMA 3IOVA 3FXQA 3MVWA 5FHNA 1B05A 4QFOA 3U1OA 1B32A 4OTEA 3IO4A 2I4CA 4DZ1A 3K6WA 5EHSA 1ZTYA 2DS9A 1SVXB 4NF4B 3K6XA 4U2RA 1XHYA 1MXVA 3JV9A 3G7WA 4ZEFA 3PD9A 1QULA 4NF4A 1A55A 3RTFB 3G3KA 1B58A 1EZ9A 1LGBC 2ABHA 1MM6A 3C35A 4EQ7A 4OEVA 5ELVA 4NMYA 4YB6A 4IY6A 4GWOA 5DVFA 1BLFA 4ND9A 2F35A 5B70A 3FXUA 5IAIA 4OVJA 4XKQA 4WEDA 3IOUA 2V3QA 1R9LA 4EUOA 2UYFA 3EHUA 3D4CA 5KZTA 4E0WA 4GQOA 4MLQA 4HCYA 4TOZA 1UIUA 1B52A 4KI0E 3TDJA 1Y3QA 1A7LA 3SEVA 3CVGA 2XXHA 3OSRA 3CFLA 2VD2A 3PV0E 3Q25A 1TFAA 1IZ1A 4I8CA 2HAVA 3VLWA 4MF3A 4JBZA 3N6TA 3CG1A 3HV1A 1OLAA 2X26A 4O3BA 2GRVA 5F1QA 5TPAB 3T9UA 3FXRA 2XXIA 1RYXA 1ZJLA 2F8DA 5TPAA 3LUYA 3CIJA 4DCXA 4OETA 4QFNA 4KYDA 4KQPA 5CI5A 2F7BA 4BDRA 4I62A 4QSCA 2QS1A 4OQOA 2Z8FA 4MLVA 2QJEA 3ILTB 1NMUA 1WVJA 4XTCQ 4IO3A 1S50A 4KPTA 2PT2A 4OFOA 2A5SA 5CMKA 1USYE 3K1NA 1FQDA 3G3FA 4FJPA 3ZS6A 3K1PA 3OMBA 4H8JA 1N0TA 4ZEBA 1QW0A 2Z23A 4EQBA 1QUKA 3FUZA 5ITPA 1HSLA 2OWTA 4R75A 2BJJX 2Q89A 4POXA 3IK6B 4DLDA 4WKMA 5DVIA 3HCQA 2QS3A 4GVOA 4ZS9A 4EXLA 1PB8A 4N07A 4DXBA 2UYEA 5K2YA 2O7IA 1MS7A 3VVDA 1MG1A 5H8QB 2ALUA 2XD3A 4FIMA 3T9XB 1N76A 3MQ9A 4NF8B 5H8QA 1JVYA 1YPNA 3PUZE 2OJTA 1H44A 4TQUQ 1H3DA 4ELRA 5H8SA 4NF8A 1S7YA 4FAJA 3OO7A 2HCAA 1URDA 3K4UA 1GTKA 1A54A 2NUVA 1JW1A 1N7WA 4ECFA 3DP4A 2Y7PA 4H5FA 1DTZA 2B3FA 2AIXA 1PC3A 4KHZE 4F39A 2GHBA 1I69A 1YTVA 1M5DA 1FTLA 3RY3A 5TU0A 4EF2A 2PYYA 5AA2B 2H25A 2ZNTA 5JEIA 3Q28A 3LSFB 3MP8A 3VE1B 2NWJA 5AA2A 3O9PA 4OYVA 2UVIA 3IB2A 2Y7RA 3HO7A 4YAHX 3QK6A 2DVCA 1XT8A 4C0RA 4H5GA 4EDPA 1OLCA 5ITOA 1SW2A 3ZKLA 1D9YA 5CRYA 4G4PA 4DIGA 3GBBA 1B1XA 2Q2CA 4TLLB 1H76A 1TT1A 4X1DA 4AB5A 2HFBA 4UACA 2I6EA 4OEUA 1FQEA 5AA2D 2H4IA 3ZKKA 3RT6B 1Z7NE 2F34A 3PUXE 1BIYA 3MJNA 2I4BA 2Z8DA 3KFMA 3VVFA 3EQ1A 4FORA 1Y9UA 3UK4A 2VD3A 4ELQA 5KDTB 1QJMA 3TCHA 4QSDA 4YMAA 3LSLA 5KDTA 4Q8RA
chains in the Genus database with same CATH superfamily
4KYEA 2F7AA 3LR1A 5H8HB 4ZE8A 1N04A 4DDDA 3EN3A 3FVGA 1K9YA 2O68A 1JQFA 5I56A 5H8HA 3TYHA 3KZGA 3PPNA 1R1NA 2WX9A 3MZ9A 2R9JA 2V93A 4JSDA 1NV5A 4OFJA 4GWXA 3KG2A 4PETA 2QL3A 3V8XB 2QRYA 2R8TA 4IGTA 1I6BA 1NV1A 3K6UA 3K6VA 4U21A 3O29A 3H06B 4YU0A 3UGWA 1QUIA 2KR0A 3KSXA 4RXLA 3FJMA 2XX9A 4GXSB 3CSGA 4RPNA 4P3LA 5K2XA 4F1UA 4LONB 5F7VA 3TPAA 4YKJA 5J1DA 3KJTA 3E79A 3ROJA 5EYHA 3E78A 1ZMGA 3H6UA 3T96B 3KN3A 1LBYA 4R9GA 5LOMA 5BWJA 4LUBA 4R74A 1CB6A 3SETA 5I59B 3QUFA 1D9QA 4NF6B 2Y5LA 4X9TA 2UVHA 1ZBMA 2M8CA 1FPGA 5DTBA 1PBPA 4PAFA 5I59A 2FHYA 2UVGA 4NF6A 3IO6A 3FVNA 4OMBA 4IO6A 2HXRA 1B5JA 3K00A 4DCYA 5JTYB 4JWOA 1P1QA 3PU5A 4RA1A 1K9ZA 4QHQA 5JTYA 1IXHA 1UTBA 3TUSA 3SEUA 2Q2AA 1SI1A 5HPQA 1PEBA 4YB5A 2ZZVA 2FA7A 2P0SA 4DXUA 1DSNA 4PFRA 2PX1A 4GBVA 2D5WA 3I6VA 2XD2A 4R2BA 3TTRA 3QIMA 2VPOA 3IOTA 4ZZAA 3LSWA 2WKYA 3DELB 1SW5A 2PVUA 2O7UA 3CFZA 3OD7A 4QF9A 5DVJA 4HXVA 4MNPA 2E0SA 3E9XA 3FBPA 4IO7A 1DOTA 3PPRA 1Z7ME 1US4A 2OWSA 3PUWE 3S9EA 2H9BA 4P0IA 3FV1A 4LZ8A 1RDZA 2HXWA 1N7XA 3R26A 4FECA 4MH5A 4Q5TA 4YMBA 1HSJA 5IZ1A 3FJGA 1MDQA 4NQ8A 2DE2A 4G68C 2DYXA 3HFUA 2OK2A 2F36A 4ESWA 4DI3D 3MYUA 1KA0A 3PPQA 2ZNSA 3EHTA 3TTMA 3PUVE 4QBAA 1O7TA 3FD3A 4GFRA 2RINA 2PFZA 1BKAA 3MUQA 4BDLA 2XXYA 3BFUA 4R6HA 2DXRA 1Y1MA 2VGQA 3E13X 3VXBA 2PMSA 5CBRA 4OVSA 1XS5A 4FE8A 4ZDMA 3Q29A 1MQGA 1DBZA 2O1MA 4QXDA 2VP1A 2A5TB 4BDNA 2ZYNA 4R6KA 4NGUA 1JW4A 1JETA 2A5TA 4YICA 1FBGA 3H4ZA 4JWYA 2ZXTA 1P1OA 2GFEA 1SI0A 2CMOA 3JYRA 4MJOA 4EF1A 5FHMA 2I48A 5TP9B 4MMPA 2D21A 1M5FA 1FQCA 3TTKA 1MY1A 5TP9A 2H99A 4YKIA 3H6WA 3EHSA 3MVYA 4TLMB 3DM0A 1SBPA 4N6PA 4R6YA 4LN5A 1J1NA 1XC1A 3OEMA 3C9HA 4N8YA 5IM2A 1B0HA 1QVSA 4PFYA 3L6HA 4UA8A 1G0IA 3ILUB 3MBPA 3MAMA 2PT1A 5LTCA 2F7CA 1LBCA 4EQ9A 4GWUA 4OVRA 1FRPA 5CM6A 3TCGA 4R9FA 2O6AA 1LB9A 3RPLB 4G8HA 2QS2A 4G8MA 3CRBA 3RPLA 4PFBA 2PFYA 1H45A 1YYZA 1B3HA 1FBEA 5DT6A 3KN7A 1LLSA 3WAEA 3TTLA 4X04A 3IX1A 4DE8A 1LAGE 1MPBA 2NVUB 3IFCA 3SEYA 2AL4A 3D4GA 1M5BA 3O6GA 2V25A 4OESA 4YKPA 4KD5A 3F11A 3IJXB 3OO9A 4IY5A 2XXXA 3MPLA 1FQBA 4OERA 2WBDA 1MY0A 3JZJA 2QS4A 5HBCA 4H65A 3FXBA 3LV0A 1A8FA 3CSBA 3LC8A 1AOVA 3GLBA 2DE3A 3OEKA 1FQFA 4IO2A 2MKZA 3SESA 4UABA 2F6PA 5AA1A 5ET7A 5AA4B 1T0KA 4NWDA 4LZ5A 2Y7KA 4KR5A 3B8BA 4C1TA 4HW8A 5AA4A 1B46A 3W9WA 2PBWA 3M3LA 3QAXA 2Y5KA 3S9LC 1FPBA 1B7ZA 2ONKE 3PMVA 5I84A 3FZVA 2QVUA 1P1WA 4HE0A 3M8UA 4P56A 2RC7A 4ZEIA 4GX6A 4U1ZA 4IB2A 1DMBA 4RY1A 3K01A 3DLNA 1B40A 1YAEA 2VT5A 3H6VA 4PF8A 4Z0IA 1N84A 4NE4A 3USDA 3K1MA 3MP1A 1S9TA 3OOAA 3UN6A 1D4NA 3MPKA 2OBGA 3CR9A 4BDQA 2UVJA 3U65A 1JNFA 4QRZA 5CC2A 3SZPA 4K3FA 3HHGA 2THIA 3KJ7A 1MY3A 1MQHA 3PD8A 3TCFA 2KQZA 4BLAA 4I3YA 1IMBA 1B3LA 1FW0A 2I0CA 4U4SA 3MZ1A 3C34A 1AIVA 4OWDA 1IMFA 3OO8A 3NOHA 4PE5B 1D9VA 1B51A 3TQWA 1NUZA 4R2FA 1ZU0A 2ONRA 3RQTA 1DTGA 3TTNA 3TELA 4I40A 2Y7WA 3S4UA 1ZKBA 4AB6A 4O8MA 3ISPA 1AL3A 1RYOA 3DP8A 4BDMA 3AXFA 3MC2A 4LVQA 4F18A 1DCUA 4XF5A 4NX1A 3OO6A 4F19A 4F3PA 3PPOA 1RDYA 2QMXA 3C36A 3RT8A 3C33A 3RGYA 5L9SA 3O66A 1WODA 4YKKA 1SW1A 3IJOB 4M4GA 2XX8A 4PFWA 4N91A 1KZ8A 5I2NB 3TODA 3N26A 1AH5A 3IR1A 1LFHA 4G68B 3FGSA 5I2NA 3VDFA 2DSFA 4KFQA 4NAPA 1YCJA 5KCJB 1JVXA 4PAIA 4G68A 3TKDA 4GD5A 4MCOA 2OCUA 4ZZEA 5KCJA 1Y1ZA 5IZ3B 1LCFA 4P47A 4WEPA 4F22A 2YPNA 1VFEA 4O3AA 2FIEA 5ESYA 3IB1A 3FJ7A 1NI9A 5IZ3A 5IKBA 3N94A 4OENA 1BP5A 2R6GE 1MPCA 3PGFA 5H8NB 1MPDA 4IGRA 1ZLQA 1A8EA 2I3VA 1NUWA 1B1HA 4GIZA 4H8IA 2ANJA 4NF5B 5H8NA 3MVXA 2OWZA 1EZPA 1XVXA 3L6GA 3FASA 4OXVA 2OX3A 1QUJA 4NF5A 1LBVA 2DOJA 1NKXA 1F9BA 4N13A 1M5EA 3CFXA 3LBSA 3QYTA 4HE1A 2O1LA 2E1SA 2G93A 2RCBA 2B3BA 3QUJA 2XXWA 4YZZA 3T66A 1Y4CA 1SQYA 2V84A 5AE4A 3SEXA 4XXUA 1POTA 4PDDA 1US5A 5H8FB 3E3KA 4F29A 2HZKA 4X8RA 4H6DA 5CBSA 2XXQA 5H8FA 1II5A 2QMWA 2QFLA 1H43A 2FBPA 1VDWA 1CE2A 1GV8A 1MQIA 1KA1A 1SYIA 1WDNA 2RF1A 1N3XA 4OVQA 3EPEA 2R71A 1OMPA 4MFIA 1EH3A 2HPGA 3CHGA 4H46A 1AMFA 2NOOA 1EZOA 2GH9A 3EF7A 3G3HA 5EQ7A 1CNQA 4GL0A 2F78A 5L8DA 2XXVA 3OENA 4GXAA 4DXCA 4IR8A 1SYHA 3LSXA 2WEFA 1Q9DA 1KWHA 1O64A 3IOWA 2HEUA 1ANFA 3FVOA 4RPOA 1NUYA 3B6WA 3Q27A 3HSTA 2L5VA 2UXAA 2ZNUA 1NUXA 4JXIA 5I56B 2O51A 4H45A 3QXMA 2DQVA 1OVTA 4F2OA 1USYH 3RUMA 1NL5A 1IMAA 3PUYE 1OVBA 1OIBA 4NWCA 1MXXA 4U4XA 5DEXB 3ODBA 4LA9A 1Q1KA 4JSOA 4PP0A 3S2VA 3ZSFA 1IXCA 5L9MA 5DEXA 3T93B 4PTKA 2HQ0A 4PGPA 1M5CA 4IO5A 2XXKA 5ET5A 3TMGA 1NFTA 3CI8A 3TFLA 3C31A 3IAZA 3O28A 1FPLA 1FQAA 1MY2A 3O6IA 2XA5A 3B6QA 4N81A 3W15C 1LFGA 3SDFA 1FBPA 4PBQA 4P1LA 1LBBA 4H67A 5I58B 5ICQA 1QGXA 4L17A 1VR5A 4N17A 3WAFA 3HPIA 2H98A 5I58A 1L5TA 3R7XA 1LSTA 3W9VA 3A09A 1SPIA 4MNCA 4Q0CA 4F2QA 1FPFA 1Q35A 2O69A 3V83A 1BTJA 1R9QA 1SDXA 2REGA 4E0XA 2V3UA 3PMXA 2OLBA 2XXTA 1NNKA 3VLVA 4ONYA 1B9JA 3M3FA 3ONMA 4AS5A 1URSA 2AL5A 1IXGA 3RLFE 5AA3A 1LAFE 2VHAA 5I57B 2H5YA 2BJIA 4PGNA 3UA8A 1NNPA 3H3GA 3A3UA 3OELA 4MIJA 4PQJA 2NXOA 4GF8A 1FPDA 5I57A 1B5HA 5L9OA 2Y84A 4QFLA 3RPWA 5A5XB 5J16A 1B5IA 1UTHB 1ATGA 1MRPA 2F6GA 1LB8A 1INPA 3MWBA 4XIGQ 5A5XA 1RKMA 4GOTA 1FSAA 1TWYA 1URGA 1UTHA 3FVKA 4QFKA 3T22A 3BFTA 4KYSA 2Q8JA 5ISUA 2DVZA 1SD3A 2YJPA 1JEVA 4N8GA 4OANA 5HM4B 4F3SA 1MQDA 2ZYOA 3TQLA 2XX7A 1O63A 3RTWB 1PBQA 3PPPA 1MM7A 4U1OA 1B3GA 3K02A 4LATA 4PFUA 5EYFA 4X48A 4RNSA 2O84X 4FEDA 3HN0A 3U72A 2Z8EA 3MVZA 3T0JA 4GLIA 3KOSA 1P99A 1GGGA 3O97A 2YLNA 4DI4B 3DP6A 1LAHE 4GRKA 1B0LA 4OA4A 3H7MA 2DWHA 2ZZWA 3VLUA 3K2DA 4THIA 4BDOA 4KCDA 4PAKA 1D3KA 4OZ9A 1B4HA 4N6KA 3S9MC 4NN3A 4Z7EA 5EQ8A 1GVCA 1A40A 3E4RA 4FBPA 2ZYMA 4GBWA 3LUZA 1IEJA 1P1NA 4R73A 4P8BA 3KSJA 5DYHA 4LQ5A 3C32A 5ET6A 4KCCA 1P1UA 2DWAA 4G8NA 3BKIB 4P11A 3G3IA 4I9DA 1DPEA 2DWJA 3T1BA 2P1SA 3G3JA 1DPPA 3CG3A 1MXYA 1MXUA 3GZGA 2V3TA 2HZLA 3PTYA 4XKRA 1VE4A 3C4MA 3TZAA 3TEPA 4NG7A 3HHFA 1TFDA 4R72A 3U93A 1EU8A 1Y3NA 3G3GA 4G77A 2X7QA 1XVYA 3PMWA 4N15A 1NV4A 4G2ZA 1UQWA 3BBRA 4PDHA 4ZEKA 2FYIA 2FIXA 2IA4A 2F3DA 4RK9A 1Y3PA 3N5LA 5A5LA 4N6DA 4POWA 1MDP1 3KC1A 3A29A 1MH3A 4HS7A 4LP2B 2PCRA 4HCWA 1NV2A 3MSTA 2DXYA 4H0WA 5JK4A 4ZE9A 3SERA 2DP8A 4O3CA 4RJZA 1VSOA 2F5XA 2ONSA 5IZZA 4PFTA 3IORA 2B65A 4GX3A 5T3JA 4EXKA 2I0BA 1A99A 1NV7A 4ESXA 1GR2A 5B7DA 2I58A 2QVVA 3KBZA 1FTJA 4ZEDA 4NF0A 5I5PA 2Z22A 1FPJA 1I6QA 1PB7A 4NHBA 4F3GA 1POY1 2D3IA 2G29A 2XXUA 4F31B 4OHNA 5FTHA 1I6AA 4LQ2A 3MW0A 3EKIA 3A3CA 1FCKA 3KBRA 1B3EA 1LEVA 2P3VA 5ICTA 2HHMA 3O2AA 4RK2A 1JW5A 2FNCA 5BUUA 2XXPA 2X7PA 1TXFA 4ELOA 1IUDA 3KOTA 1IMEA 2Q9TA 4XKPA 4NEDA 1HSEA 1LAXA 5CMMA 2Y7IA 1OQGA 2XWVA 2DE4A 3B6TA 3KEIA 1FTKA 1FPIA 4GWYA 3T9VA 1FTAA 2WYPA 4LZ7A 4MNIA 4JWXA 3FATA 3SKPA 4ISUA 2LAOA 4FATA 2KLFA 2Q88A 4XKNA 3I5OA 4QSEA 4RYAA 3N6UA 1IQ7A 4NTLA 4X1BA 1NH7A 2REJA 3QSLA 2HAUA 2XHDA 4P9KA 1IITA 3FIRA 1IIWA 1IMDA 2QVRA 5FHOA 1R6ZA 3OSQA 1LFIA 3VXCA 1XOCA 2W7YA 1B7UA 3UP9A 2VOZA 4JB7A 1B7HA 1EYIA 2FVZA 3K0VA 3GXAA 1PB9A 4HTGA 1LBWA 4C1UA 3MP6A 1Y20A 3GBAA 5EHMA 3R6UA 2QSXA 1N3WA 1MXWA 2RCAA 3I3VA 3P7IA 1QKAA 2CEYA 4I3EA 1MY4A 4AQ4A 2ZYKA 4GL8A 2RKMA 2I3WA 1FBDA 4Q30B 2ZZXA 2I49A 2OZZA 1G0HA 3RNNA 5IGAA 3V89B 2XXRA 3UORA 4WXJA 3IL1B 3H6TA 2DWIA 2IEEA 1SW4A 1IXIA 3THIA 1Y4TA 4IO4A 4O94A 4P0GA 1LCTA 3MZBA 4ZECA 1NH8A 2ZMBA 4F1YA 4OFLA 3QMFA 4MHFA 3VVEA 1NNFA 3BIHA 3RN8A 3U8QA 4GX4A 1OQHA 4G61A 3U92A 1MXZA 1VFDA 4ELPA 2XWIA 4YB7A 4P1EA 5I2KB 3FV2A 1XI6A 3IB0A 3H03A 5I2KA 3B7DA 4JDFA 4F3BA 3T9HB 4N4UA 4U22A 3SEWA 2ESNA 1B2HA 5CMCA 1B6HA 1NNTA 4M1VA 4MEVA 1UIVA 1UTBB 1QKBA 1PDAA 3TAJA 3KN8A 2V4CA 1FTOA 3U94A 3UIFA 4U23A 5FTIA 1JEUA 3V5AA 4F1VA 2AYSA 2RC8A 3O6HA 4I1DA 4H1XA 3VV5A 1MQJA 5CMBA 3KGCA 2P2AA 3VFJA 1B4ZA 1ELJA 1MH4A 2F97A 1RDXA 3M3KA 3OXNA 3S9NC 3ECRA 2RC9A 2DDKA 3Q26A 2GHAA 2QPQA 2CZLA 5M2VA 4FEBA 2Q8MA 1B3FA 4QFPA 1ZIUA 4MBPA 1FTMA 3IOVA 5EYGA 3FXQA 3MVWA 5FHNA 2WBBA 4O7MA 1B05A 4QFOA 3U1OA 1B32A 4OTEA 4JVIA 3IO4A 2I4CA 4DZ1A 4MX6A 3K6WA 5EHSA 1ZTYA 2DS9A 3BIGA 1SVXB 4MAGA 4NF4B 3K6XA 4U2RA 1XHYA 1MXVA 1NV6A 3JV9A 3G7WA 4ZEFA 3PD9A 1QULA 4NF4A 1DK4A 1A55A 3RTFB 3G3KA 1B58A 1EZ9A 2B4LA 1LGBC 2ABHA 1MM6A 3C35A 4EQ7A 1FJ9A 2WYKA 4OEVA 2VPNA 5ELVA 4NMYA 4XEQA 1EYJA 4YB6A 4IY6A 4GWOA 5EQ9A 5DVFA 1BLFA 4ND9A 2F35A 4GWSA 5B70A 3FXUA 5IAIA 4OVJA 2B4MA 4XKQA 4WEDA 3IOUA 2V3QA 1R9LA 4PE3A 4EUOA 2UYFA 2P3NA 3EHUA 3D4CA 5KZTA 4E0WA 2XWOA 4GQOA 4MLQA 4HCYA 1NV3A 4TOZA 1UIUA 1B52A 1NV0A 3B50A 4KI0E 3TDJA 1Y3QA 1A7LA 3SEVA 3CVGA 2XXHA 3OSRA 3CFLA 1IMCA 2VD2A 3PV0E 3Q25A 1TFAA 2F3BA 1IZ1A 4I8CA 4PBHA 2HAVA 3VLWA 4MF3A 4JBZA 3N6TA 3CG1A 3HV1A 1OLAA 2X26A 4O3BA 2GRVA 5F1QA 5TPAB 3T9UA 3FXRA 2XXIA 1JP4A 1RYXA 1ZJLA 2F8DA 5TPAA 3LUYA 3CIJA 4DCXA 4OETA 4QFNA 4KYDA 4KQPA 5CI5A 2F7BA 4BDRA 4I62A 4QSCA 2QS1A 4OQOA 2Z8FA 1YXIA 4MLVA 2QJEA 2Q74A 3ILTB 1NMUA 1WVJA 4XTCQ 4IO3A 5F24A 1S50A 4KPTA 2PT2A 4OFOA 2A5SA 4KXPA 1USYE 5CMKA 3K1NA 1FQDA 3G3FA 4FJPA 3ZS6A 3K1PA 3OMBA 4H8JA 1N0TA 4ZEBA 1QW0A 2Z23A 4EQBA 1QUKA 3FUZA 1LBXA 5EQAA 5ITPA 1HSLA 2OWTA 4R75A 4PFIA 2BJJX 2Q89A 4POXA 3IK6B 4DLDA 4WKMA 5DVIA 1LBZA 3HCQA 5I7IA 2QS3A 4OVTA 4GVOA 4ZS9A 4EXLA 1PB8A 4N07A 4DXBA 4GWZA 2UYEA 5K2YA 2O7IA 1MS7A 3VVDA 1MG1A 5H8QB 2ALUA 2XD3A 4FIMA 3T9XB 1N76A 3MQ9A 4NF8B 5H8QA 1JVYA 1YPNA 3PUZE 2OJTA 1H44A 5FBPA 4TQUQ 1H3DA 4ELRA 5H8SA 4NF8A 1S7YA 4HE2A 3IFAA 4FAJA 3OO7A 2HCAA 5I3SA 1URDA 3K4UA 1AWBA 1FBFA 1GTKA 1A54A 2NUVA 1JW1A 1N7WA 4O7IA 4ECFA 3DP4A 5LDZA 2Y7PA 4XFEA 4H5FA 3GYYA 1DTZA 2B3FA 2AIXA 1FPEA 1PC3A 4KHZE 4PCDA 4F39A 5DW8A 2GHBA 1I69A 1YTVA 1M5DA 1FTLA 1EYKA 3RY3A 5TU0A 1BK4A 4EF2A 2PYYA 5AA2B 2H25A 2ZNTA 5JEIA 3Q28A 3LSFB 2XWKA 3MP8A 3VE1B 2GQ1A 1YZ0A 2NWJA 5AA2A 3O9PA 2CZKA 4OYVA 2UVIA 4PF6A 3KC0A 3IB2A 2Y7RA 3HO7A 4YAHX 4OVPA 3QK6A 2DVCA 1XT8A 2JJKA 4H5GA 4C0RA 4EDPA 1OLCA 2CEXA 2CZIA 5ITOA 1SW2A 4JVCA 1FPKA 3ZKLA 1D9YA 5CRYA 4G4PA 4DIGA 3RYDA 3GBBA 2CZHA 1B1XA 2Q2CA 4TLLB 1H76A 1TT1A 4X1DA 4AB5A 2HFBA 4UACA 2I6EA 1FBCA 4OEUA 1FQEA 1FJ6A 5AA2D 2H4IA 3RT6B 3ZKKA 1Z7NE 2F34A 3D1RA 3PUXE 5ET8A 1BIYA 3MJNA 2I4BA 2Z8DA 3KFMA 4AS4A 3VVFA 3EQ1A 4FORA 1Y9UA 4PC9A 4GWWA 3UK4A 2VD3A 4ELQA 5KDTB 1FBHA 1QJMA 3TCHA 4QSDA 4YMAA 3LSLA 4JVDA 5KDTA 4Q8RA
chains in the Genus database with same CATH topology
4KYEA 2F7AA 3LR1A 5H8HB 4ZE8A 1N04A 4DDDA 3EN3A 3FVGA 2O68A 1JQFA 5I56A 5H8HA 3TYHA 3KZGA 3PPNA 1R1NA 3MZ9A 2R9JA 2V93A 4JSDA 4OFJA 3KG2A 4PETA 2QL3A 3V8XB 2QRYA 4IGTA 1I6BA 3K6UA 3K6VA 4U21A 3O29A 3H06B 4YU0A 3UGWA 1QUIA 3KSXA 4RXLA 3FJMA 2XX9A 4GXSB 3CSGA 4RPNA 5K2XA 4F1UA 4LONB 5F7VA 3TPAA 4YKJA 5J1DA 3KJTA 1ZMGA 3H6UA 3T96B 3KN3A 4R9GA 5LOMA 5BWJA 4LUBA 4R74A 1CB6A 3SETA 5I59B 3QUFA 4NF6B 4X9TA 2UVHA 1ZBMA 2M8CA 5DTBA 1PBPA 5I59A 2UVGA 4NF6A 3IO6A 3FVNA 4OMBA 4IO6A 1B5JA 3K00A 4DCYA 5JTYB 4JWOA 1P1QA 3PU5A 4RA1A 4QHQA 5JTYA 1IXHA 1UTBA 3TUSA 3SEUA 2Q2AA 1SI1A 5HPQA 1PEBA 4YB5A 2FA7A 2P0SA 4DXUA 1DSNA 2PX1A 2D5WA 3I6VA 2XD2A 4R2BA 3TTRA 3QIMA 3IOTA 4ZZAA 3LSWA 2WKYA 3DELB 1SW5A 2PVUA 2O7UA 3CFZA 3OD7A 4QF9A 5DVJA 2E0SA 3E9XA 4IO7A 1DOTA 3PPRA 1Z7ME 1US4A 2OWSA 3PUWE 3S9EA 2H9BA 4P0IA 3FV1A 4LZ8A 2HXWA 1N7XA 3R26A 4FECA 4MH5A 4Q5TA 4YMBA 1HSJA 3FJGA 1MDQA 2DE2A 4G68C 2DYXA 2OK2A 2F36A 4ESWA 3PPQA 2ZNSA 3EHTA 3TTMA 3PUVE 1O7TA 3FD3A 4GFRA 2RINA 1BKAA 3MUQA 4BDLA 2XXYA 3BFUA 4R6HA 2DXRA 1Y1MA 2VGQA 3E13X 3VXBA 2PMSA 5CBRA 1XS5A 4FE8A 4ZDMA 3Q29A 1MQGA 2O1MA 2VP1A 2A5TB 4BDNA 2ZYNA 4R6KA 1JW4A 1JETA 2A5TA 4YICA 3H4ZA 4JWYA 2ZXTA 1P1OA 2GFEA 1SI0A 2CMOA 3JYRA 4EF1A 5FHMA 2I48A 5TP9B 2D21A 1M5FA 1FQCA 3TTKA 1MY1A 5TP9A 2H99A 4YKIA 3H6WA 3EHSA 3MVYA 4TLMB 3DM0A 1SBPA 4N6PA 4R6YA 1J1NA 1XC1A 3OEMA 3C9HA 1B0HA 1QVSA 4PFYA 3L6HA 4UA8A 3ILUB 3MBPA 3MAMA 2PT1A 2F7CA 1LBCA 4EQ9A 5CM6A 3TCGA 4R9FA 2O6AA 1LB9A 4G8HA 2QS2A 4G8MA 3CRBA 1H45A 1B3HA 5DT6A 3KN7A 1LLSA 3WAEA 3TTLA 3IX1A 4DE8A 1LAGE 1MPBA 2NVUB 3SEYA 2AL4A 3D4GA 1M5BA 3O6GA 2V25A 4OESA 4YKPA 4KD5A 3F11A 3IJXB 3OO9A 4IY5A 2XXXA 3MPLA 1FQBA 4OERA 1MY0A 3JZJA 2QS4A 5HBCA 4H65A 1A8FA 3CSBA 3LC8A 1AOVA 3GLBA 2DE3A 3OEKA 1FQFA 4IO2A 3SESA 2F6PA 5AA1A 5AA4B 1T0KA 4NWDA 4LZ5A 2Y7KA 4KR5A 4C1TA 4HW8A 5AA4A 1B46A 3W9WA 2PBWA 3M3LA 3QAXA 3S9LC 1B7ZA 2ONKE 3PMVA 5I84A 3FZVA 1P1WA 3M8UA 2RC7A 4ZEIA 4U1ZA 4IB2A 1DMBA 4RY1A 3K01A 3DLNA 1B40A 1YAEA 3H6VA 4Z0IA 1N84A 4NE4A 3USDA 3K1MA 3MP1A 1S9TA 3OOAA 3UN6A 1D4NA 3MPKA 2OBGA 3CR9A 4BDQA 2UVJA 1JNFA 4QRZA 5CC2A 4K3FA 3HHGA 2THIA 3KJ7A 1MY3A 1MQHA 3PD8A 3TCFA 4BLAA 1B3LA 1FW0A 2I0CA 4U4SA 3MZ1A 3C34A 1AIVA 4OWDA 3OO8A 4PE5B 1D9VA 1B51A 3TQWA 4R2FA 1ZU0A 2ONRA 3RQTA 1DTGA 3TTNA 3TELA 2Y7WA 3S4UA 1ZKBA 4AB6A 1AL3A 1RYOA 3DP8A 4BDMA 3AXFA 3MC2A 4LVQA 4F18A 3OO6A 4F19A 4F3PA 3PPOA 2QMXA 3C36A 3RT8A 3C33A 3RGYA 5L9SA 3O66A 1WODA 4YKKA 1SW1A 3IJOB 4M4GA 2XX8A 4PFWA 5I2NB 3TODA 3N26A 1AH5A 3IR1A 1LFHA 4G68B 3FGSA 5I2NA 3VDFA 2DSFA 4KFQA 1YCJA 5KCJB 1JVXA 4G68A 3TKDA 4GD5A 2OCUA 4ZZEA 5KCJA 1Y1ZA 1LCFA 4F22A 4WEPA 2YPNA 1VFEA 4O3AA 3IB1A 3FJ7A 5IKBA 3N94A 4OENA 1BP5A 2R6GE 1MPCA 3PGFA 5H8NB 1MPDA 4IGRA 1ZLQA 1A8EA 2I3VA 1B1HA 4GIZA 4H8IA 2ANJA 4NF5B 5H8NA 3MVXA 1EZPA 1XVXA 3L6GA 3FASA 4OXVA 1QUJA 4NF5A 2DOJA 1NKXA 1F9BA 4N13A 1M5EA 3CFXA 3LBSA 3QYTA 2O1LA 2E1SA 2G93A 2RCBA 2B3BA 3QUJA 2XXWA 4YZZA 3T66A 1Y4CA 1SQYA 2V84A 5AE4A 3SEXA 4XXUA 1POTA 1US5A 5H8FB 3E3KA 4F29A 2HZKA 4H6DA 5CBSA 2XXQA 5H8FA 1II5A 2QMWA 1H43A 1CE2A 1GV8A 1MQIA 1SYIA 1WDNA 2RF1A 1N3XA 3EPEA 2R71A 1OMPA 4MFIA 1EH3A 1AMFA 2NOOA 1EZOA 2GH9A 3EF7A 3G3HA 4GL0A 2F78A 5L8DA 2XXVA 3OENA 4GXAA 4DXCA 1SYHA 3LSXA 1KWHA 1O64A 3IOWA 2HEUA 1ANFA 3FVOA 4RPOA 3B6WA 3Q27A 3HSTA 2UXAA 2ZNUA 4JXIA 5I56B 2O51A 3QXMA 2DQVA 1OVTA 4F2OA 1USYH 3RUMA 1NL5A 3PUYE 1OVBA 1OIBA 4NWCA 1MXXA 4U4XA 5DEXB 3ODBA 4LA9A 1Q1KA 4JSOA 4PP0A 3S2VA 3ZSFA 1IXCA 5L9MA 5DEXA 3T93B 2HQ0A 1M5CA 4IO5A 3TMGA 1NFTA 3CI8A 3TFLA 3C31A 3IAZA 3O28A 1FQAA 1MY2A 3O6IA 3B6QA 3W15C 1LFGA 3SDFA 1LBBA 4H67A 5I58B 5ICQA 4L17A 1VR5A 3WAFA 3HPIA 2H98A 5I58A 1L5TA 3R7XA 1LSTA 3W9VA 3A09A 4Q0CA 4F2QA 1Q35A 2O69A 3V83A 1BTJA 1R9QA 1SDXA 2REGA 4E0XA 2V3UA 3PMXA 2OLBA 2XXTA 1NNKA 3VLVA 4ONYA 1B9JA 3M3FA 3ONMA 1URSA 2AL5A 1IXGA 3RLFE 5AA3A 1LAFE 2VHAA 5I57B 2H5YA 3UA8A 1NNPA 3H3GA 3A3UA 3OELA 4PQJA 2NXOA 4GF8A 5I57A 1B5HA 5L9OA 2Y84A 4QFLA 3RPWA 5A5XB 1B5IA 1UTHB 1ATGA 1MRPA 2F6GA 1LB8A 3MWBA 4XIGQ 5A5XA 1RKMA 4GOTA 1URGA 1TWYA 1UTHA 3FVKA 4QFKA 3T22A 3BFTA 4KYSA 2Q8JA 5ISUA 2DVZA 1SD3A 2YJPA 1JEVA 5HM4B 4F3SA 1MQDA 2ZYOA 3TQLA 2XX7A 1O63A 3RTWB 1PBQA 3PPPA 1MM7A 4U1OA 1B3GA 3K02A 4LATA 4PFUA 5EYFA 4X48A 4RNSA 2O84X 4FEDA 3HN0A 3U72A 2Z8EA 3MVZA 4GLIA 3KOSA 1P99A 1GGGA 3O97A 2YLNA 3DP6A 1LAHE 4GRKA 1B0LA 3H7MA 2DWHA 3VLUA 3K2DA 4THIA 4BDOA 4KCDA 1D3KA 4OZ9A 1B4HA 3S9MC 4Z7EA 1GVCA 1A40A 3E4RA 2ZYMA 1IEJA 1P1NA 4R73A 3KSJA 5DYHA 4LQ5A 3C32A 4KCCA 1P1UA 2DWAA 4G8NA 3BKIB 4P11A 3G3IA 4I9DA 1DPEA 2DWJA 2P1SA 3G3JA 1DPPA 3CG3A 1MXYA 1MXUA 3GZGA 2V3TA 2HZLA 4XKRA 1VE4A 3C4MA 3TZAA 3TEPA 3HHFA 1TFDA 4R72A 3U93A 1EU8A 1Y3NA 3G3GA 4G77A 2X7QA 1XVYA 3PMWA 4G2ZA 1UQWA 3BBRA 4ZEKA 2FYIA 2IA4A 4RK9A 1Y3PA 3N5LA 4POWA 1MDP1 1MH3A 4HS7A 4LP2B 4HCWA 2DXYA 4H0WA 5JK4A 4ZE9A 3SERA 2DP8A 4O3CA 4RJZA 1VSOA 2F5XA 2ONSA 4PFTA 3IORA 2B65A 4EXKA 2I0BA 1A99A 4ESXA 1GR2A 5B7DA 2I58A 1FTJA 4ZEDA 2Z22A 1I6QA 1PB7A 4F3GA 1POY1 2D3IA 2G29A 2XXUA 4F31B 4OHNA 5FTHA 1I6AA 4LQ2A 3MW0A 3A3CA 1FCKA 3KBRA 1B3EA 5ICTA 3O2AA 4RK2A 1JW5A 2FNCA 5BUUA 2XXPA 2X7PA 1TXFA 4ELOA 1IUDA 3KOTA 2Q9TA 4XKPA 4NEDA 1HSEA 1LAXA 5CMMA 2Y7IA 1OQGA 2DE4A 3B6TA 3KEIA 1FTKA 3T9VA 4LZ7A 4JWXA 3FATA 3SKPA 4ISUA 2LAOA 4FATA 2KLFA 2Q88A 4XKNA 3I5OA 4QSEA 4RYAA 3N6UA 1IQ7A 4NTLA 4X1BA 1NH7A 2REJA 3QSLA 2HAUA 2XHDA 1IITA 3FIRA 1IIWA 5FHOA 1R6ZA 3OSQA 1LFIA 3VXCA 1XOCA 2W7YA 1B7UA 3UP9A 2VOZA 4JB7A 1B7HA 3K0VA 3GXAA 1PB9A 4HTGA 4C1UA 3MP6A 1Y20A 3GBAA 5EHMA 3R6UA 2QSXA 1N3WA 1MXWA 2RCAA 3I3VA 3P7IA 1QKAA 1MY4A 4AQ4A 2ZYKA 4GL8A 2RKMA 2I3WA 4Q30B 2I49A 2OZZA 3RNNA 3V89B 2XXRA 3UORA 4WXJA 3IL1B 3H6TA 2DWIA 2IEEA 1SW4A 1IXIA 3THIA 1Y4TA 4IO4A 4P0GA 1LCTA 3MZBA 4ZECA 1NH8A 2ZMBA 4F1YA 4OFLA 3VVEA 1NNFA 3RN8A 3U8QA 1OQHA 3U92A 1MXZA 1VFDA 4ELPA 4YB7A 5I2KB 3FV2A 3IB0A 3H03A 5I2KA 3B7DA 4JDFA 4F3BA 3T9HB 4U22A 3SEWA 2ESNA 1B2HA 5CMCA 1B6HA 1NNTA 4M1VA 1UIVA 1UTBB 1QKBA 1PDAA 3TAJA 3KN8A 1FTOA 3U94A 3UIFA 4U23A 5FTIA 1JEUA 3V5AA 4F1VA 2AYSA 2RC8A 3O6HA 4I1DA 4H1XA 3VV5A 1MQJA 5CMBA 3KGCA 2P2AA 3VFJA 1B4ZA 1ELJA 1MH4A 2F97A 3M3KA 3OXNA 3S9NC 3ECRA 2RC9A 3Q26A 2GHAA 2QPQA 2CZLA 5M2VA 4FEBA 1B3FA 4QFPA 1ZIUA 4MBPA 1FTMA 3IOVA 3FXQA 3MVWA 5FHNA 1B05A 4QFOA 3U1OA 1B32A 4OTEA 3IO4A 2I4CA 4DZ1A 3K6WA 5EHSA 1ZTYA 2DS9A 1SVXB 4NF4B 3K6XA 4U2RA 1XHYA 1MXVA 3JV9A 3G7WA 4ZEFA 3PD9A 1QULA 4NF4A 1A55A 3RTFB 3G3KA 1B58A 1EZ9A 1LGBC 2ABHA 1MM6A 3C35A 4EQ7A 4OEVA 5ELVA 4NMYA 4YB6A 4IY6A 4GWOA 5DVFA 1BLFA 4ND9A 2F35A 5B70A 3FXUA 5IAIA 4OVJA 4XKQA 4WEDA 3IOUA 2V3QA 1R9LA 4EUOA 2UYFA 3EHUA 3D4CA 5KZTA 4E0WA 4GQOA 4MLQA 4HCYA 4TOZA 1UIUA 1B52A 4KI0E 3TDJA 1Y3QA 1A7LA 3SEVA 3CVGA 2XXHA 3OSRA 3CFLA 2VD2A 3PV0E 3Q25A 1TFAA 1IZ1A 4I8CA 2HAVA 3VLWA 4MF3A 4JBZA 3N6TA 3CG1A 3HV1A 1OLAA 2X26A 4O3BA 2GRVA 5F1QA 5TPAB 3T9UA 3FXRA 2XXIA 1RYXA 1ZJLA 2F8DA 5TPAA 3LUYA 3CIJA 4DCXA 4OETA 4QFNA 4KYDA 4KQPA 5CI5A 2F7BA 4BDRA 4I62A 4QSCA 2QS1A 4OQOA 2Z8FA 4MLVA 2QJEA 3ILTB 1NMUA 1WVJA 4XTCQ 4IO3A 1S50A 4KPTA 2PT2A 4OFOA 2A5SA 5CMKA 1USYE 3K1NA 1FQDA 3G3FA 4FJPA 3ZS6A 3K1PA 3OMBA 4H8JA 1N0TA 4ZEBA 1QW0A 2Z23A 4EQBA 1QUKA 3FUZA 5ITPA 1HSLA 2OWTA 4R75A 2BJJX 2Q89A 4POXA 3IK6B 4DLDA 4WKMA 5DVIA 3HCQA 2QS3A 4GVOA 4ZS9A 4EXLA 1PB8A 4N07A 4DXBA 2UYEA 5K2YA 2O7IA 1MS7A 3VVDA 1MG1A 5H8QB 2ALUA 2XD3A 4FIMA 3T9XB 1N76A 3MQ9A 4NF8B 5H8QA 1JVYA 1YPNA 3PUZE 2OJTA 1H44A 4TQUQ 1H3DA 4ELRA 5H8SA 4NF8A 1S7YA 4FAJA 3OO7A 2HCAA 1URDA 3K4UA 1GTKA 1A54A 2NUVA 1JW1A 1N7WA 4ECFA 3DP4A 2Y7PA 4H5FA 1DTZA 2B3FA 2AIXA 1PC3A 4KHZE 4F39A 2GHBA 1I69A 1YTVA 1M5DA 1FTLA 3RY3A 5TU0A 4EF2A 2PYYA 5AA2B 2H25A 2ZNTA 5JEIA 3Q28A 3LSFB 3MP8A 3VE1B 2NWJA 5AA2A 3O9PA 4OYVA 2UVIA 3IB2A 2Y7RA 3HO7A 4YAHX 3QK6A 2DVCA 1XT8A 4C0RA 4H5GA 4EDPA 1OLCA 5ITOA 1SW2A 3ZKLA 1D9YA 5CRYA 4G4PA 4DIGA 3GBBA 1B1XA 2Q2CA 4TLLB 1H76A 1TT1A 4X1DA 4AB5A 2HFBA 4UACA 2I6EA 4OEUA 1FQEA 5AA2D 2H4IA 3ZKKA 3RT6B 1Z7NE 2F34A 3PUXE 1BIYA 3MJNA 2I4BA 2Z8DA 3KFMA 3VVFA 3EQ1A 4FORA 1Y9UA 3UK4A 2VD3A 4ELQA 5KDTB 1QJMA 3TCHA 4QSDA 4YMAA 3LSLA 5KDTA 4Q8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYE A;  2F7A A;  3LR1 A;  5H8H B;  4ZE8 A;  1N04 A;  4DDD A;  3EN3 A;  3FVG A;  2O68 A;  1JQF A;  5I56 A;  5H8H A;  3TYH A;  3KZG A;  3PPN A;  1R1N A;  3MZ9 A;  2R9J A;  2V93 A;  4JSD A;  4OFJ A;  3KG2 A;  4PET A;  2QL3 A;  3V8X B;  2QRY A;  4IGT A;  1I6B A;  3K6U A;  3K6V A;  4U21 A;  3O29 A;  3H06 B;  4YU0 A;  3UGW A;  1QUI A;  3KSX A;  4RXL A;  3FJM A;  2XX9 A;  4GXS B;  3CSG A;  4RPN A;  5K2X A;  4F1U A;  4LON B;  5F7V A;  3TPA A;  4YKJ A;  5J1D A;  3KJT A;  1ZMG A;  3H6U A;  3T96 B;  3KN3 A;  4R9G A;  5LOM A;  5BWJ A;  4LUB A;  4R74 A;  1CB6 A;  3SET A;  5I59 B;  3QUF A;  4NF6 B;  4X9T A;  2UVH A;  1ZBM A;  2M8C A;  5DTB A;  1PBP A;  5I59 A;  2UVG A;  4NF6 A;  3IO6 A;  3FVN A;  4OMB A;  4IO6 A;  1B5J A;  3K00 A;  4DCY A;  5JTY B;  4JWO A;  1P1Q A;  3PU5 A;  4RA1 A;  4QHQ A;  5JTY A;  1IXH A;  1UTB A;  3TUS A;  3SEU A;  2Q2A A;  1SI1 A;  5HPQ A;  1PEB A;  4YB5 A;  2FA7 A;  2P0S A;  4DXU A;  1DSN A;  2PX1 A;  2D5W A;  3I6V A;  2XD2 A;  4R2B A;  3TTR A;  3QIM A;  3IOT A;  4ZZA A;  3LSW A;  2WKY A;  3DEL B;  1SW5 A;  2PVU A;  2O7U A;  3CFZ A;  3OD7 A;  4QF9 A;  5DVJ A;  2E0S A;  3E9X A;  4IO7 A;  1DOT A;  3PPR A;  1Z7M E;  1US4 A;  2OWS A;  3PUW E;  3S9E A;  2H9B A;  4P0I A;  3FV1 A;  4LZ8 A;  2HXW A;  1N7X A;  3R26 A;  4FEC A;  4MH5 A;  4Q5T A;  4YMB A;  1HSJ A;  3FJG A;  1MDQ A;  2DE2 A;  4G68 C;  2DYX A;  2OK2 A;  2F36 A;  4ESW A;  3PPQ A;  2ZNS A;  3EHT A;  3TTM A;  3PUV E;  1O7T A;  3FD3 A;  4GFR A;  2RIN A;  1BKA A;  3MUQ A;  4BDL A;  2XXY A;  3BFU A;  4R6H A;  2DXR A;  1Y1M A;  2VGQ A;  3E13 X;  3VXB A;  2PMS A;  5CBR A;  1XS5 A;  4FE8 A;  4ZDM A;  3Q29 A;  1MQG A;  2O1M A;  2VP1 A;  2A5T B;  4BDN A;  2ZYN A;  4R6K A;  1JW4 A;  1JET A;  2A5T A;  4YIC A;  3H4Z A;  4JWY A;  2ZXT A;  1P1O A;  2GFE A;  1SI0 A;  2CMO A;  3JYR A;  4EF1 A;  5FHM A;  2I48 A;  5TP9 B;  2D21 A;  1M5F A;  1FQC A;  3TTK A;  1MY1 A;  5TP9 A;  2H99 A;  4YKI A;  3H6W A;  3EHS A;  3MVY A;  4TLM B;  3DM0 A;  1SBP A;  4N6P A;  4R6Y A;  1J1N A;  1XC1 A;  3OEM A;  3C9H A;  1B0H A;  1QVS A;  4PFY A;  3L6H A;  4UA8 A;  3ILU B;  3MBP A;  3MAM A;  2PT1 A;  2F7C A;  1LBC A;  4EQ9 A;  5CM6 A;  3TCG A;  4R9F A;  2O6A A;  1LB9 A;  4G8H A;  2QS2 A;  4G8M A;  3CRB A;  1H45 A;  1B3H A;  5DT6 A;  3KN7 A;  1LLS A;  3WAE A;  3TTL A;  3IX1 A;  4DE8 A;  1LAG E;  1MPB A;  2NVU B;  3SEY A;  2AL4 A;  3D4G A;  1M5B A;  3O6G A;  2V25 A;  4OES A;  4YKP A;  4KD5 A;  3F11 A;  3IJX B;  3OO9 A;  4IY5 A;  2XXX A;  3MPL A;  1FQB A;  4OER A;  1MY0 A;  3JZJ A;  2QS4 A;  5HBC A;  4H65 A;  1A8F A;  3CSB A;  3LC8 A;  1AOV A;  3GLB A;  2DE3 A;  3OEK A;  1FQF A;  4IO2 A;  3SES A;  2F6P A;  5AA1 A;  5AA4 B;  1T0K A;  4NWD A;  4LZ5 A;  2Y7K A;  4KR5 A;  4C1T A;  4HW8 A;  5AA4 A;  1B46 A;  3W9W A;  2PBW A;  3M3L A;  3QAX A;  3S9L C;  1B7Z A;  2ONK E;  3PMV A;  5I84 A;  3FZV A;  1P1W A;  3M8U A;  2RC7 A;  4ZEI A;  4U1Z A;  4IB2 A;  1DMB A;  4RY1 A;  3K01 A;  3DLN A;  1B40 A;  1YAE A;  3H6V A;  4Z0I A;  1N84 A;  4NE4 A;  3USD A;  3K1M A;  3MP1 A;  1S9T A;  3OOA A;  3UN6 A;  1D4N A;  3MPK A;  2OBG A;  3CR9 A;  4BDQ A;  2UVJ A;  1JNF A;  4QRZ A;  5CC2 A;  4K3F A;  3HHG A;  2THI A;  3KJ7 A;  1MY3 A;  1MQH A;  3PD8 A;  3TCF A;  4BLA A;  1B3L A;  1FW0 A;  2I0C A;  4U4S A;  3MZ1 A;  3C34 A;  1AIV A;  4OWD A;  3OO8 A;  4PE5 B;  1D9V A;  1B51 A;  3TQW A;  4R2F A;  1ZU0 A;  2ONR A;  3RQT A;  1DTG A;  3TTN A;  3TEL A;  2Y7W A;  3S4U A;  1ZKB A;  4AB6 A;  1AL3 A;  1RYO A;  3DP8 A;  4BDM A;  3AXF A;  3MC2 A;  4LVQ A;  4F18 A;  3OO6 A;  4F19 A;  4F3P A;  3PPO A;  2QMX A;  3C36 A;  3RT8 A;  3C33 A;  3RGY A;  5L9S A;  3O66 A;  1WOD A;  4YKK A;  1SW1 A;  3IJO B;  4M4G A;  2XX8 A;  4PFW A;  5I2N B;  3TOD A;  3N26 A;  1AH5 A;  3IR1 A;  1LFH A;  4G68 B;  3FGS A;  5I2N A;  3VDF A;  2DSF A;  4KFQ A;  1YCJ A;  5KCJ B;  1JVX A;  4G68 A;  3TKD A;  4GD5 A;  2OCU A;  4ZZE A;  5KCJ A;  1Y1Z A;  1LCF A;  4F22 A;  4WEP A;  2YPN A;  1VFE A;  4O3A A;  3IB1 A;  3FJ7 A;  5IKB A;  3N94 A;  4OEN A;  1BP5 A;  2R6G E;  1MPC A;  3PGF A;  5H8N B;  1MPD A;  4IGR A;  1ZLQ A;  1A8E A;  2I3V A;  1B1H A;  4GIZ A;  4H8I A;  2ANJ A;  4NF5 B;  5H8N A;  3MVX A;  1EZP A;  1XVX A;  3L6G A;  3FAS A;  4OXV A;  1QUJ A;  4NF5 A;  2DOJ A;  1NKX A;  1F9B A;  4N13 A;  1M5E A;  3CFX A;  3LBS A;  3QYT A;  2O1L A;  2E1S A;  2G93 A;  2RCB A;  2B3B A;  3QUJ A;  2XXW A;  4YZZ A;  3T66 A;  1Y4C A;  1SQY A;  2V84 A;  5AE4 A;  3SEX A;  4XXU A;  1POT A;  1US5 A;  5H8F B;  3E3K A;  4F29 A;  2HZK A;  4H6D A;  5CBS A;  2XXQ A;  5H8F A;  1II5 A;  2QMW A;  1H43 A;  1CE2 A;  1GV8 A;  1MQI A;  1SYI A;  1WDN A;  2RF1 A;  1N3X A;  3EPE A;  2R71 A;  1OMP A;  4MFI A;  1EH3 A;  1AMF A;  2NOO A;  1EZO A;  2GH9 A;  3EF7 A;  3G3H A;  4GL0 A;  2F78 A;  5L8D A;  2XXV A;  3OEN A;  4GXA A;  4DXC A;  1SYH A;  3LSX A;  1KWH A;  1O64 A;  3IOW A;  2HEU A;  1ANF A;  3FVO A;  4RPO A;  3B6W A;  3Q27 A;  3HST A;  2UXA A;  2ZNU A;  4JXI A;  5I56 B;  2O51 A;  3QXM A;  2DQV A;  1OVT A;  4F2O A;  1USY H;  3RUM A;  1NL5 A;  3PUY E;  1OVB A;  1OIB A;  4NWC A;  1MXX A;  4U4X A;  5DEX B;  3ODB A;  4LA9 A;  1Q1K A;  4JSO A;  4PP0 A;  3S2V A;  3ZSF A;  1IXC A;  5L9M A;  5DEX A;  3T93 B;  2HQ0 A;  1M5C A;  4IO5 A;  3TMG A;  1NFT A;  3CI8 A;  3TFL A;  3C31 A;  3IAZ A;  3O28 A;  1FQA A;  1MY2 A;  3O6I A;  3B6Q A;  3W15 C;  1LFG A;  3SDF A;  1LBB A;  4H67 A;  5I58 B;  5ICQ A;  4L17 A;  1VR5 A;  3WAF A;  3HPI A;  2H98 A;  5I58 A;  1L5T A;  3R7X A;  1LST A;  3W9V A;  3A09 A;  4Q0C A;  4F2Q A;  1Q35 A;  2O69 A;  3V83 A;  1BTJ A;  1R9Q A;  1SDX A;  2REG A;  4E0X A;  2V3U A;  3PMX A;  2OLB A;  2XXT A;  1NNK A;  3VLV A;  4ONY A;  1B9J A;  3M3F A;  3ONM A;  1URS A;  2AL5 A;  1IXG A;  3RLF E;  5AA3 A;  1LAF E;  2VHA A;  5I57 B;  2H5Y A;  3UA8 A;  1NNP A;  3H3G A;  3A3U A;  3OEL A;  4PQJ A;  2NXO A;  4GF8 A;  5I57 A;  1B5H A;  5L9O A;  2Y84 A;  4QFL A;  3RPW A;  5A5X B;  1B5I A;  1UTH B;  1ATG A;  1MRP A;  2F6G A;  1LB8 A;  3MWB A;  4XIG Q;  5A5X A;  1RKM A;  4GOT A;  1URG A;  1TWY A;  1UTH A;  3FVK A;  4QFK A;  3T22 A;  3BFT A;  4KYS A;  2Q8J A;  5ISU A;  2DVZ A;  1SD3 A;  2YJP A;  1JEV A;  5HM4 B;  4F3S A;  1MQD A;  2ZYO A;  3TQL A;  2XX7 A;  1O63 A;  3RTW B;  1PBQ A;  3PPP A;  1MM7 A;  4U1O A;  1B3G A;  3K02 A;  4LAT A;  4PFU A;  5EYF A;  4X48 A;  4RNS A;  2O84 X;  4FED A;  3HN0 A;  3U72 A;  2Z8E A;  3MVZ A;  4GLI A;  3KOS A;  1P99 A;  1GGG A;  3O97 A;  2YLN A;  3DP6 A;  1LAH E;  4GRK A;  1B0L A;  3H7M A;  2DWH A;  3VLU A;  3K2D A;  4THI A;  4BDO A;  4KCD A;  1D3K A;  4OZ9 A;  1B4H A;  3S9M C;  4Z7E A;  1GVC A;  1A40 A;  3E4R A;  2ZYM A;  1IEJ A;  1P1N A;  4R73 A;  3KSJ A;  5DYH A;  4LQ5 A;  3C32 A;  4KCC A;  1P1U A;  2DWA A;  4G8N A;  3BKI B;  4P11 A;  3G3I A;  4I9D A;  1DPE A;  2DWJ A;  2P1S A;  3G3J A;  1DPP A;  3CG3 A;  1MXY A;  1MXU A;  3GZG A;  2V3T A;  2HZL A;  4XKR A;  1VE4 A;  3C4M A;  3TZA A;  3TEP A;  3HHF A;  1TFD A;  4R72 A;  3U93 A;  1EU8 A;  1Y3N A;  3G3G A;  4G77 A;  2X7Q A;  1XVY A;  3PMW A;  4G2Z A;  1UQW A;  3BBR A;  4ZEK A;  2FYI A;  2IA4 A;  4RK9 A;  1Y3P A;  3N5L A;  4POW A;  1MDP 1;  1MH3 A;  4HS7 A;  4LP2 B;  4HCW A;  2DXY A;  4H0W A;  5JK4 A;  4ZE9 A;  3SER A;  2DP8 A;  4O3C A;  4RJZ A;  1VSO A;  2F5X A;  2ONS A;  4PFT A;  3IOR A;  2B65 A;  4EXK A;  2I0B A;  1A99 A;  4ESX A;  1GR2 A;  5B7D A;  2I58 A;  1FTJ A;  4ZED A;  2Z22 A;  1I6Q A;  1PB7 A;  4F3G A;  1POY 1;  2D3I A;  2G29 A;  2XXU A;  4F31 B;  4OHN A;  5FTH A;  1I6A A;  4LQ2 A;  3MW0 A;  3A3C A;  1FCK A;  3KBR A;  1B3E A;  5ICT A;  3O2A A;  4RK2 A;  1JW5 A;  2FNC A;  5BUU A;  2XXP A;  2X7P A;  1TXF A;  4ELO A;  1IUD A;  3KOT A;  2Q9T A;  4XKP A;  4NED A;  1HSE A;  1LAX A;  5CMM A;  2Y7I A;  1OQG A;  2DE4 A;  3B6T A;  3KEI A;  1FTK A;  3T9V A;  4LZ7 A;  4JWX A;  3FAT A;  3SKP A;  4ISU A;  2LAO A;  4FAT A;  2KLF A;  2Q88 A;  4XKN A;  3I5O A;  4QSE A;  4RYA A;  3N6U A;  1IQ7 A;  4NTL A;  4X1B A;  1NH7 A;  2REJ A;  3QSL A;  2HAU A;  2XHD A;  1IIT A;  3FIR A;  1IIW A;  5FHO A;  1R6Z A;  3OSQ A;  1LFI A;  3VXC A;  1XOC A;  2W7Y A;  1B7U A;  3UP9 A;  2VOZ A;  4JB7 A;  1B7H A;  3K0V A;  3GXA A;  1PB9 A;  4HTG A;  4C1U A;  3MP6 A;  1Y20 A;  3GBA A;  5EHM A;  3R6U A;  2QSX A;  1N3W A;  1MXW A;  2RCA A;  3I3V A;  3P7I A;  1QKA A;  1MY4 A;  4AQ4 A;  2ZYK A;  4GL8 A;  2RKM A;  2I3W A;  4Q30 B;  2I49 A;  2OZZ A;  3RNN A;  3V89 B;  2XXR A;  3UOR A;  4WXJ A;  3IL1 B;  3H6T A;  2DWI A;  2IEE A;  1SW4 A;  1IXI A;  3THI A;  1Y4T A;  4IO4 A;  4P0G A;  1LCT A;  3MZB A;  4ZEC A;  1NH8 A;  2ZMB A;  4F1Y A;  4OFL A;  3VVE A;  1NNF A;  3RN8 A;  3U8Q A;  1OQH A;  3U92 A;  1MXZ A;  1VFD A;  4ELP A;  4YB7 A;  5I2K B;  3FV2 A;  3IB0 A;  3H03 A;  5I2K A;  3B7D A;  4JDF A;  4F3B A;  3T9H B;  4U22 A;  3SEW A;  2ESN A;  1B2H A;  5CMC A;  1B6H A;  1NNT A;  4M1V A;  1UIV A;  1UTB B;  1QKB A;  1PDA A;  3TAJ A;  3KN8 A;  1FTO A;  3U94 A;  3UIF A;  4U23 A;  5FTI A;  1JEU A;  3V5A A;  4F1V A;  2AYS A;  2RC8 A;  3O6H A;  4I1D A;  4H1X A;  3VV5 A;  1MQJ A;  5CMB A;  3KGC A;  2P2A A;  3VFJ A;  1B4Z A;  1ELJ A;  1MH4 A;  2F97 A;  3M3K A;  3OXN A;  3S9N C;  3ECR A;  2RC9 A;  3Q26 A;  2GHA A;  2QPQ A;  2CZL A;  5M2V A;  4FEB A;  1B3F A;  4QFP A;  1ZIU A;  4MBP A;  1FTM A;  3IOV A;  3FXQ A;  3MVW A;  5FHN A;  1B05 A;  4QFO A;  3U1O A;  1B32 A;  4OTE A;  3IO4 A;  2I4C A;  4DZ1 A;  3K6W A;  5EHS A;  1ZTY A;  2DS9 A;  1SVX B;  4NF4 B;  3K6X A;  4U2R A;  1XHY A;  1MXV A;  3JV9 A;  3G7W A;  4ZEF A;  3PD9 A;  1QUL A;  4NF4 A;  1A55 A;  3RTF B;  3G3K A;  1B58 A;  1EZ9 A;  1LGB C;  2ABH A;  1MM6 A;  3C35 A;  4EQ7 A;  4OEV A;  5ELV A;  4NMY A;  4YB6 A;  4IY6 A;  4GWO A;  5DVF A;  1BLF A;  4ND9 A;  2F35 A;  5B70 A;  3FXU A;  5IAI A;  4OVJ A;  4XKQ A;  4WED A;  3IOU A;  2V3Q A;  1R9L A;  4EUO A;  2UYF A;  3EHU A;  3D4C A;  5KZT A;  4E0W A;  4GQO A;  4MLQ A;  4HCY A;  4TOZ A;  1UIU A;  1B52 A;  4KI0 E;  3TDJ A;  1Y3Q A;  1A7L A;  3SEV A;  3CVG A;  2XXH A;  3OSR A;  3CFL A;  2VD2 A;  3PV0 E;  3Q25 A;  1TFA A;  1IZ1 A;  4I8C A;  2HAV A;  3VLW A;  4MF3 A;  4JBZ A;  3N6T A;  3CG1 A;  3HV1 A;  1OLA A;  2X26 A;  4O3B A;  2GRV A;  5F1Q A;  5TPA B;  3T9U A;  3FXR A;  2XXI A;  1RYX A;  1ZJL A;  2F8D A;  5TPA A;  3LUY A;  3CIJ A;  4DCX A;  4OET A;  4QFN A;  4KYD A;  4KQP A;  5CI5 A;  2F7B A;  4BDR A;  4I62 A;  4QSC A;  2QS1 A;  4OQO A;  2Z8F A;  4MLV A;  2QJE A;  3ILT B;  1NMU A;  1WVJ A;  4XTC Q;  4IO3 A;  1S50 A;  4KPT A;  2PT2 A;  4OFO A;  2A5S A;  5CMK A;  1USY E;  3K1N A;  1FQD A;  3G3F A;  4FJP A;  3ZS6 A;  3K1P A;  3OMB A;  4H8J A;  1N0T A;  4ZEB A;  1QW0 A;  2Z23 A;  4EQB A;  1QUK A;  3FUZ A;  5ITP A;  1HSL A;  2OWT A;  4R75 A;  2BJJ X;  2Q89 A;  4POX A;  3IK6 B;  4DLD A;  4WKM A;  5DVI A;  3HCQ A;  2QS3 A;  4GVO A;  4ZS9 A;  4EXL A;  1PB8 A;  4N07 A;  4DXB A;  2UYE A;  5K2Y A;  2O7I A;  1MS7 A;  3VVD A;  1MG1 A;  5H8Q B;  2ALU A;  2XD3 A;  4FIM A;  3T9X B;  1N76 A;  3MQ9 A;  4NF8 B;  5H8Q A;  1JVY A;  1YPN A;  3PUZ E;  2OJT A;  1H44 A;  4TQU Q;  1H3D A;  4ELR A;  5H8S A;  4NF8 A;  1S7Y A;  4FAJ A;  3OO7 A;  2HCA A;  1URD A;  3K4U A;  1GTK A;  1A54 A;  2NUV A;  1JW1 A;  1N7W A;  4ECF A;  3DP4 A;  2Y7P A;  4H5F A;  1DTZ A;  2B3F A;  2AIX A;  1PC3 A;  4KHZ E;  4F39 A;  2GHB A;  1I69 A;  1YTV A;  1M5D A;  1FTL A;  3RY3 A;  5TU0 A;  4EF2 A;  2PYY A;  5AA2 B;  2H25 A;  2ZNT A;  5JEI A;  3Q28 A;  3LSF B;  3MP8 A;  3VE1 B;  2NWJ A;  5AA2 A;  3O9P A;  4OYV A;  2UVI A;  3IB2 A;  2Y7R A;  3HO7 A;  4YAH X;  3QK6 A;  2DVC A;  1XT8 A;  4C0R A;  4H5G A;  4EDP A;  1OLC A;  5ITO A;  1SW2 A;  3ZKL A;  1D9Y A;  5CRY A;  4G4P A;  4DIG A;  3GBB A;  1B1X A;  2Q2C A;  4TLL B;  1H76 A;  1TT1 A;  4X1D A;  4AB5 A;  2HFB A;  4UAC A;  2I6E A;  4OEU A;  1FQE A;  5AA2 D;  2H4I A;  3ZKK A;  3RT6 B;  1Z7N E;  2F34 A;  3PUX E;  1BIY A;  3MJN A;  2I4B A;  2Z8D A;  3KFM A;  3VVF A;  3EQ1 A;  4FOR A;  1Y9U A;  3UK4 A;  2VD3 A;  4ELQ A;  5KDT B;  1QJM A;  3TCH A;  4QSD A;  4YMA A;  3LSL A;  5KDT A;  4Q8R A; 
#chains in the Genus database with same CATH topology
 4KYE A;  2F7A A;  3LR1 A;  5H8H B;  4ZE8 A;  1N04 A;  4DDD A;  3EN3 A;  3FVG A;  1K9Y A;  2O68 A;  1JQF A;  5I56 A;  5H8H A;  3TYH A;  3KZG A;  3PPN A;  1R1N A;  2WX9 A;  3MZ9 A;  2R9J A;  2V93 A;  4JSD A;  1NV5 A;  4OFJ A;  4GWX A;  3KG2 A;  4PET A;  2QL3 A;  3V8X B;  2QRY A;  2R8T A;  4IGT A;  1I6B A;  1NV1 A;  3K6U A;  3K6V A;  4U21 A;  3O29 A;  3H06 B;  4YU0 A;  3UGW A;  1QUI A;  2KR0 A;  3KSX A;  4RXL A;  3FJM A;  2XX9 A;  4GXS B;  3CSG A;  4RPN A;  4P3L A;  5K2X A;  4F1U A;  4LON B;  5F7V A;  3TPA A;  4YKJ A;  5J1D A;  3KJT A;  3E79 A;  3ROJ A;  5EYH A;  3E78 A;  1ZMG A;  3H6U A;  3T96 B;  3KN3 A;  1LBY A;  4R9G A;  5LOM A;  5BWJ A;  4LUB A;  4R74 A;  1CB6 A;  3SET A;  5I59 B;  3QUF A;  1D9Q A;  4NF6 B;  2Y5L A;  4X9T A;  2UVH A;  1ZBM A;  2M8C A;  1FPG A;  5DTB A;  1PBP A;  4PAF A;  5I59 A;  2FHY A;  2UVG A;  4NF6 A;  3IO6 A;  3FVN A;  4OMB A;  4IO6 A;  2HXR A;  1B5J A;  3K00 A;  4DCY A;  5JTY B;  4JWO A;  1P1Q A;  3PU5 A;  4RA1 A;  1K9Z A;  4QHQ A;  5JTY A;  1IXH A;  1UTB A;  3TUS A;  3SEU A;  2Q2A A;  1SI1 A;  5HPQ A;  1PEB A;  4YB5 A;  2ZZV A;  2FA7 A;  2P0S A;  4DXU A;  1DSN A;  4PFR A;  2PX1 A;  4GBV A;  2D5W A;  3I6V A;  2XD2 A;  4R2B A;  3TTR A;  3QIM A;  2VPO A;  3IOT A;  4ZZA A;  3LSW A;  2WKY A;  3DEL B;  1SW5 A;  2PVU A;  2O7U A;  3CFZ A;  3OD7 A;  4QF9 A;  5DVJ A;  4HXV A;  4MNP A;  2E0S A;  3E9X A;  3FBP A;  4IO7 A;  1DOT A;  3PPR A;  1Z7M E;  1US4 A;  2OWS A;  3PUW E;  3S9E A;  2H9B A;  4P0I A;  3FV1 A;  4LZ8 A;  1RDZ A;  2HXW A;  1N7X A;  3R26 A;  4FEC A;  4MH5 A;  4Q5T A;  4YMB A;  1HSJ A;  5IZ1 A;  3FJG A;  1MDQ A;  4NQ8 A;  2DE2 A;  4G68 C;  2DYX A;  3HFU A;  2OK2 A;  2F36 A;  4ESW A;  4DI3 D;  3MYU A;  1KA0 A;  3PPQ A;  2ZNS A;  3EHT A;  3TTM A;  3PUV E;  4QBA A;  1O7T A;  3FD3 A;  4GFR A;  2RIN A;  2PFZ A;  1BKA A;  3MUQ A;  4BDL A;  2XXY A;  3BFU A;  4R6H A;  2DXR A;  1Y1M A;  2VGQ A;  3E13 X;  3VXB A;  2PMS A;  5CBR A;  4OVS A;  1XS5 A;  4FE8 A;  4ZDM A;  3Q29 A;  1MQG A;  1DBZ A;  2O1M A;  4QXD A;  2VP1 A;  2A5T B;  4BDN A;  2ZYN A;  4R6K A;  4NGU A;  1JW4 A;  1JET A;  2A5T A;  4YIC A;  1FBG A;  3H4Z A;  4JWY A;  2ZXT A;  1P1O A;  2GFE A;  1SI0 A;  2CMO A;  3JYR A;  4MJO A;  4EF1 A;  5FHM A;  2I48 A;  5TP9 B;  4MMP A;  2D21 A;  1M5F A;  1FQC A;  3TTK A;  1MY1 A;  5TP9 A;  2H99 A;  4YKI A;  3H6W A;  3EHS A;  3MVY A;  4TLM B;  3DM0 A;  1SBP A;  4N6P A;  4R6Y A;  4LN5 A;  1J1N A;  1XC1 A;  3OEM A;  3C9H A;  4N8Y A;  5IM2 A;  1B0H A;  1QVS A;  4PFY A;  3L6H A;  4UA8 A;  1G0I A;  3ILU B;  3MBP A;  3MAM A;  2PT1 A;  5LTC A;  2F7C A;  1LBC A;  4EQ9 A;  4GWU A;  4OVR A;  1FRP A;  5CM6 A;  3TCG A;  4R9F A;  2O6A A;  1LB9 A;  3RPL B;  4G8H A;  2QS2 A;  4G8M A;  3CRB A;  3RPL A;  4PFB A;  2PFY A;  1H45 A;  1YYZ A;  1B3H A;  1FBE A;  5DT6 A;  3KN7 A;  1LLS A;  3WAE A;  3TTL A;  4X04 A;  3IX1 A;  4DE8 A;  1LAG E;  1MPB A;  2NVU B;  3IFC A;  3SEY A;  2AL4 A;  3D4G A;  1M5B A;  3O6G A;  2V25 A;  4OES A;  4YKP A;  4KD5 A;  3F11 A;  3IJX B;  3OO9 A;  4IY5 A;  2XXX A;  3MPL A;  1FQB A;  4OER A;  2WBD A;  1MY0 A;  3JZJ A;  2QS4 A;  5HBC A;  4H65 A;  3FXB A;  3LV0 A;  1A8F A;  3CSB A;  3LC8 A;  1AOV A;  3GLB A;  2DE3 A;  3OEK A;  1FQF A;  4IO2 A;  2MKZ A;  3SES A;  4UAB A;  2F6P A;  5AA1 A;  5ET7 A;  5AA4 B;  1T0K A;  4NWD A;  4LZ5 A;  2Y7K A;  4KR5 A;  3B8B A;  4C1T A;  4HW8 A;  5AA4 A;  1B46 A;  3W9W A;  2PBW A;  3M3L A;  3QAX A;  2Y5K A;  3S9L C;  1FPB A;  1B7Z A;  2ONK E;  3PMV A;  5I84 A;  3FZV A;  2QVU A;  1P1W A;  4HE0 A;  3M8U A;  4P56 A;  2RC7 A;  4ZEI A;  4GX6 A;  4U1Z A;  4IB2 A;  1DMB A;  4RY1 A;  3K01 A;  3DLN A;  1B40 A;  1YAE A;  2VT5 A;  3H6V A;  4PF8 A;  4Z0I A;  1N84 A;  4NE4 A;  3USD A;  3K1M A;  3MP1 A;  1S9T A;  3OOA A;  3UN6 A;  1D4N A;  3MPK A;  2OBG A;  3CR9 A;  4BDQ A;  2UVJ A;  3U65 A;  1JNF A;  4QRZ A;  5CC2 A;  3SZP A;  4K3F A;  3HHG A;  2THI A;  3KJ7 A;  1MY3 A;  1MQH A;  3PD8 A;  3TCF A;  2KQZ A;  4BLA A;  4I3Y A;  1IMB A;  1B3L A;  1FW0 A;  2I0C A;  4U4S A;  3MZ1 A;  3C34 A;  1AIV A;  4OWD A;  1IMF A;  3OO8 A;  3NOH A;  4PE5 B;  1D9V A;  1B51 A;  3TQW A;  1NUZ A;  4R2F A;  1ZU0 A;  2ONR A;  3RQT A;  1DTG A;  3TTN A;  3TEL A;  4I40 A;  2Y7W A;  3S4U A;  1ZKB A;  4AB6 A;  4O8M A;  3ISP A;  1AL3 A;  1RYO A;  3DP8 A;  4BDM A;  3AXF A;  3MC2 A;  4LVQ A;  4F18 A;  1DCU A;  4XF5 A;  4NX1 A;  3OO6 A;  4F19 A;  4F3P A;  3PPO A;  1RDY A;  2QMX A;  3C36 A;  3RT8 A;  3C33 A;  3RGY A;  5L9S A;  3O66 A;  1WOD A;  4YKK A;  1SW1 A;  3IJO B;  4M4G A;  2XX8 A;  4PFW A;  4N91 A;  1KZ8 A;  5I2N B;  3TOD A;  3N26 A;  1AH5 A;  3IR1 A;  1LFH A;  4G68 B;  3FGS A;  5I2N A;  3VDF A;  2DSF A;  4KFQ A;  4NAP A;  1YCJ A;  5KCJ B;  1JVX A;  4PAI A;  4G68 A;  3TKD A;  4GD5 A;  4MCO A;  2OCU A;  4ZZE A;  5KCJ A;  1Y1Z A;  5IZ3 B;  1LCF A;  4P47 A;  4WEP A;  4F22 A;  2YPN A;  1VFE A;  4O3A A;  2FIE A;  5ESY A;  3IB1 A;  3FJ7 A;  1NI9 A;  5IZ3 A;  5IKB A;  3N94 A;  4OEN A;  1BP5 A;  2R6G E;  1MPC A;  3PGF A;  5H8N B;  1MPD A;  4IGR A;  1ZLQ A;  1A8E A;  2I3V A;  1NUW A;  1B1H A;  4GIZ A;  4H8I A;  2ANJ A;  4NF5 B;  5H8N A;  3MVX A;  2OWZ A;  1EZP A;  1XVX A;  3L6G A;  3FAS A;  4OXV A;  2OX3 A;  1QUJ A;  4NF5 A;  1LBV A;  2DOJ A;  1NKX A;  1F9B A;  4N13 A;  1M5E A;  3CFX A;  3LBS A;  3QYT A;  4HE1 A;  2O1L A;  2E1S A;  2G93 A;  2RCB A;  2B3B A;  3QUJ A;  2XXW A;  4YZZ A;  3T66 A;  1Y4C A;  1SQY A;  2V84 A;  5AE4 A;  3SEX A;  4XXU A;  1POT A;  4PDD A;  1US5 A;  5H8F B;  3E3K A;  4F29 A;  2HZK A;  4X8R A;  4H6D A;  5CBS A;  2XXQ A;  5H8F A;  1II5 A;  2QMW A;  2QFL A;  1H43 A;  2FBP A;  1VDW A;  1CE2 A;  1GV8 A;  1MQI A;  1KA1 A;  1SYI A;  1WDN A;  2RF1 A;  1N3X A;  4OVQ A;  3EPE A;  2R71 A;  1OMP A;  4MFI A;  1EH3 A;  2HPG A;  3CHG A;  4H46 A;  1AMF A;  2NOO A;  1EZO A;  2GH9 A;  3EF7 A;  3G3H A;  5EQ7 A;  1CNQ A;  4GL0 A;  2F78 A;  5L8D A;  2XXV A;  3OEN A;  4GXA A;  4DXC A;  4IR8 A;  1SYH A;  3LSX A;  2WEF A;  1Q9D A;  1KWH A;  1O64 A;  3IOW A;  2HEU A;  1ANF A;  3FVO A;  4RPO A;  1NUY A;  3B6W A;  3Q27 A;  3HST A;  2L5V A;  2UXA A;  2ZNU A;  1NUX A;  4JXI A;  5I56 B;  2O51 A;  4H45 A;  3QXM A;  2DQV A;  1OVT A;  4F2O A;  1USY H;  3RUM A;  1NL5 A;  1IMA A;  3PUY E;  1OVB A;  1OIB A;  4NWC A;  1MXX A;  4U4X A;  5DEX B;  3ODB A;  4LA9 A;  1Q1K A;  4JSO A;  4PP0 A;  3S2V A;  3ZSF A;  1IXC A;  5L9M A;  5DEX A;  3T93 B;  4PTK A;  2HQ0 A;  4PGP A;  1M5C A;  4IO5 A;  2XXK A;  5ET5 A;  3TMG A;  1NFT A;  3CI8 A;  3TFL A;  3C31 A;  3IAZ A;  3O28 A;  1FPL A;  1FQA A;  1MY2 A;  3O6I A;  2XA5 A;  3B6Q A;  4N81 A;  3W15 C;  1LFG A;  3SDF A;  1FBP A;  4PBQ A;  4P1L A;  1LBB A;  4H67 A;  5I58 B;  5ICQ A;  1QGX A;  4L17 A;  1VR5 A;  4N17 A;  3WAF A;  3HPI A;  2H98 A;  5I58 A;  1L5T A;  3R7X A;  1LST A;  3W9V A;  3A09 A;  1SPI A;  4MNC A;  4Q0C A;  4F2Q A;  1FPF A;  1Q35 A;  2O69 A;  3V83 A;  1BTJ A;  1R9Q A;  1SDX A;  2REG A;  4E0X A;  2V3U A;  3PMX A;  2OLB A;  2XXT A;  1NNK A;  3VLV A;  4ONY A;  1B9J A;  3M3F A;  3ONM A;  4AS5 A;  1URS A;  2AL5 A;  1IXG A;  3RLF E;  5AA3 A;  1LAF E;  2VHA A;  5I57 B;  2H5Y A;  2BJI A;  4PGN A;  3UA8 A;  1NNP A;  3H3G A;  3A3U A;  3OEL A;  4MIJ A;  4PQJ A;  2NXO A;  4GF8 A;  1FPD A;  5I57 A;  1B5H A;  5L9O A;  2Y84 A;  4QFL A;  3RPW A;  5A5X B;  5J16 A;  1B5I A;  1UTH B;  1ATG A;  1MRP A;  2F6G A;  1LB8 A;  1INP A;  3MWB A;  4XIG Q;  5A5X A;  1RKM A;  4GOT A;  1FSA A;  1TWY A;  1URG A;  1UTH A;  3FVK A;  4QFK A;  3T22 A;  3BFT A;  4KYS A;  2Q8J A;  5ISU A;  2DVZ A;  1SD3 A;  2YJP A;  1JEV A;  4N8G A;  4OAN A;  5HM4 B;  4F3S A;  1MQD A;  2ZYO A;  3TQL A;  2XX7 A;  1O63 A;  3RTW B;  1PBQ A;  3PPP A;  1MM7 A;  4U1O A;  1B3G A;  3K02 A;  4LAT A;  4PFU A;  5EYF A;  4X48 A;  4RNS A;  2O84 X;  4FED A;  3HN0 A;  3U72 A;  2Z8E A;  3MVZ A;  3T0J A;  4GLI A;  3KOS A;  1P99 A;  1GGG A;  3O97 A;  2YLN A;  4DI4 B;  3DP6 A;  1LAH E;  4GRK A;  1B0L A;  4OA4 A;  3H7M A;  2DWH A;  2ZZW A;  3VLU A;  3K2D A;  4THI A;  4BDO A;  4KCD A;  4PAK A;  1D3K A;  4OZ9 A;  1B4H A;  4N6K A;  3S9M C;  4NN3 A;  4Z7E A;  5EQ8 A;  1GVC A;  1A40 A;  3E4R A;  4FBP A;  2ZYM A;  4GBW A;  3LUZ A;  1IEJ A;  1P1N A;  4R73 A;  4P8B A;  3KSJ A;  5DYH A;  4LQ5 A;  3C32 A;  5ET6 A;  4KCC A;  1P1U A;  2DWA A;  4G8N A;  3BKI B;  4P11 A;  3G3I A;  4I9D A;  1DPE A;  2DWJ A;  3T1B A;  2P1S A;  3G3J A;  1DPP A;  3CG3 A;  1MXY A;  1MXU A;  3GZG A;  2V3T A;  2HZL A;  3PTY A;  4XKR A;  1VE4 A;  3C4M A;  3TZA A;  3TEP A;  4NG7 A;  3HHF A;  1TFD A;  4R72 A;  3U93 A;  1EU8 A;  1Y3N A;  3G3G A;  4G77 A;  2X7Q A;  1XVY A;  3PMW A;  4N15 A;  1NV4 A;  4G2Z A;  1UQW A;  3BBR A;  4PDH A;  4ZEK A;  2FYI A;  2FIX A;  2IA4 A;  2F3D A;  4RK9 A;  1Y3P A;  3N5L A;  5A5L A;  4N6D A;  4POW A;  1MDP 1;  3KC1 A;  3A29 A;  1MH3 A;  4HS7 A;  4LP2 B;  2PCR A;  4HCW A;  1NV2 A;  3MST A;  2DXY A;  4H0W A;  5JK4 A;  4ZE9 A;  3SER A;  2DP8 A;  4O3C A;  4RJZ A;  1VSO A;  2F5X A;  2ONS A;  5IZZ A;  4PFT A;  3IOR A;  2B65 A;  4GX3 A;  5T3J A;  4EXK A;  2I0B A;  1A99 A;  1NV7 A;  4ESX A;  1GR2 A;  5B7D A;  2I58 A;  2QVV A;  3KBZ A;  1FTJ A;  4ZED A;  4NF0 A;  5I5P A;  2Z22 A;  1FPJ A;  1I6Q A;  1PB7 A;  4NHB A;  4F3G A;  1POY 1;  2D3I A;  2G29 A;  2XXU A;  4F31 B;  4OHN A;  5FTH A;  1I6A A;  4LQ2 A;  3MW0 A;  3EKI A;  3A3C A;  1FCK A;  3KBR A;  1B3E A;  1LEV A;  2P3V A;  5ICT A;  2HHM A;  3O2A A;  4RK2 A;  1JW5 A;  2FNC A;  5BUU A;  2XXP A;  2X7P A;  1TXF A;  4ELO A;  1IUD A;  3KOT A;  1IME A;  2Q9T A;  4XKP A;  4NED A;  1HSE A;  1LAX A;  5CMM A;  2Y7I A;  1OQG A;  2XWV A;  2DE4 A;  3B6T A;  3KEI A;  1FTK A;  1FPI A;  4GWY A;  3T9V A;  1FTA A;  2WYP A;  4LZ7 A;  4MNI A;  4JWX A;  3FAT A;  3SKP A;  4ISU A;  2LAO A;  4FAT A;  2KLF A;  2Q88 A;  4XKN A;  3I5O A;  4QSE A;  4RYA A;  3N6U A;  1IQ7 A;  4NTL A;  4X1B A;  1NH7 A;  2REJ A;  3QSL A;  2HAU A;  2XHD A;  4P9K A;  1IIT A;  3FIR A;  1IIW A;  1IMD A;  2QVR A;  5FHO A;  1R6Z A;  3OSQ A;  1LFI A;  3VXC A;  1XOC A;  2W7Y A;  1B7U A;  3UP9 A;  2VOZ A;  4JB7 A;  1B7H A;  1EYI A;  2FVZ A;  3K0V A;  3GXA A;  1PB9 A;  4HTG A;  1LBW A;  4C1U A;  3MP6 A;  1Y20 A;  3GBA A;  5EHM A;  3R6U A;  2QSX A;  1N3W A;  1MXW A;  2RCA A;  3I3V A;  3P7I A;  1QKA A;  2CEY A;  4I3E A;  1MY4 A;  4AQ4 A;  2ZYK A;  4GL8 A;  2RKM A;  2I3W A;  1FBD A;  4Q30 B;  2ZZX A;  2I49 A;  2OZZ A;  1G0H A;  3RNN A;  5IGA A;  3V89 B;  2XXR A;  3UOR A;  4WXJ A;  3IL1 B;  3H6T A;  2DWI A;  2IEE A;  1SW4 A;  1IXI A;  3THI A;  1Y4T A;  4IO4 A;  4O94 A;  4P0G A;  1LCT A;  3MZB A;  4ZEC A;  1NH8 A;  2ZMB A;  4F1Y A;  4OFL A;  3QMF A;  4MHF A;  3VVE A;  1NNF A;  3BIH A;  3RN8 A;  3U8Q A;  4GX4 A;  1OQH A;  4G61 A;  3U92 A;  1MXZ A;  1VFD A;  4ELP A;  2XWI A;  4YB7 A;  4P1E A;  5I2K B;  3FV2 A;  1XI6 A;  3IB0 A;  3H03 A;  5I2K A;  3B7D A;  4JDF A;  4F3B A;  3T9H B;  4N4U A;  4U22 A;  3SEW A;  2ESN A;  1B2H A;  5CMC A;  1B6H A;  1NNT A;  4M1V A;  4MEV A;  1UIV A;  1UTB B;  1QKB A;  1PDA A;  3TAJ A;  3KN8 A;  2V4C A;  1FTO A;  3U94 A;  3UIF A;  4U23 A;  5FTI A;  1JEU A;  3V5A A;  4F1V A;  2AYS A;  2RC8 A;  3O6H A;  4I1D A;  4H1X A;  3VV5 A;  1MQJ A;  5CMB A;  3KGC A;  2P2A A;  3VFJ A;  1B4Z A;  1ELJ A;  1MH4 A;  2F97 A;  1RDX A;  3M3K A;  3OXN A;  3S9N C;  3ECR A;  2RC9 A;  2DDK A;  3Q26 A;  2GHA A;  2QPQ A;  2CZL A;  5M2V A;  4FEB A;  2Q8M A;  1B3F A;  4QFP A;  1ZIU A;  4MBP A;  1FTM A;  3IOV A;  5EYG A;  3FXQ A;  3MVW A;  5FHN A;  2WBB A;  4O7M A;  1B05 A;  4QFO A;  3U1O A;  1B32 A;  4OTE A;  4JVI A;  3IO4 A;  2I4C A;  4DZ1 A;  4MX6 A;  3K6W A;  5EHS A;  1ZTY A;  2DS9 A;  3BIG A;  1SVX B;  4MAG A;  4NF4 B;  3K6X A;  4U2R A;  1XHY A;  1MXV A;  1NV6 A;  3JV9 A;  3G7W A;  4ZEF A;  3PD9 A;  1QUL A;  4NF4 A;  1DK4 A;  1A55 A;  3RTF B;  3G3K A;  1B58 A;  1EZ9 A;  2B4L A;  1LGB C;  2ABH A;  1MM6 A;  3C35 A;  4EQ7 A;  1FJ9 A;  2WYK A;  4OEV A;  2VPN A;  5ELV A;  4NMY A;  4XEQ A;  1EYJ A;  4YB6 A;  4IY6 A;  4GWO A;  5EQ9 A;  5DVF A;  1BLF A;  4ND9 A;  2F35 A;  4GWS A;  5B70 A;  3FXU A;  5IAI A;  4OVJ A;  2B4M A;  4XKQ A;  4WED A;  3IOU A;  2V3Q A;  1R9L A;  4PE3 A;  4EUO A;  2UYF A;  2P3N A;  3EHU A;  3D4C A;  5KZT A;  4E0W A;  2XWO A;  4GQO A;  4MLQ A;  4HCY A;  1NV3 A;  4TOZ A;  1UIU A;  1B52 A;  1NV0 A;  3B50 A;  4KI0 E;  3TDJ A;  1Y3Q A;  1A7L A;  3SEV A;  3CVG A;  2XXH A;  3OSR A;  3CFL A;  1IMC A;  2VD2 A;  3PV0 E;  3Q25 A;  1TFA A;  2F3B A;  1IZ1 A;  4I8C A;  4PBH A;  2HAV A;  3VLW A;  4MF3 A;  4JBZ A;  3N6T A;  3CG1 A;  3HV1 A;  1OLA A;  2X26 A;  4O3B A;  2GRV A;  5F1Q A;  5TPA B;  3T9U A;  3FXR A;  2XXI A;  1JP4 A;  1RYX A;  1ZJL A;  2F8D A;  5TPA A;  3LUY A;  3CIJ A;  4DCX A;  4OET A;  4QFN A;  4KYD A;  4KQP A;  5CI5 A;  2F7B A;  4BDR A;  4I62 A;  4QSC A;  2QS1 A;  4OQO A;  2Z8F A;  1YXI A;  4MLV A;  2QJE A;  2Q74 A;  3ILT B;  1NMU A;  1WVJ A;  4XTC Q;  4IO3 A;  5F24 A;  1S50 A;  4KPT A;  2PT2 A;  4OFO A;  2A5S A;  4KXP A;  1USY E;  5CMK A;  3K1N A;  1FQD A;  3G3F A;  4FJP A;  3ZS6 A;  3K1P A;  3OMB A;  4H8J A;  1N0T A;  4ZEB A;  1QW0 A;  2Z23 A;  4EQB A;  1QUK A;  3FUZ A;  1LBX A;  5EQA A;  5ITP A;  1HSL A;  2OWT A;  4R75 A;  4PFI A;  2BJJ X;  2Q89 A;  4POX A;  3IK6 B;  4DLD A;  4WKM A;  5DVI A;  1LBZ A;  3HCQ A;  5I7I A;  2QS3 A;  4OVT A;  4GVO A;  4ZS9 A;  4EXL A;  1PB8 A;  4N07 A;  4DXB A;  4GWZ A;  2UYE A;  5K2Y A;  2O7I A;  1MS7 A;  3VVD A;  1MG1 A;  5H8Q B;  2ALU A;  2XD3 A;  4FIM A;  3T9X B;  1N76 A;  3MQ9 A;  4NF8 B;  5H8Q A;  1JVY A;  1YPN A;  3PUZ E;  2OJT A;  1H44 A;  5FBP A;  4TQU Q;  1H3D A;  4ELR A;  5H8S A;  4NF8 A;  1S7Y A;  4HE2 A;  3IFA A;  4FAJ A;  3OO7 A;  2HCA A;  5I3S A;  1URD A;  3K4U A;  1AWB A;  1FBF A;  1GTK A;  1A54 A;  2NUV A;  1JW1 A;  1N7W A;  4O7I A;  4ECF A;  3DP4 A;  5LDZ A;  2Y7P A;  4XFE A;  4H5F A;  3GYY A;  1DTZ A;  2B3F A;  2AIX A;  1FPE A;  1PC3 A;  4KHZ E;  4PCD A;  4F39 A;  5DW8 A;  2GHB A;  1I69 A;  1YTV A;  1M5D A;  1FTL A;  1EYK A;  3RY3 A;  5TU0 A;  1BK4 A;  4EF2 A;  2PYY A;  5AA2 B;  2H25 A;  2ZNT A;  5JEI A;  3Q28 A;  3LSF B;  2XWK A;  3MP8 A;  3VE1 B;  2GQ1 A;  1YZ0 A;  2NWJ A;  5AA2 A;  3O9P A;  2CZK A;  4OYV A;  2UVI A;  4PF6 A;  3KC0 A;  3IB2 A;  2Y7R A;  3HO7 A;  4YAH X;  4OVP A;  3QK6 A;  2DVC A;  1XT8 A;  2JJK A;  4H5G A;  4C0R A;  4EDP A;  1OLC A;  2CEX A;  2CZI A;  5ITO A;  1SW2 A;  4JVC A;  1FPK A;  3ZKL A;  1D9Y A;  5CRY A;  4G4P A;  4DIG A;  3RYD A;  3GBB A;  2CZH A;  1B1X A;  2Q2C A;  4TLL B;  1H76 A;  1TT1 A;  4X1D A;  4AB5 A;  2HFB A;  4UAC A;  2I6E A;  1FBC A;  4OEU A;  1FQE A;  1FJ6 A;  5AA2 D;  2H4I A;  3RT6 B;  3ZKK A;  1Z7N E;  2F34 A;  3D1R A;  3PUX E;  5ET8 A;  1BIY A;  3MJN A;  2I4B A;  2Z8D A;  3KFM A;  4AS4 A;  3VVF A;  3EQ1 A;  4FOR A;  1Y9U A;  4PC9 A;  4GWW A;  3UK4 A;  2VD3 A;  4ELQ A;  5KDT B;  1FBH A;  1QJM A;  3TCH A;  4QSD A;  4YMA A;  3LSL A;  4JVD A;  5KDT A;  4Q8R A; 
#chains in the Genus database with same CATH homology
 4KYE A;  2F7A A;  3LR1 A;  5H8H B;  4ZE8 A;  1N04 A;  4DDD A;  3EN3 A;  3FVG A;  2O68 A;  1JQF A;  5I56 A;  5H8H A;  3TYH A;  3KZG A;  3PPN A;  1R1N A;  3MZ9 A;  2R9J A;  2V93 A;  4JSD A;  4OFJ A;  3KG2 A;  4PET A;  2QL3 A;  3V8X B;  2QRY A;  4IGT A;  1I6B A;  3K6U A;  3K6V A;  4U21 A;  3O29 A;  3H06 B;  4YU0 A;  3UGW A;  1QUI A;  3KSX A;  4RXL A;  3FJM A;  2XX9 A;  4GXS B;  3CSG A;  4RPN A;  5K2X A;  4F1U A;  4LON B;  5F7V A;  3TPA A;  4YKJ A;  5J1D A;  3KJT A;  1ZMG A;  3H6U A;  3T96 B;  3KN3 A;  4R9G A;  5LOM A;  5BWJ A;  4LUB A;  4R74 A;  1CB6 A;  3SET A;  5I59 B;  3QUF A;  4NF6 B;  4X9T A;  2UVH A;  1ZBM A;  2M8C A;  5DTB A;  1PBP A;  5I59 A;  2UVG A;  4NF6 A;  3IO6 A;  3FVN A;  4OMB A;  4IO6 A;  1B5J A;  3K00 A;  4DCY A;  5JTY B;  4JWO A;  1P1Q A;  3PU5 A;  4RA1 A;  4QHQ A;  5JTY A;  1IXH A;  1UTB A;  3TUS A;  3SEU A;  2Q2A A;  1SI1 A;  5HPQ A;  1PEB A;  4YB5 A;  2FA7 A;  2P0S A;  4DXU A;  1DSN A;  2PX1 A;  2D5W A;  3I6V A;  2XD2 A;  4R2B A;  3TTR A;  3QIM A;  3IOT A;  4ZZA A;  3LSW A;  2WKY A;  3DEL B;  1SW5 A;  2PVU A;  2O7U A;  3CFZ A;  3OD7 A;  4QF9 A;  5DVJ A;  2E0S A;  3E9X A;  4IO7 A;  1DOT A;  3PPR A;  1Z7M E;  1US4 A;  2OWS A;  3PUW E;  3S9E A;  2H9B A;  4P0I A;  3FV1 A;  4LZ8 A;  2HXW A;  1N7X A;  3R26 A;  4FEC A;  4MH5 A;  4Q5T A;  4YMB A;  1HSJ A;  3FJG A;  1MDQ A;  2DE2 A;  4G68 C;  2DYX A;  2OK2 A;  2F36 A;  4ESW A;  3PPQ A;  2ZNS A;  3EHT A;  3TTM A;  3PUV E;  1O7T A;  3FD3 A;  4GFR A;  2RIN A;  1BKA A;  3MUQ A;  4BDL A;  2XXY A;  3BFU A;  4R6H A;  2DXR A;  1Y1M A;  2VGQ A;  3E13 X;  3VXB A;  2PMS A;  5CBR A;  1XS5 A;  4FE8 A;  4ZDM A;  3Q29 A;  1MQG A;  2O1M A;  2VP1 A;  2A5T B;  4BDN A;  2ZYN A;  4R6K A;  1JW4 A;  1JET A;  2A5T A;  4YIC A;  3H4Z A;  4JWY A;  2ZXT A;  1P1O A;  2GFE A;  1SI0 A;  2CMO A;  3JYR A;  4EF1 A;  5FHM A;  2I48 A;  5TP9 B;  2D21 A;  1M5F A;  1FQC A;  3TTK A;  1MY1 A;  5TP9 A;  2H99 A;  4YKI A;  3H6W A;  3EHS A;  3MVY A;  4TLM B;  3DM0 A;  1SBP A;  4N6P A;  4R6Y A;  1J1N A;  1XC1 A;  3OEM A;  3C9H A;  1B0H A;  1QVS A;  4PFY A;  3L6H A;  4UA8 A;  3ILU B;  3MBP A;  3MAM A;  2PT1 A;  2F7C A;  1LBC A;  4EQ9 A;  5CM6 A;  3TCG A;  4R9F A;  2O6A A;  1LB9 A;  4G8H A;  2QS2 A;  4G8M A;  3CRB A;  1H45 A;  1B3H A;  5DT6 A;  3KN7 A;  1LLS A;  3WAE A;  3TTL A;  3IX1 A;  4DE8 A;  1LAG E;  1MPB A;  2NVU B;  3SEY A;  2AL4 A;  3D4G A;  1M5B A;  3O6G A;  2V25 A;  4OES A;  4YKP A;  4KD5 A;  3F11 A;  3IJX B;  3OO9 A;  4IY5 A;  2XXX A;  3MPL A;  1FQB A;  4OER A;  1MY0 A;  3JZJ A;  2QS4 A;  5HBC A;  4H65 A;  1A8F A;  3CSB A;  3LC8 A;  1AOV A;  3GLB A;  2DE3 A;  3OEK A;  1FQF A;  4IO2 A;  3SES A;  2F6P A;  5AA1 A;  5AA4 B;  1T0K A;  4NWD A;  4LZ5 A;  2Y7K A;  4KR5 A;  4C1T A;  4HW8 A;  5AA4 A;  1B46 A;  3W9W A;  2PBW A;  3M3L A;  3QAX A;  3S9L C;  1B7Z A;  2ONK E;  3PMV A;  5I84 A;  3FZV A;  1P1W A;  3M8U A;  2RC7 A;  4ZEI A;  4U1Z A;  4IB2 A;  1DMB A;  4RY1 A;  3K01 A;  3DLN A;  1B40 A;  1YAE A;  3H6V A;  4Z0I A;  1N84 A;  4NE4 A;  3USD A;  3K1M A;  3MP1 A;  1S9T A;  3OOA A;  3UN6 A;  1D4N A;  3MPK A;  2OBG A;  3CR9 A;  4BDQ A;  2UVJ A;  1JNF A;  4QRZ A;  5CC2 A;  4K3F A;  3HHG A;  2THI A;  3KJ7 A;  1MY3 A;  1MQH A;  3PD8 A;  3TCF A;  4BLA A;  1B3L A;  1FW0 A;  2I0C A;  4U4S A;  3MZ1 A;  3C34 A;  1AIV A;  4OWD A;  3OO8 A;  4PE5 B;  1D9V A;  1B51 A;  3TQW A;  4R2F A;  1ZU0 A;  2ONR A;  3RQT A;  1DTG A;  3TTN A;  3TEL A;  2Y7W A;  3S4U A;  1ZKB A;  4AB6 A;  1AL3 A;  1RYO A;  3DP8 A;  4BDM A;  3AXF A;  3MC2 A;  4LVQ A;  4F18 A;  3OO6 A;  4F19 A;  4F3P A;  3PPO A;  2QMX A;  3C36 A;  3RT8 A;  3C33 A;  3RGY A;  5L9S A;  3O66 A;  1WOD A;  4YKK A;  1SW1 A;  3IJO B;  4M4G A;  2XX8 A;  4PFW A;  5I2N B;  3TOD A;  3N26 A;  1AH5 A;  3IR1 A;  1LFH A;  4G68 B;  3FGS A;  5I2N A;  3VDF A;  2DSF A;  4KFQ A;  1YCJ A;  5KCJ B;  1JVX A;  4G68 A;  3TKD A;  4GD5 A;  2OCU A;  4ZZE A;  5KCJ A;  1Y1Z A;  1LCF A;  4F22 A;  4WEP A;  2YPN A;  1VFE A;  4O3A A;  3IB1 A;  3FJ7 A;  5IKB A;  3N94 A;  4OEN A;  1BP5 A;  2R6G E;  1MPC A;  3PGF A;  5H8N B;  1MPD A;  4IGR A;  1ZLQ A;  1A8E A;  2I3V A;  1B1H A;  4GIZ A;  4H8I A;  2ANJ A;  4NF5 B;  5H8N A;  3MVX A;  1EZP A;  1XVX A;  3L6G A;  3FAS A;  4OXV A;  1QUJ A;  4NF5 A;  2DOJ A;  1NKX A;  1F9B A;  4N13 A;  1M5E A;  3CFX A;  3LBS A;  3QYT A;  2O1L A;  2E1S A;  2G93 A;  2RCB A;  2B3B A;  3QUJ A;  2XXW A;  4YZZ A;  3T66 A;  1Y4C A;  1SQY A;  2V84 A;  5AE4 A;  3SEX A;  4XXU A;  1POT A;  1US5 A;  5H8F B;  3E3K A;  4F29 A;  2HZK A;  4H6D A;  5CBS A;  2XXQ A;  5H8F A;  1II5 A;  2QMW A;  1H43 A;  1CE2 A;  1GV8 A;  1MQI A;  1SYI A;  1WDN A;  2RF1 A;  1N3X A;  3EPE A;  2R71 A;  1OMP A;  4MFI A;  1EH3 A;  1AMF A;  2NOO A;  1EZO A;  2GH9 A;  3EF7 A;  3G3H A;  4GL0 A;  2F78 A;  5L8D A;  2XXV A;  3OEN A;  4GXA A;  4DXC A;  1SYH A;  3LSX A;  1KWH A;  1O64 A;  3IOW A;  2HEU A;  1ANF A;  3FVO A;  4RPO A;  3B6W A;  3Q27 A;  3HST A;  2UXA A;  2ZNU A;  4JXI A;  5I56 B;  2O51 A;  3QXM A;  2DQV A;  1OVT A;  4F2O A;  1USY H;  3RUM A;  1NL5 A;  3PUY E;  1OVB A;  1OIB A;  4NWC A;  1MXX A;  4U4X A;  5DEX B;  3ODB A;  4LA9 A;  1Q1K A;  4JSO A;  4PP0 A;  3S2V A;  3ZSF A;  1IXC A;  5L9M A;  5DEX A;  3T93 B;  2HQ0 A;  1M5C A;  4IO5 A;  3TMG A;  1NFT A;  3CI8 A;  3TFL A;  3C31 A;  3IAZ A;  3O28 A;  1FQA A;  1MY2 A;  3O6I A;  3B6Q A;  3W15 C;  1LFG A;  3SDF A;  1LBB A;  4H67 A;  5I58 B;  5ICQ A;  4L17 A;  1VR5 A;  3WAF A;  3HPI A;  2H98 A;  5I58 A;  1L5T A;  3R7X A;  1LST A;  3W9V A;  3A09 A;  4Q0C A;  4F2Q A;  1Q35 A;  2O69 A;  3V83 A;  1BTJ A;  1R9Q A;  1SDX A;  2REG A;  4E0X A;  2V3U A;  3PMX A;  2OLB A;  2XXT A;  1NNK A;  3VLV A;  4ONY A;  1B9J A;  3M3F A;  3ONM A;  1URS A;  2AL5 A;  1IXG A;  3RLF E;  5AA3 A;  1LAF E;  2VHA A;  5I57 B;  2H5Y A;  3UA8 A;  1NNP A;  3H3G A;  3A3U A;  3OEL A;  4PQJ A;  2NXO A;  4GF8 A;  5I57 A;  1B5H A;  5L9O A;  2Y84 A;  4QFL A;  3RPW A;  5A5X B;  1B5I A;  1UTH B;  1ATG A;  1MRP A;  2F6G A;  1LB8 A;  3MWB A;  4XIG Q;  5A5X A;  1RKM A;  4GOT A;  1URG A;  1TWY A;  1UTH A;  3FVK A;  4QFK A;  3T22 A;  3BFT A;  4KYS A;  2Q8J A;  5ISU A;  2DVZ A;  1SD3 A;  2YJP A;  1JEV A;  5HM4 B;  4F3S A;  1MQD A;  2ZYO A;  3TQL A;  2XX7 A;  1O63 A;  3RTW B;  1PBQ A;  3PPP A;  1MM7 A;  4U1O A;  1B3G A;  3K02 A;  4LAT A;  4PFU A;  5EYF A;  4X48 A;  4RNS A;  2O84 X;  4FED A;  3HN0 A;  3U72 A;  2Z8E A;  3MVZ A;  4GLI A;  3KOS A;  1P99 A;  1GGG A;  3O97 A;  2YLN A;  3DP6 A;  1LAH E;  4GRK A;  1B0L A;  3H7M A;  2DWH A;  3VLU A;  3K2D A;  4THI A;  4BDO A;  4KCD A;  1D3K A;  4OZ9 A;  1B4H A;  3S9M C;  4Z7E A;  1GVC A;  1A40 A;  3E4R A;  2ZYM A;  1IEJ A;  1P1N A;  4R73 A;  3KSJ A;  5DYH A;  4LQ5 A;  3C32 A;  4KCC A;  1P1U A;  2DWA A;  4G8N A;  3BKI B;  4P11 A;  3G3I A;  4I9D A;  1DPE A;  2DWJ A;  2P1S A;  3G3J A;  1DPP A;  3CG3 A;  1MXY A;  1MXU A;  3GZG A;  2V3T A;  2HZL A;  4XKR A;  1VE4 A;  3C4M A;  3TZA A;  3TEP A;  3HHF A;  1TFD A;  4R72 A;  3U93 A;  1EU8 A;  1Y3N A;  3G3G A;  4G77 A;  2X7Q A;  1XVY A;  3PMW A;  4G2Z A;  1UQW A;  3BBR A;  4ZEK A;  2FYI A;  2IA4 A;  4RK9 A;  1Y3P A;  3N5L A;  4POW A;  1MDP 1;  1MH3 A;  4HS7 A;  4LP2 B;  4HCW A;  2DXY A;  4H0W A;  5JK4 A;  4ZE9 A;  3SER A;  2DP8 A;  4O3C A;  4RJZ A;  1VSO A;  2F5X A;  2ONS A;  4PFT A;  3IOR A;  2B65 A;  4EXK A;  2I0B A;  1A99 A;  4ESX A;  1GR2 A;  5B7D A;  2I58 A;  1FTJ A;  4ZED A;  2Z22 A;  1I6Q A;  1PB7 A;  4F3G A;  1POY 1;  2D3I A;  2G29 A;  2XXU A;  4F31 B;  4OHN A;  5FTH A;  1I6A A;  4LQ2 A;  3MW0 A;  3A3C A;  1FCK A;  3KBR A;  1B3E A;  5ICT A;  3O2A A;  4RK2 A;  1JW5 A;  2FNC A;  5BUU A;  2XXP A;  2X7P A;  1TXF A;  4ELO A;  1IUD A;  3KOT A;  2Q9T A;  4XKP A;  4NED A;  1HSE A;  1LAX A;  5CMM A;  2Y7I A;  1OQG A;  2DE4 A;  3B6T A;  3KEI A;  1FTK A;  3T9V A;  4LZ7 A;  4JWX A;  3FAT A;  3SKP A;  4ISU A;  2LAO A;  4FAT A;  2KLF A;  2Q88 A;  4XKN A;  3I5O A;  4QSE A;  4RYA A;  3N6U A;  1IQ7 A;  4NTL A;  4X1B A;  1NH7 A;  2REJ A;  3QSL A;  2HAU A;  2XHD A;  1IIT A;  3FIR A;  1IIW A;  5FHO A;  1R6Z A;  3OSQ A;  1LFI A;  3VXC A;  1XOC A;  2W7Y A;  1B7U A;  3UP9 A;  2VOZ A;  4JB7 A;  1B7H A;  3K0V A;  3GXA A;  1PB9 A;  4HTG A;  4C1U A;  3MP6 A;  1Y20 A;  3GBA A;  5EHM A;  3R6U A;  2QSX A;  1N3W A;  1MXW A;  2RCA A;  3I3V A;  3P7I A;  1QKA A;  1MY4 A;  4AQ4 A;  2ZYK A;  4GL8 A;  2RKM A;  2I3W A;  4Q30 B;  2I49 A;  2OZZ A;  3RNN A;  3V89 B;  2XXR A;  3UOR A;  4WXJ A;  3IL1 B;  3H6T A;  2DWI A;  2IEE A;  1SW4 A;  1IXI A;  3THI A;  1Y4T A;  4IO4 A;  4P0G A;  1LCT A;  3MZB A;  4ZEC A;  1NH8 A;  2ZMB A;  4F1Y A;  4OFL A;  3VVE A;  1NNF A;  3RN8 A;  3U8Q A;  1OQH A;  3U92 A;  1MXZ A;  1VFD A;  4ELP A;  4YB7 A;  5I2K B;  3FV2 A;  3IB0 A;  3H03 A;  5I2K A;  3B7D A;  4JDF A;  4F3B A;  3T9H B;  4U22 A;  3SEW A;  2ESN A;  1B2H A;  5CMC A;  1B6H A;  1NNT A;  4M1V A;  1UIV A;  1UTB B;  1QKB A;  1PDA A;  3TAJ A;  3KN8 A;  1FTO A;  3U94 A;  3UIF A;  4U23 A;  5FTI A;  1JEU A;  3V5A A;  4F1V A;  2AYS A;  2RC8 A;  3O6H A;  4I1D A;  4H1X A;  3VV5 A;  1MQJ A;  5CMB A;  3KGC A;  2P2A A;  3VFJ A;  1B4Z A;  1ELJ A;  1MH4 A;  2F97 A;  3M3K A;  3OXN A;  3S9N C;  3ECR A;  2RC9 A;  3Q26 A;  2GHA A;  2QPQ A;  2CZL A;  5M2V A;  4FEB A;  1B3F A;  4QFP A;  1ZIU A;  4MBP A;  1FTM A;  3IOV A;  3FXQ A;  3MVW A;  5FHN A;  1B05 A;  4QFO A;  3U1O A;  1B32 A;  4OTE A;  3IO4 A;  2I4C A;  4DZ1 A;  3K6W A;  5EHS A;  1ZTY A;  2DS9 A;  1SVX B;  4NF4 B;  3K6X A;  4U2R A;  1XHY A;  1MXV A;  3JV9 A;  3G7W A;  4ZEF A;  3PD9 A;  1QUL A;  4NF4 A;  1A55 A;  3RTF B;  3G3K A;  1B58 A;  1EZ9 A;  1LGB C;  2ABH A;  1MM6 A;  3C35 A;  4EQ7 A;  4OEV A;  5ELV A;  4NMY A;  4YB6 A;  4IY6 A;  4GWO A;  5DVF A;  1BLF A;  4ND9 A;  2F35 A;  5B70 A;  3FXU A;  5IAI A;  4OVJ A;  4XKQ A;  4WED A;  3IOU A;  2V3Q A;  1R9L A;  4EUO A;  2UYF A;  3EHU A;  3D4C A;  5KZT A;  4E0W A;  4GQO A;  4MLQ A;  4HCY A;  4TOZ A;  1UIU A;  1B52 A;  4KI0 E;  3TDJ A;  1Y3Q A;  1A7L A;  3SEV A;  3CVG A;  2XXH A;  3OSR A;  3CFL A;  2VD2 A;  3PV0 E;  3Q25 A;  1TFA A;  1IZ1 A;  4I8C A;  2HAV A;  3VLW A;  4MF3 A;  4JBZ A;  3N6T A;  3CG1 A;  3HV1 A;  1OLA A;  2X26 A;  4O3B A;  2GRV A;  5F1Q A;  5TPA B;  3T9U A;  3FXR A;  2XXI A;  1RYX A;  1ZJL A;  2F8D A;  5TPA A;  3LUY A;  3CIJ A;  4DCX A;  4OET A;  4QFN A;  4KYD A;  4KQP A;  5CI5 A;  2F7B A;  4BDR A;  4I62 A;  4QSC A;  2QS1 A;  4OQO A;  2Z8F A;  4MLV A;  2QJE A;  3ILT B;  1NMU A;  1WVJ A;  4XTC Q;  4IO3 A;  1S50 A;  4KPT A;  2PT2 A;  4OFO A;  2A5S A;  5CMK A;  1USY E;  3K1N A;  1FQD A;  3G3F A;  4FJP A;  3ZS6 A;  3K1P A;  3OMB A;  4H8J A;  1N0T A;  4ZEB A;  1QW0 A;  2Z23 A;  4EQB A;  1QUK A;  3FUZ A;  5ITP A;  1HSL A;  2OWT A;  4R75 A;  2BJJ X;  2Q89 A;  4POX A;  3IK6 B;  4DLD A;  4WKM A;  5DVI A;  3HCQ A;  2QS3 A;  4GVO A;  4ZS9 A;  4EXL A;  1PB8 A;  4N07 A;  4DXB A;  2UYE A;  5K2Y A;  2O7I A;  1MS7 A;  3VVD A;  1MG1 A;  5H8Q B;  2ALU A;  2XD3 A;  4FIM A;  3T9X B;  1N76 A;  3MQ9 A;  4NF8 B;  5H8Q A;  1JVY A;  1YPN A;  3PUZ E;  2OJT A;  1H44 A;  4TQU Q;  1H3D A;  4ELR A;  5H8S A;  4NF8 A;  1S7Y A;  4FAJ A;  3OO7 A;  2HCA A;  1URD A;  3K4U A;  1GTK A;  1A54 A;  2NUV A;  1JW1 A;  1N7W A;  4ECF A;  3DP4 A;  2Y7P A;  4H5F A;  1DTZ A;  2B3F A;  2AIX A;  1PC3 A;  4KHZ E;  4F39 A;  2GHB A;  1I69 A;  1YTV A;  1M5D A;  1FTL A;  3RY3 A;  5TU0 A;  4EF2 A;  2PYY A;  5AA2 B;  2H25 A;  2ZNT A;  5JEI A;  3Q28 A;  3LSF B;  3MP8 A;  3VE1 B;  2NWJ A;  5AA2 A;  3O9P A;  4OYV A;  2UVI A;  3IB2 A;  2Y7R A;  3HO7 A;  4YAH X;  3QK6 A;  2DVC A;  1XT8 A;  4C0R A;  4H5G A;  4EDP A;  1OLC A;  5ITO A;  1SW2 A;  3ZKL A;  1D9Y A;  5CRY A;  4G4P A;  4DIG A;  3GBB A;  1B1X A;  2Q2C A;  4TLL B;  1H76 A;  1TT1 A;  4X1D A;  4AB5 A;  2HFB A;  4UAC A;  2I6E A;  4OEU A;  1FQE A;  5AA2 D;  2H4I A;  3ZKK A;  3RT6 B;  1Z7N E;  2F34 A;  3PUX E;  1BIY A;  3MJN A;  2I4B A;  2Z8D A;  3KFM A;  3VVF A;  3EQ1 A;  4FOR A;  1Y9U A;  3UK4 A;  2VD3 A;  4ELQ A;  5KDT B;  1QJM A;  3TCH A;  4QSD A;  4YMA A;  3LSL A;  5KDT A;  4Q8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...