1IXHA

Phosphate-binding protein (pbp) complexed with phosphate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphate transport
molecule keywords PHOSPHATE-BINDING PROTEIN
publication title A low energy short hydrogen bond in very high resolution structures of protein receptor--phosphate complexes.
pubmed doi rcsb
source organism Escherichia coli
total genus 111
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1996-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixhA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixhA02
1XVYA 5I59B 4OYVA 1FQDA 5I58B 4BDOA 4QSEA 3TEPA 2DWJA 4H5FA 2B3FA 4GFRA 3LSXA 4Q0CA 4X48A 4HCYA 3O97A 3K0VA 1QUKA 1EZPA 2OK2A 1XVXA 3OMBA 1MXYA 1B1HA 4IB2A 4QFLA 4IGTA 4OEUA 1DSNA 1FTJA 3HCQA 1FTOA 3CRBA 4KYSA 3WAEA 3KJ7A 1IXCA 1Y3PA 3PD9A 5JTYB 1JW1A 1MQIA 1MQHA 4N07A 2OWTA 1N0TA 4LA9A 3FV2A 3TKDA 4QFPA 1P1OA 1TXFA 4F3GA 4WKMA 4TLLB 3O28A 5FTHA 4Z0IA 3VVEA 4F3SA 5H8QA 2YJPA 1DTZA 3ZKLA 4G8NA 3PPPA 1MY3A 1S9TA 3CVGA 4O3BA 2ZNSA 1FQCA 3QYTA 1LB9A 4FECA 5H8HA 3RUMA 5LOMA 4IO2A 3S2VA 3OEMA 1ZIUA 3MP8A 4KYDA 4NF8A 1USYH 5BUUA 2PMSA 3ZS6A 2DWAA 1US4A 3N94A 4IO4A 3U93A 3VXBA 2OLBA 5J1DA 2XX9A 2R71A 4G68A 4RPNA 4H1XA 4OFLA 3EHTA 1A8EA 4R75A 3Q28A 1AL3A 3G3IA 3IJXB 3OO8A 3SKPA 5FHOA 3IR1A 1MY2A 4QRZA 5KCJB 3S9NC 1URGA 1IXHA 2GHBA 4IY6A 1LFGA 1Y4TA 4LZ8A 4G4PA 4GXAA 1ATGA 2X26A 4R74A 3K6UA 1EZ9A 5TP9B 2XXUA 5TPAA 1Z7ME 1ZTYA 1YTVA 4F3BA 5CMCA 5EHMA 2F6PA 3MJNA 1A8FA 4QF9A 4GD5A 4XKRA 2Q2CA 5DT6A 3W15C 2QS3A 3IOVA 5FTIA 4R2FA 4IGRA 1B58A 2V84A 1LLSA 4FEDA 1S50A 2Y7PA 2ZYNA 1OQHA 5DVIA 4YMBA 3T22A 4KD5A 1PB8A 5I2KA 3K02A 4HTGA 3T9HB 2YLNA 3THIA 5IAIA 4OFJA 3EHSA 3C33A 1N76A 2VP1A 5AA4A 4ISUA 3K1PA 3GBBA 4P0GA 1II5A 3OELA 1HSEA 3B7DA 5L9MA 1N3WA 1MM6A 1JW4A 3N5LA 3VVFA 3RPWA 1M5BA 4POXA 3VLUA 4GWOA 2O1MA 3KEIA 1MG1A 5M2VA 3VLWA 1Y3QA 2FNCA 5TU0A 1XHYA 4FIMA 2GFEA 4RK2A 5CM6A 1OQGA 2A5TB 4NF4A 4JWOA 3MZ1A 3C31A 1MQDA 4IO6A 4U22A 2D21A 1CB6A 5CC2A 4I9DA 1Y1MA 3W9WA 1GR2A 2F5XA 2RINA 1B0LA 1B0HA 2UVHA 1B4HA 2HQ0A 3LUYA 2Z8FA 4G8HA 1SQYA 4NF6B 5FHMA 2REGA 4DXUA 1S7YA 5AE4A 4H8JA 1GV8A 3QSLA 4XKPA 1ZKBA 2F78A 2O51A 1URSA 1QULA 3DLNA 3L6HA 1US5A 2NVUB 3VXCA 3PV0E 3TTMA 1PB9A 2P0SA 3IOWA 4WEPA 1Q35A 4LQ5A 4ZZAA 3UN6A 3TTRA 1MXUA 4R6KA 1LGBC 1B7UA 3U94A 3ECRA 3KN8A 1LFIA 4RYAA 2I49A 2Y7RA 3Q26A 3ONMA 3O6GA 3QIMA 1SW5A 3I5OA 4F18A 3FVOA 2GRVA 4IO3A 1TFDA 4WEDA 1FCKA 1WVJA 4ESXA 3K2DA 2F6GA 5H8SA 4QSDA 1SDXA 1Y20A 5L9SA 5DEXB 4EXKA 1B3FA 1FQBA 4ONYA 3RT6B 5AA3A 4I62A 3H06B 3SESA 1YCJA 4XKQA 4G68C 3KSJA 3UP9A 5B70A 4FORA 2IA4A 3MP6A 4BDMA 5AA2D 3C36A 3R6UA 1B3EA 4YB5A 1Y9UA 1B3GA 2HZKA 4BDNA 3HO7A 2VD2A 4RK9A 1A7LA 2OWSA 5I84A 4Q5TA 3TAJA 2ZNUA 5ITOA 3B6TA 3V5AA 3FJGA 1UTHB 3G3HA 1D9VA 3TPAA 3H6VA 1LCFA 4GOTA 2B65A 3DP6A 2VHAA 3FJMA 5AA2A 1SVXB 1R1NA 4Q8RA 2KLFA 1M5FA 1A54A 1VSOA 2H99A 1NKXA 1RYXA 3UK4A 4GLIA 3QAXA 1MQGA 1EZOA 3JYRA 1XOCA 2V3TA 3H4ZA 1NNKA 1TFAA 1TWYA 4RA1A 2QL3A 3R7XA 1XC1A 2O84X 3OO9A 3I3VA 4FJPA 5KDTB 3LBSA 5L8DA 4XXUA 3A09A 2UXAA 2DE4A 3IOUA 1LAFE 1UQWA 2G29A 3IOTA 4UA8A 4I8CA 4YKIA 3ZSFA 4OESA 1LSTA 4GVOA 4OQOA 3CFLA 3OSRA 4F1UA 3QK6A 4JSDA 2DWIA 4BDQA 4RXLA 4L17A 2A5SA 3ODBA 4YKJA 4KR5A 3FD3A 2YPNA 2O7UA 3E3KA 1B9JA 2F8DA 3OSQA 1B5JA 2F35A 3KZGA 3H6UA 5EHSA 1OIBA 2Q88A 2CZLA 4OENA 3DELB 3M3KA 2ONSA 1OVBA 4F22A 5F1QA 4MH5A 3TCHA 2IEEA 2RCAA 3G3KA 1VFDA 3U92A 4ELRA 4O3AA 3GLBA 1QUIA 1IXGA 1JQFA 2XXVA 1POTA 3H03A 3D4CA 1B32A 2XXXA 3R26A 3FVKA 5I56A 5CMKA 2F7BA 1LBBA 3U1OA 4DCYA 3TDJA 3TQWA 2XHDA 2HXWA 3TCGA 5FHNA 3MAMA 1N3XA 3N6TA 4ESWA 4GXSB 2ZNTA 3C35A 4NF5B 5CRYA 3LR1A 4POWA 4DCXA 3GZGA 3SEWA 1B52A 1MPDA 1L5TA 5I2NA 1AOVA 3IORA 1MM7A 1B2HA 2AYSA 3OXNA 3O6IA 3S9MC 2VOZA 1P1NA 3CSGA 1MH4A 1YPNA 5JK4A 4R72A 1PC3A 4ND9A 4JWXA 4G77A 3ILUB 1DPEA 4K3FA 1BIYA 1N7WA 3MVXA 3O2AA 3FASA 1PEBA 3CFXA 2QS1A 5H8FA 1ZJLA 2DSFA 1MXVA 2ONRA 5H8NA 2O1LA 2Y7KA 3SEUA 3UIFA 1M5EA 5HBCA 3RT8A 2OCUA 2PVUA 3S4UA 4Q30B 3FXUA 3SERA 2PT2A 4FE8A 2BJJX 4I1DA 2V25A 1JETA 1MY1A 2X7QA 1GTKA 4HS7A 5CMMA 3Q29A 4OXVA 3VDFA 2XD2A 3TZAA 1Y3NA 5I57A 3TYHA 1Z7NE 3H6TA 1LCTA 4JB7A 1ZBMA 1IIWA 1T0KA 3BKIB 3KGCA 3UORA 3IO6A 4R9GA 3HHGA 4OEVA 3AXFA 1JNFA 1AMFA 2H4IA 5H8QB 2OBGA 2AL4A 1MXXA 1FTLA 1SI1A 3PUXE 2E1SA 3MPLA 2XX8A 3G3JA 1IZ1A 2Q2AA 1Y4CA 1WODA 4RJZA 4JBZA 2RC8A 5DYHA 4FAJA 4U4XA 3KN7A 3MZBA 1SW4A 1F9BA 5DTBA 4GL8A 5H8HB 4EQBA 3PGFA 2PX1A 1QVSA 4XIGQ 3BFUA 1VFEA 2XXPA 4NF8B 1QW0A 1IEJA 4JDFA 5B7DA 3KBRA 1DOTA 1NL5A 3UGWA 4U1ZA 3MP1A 4JSOA 4IO5A 5ICQA 4G68B 1QKAA 3C9HA 4EQ9A 1A55A 3VVDA 1O7TA 5HM4B 4DLDA 1OVTA 2I3VA 2M8CA 3KOTA 1P1UA 4PFWA 3O29A 2O7IA 2Z8EA 4ZEBA 4R9FA 2Z23A 4H67A 4IO7A 2DWHA 2ONKE 3FXRA 1Q1KA 3MVYA 5TPAB 4ZDMA 4R6YA 2XXWA 1GVCA 4WXJA 4ELOA 4LVQA 4KYEA 3LSFB 4H0WA 1UTBA 3M3FA 4QHQA 3CIJA 3CG3A 2RC9A 4EF2A 4EQ7A 1XT8A 1P1WA 3G3GA 4ZE8A 3GXAA 4G8MA 5A5XA 4KCCA 2E0SA 3M8UA 3IB0A 1ZLQA 1OLCA 3V83A 4QFNA 5I2KB 3MUQA 1AIVA 3G3FA 2Y7WA 3O6HA 3QUFA 1B1XA 1H44A 4BLAA 4MF3A 3T93B 1HSLA 1B7HA 4GIZA 2NUVA 4KPTA 3CI8A 3PMVA 4BDRA 1LAXA 4U1OA 2I48A 4PFUA 3LSLA 4GRKA 3RTFB 2F36A 2CMOA 1QJMA 1RYOA 4EF1A 2NOOA 1DPPA 4OTEA 2XXRA 3C32A 3MZ9A 1NH7A 1RKMA 3FIRA 4HW8A 4DZ1A 2ZYOA 3FUZA 2OZZA 4NF4B 1SBPA 4MLQA 2H9BA 3WAFA 1PBPA 3CFZA 3TQLA 1NNTA 5IKBA 4DE8A 1NH8A 3TCFA 4TLMB 4U4SA 2ALUA 2UYEA 2F34A 3VV5A 4F3PA 2RKMA 5ELVA 2H5YA 3FGSA 3Q27A 5I59A 4F31B 5I58A 1I69A 4ECFA 4PFYA 4DXBA 2ESNA 2HAVA 1KWHA 3MBPA 4MFIA 1ELJA 4R73A 2D3IA 3PUZE 3OD7A 2Q8JA 4LZ5A 3S9EA 2UVJA 4H8IA 3KJTA 3I6VA 1BP5A 2O68A 4R2BA 2Y7IA 1D3KA 3HV1A 3SETA 2Y84A 3TELA 2UVGA 1B05A 3HN0A 2QMXA 3HPIA 3EHUA 2ZYKA 1BLFA 4ZEFA 3MW0A 4DDDA 4GQOA 5JTYA 4YB7A 1H45A 2PYYA 3K1MA 1PBQA 4NMYA 5K2YA 3P7IA 1GGGA 3TODA 2ZYMA 3CR9A 1JVXA 5CI5A 1I6BA 3RY3A 5EYFA 2I0BA 2HZLA 4EXLA 4YU0A 3IAZA 1SI0A 4Z7EA 2FYIA 1B5HA 3PPOA 1Y1ZA 3MWBA 1NMUA 1A40A 3PPRA 4PQJA 1SYHA 1D4NA 3CSBA 2B3BA 3DP4A 3W9VA 4EDPA 3O66A 2DOJA 1EU8A 4YKPA 4BDLA 4C1UA 1B6HA 1I6QA 3C34A 1M5DA 4UACA 2QMWA 2O69A 3PMWA 4JXIA 4MBPA 2G93A 2AL5A 4LUBA 1VE4A 4F29A 1DMBA 4F2QA 4IY5A 5K2XA 5KCJA 3RNNA 4H65A 4F2OA 2V3UA 3GBAA 1HSJA 4LZ7A 5AA2B 2XXTA 3TFLA 5ITPA 3PPQA 4ELPA 5TP9A 1MPCA 3V8XB 1XS5A 3TTNA 4ZEIA 3PUWE 1SW1A 3CG1A 1IITA 1EH3A 1MDQA 1LB8A 3L6GA 3SEVA 3U8QA 1FQAA 3IJOB 3OO7A 3T66A 1R9QA 3MC2A 4C1TA 1B7ZA 2XXIA 1POY1 4LATA 3K6WA 2UVIA 3UA8A 5HPQA 2QSXA 3SEYA 4X1BA 3EQ1A 4O3CA 4QFOA 1ZU0A 4E0WA 4KHZE 2I4CA 3KOSA 1B4ZA 4H5GA 2F7AA 4RPOA 4NWCA 3V89B 4DXCA 3KG2A 1MS7A 3TMGA 3FXQA 3SEXA 2QJEA 3K01A 2R6GE 4JWYA 2Q9TA 4YKKA 4TOZA 4YAHX 3TUSA 1FTMA 1H43A 1R6ZA 1A99A 4KCDA 1LBCA 3ZKKA 2HAUA 4N13A 2I6EA 1MXZA 2XXYA 3USDA 3C4MA 1SYIA 3OENA 1R9LA 2A5TA 2Z22A 4OERA 4YZZA 5KZTA 1PB7A 3BFTA 4OWDA 3N26A 4OZ9A 3B6WA 4RY1A 1D9YA 3DP8A 4H6DA 4AB5A 2NXOA 2ZXTA 5CBSA 3RN8A 2ANJA 1QUJA 1B51A 2DE2A 1MY0A 1M5CA 2QS2A 2I3WA 4LP2B 1USYE 4F1YA 3IB2A 4NF6A 2XXQA 5DVJA 3Q25A 1OLAA 1BTJA 5I56B 1AH5A 3HSTA 4R6HA 2F7CA 2DS9A 3PU5A 3LC8A 4AB6A 3G7WA 3RLFE 1FQEA 3FATA 2HEUA 2DQVA 4DIGA 4C0RA 3PUYE 5CMBA 1TT1A 3M3LA 2DYXA 1SW2A 1NFTA 4ELQA 4ZZEA 5L9OA 4P0IA 3O9PA 4X1DA 5JEIA 2DP8A 2PT1A 3JZJA 1MXWA 3MQ9A 2QS4A 2XD3A 4GL0A 5I2NB 2F97A 3RGYA 4KI0E 2ZMBA 3IO4A 4XTCQ 1N04A 3IK6B 3PMXA 3KSXA 4F19A 3E9XA 1JEVA 2DE3A 3LSWA 3T9VA 3KN3A 1B3LA 1J1NA 4M1VA 2O6AA 3T96B 5H8FB 2FA7A 5DEXA 1IQ7A 3IB1A 4NTLA 4U21A 3FV1A 5F7VA 3H6WA 2I4BA 1B40A 3A3CA 5H8NB 2QPQA 3F11A 4HCWA 3RTWB 1B3HA 3B6QA 1NNFA 2I58A 5ICTA 3OEKA 1PDAA 3U72A 1N84A 3H3GA 3SDFA 2R9JA 3MVWA 3T9XB 5I57B 2I0CA 4XKNA 2RF1A 4F39A 1QKBA 5CBRA 1IXIA 2H98A 3EF7A 1UTHA 3BBRA 1N7XA 1CE2A 4ZEKA 1B46A 2Z8DA 4OHNA 1VR5A 3QXMA 3EN3A 3KFMA 2DVCA 3E4RA 1ANFA 4OVJA 4U23A 1FQFA 1SD3A 2DXRA 4MLVA 3IX1A 2X7PA 2AIXA 5AA4B 1UIVA 3E13X 3K6XA 1FTKA 3PUVE 3OOAA 2P2AA 3FVGA 4KFQA 1JEUA 4NE4A 3K1NA 3PPNA 2P1SA 2WKYA 3TTKA 4PFTA 1BKAA 2GHAA 4GF8A 3FVNA 2ABHA 2VD3A 4FEBA 4YICA 3VLVA 3A3UA 3MPKA 5KDTA 3PD8A 4X9TA 4EUOA 4AQ4A 1H76A 2XXHA 1URDA 3VFJA 3JV9A 4LONB 1P99A 2RCBA 4OETA 3T9UA 4U2RA 2NWJA 2GH9A 4FATA 2W7YA 2OJTA 4P11A 1P1QA 1MDP1 2REJA 4YB6A 4ZECA 5ISUA 1MPBA 1ZMGA 1MH3A 4NWDA 4G2ZA 4M4GA 2D5WA 3IL1B 1MQJA 1IUDA 3FJ7A 1UTBB 4QSCA 2H25A 1JW5A 3H7MA 4THIA 4ZS9A 1NNPA 1DTGA 2Q89A 1LAGE 1O64A 4TQUQ 1B5IA 5A5XB 5AA1A 4LQ2A 1O63A 2V3QA 4PE5B 2UYFA 3MVZA 2VGQA 1MY4A 4PETA 1LAHE 3K00A 3QUJA 2RC7A 2V93A 3S9LC 1H3DA 4RNSA 1MRPA 3TTLA 4KQPA 1OMPA 4QFKA 1JVYA 4NEDA 3OO6A 2LAOA 3ILTB 1WDNA 1I6AA 3K6VA 2HCAA 1LFHA 1UIUA 2DVZA 4NF5A 3FZVA 2XX7A 3HHFA 1FW0A 4OMBA 5DVFA 3N6UA 4ZEDA 4E0XA 1YAEA 3DM0A 3VE1B 4F1VA 2THIA 3K4UA 4PP0A 2PBWA 2HFBA 3EPEA 5BWJA 3RQTA 4OFOA 3D4GA 4YMAA 4ZE9A 4N6PA 2QRYA 2DXYA
chains in the Genus database with same CATH superfamily
4QBAA 1XVYA 1LBZA 5I59B 4OYVA 4GX6A 1FQDA 5I58B 4BDOA 4QSEA 3TEPA 2DWJA 4H5FA 2B3FA 4GFRA 3LSXA 4Q0CA 4X48A 4HCYA 3O97A 3K0VA 1QUKA 1EZPA 2OK2A 1XVXA 3OMBA 1MXYA 1B1HA 4XEQA 4IB2A 4QFLA 4IGTA 4OEUA 1DSNA 1FTJA 3HCQA 1FTOA 3CRBA 4KYSA 3WAEA 3KJ7A 2CZKA 1IXCA 1Y3PA 3PD9A 5JTYB 1LBVA 1JW1A 2PFYA 1MQIA 1MQHA 1VDWA 4N07A 2ZZVA 2OWTA 1N0TA 4LA9A 3FV2A 3TKDA 4QFPA 1P1OA 3E78A 1TXFA 1RDZA 4F3GA 4WKMA 4TLLB 3O28A 5FTHA 4Z0IA 3VVEA 4F3SA 5H8QA 2YJPA 1DTZA 1NUYA 3A29A 4GX3A 3ZKLA 2XWVA 4G8NA 3PPPA 1MY3A 2F3BA 1S9TA 3CVGA 5I5PA 1RDYA 4O3BA 2ZNSA 1FQCA 3QYTA 1LB9A 4FECA 2FHYA 5H8HA 3RUMA 5LOMA 4IO2A 3S2VA 3OEMA 1ZIUA 4PAKA 3MP8A 4KYDA 4NF8A 1USYH 5BUUA 2PMSA 4N81A 3ZS6A 2DWAA 1US4A 3N94A 4IO4A 3U93A 3VXBA 1FTAA 2OLBA 5J1DA 2XX9A 2R71A 1EYIA 4G68A 4RPNA 4H1XA 4OFLA 3EHTA 1A8EA 4R75A 1CNQA 2GQ1A 5EQAA 3Q28A 4X04A 1AL3A 3G3IA 3IJXB 3OO8A 3SKPA 5FHOA 3IR1A 1MY2A 4QRZA 2ZZXA 4OVPA 5KCJB 3S9NC 1URGA 1IXHA 2GHBA 4IY6A 1LFGA 1Y4TA 4LZ8A 4G4PA 4GXAA 1ATGA 2X26A 4R74A 3K6UA 1EZ9A 4P1LA 5TP9B 2XXUA 5TPAA 1Z7ME 2L5VA 1ZTYA 1YTVA 4F3BA 5CMCA 5EHMA 5IZ3A 2F6PA 3MJNA 1A8FA 4QF9A 4GD5A 1FBGA 3EKIA 4XKRA 4PF8A 2Q2CA 5DT6A 2CZHA 3W15C 2QS3A 3IOVA 5FTIA 4R2FA 4IGRA 1B58A 2V84A 1LLSA 4FEDA 1RDXA 1S50A 2Y7PA 2ZYNA 4NGUA 2WBBA 1OQHA 1NV7A 5DVIA 4YMBA 2QVUA 3T22A 4JVDA 4KD5A 1PB8A 5I2KA 3K02A 3B50A 4HTGA 3T9HB 2YLNA 3BIHA 3THIA 5IAIA 4OFJA 3EHSA 3C33A 1N76A 2VP1A 5AA4A 1IMCA 4NQ8A 4ISUA 3K1PA 3GBBA 4P0GA 1II5A 3OELA 1HSEA 3B7DA 4MHFA 4PDHA 5L9MA 1N3WA 1MM6A 1JW4A 2QFLA 3N5LA 3VVFA 4PC9A 3RPWA 1M5BA 4POXA 4GWUA 3VLUA 4GWOA 2O1MA 3KEIA 1MG1A 5M2VA 3VLWA 1Y3QA 2FNCA 5TU0A 1XHYA 4FIMA 2GFEA 4RK2A 5CM6A 1OQGA 2A5TB 4NF4A 4JWOA 4JVIA 3MZ1A 3C31A 1MQDA 4IO6A 4U22A 1LEVA 3PTYA 2D21A 1CB6A 1FSAA 5CC2A 2XWIA 4I9DA 1Y1MA 3W9WA 1IMBA 1GR2A 2F5XA 2RINA 1B0LA 1B0HA 2UVHA 1B4HA 2VPOA 2HQ0A 3LUYA 2Z8FA 4G8HA 1SQYA 4NF6B 5FHMA 2REGA 4DXUA 1S7YA 5AE4A 4H8JA 1GV8A 3QSLA 4XKPA 1ZKBA 4HE2A 2F78A 2O51A 1FPKA 5T3JA 1URSA 1QULA 3DLNA 4N91A 3L6HA 4O94A 5IZ1A 1US5A 2NVUB 3VXCA 3PV0E 3TTMA 1PB9A 2P0SA 3IOWA 4WEPA 1Q35A 4LQ5A 4ZZAA 3UN6A 3TTRA 5I3SA 1MXUA 4PAIA 2QVRA 2PCRA 4R6KA 1LGBC 1B7UA 3U94A 3ECRA 3KN8A 1LFIA 4RYAA 2I49A 2Y7RA 3Q26A 3ONMA 3O6GA 3CHGA 3QIMA 1SW5A 3I5OA 4F18A 3FVOA 2GRVA 4IO3A 1TFDA 4WEDA 1FCKA 1WVJA 4ESXA 3K2DA 2F6GA 5H8SA 4QSDA 1SDXA 1Y20A 5L9SA 5DEXB 4EXKA 1B3FA 1FQBA 4ONYA 3RT6B 5AA3A 4I62A 3H06B 3SESA 1YCJA 4XKQA 4G68C 3KSJA 3UP9A 5B70A 4FORA 2IA4A 3MP6A 4BDMA 5AA2D 3C36A 3R6UA 1B3EA 4YB5A 1Y9UA 1B3GA 2HZKA 2KQZA 4BDNA 3HO7A 2VD2A 4RK9A 1A7LA 2OWSA 4PGPA 2CEYA 2P3NA 5I84A 3RPLA 4Q5TA 3TAJA 2ZNUA 5ITOA 3B6TA 3V5AA 3FJGA 5EYGA 4AS4A 1UTHB 3G3HA 1D9VA 3TPAA 3H6VA 5IZZA 2P3VA 1IMFA 1LCFA 4GOTA 2B65A 3DP6A 2VHAA 3FJMA 5AA2A 4KXPA 1SVXB 1R1NA 4OVSA 4Q8RA 2KLFA 1M5FA 4OA4A 1A54A 1NV0A 1VSOA 2H99A 1NKXA 1RYXA 4DI3D 3UK4A 4GLIA 3QAXA 1MQGA 1EZOA 3JYRA 1XOCA 2V3TA 4DI4B 3H4ZA 1NNKA 1TFAA 1TWYA 4RA1A 2QL3A 3R7XA 4OANA 1XC1A 2O84X 3OO9A 1NV3A 3I3VA 4FJPA 5KDTB 1K9ZA 3LBSA 5L8DA 5ET8A 4XXUA 3A09A 2UXAA 2DE4A 3IOUA 1LAFE 4MAGA 1UQWA 2XWKA 2G29A 3IOTA 4UA8A 4I8CA 4YKIA 3ZSFA 4OESA 1LSTA 4GVOA 4GWXA 4OQOA 3CFLA 3OSRA 4F1UA 3QK6A 1FJ6A 4JSDA 2DWIA 4BDQA 4RXLA 4L17A 2A5SA 4IR8A 3ODBA 4YKJA 4KR5A 3FD3A 2YPNA 2O7UA 3E3KA 1B9JA 2F8DA 4NX1A 3OSQA 1B5JA 2F35A 3KZGA 4N8GA 3H6UA 5EHSA 1OIBA 2Q88A 1AWBA 2CZLA 3T1BA 1KA0A 4OENA 4MNPA 3DELB 4PAFA 3M3KA 2ONSA 1OVBA 3FBPA 4F22A 4OVTA 5F1QA 4MH5A 3TCHA 2IEEA 2RCAA 3G3KA 1VFDA 3U92A 4ELRA 4O3AA 3GLBA 1QUIA 1FPIA 1IXGA 1JQFA 2Q8MA 2XXVA 1POTA 3H03A 3D4CA 4H45A 1B32A 2XXXA 3R26A 3FVKA 4PE3A 5I56A 5CMKA 2F7BA 2FBPA 1LBBA 3U1OA 4DCYA 4MEVA 3TDJA 3TQWA 2XHDA 2Y5KA 2HXWA 3TCGA 5FHNA 3MAMA 1N3XA 4P47A 5DW8A 3N6TA 4ESWA 4GXSB 1FBDA 2ZNTA 3C35A 4NF5B 1IMEA 5CRYA 3LR1A 4POWA 4DCXA 4I3EA 3GZGA 1NV5A 4N6DA 3SEWA 1B52A 1MPDA 1L5TA 5I2NA 1AOVA 3IORA 1MM7A 1B2HA 2AYSA 3OXNA 3O6IA 2B4MA 4PDDA 3S9MC 2VOZA 1P1NA 3CSGA 1MH4A 2WX9A 1YPNA 5JK4A 4R72A 1PC3A 3KC1A 4PFRA 4OVQA 4ND9A 4JWXA 4G77A 3ILUB 1DPEA 4K3FA 1BIYA 1N7WA 3MVXA 3O2AA 3FASA 1PEBA 3CFXA 4H46A 2QS1A 4PTKA 5H8FA 1ZJLA 2Y5LA 2DSFA 1MXVA 3E79A 2ONRA 5H8NA 2O1LA 2Y7KA 3SEUA 3UIFA 1M5EA 5HBCA 3RT8A 2OCUA 2PVUA 3S4UA 4PFBA 3FXUA 4Q30B 3SERA 2PT2A 4FE8A 2BJJX 4I1DA 2V25A 1JETA 1MY1A 2WYKA 2X7QA 1GTKA 4HS7A 5CMMA 3Q29A 4OXVA 3VDFA 2XD2A 3TZAA 1Y3NA 5I57A 3TYHA 1Z7NE 3H6TA 1FPEA 1LCTA 4JB7A 1ZBMA 1FPBA 1IIWA 1T0KA 3BKIB 3KGCA 3UORA 3IO6A 4R9GA 1FPJA 3HHGA 4OEVA 1FRPA 1DCUA 3AXFA 4P1EA 4P3LA 1JNFA 1AMFA 2H4IA 5H8QB 2OBGA 2AL4A 1MXXA 1FTLA 1SI1A 3PUXE 2E1SA 3MPLA 2XX8A 3G3JA 4MNIA 1IZ1A 2Q2AA 1LBXA 1Y4CA 1WODA 4RJZA 4JBZA 2RC8A 5DYHA 4QXDA 4FAJA 4U4XA 3KN7A 4O7IA 1FBPA 3MZBA 1SW4A 1F9BA 5DTBA 1Q9DA 4GL8A 5H8HB 4EQBA 4JVCA 3PGFA 4PCDA 2PX1A 1QVSA 4XIGQ 3BFUA 1VFEA 2XXPA 4NF8B 1QW0A 1IEJA 4JDFA 2VT5A 5B7DA 3KBRA 1G0IA 1DOTA 1NL5A 3UGWA 4U1ZA 3MP1A 2WEFA 4JSOA 4IO5A 4P8BA 5ICQA 4G68B 4NN3A 1QKAA 3C9HA 4EQ9A 1A55A 3VVDA 1O7TA 5HM4B 4DLDA 1OVTA 2I3VA 1FJ9A 2M8CA 3KOTA 1P1UA 2ZZWA 4PFWA 3O29A 1YZ0A 4MCOA 2O7IA 2Z8EA 2MKZA 4ZEBA 4R9FA 2Z23A 4H67A 4IO7A 2DWHA 2ONKE 3FXRA 1Q1KA 3MVYA 4GWWA 4MX6A 5TPAB 4ZDMA 4R6YA 2XXWA 5IZ3B 1GVCA 4WXJA 4ELOA 3D1RA 4LVQA 4KYEA 3LSFB 4H0WA 4XF5A 1UTBA 1KZ8A 3M3FA 4QHQA 3CIJA 3CG3A 2RC9A 4EF2A 4EQ7A 1XT8A 1P1WA 3G3GA 4ZE8A 3GXAA 4G8MA 5A5XA 4KCCA 5J16A 2E0SA 3M8UA 3IB0A 5IM2A 1ZLQA 1OLCA 3V83A 4QFNA 5I2KB 3MUQA 1AIVA 3G3FA 4GWYA 2Y7WA 3O6HA 2R8TA 1FBCA 3QUFA 1B1XA 1H44A 4BLAA 4MF3A 3T93B 1HSLA 1B7HA 4GIZA 4HXVA 2NUVA 4KPTA 3CI8A 3PMVA 4BDRA 1LAXA 3NOHA 4U1OA 2I48A 4PFUA 3LSLA 4GRKA 2BJIA 3RTFB 2F36A 4HE1A 2CMOA 1QJMA 1RYOA 4EF1A 2NOOA 1DPPA 4OTEA 2XXRA 3C32A 3MZ9A 1NH7A 1RKMA 3FIRA 4FBPA 4HW8A 4N6KA 4DZ1A 2ZYOA 3FUZA 2OZZA 4NF4B 1SBPA 4MLQA 2H9BA 3WAFA 4N4UA 1PBPA 3CFZA 1FBFA 3TQLA 1NNTA 5IKBA 4DE8A 1NH8A 2FVZA 3TCFA 4TLMB 4U4SA 2ALUA 2UYEA 2F34A 3VV5A 4F3PA 2RKMA 5ELVA 2H5YA 3FGSA 3Q27A 5I59A 4F31B 5I58A 1I69A 2HHMA 4P9KA 4ECFA 1NV1A 4PFYA 4DXBA 2ESNA 2HAVA 1KWHA 3MBPA 4MFIA 1ELJA 4R73A 2HXRA 2D3IA 3PUZE 5ET6A 3OD7A 2Q8JA 4LZ5A 3LV0A 2XA5A 3S9EA 2UVJA 4H8IA 3KJTA 3I6VA 1BP5A 2O68A 5LDZA 4R2BA 2Y7IA 1D3KA 3HV1A 3BIGA 3SETA 2Y84A 3TELA 2UVGA 1B05A 3HN0A 1NV2A 2QMXA 3HPIA 3EHUA 2ZYKA 1BLFA 4ZEFA 4G61A 3MW0A 4DDDA 1KA1A 2WBDA 4GQOA 4YB7A 1H45A 5JTYA 2PYYA 3K1MA 1NV4A 3KC0A 1PBQA 4NMYA 2FIXA 5K2YA 4N17A 3P7IA 3MYUA 1GGGA 3TODA 2ZYMA 3CR9A 1JVXA 5CI5A 1I6BA 3RY3A 5I7IA 5EYFA 2I0BA 2HZLA 5A5LA 3RYDA 4EXLA 4YU0A 3IAZA 1SI0A 4Z7EA 2FYIA 1B5HA 3PPOA 1Y1ZA 3MWBA 4NF0A 1NMUA 3B8BA 1A40A 3PPRA 4PQJA 2XXKA 1SYHA 1BK4A 1D4NA 5ET7A 3CSBA 2B3BA 1DBZA 3DP4A 3W9VA 4EDPA 3O66A 2DOJA 1EU8A 4LN5A 4YKPA 3ROJA 4BDLA 4C1UA 1B6HA 1I6QA 3C34A 1M5DA 4UACA 3LUZA 2QMWA 2O69A 3PMWA 5EQ9A 3RPLB 4JXIA 4MBPA 2G93A 2AL5A 4LUBA 1VE4A 4F29A 1DMBA 4F2QA 4IY5A 5K2XA 5KCJA 3RNNA 4H65A 1FPDA 4F2OA 2V3UA 3GBAA 1HSJA 5ET5A 4LZ7A 5AA2B 1G0HA 2XXTA 3TFLA 5ITPA 3PPQA 4ELPA 2CZIA 5TP9A 1MPCA 3V8XB 1XS5A 3TTNA 1LBWA 4ZEIA 3PUWE 1SW1A 3CG1A 1IITA 1EH3A 1MDQA 1EYKA 1LB8A 3L6GA 3SEVA 3U8QA 1FQAA 3IJOB 3OO7A 3T66A 1R9QA 3MC2A 4C1TA 1B7ZA 2XXIA 3FXBA 1POY1 4LATA 3K6WA 2UVIA 3UA8A 5HPQA 2QSXA 1DK4A 3SEYA 4X1BA 3EQ1A 4O3CA 4QFOA 1ZU0A 4E0WA 1IMDA 4KHZE 2I4CA 3KOSA 1B4ZA 4H5GA 2F7AA 1NUZA 2F3DA 4RPOA 4NWCA 1SPIA 3V89B 4DXCA 3KG2A 1MS7A 4X8RA 3TMGA 3FXQA 3SEXA 2QJEA 3K01A 2R6GE 4JWYA 2Q9TA 4YKKA 4I3YA 4TOZA 4YAHX 3TUSA 1JP4A 1FTMA 1H43A 1R6ZA 1A99A 4KCDA 1LBCA 3ZKKA 2OX3A 2HAUA 4N13A 2I6EA 4GBVA 1MXZA 2XXYA 3USDA 3C4MA 1SYIA 3OENA 1R9LA 2A5TA 2Z22A 4UABA 4OERA 4YZZA 5KZTA 1PB7A 3BFTA 1D9QA 4PBHA 4PBQA 4OWDA 3N26A 4OZ9A 4MMPA 3B6WA 3SZPA 4RY1A 1D9YA 3T0JA 3DP8A 4H6DA 4AB5A 1FBEA 2NXOA 1K9YA 1YXIA 5F24A 2ZXTA 5CBSA 3RN8A 2ANJA 1QUJA 1B51A 2DE2A 1MY0A 2B4LA 1M5CA 2QS2A 2I3WA 4LP2B 1USYE 4F1YA 3IB2A 1NUXA 4NF6A 4NG7A 4HE0A 2XXQA 5DVJA 3Q25A 4I40A 1OLAA 1BTJA 5I56B 1AH5A 3HSTA 4R6HA 2F7CA 2DS9A 3PU5A 3LC8A 4N8YA 4AB6A 3ISPA 3G7WA 3RLFE 4MNCA 1FQEA 3FATA 2HEUA 2CEXA 2DQVA 3IFAA 4N15A 4DIGA 4C0RA 3PUYE 5CMBA 1TT1A 3M3LA 2DYXA 1SW2A 1NFTA 4ELQA 4ZZEA 5L9OA 4P0IA 3O9PA 4X1DA 5JEIA 2DP8A 2PT1A 2HPGA 3KBZA 3JZJA 2PFZA 1MXWA 3MQ9A 2QS4A 2XD3A 4GL0A 5I2NB 2F97A 3RGYA 4KI0E 2FIEA 5LTCA 2ZMBA 3IO4A 4XTCQ 1N04A 5EYHA 1YYZA 3IK6B 3PMXA 3KSXA 4F19A 3E9XA 1JEVA 2DE3A 3LSWA 3T9VA 3KN3A 1B3LA 1J1NA 4M1VA 2O6AA 3T96B 5H8FB 3U65A 2FA7A 5DEXA 1IQ7A 3IB1A 1NI9A 4NTLA 4U21A 3FV1A 5F7VA 2WYPA 3H6WA 2I4BA 1B40A 3A3CA 1QGXA 5H8NB 2QPQA 3F11A 2JJKA 4HCWA 3RTWB 1B3HA 3B6QA 1NNFA 2I58A 5ICTA 3OEKA 1PDAA 3U72A 1N84A 4PF6A 3H3GA 3SDFA 2R9JA 3MVWA 3T9XB 5I57B 2VPNA 2I0CA 4XKNA 2RF1A 4F39A 1QKBA 5CBRA 1IXIA 2H98A 3EF7A 1IMAA 1UTHA 3BBRA 1N7XA 1CE2A 4ZEKA 1B46A 2Z8DA 4OHNA 1VR5A 3QXMA 3EN3A 3KFMA 2DVCA 3E4RA 1ANFA 4OVJA 4GWSA 4U23A 5FBPA 1FQFA 1SD3A 2DXRA 2Q74A 4MLVA 3IX1A 2X7PA 2OWZA 2AIXA 2QVVA 1FBHA 5AA4B 1UIVA 3E13X 5EQ8A 3K6XA 1FTKA 3PUVE 3OOAA 2P2AA 3FVGA 4KFQA 1JEUA 4NE4A 3K1NA 3PPNA 5ESYA 2P1SA 2WKYA 3TTKA 4PFTA 1BKAA 2GHAA 4GF8A 1LBYA 3FVNA 1INPA 2ABHA 2VD3A 4FEBA 5EQ7A 4YICA 3VLVA 4O7MA 2XWOA 3A3UA 3MPKA 5KDTA 3PD8A 4PFIA 4X9TA 4EUOA 1EYJA 4AQ4A 1NUWA 1H76A 4NAPA 2XXHA 3MSTA 1URDA 3VFJA 3JV9A 4LONB 1P99A 2RCBA 4OETA 3T9UA 4U2RA 2NWJA 2GH9A 4FATA 1FPLA 2W7YA 2OJTA 4P11A 1P1QA 1MDP1 2REJA 4YB6A 4ZECA 5ISUA 1MPBA 1ZMGA 1MH3A 4NWDA 4G2ZA 4NHBA 2DDKA 4M4GA 2D5WA 3IL1B 3QMFA 1MQJA 1IUDA 1XI6A 3FJ7A 1UTBB 4QSCA 2H25A 1JW5A 3H7MA 4THIA 1FPGA 4ZS9A 1NNPA 1DTGA 2Q89A 1LAGE 1O64A 4TQUQ 1B5IA 4XFEA 5A5XB 5AA1A 4LQ2A 1O63A 2V3QA 4PGNA 4PE5B 2UYFA 4OVRA 3MVZA 2VGQA 4MIJA 2V4CA 1MY4A 4PETA 1LAHE 3K00A 3QUJA 2RC7A 2V93A 3S9LC 1H3DA 4RNSA 1MRPA 4P56A 3TTLA 4GX4A 1FPFA 1NV6A 3GYYA 4KQPA 1OMPA 4QFKA 1JVYA 3HFUA 4NEDA 5IGAA 4GBWA 3OO6A 2LAOA 3ILTB 1WDNA 4O8MA 1I6AA 3IFCA 3K6VA 2HCAA 1LFHA 1UIUA 2DVZA 4NF5A 3FZVA 2XX7A 3HHFA 1FW0A 4OMBA 5DVFA 4GWZA 3N6UA 4ZEDA 4E0XA 1YAEA 4AS5A 3DM0A 3VE1B 4F1VA 2THIA 3K4UA 4PP0A 2PBWA 2KR0A 2HFBA 3EPEA 5BWJA 3RQTA 4OFOA 3D4GA 4MJOA 4YMAA 4ZE9A 4N6PA 2QRYA 2DXYA
chains in the Genus database with same CATH topology
1XVYA 5I59B 4OYVA 1FQDA 5I58B 4BDOA 4QSEA 3TEPA 2DWJA 4H5FA 2B3FA 4GFRA 3LSXA 4Q0CA 4X48A 4HCYA 3O97A 3K0VA 1QUKA 1EZPA 2OK2A 1XVXA 3OMBA 1MXYA 1B1HA 4IB2A 4QFLA 4IGTA 4OEUA 1DSNA 1FTJA 3HCQA 1FTOA 3CRBA 4KYSA 3WAEA 3KJ7A 1IXCA 1Y3PA 3PD9A 5JTYB 1JW1A 1MQIA 1MQHA 4N07A 2OWTA 1N0TA 4LA9A 3FV2A 3TKDA 4QFPA 1P1OA 1TXFA 4F3GA 4WKMA 4TLLB 3O28A 5FTHA 4Z0IA 3VVEA 4F3SA 5H8QA 2YJPA 1DTZA 3ZKLA 4G8NA 3PPPA 1MY3A 1S9TA 3CVGA 4O3BA 2ZNSA 1FQCA 3QYTA 1LB9A 4FECA 5H8HA 3RUMA 5LOMA 4IO2A 3S2VA 3OEMA 1ZIUA 3MP8A 4KYDA 4NF8A 1USYH 5BUUA 2PMSA 3ZS6A 2DWAA 1US4A 3N94A 4IO4A 3U93A 3VXBA 2OLBA 5J1DA 2XX9A 2R71A 4G68A 4RPNA 4H1XA 4OFLA 3EHTA 1A8EA 4R75A 3Q28A 1AL3A 3G3IA 3IJXB 3OO8A 3SKPA 5FHOA 3IR1A 1MY2A 4QRZA 5KCJB 3S9NC 1URGA 1IXHA 2GHBA 4IY6A 1LFGA 1Y4TA 4LZ8A 4G4PA 4GXAA 1ATGA 2X26A 4R74A 3K6UA 1EZ9A 5TP9B 2XXUA 5TPAA 1Z7ME 1ZTYA 1YTVA 4F3BA 5CMCA 5EHMA 2F6PA 3MJNA 1A8FA 4QF9A 4GD5A 4XKRA 2Q2CA 5DT6A 3W15C 2QS3A 3IOVA 5FTIA 4R2FA 4IGRA 1B58A 2V84A 1LLSA 4FEDA 1S50A 2Y7PA 2ZYNA 1OQHA 5DVIA 4YMBA 3T22A 4KD5A 1PB8A 5I2KA 3K02A 4HTGA 3T9HB 2YLNA 3THIA 5IAIA 4OFJA 3EHSA 3C33A 1N76A 2VP1A 5AA4A 4ISUA 3K1PA 3GBBA 4P0GA 1II5A 3OELA 1HSEA 3B7DA 5L9MA 1N3WA 1MM6A 1JW4A 3N5LA 3VVFA 3RPWA 1M5BA 4POXA 3VLUA 4GWOA 2O1MA 3KEIA 1MG1A 5M2VA 3VLWA 1Y3QA 2FNCA 5TU0A 1XHYA 4FIMA 2GFEA 4RK2A 5CM6A 1OQGA 2A5TB 4NF4A 4JWOA 3MZ1A 3C31A 1MQDA 4IO6A 4U22A 2D21A 1CB6A 5CC2A 4I9DA 1Y1MA 3W9WA 1GR2A 2F5XA 2RINA 1B0LA 1B0HA 2UVHA 1B4HA 2HQ0A 3LUYA 2Z8FA 4G8HA 1SQYA 4NF6B 5FHMA 2REGA 4DXUA 1S7YA 5AE4A 4H8JA 1GV8A 3QSLA 4XKPA 1ZKBA 2F78A 2O51A 1URSA 1QULA 3DLNA 3L6HA 1US5A 2NVUB 3VXCA 3PV0E 3TTMA 1PB9A 2P0SA 3IOWA 4WEPA 1Q35A 4LQ5A 4ZZAA 3UN6A 3TTRA 1MXUA 4R6KA 1LGBC 1B7UA 3U94A 3ECRA 3KN8A 1LFIA 4RYAA 2I49A 2Y7RA 3Q26A 3ONMA 3O6GA 3QIMA 1SW5A 3I5OA 4F18A 3FVOA 2GRVA 4IO3A 1TFDA 4WEDA 1FCKA 1WVJA 4ESXA 3K2DA 2F6GA 5H8SA 4QSDA 1SDXA 1Y20A 5L9SA 5DEXB 4EXKA 1B3FA 1FQBA 4ONYA 3RT6B 5AA3A 4I62A 3H06B 3SESA 1YCJA 4XKQA 4G68C 3KSJA 3UP9A 5B70A 4FORA 2IA4A 3MP6A 4BDMA 5AA2D 3C36A 3R6UA 1B3EA 4YB5A 1Y9UA 1B3GA 2HZKA 4BDNA 3HO7A 2VD2A 4RK9A 1A7LA 2OWSA 5I84A 4Q5TA 3TAJA 2ZNUA 5ITOA 3B6TA 3V5AA 3FJGA 1UTHB 3G3HA 1D9VA 3TPAA 3H6VA 1LCFA 4GOTA 2B65A 3DP6A 2VHAA 3FJMA 5AA2A 1SVXB 1R1NA 4Q8RA 2KLFA 1M5FA 1A54A 1VSOA 2H99A 1NKXA 1RYXA 3UK4A 4GLIA 3QAXA 1MQGA 1EZOA 3JYRA 1XOCA 2V3TA 3H4ZA 1NNKA 1TFAA 1TWYA 4RA1A 2QL3A 3R7XA 1XC1A 2O84X 3OO9A 3I3VA 4FJPA 5KDTB 3LBSA 5L8DA 4XXUA 3A09A 2UXAA 2DE4A 3IOUA 1LAFE 1UQWA 2G29A 3IOTA 4UA8A 4I8CA 4YKIA 3ZSFA 4OESA 1LSTA 4GVOA 4OQOA 3CFLA 3OSRA 4F1UA 3QK6A 4JSDA 2DWIA 4BDQA 4RXLA 4L17A 2A5SA 3ODBA 4YKJA 4KR5A 3FD3A 2YPNA 2O7UA 3E3KA 1B9JA 2F8DA 3OSQA 1B5JA 2F35A 3KZGA 3H6UA 5EHSA 1OIBA 2Q88A 2CZLA 4OENA 3DELB 3M3KA 2ONSA 1OVBA 4F22A 5F1QA 4MH5A 3TCHA 2IEEA 2RCAA 3G3KA 1VFDA 3U92A 4ELRA 4O3AA 3GLBA 1QUIA 1IXGA 1JQFA 2XXVA 1POTA 3H03A 3D4CA 1B32A 2XXXA 3R26A 3FVKA 5I56A 5CMKA 2F7BA 1LBBA 3U1OA 4DCYA 3TDJA 3TQWA 2XHDA 2HXWA 3TCGA 5FHNA 3MAMA 1N3XA 3N6TA 4ESWA 4GXSB 2ZNTA 3C35A 4NF5B 5CRYA 3LR1A 4POWA 4DCXA 3GZGA 3SEWA 1B52A 1MPDA 1L5TA 5I2NA 1AOVA 3IORA 1MM7A 1B2HA 2AYSA 3OXNA 3O6IA 3S9MC 2VOZA 1P1NA 3CSGA 1MH4A 1YPNA 5JK4A 4R72A 1PC3A 4ND9A 4JWXA 4G77A 3ILUB 1DPEA 4K3FA 1BIYA 1N7WA 3MVXA 3O2AA 3FASA 1PEBA 3CFXA 2QS1A 5H8FA 1ZJLA 2DSFA 1MXVA 2ONRA 5H8NA 2O1LA 2Y7KA 3SEUA 3UIFA 1M5EA 5HBCA 3RT8A 2OCUA 2PVUA 3S4UA 4Q30B 3FXUA 3SERA 2PT2A 4FE8A 2BJJX 4I1DA 2V25A 1JETA 1MY1A 2X7QA 1GTKA 4HS7A 5CMMA 3Q29A 4OXVA 3VDFA 2XD2A 3TZAA 1Y3NA 5I57A 3TYHA 1Z7NE 3H6TA 1LCTA 4JB7A 1ZBMA 1IIWA 1T0KA 3BKIB 3KGCA 3UORA 3IO6A 4R9GA 3HHGA 4OEVA 3AXFA 1JNFA 1AMFA 2H4IA 5H8QB 2OBGA 2AL4A 1MXXA 1FTLA 1SI1A 3PUXE 2E1SA 3MPLA 2XX8A 3G3JA 1IZ1A 2Q2AA 1Y4CA 1WODA 4RJZA 4JBZA 2RC8A 5DYHA 4FAJA 4U4XA 3KN7A 3MZBA 1SW4A 1F9BA 5DTBA 4GL8A 5H8HB 4EQBA 3PGFA 2PX1A 1QVSA 4XIGQ 3BFUA 1VFEA 2XXPA 4NF8B 1QW0A 1IEJA 4JDFA 5B7DA 3KBRA 1DOTA 1NL5A 3UGWA 4U1ZA 3MP1A 4JSOA 4IO5A 5ICQA 4G68B 1QKAA 3C9HA 4EQ9A 1A55A 3VVDA 1O7TA 5HM4B 4DLDA 1OVTA 2I3VA 2M8CA 3KOTA 1P1UA 4PFWA 3O29A 2O7IA 2Z8EA 4ZEBA 4R9FA 2Z23A 4H67A 4IO7A 2DWHA 2ONKE 3FXRA 1Q1KA 3MVYA 5TPAB 4ZDMA 4R6YA 2XXWA 1GVCA 4WXJA 4ELOA 4LVQA 4KYEA 3LSFB 4H0WA 1UTBA 3M3FA 4QHQA 3CIJA 3CG3A 2RC9A 4EF2A 4EQ7A 1XT8A 1P1WA 3G3GA 4ZE8A 3GXAA 4G8MA 5A5XA 4KCCA 2E0SA 3M8UA 3IB0A 1ZLQA 1OLCA 3V83A 4QFNA 5I2KB 3MUQA 1AIVA 3G3FA 2Y7WA 3O6HA 3QUFA 1B1XA 1H44A 4BLAA 4MF3A 3T93B 1HSLA 1B7HA 4GIZA 2NUVA 4KPTA 3CI8A 3PMVA 4BDRA 1LAXA 4U1OA 2I48A 4PFUA 3LSLA 4GRKA 3RTFB 2F36A 2CMOA 1QJMA 1RYOA 4EF1A 2NOOA 1DPPA 4OTEA 2XXRA 3C32A 3MZ9A 1NH7A 1RKMA 3FIRA 4HW8A 4DZ1A 2ZYOA 3FUZA 2OZZA 4NF4B 1SBPA 4MLQA 2H9BA 3WAFA 1PBPA 3CFZA 3TQLA 1NNTA 5IKBA 4DE8A 1NH8A 3TCFA 4TLMB 4U4SA 2ALUA 2UYEA 2F34A 3VV5A 4F3PA 2RKMA 5ELVA 2H5YA 3FGSA 3Q27A 5I59A 4F31B 5I58A 1I69A 4ECFA 4PFYA 4DXBA 2ESNA 2HAVA 1KWHA 3MBPA 4MFIA 1ELJA 4R73A 2D3IA 3PUZE 3OD7A 2Q8JA 4LZ5A 3S9EA 2UVJA 4H8IA 3KJTA 3I6VA 1BP5A 2O68A 4R2BA 2Y7IA 1D3KA 3HV1A 3SETA 2Y84A 3TELA 2UVGA 1B05A 3HN0A 2QMXA 3HPIA 3EHUA 2ZYKA 1BLFA 4ZEFA 3MW0A 4DDDA 4GQOA 5JTYA 4YB7A 1H45A 2PYYA 3K1MA 1PBQA 4NMYA 5K2YA 3P7IA 1GGGA 3TODA 2ZYMA 3CR9A 1JVXA 5CI5A 1I6BA 3RY3A 5EYFA 2I0BA 2HZLA 4EXLA 4YU0A 3IAZA 1SI0A 4Z7EA 2FYIA 1B5HA 3PPOA 1Y1ZA 3MWBA 1NMUA 1A40A 3PPRA 4PQJA 1SYHA 1D4NA 3CSBA 2B3BA 3DP4A 3W9VA 4EDPA 3O66A 2DOJA 1EU8A 4YKPA 4BDLA 4C1UA 1B6HA 1I6QA 3C34A 1M5DA 4UACA 2QMWA 2O69A 3PMWA 4JXIA 4MBPA 2G93A 2AL5A 4LUBA 1VE4A 4F29A 1DMBA 4F2QA 4IY5A 5K2XA 5KCJA 3RNNA 4H65A 4F2OA 2V3UA 3GBAA 1HSJA 4LZ7A 5AA2B 2XXTA 3TFLA 5ITPA 3PPQA 4ELPA 5TP9A 1MPCA 3V8XB 1XS5A 3TTNA 4ZEIA 3PUWE 1SW1A 3CG1A 1IITA 1EH3A 1MDQA 1LB8A 3L6GA 3SEVA 3U8QA 1FQAA 3IJOB 3OO7A 3T66A 1R9QA 3MC2A 4C1TA 1B7ZA 2XXIA 1POY1 4LATA 3K6WA 2UVIA 3UA8A 5HPQA 2QSXA 3SEYA 4X1BA 3EQ1A 4O3CA 4QFOA 1ZU0A 4E0WA 4KHZE 2I4CA 3KOSA 1B4ZA 4H5GA 2F7AA 4RPOA 4NWCA 3V89B 4DXCA 3KG2A 1MS7A 3TMGA 3FXQA 3SEXA 2QJEA 3K01A 2R6GE 4JWYA 2Q9TA 4YKKA 4TOZA 4YAHX 3TUSA 1FTMA 1H43A 1R6ZA 1A99A 4KCDA 1LBCA 3ZKKA 2HAUA 4N13A 2I6EA 1MXZA 2XXYA 3USDA 3C4MA 1SYIA 3OENA 1R9LA 2A5TA 2Z22A 4OERA 4YZZA 5KZTA 1PB7A 3BFTA 4OWDA 3N26A 4OZ9A 3B6WA 4RY1A 1D9YA 3DP8A 4H6DA 4AB5A 2NXOA 2ZXTA 5CBSA 3RN8A 2ANJA 1QUJA 1B51A 2DE2A 1MY0A 1M5CA 2QS2A 2I3WA 4LP2B 1USYE 4F1YA 3IB2A 4NF6A 2XXQA 5DVJA 3Q25A 1OLAA 1BTJA 5I56B 1AH5A 3HSTA 4R6HA 2F7CA 2DS9A 3PU5A 3LC8A 4AB6A 3G7WA 3RLFE 1FQEA 3FATA 2HEUA 2DQVA 4DIGA 4C0RA 3PUYE 5CMBA 1TT1A 3M3LA 2DYXA 1SW2A 1NFTA 4ELQA 4ZZEA 5L9OA 4P0IA 3O9PA 4X1DA 5JEIA 2DP8A 2PT1A 3JZJA 1MXWA 3MQ9A 2QS4A 2XD3A 4GL0A 5I2NB 2F97A 3RGYA 4KI0E 2ZMBA 3IO4A 4XTCQ 1N04A 3IK6B 3PMXA 3KSXA 4F19A 3E9XA 1JEVA 2DE3A 3LSWA 3T9VA 3KN3A 1B3LA 1J1NA 4M1VA 2O6AA 3T96B 5H8FB 2FA7A 5DEXA 1IQ7A 3IB1A 4NTLA 4U21A 3FV1A 5F7VA 3H6WA 2I4BA 1B40A 3A3CA 5H8NB 2QPQA 3F11A 4HCWA 3RTWB 1B3HA 3B6QA 1NNFA 2I58A 5ICTA 3OEKA 1PDAA 3U72A 1N84A 3H3GA 3SDFA 2R9JA 3MVWA 3T9XB 5I57B 2I0CA 4XKNA 2RF1A 4F39A 1QKBA 5CBRA 1IXIA 2H98A 3EF7A 1UTHA 3BBRA 1N7XA 1CE2A 4ZEKA 1B46A 2Z8DA 4OHNA 1VR5A 3QXMA 3EN3A 3KFMA 2DVCA 3E4RA 1ANFA 4OVJA 4U23A 1FQFA 1SD3A 2DXRA 4MLVA 3IX1A 2X7PA 2AIXA 5AA4B 1UIVA 3E13X 3K6XA 1FTKA 3PUVE 3OOAA 2P2AA 3FVGA 4KFQA 1JEUA 4NE4A 3K1NA 3PPNA 2P1SA 2WKYA 3TTKA 4PFTA 1BKAA 2GHAA 4GF8A 3FVNA 2ABHA 2VD3A 4FEBA 4YICA 3VLVA 3A3UA 3MPKA 5KDTA 3PD8A 4X9TA 4EUOA 4AQ4A 1H76A 2XXHA 1URDA 3VFJA 3JV9A 4LONB 1P99A 2RCBA 4OETA 3T9UA 4U2RA 2NWJA 2GH9A 4FATA 2W7YA 2OJTA 4P11A 1P1QA 1MDP1 2REJA 4YB6A 4ZECA 5ISUA 1MPBA 1ZMGA 1MH3A 4NWDA 4G2ZA 4M4GA 2D5WA 3IL1B 1MQJA 1IUDA 3FJ7A 1UTBB 4QSCA 2H25A 1JW5A 3H7MA 4THIA 4ZS9A 1NNPA 1DTGA 2Q89A 1LAGE 1O64A 4TQUQ 1B5IA 5A5XB 5AA1A 4LQ2A 1O63A 2V3QA 4PE5B 2UYFA 3MVZA 2VGQA 1MY4A 4PETA 1LAHE 3K00A 3QUJA 2RC7A 2V93A 3S9LC 1H3DA 4RNSA 1MRPA 3TTLA 4KQPA 1OMPA 4QFKA 1JVYA 4NEDA 3OO6A 2LAOA 3ILTB 1WDNA 1I6AA 3K6VA 2HCAA 1LFHA 1UIUA 2DVZA 4NF5A 3FZVA 2XX7A 3HHFA 1FW0A 4OMBA 5DVFA 3N6UA 4ZEDA 4E0XA 1YAEA 3DM0A 3VE1B 4F1VA 2THIA 3K4UA 4PP0A 2PBWA 2HFBA 3EPEA 5BWJA 3RQTA 4OFOA 3D4GA 4YMAA 4ZE9A 4N6PA 2QRYA 2DXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVY A;  5I59 B;  4OYV A;  1FQD A;  5I58 B;  4BDO A;  4QSE A;  3TEP A;  2DWJ A;  4H5F A;  2B3F A;  4GFR A;  3LSX A;  4Q0C A;  4X48 A;  4HCY A;  3O97 A;  3K0V A;  1QUK A;  1EZP A;  2OK2 A;  1XVX A;  3OMB A;  1MXY A;  1B1H A;  4IB2 A;  4QFL A;  4IGT A;  4OEU A;  1DSN A;  1FTJ A;  3HCQ A;  1FTO A;  3CRB A;  4KYS A;  3WAE A;  3KJ7 A;  1IXC A;  1Y3P A;  3PD9 A;  5JTY B;  1JW1 A;  1MQI A;  1MQH A;  4N07 A;  2OWT A;  1N0T A;  4LA9 A;  3FV2 A;  3TKD A;  4QFP A;  1P1O A;  1TXF A;  4F3G A;  4WKM A;  4TLL B;  3O28 A;  5FTH A;  4Z0I A;  3VVE A;  4F3S A;  5H8Q A;  2YJP A;  1DTZ A;  3ZKL A;  4G8N A;  3PPP A;  1MY3 A;  1S9T A;  3CVG A;  4O3B A;  2ZNS A;  1FQC A;  3QYT A;  1LB9 A;  4FEC A;  5H8H A;  3RUM A;  5LOM A;  4IO2 A;  3S2V A;  3OEM A;  1ZIU A;  3MP8 A;  4KYD A;  4NF8 A;  1USY H;  5BUU A;  2PMS A;  3ZS6 A;  2DWA A;  1US4 A;  3N94 A;  4IO4 A;  3U93 A;  3VXB A;  2OLB A;  5J1D A;  2XX9 A;  2R71 A;  4G68 A;  4RPN A;  4H1X A;  4OFL A;  3EHT A;  1A8E A;  4R75 A;  3Q28 A;  1AL3 A;  3G3I A;  3IJX B;  3OO8 A;  3SKP A;  5FHO A;  3IR1 A;  1MY2 A;  4QRZ A;  5KCJ B;  3S9N C;  1URG A;  1IXH A;  2GHB A;  4IY6 A;  1LFG A;  1Y4T A;  4LZ8 A;  4G4P A;  4GXA A;  1ATG A;  2X26 A;  4R74 A;  3K6U A;  1EZ9 A;  5TP9 B;  2XXU A;  5TPA A;  1Z7M E;  1ZTY A;  1YTV A;  4F3B A;  5CMC A;  5EHM A;  2F6P A;  3MJN A;  1A8F A;  4QF9 A;  4GD5 A;  4XKR A;  2Q2C A;  5DT6 A;  3W15 C;  2QS3 A;  3IOV A;  5FTI A;  4R2F A;  4IGR A;  1B58 A;  2V84 A;  1LLS A;  4FED A;  1S50 A;  2Y7P A;  2ZYN A;  1OQH A;  5DVI A;  4YMB A;  3T22 A;  4KD5 A;  1PB8 A;  5I2K A;  3K02 A;  4HTG A;  3T9H B;  2YLN A;  3THI A;  5IAI A;  4OFJ A;  3EHS A;  3C33 A;  1N76 A;  2VP1 A;  5AA4 A;  4ISU A;  3K1P A;  3GBB A;  4P0G A;  1II5 A;  3OEL A;  1HSE A;  3B7D A;  5L9M A;  1N3W A;  1MM6 A;  1JW4 A;  3N5L A;  3VVF A;  3RPW A;  1M5B A;  4POX A;  3VLU A;  4GWO A;  2O1M A;  3KEI A;  1MG1 A;  5M2V A;  3VLW A;  1Y3Q A;  2FNC A;  5TU0 A;  1XHY A;  4FIM A;  2GFE A;  4RK2 A;  5CM6 A;  1OQG A;  2A5T B;  4NF4 A;  4JWO A;  3MZ1 A;  3C31 A;  1MQD A;  4IO6 A;  4U22 A;  2D21 A;  1CB6 A;  5CC2 A;  4I9D A;  1Y1M A;  3W9W A;  1GR2 A;  2F5X A;  2RIN A;  1B0L A;  1B0H A;  2UVH A;  1B4H A;  2HQ0 A;  3LUY A;  2Z8F A;  4G8H A;  1SQY A;  4NF6 B;  5FHM A;  2REG A;  4DXU A;  1S7Y A;  5AE4 A;  4H8J A;  1GV8 A;  3QSL A;  4XKP A;  1ZKB A;  2F78 A;  2O51 A;  1URS A;  1QUL A;  3DLN A;  3L6H A;  1US5 A;  2NVU B;  3VXC A;  3PV0 E;  3TTM A;  1PB9 A;  2P0S A;  3IOW A;  4WEP A;  1Q35 A;  4LQ5 A;  4ZZA A;  3UN6 A;  3TTR A;  1MXU A;  4R6K A;  1LGB C;  1B7U A;  3U94 A;  3ECR A;  3KN8 A;  1LFI A;  4RYA A;  2I49 A;  2Y7R A;  3Q26 A;  3ONM A;  3O6G A;  3QIM A;  1SW5 A;  3I5O A;  4F18 A;  3FVO A;  2GRV A;  4IO3 A;  1TFD A;  4WED A;  1FCK A;  1WVJ A;  4ESX A;  3K2D A;  2F6G A;  5H8S A;  4QSD A;  1SDX A;  1Y20 A;  5L9S A;  5DEX B;  4EXK A;  1B3F A;  1FQB A;  4ONY A;  3RT6 B;  5AA3 A;  4I62 A;  3H06 B;  3SES A;  1YCJ A;  4XKQ A;  4G68 C;  3KSJ A;  3UP9 A;  5B70 A;  4FOR A;  2IA4 A;  3MP6 A;  4BDM A;  5AA2 D;  3C36 A;  3R6U A;  1B3E A;  4YB5 A;  1Y9U A;  1B3G A;  2HZK A;  4BDN A;  3HO7 A;  2VD2 A;  4RK9 A;  1A7L A;  2OWS A;  5I84 A;  4Q5T A;  3TAJ A;  2ZNU A;  5ITO A;  3B6T A;  3V5A A;  3FJG A;  1UTH B;  3G3H A;  1D9V A;  3TPA A;  3H6V A;  1LCF A;  4GOT A;  2B65 A;  3DP6 A;  2VHA A;  3FJM A;  5AA2 A;  1SVX B;  1R1N A;  4Q8R A;  2KLF A;  1M5F A;  1A54 A;  1VSO A;  2H99 A;  1NKX A;  1RYX A;  3UK4 A;  4GLI A;  3QAX A;  1MQG A;  1EZO A;  3JYR A;  1XOC A;  2V3T A;  3H4Z A;  1NNK A;  1TFA A;  1TWY A;  4RA1 A;  2QL3 A;  3R7X A;  1XC1 A;  2O84 X;  3OO9 A;  3I3V A;  4FJP A;  5KDT B;  3LBS A;  5L8D A;  4XXU A;  3A09 A;  2UXA A;  2DE4 A;  3IOU A;  1LAF E;  1UQW A;  2G29 A;  3IOT A;  4UA8 A;  4I8C A;  4YKI A;  3ZSF A;  4OES A;  1LST A;  4GVO A;  4OQO A;  3CFL A;  3OSR A;  4F1U A;  3QK6 A;  4JSD A;  2DWI A;  4BDQ A;  4RXL A;  4L17 A;  2A5S A;  3ODB A;  4YKJ A;  4KR5 A;  3FD3 A;  2YPN A;  2O7U A;  3E3K A;  1B9J A;  2F8D A;  3OSQ A;  1B5J A;  2F35 A;  3KZG A;  3H6U A;  5EHS A;  1OIB A;  2Q88 A;  2CZL A;  4OEN A;  3DEL B;  3M3K A;  2ONS A;  1OVB A;  4F22 A;  5F1Q A;  4MH5 A;  3TCH A;  2IEE A;  2RCA A;  3G3K A;  1VFD A;  3U92 A;  4ELR A;  4O3A A;  3GLB A;  1QUI A;  1IXG A;  1JQF A;  2XXV A;  1POT A;  3H03 A;  3D4C A;  1B32 A;  2XXX A;  3R26 A;  3FVK A;  5I56 A;  5CMK A;  2F7B A;  1LBB A;  3U1O A;  4DCY A;  3TDJ A;  3TQW A;  2XHD A;  2HXW A;  3TCG A;  5FHN A;  3MAM A;  1N3X A;  3N6T A;  4ESW A;  4GXS B;  2ZNT A;  3C35 A;  4NF5 B;  5CRY A;  3LR1 A;  4POW A;  4DCX A;  3GZG A;  3SEW A;  1B52 A;  1MPD A;  1L5T A;  5I2N A;  1AOV A;  3IOR A;  1MM7 A;  1B2H A;  2AYS A;  3OXN A;  3O6I A;  3S9M C;  2VOZ A;  1P1N A;  3CSG A;  1MH4 A;  1YPN A;  5JK4 A;  4R72 A;  1PC3 A;  4ND9 A;  4JWX A;  4G77 A;  3ILU B;  1DPE A;  4K3F A;  1BIY A;  1N7W A;  3MVX A;  3O2A A;  3FAS A;  1PEB A;  3CFX A;  2QS1 A;  5H8F A;  1ZJL A;  2DSF A;  1MXV A;  2ONR A;  5H8N A;  2O1L A;  2Y7K A;  3SEU A;  3UIF A;  1M5E A;  5HBC A;  3RT8 A;  2OCU A;  2PVU A;  3S4U A;  4Q30 B;  3FXU A;  3SER A;  2PT2 A;  4FE8 A;  2BJJ X;  4I1D A;  2V25 A;  1JET A;  1MY1 A;  2X7Q A;  1GTK A;  4HS7 A;  5CMM A;  3Q29 A;  4OXV A;  3VDF A;  2XD2 A;  3TZA A;  1Y3N A;  5I57 A;  3TYH A;  1Z7N E;  3H6T A;  1LCT A;  4JB7 A;  1ZBM A;  1IIW A;  1T0K A;  3BKI B;  3KGC A;  3UOR A;  3IO6 A;  4R9G A;  3HHG A;  4OEV A;  3AXF A;  1JNF A;  1AMF A;  2H4I A;  5H8Q B;  2OBG A;  2AL4 A;  1MXX A;  1FTL A;  1SI1 A;  3PUX E;  2E1S A;  3MPL A;  2XX8 A;  3G3J A;  1IZ1 A;  2Q2A A;  1Y4C A;  1WOD A;  4RJZ A;  4JBZ A;  2RC8 A;  5DYH A;  4FAJ A;  4U4X A;  3KN7 A;  3MZB A;  1SW4 A;  1F9B A;  5DTB A;  4GL8 A;  5H8H B;  4EQB A;  3PGF A;  2PX1 A;  1QVS A;  4XIG Q;  3BFU A;  1VFE A;  2XXP A;  4NF8 B;  1QW0 A;  1IEJ A;  4JDF A;  5B7D A;  3KBR A;  1DOT A;  1NL5 A;  3UGW A;  4U1Z A;  3MP1 A;  4JSO A;  4IO5 A;  5ICQ A;  4G68 B;  1QKA A;  3C9H A;  4EQ9 A;  1A55 A;  3VVD A;  1O7T A;  5HM4 B;  4DLD A;  1OVT A;  2I3V A;  2M8C A;  3KOT A;  1P1U A;  4PFW A;  3O29 A;  2O7I A;  2Z8E A;  4ZEB A;  4R9F A;  2Z23 A;  4H67 A;  4IO7 A;  2DWH A;  2ONK E;  3FXR A;  1Q1K A;  3MVY A;  5TPA B;  4ZDM A;  4R6Y A;  2XXW A;  1GVC A;  4WXJ A;  4ELO A;  4LVQ A;  4KYE A;  3LSF B;  4H0W A;  1UTB A;  3M3F A;  4QHQ A;  3CIJ A;  3CG3 A;  2RC9 A;  4EF2 A;  4EQ7 A;  1XT8 A;  1P1W A;  3G3G A;  4ZE8 A;  3GXA A;  4G8M A;  5A5X A;  4KCC A;  2E0S A;  3M8U A;  3IB0 A;  1ZLQ A;  1OLC A;  3V83 A;  4QFN A;  5I2K B;  3MUQ A;  1AIV A;  3G3F A;  2Y7W A;  3O6H A;  3QUF A;  1B1X A;  1H44 A;  4BLA A;  4MF3 A;  3T93 B;  1HSL A;  1B7H A;  4GIZ A;  2NUV A;  4KPT A;  3CI8 A;  3PMV A;  4BDR A;  1LAX A;  4U1O A;  2I48 A;  4PFU A;  3LSL A;  4GRK A;  3RTF B;  2F36 A;  2CMO A;  1QJM A;  1RYO A;  4EF1 A;  2NOO A;  1DPP A;  4OTE A;  2XXR A;  3C32 A;  3MZ9 A;  1NH7 A;  1RKM A;  3FIR A;  4HW8 A;  4DZ1 A;  2ZYO A;  3FUZ A;  2OZZ A;  4NF4 B;  1SBP A;  4MLQ A;  2H9B A;  3WAF A;  1PBP A;  3CFZ A;  3TQL A;  1NNT A;  5IKB A;  4DE8 A;  1NH8 A;  3TCF A;  4TLM B;  4U4S A;  2ALU A;  2UYE A;  2F34 A;  3VV5 A;  4F3P A;  2RKM A;  5ELV A;  2H5Y A;  3FGS A;  3Q27 A;  5I59 A;  4F31 B;  5I58 A;  1I69 A;  4ECF A;  4PFY A;  4DXB A;  2ESN A;  2HAV A;  1KWH A;  3MBP A;  4MFI A;  1ELJ A;  4R73 A;  2D3I A;  3PUZ E;  3OD7 A;  2Q8J A;  4LZ5 A;  3S9E A;  2UVJ A;  4H8I A;  3KJT A;  3I6V A;  1BP5 A;  2O68 A;  4R2B A;  2Y7I A;  1D3K A;  3HV1 A;  3SET A;  2Y84 A;  3TEL A;  2UVG A;  1B05 A;  3HN0 A;  2QMX A;  3HPI A;  3EHU A;  2ZYK A;  1BLF A;  4ZEF A;  3MW0 A;  4DDD A;  4GQO A;  5JTY A;  4YB7 A;  1H45 A;  2PYY A;  3K1M A;  1PBQ A;  4NMY A;  5K2Y A;  3P7I A;  1GGG A;  3TOD A;  2ZYM A;  3CR9 A;  1JVX A;  5CI5 A;  1I6B A;  3RY3 A;  5EYF A;  2I0B A;  2HZL A;  4EXL A;  4YU0 A;  3IAZ A;  1SI0 A;  4Z7E A;  2FYI A;  1B5H A;  3PPO A;  1Y1Z A;  3MWB A;  1NMU A;  1A40 A;  3PPR A;  4PQJ A;  1SYH A;  1D4N A;  3CSB A;  2B3B A;  3DP4 A;  3W9V A;  4EDP A;  3O66 A;  2DOJ A;  1EU8 A;  4YKP A;  4BDL A;  4C1U A;  1B6H A;  1I6Q A;  3C34 A;  1M5D A;  4UAC A;  2QMW A;  2O69 A;  3PMW A;  4JXI A;  4MBP A;  2G93 A;  2AL5 A;  4LUB A;  1VE4 A;  4F29 A;  1DMB A;  4F2Q A;  4IY5 A;  5K2X A;  5KCJ A;  3RNN A;  4H65 A;  4F2O A;  2V3U A;  3GBA A;  1HSJ A;  4LZ7 A;  5AA2 B;  2XXT A;  3TFL A;  5ITP A;  3PPQ A;  4ELP A;  5TP9 A;  1MPC A;  3V8X B;  1XS5 A;  3TTN A;  4ZEI A;  3PUW E;  1SW1 A;  3CG1 A;  1IIT A;  1EH3 A;  1MDQ A;  1LB8 A;  3L6G A;  3SEV A;  3U8Q A;  1FQA A;  3IJO B;  3OO7 A;  3T66 A;  1R9Q A;  3MC2 A;  4C1T A;  1B7Z A;  2XXI A;  1POY 1;  4LAT A;  3K6W A;  2UVI A;  3UA8 A;  5HPQ A;  2QSX A;  3SEY A;  4X1B A;  3EQ1 A;  4O3C A;  4QFO A;  1ZU0 A;  4E0W A;  4KHZ E;  2I4C A;  3KOS A;  1B4Z A;  4H5G A;  2F7A A;  4RPO A;  4NWC A;  3V89 B;  4DXC A;  3KG2 A;  1MS7 A;  3TMG A;  3FXQ A;  3SEX A;  2QJE A;  3K01 A;  2R6G E;  4JWY A;  2Q9T A;  4YKK A;  4TOZ A;  4YAH X;  3TUS A;  1FTM A;  1H43 A;  1R6Z A;  1A99 A;  4KCD A;  1LBC A;  3ZKK A;  2HAU A;  4N13 A;  2I6E A;  1MXZ A;  2XXY A;  3USD A;  3C4M A;  1SYI A;  3OEN A;  1R9L A;  2A5T A;  2Z22 A;  4OER A;  4YZZ A;  5KZT A;  1PB7 A;  3BFT A;  4OWD A;  3N26 A;  4OZ9 A;  3B6W A;  4RY1 A;  1D9Y A;  3DP8 A;  4H6D A;  4AB5 A;  2NXO A;  2ZXT A;  5CBS A;  3RN8 A;  2ANJ A;  1QUJ A;  1B51 A;  2DE2 A;  1MY0 A;  1M5C A;  2QS2 A;  2I3W A;  4LP2 B;  1USY E;  4F1Y A;  3IB2 A;  4NF6 A;  2XXQ A;  5DVJ A;  3Q25 A;  1OLA A;  1BTJ A;  5I56 B;  1AH5 A;  3HST A;  4R6H A;  2F7C A;  2DS9 A;  3PU5 A;  3LC8 A;  4AB6 A;  3G7W A;  3RLF E;  1FQE A;  3FAT A;  2HEU A;  2DQV A;  4DIG A;  4C0R A;  3PUY E;  5CMB A;  1TT1 A;  3M3L A;  2DYX A;  1SW2 A;  1NFT A;  4ELQ A;  4ZZE A;  5L9O A;  4P0I A;  3O9P A;  4X1D A;  5JEI A;  2DP8 A;  2PT1 A;  3JZJ A;  1MXW A;  3MQ9 A;  2QS4 A;  2XD3 A;  4GL0 A;  5I2N B;  2F97 A;  3RGY A;  4KI0 E;  2ZMB A;  3IO4 A;  4XTC Q;  1N04 A;  3IK6 B;  3PMX A;  3KSX A;  4F19 A;  3E9X A;  1JEV A;  2DE3 A;  3LSW A;  3T9V A;  3KN3 A;  1B3L A;  1J1N A;  4M1V A;  2O6A A;  3T96 B;  5H8F B;  2FA7 A;  5DEX A;  1IQ7 A;  3IB1 A;  4NTL A;  4U21 A;  3FV1 A;  5F7V A;  3H6W A;  2I4B A;  1B40 A;  3A3C A;  5H8N B;  2QPQ A;  3F11 A;  4HCW A;  3RTW B;  1B3H A;  3B6Q A;  1NNF A;  2I58 A;  5ICT A;  3OEK A;  1PDA A;  3U72 A;  1N84 A;  3H3G A;  3SDF A;  2R9J A;  3MVW A;  3T9X B;  5I57 B;  2I0C A;  4XKN A;  2RF1 A;  4F39 A;  1QKB A;  5CBR A;  1IXI A;  2H98 A;  3EF7 A;  1UTH A;  3BBR A;  1N7X A;  1CE2 A;  4ZEK A;  1B46 A;  2Z8D A;  4OHN A;  1VR5 A;  3QXM A;  3EN3 A;  3KFM A;  2DVC A;  3E4R A;  1ANF A;  4OVJ A;  4U23 A;  1FQF A;  1SD3 A;  2DXR A;  4MLV A;  3IX1 A;  2X7P A;  2AIX A;  5AA4 B;  1UIV A;  3E13 X;  3K6X A;  1FTK A;  3PUV E;  3OOA A;  2P2A A;  3FVG A;  4KFQ A;  1JEU A;  4NE4 A;  3K1N A;  3PPN A;  2P1S A;  2WKY A;  3TTK A;  4PFT A;  1BKA A;  2GHA A;  4GF8 A;  3FVN A;  2ABH A;  2VD3 A;  4FEB A;  4YIC A;  3VLV A;  3A3U A;  3MPK A;  5KDT A;  3PD8 A;  4X9T A;  4EUO A;  4AQ4 A;  1H76 A;  2XXH A;  1URD A;  3VFJ A;  3JV9 A;  4LON B;  1P99 A;  2RCB A;  4OET A;  3T9U A;  4U2R A;  2NWJ A;  2GH9 A;  4FAT A;  2W7Y A;  2OJT A;  4P11 A;  1P1Q A;  1MDP 1;  2REJ A;  4YB6 A;  4ZEC A;  5ISU A;  1MPB A;  1ZMG A;  1MH3 A;  4NWD A;  4G2Z A;  4M4G A;  2D5W A;  3IL1 B;  1MQJ A;  1IUD A;  3FJ7 A;  1UTB B;  4QSC A;  2H25 A;  1JW5 A;  3H7M A;  4THI A;  4ZS9 A;  1NNP A;  1DTG A;  2Q89 A;  1LAG E;  1O64 A;  4TQU Q;  1B5I A;  5A5X B;  5AA1 A;  4LQ2 A;  1O63 A;  2V3Q A;  4PE5 B;  2UYF A;  3MVZ A;  2VGQ A;  1MY4 A;  4PET A;  1LAH E;  3K00 A;  3QUJ A;  2RC7 A;  2V93 A;  3S9L C;  1H3D A;  4RNS A;  1MRP A;  3TTL A;  4KQP A;  1OMP A;  4QFK A;  1JVY A;  4NED A;  3OO6 A;  2LAO A;  3ILT B;  1WDN A;  1I6A A;  3K6V A;  2HCA A;  1LFH A;  1UIU A;  2DVZ A;  4NF5 A;  3FZV A;  2XX7 A;  3HHF A;  1FW0 A;  4OMB A;  5DVF A;  3N6U A;  4ZED A;  4E0X A;  1YAE A;  3DM0 A;  3VE1 B;  4F1V A;  2THI A;  3K4U A;  4PP0 A;  2PBW A;  2HFB A;  3EPE A;  5BWJ A;  3RQT A;  4OFO A;  3D4G A;  4YMA A;  4ZE9 A;  4N6P A;  2QRY A;  2DXY A; 
#chains in the Genus database with same CATH topology
 4QBA A;  1XVY A;  1LBZ A;  5I59 B;  4OYV A;  4GX6 A;  1FQD A;  5I58 B;  4BDO A;  4QSE A;  3TEP A;  2DWJ A;  4H5F A;  2B3F A;  4GFR A;  3LSX A;  4Q0C A;  4X48 A;  4HCY A;  3O97 A;  3K0V A;  1QUK A;  1EZP A;  2OK2 A;  1XVX A;  3OMB A;  1MXY A;  1B1H A;  4XEQ A;  4IB2 A;  4QFL A;  4IGT A;  4OEU A;  1DSN A;  1FTJ A;  3HCQ A;  1FTO A;  3CRB A;  4KYS A;  3WAE A;  3KJ7 A;  2CZK A;  1IXC A;  1Y3P A;  3PD9 A;  5JTY B;  1LBV A;  1JW1 A;  2PFY A;  1MQI A;  1MQH A;  1VDW A;  4N07 A;  2ZZV A;  2OWT A;  1N0T A;  4LA9 A;  3FV2 A;  3TKD A;  4QFP A;  1P1O A;  3E78 A;  1TXF A;  1RDZ A;  4F3G A;  4WKM A;  4TLL B;  3O28 A;  5FTH A;  4Z0I A;  3VVE A;  4F3S A;  5H8Q A;  2YJP A;  1DTZ A;  1NUY A;  3A29 A;  4GX3 A;  3ZKL A;  2XWV A;  4G8N A;  3PPP A;  1MY3 A;  2F3B A;  1S9T A;  3CVG A;  5I5P A;  1RDY A;  4O3B A;  2ZNS A;  1FQC A;  3QYT A;  1LB9 A;  4FEC A;  2FHY A;  5H8H A;  3RUM A;  5LOM A;  4IO2 A;  3S2V A;  3OEM A;  1ZIU A;  4PAK A;  3MP8 A;  4KYD A;  4NF8 A;  1USY H;  5BUU A;  2PMS A;  4N81 A;  3ZS6 A;  2DWA A;  1US4 A;  3N94 A;  4IO4 A;  3U93 A;  3VXB A;  1FTA A;  2OLB A;  5J1D A;  2XX9 A;  2R71 A;  1EYI A;  4G68 A;  4RPN A;  4H1X A;  4OFL A;  3EHT A;  1A8E A;  4R75 A;  1CNQ A;  2GQ1 A;  5EQA A;  3Q28 A;  4X04 A;  1AL3 A;  3G3I A;  3IJX B;  3OO8 A;  3SKP A;  5FHO A;  3IR1 A;  1MY2 A;  4QRZ A;  2ZZX A;  4OVP A;  5KCJ B;  3S9N C;  1URG A;  1IXH A;  2GHB A;  4IY6 A;  1LFG A;  1Y4T A;  4LZ8 A;  4G4P A;  4GXA A;  1ATG A;  2X26 A;  4R74 A;  3K6U A;  1EZ9 A;  4P1L A;  5TP9 B;  2XXU A;  5TPA A;  1Z7M E;  2L5V A;  1ZTY A;  1YTV A;  4F3B A;  5CMC A;  5EHM A;  5IZ3 A;  2F6P A;  3MJN A;  1A8F A;  4QF9 A;  4GD5 A;  1FBG A;  3EKI A;  4XKR A;  4PF8 A;  2Q2C A;  5DT6 A;  2CZH A;  3W15 C;  2QS3 A;  3IOV A;  5FTI A;  4R2F A;  4IGR A;  1B58 A;  2V84 A;  1LLS A;  4FED A;  1RDX A;  1S50 A;  2Y7P A;  2ZYN A;  4NGU A;  2WBB A;  1OQH A;  1NV7 A;  5DVI A;  4YMB A;  2QVU A;  3T22 A;  4JVD A;  4KD5 A;  1PB8 A;  5I2K A;  3K02 A;  3B50 A;  4HTG A;  3T9H B;  2YLN A;  3BIH A;  3THI A;  5IAI A;  4OFJ A;  3EHS A;  3C33 A;  1N76 A;  2VP1 A;  5AA4 A;  1IMC A;  4NQ8 A;  4ISU A;  3K1P A;  3GBB A;  4P0G A;  1II5 A;  3OEL A;  1HSE A;  3B7D A;  4MHF A;  4PDH A;  5L9M A;  1N3W A;  1MM6 A;  1JW4 A;  2QFL A;  3N5L A;  3VVF A;  4PC9 A;  3RPW A;  1M5B A;  4POX A;  4GWU A;  3VLU A;  4GWO A;  2O1M A;  3KEI A;  1MG1 A;  5M2V A;  3VLW A;  1Y3Q A;  2FNC A;  5TU0 A;  1XHY A;  4FIM A;  2GFE A;  4RK2 A;  5CM6 A;  1OQG A;  2A5T B;  4NF4 A;  4JWO A;  4JVI A;  3MZ1 A;  3C31 A;  1MQD A;  4IO6 A;  4U22 A;  1LEV A;  3PTY A;  2D21 A;  1CB6 A;  1FSA A;  5CC2 A;  2XWI A;  4I9D A;  1Y1M A;  3W9W A;  1IMB A;  1GR2 A;  2F5X A;  2RIN A;  1B0L A;  1B0H A;  2UVH A;  1B4H A;  2VPO A;  2HQ0 A;  3LUY A;  2Z8F A;  4G8H A;  1SQY A;  4NF6 B;  5FHM A;  2REG A;  4DXU A;  1S7Y A;  5AE4 A;  4H8J A;  1GV8 A;  3QSL A;  4XKP A;  1ZKB A;  4HE2 A;  2F78 A;  2O51 A;  1FPK A;  5T3J A;  1URS A;  1QUL A;  3DLN A;  4N91 A;  3L6H A;  4O94 A;  5IZ1 A;  1US5 A;  2NVU B;  3VXC A;  3PV0 E;  3TTM A;  1PB9 A;  2P0S A;  3IOW A;  4WEP A;  1Q35 A;  4LQ5 A;  4ZZA A;  3UN6 A;  3TTR A;  5I3S A;  1MXU A;  4PAI A;  2QVR A;  2PCR A;  4R6K A;  1LGB C;  1B7U A;  3U94 A;  3ECR A;  3KN8 A;  1LFI A;  4RYA A;  2I49 A;  2Y7R A;  3Q26 A;  3ONM A;  3O6G A;  3CHG A;  3QIM A;  1SW5 A;  3I5O A;  4F18 A;  3FVO A;  2GRV A;  4IO3 A;  1TFD A;  4WED A;  1FCK A;  1WVJ A;  4ESX A;  3K2D A;  2F6G A;  5H8S A;  4QSD A;  1SDX A;  1Y20 A;  5L9S A;  5DEX B;  4EXK A;  1B3F A;  1FQB A;  4ONY A;  3RT6 B;  5AA3 A;  4I62 A;  3H06 B;  3SES A;  1YCJ A;  4XKQ A;  4G68 C;  3KSJ A;  3UP9 A;  5B70 A;  4FOR A;  2IA4 A;  3MP6 A;  4BDM A;  5AA2 D;  3C36 A;  3R6U A;  1B3E A;  4YB5 A;  1Y9U A;  1B3G A;  2HZK A;  2KQZ A;  4BDN A;  3HO7 A;  2VD2 A;  4RK9 A;  1A7L A;  2OWS A;  4PGP A;  2CEY A;  2P3N A;  5I84 A;  3RPL A;  4Q5T A;  3TAJ A;  2ZNU A;  5ITO A;  3B6T A;  3V5A A;  3FJG A;  5EYG A;  4AS4 A;  1UTH B;  3G3H A;  1D9V A;  3TPA A;  3H6V A;  5IZZ A;  2P3V A;  1IMF A;  1LCF A;  4GOT A;  2B65 A;  3DP6 A;  2VHA A;  3FJM A;  5AA2 A;  4KXP A;  1SVX B;  1R1N A;  4OVS A;  4Q8R A;  2KLF A;  1M5F A;  4OA4 A;  1A54 A;  1NV0 A;  1VSO A;  2H99 A;  1NKX A;  1RYX A;  4DI3 D;  3UK4 A;  4GLI A;  3QAX A;  1MQG A;  1EZO A;  3JYR A;  1XOC A;  2V3T A;  4DI4 B;  3H4Z A;  1NNK A;  1TFA A;  1TWY A;  4RA1 A;  2QL3 A;  3R7X A;  4OAN A;  1XC1 A;  2O84 X;  3OO9 A;  1NV3 A;  3I3V A;  4FJP A;  5KDT B;  1K9Z A;  3LBS A;  5L8D A;  5ET8 A;  4XXU A;  3A09 A;  2UXA A;  2DE4 A;  3IOU A;  1LAF E;  4MAG A;  1UQW A;  2XWK A;  2G29 A;  3IOT A;  4UA8 A;  4I8C A;  4YKI A;  3ZSF A;  4OES A;  1LST A;  4GVO A;  4GWX A;  4OQO A;  3CFL A;  3OSR A;  4F1U A;  3QK6 A;  1FJ6 A;  4JSD A;  2DWI A;  4BDQ A;  4RXL A;  4L17 A;  2A5S A;  4IR8 A;  3ODB A;  4YKJ A;  4KR5 A;  3FD3 A;  2YPN A;  2O7U A;  3E3K A;  1B9J A;  2F8D A;  4NX1 A;  3OSQ A;  1B5J A;  2F35 A;  3KZG A;  4N8G A;  3H6U A;  5EHS A;  1OIB A;  2Q88 A;  1AWB A;  2CZL A;  3T1B A;  1KA0 A;  4OEN A;  4MNP A;  3DEL B;  4PAF A;  3M3K A;  2ONS A;  1OVB A;  3FBP A;  4F22 A;  4OVT A;  5F1Q A;  4MH5 A;  3TCH A;  2IEE A;  2RCA A;  3G3K A;  1VFD A;  3U92 A;  4ELR A;  4O3A A;  3GLB A;  1QUI A;  1FPI A;  1IXG A;  1JQF A;  2Q8M A;  2XXV A;  1POT A;  3H03 A;  3D4C A;  4H45 A;  1B32 A;  2XXX A;  3R26 A;  3FVK A;  4PE3 A;  5I56 A;  5CMK A;  2F7B A;  2FBP A;  1LBB A;  3U1O A;  4DCY A;  4MEV A;  3TDJ A;  3TQW A;  2XHD A;  2Y5K A;  2HXW A;  3TCG A;  5FHN A;  3MAM A;  1N3X A;  4P47 A;  5DW8 A;  3N6T A;  4ESW A;  4GXS B;  1FBD A;  2ZNT A;  3C35 A;  4NF5 B;  1IME A;  5CRY A;  3LR1 A;  4POW A;  4DCX A;  4I3E A;  3GZG A;  1NV5 A;  4N6D A;  3SEW A;  1B52 A;  1MPD A;  1L5T A;  5I2N A;  1AOV A;  3IOR A;  1MM7 A;  1B2H A;  2AYS A;  3OXN A;  3O6I A;  2B4M A;  4PDD A;  3S9M C;  2VOZ A;  1P1N A;  3CSG A;  1MH4 A;  2WX9 A;  1YPN A;  5JK4 A;  4R72 A;  1PC3 A;  3KC1 A;  4PFR A;  4OVQ A;  4ND9 A;  4JWX A;  4G77 A;  3ILU B;  1DPE A;  4K3F A;  1BIY A;  1N7W A;  3MVX A;  3O2A A;  3FAS A;  1PEB A;  3CFX A;  4H46 A;  2QS1 A;  4PTK A;  5H8F A;  1ZJL A;  2Y5L A;  2DSF A;  1MXV A;  3E79 A;  2ONR A;  5H8N A;  2O1L A;  2Y7K A;  3SEU A;  3UIF A;  1M5E A;  5HBC A;  3RT8 A;  2OCU A;  2PVU A;  3S4U A;  4PFB A;  3FXU A;  4Q30 B;  3SER A;  2PT2 A;  4FE8 A;  2BJJ X;  4I1D A;  2V25 A;  1JET A;  1MY1 A;  2WYK A;  2X7Q A;  1GTK A;  4HS7 A;  5CMM A;  3Q29 A;  4OXV A;  3VDF A;  2XD2 A;  3TZA A;  1Y3N A;  5I57 A;  3TYH A;  1Z7N E;  3H6T A;  1FPE A;  1LCT A;  4JB7 A;  1ZBM A;  1FPB A;  1IIW A;  1T0K A;  3BKI B;  3KGC A;  3UOR A;  3IO6 A;  4R9G A;  1FPJ A;  3HHG A;  4OEV A;  1FRP A;  1DCU A;  3AXF A;  4P1E A;  4P3L A;  1JNF A;  1AMF A;  2H4I A;  5H8Q B;  2OBG A;  2AL4 A;  1MXX A;  1FTL A;  1SI1 A;  3PUX E;  2E1S A;  3MPL A;  2XX8 A;  3G3J A;  4MNI A;  1IZ1 A;  2Q2A A;  1LBX A;  1Y4C A;  1WOD A;  4RJZ A;  4JBZ A;  2RC8 A;  5DYH A;  4QXD A;  4FAJ A;  4U4X A;  3KN7 A;  4O7I A;  1FBP A;  3MZB A;  1SW4 A;  1F9B A;  5DTB A;  1Q9D A;  4GL8 A;  5H8H B;  4EQB A;  4JVC A;  3PGF A;  4PCD A;  2PX1 A;  1QVS A;  4XIG Q;  3BFU A;  1VFE A;  2XXP A;  4NF8 B;  1QW0 A;  1IEJ A;  4JDF A;  2VT5 A;  5B7D A;  3KBR A;  1G0I A;  1DOT A;  1NL5 A;  3UGW A;  4U1Z A;  3MP1 A;  2WEF A;  4JSO A;  4IO5 A;  4P8B A;  5ICQ A;  4G68 B;  4NN3 A;  1QKA A;  3C9H A;  4EQ9 A;  1A55 A;  3VVD A;  1O7T A;  5HM4 B;  4DLD A;  1OVT A;  2I3V A;  1FJ9 A;  2M8C A;  3KOT A;  1P1U A;  2ZZW A;  4PFW A;  3O29 A;  1YZ0 A;  4MCO A;  2O7I A;  2Z8E A;  2MKZ A;  4ZEB A;  4R9F A;  2Z23 A;  4H67 A;  4IO7 A;  2DWH A;  2ONK E;  3FXR A;  1Q1K A;  3MVY A;  4GWW A;  4MX6 A;  5TPA B;  4ZDM A;  4R6Y A;  2XXW A;  5IZ3 B;  1GVC A;  4WXJ A;  4ELO A;  3D1R A;  4LVQ A;  4KYE A;  3LSF B;  4H0W A;  4XF5 A;  1UTB A;  1KZ8 A;  3M3F A;  4QHQ A;  3CIJ A;  3CG3 A;  2RC9 A;  4EF2 A;  4EQ7 A;  1XT8 A;  1P1W A;  3G3G A;  4ZE8 A;  3GXA A;  4G8M A;  5A5X A;  4KCC A;  5J16 A;  2E0S A;  3M8U A;  3IB0 A;  5IM2 A;  1ZLQ A;  1OLC A;  3V83 A;  4QFN A;  5I2K B;  3MUQ A;  1AIV A;  3G3F A;  4GWY A;  2Y7W A;  3O6H A;  2R8T A;  1FBC A;  3QUF A;  1B1X A;  1H44 A;  4BLA A;  4MF3 A;  3T93 B;  1HSL A;  1B7H A;  4GIZ A;  4HXV A;  2NUV A;  4KPT A;  3CI8 A;  3PMV A;  4BDR A;  1LAX A;  3NOH A;  4U1O A;  2I48 A;  4PFU A;  3LSL A;  4GRK A;  2BJI A;  3RTF B;  2F36 A;  4HE1 A;  2CMO A;  1QJM A;  1RYO A;  4EF1 A;  2NOO A;  1DPP A;  4OTE A;  2XXR A;  3C32 A;  3MZ9 A;  1NH7 A;  1RKM A;  3FIR A;  4FBP A;  4HW8 A;  4N6K A;  4DZ1 A;  2ZYO A;  3FUZ A;  2OZZ A;  4NF4 B;  1SBP A;  4MLQ A;  2H9B A;  3WAF A;  4N4U A;  1PBP A;  3CFZ A;  1FBF A;  3TQL A;  1NNT A;  5IKB A;  4DE8 A;  1NH8 A;  2FVZ A;  3TCF A;  4TLM B;  4U4S A;  2ALU A;  2UYE A;  2F34 A;  3VV5 A;  4F3P A;  2RKM A;  5ELV A;  2H5Y A;  3FGS A;  3Q27 A;  5I59 A;  4F31 B;  5I58 A;  1I69 A;  2HHM A;  4P9K A;  4ECF A;  1NV1 A;  4PFY A;  4DXB A;  2ESN A;  2HAV A;  1KWH A;  3MBP A;  4MFI A;  1ELJ A;  4R73 A;  2HXR A;  2D3I A;  3PUZ E;  5ET6 A;  3OD7 A;  2Q8J A;  4LZ5 A;  3LV0 A;  2XA5 A;  3S9E A;  2UVJ A;  4H8I A;  3KJT A;  3I6V A;  1BP5 A;  2O68 A;  5LDZ A;  4R2B A;  2Y7I A;  1D3K A;  3HV1 A;  3BIG A;  3SET A;  2Y84 A;  3TEL A;  2UVG A;  1B05 A;  3HN0 A;  1NV2 A;  2QMX A;  3HPI A;  3EHU A;  2ZYK A;  1BLF A;  4ZEF A;  4G61 A;  3MW0 A;  4DDD A;  1KA1 A;  2WBD A;  4GQO A;  4YB7 A;  1H45 A;  5JTY A;  2PYY A;  3K1M A;  1NV4 A;  3KC0 A;  1PBQ A;  4NMY A;  2FIX A;  5K2Y A;  4N17 A;  3P7I A;  3MYU A;  1GGG A;  3TOD A;  2ZYM A;  3CR9 A;  1JVX A;  5CI5 A;  1I6B A;  3RY3 A;  5I7I A;  5EYF A;  2I0B A;  2HZL A;  5A5L A;  3RYD A;  4EXL A;  4YU0 A;  3IAZ A;  1SI0 A;  4Z7E A;  2FYI A;  1B5H A;  3PPO A;  1Y1Z A;  3MWB A;  4NF0 A;  1NMU A;  3B8B A;  1A40 A;  3PPR A;  4PQJ A;  2XXK A;  1SYH A;  1BK4 A;  1D4N A;  5ET7 A;  3CSB A;  2B3B A;  1DBZ A;  3DP4 A;  3W9V A;  4EDP A;  3O66 A;  2DOJ A;  1EU8 A;  4LN5 A;  4YKP A;  3ROJ A;  4BDL A;  4C1U A;  1B6H A;  1I6Q A;  3C34 A;  1M5D A;  4UAC A;  3LUZ A;  2QMW A;  2O69 A;  3PMW A;  5EQ9 A;  3RPL B;  4JXI A;  4MBP A;  2G93 A;  2AL5 A;  4LUB A;  1VE4 A;  4F29 A;  1DMB A;  4F2Q A;  4IY5 A;  5K2X A;  5KCJ A;  3RNN A;  4H65 A;  1FPD A;  4F2O A;  2V3U A;  3GBA A;  1HSJ A;  5ET5 A;  4LZ7 A;  5AA2 B;  1G0H A;  2XXT A;  3TFL A;  5ITP A;  3PPQ A;  4ELP A;  2CZI A;  5TP9 A;  1MPC A;  3V8X B;  1XS5 A;  3TTN A;  1LBW A;  4ZEI A;  3PUW E;  1SW1 A;  3CG1 A;  1IIT A;  1EH3 A;  1MDQ A;  1EYK A;  1LB8 A;  3L6G A;  3SEV A;  3U8Q A;  1FQA A;  3IJO B;  3OO7 A;  3T66 A;  1R9Q A;  3MC2 A;  4C1T A;  1B7Z A;  2XXI A;  3FXB A;  1POY 1;  4LAT A;  3K6W A;  2UVI A;  3UA8 A;  5HPQ A;  2QSX A;  1DK4 A;  3SEY A;  4X1B A;  3EQ1 A;  4O3C A;  4QFO A;  1ZU0 A;  4E0W A;  1IMD A;  4KHZ E;  2I4C A;  3KOS A;  1B4Z A;  4H5G A;  2F7A A;  1NUZ A;  2F3D A;  4RPO A;  4NWC A;  1SPI A;  3V89 B;  4DXC A;  3KG2 A;  1MS7 A;  4X8R A;  3TMG A;  3FXQ A;  3SEX A;  2QJE A;  3K01 A;  2R6G E;  4JWY A;  2Q9T A;  4YKK A;  4I3Y A;  4TOZ A;  4YAH X;  3TUS A;  1JP4 A;  1FTM A;  1H43 A;  1R6Z A;  1A99 A;  4KCD A;  1LBC A;  3ZKK A;  2OX3 A;  2HAU A;  4N13 A;  2I6E A;  4GBV A;  1MXZ A;  2XXY A;  3USD A;  3C4M A;  1SYI A;  3OEN A;  1R9L A;  2A5T A;  2Z22 A;  4UAB A;  4OER A;  4YZZ A;  5KZT A;  1PB7 A;  3BFT A;  1D9Q A;  4PBH A;  4PBQ A;  4OWD A;  3N26 A;  4OZ9 A;  4MMP A;  3B6W A;  3SZP A;  4RY1 A;  1D9Y A;  3T0J A;  3DP8 A;  4H6D A;  4AB5 A;  1FBE A;  2NXO A;  1K9Y A;  1YXI A;  5F24 A;  2ZXT A;  5CBS A;  3RN8 A;  2ANJ A;  1QUJ A;  1B51 A;  2DE2 A;  1MY0 A;  2B4L A;  1M5C A;  2QS2 A;  2I3W A;  4LP2 B;  1USY E;  4F1Y A;  3IB2 A;  1NUX A;  4NF6 A;  4NG7 A;  4HE0 A;  2XXQ A;  5DVJ A;  3Q25 A;  4I40 A;  1OLA A;  1BTJ A;  5I56 B;  1AH5 A;  3HST A;  4R6H A;  2F7C A;  2DS9 A;  3PU5 A;  3LC8 A;  4N8Y A;  4AB6 A;  3ISP A;  3G7W A;  3RLF E;  4MNC A;  1FQE A;  3FAT A;  2HEU A;  2CEX A;  2DQV A;  3IFA A;  4N15 A;  4DIG A;  4C0R A;  3PUY E;  5CMB A;  1TT1 A;  3M3L A;  2DYX A;  1SW2 A;  1NFT A;  4ELQ A;  4ZZE A;  5L9O A;  4P0I A;  3O9P A;  4X1D A;  5JEI A;  2DP8 A;  2PT1 A;  2HPG A;  3KBZ A;  3JZJ A;  2PFZ A;  1MXW A;  3MQ9 A;  2QS4 A;  2XD3 A;  4GL0 A;  5I2N B;  2F97 A;  3RGY A;  4KI0 E;  2FIE A;  5LTC A;  2ZMB A;  3IO4 A;  4XTC Q;  1N04 A;  5EYH A;  1YYZ A;  3IK6 B;  3PMX A;  3KSX A;  4F19 A;  3E9X A;  1JEV A;  2DE3 A;  3LSW A;  3T9V A;  3KN3 A;  1B3L A;  1J1N A;  4M1V A;  2O6A A;  3T96 B;  5H8F B;  3U65 A;  2FA7 A;  5DEX A;  1IQ7 A;  3IB1 A;  1NI9 A;  4NTL A;  4U21 A;  3FV1 A;  5F7V A;  2WYP A;  3H6W A;  2I4B A;  1B40 A;  3A3C A;  1QGX A;  5H8N B;  2QPQ A;  3F11 A;  2JJK A;  4HCW A;  3RTW B;  1B3H A;  3B6Q A;  1NNF A;  2I58 A;  5ICT A;  3OEK A;  1PDA A;  3U72 A;  1N84 A;  4PF6 A;  3H3G A;  3SDF A;  2R9J A;  3MVW A;  3T9X B;  5I57 B;  2VPN A;  2I0C A;  4XKN A;  2RF1 A;  4F39 A;  1QKB A;  5CBR A;  1IXI A;  2H98 A;  3EF7 A;  1IMA A;  1UTH A;  3BBR A;  1N7X A;  1CE2 A;  4ZEK A;  1B46 A;  2Z8D A;  4OHN A;  1VR5 A;  3QXM A;  3EN3 A;  3KFM A;  2DVC A;  3E4R A;  1ANF A;  4OVJ A;  4GWS A;  4U23 A;  5FBP A;  1FQF A;  1SD3 A;  2DXR A;  2Q74 A;  4MLV A;  3IX1 A;  2X7P A;  2OWZ A;  2AIX A;  2QVV A;  1FBH A;  5AA4 B;  1UIV A;  3E13 X;  5EQ8 A;  3K6X A;  1FTK A;  3PUV E;  3OOA A;  2P2A A;  3FVG A;  4KFQ A;  1JEU A;  4NE4 A;  3K1N A;  3PPN A;  5ESY A;  2P1S A;  2WKY A;  3TTK A;  4PFT A;  1BKA A;  2GHA A;  4GF8 A;  1LBY A;  3FVN A;  1INP A;  2ABH A;  2VD3 A;  4FEB A;  5EQ7 A;  4YIC A;  3VLV A;  4O7M A;  2XWO A;  3A3U A;  3MPK A;  5KDT A;  3PD8 A;  4PFI A;  4X9T A;  4EUO A;  1EYJ A;  4AQ4 A;  1NUW A;  1H76 A;  4NAP A;  2XXH A;  3MST A;  1URD A;  3VFJ A;  3JV9 A;  4LON B;  1P99 A;  2RCB A;  4OET A;  3T9U A;  4U2R A;  2NWJ A;  2GH9 A;  4FAT A;  1FPL A;  2W7Y A;  2OJT A;  4P11 A;  1P1Q A;  1MDP 1;  2REJ A;  4YB6 A;  4ZEC A;  5ISU A;  1MPB A;  1ZMG A;  1MH3 A;  4NWD A;  4G2Z A;  4NHB A;  2DDK A;  4M4G A;  2D5W A;  3IL1 B;  3QMF A;  1MQJ A;  1IUD A;  1XI6 A;  3FJ7 A;  1UTB B;  4QSC A;  2H25 A;  1JW5 A;  3H7M A;  4THI A;  1FPG A;  4ZS9 A;  1NNP A;  1DTG A;  2Q89 A;  1LAG E;  1O64 A;  4TQU Q;  1B5I A;  4XFE A;  5A5X B;  5AA1 A;  4LQ2 A;  1O63 A;  2V3Q A;  4PGN A;  4PE5 B;  2UYF A;  4OVR A;  3MVZ A;  2VGQ A;  4MIJ A;  2V4C A;  1MY4 A;  4PET A;  1LAH E;  3K00 A;  3QUJ A;  2RC7 A;  2V93 A;  3S9L C;  1H3D A;  4RNS A;  1MRP A;  4P56 A;  3TTL A;  4GX4 A;  1FPF A;  1NV6 A;  3GYY A;  4KQP A;  1OMP A;  4QFK A;  1JVY A;  3HFU A;  4NED A;  5IGA A;  4GBW A;  3OO6 A;  2LAO A;  3ILT B;  1WDN A;  4O8M A;  1I6A A;  3IFC A;  3K6V A;  2HCA A;  1LFH A;  1UIU A;  2DVZ A;  4NF5 A;  3FZV A;  2XX7 A;  3HHF A;  1FW0 A;  4OMB A;  5DVF A;  4GWZ A;  3N6U A;  4ZED A;  4E0X A;  1YAE A;  4AS5 A;  3DM0 A;  3VE1 B;  4F1V A;  2THI A;  3K4U A;  4PP0 A;  2PBW A;  2KR0 A;  2HFB A;  3EPE A;  5BWJ A;  3RQT A;  4OFO A;  3D4G A;  4MJO A;  4YMA A;  4ZE9 A;  4N6P A;  2QRY A;  2DXY A; 
#chains in the Genus database with same CATH homology
 1XVY A;  5I59 B;  4OYV A;  1FQD A;  5I58 B;  4BDO A;  4QSE A;  3TEP A;  2DWJ A;  4H5F A;  2B3F A;  4GFR A;  3LSX A;  4Q0C A;  4X48 A;  4HCY A;  3O97 A;  3K0V A;  1QUK A;  1EZP A;  2OK2 A;  1XVX A;  3OMB A;  1MXY A;  1B1H A;  4IB2 A;  4QFL A;  4IGT A;  4OEU A;  1DSN A;  1FTJ A;  3HCQ A;  1FTO A;  3CRB A;  4KYS A;  3WAE A;  3KJ7 A;  1IXC A;  1Y3P A;  3PD9 A;  5JTY B;  1JW1 A;  1MQI A;  1MQH A;  4N07 A;  2OWT A;  1N0T A;  4LA9 A;  3FV2 A;  3TKD A;  4QFP A;  1P1O A;  1TXF A;  4F3G A;  4WKM A;  4TLL B;  3O28 A;  5FTH A;  4Z0I A;  3VVE A;  4F3S A;  5H8Q A;  2YJP A;  1DTZ A;  3ZKL A;  4G8N A;  3PPP A;  1MY3 A;  1S9T A;  3CVG A;  4O3B A;  2ZNS A;  1FQC A;  3QYT A;  1LB9 A;  4FEC A;  5H8H A;  3RUM A;  5LOM A;  4IO2 A;  3S2V A;  3OEM A;  1ZIU A;  3MP8 A;  4KYD A;  4NF8 A;  1USY H;  5BUU A;  2PMS A;  3ZS6 A;  2DWA A;  1US4 A;  3N94 A;  4IO4 A;  3U93 A;  3VXB A;  2OLB A;  5J1D A;  2XX9 A;  2R71 A;  4G68 A;  4RPN A;  4H1X A;  4OFL A;  3EHT A;  1A8E A;  4R75 A;  3Q28 A;  1AL3 A;  3G3I A;  3IJX B;  3OO8 A;  3SKP A;  5FHO A;  3IR1 A;  1MY2 A;  4QRZ A;  5KCJ B;  3S9N C;  1URG A;  1IXH A;  2GHB A;  4IY6 A;  1LFG A;  1Y4T A;  4LZ8 A;  4G4P A;  4GXA A;  1ATG A;  2X26 A;  4R74 A;  3K6U A;  1EZ9 A;  5TP9 B;  2XXU A;  5TPA A;  1Z7M E;  1ZTY A;  1YTV A;  4F3B A;  5CMC A;  5EHM A;  2F6P A;  3MJN A;  1A8F A;  4QF9 A;  4GD5 A;  4XKR A;  2Q2C A;  5DT6 A;  3W15 C;  2QS3 A;  3IOV A;  5FTI A;  4R2F A;  4IGR A;  1B58 A;  2V84 A;  1LLS A;  4FED A;  1S50 A;  2Y7P A;  2ZYN A;  1OQH A;  5DVI A;  4YMB A;  3T22 A;  4KD5 A;  1PB8 A;  5I2K A;  3K02 A;  4HTG A;  3T9H B;  2YLN A;  3THI A;  5IAI A;  4OFJ A;  3EHS A;  3C33 A;  1N76 A;  2VP1 A;  5AA4 A;  4ISU A;  3K1P A;  3GBB A;  4P0G A;  1II5 A;  3OEL A;  1HSE A;  3B7D A;  5L9M A;  1N3W A;  1MM6 A;  1JW4 A;  3N5L A;  3VVF A;  3RPW A;  1M5B A;  4POX A;  3VLU A;  4GWO A;  2O1M A;  3KEI A;  1MG1 A;  5M2V A;  3VLW A;  1Y3Q A;  2FNC A;  5TU0 A;  1XHY A;  4FIM A;  2GFE A;  4RK2 A;  5CM6 A;  1OQG A;  2A5T B;  4NF4 A;  4JWO A;  3MZ1 A;  3C31 A;  1MQD A;  4IO6 A;  4U22 A;  2D21 A;  1CB6 A;  5CC2 A;  4I9D A;  1Y1M A;  3W9W A;  1GR2 A;  2F5X A;  2RIN A;  1B0L A;  1B0H A;  2UVH A;  1B4H A;  2HQ0 A;  3LUY A;  2Z8F A;  4G8H A;  1SQY A;  4NF6 B;  5FHM A;  2REG A;  4DXU A;  1S7Y A;  5AE4 A;  4H8J A;  1GV8 A;  3QSL A;  4XKP A;  1ZKB A;  2F78 A;  2O51 A;  1URS A;  1QUL A;  3DLN A;  3L6H A;  1US5 A;  2NVU B;  3VXC A;  3PV0 E;  3TTM A;  1PB9 A;  2P0S A;  3IOW A;  4WEP A;  1Q35 A;  4LQ5 A;  4ZZA A;  3UN6 A;  3TTR A;  1MXU A;  4R6K A;  1LGB C;  1B7U A;  3U94 A;  3ECR A;  3KN8 A;  1LFI A;  4RYA A;  2I49 A;  2Y7R A;  3Q26 A;  3ONM A;  3O6G A;  3QIM A;  1SW5 A;  3I5O A;  4F18 A;  3FVO A;  2GRV A;  4IO3 A;  1TFD A;  4WED A;  1FCK A;  1WVJ A;  4ESX A;  3K2D A;  2F6G A;  5H8S A;  4QSD A;  1SDX A;  1Y20 A;  5L9S A;  5DEX B;  4EXK A;  1B3F A;  1FQB A;  4ONY A;  3RT6 B;  5AA3 A;  4I62 A;  3H06 B;  3SES A;  1YCJ A;  4XKQ A;  4G68 C;  3KSJ A;  3UP9 A;  5B70 A;  4FOR A;  2IA4 A;  3MP6 A;  4BDM A;  5AA2 D;  3C36 A;  3R6U A;  1B3E A;  4YB5 A;  1Y9U A;  1B3G A;  2HZK A;  4BDN A;  3HO7 A;  2VD2 A;  4RK9 A;  1A7L A;  2OWS A;  5I84 A;  4Q5T A;  3TAJ A;  2ZNU A;  5ITO A;  3B6T A;  3V5A A;  3FJG A;  1UTH B;  3G3H A;  1D9V A;  3TPA A;  3H6V A;  1LCF A;  4GOT A;  2B65 A;  3DP6 A;  2VHA A;  3FJM A;  5AA2 A;  1SVX B;  1R1N A;  4Q8R A;  2KLF A;  1M5F A;  1A54 A;  1VSO A;  2H99 A;  1NKX A;  1RYX A;  3UK4 A;  4GLI A;  3QAX A;  1MQG A;  1EZO A;  3JYR A;  1XOC A;  2V3T A;  3H4Z A;  1NNK A;  1TFA A;  1TWY A;  4RA1 A;  2QL3 A;  3R7X A;  1XC1 A;  2O84 X;  3OO9 A;  3I3V A;  4FJP A;  5KDT B;  3LBS A;  5L8D A;  4XXU A;  3A09 A;  2UXA A;  2DE4 A;  3IOU A;  1LAF E;  1UQW A;  2G29 A;  3IOT A;  4UA8 A;  4I8C A;  4YKI A;  3ZSF A;  4OES A;  1LST A;  4GVO A;  4OQO A;  3CFL A;  3OSR A;  4F1U A;  3QK6 A;  4JSD A;  2DWI A;  4BDQ A;  4RXL A;  4L17 A;  2A5S A;  3ODB A;  4YKJ A;  4KR5 A;  3FD3 A;  2YPN A;  2O7U A;  3E3K A;  1B9J A;  2F8D A;  3OSQ A;  1B5J A;  2F35 A;  3KZG A;  3H6U A;  5EHS A;  1OIB A;  2Q88 A;  2CZL A;  4OEN A;  3DEL B;  3M3K A;  2ONS A;  1OVB A;  4F22 A;  5F1Q A;  4MH5 A;  3TCH A;  2IEE A;  2RCA A;  3G3K A;  1VFD A;  3U92 A;  4ELR A;  4O3A A;  3GLB A;  1QUI A;  1IXG A;  1JQF A;  2XXV A;  1POT A;  3H03 A;  3D4C A;  1B32 A;  2XXX A;  3R26 A;  3FVK A;  5I56 A;  5CMK A;  2F7B A;  1LBB A;  3U1O A;  4DCY A;  3TDJ A;  3TQW A;  2XHD A;  2HXW A;  3TCG A;  5FHN A;  3MAM A;  1N3X A;  3N6T A;  4ESW A;  4GXS B;  2ZNT A;  3C35 A;  4NF5 B;  5CRY A;  3LR1 A;  4POW A;  4DCX A;  3GZG A;  3SEW A;  1B52 A;  1MPD A;  1L5T A;  5I2N A;  1AOV A;  3IOR A;  1MM7 A;  1B2H A;  2AYS A;  3OXN A;  3O6I A;  3S9M C;  2VOZ A;  1P1N A;  3CSG A;  1MH4 A;  1YPN A;  5JK4 A;  4R72 A;  1PC3 A;  4ND9 A;  4JWX A;  4G77 A;  3ILU B;  1DPE A;  4K3F A;  1BIY A;  1N7W A;  3MVX A;  3O2A A;  3FAS A;  1PEB A;  3CFX A;  2QS1 A;  5H8F A;  1ZJL A;  2DSF A;  1MXV A;  2ONR A;  5H8N A;  2O1L A;  2Y7K A;  3SEU A;  3UIF A;  1M5E A;  5HBC A;  3RT8 A;  2OCU A;  2PVU A;  3S4U A;  4Q30 B;  3FXU A;  3SER A;  2PT2 A;  4FE8 A;  2BJJ X;  4I1D A;  2V25 A;  1JET A;  1MY1 A;  2X7Q A;  1GTK A;  4HS7 A;  5CMM A;  3Q29 A;  4OXV A;  3VDF A;  2XD2 A;  3TZA A;  1Y3N A;  5I57 A;  3TYH A;  1Z7N E;  3H6T A;  1LCT A;  4JB7 A;  1ZBM A;  1IIW A;  1T0K A;  3BKI B;  3KGC A;  3UOR A;  3IO6 A;  4R9G A;  3HHG A;  4OEV A;  3AXF A;  1JNF A;  1AMF A;  2H4I A;  5H8Q B;  2OBG A;  2AL4 A;  1MXX A;  1FTL A;  1SI1 A;  3PUX E;  2E1S A;  3MPL A;  2XX8 A;  3G3J A;  1IZ1 A;  2Q2A A;  1Y4C A;  1WOD A;  4RJZ A;  4JBZ A;  2RC8 A;  5DYH A;  4FAJ A;  4U4X A;  3KN7 A;  3MZB A;  1SW4 A;  1F9B A;  5DTB A;  4GL8 A;  5H8H B;  4EQB A;  3PGF A;  2PX1 A;  1QVS A;  4XIG Q;  3BFU A;  1VFE A;  2XXP A;  4NF8 B;  1QW0 A;  1IEJ A;  4JDF A;  5B7D A;  3KBR A;  1DOT A;  1NL5 A;  3UGW A;  4U1Z A;  3MP1 A;  4JSO A;  4IO5 A;  5ICQ A;  4G68 B;  1QKA A;  3C9H A;  4EQ9 A;  1A55 A;  3VVD A;  1O7T A;  5HM4 B;  4DLD A;  1OVT A;  2I3V A;  2M8C A;  3KOT A;  1P1U A;  4PFW A;  3O29 A;  2O7I A;  2Z8E A;  4ZEB A;  4R9F A;  2Z23 A;  4H67 A;  4IO7 A;  2DWH A;  2ONK E;  3FXR A;  1Q1K A;  3MVY A;  5TPA B;  4ZDM A;  4R6Y A;  2XXW A;  1GVC A;  4WXJ A;  4ELO A;  4LVQ A;  4KYE A;  3LSF B;  4H0W A;  1UTB A;  3M3F A;  4QHQ A;  3CIJ A;  3CG3 A;  2RC9 A;  4EF2 A;  4EQ7 A;  1XT8 A;  1P1W A;  3G3G A;  4ZE8 A;  3GXA A;  4G8M A;  5A5X A;  4KCC A;  2E0S A;  3M8U A;  3IB0 A;  1ZLQ A;  1OLC A;  3V83 A;  4QFN A;  5I2K B;  3MUQ A;  1AIV A;  3G3F A;  2Y7W A;  3O6H A;  3QUF A;  1B1X A;  1H44 A;  4BLA A;  4MF3 A;  3T93 B;  1HSL A;  1B7H A;  4GIZ A;  2NUV A;  4KPT A;  3CI8 A;  3PMV A;  4BDR A;  1LAX A;  4U1O A;  2I48 A;  4PFU A;  3LSL A;  4GRK A;  3RTF B;  2F36 A;  2CMO A;  1QJM A;  1RYO A;  4EF1 A;  2NOO A;  1DPP A;  4OTE A;  2XXR A;  3C32 A;  3MZ9 A;  1NH7 A;  1RKM A;  3FIR A;  4HW8 A;  4DZ1 A;  2ZYO A;  3FUZ A;  2OZZ A;  4NF4 B;  1SBP A;  4MLQ A;  2H9B A;  3WAF A;  1PBP A;  3CFZ A;  3TQL A;  1NNT A;  5IKB A;  4DE8 A;  1NH8 A;  3TCF A;  4TLM B;  4U4S A;  2ALU A;  2UYE A;  2F34 A;  3VV5 A;  4F3P A;  2RKM A;  5ELV A;  2H5Y A;  3FGS A;  3Q27 A;  5I59 A;  4F31 B;  5I58 A;  1I69 A;  4ECF A;  4PFY A;  4DXB A;  2ESN A;  2HAV A;  1KWH A;  3MBP A;  4MFI A;  1ELJ A;  4R73 A;  2D3I A;  3PUZ E;  3OD7 A;  2Q8J A;  4LZ5 A;  3S9E A;  2UVJ A;  4H8I A;  3KJT A;  3I6V A;  1BP5 A;  2O68 A;  4R2B A;  2Y7I A;  1D3K A;  3HV1 A;  3SET A;  2Y84 A;  3TEL A;  2UVG A;  1B05 A;  3HN0 A;  2QMX A;  3HPI A;  3EHU A;  2ZYK A;  1BLF A;  4ZEF A;  3MW0 A;  4DDD A;  4GQO A;  5JTY A;  4YB7 A;  1H45 A;  2PYY A;  3K1M A;  1PBQ A;  4NMY A;  5K2Y A;  3P7I A;  1GGG A;  3TOD A;  2ZYM A;  3CR9 A;  1JVX A;  5CI5 A;  1I6B A;  3RY3 A;  5EYF A;  2I0B A;  2HZL A;  4EXL A;  4YU0 A;  3IAZ A;  1SI0 A;  4Z7E A;  2FYI A;  1B5H A;  3PPO A;  1Y1Z A;  3MWB A;  1NMU A;  1A40 A;  3PPR A;  4PQJ A;  1SYH A;  1D4N A;  3CSB A;  2B3B A;  3DP4 A;  3W9V A;  4EDP A;  3O66 A;  2DOJ A;  1EU8 A;  4YKP A;  4BDL A;  4C1U A;  1B6H A;  1I6Q A;  3C34 A;  1M5D A;  4UAC A;  2QMW A;  2O69 A;  3PMW A;  4JXI A;  4MBP A;  2G93 A;  2AL5 A;  4LUB A;  1VE4 A;  4F29 A;  1DMB A;  4F2Q A;  4IY5 A;  5K2X A;  5KCJ A;  3RNN A;  4H65 A;  4F2O A;  2V3U A;  3GBA A;  1HSJ A;  4LZ7 A;  5AA2 B;  2XXT A;  3TFL A;  5ITP A;  3PPQ A;  4ELP A;  5TP9 A;  1MPC A;  3V8X B;  1XS5 A;  3TTN A;  4ZEI A;  3PUW E;  1SW1 A;  3CG1 A;  1IIT A;  1EH3 A;  1MDQ A;  1LB8 A;  3L6G A;  3SEV A;  3U8Q A;  1FQA A;  3IJO B;  3OO7 A;  3T66 A;  1R9Q A;  3MC2 A;  4C1T A;  1B7Z A;  2XXI A;  1POY 1;  4LAT A;  3K6W A;  2UVI A;  3UA8 A;  5HPQ A;  2QSX A;  3SEY A;  4X1B A;  3EQ1 A;  4O3C A;  4QFO A;  1ZU0 A;  4E0W A;  4KHZ E;  2I4C A;  3KOS A;  1B4Z A;  4H5G A;  2F7A A;  4RPO A;  4NWC A;  3V89 B;  4DXC A;  3KG2 A;  1MS7 A;  3TMG A;  3FXQ A;  3SEX A;  2QJE A;  3K01 A;  2R6G E;  4JWY A;  2Q9T A;  4YKK A;  4TOZ A;  4YAH X;  3TUS A;  1FTM A;  1H43 A;  1R6Z A;  1A99 A;  4KCD A;  1LBC A;  3ZKK A;  2HAU A;  4N13 A;  2I6E A;  1MXZ A;  2XXY A;  3USD A;  3C4M A;  1SYI A;  3OEN A;  1R9L A;  2A5T A;  2Z22 A;  4OER A;  4YZZ A;  5KZT A;  1PB7 A;  3BFT A;  4OWD A;  3N26 A;  4OZ9 A;  3B6W A;  4RY1 A;  1D9Y A;  3DP8 A;  4H6D A;  4AB5 A;  2NXO A;  2ZXT A;  5CBS A;  3RN8 A;  2ANJ A;  1QUJ A;  1B51 A;  2DE2 A;  1MY0 A;  1M5C A;  2QS2 A;  2I3W A;  4LP2 B;  1USY E;  4F1Y A;  3IB2 A;  4NF6 A;  2XXQ A;  5DVJ A;  3Q25 A;  1OLA A;  1BTJ A;  5I56 B;  1AH5 A;  3HST A;  4R6H A;  2F7C A;  2DS9 A;  3PU5 A;  3LC8 A;  4AB6 A;  3G7W A;  3RLF E;  1FQE A;  3FAT A;  2HEU A;  2DQV A;  4DIG A;  4C0R A;  3PUY E;  5CMB A;  1TT1 A;  3M3L A;  2DYX A;  1SW2 A;  1NFT A;  4ELQ A;  4ZZE A;  5L9O A;  4P0I A;  3O9P A;  4X1D A;  5JEI A;  2DP8 A;  2PT1 A;  3JZJ A;  1MXW A;  3MQ9 A;  2QS4 A;  2XD3 A;  4GL0 A;  5I2N B;  2F97 A;  3RGY A;  4KI0 E;  2ZMB A;  3IO4 A;  4XTC Q;  1N04 A;  3IK6 B;  3PMX A;  3KSX A;  4F19 A;  3E9X A;  1JEV A;  2DE3 A;  3LSW A;  3T9V A;  3KN3 A;  1B3L A;  1J1N A;  4M1V A;  2O6A A;  3T96 B;  5H8F B;  2FA7 A;  5DEX A;  1IQ7 A;  3IB1 A;  4NTL A;  4U21 A;  3FV1 A;  5F7V A;  3H6W A;  2I4B A;  1B40 A;  3A3C A;  5H8N B;  2QPQ A;  3F11 A;  4HCW A;  3RTW B;  1B3H A;  3B6Q A;  1NNF A;  2I58 A;  5ICT A;  3OEK A;  1PDA A;  3U72 A;  1N84 A;  3H3G A;  3SDF A;  2R9J A;  3MVW A;  3T9X B;  5I57 B;  2I0C A;  4XKN A;  2RF1 A;  4F39 A;  1QKB A;  5CBR A;  1IXI A;  2H98 A;  3EF7 A;  1UTH A;  3BBR A;  1N7X A;  1CE2 A;  4ZEK A;  1B46 A;  2Z8D A;  4OHN A;  1VR5 A;  3QXM A;  3EN3 A;  3KFM A;  2DVC A;  3E4R A;  1ANF A;  4OVJ A;  4U23 A;  1FQF A;  1SD3 A;  2DXR A;  4MLV A;  3IX1 A;  2X7P A;  2AIX A;  5AA4 B;  1UIV A;  3E13 X;  3K6X A;  1FTK A;  3PUV E;  3OOA A;  2P2A A;  3FVG A;  4KFQ A;  1JEU A;  4NE4 A;  3K1N A;  3PPN A;  2P1S A;  2WKY A;  3TTK A;  4PFT A;  1BKA A;  2GHA A;  4GF8 A;  3FVN A;  2ABH A;  2VD3 A;  4FEB A;  4YIC A;  3VLV A;  3A3U A;  3MPK A;  5KDT A;  3PD8 A;  4X9T A;  4EUO A;  4AQ4 A;  1H76 A;  2XXH A;  1URD A;  3VFJ A;  3JV9 A;  4LON B;  1P99 A;  2RCB A;  4OET A;  3T9U A;  4U2R A;  2NWJ A;  2GH9 A;  4FAT A;  2W7Y A;  2OJT A;  4P11 A;  1P1Q A;  1MDP 1;  2REJ A;  4YB6 A;  4ZEC A;  5ISU A;  1MPB A;  1ZMG A;  1MH3 A;  4NWD A;  4G2Z A;  4M4G A;  2D5W A;  3IL1 B;  1MQJ A;  1IUD A;  3FJ7 A;  1UTB B;  4QSC A;  2H25 A;  1JW5 A;  3H7M A;  4THI A;  4ZS9 A;  1NNP A;  1DTG A;  2Q89 A;  1LAG E;  1O64 A;  4TQU Q;  1B5I A;  5A5X B;  5AA1 A;  4LQ2 A;  1O63 A;  2V3Q A;  4PE5 B;  2UYF A;  3MVZ A;  2VGQ A;  1MY4 A;  4PET A;  1LAH E;  3K00 A;  3QUJ A;  2RC7 A;  2V93 A;  3S9L C;  1H3D A;  4RNS A;  1MRP A;  3TTL A;  4KQP A;  1OMP A;  4QFK A;  1JVY A;  4NED A;  3OO6 A;  2LAO A;  3ILT B;  1WDN A;  1I6A A;  3K6V A;  2HCA A;  1LFH A;  1UIU A;  2DVZ A;  4NF5 A;  3FZV A;  2XX7 A;  3HHF A;  1FW0 A;  4OMB A;  5DVF A;  3N6U A;  4ZED A;  4E0X A;  1YAE A;  3DM0 A;  3VE1 B;  4F1V A;  2THI A;  3K4U A;  4PP0 A;  2PBW A;  2HFB A;  3EPE A;  5BWJ A;  3RQT A;  4OFO A;  3D4G A;  4YMA A;  4ZE9 A;  4N6P A;  2QRY A;  2DXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...