3A3CA

Crystal structure of tim40/mia40 fusing mbp, c296s and c298s mutant
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
451
structure length
451
Chain Sequence
EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSVPGRGSIEGRPEFAYNPDTGEINWDSPSLGGMAHGPCGEEFKSAFSCFVYSEAEPKGIDCVEKFQHMQDCFRKYPEHYAEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Maltose-binding periplasmic protein, LINKER, Mitochondrial i
publication title Structural basis of yeast Tim40/Mia40 as an oxidative translocator in the mitochondrial intermembrane space.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 122
structure length 451
sequence length 451
ec nomenclature
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF06747 CHCH CHCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3a3cA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3a3cA01
1CE2A 3G3FA 4PETA 3OSRA 1QKAA 1P1OA 4Q30B 2F8DA 4BDQA 1QKBA 1I69A 1Y3NA 1QULA 3UN6A 3CFLA 4NWCA 3W9VA 2XXRA 1P1NA 3TDJA 4ZE8A 3I3VA 2O7UA 5FHNA 4NF6A 1ELJA 3B6TA 4OQOA 4R74A 3VVFA 3ECRA 3FUZA 4EUOA 3V83A 5AA2A 1ZU0A 3E3KA 1HSEA 3A3CA 1JW1A 5J1DA 4Z0IA 4DDDA 1M5BA 3CFZA 1M5CA 3CR9A 5AA1A 3OEKA 5KDTA 3O6HA 4RY1A 4PP0A 4JSDA 3VXBA 3O6IA 3HPIA 5K2XA 2LAOA 3FJGA 4DCXA 1BKAA 4H65A 1JVXA 4F1YA 4F22A 3I6VA 3GZGA 4HCWA 3VVEA 2HZLA 3H03A 1JW5A 3IR1A 2HEUA 3E13X 2XXPA 1MXYA 3K1MA 1N3WA 3TCHA 2M8CA 4MF3A 3K01A 3IOVA 1IXIA 1P1WA 2V3QA 5CC2A 2DS9A 4OZ9A 1XVXA 3QXMA 1LSTA 5KZTA 4I9DA 1VFEA 4YKKA 3CFXA 3LR1A 1MDQA 1MXWA 2DYXA 3C32A 4TQUQ 3RUMA 1GVCA 3CG1A 3VV5A 2XD2A 1MQJA 1GGGA 1B3HA 5A5XB 4KR5A 1R6ZA 2ZYNA 3QSLA 4LZ5A 5L9SA 5I58B 3K4UA 3DLNA 4U21A 1B40A 5I2NA 3QUJA 4WEPA 3KOSA 4EQBA 3K6XA 1IITA 4DE8A 1F9BA 2XX9A 1H76A 5L8DA 3TODA 2O6AA 2CMOA 2F78A 5IKBA 4JWYA 3B7DA 1AMFA 1XS5A 2NWJA 3KOTA 5B70A 4H8IA 4BDRA 3FXQA 4NTLA 4AB6A 1DMBA 2A5TB 1I6AA 3OOAA 3QK6A 2GHAA 1SYHA 1B0HA 1ZJLA 4KQPA 2Y7RA 2OWSA 5ELVA 2ZYOA 5DTBA 5BUUA 3ILUB 3RY3A 1B3LA 1SW1A 4P0GA 4KI0E 3TTRA 3RNNA 4YU0A 2I49A 3VLUA 4EF2A 2IA4A 1NH7A 4ZECA 4POWA 2XXIA 3HCQA 3K6WA 3QIMA 4NWDA 3FGSA 4KPTA 4IY6A 3T22A 4KYSA 3MP1A 2XX7A 3M3LA 3TCFA 1B4HA 3MZ1A 3MP6A 4AQ4A 2DOJA 4EXLA 2UYEA 1LAFE 2RC8A 4RXLA 3L6GA 1N7WA 3H4ZA 3TELA 3H3GA 3CG3A 3UGWA 1NNKA 5I56A 1UTHB 3E4RA 2I58A 3PD8A 5I57B 1QJMA 2UYFA 2QS2A 5KCJB 3T9UA 4F29A 5DEXA 1SDXA 1WODA 1OLCA 4OFOA 1YAEA 3TKDA 5L9MA 4YMAA 4OMBA 4QFPA 2ZMBA 1URGA 3C34A 1Y9UA 4GVOA 4OVJA 1TFDA 1B05A 2VHAA 2YLNA 1LAHE 4IO2A 1EU8A 2REJA 2O68A 4YMBA 2Z23A 3V5AA 1FQFA 3HO7A 4BDLA 1SW2A 1MY4A 3O9PA 1R1NA 3TPAA 3K2DA 1GR2A 5ITOA 3BKIB 4H6DA 4M1VA 3OO9A 5CMBA 1USYE 3P7IA 3G7WA 5K2YA 4G2ZA 1NMUA 2R9JA 4E0WA 4DXBA 4TLMB 2X7QA 3S4UA 3B6WA 4YICA 3CVGA 4HTGA 1P1UA 5FTHA 1ATGA 5ITPA 4RNSA 1EZ9A 2VGQA 2QRYA 4F2QA 4OEUA 2PVUA 2I0BA 1LCTA 4MLVA 2H9BA 3UK4A 4ZZEA 3RN8A 1MM6A 3ZS6A 2IEEA 1OVTA 1J1NA 4YKJA 4ZEDA 5TPAA 4FECA 4ELPA 1MPBA 3Q28A 3O29A 1PBQA 4XKPA 4F31B 3K1NA 2I6EA 1A8FA 1O7TA 4Q5TA 5ISUA 2O84X 1FTLA 3MZ9A 1MQIA 3UIFA 2W7YA 4JBZA 4X9TA 3S9MC 4EF1A 3UORA 1Y1ZA 3SEWA 1B7HA 4F1VA 2P2AA 4KYEA 2WKYA 4WKMA 3OO6A 3H06B 4F18A 4N07A 3ONMA 3M3FA 1T0KA 1EH3A 3CSBA 5FHOA 4F3PA 1B4ZA 1ZKBA 1JEUA 5F1QA 1ZTYA 3FASA 5H8FA 1D4NA 3AXFA 3WAFA 4GLIA 1JNFA 4XIGQ 3CI8A 3O6GA 1DTGA 3EHSA 2RF1A 3LSLA 2DE3A 2ZNTA 3ODBA 4FJPA 4OXVA 5EHMA 3TTMA 5ICTA 3IAZA 2H5YA 2QSXA 4G68B 4R6HA 3KFMA 3RGYA 2B3FA 4R9GA 4GXSB 2ANJA 2DVCA 4FAJA 3HSTA 3KZGA 1Q35A 4XKNA 4OFJA 4I62A 3T9XB 1ZLQA 2RC9A 3TZAA 4YAHX 3C31A 3FVOA 3PGFA 4GD5A 5I84A 3MAMA 3FIRA 1A7LA 1YPNA 1NFTA 2ABHA 3G3IA 2QMXA 3OD7A 3G3GA 2YJPA 2AL4A 1US4A 2GHBA 4OEVA 1YTVA 1NNFA 4F2OA 1UIVA 4G68C 5CBSA 2G93A 3K0VA 2Y84A 1GV8A 3U1OA 3R6UA 1SBPA 4GF8A 1B2HA 3T66A 4GRKA 5HPQA 2F7CA 3FVKA 2D5WA 3OO7A 2PX1A 3EF7A 3TQLA 3M8UA 2ZYMA 1LFHA 1FCKA 2F6PA 2H25A 2RCBA 4G8NA 5DYHA 5JTYB 3VLWA 3KBRA 1FQAA 1SD3A 4GFRA 1S7YA 4DXUA 3UP9A 5H8QB 3PUVE 1B3FA 5TU0A 1MY2A 2OJTA 2BJJX 4KHZE 3IOTA 3LSXA 4QF9A 1Y3PA 1M5FA 3E9XA 2H4IA 3QAXA 1LFIA 1LB8A 1OIBA 2PBWA 1JQFA 1DTZA 3FVNA 3FD3A 2H98A 3MVXA 1H3DA 4NF8B 3U92A 3O28A 3V8XB 2DP8A 3RLFE 4ND9A 4FEDA 4BLAA 3TFLA 3IJOB 1H45A 4U1ZA 3SEUA 1SW5A 1QVSA 4MLQA 5CMCA 2PMSA 3IO4A 3IOUA 4RA1A 1MY3A 4O3CA 2F97A 3ZSFA 3MVZA 3SESA 2Y7PA 1TWYA 1UTBB 1DOTA 1LAXA 1M5DA 4OERA 4R72A 4ELRA 1EZPA 1MXZA 4RYAA 2QS4A 3N5LA 5F7VA 3IB2A 4NE4A 4HW8A 3S2VA 1P99A 1PDAA 2D3IA 1L5TA 3N6UA 3Q26A 2QJEA 1US5A 3FZVA 1Y1MA 5A5XA 3TEPA 3KSXA 2O1LA 4O3AA 3SETA 3TAJA 2Z8EA 4ONYA 5AA2D 5I2KB 5I58A 3RT8A 4GWOA 1BIYA 4DIGA 4YKIA 3PMVA 5CBRA 4ZZAA 3C9HA 2I0CA 4RK2A 2HAVA 1N7XA 4OETA 3U72A 4H8JA 3IB0A 1SVXB 2HFBA 5I59B 4XXUA 1LB9A 2O1MA 3GXAA 3T93B 2B3BA 3FATA 3IORA 2G29A 4YB5A 3MC2A 1II5A 2A5TA 1MH4A 2VP1A 4M4GA 4FIMA 4OENA 1PC3A 4PFUA 3CIJA 4U22A 2ONSA 3K6UA 4NF4B 2V93A 4R2FA 2PT1A 2XX8A 2UXAA 1POY1 3H6TA 1O63A 5CM6A 4H67A 2DWHA 3MPKA 4LVQA 1B0LA 1OQGA 1S9TA 4LQ5A 3K1PA 1S50A 1FQDA 3U8QA 2D21A 4BDMA 3MW0A 2XXHA 4RPNA 1YCJA 2FNCA 4JWXA 4U4SA 4OYVA 2Y7IA 4GIZA 2UVHA 2YPNA 3B6QA 2ZYKA 1MPCA 3S9LC 3FXRA 1TXFA 2R71A 2QL3A 2B65A 5JK4A 1CB6A 1O64A 1MM7A 3KG2A 1MRPA 4YZZA 4G4PA 4IO3A 1FTMA 1POTA 2AYSA 4LZ8A 4QFOA 4P11A 4FATA 1UTHA 3BFUA 3DP6A 1RYOA 4PE5B 3IK6B 5I57A 1PB8A 1LGBC 1JETA 2OWTA 1ANFA 4C1UA 4X1BA 2I48A 4QSEA 1N3XA 5KCJA 3C35A 1NKXA 3TQWA 1IXCA 4X1DA 3MJNA 2AL5A 1MQHA 3THIA 5AA3A 2ONRA 3EQ1A 3G3KA 5DT6A 2XXUA 3MWBA 3W15C 3WAEA 1FTJA 4GOTA 3G3JA 4OFLA 1B7ZA 2F35A 2ZNUA 2HCAA 3Q27A 3CSGA 1SI0A 4QHQA 5ICQA 3MBPA 3TTLA 3K00A 3VXCA 3VFJA 2DXYA 3HHFA 4JWOA 2Z8DA 1XT8A 4YB7A 2DWAA 1ZBMA 2THIA 3KJTA 1WDNA 1DPEA 1QW0A 1VE4A 3U94A 4MBPA 4C0RA 2NOOA 1BTJA 3EHTA 3SEYA 1NH8A 4JDFA 3D4GA 1SI1A 1PEBA 1OLAA 2ZXTA 2I4BA 1XVYA 4F3BA 4DCYA 3KN7A 4KCCA 2OLBA 4Q0CA 1NL5A 4YB6A 2I3VA 4RPOA 5AE4A 2XD3A 3LSFB 4YKPA 3FV2A 3LSWA 4IGTA 4ZE9A 3MPLA 3DELB 3HN0A 2VOZA 4U2RA 3TCGA 4OESA 1IEJA 2Y7KA 4N6PA 5DVJA 2DSFA 1N84A 3PV0E 5B7DA 4R75A 3T96B 3EPEA 1LCFA 2XXQA 1LLSA 4THIA 3Q29A 2UVGA 4X48A 3RTFB 5IAIA 4DZ1A 1H44A 2OBGA 1NNPA 3IJXB 5H8HB 2A5SA 1OVBA 1SQYA 3R7XA 1Y3QA 2NUVA 5AA4B 5H8NB 1TFAA 4KYDA 1B46A 1UQWA 4QFNA 3OELA 3RTWB 3PUZE 4U1OA 3H6WA 4G8MA 4ZS9A 1DSNA 2XXXA 4G68A 4NF5B 1A54A 5TP9B 3MP8A 4KFQA 5FTIA 3BBRA 3T9VA 2RINA 3FVGA 3RQTA 4GL0A 1B52A 4KD5A 3IB1A 4K3FA 4BDOA 2R6GE 2DE2A 1LFGA 3W9WA 2OZZA 1A99A 4UACA 2XXVA 5HBCA 1FW0A 2DWIA 2Q9TA 2XHDA 4R6YA 4FORA 1AH5A 3MVYA 3LUYA 4POXA 4JSOA 4NF6B 1VSOA 4TLLB 3USDA 4C1TA 3A3UA 1A8EA 3GBAA 3A09A 4LATA 2FYIA 1XHYA 3DM0A 3SKPA 4HCYA 3FXUA 1MDP1 5AA2B 1LBCA 4ZEIA 1Z7NE 5CMKA 4PQJA 4GQOA 1B5IA 2XXYA 2AIXA 4H5GA 1ZMGA 1OQHA 5KDTB 5CRYA 1IUDA 1B32A 3R26A 4F3SA 4GXAA 4FE8A 1BLFA 3PPRA 1XC1A 2H99A 5JTYA 1A40A 3PD9A 3PUWE 2VD3A 2P0SA 5H8QA 3PPNA 4I1DA 1LBBA 5JEIA 1A55A 1IXHA 2X7PA 1D9VA 3OEMA 2CZLA 1QUIA 4OWDA 1SW4A 1MY1A 1MG1A 2RCAA 3UA8A 4F1UA 1RYXA 4G77A 4O3BA 3H7MA 3O66A 4NF8A 3PUYE 3TUSA 2HZKA 2ONKE 4H0WA 3G3HA 4R6KA 3HV1A 3VVDA 3PPQA 1Y4CA 1RKMA 5EHSA 1B1XA 1Z7ME 3PPPA 2PT2A 1Y4TA 2REGA 2Y7WA 1M5EA 4R2BA 1AIVA 5EYFA 3BFTA 2FA7A 2F36A 5I2NB 4I8CA 4XKQA 1MS7A 1UTBA 4EQ9A 4N13A 3IL1B 4LQ2A 4BDNA 3T9HB 2GFEA 3KN8A 2NVUB 3PU5A 1I6QA 4P0IA 2V3UA 1JEVA 3FV1A 1B5JA 1R9LA 4PFYA 4ZEKA 2OCUA 4ELQA 4UA8A 4OHNA 2RKMA 4H1XA 1PB7A 3FJ7A 2PYYA 4MH5A 1PBPA 3OENA 3KSJA 4TOZA 2F34A 4XTCQ 3VLVA 3MZBA 5I2KA 3TMGA 3SEVA 2Z22A 1NNTA 4JB7A 2GRVA 2V25A 3KGCA 4ZDMA 3HHGA 3I5OA 3KN3A 3OO8A 1B3GA 4QSCA 1MY0A 1MXUA 4QFLA 3FJMA 4IY5A 4ESXA 1AL3A 1B1HA 5HM4B 1FQBA 2E0SA 3MQ9A 2VD2A 5I59A 1H43A 1USYH 3OSQA 1EZOA 3KEIA 3C33A 4FEBA 3SDFA 2P1SA 4PFTA 1B5HA 3DP4A 4QFKA 3ZKKA 2QPQA 1FQCA 1VR5A 1UIUA 3IO6A 1MQDA 4IO7A 3RPWA 3EHUA 4KCDA 5CI5A 1SYIA 4NF4A 5I56B 2UVJA 1FQEA 3L6HA 5DVIA 3V89B 3IX1A 2DE4A 3OMBA 3LBSA 2HQ0A 2Z8FA 4XKRA 2E1SA 2Q8JA 5DEXB 2I3WA 3TYHA 3U93A 1HSJA 2DQVA 1FTKA 3TTKA 2O7IA 1P1QA 3TTNA 5DVFA 4NEDA 1HSLA 5BWJA 4MFIA 1FTOA 3JV9A 5FHMA 1JVYA 3M3KA 2UVIA 1MQGA 4RJZA 4JXIA 1B51A 4L17A 3PMXA 3GLBA 3PMWA 1IQ7A 1R9QA 3MUQA 4U4XA 1MXVA 2ALUA 2GH9A 3DP8A 3H6VA 4LZ7A 4DLDA 3Q25A 1PB9A 2HAUA 3LC8A 4RK9A 2RC7A 3JYRA 4IO4A 3SEXA 2XXTA 1N0TA 4ESWA 1B7UA 4EDPA 1JW4A 2QS1A 1IXGA 4QRZA 3SERA 2Q2CA 4G8HA 1Q1KA 3N26A 4ZEFA 3MVWA 4LONB 5CMMA 3IOWA 5TPAB 4IO6A 2F7BA 1MXXA 3D4CA 1WVJA 1B6HA 4E0XA 4IO5A 4DXCA 2Q2AA 2XXWA 2F5XA 4F3GA 3N6TA 2DXRA 4OTEA 2HXWA 1OMPA 2DWJA 1B9JA 3QUFA 1MH3A 3S9NC 3PPOA 4F19A 4H5FA 1LAGE 4WXJA 3K6VA 2X26A 1QUJA 2ZNSA 3ZKLA 4HS7A 4ZEBA 3S9EA 1VFDA 1URDA 4GL8A 1URSA 3N94A 3C36A 5H8FB 1Y20A 4R73A 3K02A 1IIWA 1D3KA 4ECFA 4LA9A 1XOCA 3VDFA 5L9OA 1IZ1A 4PFWA 4NMYA 3VE1B 1N76A 4WEDA 4Q8RA 4IB2A 4EXKA 3GBBA 4LUBA 4QSDA 1GTKA 3O97A 1ZIUA 4U23A 2F6GA 1BP5A 2ESNA 2OK2A 5H8HA 3KJ7A 1B3EA 4F39A 3QYTA 4EQ7A 3RT6B 4LP2B 3OXNA 2F7AA 5AA4A 5H8NA 4ELOA 3JZJA 1MPDA 2Q89A 2QS3A 2KLFA 1B58A 2O69A 1QUKA 1N04A 2QMWA 4IGRA 1I6BA 1TT1A 2NXOA 3PUXE 1DPPA 5H8SA 3O2AA 2Q88A 4NF5A 5TP9A 2DVZA 4R9FA 5M2VA 4AB5A 3EN3A 2V84A 4ISUA 3CRBA 1KWHA 1D9YA 3F11A 4Z7EA 5LOMA 2O51A 3ILTB 3H6UA 2V3TA 2I4CA 1AOVA 3C4MA
chains in the Genus database with same CATH superfamily
1CE2A 3G3FA 4PETA 3OSRA 1QKAA 1P1OA 4Q30B 2F8DA 4BDQA 2CEYA 1QKBA 3A29A 1I69A 1Y3NA 1QULA 3UN6A 3CFLA 2Y5KA 4NWCA 3W9VA 2XXRA 1P1NA 4OVSA 3TDJA 4ZE8A 3I3VA 2O7UA 5FHNA 4NF6A 1ELJA 3MYUA 3B6TA 4OQOA 3ROJA 4R74A 3VVFA 3ECRA 3FUZA 4EUOA 3V83A 5AA2A 1ZU0A 1FRPA 3E3KA 1HSEA 3A3CA 1JW1A 5J1DA 4Z0IA 4DDDA 1M5BA 3CFZA 1M5CA 3CR9A 5AA1A 3OEKA 5KDTA 3O6HA 1DBZA 4RY1A 4PP0A 4JSDA 3VXBA 3O6IA 3HPIA 4P47A 5K2XA 2LAOA 3FJGA 4DCXA 1BKAA 1NV4A 1JVXA 4H65A 3RPLB 4F1YA 4F22A 3I6VA 3GZGA 1KA0A 4HCWA 3KC1A 3VVEA 2HZLA 3H03A 1JW5A 3IR1A 2HEUA 3E13X 2XXPA 1MXYA 3K1MA 1N3WA 3TCHA 2M8CA 1FBFA 4GWXA 4MF3A 3K01A 3IOVA 4FBPA 1IXIA 2XWOA 1P1WA 2V3QA 2XWVA 5CC2A 2DS9A 4OZ9A 1KZ8A 4MCOA 1XVXA 3QXMA 1LSTA 5KZTA 4I9DA 1VFEA 4YKKA 3CFXA 3LR1A 1MDQA 2FIXA 1MXWA 2DYXA 3C32A 4TQUQ 3RUMA 1GVCA 3CG1A 3VV5A 2XD2A 1MQJA 1GGGA 1B3HA 5A5XB 4KR5A 1R6ZA 2ZYNA 3QSLA 4LZ5A 2MKZA 5L9SA 5I58B 2PFYA 3K4UA 3DLNA 2QVUA 2QVVA 4U21A 1B40A 2KQZA 5I2NA 3QUJA 4WEPA 3KOSA 4EQBA 3K6XA 1IITA 4DE8A 4XEQA 1F9BA 2XX9A 1H76A 5L8DA 3TODA 2O6AA 4MAGA 4PAIA 4GBVA 2CMOA 2F78A 5IKBA 4NQ8A 4OVQA 4JWYA 3B7DA 1AMFA 1XS5A 2NWJA 3KOTA 5B70A 4H8IA 4BDRA 3FXQA 4NTLA 4AB6A 1DMBA 2A5TB 1I6AA 3OOAA 3QK6A 5IZZA 2GHAA 1SYHA 1B0HA 1ZJLA 4KQPA 2Y7RA 2OWSA 5ELVA 2ZYOA 5DTBA 5BUUA 3ILUB 3RY3A 1B3LA 1SW1A 4GWZA 1K9YA 4P0GA 4KI0E 3TTRA 1NV1A 3RNNA 4DI3D 4YU0A 2I49A 3VLUA 4EF2A 5LTCA 4MX6A 2OX3A 2IA4A 2P3NA 1NH7A 4ZECA 4POWA 4OVTA 2XXIA 3HCQA 3K6WA 3QIMA 4NWDA 3FGSA 4KPTA 4IY6A 3T22A 4NHBA 4KYSA 4UABA 3MP1A 2XX7A 3M3LA 4GX4A 3TCFA 1B4HA 3MZ1A 5EQ8A 5EQAA 3MP6A 4AQ4A 2DOJA 2PFZA 4EXLA 2UYEA 1LAFE 2RC8A 4RXLA 1EYJA 3L6GA 4OA4A 1N7WA 3H4ZA 1LBVA 3TELA 2XA5A 3H3GA 3CG3A 3UGWA 1NNKA 5I56A 1UTHB 3E4RA 2I58A 2Q74A 3PD8A 5I57B 1QJMA 2UYFA 2QS2A 4O8MA 5KCJB 1NV6A 3T9UA 4F29A 5DEXA 1SDXA 1WODA 4P1EA 4P1LA 1OLCA 4OFOA 1YAEA 3TKDA 5L9MA 4YMAA 4OMBA 2HHMA 4QFPA 2ZMBA 1URGA 3C34A 1Y9UA 5FBPA 4GVOA 4OVJA 1TFDA 1B05A 2VHAA 2YLNA 1LAHE 4IO2A 1EU8A 2REJA 5I7IA 2O68A 4O94A 4YMBA 2Z23A 3V5AA 1FQFA 3HO7A 4BDLA 1SW2A 2B4MA 4HE0A 1MY4A 3O9PA 1R1NA 3TPAA 3K2DA 1GR2A 5ITOA 1IMCA 3BKIB 4H6DA 4M1VA 3OO9A 5CMBA 1USYE 3P7IA 3G7WA 5K2YA 4G2ZA 1D9QA 4NX1A 1NMUA 2R9JA 4E0WA 4DXBA 4TLMB 2X7QA 3S4UA 3B6WA 4YICA 4PE3A 3CVGA 4HTGA 1P1UA 5FTHA 1ATGA 5ITPA 4RNSA 1EZ9A 2VGQA 2QRYA 1LBXA 4F2QA 1FPFA 4OEUA 2PVUA 2I0BA 4NAPA 1LCTA 4MLVA 2H9BA 3UK4A 4ZZEA 3RN8A 1MM6A 3ZS6A 2IEEA 1OVTA 1J1NA 4YKJA 4ZEDA 5TPAA 4NF0A 4FECA 4ELPA 1MPBA 3Q28A 3KC0A 3O29A 1PBQA 4XKPA 4F31B 3K1NA 2I6EA 1A8FA 1O7TA 4Q5TA 5ISUA 2O84X 1FTLA 3MZ9A 1FPBA 1MQIA 3IFCA 2W7YA 4JBZA 4X9TA 3FXBA 3UIFA 3S9MC 4EF1A 3UORA 1Y1ZA 3BIGA 3SEWA 1B7HA 4F1VA 2P2AA 4LN5A 4KYEA 2WKYA 4WKMA 3OO6A 3H06B 4F18A 1NI9A 4N07A 3ONMA 3M3FA 1T0KA 1EH3A 3CSBA 5FHOA 4F3PA 4PBHA 1B4ZA 1ZKBA 1JEUA 5F1QA 1ZTYA 3FASA 5H8FA 1D4NA 3AXFA 3WAFA 4GLIA 2XXKA 1JNFA 4XIGQ 3CI8A 3O6GA 1DTGA 3EHSA 2RF1A 3LSLA 5I3SA 2DE3A 5LDZA 2ZNTA 3ODBA 4FJPA 4OXVA 5EHMA 3TTMA 5ICTA 3IAZA 2H5YA 2QSXA 4G68B 4X04A 4R6HA 3KFMA 4N15A 3RGYA 2B3FA 4R9GA 4GXSB 2ANJA 2DVCA 4FAJA 3HSTA 3KZGA 1Q35A 4XKNA 4OFJA 1NV3A 4I62A 3T9XB 1ZLQA 2RC9A 3TZAA 4YAHX 3C31A 3FVOA 3PGFA 4GD5A 5I84A 3MAMA 3FIRA 1A7LA 1YPNA 1NFTA 2ABHA 3G3IA 2QMXA 3OD7A 3G3GA 2YJPA 2AL4A 1US4A 2GHBA 4OEVA 1YTVA 1NNFA 4F2OA 1UIVA 4G68C 5CBSA 2G93A 2ZZWA 3K0VA 2Y84A 2WYPA 1GV8A 3U1OA 3R6UA 1SBPA 3T0JA 4GF8A 1B2HA 2VT5A 3T66A 4GRKA 5HPQA 2F7CA 3FVKA 2D5WA 3OO7A 3CHGA 2PX1A 3EF7A 3TQLA 3M8UA 2ZYMA 1LBWA 1LFHA 1FCKA 2F6PA 1NV5A 2H25A 2RCBA 4G8NA 5DYHA 5JTYB 3VLWA 3KBRA 1FQAA 1SD3A 4GWUA 4GFRA 1S7YA 4DXUA 3UP9A 5H8QB 3PUVE 1B3FA 1K9ZA 5TU0A 1MY2A 4JVCA 2OJTA 2BJJX 4KHZE 3IOTA 1FTAA 3LSXA 4QF9A 1Y3PA 1M5FA 3E9XA 2H4IA 3QAXA 1LFIA 3QMFA 1LB8A 1YZ0A 1OIBA 2PBWA 1JQFA 4X8RA 1DTZA 3FVNA 3FD3A 2H98A 3MVXA 1H3DA 4NF8B 1YYZA 3U92A 5J16A 3O28A 2CZIA 1NV0A 3V8XB 2DP8A 3RLFE 4ND9A 2CEXA 4FEDA 4BLAA 3TFLA 3IJOB 3RPLA 1H45A 4U1ZA 3SEUA 1SW5A 1QVSA 4MLQA 5CMCA 2PMSA 4PDDA 3IO4A 3IOUA 4RA1A 2L5VA 1MY3A 4O3CA 2F97A 3ZSFA 3MVZA 3SESA 2Y7PA 2F3BA 1TWYA 1UTBB 1DOTA 5I5PA 1LAXA 4PAKA 1M5DA 4OERA 4R72A 4ELRA 4PFRA 1EZPA 4P56A 1MXZA 4RYAA 2QS4A 4MMPA 3N5LA 5F7VA 3IB2A 4NE4A 4HW8A 3S2VA 1P99A 1PDAA 1FPGA 2D3IA 1L5TA 4GBWA 1QGXA 3N6UA 3Q26A 2QJEA 3ISPA 1US5A 3FZVA 4PFBA 1Y1MA 5A5XA 3TEPA 3KSXA 4MJOA 2O1LA 4O3AA 5IZ3B 3SETA 3TAJA 2Z8EA 4ONYA 5AA2D 5I2KB 5I58A 3RT8A 4GWOA 1BIYA 4DIGA 4YKIA 4OVRA 3PMVA 5CBRA 4ZZAA 3C9HA 2I0CA 4RK2A 2HAVA 1N7XA 2R8TA 4N91A 4OETA 2OWZA 3U72A 4H8JA 3IB0A 1SVXB 2HFBA 1RDXA 5I59B 4XXUA 1LB9A 2O1MA 3GXAA 3T93B 2B3BA 4O7MA 4NN3A 3FATA 3IORA 5ESYA 2ZZXA 2G29A 4YB5A 3MC2A 1II5A 5F24A 2A5TA 1MH4A 2VP1A 4M4GA 2VPOA 4FIMA 4OENA 1PC3A 4PFUA 3CIJA 4U22A 2ONSA 3K6UA 4NF4B 2V93A 4R2FA 2PT1A 2XX8A 1NV2A 2UXAA 1POY1 3H6TA 2DDKA 1NUWA 4G61A 1O63A 5CM6A 4H67A 2DWHA 3MPKA 4AS4A 4LVQA 1B0LA 1OQGA 1S9TA 4LQ5A 3K1PA 1S50A 1FQDA 3U8QA 2D21A 4BDMA 3MW0A 2XXHA 4RPNA 1YCJA 2FNCA 4JWXA 4U4SA 4OYVA 2Y7IA 4GIZA 4OANA 2FBPA 2UVHA 2YPNA 3B6QA 2ZYKA 1MPCA 3S9LC 3FXRA 1TXFA 2R71A 2QL3A 2B65A 5JK4A 1CB6A 1O64A 1MM7A 3KG2A 1MRPA 5ET7A 4PF8A 4YZZA 4G4PA 4IO3A 4H45A 1FTMA 4PFIA 1POTA 2AYSA 4LZ8A 4QFOA 4P11A 4FATA 1UTHA 3BFUA 1FPKA 3DP6A 5ET8A 1RYOA 1FBHA 4PE5B 3IK6B 5I57A 1PB8A 1LGBC 1JETA 2OWTA 1ANFA 4C1UA 4X1BA 2I48A 4QSEA 1N3XA 5KCJA 3C35A 1NKXA 3TQWA 2F3DA 1IXCA 2Y5LA 4X1DA 3MJNA 2AL5A 5EQ7A 1MQHA 3THIA 5AA3A 1CNQA 2ONRA 3EQ1A 3G3KA 5DT6A 3B50A 2XXUA 3MWBA 3W15C 3WAEA 1FTJA 4GOTA 3G3JA 4OFLA 4PC9A 1B7ZA 2F35A 2ZNUA 1FPIA 2HCAA 3Q27A 3SZPA 4JVIA 3CSGA 1SI0A 4QHQA 5ICQA 3MBPA 1BK4A 3TTLA 3K00A 1YXIA 3VXCA 3VFJA 2DXYA 3HHFA 4JWOA 2Z8DA 1XT8A 4YB7A 2DWAA 1ZBMA 3U65A 2THIA 3KJTA 1SPIA 1WDNA 1DPEA 1QW0A 1VE4A 3U94A 2JJKA 4MBPA 4C0RA 2NOOA 1BTJA 3EHTA 3SEYA 1NH8A 4JDFA 4DI4B 3D4GA 1SI1A 1PEBA 1OLAA 5A5LA 2ZXTA 2I4BA 1XVYA 4F3BA 4DCYA 3KN7A 4OVPA 4KCCA 2OLBA 4Q0CA 4PTKA 1NL5A 4YB6A 2I3VA 2P3VA 4RPOA 5EYGA 5AE4A 2XD3A 3LSFB 1NUXA 4YKPA 3FV2A 3LSWA 4IGTA 4ZE9A 4HXVA 3MPLA 4GX3A 4P8BA 3DELB 3HN0A 2VOZA 4U2RA 4N6DA 3TCGA 4OESA 1IEJA 2Y7KA 4N6PA 5DVJA 2DSFA 1N84A 3PV0E 5B7DA 4R75A 1VDWA 3T96B 3D1RA 3EPEA 1LCFA 2XXQA 1LLSA 4THIA 3MSTA 3Q29A 2UVGA 4X48A 3RTFB 5IAIA 4DZ1A 1H44A 2OBGA 3KBZA 1NNPA 3IJXB 5H8HB 2A5SA 2ZZVA 1OVBA 1SQYA 3R7XA 1Y3QA 4AS5A 4GWWA 1NV7A 2NUVA 5AA4B 2HPGA 5H8NB 4PGNA 1TFAA 4KYDA 1B46A 2WYKA 1UQWA 4QFNA 1FBDA 3OELA 3RTWB 3RYDA 3PUZE 1LEVA 4U1OA 3H6WA 4G8MA 4ZS9A 1DSNA 2WBBA 2XXXA 4P9KA 4G68A 4NF5B 1A54A 5TP9B 3MP8A 5T3JA 4KFQA 5FTIA 3BBRA 3T9VA 1FBGA 2RINA 1FBPA 3FVGA 3RQTA 4GL0A 1B52A 4KD5A 3IB1A 1Q9DA 4K3FA 4PF6A 1DK4A 4BDOA 2R6GE 2DE2A 4GX6A 2Q8MA 1LFGA 3W9WA 2OZZA 1A99A 4UACA 2XXVA 5HBCA 3LUZA 1FW0A 2DWIA 2Q9TA 4NG7A 2XHDA 4R6YA 4FORA 1AH5A 3MVYA 3LUYA 1IMFA 3GYYA 1FSAA 4POXA 4JSOA 4NF6B 1VSOA 4TLLB 3USDA 4C1TA 1FJ6A 5ET6A 3A3UA 1A8EA 3GBAA 3A09A 4JVDA 4LATA 2FYIA 1XHYA 3DM0A 3SKPA 4HCYA 3FXUA 1MDP1 5AA2B 1LBCA 4ZEIA 1Z7NE 3BIHA 5CMKA 4PQJA 4GQOA 4PDHA 1B5IA 2XXYA 2FVZA 2AIXA 4H5GA 1ZMGA 1OQHA 5KDTB 4QBAA 1G0IA 5CRYA 2XWIA 1IUDA 1IMEA 4MNCA 1B32A 3R26A 4F3SA 4I3EA 4GXAA 4FE8A 2XWKA 1BLFA 3PPRA 1XC1A 2H99A 3IFAA 5JTYA 1A40A 3PD9A 3PUWE 2VD3A 2P0SA 1KA1A 5H8QA 3PPNA 4I1DA 1LBBA 5JEIA 1A55A 4HE2A 1IXHA 4NGUA 2X7PA 3E79A 1D9VA 3OEMA 2CZLA 1QUIA 4IR8A 4OWDA 1SW4A 1MY1A 1MG1A 2RCAA 3UA8A 4QXDA 4F1UA 1RYXA 4G77A 4O3BA 3H7MA 2QVRA 3O66A 4GWYA 4NF8A 3PUYE 4N8YA 3TUSA 2HZKA 2ONKE 4H0WA 3G3HA 4R6KA 3HV1A 1FJ9A 3VVDA 1EYKA 3PPQA 1Y4CA 1RKMA 5EHSA 1B1XA 1Z7ME 3PPPA 2PT2A 2FHYA 1Y4TA 2REGA 2Y7WA 1M5EA 4R2BA 1AIVA 5EYFA 3BFTA 2FA7A 5IGAA 2F36A 4I3YA 5I2NB 1FPLA 4I8CA 4XKQA 1MS7A 1UTBA 3FBPA 4EQ9A 4N13A 3IL1B 1NUYA 4LQ2A 4BDNA 1NUZA 3T9HB 2GFEA 3KN8A 2CZKA 2NVUB 3PU5A 1I6QA 4P0IA 2V3UA 1JEVA 3FV1A 1B5JA 1R9LA 4PFYA 4ZEKA 2OCUA 4ELQA 4UA8A 4OHNA 2RKMA 4H1XA 1PB7A 3FJ7A 2PYYA 5IZ3A 4MH5A 1PBPA 3OENA 3KSJA 4N4UA 4TOZA 2F34A 4XTCQ 3VLVA 2BJIA 3MZBA 5I2KA 3TMGA 3SEVA 4XF5A 2Z22A 2CZHA 1NNTA 4JB7A 2GRVA 2V25A 4MNPA 3KGCA 4ZDMA 3HHGA 4KXPA 3I5OA 3KN3A 3OO8A 3E78A 1B3GA 4QSCA 1MY0A 1MXUA 4QFLA 3FJMA 4IY5A 4ESXA 1AL3A 1B1HA 5HM4B 1FPDA 1FQBA 2E0SA 3MQ9A 2VD2A 5I59A 1H43A 1USYH 3OSQA 3LV0A 1EZOA 3KEIA 3C33A 4FEBA 3SDFA 2P1SA 3NOHA 4PFTA 1B5HA 3DP4A 4QFKA 3ZKKA 2QPQA 4MEVA 1FQCA 1VR5A 1FBCA 1UIUA 3IO6A 1MQDA 5EYHA 4IO7A 3RPWA 3EHUA 4KCDA 5CI5A 1SYIA 4NF4A 5I56B 2UVJA 1FQEA 3L6HA 5DVIA 3V89B 3IX1A 2DE4A 3OMBA 3LBSA 2HQ0A 2Z8FA 4XKRA 2E1SA 1IMBA 4GWSA 4N6KA 2Q8JA 5DEXB 2I3WA 3TYHA 3U93A 1HSJA 2DQVA 1FTKA 3TTKA 2PCRA 1RDZA 2O7IA 1P1QA 3B8BA 3TTNA 5DVFA 4NEDA 1HSLA 5BWJA 4MFIA 4N17A 1FPEA 1FTOA 1DCUA 3JV9A 4H46A 1AWBA 5FHMA 1JVYA 3M3KA 2UVIA 1MQGA 4RJZA 4JXIA 1B51A 4L17A 2WX9A 3PMXA 3GLBA 3PMWA 1IQ7A 1R9QA 3MUQA 4U4XA 1LBZA 2WEFA 1MXVA 1G0HA 2ALUA 2GH9A 3DP8A 3H6VA 4LZ7A 4DLDA 3Q25A 1PB9A 2HAUA 3LC8A 4RK9A 2RC7A 3JYRA 4IO4A 3SEXA 2XXTA 3HFUA 1N0TA 5ET5A 4ESWA 1B7UA 4EDPA 4MIJA 4N81A 1LBYA 1JW4A 1FPJA 2QS1A 1IXGA 4QRZA 3SERA 2Q2CA 2FIEA 4G8HA 1Q1KA 3N26A 3EKIA 3MVWA 4LONB 3PTYA 5CMMA 4ZEFA 3IOWA 5IZ1A 2HXRA 5TPAB 4IO6A 2F7BA 1MXXA 3D4CA 1WVJA 2QFLA 1B6HA 4E0XA 5DW8A 4O7IA 4IO5A 4DXCA 2Q2AA 2XXWA 2F5XA 4F3GA 3N6TA 4MHFA 2DXRA 4OTEA 2HXWA 3T1BA 1OMPA 1JP4A 2DWJA 4I40A 1B9JA 3QUFA 1MH3A 4PGPA 3S9NC 3PPOA 4F19A 4PBQA 4H5FA 1LAGE 4WXJA 3K6VA 2X26A 1QUJA 2ZNSA 3ZKLA 4HS7A 4ZEBA 3S9EA 1VFDA 1XI6A 1URDA 1INPA 4GL8A 1URSA 3N94A 3C36A 5H8FB 1Y20A 4N8GA 4R73A 3K02A 1IIWA 1D3KA 4ECFA 4LA9A 2B4LA 1XOCA 3VDFA 1IMDA 5L9OA 1IZ1A 4PFWA 4NMYA 3VE1B 1N76A 4WEDA 4Q8RA 5EQ9A 4IB2A 4EXKA 1IMAA 4XFEA 3GBBA 4LUBA 4QSDA 1GTKA 5IM2A 2V4CA 3O97A 1ZIUA 4P3LA 4MNIA 4U23A 2F6GA 2WBDA 1BP5A 2ESNA 2OK2A 5H8HA 3KJ7A 4PCDA 1B3EA 4F39A 3QYTA 4EQ7A 1RDYA 2KR0A 3RT6B 4LP2B 3OXNA 2F7AA 5AA4A 5H8NA 4ELOA 3JZJA 1MPDA 4PAFA 2Q89A 2QS3A 2KLFA 1B58A 2O69A 2GQ1A 1FBEA 1QUKA 1N04A 2QMWA 4IGRA 1I6BA 1TT1A 2NXOA 3PUXE 1DPPA 2VPNA 5H8SA 3O2AA 2Q88A 4NF5A 5TP9A 2DVZA 4R9FA 5M2VA 4AB5A 3EN3A 2V84A 4ISUA 3CRBA 1KWHA 1D9YA 3F11A 4Z7EA 5LOMA 1EYIA 2O51A 3ILTB 3H6UA 2V3TA 2I4CA 4HE1A 1AOVA 3C4MA
chains in the Genus database with same CATH topology
1CE2A 3G3FA 4PETA 3OSRA 1QKAA 1P1OA 4Q30B 2F8DA 4BDQA 1QKBA 1I69A 1Y3NA 1QULA 3UN6A 3CFLA 4NWCA 3W9VA 2XXRA 1P1NA 3TDJA 4ZE8A 3I3VA 2O7UA 5FHNA 4NF6A 1ELJA 3B6TA 4OQOA 4R74A 3VVFA 3ECRA 3FUZA 4EUOA 3V83A 5AA2A 1ZU0A 3E3KA 1HSEA 3A3CA 1JW1A 5J1DA 4Z0IA 4DDDA 1M5BA 3CFZA 1M5CA 3CR9A 5AA1A 3OEKA 5KDTA 3O6HA 4RY1A 4PP0A 4JSDA 3VXBA 3O6IA 3HPIA 5K2XA 2LAOA 3FJGA 4DCXA 1BKAA 4H65A 1JVXA 4F1YA 4F22A 3I6VA 3GZGA 4HCWA 3VVEA 2HZLA 3H03A 1JW5A 3IR1A 2HEUA 3E13X 2XXPA 1MXYA 3K1MA 1N3WA 3TCHA 2M8CA 4MF3A 3K01A 3IOVA 1IXIA 1P1WA 2V3QA 5CC2A 2DS9A 4OZ9A 1XVXA 3QXMA 1LSTA 5KZTA 4I9DA 1VFEA 4YKKA 3CFXA 3LR1A 1MDQA 1MXWA 2DYXA 3C32A 4TQUQ 3RUMA 1GVCA 3CG1A 3VV5A 2XD2A 1MQJA 1GGGA 1B3HA 5A5XB 4KR5A 1R6ZA 2ZYNA 3QSLA 4LZ5A 5L9SA 5I58B 3K4UA 3DLNA 4U21A 1B40A 5I2NA 3QUJA 4WEPA 3KOSA 4EQBA 3K6XA 1IITA 4DE8A 1F9BA 2XX9A 1H76A 5L8DA 3TODA 2O6AA 2CMOA 2F78A 5IKBA 4JWYA 3B7DA 1AMFA 1XS5A 2NWJA 3KOTA 5B70A 4H8IA 4BDRA 3FXQA 4NTLA 4AB6A 1DMBA 2A5TB 1I6AA 3OOAA 3QK6A 2GHAA 1SYHA 1B0HA 1ZJLA 4KQPA 2Y7RA 2OWSA 5ELVA 2ZYOA 5DTBA 5BUUA 3ILUB 3RY3A 1B3LA 1SW1A 4P0GA 4KI0E 3TTRA 3RNNA 4YU0A 2I49A 3VLUA 4EF2A 2IA4A 1NH7A 4ZECA 4POWA 2XXIA 3HCQA 3K6WA 3QIMA 4NWDA 3FGSA 4KPTA 4IY6A 3T22A 4KYSA 3MP1A 2XX7A 3M3LA 3TCFA 1B4HA 3MZ1A 3MP6A 4AQ4A 2DOJA 4EXLA 2UYEA 1LAFE 2RC8A 4RXLA 3L6GA 1N7WA 3H4ZA 3TELA 3H3GA 3CG3A 3UGWA 1NNKA 5I56A 1UTHB 3E4RA 2I58A 3PD8A 5I57B 1QJMA 2UYFA 2QS2A 5KCJB 3T9UA 4F29A 5DEXA 1SDXA 1WODA 1OLCA 4OFOA 1YAEA 3TKDA 5L9MA 4YMAA 4OMBA 4QFPA 2ZMBA 1URGA 3C34A 1Y9UA 4GVOA 4OVJA 1TFDA 1B05A 2VHAA 2YLNA 1LAHE 4IO2A 1EU8A 2REJA 2O68A 4YMBA 2Z23A 3V5AA 1FQFA 3HO7A 4BDLA 1SW2A 1MY4A 3O9PA 1R1NA 3TPAA 3K2DA 1GR2A 5ITOA 3BKIB 4H6DA 4M1VA 3OO9A 5CMBA 1USYE 3P7IA 3G7WA 5K2YA 4G2ZA 1NMUA 2R9JA 4E0WA 4DXBA 4TLMB 2X7QA 3S4UA 3B6WA 4YICA 3CVGA 4HTGA 1P1UA 5FTHA 1ATGA 5ITPA 4RNSA 1EZ9A 2VGQA 2QRYA 4F2QA 4OEUA 2PVUA 2I0BA 1LCTA 4MLVA 2H9BA 3UK4A 4ZZEA 3RN8A 1MM6A 3ZS6A 2IEEA 1OVTA 1J1NA 4YKJA 4ZEDA 5TPAA 4FECA 4ELPA 1MPBA 3Q28A 3O29A 1PBQA 4XKPA 4F31B 3K1NA 2I6EA 1A8FA 1O7TA 4Q5TA 5ISUA 2O84X 1FTLA 3MZ9A 1MQIA 3UIFA 2W7YA 4JBZA 4X9TA 3S9MC 4EF1A 3UORA 1Y1ZA 3SEWA 1B7HA 4F1VA 2P2AA 4KYEA 2WKYA 4WKMA 3OO6A 3H06B 4F18A 4N07A 3ONMA 3M3FA 1T0KA 1EH3A 3CSBA 5FHOA 4F3PA 1B4ZA 1ZKBA 1JEUA 5F1QA 1ZTYA 3FASA 5H8FA 1D4NA 3AXFA 3WAFA 4GLIA 1JNFA 4XIGQ 3CI8A 3O6GA 1DTGA 3EHSA 2RF1A 3LSLA 2DE3A 2ZNTA 3ODBA 4FJPA 4OXVA 5EHMA 3TTMA 5ICTA 3IAZA 2H5YA 2QSXA 4G68B 4R6HA 3KFMA 3RGYA 2B3FA 4R9GA 4GXSB 2ANJA 2DVCA 4FAJA 3HSTA 3KZGA 1Q35A 4XKNA 4OFJA 4I62A 3T9XB 1ZLQA 2RC9A 3TZAA 4YAHX 3C31A 3FVOA 3PGFA 4GD5A 5I84A 3MAMA 3FIRA 1A7LA 1YPNA 1NFTA 2ABHA 3G3IA 2QMXA 3OD7A 3G3GA 2YJPA 2AL4A 1US4A 2GHBA 4OEVA 1YTVA 1NNFA 4F2OA 1UIVA 4G68C 5CBSA 2G93A 3K0VA 2Y84A 1GV8A 3U1OA 3R6UA 1SBPA 4GF8A 1B2HA 3T66A 4GRKA 5HPQA 2F7CA 3FVKA 2D5WA 3OO7A 2PX1A 3EF7A 3TQLA 3M8UA 2ZYMA 1LFHA 1FCKA 2F6PA 2H25A 2RCBA 4G8NA 5DYHA 5JTYB 3VLWA 3KBRA 1FQAA 1SD3A 4GFRA 1S7YA 4DXUA 3UP9A 5H8QB 3PUVE 1B3FA 5TU0A 1MY2A 2OJTA 2BJJX 4KHZE 3IOTA 3LSXA 4QF9A 1Y3PA 1M5FA 3E9XA 2H4IA 3QAXA 1LFIA 1LB8A 1OIBA 2PBWA 1JQFA 1DTZA 3FVNA 3FD3A 2H98A 3MVXA 1H3DA 4NF8B 3U92A 3O28A 3V8XB 2DP8A 3RLFE 4ND9A 4FEDA 4BLAA 3TFLA 3IJOB 1H45A 4U1ZA 3SEUA 1SW5A 1QVSA 4MLQA 5CMCA 2PMSA 3IO4A 3IOUA 4RA1A 1MY3A 4O3CA 2F97A 3ZSFA 3MVZA 3SESA 2Y7PA 1TWYA 1UTBB 1DOTA 1LAXA 1M5DA 4OERA 4R72A 4ELRA 1EZPA 1MXZA 4RYAA 2QS4A 3N5LA 5F7VA 3IB2A 4NE4A 4HW8A 3S2VA 1P99A 1PDAA 2D3IA 1L5TA 3N6UA 3Q26A 2QJEA 1US5A 3FZVA 1Y1MA 5A5XA 3TEPA 3KSXA 2O1LA 4O3AA 3SETA 3TAJA 2Z8EA 4ONYA 5AA2D 5I2KB 5I58A 3RT8A 4GWOA 1BIYA 4DIGA 4YKIA 3PMVA 5CBRA 4ZZAA 3C9HA 2I0CA 4RK2A 2HAVA 1N7XA 4OETA 3U72A 4H8JA 3IB0A 1SVXB 2HFBA 5I59B 4XXUA 1LB9A 2O1MA 3GXAA 3T93B 2B3BA 3FATA 3IORA 2G29A 4YB5A 3MC2A 1II5A 2A5TA 1MH4A 2VP1A 4M4GA 4FIMA 4OENA 1PC3A 4PFUA 3CIJA 4U22A 2ONSA 3K6UA 4NF4B 2V93A 4R2FA 2PT1A 2XX8A 2UXAA 1POY1 3H6TA 1O63A 5CM6A 4H67A 2DWHA 3MPKA 4LVQA 1B0LA 1OQGA 1S9TA 4LQ5A 3K1PA 1S50A 1FQDA 3U8QA 2D21A 4BDMA 3MW0A 2XXHA 4RPNA 1YCJA 2FNCA 4JWXA 4U4SA 4OYVA 2Y7IA 4GIZA 2UVHA 2YPNA 3B6QA 2ZYKA 1MPCA 3S9LC 3FXRA 1TXFA 2R71A 2QL3A 2B65A 5JK4A 1CB6A 1O64A 1MM7A 3KG2A 1MRPA 4YZZA 4G4PA 4IO3A 1FTMA 1POTA 2AYSA 4LZ8A 4QFOA 4P11A 4FATA 1UTHA 3BFUA 3DP6A 1RYOA 4PE5B 3IK6B 5I57A 1PB8A 1LGBC 1JETA 2OWTA 1ANFA 4C1UA 4X1BA 2I48A 4QSEA 1N3XA 5KCJA 3C35A 1NKXA 3TQWA 1IXCA 4X1DA 3MJNA 2AL5A 1MQHA 3THIA 5AA3A 2ONRA 3EQ1A 3G3KA 5DT6A 2XXUA 3MWBA 3W15C 3WAEA 1FTJA 4GOTA 3G3JA 4OFLA 1B7ZA 2F35A 2ZNUA 2HCAA 3Q27A 3CSGA 1SI0A 4QHQA 5ICQA 3MBPA 3TTLA 3K00A 3VXCA 3VFJA 2DXYA 3HHFA 4JWOA 2Z8DA 1XT8A 4YB7A 2DWAA 1ZBMA 2THIA 3KJTA 1WDNA 1DPEA 1QW0A 1VE4A 3U94A 4MBPA 4C0RA 2NOOA 1BTJA 3EHTA 3SEYA 1NH8A 4JDFA 3D4GA 1SI1A 1PEBA 1OLAA 2ZXTA 2I4BA 1XVYA 4F3BA 4DCYA 3KN7A 4KCCA 2OLBA 4Q0CA 1NL5A 4YB6A 2I3VA 4RPOA 5AE4A 2XD3A 3LSFB 4YKPA 3FV2A 3LSWA 4IGTA 4ZE9A 3MPLA 3DELB 3HN0A 2VOZA 4U2RA 3TCGA 4OESA 1IEJA 2Y7KA 4N6PA 5DVJA 2DSFA 1N84A 3PV0E 5B7DA 4R75A 3T96B 3EPEA 1LCFA 2XXQA 1LLSA 4THIA 3Q29A 2UVGA 4X48A 3RTFB 5IAIA 4DZ1A 1H44A 2OBGA 1NNPA 3IJXB 5H8HB 2A5SA 1OVBA 1SQYA 3R7XA 1Y3QA 2NUVA 5AA4B 5H8NB 1TFAA 4KYDA 1B46A 1UQWA 4QFNA 3OELA 3RTWB 3PUZE 4U1OA 3H6WA 4G8MA 4ZS9A 1DSNA 2XXXA 4G68A 4NF5B 1A54A 5TP9B 3MP8A 4KFQA 5FTIA 3BBRA 3T9VA 2RINA 3FVGA 3RQTA 4GL0A 1B52A 4KD5A 3IB1A 4K3FA 4BDOA 2R6GE 2DE2A 1LFGA 3W9WA 2OZZA 1A99A 4UACA 2XXVA 5HBCA 1FW0A 2DWIA 2Q9TA 2XHDA 4R6YA 4FORA 1AH5A 3MVYA 3LUYA 4POXA 4JSOA 4NF6B 1VSOA 4TLLB 3USDA 4C1TA 3A3UA 1A8EA 3GBAA 3A09A 4LATA 2FYIA 1XHYA 3DM0A 3SKPA 4HCYA 3FXUA 1MDP1 5AA2B 1LBCA 4ZEIA 1Z7NE 5CMKA 4PQJA 4GQOA 1B5IA 2XXYA 2AIXA 4H5GA 1ZMGA 1OQHA 5KDTB 5CRYA 1IUDA 1B32A 3R26A 4F3SA 4GXAA 4FE8A 1BLFA 3PPRA 1XC1A 2H99A 5JTYA 1A40A 3PD9A 3PUWE 2VD3A 2P0SA 5H8QA 3PPNA 4I1DA 1LBBA 5JEIA 1A55A 1IXHA 2X7PA 1D9VA 3OEMA 2CZLA 1QUIA 4OWDA 1SW4A 1MY1A 1MG1A 2RCAA 3UA8A 4F1UA 1RYXA 4G77A 4O3BA 3H7MA 3O66A 4NF8A 3PUYE 3TUSA 2HZKA 2ONKE 4H0WA 3G3HA 4R6KA 3HV1A 3VVDA 3PPQA 1Y4CA 1RKMA 5EHSA 1B1XA 1Z7ME 3PPPA 2PT2A 1Y4TA 2REGA 2Y7WA 1M5EA 4R2BA 1AIVA 5EYFA 3BFTA 2FA7A 2F36A 5I2NB 4I8CA 4XKQA 1MS7A 1UTBA 4EQ9A 4N13A 3IL1B 4LQ2A 4BDNA 3T9HB 2GFEA 3KN8A 2NVUB 3PU5A 1I6QA 4P0IA 2V3UA 1JEVA 3FV1A 1B5JA 1R9LA 4PFYA 4ZEKA 2OCUA 4ELQA 4UA8A 4OHNA 2RKMA 4H1XA 1PB7A 3FJ7A 2PYYA 4MH5A 1PBPA 3OENA 3KSJA 4TOZA 2F34A 4XTCQ 3VLVA 3MZBA 5I2KA 3TMGA 3SEVA 2Z22A 1NNTA 4JB7A 2GRVA 2V25A 3KGCA 4ZDMA 3HHGA 3I5OA 3KN3A 3OO8A 1B3GA 4QSCA 1MY0A 1MXUA 4QFLA 3FJMA 4IY5A 4ESXA 1AL3A 1B1HA 5HM4B 1FQBA 2E0SA 3MQ9A 2VD2A 5I59A 1H43A 1USYH 3OSQA 1EZOA 3KEIA 3C33A 4FEBA 3SDFA 2P1SA 4PFTA 1B5HA 3DP4A 4QFKA 3ZKKA 2QPQA 1FQCA 1VR5A 1UIUA 3IO6A 1MQDA 4IO7A 3RPWA 3EHUA 4KCDA 5CI5A 1SYIA 4NF4A 5I56B 2UVJA 1FQEA 3L6HA 5DVIA 3V89B 3IX1A 2DE4A 3OMBA 3LBSA 2HQ0A 2Z8FA 4XKRA 2E1SA 2Q8JA 5DEXB 2I3WA 3TYHA 3U93A 1HSJA 2DQVA 1FTKA 3TTKA 2O7IA 1P1QA 3TTNA 5DVFA 4NEDA 1HSLA 5BWJA 4MFIA 1FTOA 3JV9A 5FHMA 1JVYA 3M3KA 2UVIA 1MQGA 4RJZA 4JXIA 1B51A 4L17A 3PMXA 3GLBA 3PMWA 1IQ7A 1R9QA 3MUQA 4U4XA 1MXVA 2ALUA 2GH9A 3DP8A 3H6VA 4LZ7A 4DLDA 3Q25A 1PB9A 2HAUA 3LC8A 4RK9A 2RC7A 3JYRA 4IO4A 3SEXA 2XXTA 1N0TA 4ESWA 1B7UA 4EDPA 1JW4A 2QS1A 1IXGA 4QRZA 3SERA 2Q2CA 4G8HA 1Q1KA 3N26A 4ZEFA 3MVWA 4LONB 5CMMA 3IOWA 5TPAB 4IO6A 2F7BA 1MXXA 3D4CA 1WVJA 1B6HA 4E0XA 4IO5A 4DXCA 2Q2AA 2XXWA 2F5XA 4F3GA 3N6TA 2DXRA 4OTEA 2HXWA 1OMPA 2DWJA 1B9JA 3QUFA 1MH3A 3S9NC 3PPOA 4F19A 4H5FA 1LAGE 4WXJA 3K6VA 2X26A 1QUJA 2ZNSA 3ZKLA 4HS7A 4ZEBA 3S9EA 1VFDA 1URDA 4GL8A 1URSA 3N94A 3C36A 5H8FB 1Y20A 4R73A 3K02A 1IIWA 1D3KA 4ECFA 4LA9A 1XOCA 3VDFA 5L9OA 1IZ1A 4PFWA 4NMYA 3VE1B 1N76A 4WEDA 4Q8RA 4IB2A 4EXKA 3GBBA 4LUBA 4QSDA 1GTKA 3O97A 1ZIUA 4U23A 2F6GA 1BP5A 2ESNA 2OK2A 5H8HA 3KJ7A 1B3EA 4F39A 3QYTA 4EQ7A 3RT6B 4LP2B 3OXNA 2F7AA 5AA4A 5H8NA 4ELOA 3JZJA 1MPDA 2Q89A 2QS3A 2KLFA 1B58A 2O69A 1QUKA 1N04A 2QMWA 4IGRA 1I6BA 1TT1A 2NXOA 3PUXE 1DPPA 5H8SA 3O2AA 2Q88A 4NF5A 5TP9A 2DVZA 4R9FA 5M2VA 4AB5A 3EN3A 2V84A 4ISUA 3CRBA 1KWHA 1D9YA 3F11A 4Z7EA 5LOMA 2O51A 3ILTB 3H6UA 2V3TA 2I4CA 1AOVA 3C4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CE2 A;  3G3F A;  4PET A;  3OSR A;  1QKA A;  1P1O A;  4Q30 B;  2F8D A;  4BDQ A;  1QKB A;  1I69 A;  1Y3N A;  1QUL A;  3UN6 A;  3CFL A;  4NWC A;  3W9V A;  2XXR A;  1P1N A;  3TDJ A;  4ZE8 A;  3I3V A;  2O7U A;  5FHN A;  4NF6 A;  1ELJ A;  3B6T A;  4OQO A;  4R74 A;  3VVF A;  3ECR A;  3FUZ A;  4EUO A;  3V83 A;  5AA2 A;  1ZU0 A;  3E3K A;  1HSE A;  3A3C A;  1JW1 A;  5J1D A;  4Z0I A;  4DDD A;  1M5B A;  3CFZ A;  1M5C A;  3CR9 A;  5AA1 A;  3OEK A;  5KDT A;  3O6H A;  4RY1 A;  4PP0 A;  4JSD A;  3VXB A;  3O6I A;  3HPI A;  5K2X A;  2LAO A;  3FJG A;  4DCX A;  1BKA A;  4H65 A;  1JVX A;  4F1Y A;  4F22 A;  3I6V A;  3GZG A;  4HCW A;  3VVE A;  2HZL A;  3H03 A;  1JW5 A;  3IR1 A;  2HEU A;  3E13 X;  2XXP A;  1MXY A;  3K1M A;  1N3W A;  3TCH A;  2M8C A;  4MF3 A;  3K01 A;  3IOV A;  1IXI A;  1P1W A;  2V3Q A;  5CC2 A;  2DS9 A;  4OZ9 A;  1XVX A;  3QXM A;  1LST A;  5KZT A;  4I9D A;  1VFE A;  4YKK A;  3CFX A;  3LR1 A;  1MDQ A;  1MXW A;  2DYX A;  3C32 A;  4TQU Q;  3RUM A;  1GVC A;  3CG1 A;  3VV5 A;  2XD2 A;  1MQJ A;  1GGG A;  1B3H A;  5A5X B;  4KR5 A;  1R6Z A;  2ZYN A;  3QSL A;  4LZ5 A;  5L9S A;  5I58 B;  3K4U A;  3DLN A;  4U21 A;  1B40 A;  5I2N A;  3QUJ A;  4WEP A;  3KOS A;  4EQB A;  3K6X A;  1IIT A;  4DE8 A;  1F9B A;  2XX9 A;  1H76 A;  5L8D A;  3TOD A;  2O6A A;  2CMO A;  2F78 A;  5IKB A;  4JWY A;  3B7D A;  1AMF A;  1XS5 A;  2NWJ A;  3KOT A;  5B70 A;  4H8I A;  4BDR A;  3FXQ A;  4NTL A;  4AB6 A;  1DMB A;  2A5T B;  1I6A A;  3OOA A;  3QK6 A;  2GHA A;  1SYH A;  1B0H A;  1ZJL A;  4KQP A;  2Y7R A;  2OWS A;  5ELV A;  2ZYO A;  5DTB A;  5BUU A;  3ILU B;  3RY3 A;  1B3L A;  1SW1 A;  4P0G A;  4KI0 E;  3TTR A;  3RNN A;  4YU0 A;  2I49 A;  3VLU A;  4EF2 A;  2IA4 A;  1NH7 A;  4ZEC A;  4POW A;  2XXI A;  3HCQ A;  3K6W A;  3QIM A;  4NWD A;  3FGS A;  4KPT A;  4IY6 A;  3T22 A;  4KYS A;  3MP1 A;  2XX7 A;  3M3L A;  3TCF A;  1B4H A;  3MZ1 A;  3MP6 A;  4AQ4 A;  2DOJ A;  4EXL A;  2UYE A;  1LAF E;  2RC8 A;  4RXL A;  3L6G A;  1N7W A;  3H4Z A;  3TEL A;  3H3G A;  3CG3 A;  3UGW A;  1NNK A;  5I56 A;  1UTH B;  3E4R A;  2I58 A;  3PD8 A;  5I57 B;  1QJM A;  2UYF A;  2QS2 A;  5KCJ B;  3T9U A;  4F29 A;  5DEX A;  1SDX A;  1WOD A;  1OLC A;  4OFO A;  1YAE A;  3TKD A;  5L9M A;  4YMA A;  4OMB A;  4QFP A;  2ZMB A;  1URG A;  3C34 A;  1Y9U A;  4GVO A;  4OVJ A;  1TFD A;  1B05 A;  2VHA A;  2YLN A;  1LAH E;  4IO2 A;  1EU8 A;  2REJ A;  2O68 A;  4YMB A;  2Z23 A;  3V5A A;  1FQF A;  3HO7 A;  4BDL A;  1SW2 A;  1MY4 A;  3O9P A;  1R1N A;  3TPA A;  3K2D A;  1GR2 A;  5ITO A;  3BKI B;  4H6D A;  4M1V A;  3OO9 A;  5CMB A;  1USY E;  3P7I A;  3G7W A;  5K2Y A;  4G2Z A;  1NMU A;  2R9J A;  4E0W A;  4DXB A;  4TLM B;  2X7Q A;  3S4U A;  3B6W A;  4YIC A;  3CVG A;  4HTG A;  1P1U A;  5FTH A;  1ATG A;  5ITP A;  4RNS A;  1EZ9 A;  2VGQ A;  2QRY A;  4F2Q A;  4OEU A;  2PVU A;  2I0B A;  1LCT A;  4MLV A;  2H9B A;  3UK4 A;  4ZZE A;  3RN8 A;  1MM6 A;  3ZS6 A;  2IEE A;  1OVT A;  1J1N A;  4YKJ A;  4ZED A;  5TPA A;  4FEC A;  4ELP A;  1MPB A;  3Q28 A;  3O29 A;  1PBQ A;  4XKP A;  4F31 B;  3K1N A;  2I6E A;  1A8F A;  1O7T A;  4Q5T A;  5ISU A;  2O84 X;  1FTL A;  3MZ9 A;  1MQI A;  3UIF A;  2W7Y A;  4JBZ A;  4X9T A;  3S9M C;  4EF1 A;  3UOR A;  1Y1Z A;  3SEW A;  1B7H A;  4F1V A;  2P2A A;  4KYE A;  2WKY A;  4WKM A;  3OO6 A;  3H06 B;  4F18 A;  4N07 A;  3ONM A;  3M3F A;  1T0K A;  1EH3 A;  3CSB A;  5FHO A;  4F3P A;  1B4Z A;  1ZKB A;  1JEU A;  5F1Q A;  1ZTY A;  3FAS A;  5H8F A;  1D4N A;  3AXF A;  3WAF A;  4GLI A;  1JNF A;  4XIG Q;  3CI8 A;  3O6G A;  1DTG A;  3EHS A;  2RF1 A;  3LSL A;  2DE3 A;  2ZNT A;  3ODB A;  4FJP A;  4OXV A;  5EHM A;  3TTM A;  5ICT A;  3IAZ A;  2H5Y A;  2QSX A;  4G68 B;  4R6H A;  3KFM A;  3RGY A;  2B3F A;  4R9G A;  4GXS B;  2ANJ A;  2DVC A;  4FAJ A;  3HST A;  3KZG A;  1Q35 A;  4XKN A;  4OFJ A;  4I62 A;  3T9X B;  1ZLQ A;  2RC9 A;  3TZA A;  4YAH X;  3C31 A;  3FVO A;  3PGF A;  4GD5 A;  5I84 A;  3MAM A;  3FIR A;  1A7L A;  1YPN A;  1NFT A;  2ABH A;  3G3I A;  2QMX A;  3OD7 A;  3G3G A;  2YJP A;  2AL4 A;  1US4 A;  2GHB A;  4OEV A;  1YTV A;  1NNF A;  4F2O A;  1UIV A;  4G68 C;  5CBS A;  2G93 A;  3K0V A;  2Y84 A;  1GV8 A;  3U1O A;  3R6U A;  1SBP A;  4GF8 A;  1B2H A;  3T66 A;  4GRK A;  5HPQ A;  2F7C A;  3FVK A;  2D5W A;  3OO7 A;  2PX1 A;  3EF7 A;  3TQL A;  3M8U A;  2ZYM A;  1LFH A;  1FCK A;  2F6P A;  2H25 A;  2RCB A;  4G8N A;  5DYH A;  5JTY B;  3VLW A;  3KBR A;  1FQA A;  1SD3 A;  4GFR A;  1S7Y A;  4DXU A;  3UP9 A;  5H8Q B;  3PUV E;  1B3F A;  5TU0 A;  1MY2 A;  2OJT A;  2BJJ X;  4KHZ E;  3IOT A;  3LSX A;  4QF9 A;  1Y3P A;  1M5F A;  3E9X A;  2H4I A;  3QAX A;  1LFI A;  1LB8 A;  1OIB A;  2PBW A;  1JQF A;  1DTZ A;  3FVN A;  3FD3 A;  2H98 A;  3MVX A;  1H3D A;  4NF8 B;  3U92 A;  3O28 A;  3V8X B;  2DP8 A;  3RLF E;  4ND9 A;  4FED A;  4BLA A;  3TFL A;  3IJO B;  1H45 A;  4U1Z A;  3SEU A;  1SW5 A;  1QVS A;  4MLQ A;  5CMC A;  2PMS A;  3IO4 A;  3IOU A;  4RA1 A;  1MY3 A;  4O3C A;  2F97 A;  3ZSF A;  3MVZ A;  3SES A;  2Y7P A;  1TWY A;  1UTB B;  1DOT A;  1LAX A;  1M5D A;  4OER A;  4R72 A;  4ELR A;  1EZP A;  1MXZ A;  4RYA A;  2QS4 A;  3N5L A;  5F7V A;  3IB2 A;  4NE4 A;  4HW8 A;  3S2V A;  1P99 A;  1PDA A;  2D3I A;  1L5T A;  3N6U A;  3Q26 A;  2QJE A;  1US5 A;  3FZV A;  1Y1M A;  5A5X A;  3TEP A;  3KSX A;  2O1L A;  4O3A A;  3SET A;  3TAJ A;  2Z8E A;  4ONY A;  5AA2 D;  5I2K B;  5I58 A;  3RT8 A;  4GWO A;  1BIY A;  4DIG A;  4YKI A;  3PMV A;  5CBR A;  4ZZA A;  3C9H A;  2I0C A;  4RK2 A;  2HAV A;  1N7X A;  4OET A;  3U72 A;  4H8J A;  3IB0 A;  1SVX B;  2HFB A;  5I59 B;  4XXU A;  1LB9 A;  2O1M A;  3GXA A;  3T93 B;  2B3B A;  3FAT A;  3IOR A;  2G29 A;  4YB5 A;  3MC2 A;  1II5 A;  2A5T A;  1MH4 A;  2VP1 A;  4M4G A;  4FIM A;  4OEN A;  1PC3 A;  4PFU A;  3CIJ A;  4U22 A;  2ONS A;  3K6U A;  4NF4 B;  2V93 A;  4R2F A;  2PT1 A;  2XX8 A;  2UXA A;  1POY 1;  3H6T A;  1O63 A;  5CM6 A;  4H67 A;  2DWH A;  3MPK A;  4LVQ A;  1B0L A;  1OQG A;  1S9T A;  4LQ5 A;  3K1P A;  1S50 A;  1FQD A;  3U8Q A;  2D21 A;  4BDM A;  3MW0 A;  2XXH A;  4RPN A;  1YCJ A;  2FNC A;  4JWX A;  4U4S A;  4OYV A;  2Y7I A;  4GIZ A;  2UVH A;  2YPN A;  3B6Q A;  2ZYK A;  1MPC A;  3S9L C;  3FXR A;  1TXF A;  2R71 A;  2QL3 A;  2B65 A;  5JK4 A;  1CB6 A;  1O64 A;  1MM7 A;  3KG2 A;  1MRP A;  4YZZ A;  4G4P A;  4IO3 A;  1FTM A;  1POT A;  2AYS A;  4LZ8 A;  4QFO A;  4P11 A;  4FAT A;  1UTH A;  3BFU A;  3DP6 A;  1RYO A;  4PE5 B;  3IK6 B;  5I57 A;  1PB8 A;  1LGB C;  1JET A;  2OWT A;  1ANF A;  4C1U A;  4X1B A;  2I48 A;  4QSE A;  1N3X A;  5KCJ A;  3C35 A;  1NKX A;  3TQW A;  1IXC A;  4X1D A;  3MJN A;  2AL5 A;  1MQH A;  3THI A;  5AA3 A;  2ONR A;  3EQ1 A;  3G3K A;  5DT6 A;  2XXU A;  3MWB A;  3W15 C;  3WAE A;  1FTJ A;  4GOT A;  3G3J A;  4OFL A;  1B7Z A;  2F35 A;  2ZNU A;  2HCA A;  3Q27 A;  3CSG A;  1SI0 A;  4QHQ A;  5ICQ A;  3MBP A;  3TTL A;  3K00 A;  3VXC A;  3VFJ A;  2DXY A;  3HHF A;  4JWO A;  2Z8D A;  1XT8 A;  4YB7 A;  2DWA A;  1ZBM A;  2THI A;  3KJT A;  1WDN A;  1DPE A;  1QW0 A;  1VE4 A;  3U94 A;  4MBP A;  4C0R A;  2NOO A;  1BTJ A;  3EHT A;  3SEY A;  1NH8 A;  4JDF A;  3D4G A;  1SI1 A;  1PEB A;  1OLA A;  2ZXT A;  2I4B A;  1XVY A;  4F3B A;  4DCY A;  3KN7 A;  4KCC A;  2OLB A;  4Q0C A;  1NL5 A;  4YB6 A;  2I3V A;  4RPO A;  5AE4 A;  2XD3 A;  3LSF B;  4YKP A;  3FV2 A;  3LSW A;  4IGT A;  4ZE9 A;  3MPL A;  3DEL B;  3HN0 A;  2VOZ A;  4U2R A;  3TCG A;  4OES A;  1IEJ A;  2Y7K A;  4N6P A;  5DVJ A;  2DSF A;  1N84 A;  3PV0 E;  5B7D A;  4R75 A;  3T96 B;  3EPE A;  1LCF A;  2XXQ A;  1LLS A;  4THI A;  3Q29 A;  2UVG A;  4X48 A;  3RTF B;  5IAI A;  4DZ1 A;  1H44 A;  2OBG A;  1NNP A;  3IJX B;  5H8H B;  2A5S A;  1OVB A;  1SQY A;  3R7X A;  1Y3Q A;  2NUV A;  5AA4 B;  5H8N B;  1TFA A;  4KYD A;  1B46 A;  1UQW A;  4QFN A;  3OEL A;  3RTW B;  3PUZ E;  4U1O A;  3H6W A;  4G8M A;  4ZS9 A;  1DSN A;  2XXX A;  4G68 A;  4NF5 B;  1A54 A;  5TP9 B;  3MP8 A;  4KFQ A;  5FTI A;  3BBR A;  3T9V A;  2RIN A;  3FVG A;  3RQT A;  4GL0 A;  1B52 A;  4KD5 A;  3IB1 A;  4K3F A;  4BDO A;  2R6G E;  2DE2 A;  1LFG A;  3W9W A;  2OZZ A;  1A99 A;  4UAC A;  2XXV A;  5HBC A;  1FW0 A;  2DWI A;  2Q9T A;  2XHD A;  4R6Y A;  4FOR A;  1AH5 A;  3MVY A;  3LUY A;  4POX A;  4JSO A;  4NF6 B;  1VSO A;  4TLL B;  3USD A;  4C1T A;  3A3U A;  1A8E A;  3GBA A;  3A09 A;  4LAT A;  2FYI A;  1XHY A;  3DM0 A;  3SKP A;  4HCY A;  3FXU A;  1MDP 1;  5AA2 B;  1LBC A;  4ZEI A;  1Z7N E;  5CMK A;  4PQJ A;  4GQO A;  1B5I A;  2XXY A;  2AIX A;  4H5G A;  1ZMG A;  1OQH A;  5KDT B;  5CRY A;  1IUD A;  1B32 A;  3R26 A;  4F3S A;  4GXA A;  4FE8 A;  1BLF A;  3PPR A;  1XC1 A;  2H99 A;  5JTY A;  1A40 A;  3PD9 A;  3PUW E;  2VD3 A;  2P0S A;  5H8Q A;  3PPN A;  4I1D A;  1LBB A;  5JEI A;  1A55 A;  1IXH A;  2X7P A;  1D9V A;  3OEM A;  2CZL A;  1QUI A;  4OWD A;  1SW4 A;  1MY1 A;  1MG1 A;  2RCA A;  3UA8 A;  4F1U A;  1RYX A;  4G77 A;  4O3B A;  3H7M A;  3O66 A;  4NF8 A;  3PUY E;  3TUS A;  2HZK A;  2ONK E;  4H0W A;  3G3H A;  4R6K A;  3HV1 A;  3VVD A;  3PPQ A;  1Y4C A;  1RKM A;  5EHS A;  1B1X A;  1Z7M E;  3PPP A;  2PT2 A;  1Y4T A;  2REG A;  2Y7W A;  1M5E A;  4R2B A;  1AIV A;  5EYF A;  3BFT A;  2FA7 A;  2F36 A;  5I2N B;  4I8C A;  4XKQ A;  1MS7 A;  1UTB A;  4EQ9 A;  4N13 A;  3IL1 B;  4LQ2 A;  4BDN A;  3T9H B;  2GFE A;  3KN8 A;  2NVU B;  3PU5 A;  1I6Q A;  4P0I A;  2V3U A;  1JEV A;  3FV1 A;  1B5J A;  1R9L A;  4PFY A;  4ZEK A;  2OCU A;  4ELQ A;  4UA8 A;  4OHN A;  2RKM A;  4H1X A;  1PB7 A;  3FJ7 A;  2PYY A;  4MH5 A;  1PBP A;  3OEN A;  3KSJ A;  4TOZ A;  2F34 A;  4XTC Q;  3VLV A;  3MZB A;  5I2K A;  3TMG A;  3SEV A;  2Z22 A;  1NNT A;  4JB7 A;  2GRV A;  2V25 A;  3KGC A;  4ZDM A;  3HHG A;  3I5O A;  3KN3 A;  3OO8 A;  1B3G A;  4QSC A;  1MY0 A;  1MXU A;  4QFL A;  3FJM A;  4IY5 A;  4ESX A;  1AL3 A;  1B1H A;  5HM4 B;  1FQB A;  2E0S A;  3MQ9 A;  2VD2 A;  5I59 A;  1H43 A;  1USY H;  3OSQ A;  1EZO A;  3KEI A;  3C33 A;  4FEB A;  3SDF A;  2P1S A;  4PFT A;  1B5H A;  3DP4 A;  4QFK A;  3ZKK A;  2QPQ A;  1FQC A;  1VR5 A;  1UIU A;  3IO6 A;  1MQD A;  4IO7 A;  3RPW A;  3EHU A;  4KCD A;  5CI5 A;  1SYI A;  4NF4 A;  5I56 B;  2UVJ A;  1FQE A;  3L6H A;  5DVI A;  3V89 B;  3IX1 A;  2DE4 A;  3OMB A;  3LBS A;  2HQ0 A;  2Z8F A;  4XKR A;  2E1S A;  2Q8J A;  5DEX B;  2I3W A;  3TYH A;  3U93 A;  1HSJ A;  2DQV A;  1FTK A;  3TTK A;  2O7I A;  1P1Q A;  3TTN A;  5DVF A;  4NED A;  1HSL A;  5BWJ A;  4MFI A;  1FTO A;  3JV9 A;  5FHM A;  1JVY A;  3M3K A;  2UVI A;  1MQG A;  4RJZ A;  4JXI A;  1B51 A;  4L17 A;  3PMX A;  3GLB A;  3PMW A;  1IQ7 A;  1R9Q A;  3MUQ A;  4U4X A;  1MXV A;  2ALU A;  2GH9 A;  3DP8 A;  3H6V A;  4LZ7 A;  4DLD A;  3Q25 A;  1PB9 A;  2HAU A;  3LC8 A;  4RK9 A;  2RC7 A;  3JYR A;  4IO4 A;  3SEX A;  2XXT A;  1N0T A;  4ESW A;  1B7U A;  4EDP A;  1JW4 A;  2QS1 A;  1IXG A;  4QRZ A;  3SER A;  2Q2C A;  4G8H A;  1Q1K A;  3N26 A;  4ZEF A;  3MVW A;  4LON B;  5CMM A;  3IOW A;  5TPA B;  4IO6 A;  2F7B A;  1MXX A;  3D4C A;  1WVJ A;  1B6H A;  4E0X A;  4IO5 A;  4DXC A;  2Q2A A;  2XXW A;  2F5X A;  4F3G A;  3N6T A;  2DXR A;  4OTE A;  2HXW A;  1OMP A;  2DWJ A;  1B9J A;  3QUF A;  1MH3 A;  3S9N C;  3PPO A;  4F19 A;  4H5F A;  1LAG E;  4WXJ A;  3K6V A;  2X26 A;  1QUJ A;  2ZNS A;  3ZKL A;  4HS7 A;  4ZEB A;  3S9E A;  1VFD A;  1URD A;  4GL8 A;  1URS A;  3N94 A;  3C36 A;  5H8F B;  1Y20 A;  4R73 A;  3K02 A;  1IIW A;  1D3K A;  4ECF A;  4LA9 A;  1XOC A;  3VDF A;  5L9O A;  1IZ1 A;  4PFW A;  4NMY A;  3VE1 B;  1N76 A;  4WED A;  4Q8R A;  4IB2 A;  4EXK A;  3GBB A;  4LUB A;  4QSD A;  1GTK A;  3O97 A;  1ZIU A;  4U23 A;  2F6G A;  1BP5 A;  2ESN A;  2OK2 A;  5H8H A;  3KJ7 A;  1B3E A;  4F39 A;  3QYT A;  4EQ7 A;  3RT6 B;  4LP2 B;  3OXN A;  2F7A A;  5AA4 A;  5H8N A;  4ELO A;  3JZJ A;  1MPD A;  2Q89 A;  2QS3 A;  2KLF A;  1B58 A;  2O69 A;  1QUK A;  1N04 A;  2QMW A;  4IGR A;  1I6B A;  1TT1 A;  2NXO A;  3PUX E;  1DPP A;  5H8S A;  3O2A A;  2Q88 A;  4NF5 A;  5TP9 A;  2DVZ A;  4R9F A;  5M2V A;  4AB5 A;  3EN3 A;  2V84 A;  4ISU A;  3CRB A;  1KWH A;  1D9Y A;  3F11 A;  4Z7E A;  5LOM A;  2O51 A;  3ILT B;  3H6U A;  2V3T A;  2I4C A;  1AOV A;  3C4M A; 
#chains in the Genus database with same CATH topology
 1CE2 A;  3G3F A;  4PET A;  3OSR A;  1QKA A;  1P1O A;  4Q30 B;  2F8D A;  4BDQ A;  2CEY A;  1QKB A;  3A29 A;  1I69 A;  1Y3N A;  1QUL A;  3UN6 A;  3CFL A;  2Y5K A;  4NWC A;  3W9V A;  2XXR A;  1P1N A;  4OVS A;  3TDJ A;  4ZE8 A;  3I3V A;  2O7U A;  5FHN A;  4NF6 A;  1ELJ A;  3MYU A;  3B6T A;  4OQO A;  3ROJ A;  4R74 A;  3VVF A;  3ECR A;  3FUZ A;  4EUO A;  3V83 A;  5AA2 A;  1ZU0 A;  1FRP A;  3E3K A;  1HSE A;  3A3C A;  1JW1 A;  5J1D A;  4Z0I A;  4DDD A;  1M5B A;  3CFZ A;  1M5C A;  3CR9 A;  5AA1 A;  3OEK A;  5KDT A;  3O6H A;  1DBZ A;  4RY1 A;  4PP0 A;  4JSD A;  3VXB A;  3O6I A;  3HPI A;  4P47 A;  5K2X A;  2LAO A;  3FJG A;  4DCX A;  1BKA A;  1NV4 A;  1JVX A;  4H65 A;  3RPL B;  4F1Y A;  4F22 A;  3I6V A;  3GZG A;  1KA0 A;  4HCW A;  3KC1 A;  3VVE A;  2HZL A;  3H03 A;  1JW5 A;  3IR1 A;  2HEU A;  3E13 X;  2XXP A;  1MXY A;  3K1M A;  1N3W A;  3TCH A;  2M8C A;  1FBF A;  4GWX A;  4MF3 A;  3K01 A;  3IOV A;  4FBP A;  1IXI A;  2XWO A;  1P1W A;  2V3Q A;  2XWV A;  5CC2 A;  2DS9 A;  4OZ9 A;  1KZ8 A;  4MCO A;  1XVX A;  3QXM A;  1LST A;  5KZT A;  4I9D A;  1VFE A;  4YKK A;  3CFX A;  3LR1 A;  1MDQ A;  2FIX A;  1MXW A;  2DYX A;  3C32 A;  4TQU Q;  3RUM A;  1GVC A;  3CG1 A;  3VV5 A;  2XD2 A;  1MQJ A;  1GGG A;  1B3H A;  5A5X B;  4KR5 A;  1R6Z A;  2ZYN A;  3QSL A;  4LZ5 A;  2MKZ A;  5L9S A;  5I58 B;  2PFY A;  3K4U A;  3DLN A;  2QVU A;  2QVV A;  4U21 A;  1B40 A;  2KQZ A;  5I2N A;  3QUJ A;  4WEP A;  3KOS A;  4EQB A;  3K6X A;  1IIT A;  4DE8 A;  4XEQ A;  1F9B A;  2XX9 A;  1H76 A;  5L8D A;  3TOD A;  2O6A A;  4MAG A;  4PAI A;  4GBV A;  2CMO A;  2F78 A;  5IKB A;  4NQ8 A;  4OVQ A;  4JWY A;  3B7D A;  1AMF A;  1XS5 A;  2NWJ A;  3KOT A;  5B70 A;  4H8I A;  4BDR A;  3FXQ A;  4NTL A;  4AB6 A;  1DMB A;  2A5T B;  1I6A A;  3OOA A;  3QK6 A;  5IZZ A;  2GHA A;  1SYH A;  1B0H A;  1ZJL A;  4KQP A;  2Y7R A;  2OWS A;  5ELV A;  2ZYO A;  5DTB A;  5BUU A;  3ILU B;  3RY3 A;  1B3L A;  1SW1 A;  4GWZ A;  1K9Y A;  4P0G A;  4KI0 E;  3TTR A;  1NV1 A;  3RNN A;  4DI3 D;  4YU0 A;  2I49 A;  3VLU A;  4EF2 A;  5LTC A;  4MX6 A;  2OX3 A;  2IA4 A;  2P3N A;  1NH7 A;  4ZEC A;  4POW A;  4OVT A;  2XXI A;  3HCQ A;  3K6W A;  3QIM A;  4NWD A;  3FGS A;  4KPT A;  4IY6 A;  3T22 A;  4NHB A;  4KYS A;  4UAB A;  3MP1 A;  2XX7 A;  3M3L A;  4GX4 A;  3TCF A;  1B4H A;  3MZ1 A;  5EQ8 A;  5EQA A;  3MP6 A;  4AQ4 A;  2DOJ A;  2PFZ A;  4EXL A;  2UYE A;  1LAF E;  2RC8 A;  4RXL A;  1EYJ A;  3L6G A;  4OA4 A;  1N7W A;  3H4Z A;  1LBV A;  3TEL A;  2XA5 A;  3H3G A;  3CG3 A;  3UGW A;  1NNK A;  5I56 A;  1UTH B;  3E4R A;  2I58 A;  2Q74 A;  3PD8 A;  5I57 B;  1QJM A;  2UYF A;  2QS2 A;  4O8M A;  5KCJ B;  1NV6 A;  3T9U A;  4F29 A;  5DEX A;  1SDX A;  1WOD A;  4P1E A;  4P1L A;  1OLC A;  4OFO A;  1YAE A;  3TKD A;  5L9M A;  4YMA A;  4OMB A;  2HHM A;  4QFP A;  2ZMB A;  1URG A;  3C34 A;  1Y9U A;  5FBP A;  4GVO A;  4OVJ A;  1TFD A;  1B05 A;  2VHA A;  2YLN A;  1LAH E;  4IO2 A;  1EU8 A;  2REJ A;  5I7I A;  2O68 A;  4O94 A;  4YMB A;  2Z23 A;  3V5A A;  1FQF A;  3HO7 A;  4BDL A;  1SW2 A;  2B4M A;  4HE0 A;  1MY4 A;  3O9P A;  1R1N A;  3TPA A;  3K2D A;  1GR2 A;  5ITO A;  1IMC A;  3BKI B;  4H6D A;  4M1V A;  3OO9 A;  5CMB A;  1USY E;  3P7I A;  3G7W A;  5K2Y A;  4G2Z A;  1D9Q A;  4NX1 A;  1NMU A;  2R9J A;  4E0W A;  4DXB A;  4TLM B;  2X7Q A;  3S4U A;  3B6W A;  4YIC A;  4PE3 A;  3CVG A;  4HTG A;  1P1U A;  5FTH A;  1ATG A;  5ITP A;  4RNS A;  1EZ9 A;  2VGQ A;  2QRY A;  1LBX A;  4F2Q A;  1FPF A;  4OEU A;  2PVU A;  2I0B A;  4NAP A;  1LCT A;  4MLV A;  2H9B A;  3UK4 A;  4ZZE A;  3RN8 A;  1MM6 A;  3ZS6 A;  2IEE A;  1OVT A;  1J1N A;  4YKJ A;  4ZED A;  5TPA A;  4NF0 A;  4FEC A;  4ELP A;  1MPB A;  3Q28 A;  3KC0 A;  3O29 A;  1PBQ A;  4XKP A;  4F31 B;  3K1N A;  2I6E A;  1A8F A;  1O7T A;  4Q5T A;  5ISU A;  2O84 X;  1FTL A;  3MZ9 A;  1FPB A;  1MQI A;  3IFC A;  2W7Y A;  4JBZ A;  4X9T A;  3FXB A;  3UIF A;  3S9M C;  4EF1 A;  3UOR A;  1Y1Z A;  3BIG A;  3SEW A;  1B7H A;  4F1V A;  2P2A A;  4LN5 A;  4KYE A;  2WKY A;  4WKM A;  3OO6 A;  3H06 B;  4F18 A;  1NI9 A;  4N07 A;  3ONM A;  3M3F A;  1T0K A;  1EH3 A;  3CSB A;  5FHO A;  4F3P A;  4PBH A;  1B4Z A;  1ZKB A;  1JEU A;  5F1Q A;  1ZTY A;  3FAS A;  5H8F A;  1D4N A;  3AXF A;  3WAF A;  4GLI A;  2XXK A;  1JNF A;  4XIG Q;  3CI8 A;  3O6G A;  1DTG A;  3EHS A;  2RF1 A;  3LSL A;  5I3S A;  2DE3 A;  5LDZ A;  2ZNT A;  3ODB A;  4FJP A;  4OXV A;  5EHM A;  3TTM A;  5ICT A;  3IAZ A;  2H5Y A;  2QSX A;  4G68 B;  4X04 A;  4R6H A;  3KFM A;  4N15 A;  3RGY A;  2B3F A;  4R9G A;  4GXS B;  2ANJ A;  2DVC A;  4FAJ A;  3HST A;  3KZG A;  1Q35 A;  4XKN A;  4OFJ A;  1NV3 A;  4I62 A;  3T9X B;  1ZLQ A;  2RC9 A;  3TZA A;  4YAH X;  3C31 A;  3FVO A;  3PGF A;  4GD5 A;  5I84 A;  3MAM A;  3FIR A;  1A7L A;  1YPN A;  1NFT A;  2ABH A;  3G3I A;  2QMX A;  3OD7 A;  3G3G A;  2YJP A;  2AL4 A;  1US4 A;  2GHB A;  4OEV A;  1YTV A;  1NNF A;  4F2O A;  1UIV A;  4G68 C;  5CBS A;  2G93 A;  2ZZW A;  3K0V A;  2Y84 A;  2WYP A;  1GV8 A;  3U1O A;  3R6U A;  1SBP A;  3T0J A;  4GF8 A;  1B2H A;  2VT5 A;  3T66 A;  4GRK A;  5HPQ A;  2F7C A;  3FVK A;  2D5W A;  3OO7 A;  3CHG A;  2PX1 A;  3EF7 A;  3TQL A;  3M8U A;  2ZYM A;  1LBW A;  1LFH A;  1FCK A;  2F6P A;  1NV5 A;  2H25 A;  2RCB A;  4G8N A;  5DYH A;  5JTY B;  3VLW A;  3KBR A;  1FQA A;  1SD3 A;  4GWU A;  4GFR A;  1S7Y A;  4DXU A;  3UP9 A;  5H8Q B;  3PUV E;  1B3F A;  1K9Z A;  5TU0 A;  1MY2 A;  4JVC A;  2OJT A;  2BJJ X;  4KHZ E;  3IOT A;  1FTA A;  3LSX A;  4QF9 A;  1Y3P A;  1M5F A;  3E9X A;  2H4I A;  3QAX A;  1LFI A;  3QMF A;  1LB8 A;  1YZ0 A;  1OIB A;  2PBW A;  1JQF A;  4X8R A;  1DTZ A;  3FVN A;  3FD3 A;  2H98 A;  3MVX A;  1H3D A;  4NF8 B;  1YYZ A;  3U92 A;  5J16 A;  3O28 A;  2CZI A;  1NV0 A;  3V8X B;  2DP8 A;  3RLF E;  4ND9 A;  2CEX A;  4FED A;  4BLA A;  3TFL A;  3IJO B;  3RPL A;  1H45 A;  4U1Z A;  3SEU A;  1SW5 A;  1QVS A;  4MLQ A;  5CMC A;  2PMS A;  4PDD A;  3IO4 A;  3IOU A;  4RA1 A;  2L5V A;  1MY3 A;  4O3C A;  2F97 A;  3ZSF A;  3MVZ A;  3SES A;  2Y7P A;  2F3B A;  1TWY A;  1UTB B;  1DOT A;  5I5P A;  1LAX A;  4PAK A;  1M5D A;  4OER A;  4R72 A;  4ELR A;  4PFR A;  1EZP A;  4P56 A;  1MXZ A;  4RYA A;  2QS4 A;  4MMP A;  3N5L A;  5F7V A;  3IB2 A;  4NE4 A;  4HW8 A;  3S2V A;  1P99 A;  1PDA A;  1FPG A;  2D3I A;  1L5T A;  4GBW A;  1QGX A;  3N6U A;  3Q26 A;  2QJE A;  3ISP A;  1US5 A;  3FZV A;  4PFB A;  1Y1M A;  5A5X A;  3TEP A;  3KSX A;  4MJO A;  2O1L A;  4O3A A;  5IZ3 B;  3SET A;  3TAJ A;  2Z8E A;  4ONY A;  5AA2 D;  5I2K B;  5I58 A;  3RT8 A;  4GWO A;  1BIY A;  4DIG A;  4YKI A;  4OVR A;  3PMV A;  5CBR A;  4ZZA A;  3C9H A;  2I0C A;  4RK2 A;  2HAV A;  1N7X A;  2R8T A;  4N91 A;  4OET A;  2OWZ A;  3U72 A;  4H8J A;  3IB0 A;  1SVX B;  2HFB A;  1RDX A;  5I59 B;  4XXU A;  1LB9 A;  2O1M A;  3GXA A;  3T93 B;  2B3B A;  4O7M A;  4NN3 A;  3FAT A;  3IOR A;  5ESY A;  2ZZX A;  2G29 A;  4YB5 A;  3MC2 A;  1II5 A;  5F24 A;  2A5T A;  1MH4 A;  2VP1 A;  4M4G A;  2VPO A;  4FIM A;  4OEN A;  1PC3 A;  4PFU A;  3CIJ A;  4U22 A;  2ONS A;  3K6U A;  4NF4 B;  2V93 A;  4R2F A;  2PT1 A;  2XX8 A;  1NV2 A;  2UXA A;  1POY 1;  3H6T A;  2DDK A;  1NUW A;  4G61 A;  1O63 A;  5CM6 A;  4H67 A;  2DWH A;  3MPK A;  4AS4 A;  4LVQ A;  1B0L A;  1OQG A;  1S9T A;  4LQ5 A;  3K1P A;  1S50 A;  1FQD A;  3U8Q A;  2D21 A;  4BDM A;  3MW0 A;  2XXH A;  4RPN A;  1YCJ A;  2FNC A;  4JWX A;  4U4S A;  4OYV A;  2Y7I A;  4GIZ A;  4OAN A;  2FBP A;  2UVH A;  2YPN A;  3B6Q A;  2ZYK A;  1MPC A;  3S9L C;  3FXR A;  1TXF A;  2R71 A;  2QL3 A;  2B65 A;  5JK4 A;  1CB6 A;  1O64 A;  1MM7 A;  3KG2 A;  1MRP A;  5ET7 A;  4PF8 A;  4YZZ A;  4G4P A;  4IO3 A;  4H45 A;  1FTM A;  4PFI A;  1POT A;  2AYS A;  4LZ8 A;  4QFO A;  4P11 A;  4FAT A;  1UTH A;  3BFU A;  1FPK A;  3DP6 A;  5ET8 A;  1RYO A;  1FBH A;  4PE5 B;  3IK6 B;  5I57 A;  1PB8 A;  1LGB C;  1JET A;  2OWT A;  1ANF A;  4C1U A;  4X1B A;  2I48 A;  4QSE A;  1N3X A;  5KCJ A;  3C35 A;  1NKX A;  3TQW A;  2F3D A;  1IXC A;  2Y5L A;  4X1D A;  3MJN A;  2AL5 A;  5EQ7 A;  1MQH A;  3THI A;  5AA3 A;  1CNQ A;  2ONR A;  3EQ1 A;  3G3K A;  5DT6 A;  3B50 A;  2XXU A;  3MWB A;  3W15 C;  3WAE A;  1FTJ A;  4GOT A;  3G3J A;  4OFL A;  4PC9 A;  1B7Z A;  2F35 A;  2ZNU A;  1FPI A;  2HCA A;  3Q27 A;  3SZP A;  4JVI A;  3CSG A;  1SI0 A;  4QHQ A;  5ICQ A;  3MBP A;  1BK4 A;  3TTL A;  3K00 A;  1YXI A;  3VXC A;  3VFJ A;  2DXY A;  3HHF A;  4JWO A;  2Z8D A;  1XT8 A;  4YB7 A;  2DWA A;  1ZBM A;  3U65 A;  2THI A;  3KJT A;  1SPI A;  1WDN A;  1DPE A;  1QW0 A;  1VE4 A;  3U94 A;  2JJK A;  4MBP A;  4C0R A;  2NOO A;  1BTJ A;  3EHT A;  3SEY A;  1NH8 A;  4JDF A;  4DI4 B;  3D4G A;  1SI1 A;  1PEB A;  1OLA A;  5A5L A;  2ZXT A;  2I4B A;  1XVY A;  4F3B A;  4DCY A;  3KN7 A;  4OVP A;  4KCC A;  2OLB A;  4Q0C A;  4PTK A;  1NL5 A;  4YB6 A;  2I3V A;  2P3V A;  4RPO A;  5EYG A;  5AE4 A;  2XD3 A;  3LSF B;  1NUX A;  4YKP A;  3FV2 A;  3LSW A;  4IGT A;  4ZE9 A;  4HXV A;  3MPL A;  4GX3 A;  4P8B A;  3DEL B;  3HN0 A;  2VOZ A;  4U2R A;  4N6D A;  3TCG A;  4OES A;  1IEJ A;  2Y7K A;  4N6P A;  5DVJ A;  2DSF A;  1N84 A;  3PV0 E;  5B7D A;  4R75 A;  1VDW A;  3T96 B;  3D1R A;  3EPE A;  1LCF A;  2XXQ A;  1LLS A;  4THI A;  3MST A;  3Q29 A;  2UVG A;  4X48 A;  3RTF B;  5IAI A;  4DZ1 A;  1H44 A;  2OBG A;  3KBZ A;  1NNP A;  3IJX B;  5H8H B;  2A5S A;  2ZZV A;  1OVB A;  1SQY A;  3R7X A;  1Y3Q A;  4AS5 A;  4GWW A;  1NV7 A;  2NUV A;  5AA4 B;  2HPG A;  5H8N B;  4PGN A;  1TFA A;  4KYD A;  1B46 A;  2WYK A;  1UQW A;  4QFN A;  1FBD A;  3OEL A;  3RTW B;  3RYD A;  3PUZ E;  1LEV A;  4U1O A;  3H6W A;  4G8M A;  4ZS9 A;  1DSN A;  2WBB A;  2XXX A;  4P9K A;  4G68 A;  4NF5 B;  1A54 A;  5TP9 B;  3MP8 A;  5T3J A;  4KFQ A;  5FTI A;  3BBR A;  3T9V A;  1FBG A;  2RIN A;  1FBP A;  3FVG A;  3RQT A;  4GL0 A;  1B52 A;  4KD5 A;  3IB1 A;  1Q9D A;  4K3F A;  4PF6 A;  1DK4 A;  4BDO A;  2R6G E;  2DE2 A;  4GX6 A;  2Q8M A;  1LFG A;  3W9W A;  2OZZ A;  1A99 A;  4UAC A;  2XXV A;  5HBC A;  3LUZ A;  1FW0 A;  2DWI A;  2Q9T A;  4NG7 A;  2XHD A;  4R6Y A;  4FOR A;  1AH5 A;  3MVY A;  3LUY A;  1IMF A;  3GYY A;  1FSA A;  4POX A;  4JSO A;  4NF6 B;  1VSO A;  4TLL B;  3USD A;  4C1T A;  1FJ6 A;  5ET6 A;  3A3U A;  1A8E A;  3GBA A;  3A09 A;  4JVD A;  4LAT A;  2FYI A;  1XHY A;  3DM0 A;  3SKP A;  4HCY A;  3FXU A;  1MDP 1;  5AA2 B;  1LBC A;  4ZEI A;  1Z7N E;  3BIH A;  5CMK A;  4PQJ A;  4GQO A;  4PDH A;  1B5I A;  2XXY A;  2FVZ A;  2AIX A;  4H5G A;  1ZMG A;  1OQH A;  5KDT B;  4QBA A;  1G0I A;  5CRY A;  2XWI A;  1IUD A;  1IME A;  4MNC A;  1B32 A;  3R26 A;  4F3S A;  4I3E A;  4GXA A;  4FE8 A;  2XWK A;  1BLF A;  3PPR A;  1XC1 A;  2H99 A;  3IFA A;  5JTY A;  1A40 A;  3PD9 A;  3PUW E;  2VD3 A;  2P0S A;  1KA1 A;  5H8Q A;  3PPN A;  4I1D A;  1LBB A;  5JEI A;  1A55 A;  4HE2 A;  1IXH A;  4NGU A;  2X7P A;  3E79 A;  1D9V A;  3OEM A;  2CZL A;  1QUI A;  4IR8 A;  4OWD A;  1SW4 A;  1MY1 A;  1MG1 A;  2RCA A;  3UA8 A;  4QXD A;  4F1U A;  1RYX A;  4G77 A;  4O3B A;  3H7M A;  2QVR A;  3O66 A;  4GWY A;  4NF8 A;  3PUY E;  4N8Y A;  3TUS A;  2HZK A;  2ONK E;  4H0W A;  3G3H A;  4R6K A;  3HV1 A;  1FJ9 A;  3VVD A;  1EYK A;  3PPQ A;  1Y4C A;  1RKM A;  5EHS A;  1B1X A;  1Z7M E;  3PPP A;  2PT2 A;  2FHY A;  1Y4T A;  2REG A;  2Y7W A;  1M5E A;  4R2B A;  1AIV A;  5EYF A;  3BFT A;  2FA7 A;  5IGA A;  2F36 A;  4I3Y A;  5I2N B;  1FPL A;  4I8C A;  4XKQ A;  1MS7 A;  1UTB A;  3FBP A;  4EQ9 A;  4N13 A;  3IL1 B;  1NUY A;  4LQ2 A;  4BDN A;  1NUZ A;  3T9H B;  2GFE A;  3KN8 A;  2CZK A;  2NVU B;  3PU5 A;  1I6Q A;  4P0I A;  2V3U A;  1JEV A;  3FV1 A;  1B5J A;  1R9L A;  4PFY A;  4ZEK A;  2OCU A;  4ELQ A;  4UA8 A;  4OHN A;  2RKM A;  4H1X A;  1PB7 A;  3FJ7 A;  2PYY A;  5IZ3 A;  4MH5 A;  1PBP A;  3OEN A;  3KSJ A;  4N4U A;  4TOZ A;  2F34 A;  4XTC Q;  3VLV A;  2BJI A;  3MZB A;  5I2K A;  3TMG A;  3SEV A;  4XF5 A;  2Z22 A;  2CZH A;  1NNT A;  4JB7 A;  2GRV A;  2V25 A;  4MNP A;  3KGC A;  4ZDM A;  3HHG A;  4KXP A;  3I5O A;  3KN3 A;  3OO8 A;  3E78 A;  1B3G A;  4QSC A;  1MY0 A;  1MXU A;  4QFL A;  3FJM A;  4IY5 A;  4ESX A;  1AL3 A;  1B1H A;  5HM4 B;  1FPD A;  1FQB A;  2E0S A;  3MQ9 A;  2VD2 A;  5I59 A;  1H43 A;  1USY H;  3OSQ A;  3LV0 A;  1EZO A;  3KEI A;  3C33 A;  4FEB A;  3SDF A;  2P1S A;  3NOH A;  4PFT A;  1B5H A;  3DP4 A;  4QFK A;  3ZKK A;  2QPQ A;  4MEV A;  1FQC A;  1VR5 A;  1FBC A;  1UIU A;  3IO6 A;  1MQD A;  5EYH A;  4IO7 A;  3RPW A;  3EHU A;  4KCD A;  5CI5 A;  1SYI A;  4NF4 A;  5I56 B;  2UVJ A;  1FQE A;  3L6H A;  5DVI A;  3V89 B;  3IX1 A;  2DE4 A;  3OMB A;  3LBS A;  2HQ0 A;  2Z8F A;  4XKR A;  2E1S A;  1IMB A;  4GWS A;  4N6K A;  2Q8J A;  5DEX B;  2I3W A;  3TYH A;  3U93 A;  1HSJ A;  2DQV A;  1FTK A;  3TTK A;  2PCR A;  1RDZ A;  2O7I A;  1P1Q A;  3B8B A;  3TTN A;  5DVF A;  4NED A;  1HSL A;  5BWJ A;  4MFI A;  4N17 A;  1FPE A;  1FTO A;  1DCU A;  3JV9 A;  4H46 A;  1AWB A;  5FHM A;  1JVY A;  3M3K A;  2UVI A;  1MQG A;  4RJZ A;  4JXI A;  1B51 A;  4L17 A;  2WX9 A;  3PMX A;  3GLB A;  3PMW A;  1IQ7 A;  1R9Q A;  3MUQ A;  4U4X A;  1LBZ A;  2WEF A;  1MXV A;  1G0H A;  2ALU A;  2GH9 A;  3DP8 A;  3H6V A;  4LZ7 A;  4DLD A;  3Q25 A;  1PB9 A;  2HAU A;  3LC8 A;  4RK9 A;  2RC7 A;  3JYR A;  4IO4 A;  3SEX A;  2XXT A;  3HFU A;  1N0T A;  5ET5 A;  4ESW A;  1B7U A;  4EDP A;  4MIJ A;  4N81 A;  1LBY A;  1JW4 A;  1FPJ A;  2QS1 A;  1IXG A;  4QRZ A;  3SER A;  2Q2C A;  2FIE A;  4G8H A;  1Q1K A;  3N26 A;  3EKI A;  3MVW A;  4LON B;  3PTY A;  5CMM A;  4ZEF A;  3IOW A;  5IZ1 A;  2HXR A;  5TPA B;  4IO6 A;  2F7B A;  1MXX A;  3D4C A;  1WVJ A;  2QFL A;  1B6H A;  4E0X A;  5DW8 A;  4O7I A;  4IO5 A;  4DXC A;  2Q2A A;  2XXW A;  2F5X A;  4F3G A;  3N6T A;  4MHF A;  2DXR A;  4OTE A;  2HXW A;  3T1B A;  1OMP A;  1JP4 A;  2DWJ A;  4I40 A;  1B9J A;  3QUF A;  1MH3 A;  4PGP A;  3S9N C;  3PPO A;  4F19 A;  4PBQ A;  4H5F A;  1LAG E;  4WXJ A;  3K6V A;  2X26 A;  1QUJ A;  2ZNS A;  3ZKL A;  4HS7 A;  4ZEB A;  3S9E A;  1VFD A;  1XI6 A;  1URD A;  1INP A;  4GL8 A;  1URS A;  3N94 A;  3C36 A;  5H8F B;  1Y20 A;  4N8G A;  4R73 A;  3K02 A;  1IIW A;  1D3K A;  4ECF A;  4LA9 A;  2B4L A;  1XOC A;  3VDF A;  1IMD A;  5L9O A;  1IZ1 A;  4PFW A;  4NMY A;  3VE1 B;  1N76 A;  4WED A;  4Q8R A;  5EQ9 A;  4IB2 A;  4EXK A;  1IMA A;  4XFE A;  3GBB A;  4LUB A;  4QSD A;  1GTK A;  5IM2 A;  2V4C A;  3O97 A;  1ZIU A;  4P3L A;  4MNI A;  4U23 A;  2F6G A;  2WBD A;  1BP5 A;  2ESN A;  2OK2 A;  5H8H A;  3KJ7 A;  4PCD A;  1B3E A;  4F39 A;  3QYT A;  4EQ7 A;  1RDY A;  2KR0 A;  3RT6 B;  4LP2 B;  3OXN A;  2F7A A;  5AA4 A;  5H8N A;  4ELO A;  3JZJ A;  1MPD A;  4PAF A;  2Q89 A;  2QS3 A;  2KLF A;  1B58 A;  2O69 A;  2GQ1 A;  1FBE A;  1QUK A;  1N04 A;  2QMW A;  4IGR A;  1I6B A;  1TT1 A;  2NXO A;  3PUX E;  1DPP A;  2VPN A;  5H8S A;  3O2A A;  2Q88 A;  4NF5 A;  5TP9 A;  2DVZ A;  4R9F A;  5M2V A;  4AB5 A;  3EN3 A;  2V84 A;  4ISU A;  3CRB A;  1KWH A;  1D9Y A;  3F11 A;  4Z7E A;  5LOM A;  1EYI A;  2O51 A;  3ILT B;  3H6U A;  2V3T A;  2I4C A;  4HE1 A;  1AOV A;  3C4M A; 
#chains in the Genus database with same CATH homology
 1CE2 A;  3G3F A;  4PET A;  3OSR A;  1QKA A;  1P1O A;  4Q30 B;  2F8D A;  4BDQ A;  1QKB A;  1I69 A;  1Y3N A;  1QUL A;  3UN6 A;  3CFL A;  4NWC A;  3W9V A;  2XXR A;  1P1N A;  3TDJ A;  4ZE8 A;  3I3V A;  2O7U A;  5FHN A;  4NF6 A;  1ELJ A;  3B6T A;  4OQO A;  4R74 A;  3VVF A;  3ECR A;  3FUZ A;  4EUO A;  3V83 A;  5AA2 A;  1ZU0 A;  3E3K A;  1HSE A;  3A3C A;  1JW1 A;  5J1D A;  4Z0I A;  4DDD A;  1M5B A;  3CFZ A;  1M5C A;  3CR9 A;  5AA1 A;  3OEK A;  5KDT A;  3O6H A;  4RY1 A;  4PP0 A;  4JSD A;  3VXB A;  3O6I A;  3HPI A;  5K2X A;  2LAO A;  3FJG A;  4DCX A;  1BKA A;  4H65 A;  1JVX A;  4F1Y A;  4F22 A;  3I6V A;  3GZG A;  4HCW A;  3VVE A;  2HZL A;  3H03 A;  1JW5 A;  3IR1 A;  2HEU A;  3E13 X;  2XXP A;  1MXY A;  3K1M A;  1N3W A;  3TCH A;  2M8C A;  4MF3 A;  3K01 A;  3IOV A;  1IXI A;  1P1W A;  2V3Q A;  5CC2 A;  2DS9 A;  4OZ9 A;  1XVX A;  3QXM A;  1LST A;  5KZT A;  4I9D A;  1VFE A;  4YKK A;  3CFX A;  3LR1 A;  1MDQ A;  1MXW A;  2DYX A;  3C32 A;  4TQU Q;  3RUM A;  1GVC A;  3CG1 A;  3VV5 A;  2XD2 A;  1MQJ A;  1GGG A;  1B3H A;  5A5X B;  4KR5 A;  1R6Z A;  2ZYN A;  3QSL A;  4LZ5 A;  5L9S A;  5I58 B;  3K4U A;  3DLN A;  4U21 A;  1B40 A;  5I2N A;  3QUJ A;  4WEP A;  3KOS A;  4EQB A;  3K6X A;  1IIT A;  4DE8 A;  1F9B A;  2XX9 A;  1H76 A;  5L8D A;  3TOD A;  2O6A A;  2CMO A;  2F78 A;  5IKB A;  4JWY A;  3B7D A;  1AMF A;  1XS5 A;  2NWJ A;  3KOT A;  5B70 A;  4H8I A;  4BDR A;  3FXQ A;  4NTL A;  4AB6 A;  1DMB A;  2A5T B;  1I6A A;  3OOA A;  3QK6 A;  2GHA A;  1SYH A;  1B0H A;  1ZJL A;  4KQP A;  2Y7R A;  2OWS A;  5ELV A;  2ZYO A;  5DTB A;  5BUU A;  3ILU B;  3RY3 A;  1B3L A;  1SW1 A;  4P0G A;  4KI0 E;  3TTR A;  3RNN A;  4YU0 A;  2I49 A;  3VLU A;  4EF2 A;  2IA4 A;  1NH7 A;  4ZEC A;  4POW A;  2XXI A;  3HCQ A;  3K6W A;  3QIM A;  4NWD A;  3FGS A;  4KPT A;  4IY6 A;  3T22 A;  4KYS A;  3MP1 A;  2XX7 A;  3M3L A;  3TCF A;  1B4H A;  3MZ1 A;  3MP6 A;  4AQ4 A;  2DOJ A;  4EXL A;  2UYE A;  1LAF E;  2RC8 A;  4RXL A;  3L6G A;  1N7W A;  3H4Z A;  3TEL A;  3H3G A;  3CG3 A;  3UGW A;  1NNK A;  5I56 A;  1UTH B;  3E4R A;  2I58 A;  3PD8 A;  5I57 B;  1QJM A;  2UYF A;  2QS2 A;  5KCJ B;  3T9U A;  4F29 A;  5DEX A;  1SDX A;  1WOD A;  1OLC A;  4OFO A;  1YAE A;  3TKD A;  5L9M A;  4YMA A;  4OMB A;  4QFP A;  2ZMB A;  1URG A;  3C34 A;  1Y9U A;  4GVO A;  4OVJ A;  1TFD A;  1B05 A;  2VHA A;  2YLN A;  1LAH E;  4IO2 A;  1EU8 A;  2REJ A;  2O68 A;  4YMB A;  2Z23 A;  3V5A A;  1FQF A;  3HO7 A;  4BDL A;  1SW2 A;  1MY4 A;  3O9P A;  1R1N A;  3TPA A;  3K2D A;  1GR2 A;  5ITO A;  3BKI B;  4H6D A;  4M1V A;  3OO9 A;  5CMB A;  1USY E;  3P7I A;  3G7W A;  5K2Y A;  4G2Z A;  1NMU A;  2R9J A;  4E0W A;  4DXB A;  4TLM B;  2X7Q A;  3S4U A;  3B6W A;  4YIC A;  3CVG A;  4HTG A;  1P1U A;  5FTH A;  1ATG A;  5ITP A;  4RNS A;  1EZ9 A;  2VGQ A;  2QRY A;  4F2Q A;  4OEU A;  2PVU A;  2I0B A;  1LCT A;  4MLV A;  2H9B A;  3UK4 A;  4ZZE A;  3RN8 A;  1MM6 A;  3ZS6 A;  2IEE A;  1OVT A;  1J1N A;  4YKJ A;  4ZED A;  5TPA A;  4FEC A;  4ELP A;  1MPB A;  3Q28 A;  3O29 A;  1PBQ A;  4XKP A;  4F31 B;  3K1N A;  2I6E A;  1A8F A;  1O7T A;  4Q5T A;  5ISU A;  2O84 X;  1FTL A;  3MZ9 A;  1MQI A;  3UIF A;  2W7Y A;  4JBZ A;  4X9T A;  3S9M C;  4EF1 A;  3UOR A;  1Y1Z A;  3SEW A;  1B7H A;  4F1V A;  2P2A A;  4KYE A;  2WKY A;  4WKM A;  3OO6 A;  3H06 B;  4F18 A;  4N07 A;  3ONM A;  3M3F A;  1T0K A;  1EH3 A;  3CSB A;  5FHO A;  4F3P A;  1B4Z A;  1ZKB A;  1JEU A;  5F1Q A;  1ZTY A;  3FAS A;  5H8F A;  1D4N A;  3AXF A;  3WAF A;  4GLI A;  1JNF A;  4XIG Q;  3CI8 A;  3O6G A;  1DTG A;  3EHS A;  2RF1 A;  3LSL A;  2DE3 A;  2ZNT A;  3ODB A;  4FJP A;  4OXV A;  5EHM A;  3TTM A;  5ICT A;  3IAZ A;  2H5Y A;  2QSX A;  4G68 B;  4R6H A;  3KFM A;  3RGY A;  2B3F A;  4R9G A;  4GXS B;  2ANJ A;  2DVC A;  4FAJ A;  3HST A;  3KZG A;  1Q35 A;  4XKN A;  4OFJ A;  4I62 A;  3T9X B;  1ZLQ A;  2RC9 A;  3TZA A;  4YAH X;  3C31 A;  3FVO A;  3PGF A;  4GD5 A;  5I84 A;  3MAM A;  3FIR A;  1A7L A;  1YPN A;  1NFT A;  2ABH A;  3G3I A;  2QMX A;  3OD7 A;  3G3G A;  2YJP A;  2AL4 A;  1US4 A;  2GHB A;  4OEV A;  1YTV A;  1NNF A;  4F2O A;  1UIV A;  4G68 C;  5CBS A;  2G93 A;  3K0V A;  2Y84 A;  1GV8 A;  3U1O A;  3R6U A;  1SBP A;  4GF8 A;  1B2H A;  3T66 A;  4GRK A;  5HPQ A;  2F7C A;  3FVK A;  2D5W A;  3OO7 A;  2PX1 A;  3EF7 A;  3TQL A;  3M8U A;  2ZYM A;  1LFH A;  1FCK A;  2F6P A;  2H25 A;  2RCB A;  4G8N A;  5DYH A;  5JTY B;  3VLW A;  3KBR A;  1FQA A;  1SD3 A;  4GFR A;  1S7Y A;  4DXU A;  3UP9 A;  5H8Q B;  3PUV E;  1B3F A;  5TU0 A;  1MY2 A;  2OJT A;  2BJJ X;  4KHZ E;  3IOT A;  3LSX A;  4QF9 A;  1Y3P A;  1M5F A;  3E9X A;  2H4I A;  3QAX A;  1LFI A;  1LB8 A;  1OIB A;  2PBW A;  1JQF A;  1DTZ A;  3FVN A;  3FD3 A;  2H98 A;  3MVX A;  1H3D A;  4NF8 B;  3U92 A;  3O28 A;  3V8X B;  2DP8 A;  3RLF E;  4ND9 A;  4FED A;  4BLA A;  3TFL A;  3IJO B;  1H45 A;  4U1Z A;  3SEU A;  1SW5 A;  1QVS A;  4MLQ A;  5CMC A;  2PMS A;  3IO4 A;  3IOU A;  4RA1 A;  1MY3 A;  4O3C A;  2F97 A;  3ZSF A;  3MVZ A;  3SES A;  2Y7P A;  1TWY A;  1UTB B;  1DOT A;  1LAX A;  1M5D A;  4OER A;  4R72 A;  4ELR A;  1EZP A;  1MXZ A;  4RYA A;  2QS4 A;  3N5L A;  5F7V A;  3IB2 A;  4NE4 A;  4HW8 A;  3S2V A;  1P99 A;  1PDA A;  2D3I A;  1L5T A;  3N6U A;  3Q26 A;  2QJE A;  1US5 A;  3FZV A;  1Y1M A;  5A5X A;  3TEP A;  3KSX A;  2O1L A;  4O3A A;  3SET A;  3TAJ A;  2Z8E A;  4ONY A;  5AA2 D;  5I2K B;  5I58 A;  3RT8 A;  4GWO A;  1BIY A;  4DIG A;  4YKI A;  3PMV A;  5CBR A;  4ZZA A;  3C9H A;  2I0C A;  4RK2 A;  2HAV A;  1N7X A;  4OET A;  3U72 A;  4H8J A;  3IB0 A;  1SVX B;  2HFB A;  5I59 B;  4XXU A;  1LB9 A;  2O1M A;  3GXA A;  3T93 B;  2B3B A;  3FAT A;  3IOR A;  2G29 A;  4YB5 A;  3MC2 A;  1II5 A;  2A5T A;  1MH4 A;  2VP1 A;  4M4G A;  4FIM A;  4OEN A;  1PC3 A;  4PFU A;  3CIJ A;  4U22 A;  2ONS A;  3K6U A;  4NF4 B;  2V93 A;  4R2F A;  2PT1 A;  2XX8 A;  2UXA A;  1POY 1;  3H6T A;  1O63 A;  5CM6 A;  4H67 A;  2DWH A;  3MPK A;  4LVQ A;  1B0L A;  1OQG A;  1S9T A;  4LQ5 A;  3K1P A;  1S50 A;  1FQD A;  3U8Q A;  2D21 A;  4BDM A;  3MW0 A;  2XXH A;  4RPN A;  1YCJ A;  2FNC A;  4JWX A;  4U4S A;  4OYV A;  2Y7I A;  4GIZ A;  2UVH A;  2YPN A;  3B6Q A;  2ZYK A;  1MPC A;  3S9L C;  3FXR A;  1TXF A;  2R71 A;  2QL3 A;  2B65 A;  5JK4 A;  1CB6 A;  1O64 A;  1MM7 A;  3KG2 A;  1MRP A;  4YZZ A;  4G4P A;  4IO3 A;  1FTM A;  1POT A;  2AYS A;  4LZ8 A;  4QFO A;  4P11 A;  4FAT A;  1UTH A;  3BFU A;  3DP6 A;  1RYO A;  4PE5 B;  3IK6 B;  5I57 A;  1PB8 A;  1LGB C;  1JET A;  2OWT A;  1ANF A;  4C1U A;  4X1B A;  2I48 A;  4QSE A;  1N3X A;  5KCJ A;  3C35 A;  1NKX A;  3TQW A;  1IXC A;  4X1D A;  3MJN A;  2AL5 A;  1MQH A;  3THI A;  5AA3 A;  2ONR A;  3EQ1 A;  3G3K A;  5DT6 A;  2XXU A;  3MWB A;  3W15 C;  3WAE A;  1FTJ A;  4GOT A;  3G3J A;  4OFL A;  1B7Z A;  2F35 A;  2ZNU A;  2HCA A;  3Q27 A;  3CSG A;  1SI0 A;  4QHQ A;  5ICQ A;  3MBP A;  3TTL A;  3K00 A;  3VXC A;  3VFJ A;  2DXY A;  3HHF A;  4JWO A;  2Z8D A;  1XT8 A;  4YB7 A;  2DWA A;  1ZBM A;  2THI A;  3KJT A;  1WDN A;  1DPE A;  1QW0 A;  1VE4 A;  3U94 A;  4MBP A;  4C0R A;  2NOO A;  1BTJ A;  3EHT A;  3SEY A;  1NH8 A;  4JDF A;  3D4G A;  1SI1 A;  1PEB A;  1OLA A;  2ZXT A;  2I4B A;  1XVY A;  4F3B A;  4DCY A;  3KN7 A;  4KCC A;  2OLB A;  4Q0C A;  1NL5 A;  4YB6 A;  2I3V A;  4RPO A;  5AE4 A;  2XD3 A;  3LSF B;  4YKP A;  3FV2 A;  3LSW A;  4IGT A;  4ZE9 A;  3MPL A;  3DEL B;  3HN0 A;  2VOZ A;  4U2R A;  3TCG A;  4OES A;  1IEJ A;  2Y7K A;  4N6P A;  5DVJ A;  2DSF A;  1N84 A;  3PV0 E;  5B7D A;  4R75 A;  3T96 B;  3EPE A;  1LCF A;  2XXQ A;  1LLS A;  4THI A;  3Q29 A;  2UVG A;  4X48 A;  3RTF B;  5IAI A;  4DZ1 A;  1H44 A;  2OBG A;  1NNP A;  3IJX B;  5H8H B;  2A5S A;  1OVB A;  1SQY A;  3R7X A;  1Y3Q A;  2NUV A;  5AA4 B;  5H8N B;  1TFA A;  4KYD A;  1B46 A;  1UQW A;  4QFN A;  3OEL A;  3RTW B;  3PUZ E;  4U1O A;  3H6W A;  4G8M A;  4ZS9 A;  1DSN A;  2XXX A;  4G68 A;  4NF5 B;  1A54 A;  5TP9 B;  3MP8 A;  4KFQ A;  5FTI A;  3BBR A;  3T9V A;  2RIN A;  3FVG A;  3RQT A;  4GL0 A;  1B52 A;  4KD5 A;  3IB1 A;  4K3F A;  4BDO A;  2R6G E;  2DE2 A;  1LFG A;  3W9W A;  2OZZ A;  1A99 A;  4UAC A;  2XXV A;  5HBC A;  1FW0 A;  2DWI A;  2Q9T A;  2XHD A;  4R6Y A;  4FOR A;  1AH5 A;  3MVY A;  3LUY A;  4POX A;  4JSO A;  4NF6 B;  1VSO A;  4TLL B;  3USD A;  4C1T A;  3A3U A;  1A8E A;  3GBA A;  3A09 A;  4LAT A;  2FYI A;  1XHY A;  3DM0 A;  3SKP A;  4HCY A;  3FXU A;  1MDP 1;  5AA2 B;  1LBC A;  4ZEI A;  1Z7N E;  5CMK A;  4PQJ A;  4GQO A;  1B5I A;  2XXY A;  2AIX A;  4H5G A;  1ZMG A;  1OQH A;  5KDT B;  5CRY A;  1IUD A;  1B32 A;  3R26 A;  4F3S A;  4GXA A;  4FE8 A;  1BLF A;  3PPR A;  1XC1 A;  2H99 A;  5JTY A;  1A40 A;  3PD9 A;  3PUW E;  2VD3 A;  2P0S A;  5H8Q A;  3PPN A;  4I1D A;  1LBB A;  5JEI A;  1A55 A;  1IXH A;  2X7P A;  1D9V A;  3OEM A;  2CZL A;  1QUI A;  4OWD A;  1SW4 A;  1MY1 A;  1MG1 A;  2RCA A;  3UA8 A;  4F1U A;  1RYX A;  4G77 A;  4O3B A;  3H7M A;  3O66 A;  4NF8 A;  3PUY E;  3TUS A;  2HZK A;  2ONK E;  4H0W A;  3G3H A;  4R6K A;  3HV1 A;  3VVD A;  3PPQ A;  1Y4C A;  1RKM A;  5EHS A;  1B1X A;  1Z7M E;  3PPP A;  2PT2 A;  1Y4T A;  2REG A;  2Y7W A;  1M5E A;  4R2B A;  1AIV A;  5EYF A;  3BFT A;  2FA7 A;  2F36 A;  5I2N B;  4I8C A;  4XKQ A;  1MS7 A;  1UTB A;  4EQ9 A;  4N13 A;  3IL1 B;  4LQ2 A;  4BDN A;  3T9H B;  2GFE A;  3KN8 A;  2NVU B;  3PU5 A;  1I6Q A;  4P0I A;  2V3U A;  1JEV A;  3FV1 A;  1B5J A;  1R9L A;  4PFY A;  4ZEK A;  2OCU A;  4ELQ A;  4UA8 A;  4OHN A;  2RKM A;  4H1X A;  1PB7 A;  3FJ7 A;  2PYY A;  4MH5 A;  1PBP A;  3OEN A;  3KSJ A;  4TOZ A;  2F34 A;  4XTC Q;  3VLV A;  3MZB A;  5I2K A;  3TMG A;  3SEV A;  2Z22 A;  1NNT A;  4JB7 A;  2GRV A;  2V25 A;  3KGC A;  4ZDM A;  3HHG A;  3I5O A;  3KN3 A;  3OO8 A;  1B3G A;  4QSC A;  1MY0 A;  1MXU A;  4QFL A;  3FJM A;  4IY5 A;  4ESX A;  1AL3 A;  1B1H A;  5HM4 B;  1FQB A;  2E0S A;  3MQ9 A;  2VD2 A;  5I59 A;  1H43 A;  1USY H;  3OSQ A;  1EZO A;  3KEI A;  3C33 A;  4FEB A;  3SDF A;  2P1S A;  4PFT A;  1B5H A;  3DP4 A;  4QFK A;  3ZKK A;  2QPQ A;  1FQC A;  1VR5 A;  1UIU A;  3IO6 A;  1MQD A;  4IO7 A;  3RPW A;  3EHU A;  4KCD A;  5CI5 A;  1SYI A;  4NF4 A;  5I56 B;  2UVJ A;  1FQE A;  3L6H A;  5DVI A;  3V89 B;  3IX1 A;  2DE4 A;  3OMB A;  3LBS A;  2HQ0 A;  2Z8F A;  4XKR A;  2E1S A;  2Q8J A;  5DEX B;  2I3W A;  3TYH A;  3U93 A;  1HSJ A;  2DQV A;  1FTK A;  3TTK A;  2O7I A;  1P1Q A;  3TTN A;  5DVF A;  4NED A;  1HSL A;  5BWJ A;  4MFI A;  1FTO A;  3JV9 A;  5FHM A;  1JVY A;  3M3K A;  2UVI A;  1MQG A;  4RJZ A;  4JXI A;  1B51 A;  4L17 A;  3PMX A;  3GLB A;  3PMW A;  1IQ7 A;  1R9Q A;  3MUQ A;  4U4X A;  1MXV A;  2ALU A;  2GH9 A;  3DP8 A;  3H6V A;  4LZ7 A;  4DLD A;  3Q25 A;  1PB9 A;  2HAU A;  3LC8 A;  4RK9 A;  2RC7 A;  3JYR A;  4IO4 A;  3SEX A;  2XXT A;  1N0T A;  4ESW A;  1B7U A;  4EDP A;  1JW4 A;  2QS1 A;  1IXG A;  4QRZ A;  3SER A;  2Q2C A;  4G8H A;  1Q1K A;  3N26 A;  4ZEF A;  3MVW A;  4LON B;  5CMM A;  3IOW A;  5TPA B;  4IO6 A;  2F7B A;  1MXX A;  3D4C A;  1WVJ A;  1B6H A;  4E0X A;  4IO5 A;  4DXC A;  2Q2A A;  2XXW A;  2F5X A;  4F3G A;  3N6T A;  2DXR A;  4OTE A;  2HXW A;  1OMP A;  2DWJ A;  1B9J A;  3QUF A;  1MH3 A;  3S9N C;  3PPO A;  4F19 A;  4H5F A;  1LAG E;  4WXJ A;  3K6V A;  2X26 A;  1QUJ A;  2ZNS A;  3ZKL A;  4HS7 A;  4ZEB A;  3S9E A;  1VFD A;  1URD A;  4GL8 A;  1URS A;  3N94 A;  3C36 A;  5H8F B;  1Y20 A;  4R73 A;  3K02 A;  1IIW A;  1D3K A;  4ECF A;  4LA9 A;  1XOC A;  3VDF A;  5L9O A;  1IZ1 A;  4PFW A;  4NMY A;  3VE1 B;  1N76 A;  4WED A;  4Q8R A;  4IB2 A;  4EXK A;  3GBB A;  4LUB A;  4QSD A;  1GTK A;  3O97 A;  1ZIU A;  4U23 A;  2F6G A;  1BP5 A;  2ESN A;  2OK2 A;  5H8H A;  3KJ7 A;  1B3E A;  4F39 A;  3QYT A;  4EQ7 A;  3RT6 B;  4LP2 B;  3OXN A;  2F7A A;  5AA4 A;  5H8N A;  4ELO A;  3JZJ A;  1MPD A;  2Q89 A;  2QS3 A;  2KLF A;  1B58 A;  2O69 A;  1QUK A;  1N04 A;  2QMW A;  4IGR A;  1I6B A;  1TT1 A;  2NXO A;  3PUX E;  1DPP A;  5H8S A;  3O2A A;  2Q88 A;  4NF5 A;  5TP9 A;  2DVZ A;  4R9F A;  5M2V A;  4AB5 A;  3EN3 A;  2V84 A;  4ISU A;  3CRB A;  1KWH A;  1D9Y A;  3F11 A;  4Z7E A;  5LOM A;  2O51 A;  3ILT B;  3H6U A;  2V3T A;  2I4C A;  1AOV A;  3C4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...