3A3CA

Crystal structure of tim40/mia40 fusing mbp, c296s and c298s mutant
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
451
structure length
451
Chain Sequence
EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSVPGRGSIEGRPEFAYNPDTGEINWDSPSLGGMAHGPCGEEFKSAFSCFVYSEAEPKGIDCVEKFQHMQDCFRKYPEHYAEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of yeast Tim40/Mia40 as an oxidative translocator in the mitochondrial intermembrane space.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein transport
molecule keywords Maltose-binding periplasmic protein, LINKER, Mitochondrial i
total genus 122
structure length 451
sequence length 451
ec nomenclature
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF06747 CHCH CHCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3a3cA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3a3cA01
1MRPA 3G3FA 3FXRA 4YAHX 4N6PA 3QIMA 1JW4A 1ZLQA 1FTMA 3OSQA 5DYHA 1JEUA 3RGYA 3TTNA 2DWIA 5ITOA 2P2AA 3N5LA 4R75A 5HM4B 1USYE 4OVJA 3S9NC 3FXQA 5CBSA 3QUJA 5KCJA 3AXFA 4BDOA 2QS4A 1FQAA 3HCQA 3JV9A 4PFUA 2Z8FA 4GQOA 4YB5A 3DM0A 4ZZAA 1LBCA 4ISUA 4NF6B 4YMAA 5EHMA 2I49A 4F2QA 1A54A 3T9XB 1I69A 3A3CA 3C4MA 3ZKLA 1O64A 3MPKA 1YCJA 4NWDA 3T22A 1MY2A 3PUXE 4TQUQ 3TCHA 2I0CA 1MG1A 3O6IA 4F2OA 1SD3A 4NEDA 4I1DA 1I6QA 5TU0A 3O29A 4EXLA 3TEPA 1NFTA 3IL1B 5I56A 2UVJA 3MZ1A 1SW4A 3RPWA 3LBSA 3JYRA 1MQIA 4RY1A 3UGWA 3OO6A 2RC7A 2Z23A 1UTBA 4YICA 1MXWA 4QSDA 5DTBA 3V8XB 4IGTA 1B46A 1IEJA 3RTFB 5TP9B 3LSXA 1B0LA 1N7WA 1P1QA 2XD3A 4LZ5A 4M4GA 5M2VA 1GVCA 4LUBA 4XKRA 3U1OA 3A3UA 3VV5A 4DE8A 5AA3A 2XX8A 3F11A 1TFAA 1YTVA 2ZMBA 3U94A 5AA2D 3PMXA 1OMPA 1US4A 4F29A 4NF8A 4ND9A 2V3UA 4UA8A 1LFGA 2F97A 2YJPA 4ESWA 4F3PA 4GF8A 5DT6A 5AA4A 4I8CA 1NNTA 4OQOA 1AMFA 5L9MA 3TTRA 3CSBA 5EYFA 5K2YA 1SI0A 4F19A 3G3KA 1B4HA 4U1ZA 4F3SA 1MY4A 3TFLA 5I2NA 1MPDA 2PVUA 3H06B 4G8HA 3UP9A 4Q0CA 3VLVA 1SYHA 1D9YA 1ZTYA 4OWDA 2Q8JA 1B32A 1MH3A 3MVZA 1B3LA 1QVSA 3ONMA 1JQFA 1MM6A 4M1VA 1PBQA 4ZE9A 1SW5A 3UK4A 1SYIA 3RTWB 3SDFA 5I58A 2A5TB 1R1NA 1B1XA 2QSXA 1US5A 2I48A 3IK6B 2O7IA 1LSTA 5CMBA 4F1UA 2E1SA 2Q9TA 4XTCQ 3G7WA 1HSLA 2E0SA 2VOZA 5ELVA 2V93A 3K6VA 1H45A 3KOTA 1EZPA 3PV0E 4RK2A 3HN0A 3KSXA 2ESNA 1O7TA 1Y3QA 4O3BA 4Q5TA 1XOCA 2F7BA 1QUIA 2O7UA 2OWTA 4QFNA 3R26A 1N84A 4GFRA 1NNPA 2DYXA 3TQWA 3G3JA 2XX9A 4U22A 2F35A 4NF5A 1VE4A 4OENA 4EF2A 4F18A 1SW1A 5CM6A 2A5SA 2XXQA 3W9WA 1OLCA 5JEIA 1P1UA 2DVCA 2ONRA 3BFTA 1D3KA 2PBWA 3BKIB 3M3KA 4XKPA 3TKDA 5KCJB 1BLFA 1F9BA 1B58A 2O1MA 3K1MA 4U4XA 4X1BA 4ZZEA 4DCXA 3MAMA 5H8FA 5FHNA 1B7ZA 1QJMA 2G93A 2Y7IA 3CI8A 1S50A 3N94A 1MS7A 4JB7A 4YU0A 2YLNA 4ZECA 2ZYKA 1N7XA 2Y7RA 3FJGA 3FATA 1MPBA 3KG2A 3MZ9A 5I2KB 4R6KA 4X1DA 2V3TA 2NWJA 3RT8A 3MVWA 4C0RA 3QSLA 4JXIA 4KPTA 5FHOA 3HHFA 2O84X 4OETA 4HW8A 1P1OA 4JWOA 1QUJA 2HCAA 1N3WA 2ZNTA 3PPNA 4IO3A 3FASA 4BDQA 4WEDA 3FUZA 1URDA 3IB1A 1A99A 2AYSA 2WKYA 4N13A 4OEUA 4R2FA 4HTGA 2CMOA 4DLDA 1R6ZA 1ZBMA 4R73A 3O6GA 3S9LC 1JW1A 1PB8A 5I57B 3KOSA 3E13X 1ATGA 3RN8A 3T93B 1IXCA 3B7DA 1FTJA 1MXXA 1ZIUA 3K02A 3MP1A 5TPAA 3RLFE 2Q2CA 3MZBA 2XXRA 1GTKA 3CVGA 3ODBA 4EQ7A 1ZJLA 4HS7A 2G29A 2XXVA 4YB7A 2ABHA 3C33A 4TLLB 1M5CA 4WXJA 3TCGA 2XXWA 3Q25A 2FYIA 4LZ7A 3TMGA 4C1UA 2OLBA 5BUUA 3PPPA 3O2AA 3MVXA 1FQFA 3V89B 5H8NA 2XXXA 3D4GA 2NXOA 3SEXA 5ITPA 4AQ4A 3I3VA 3KZGA 4G8NA 3EHUA 2RCBA 3SEUA 3V83A 1URSA 2QS2A 3KJTA 5A5XA 1LFHA 1AIVA 1B5JA 4UACA 2BJJX 2DXRA 3C35A 1H3DA 4POWA 2A5TA 3TPAA 1TXFA 1XC1A 2RF1A 1FTLA 4O3CA 5EHSA 4ECFA 4EUOA 3RUMA 3M3FA 5CRYA 3VLUA 2F36A 1B4ZA 2HXWA 1Y9UA 5F1QA 1OQGA 5AA1A 4IO2A 2RC8A 3MW0A 4U23A 4HCYA 2DE4A 3HV1A 4KQPA 4O3AA 2B3FA 4PQJA 2H25A 4X9TA 3LUYA 4YKJA 4R9GA 1UIUA 3T66A 3MVYA 3KFMA 1LLSA 2ANJA 2H99A 1FQDA 2RCAA 2UVHA 1Q35A 2ZNSA 2ZYNA 4GVOA 4L17A 1BIYA 2DWHA 2QMWA 4GLIA 2OK2A 3K4UA 3U8QA 4G77A 4KYDA 2ONKE 2VGQA 4NF4A 1CE2A 5DEXB 2PYYA 2F7CA 1GR2A 3MJNA 2H9BA 1GGGA 3CG1A 3IJOB 1I6BA 2FA7A 3HO7A 4E0XA 2Q2AA 1MQGA 1YPNA 1JEVA 4OXVA 1D4NA 1ELJA 1VR5A 3CG3A 3CR9A 3U72A 4EXKA 4GD5A 1JVYA 4H0WA 4ZEKA 3TDJA 2Z22A 1LCTA 3W15C 1NNFA 1B05A 3KN3A 3O6HA 5H8SA 4R2BA 4BLAA 5CMMA 4XKNA 3KSJA 3O66A 2B3BA 1DTZA 2GFEA 2I0BA 3GLBA 4YKIA 2PX1A 4FORA 3OEMA 2F34A 2R6GE 4MH5A 2QPQA 2X7QA 4OZ9A 4WKMA 1ANFA 3FVGA 4YZZA 3EPEA 4MFIA 1XVXA 5FHMA 1PEBA 1WODA 3P7IA 4PE5B 4AB5A 2I58A 5DVIA 3TZAA 1Y4TA 1B40A 4R6YA 2RINA 3SEVA 4EQ9A 5L9OA 4FE8A 4FJPA 4IB2A 2REGA 3EHTA 3FZVA 3CFZA 2VP1A 3G3IA 1A40A 3N6TA 4FEBA 2V25A 1NNKA 3O28A 3OOAA 3O9PA 4P0IA 5FTIA 4Z7EA 3UA8A 3UIFA 1IUDA 2F8DA 1Y3NA 2X26A 3TTLA 4H6DA 1LGBC 1A55A 2O69A 3RNNA 5JK4A 3SERA 1OVTA 4JDFA 3N6UA 3OO9A 3VVEA 3QUFA 1IZ1A 3DP8A 3LC8A 3PD9A 1IXIA 2IEEA 3MP6A 5CC2A 5LOMA 1HSEA 4IO4A 4XIGQ 3PGFA 3T96B 3FJ7A 1WVJA 1LAFE 1H44A 1MDQA 1Z7NE 3PUVE 2I4BA 2PT2A 4G68B 4GL0A 2OZZA 4NE4A 1MQHA 3T9VA 2P1SA 2QRYA 2RC9A 2H98A 2DWJA 2M8CA 2Y7PA 1MXVA 2AIXA 3K01A 2X7PA 4QSCA 3SEWA 3SKPA 1P99A 5A5XB 4AB6A 1UTHB 3G3HA 4JSDA 3W9VA 4DXCA 1EZ9A 4FECA 4PFTA 1P1WA 1XS5A 1II5A 2UVIA 4RYAA 5DVFA 3S2VA 5KDTB 1VFEA 1QW0A 5B70A 3WAFA 3FIRA 5I56B 4H5GA 3SESA 2NUVA 4LZ8A 4R72A 3USDA 1M5FA 3KGCA 4YKPA 3R7XA 3U92A 4E0WA 5JTYA 2DOJA 2LAOA 4DXBA 1BP5A 4FAJA 1ZMGA 3OMBA 4KYSA 1Y1ZA 3G3GA 4FEDA 2QL3A 3H4ZA 5H8FB 5I59A 1LB8A 1SDXA 5ISUA 3QK6A 3CIJA 4PFWA 2HFBA 3TAJA 3IOWA 1YAEA 3H3GA 3D4CA 2I3WA 1DTGA 3FXUA 1B52A 3TUSA 4IO7A 3KBRA 3MWBA 1MXZA 4OFLA 4YKKA 4ZEFA 3EF7A 4LVQA 2KLFA 4ELOA 1R9QA 3PPQA 4LQ2A 1NH7A 3FVOA 3TTMA 4BDMA 3IOVA 2D5WA 4RNSA 1OQHA 4KFQA 4F1YA 1ZU0A 4N07A 2XXYA 4G68A 2UVGA 2O1LA 3N26A 3PU5A 3TCFA 3Q26A 3FVNA 2DWAA 2HAVA 1H43A 2OJTA 2THIA 4GL8A 4Z0IA 1A8FA 2Z8EA 3PD8A 1EU8A 4NF6A 2CZLA 2VD2A 3K6WA 4NF4B 1EZOA 1UTHA 4KYEA 4MBPA 4H8JA 3I6VA 4P11A 5AA2B 5I58B 4ZS9A 3IO6A 1B5HA 4K3FA 2UXAA 1S9TA 3O97A 4H65A 1A7LA 1AH5A 4FATA 1IXHA 3DLNA 3OO7A 4F39A 5K2XA 4BDNA 3VXBA 2HQ0A 2QS1A 4KD5A 4EF1A 1FCKA 2XXTA 1FQBA 4RPNA 3VLWA 2DSFA 4KCDA 3TTKA 2YPNA 4POXA 3K1NA 3KN8A 1I6AA 3B6TA 1USYH 3M8UA 1UIVA 3KN7A 1MY3A 2QS3A 1RYOA 1B3EA 3OEKA 1MM7A 2B65A 3HHGA 1LAGE 1TWYA 2XD2A 3Q28A 4GRKA 4H8IA 3VVDA 4BDRA 5BWJA 1TFDA 1IIWA 3H03A 3TELA 2DQVA 1JVXA 3C32A 3V5AA 5AA2A 1FQEA 3M3LA 1FQCA 1DPPA 4H5FA 1MH4A 2DE2A 4KHZE 4P0GA 3ZS6A 1LAXA 1SVXB 4GWOA 2Y7WA 4MLQA 2AL5A 3IO4A 3K0VA 1XVYA 1PB7A 4GXSB 3TODA 2R9JA 4GOTA 4G68C 3UN6A 3B6WA 1QKAA 3CSGA 4OESA 3FGSA 5I2KA 1T0KA 2Y84A 3IAZA 3OELA 4NWCA 2R71A 4ELRA 3E3KA 3UORA 3B6QA 3WAEA 3DP6A 5F7VA 1JNFA 3E9XA 4NF8B 5L8DA 1DPEA 1RYXA 3E4RA 3PPRA 3S4UA 4BDLA 2PMSA 1MQDA 3OO8A 4IY5A 4YMBA 2XX7A 2D21A 2D3IA 1FW0A 4DDDA 1OIBA 5J1DA 1B3FA 4KCCA 2DS9A 3IOUA 4DCYA 1SBPA 3DELB 4IY6A 3QAXA 4PFYA 3L6HA 3K1PA 4RK9A 4OYVA 4DXUA 2ZXTA 1TT1A 1MDP1 4OFOA 1GV8A 1POY1 3Q27A 3RY3A 4G4PA 4QFKA 5B7DA 1J1NA 4F3GA 4ELPA 3ZSFA 1M5DA 1QUKA 1IITA 4LQ5A 5DVJA 3DP4A 1M5BA 4TOZA 1NMUA 5H8HA 5ICTA 4U1OA 4RXLA 5H8QB 3S9EA 3CFLA 2HZLA 5IAIA 3KEIA 1H76A 3K00A 3QXMA 2DXYA 4WEPA 3VFJA 4ELQA 3K6XA 3PPOA 3H7MA 1EH3A 1IQ7A 3PUZE 3T9HB 4OERA 1Y1MA 1LCFA 5ICQA 2H4IA 2FNCA 3HSTA 3THIA 1HSJA 1B7UA 1NL5A 1M5EA 2H5YA 2OBGA 5L9SA 2XHDA 4LONB 4ZEIA 1WDNA 2GRVA 4X48A 4TLMB 2O6AA 4G8MA 5I84A 1DMBA 1PB9A 2F6PA 2OWSA 2Y7KA 3JZJA 5CBRA 1MXUA 1MXYA 3H6UA 3A09A 1IXGA 5KDTA 2O51A 4EDPA 4ZDMA 1CB6A 1B3HA 3CFXA 4G2ZA 2XXIA 3K6UA 3OD7A 1AOVA 5H8QA 1LAHE 2W7YA 4QFPA 3U93A 5AE4A 1OLAA 3T9UA 3LSWA 1Q1KA 3BFUA 3ILUB 1N3XA 1Y20A 2ALUA 3OXNA 3H6WA 4OHNA 4QFOA 3RT6B 3OSRA 4PETA 4U21A 1Z7ME 4GXAA 1MY1A 1OVBA 2F7AA 4XKQA 5HPQA 2I6EA 4RPOA 2Z8DA 1N76A 1PBPA 4NMYA 4R6HA 1PC3A 2XXUA 1VFDA 2Q89A 3C31A 3RQTA 3FVKA 1URGA 1ZKBA 2ONSA 3PMVA 1Y3PA 1XT8A 3VDFA 4MLVA 3ILTB 3MUQA 3SETA 4PP0A 3KJ7A 4GIZA 4IO6A 1FTOA 2AL4A 4JBZA 4JWYA 4LP2B 3MPLA 4H67A 4OEVA 5H8NB 3PUYE 1XHYA 2VHAA 1B3GA 2VD3A 4EQBA 2Q88A 3IB0A 4OFJA 3I5OA 1O63A 4ZEDA 5I59B 1S7YA 3VVFA 2QJEA 1N04A 3IOTA 5I57A 3TYHA 1R9LA 3C9HA 2P0SA 2HZKA 2XXHA 5TPAB 1NH8A 4OMBA 3OENA 4LA9A 3C34A 4THIA 3EN3A 3MC2A 1KWHA 2ZYOA 1MPCA 4IO5A 5CMCA 4I62A 3PUWE 2F6GA 3GZGA 4HCWA 1LBBA 3PMWA 1AL3A 1B1HA 1JETA 1BKAA 2XXPA 5IKBA 2HAUA 2V84A 1LB9A 2NVUB 2HEUA 4DIGA 1B51A 3HPIA 3LSFB 2F78A 1B2HA 5CMKA 3K2DA 4I9DA 4QHQA 5H8HB 2IA4A 4KR5A 1B5IA 4XXUA 1B7HA 5DEXA 1SQYA 3EHSA 1D9VA 1DOTA 3GBAA 4R74A 3ZKKA 1SW2A 2I3VA 2PT1A 2DP8A 2QMXA 3GBBA 3H6TA 4U2RA 5FTHA 1DSNA 4ESXA 4F1VA 5AA4B 1FTKA 2F5XA 4Q30B 3SEYA 1UQWA 4DZ1A 1MQJA 3GXAA 3TQLA 3IB2A 3VE1B 5I2NB 2GHBA 1JW5A 3IJXB 3H6VA 3R6UA 4RJZA 1MY0A 4F31B 3FV1A 3FJMA 1Y4CA 1PDAA 2RKMA 3MP8A 4YB6A 3EQ1A 4JSOA 2REJA 3C36A 1SI1A 2DE3A 4JWXA 1B9JA 1L5TA 2V3QA 2UYFA 4MF3A 4ZEBA 1P1NA 3Q29A 4U4SA 4NF5B 3MBPA 4F3BA 4Q8RA 3FV2A 2UYEA 3ECRA 3CRBA 1B0HA 2O68A 3LR1A 1UTBB 4H1XA 5JTYB 3IX1A 3IR1A 5TP9A 4ONYA 2GHAA 4FIMA 4QF9A 4RA1A 4QSEA 3LSLA 3BBRA 4QFLA 1POTA 1B6HA 2I4CA 2OCUA 1A8EA 1BTJA 2ZYMA 4LATA 3QYTA 4QRZA 4F22A 4KI0E 5HBCA 1NKXA 2GH9A 4ZE8A 4OTEA 4C1TA 1VSOA 1LFIA 4IGRA 4R9FA 1RKMA 5CI5A 3MQ9A 4NTLA 3S9MC 2NOOA 3IORA 3L6GA 1N0TA 1QULA 3VXCA 2ZNUA 5KZTA 1QKBA 3FD3A 2DVZA
chains in the Genus database with same CATH superfamily
1MRPA 3G3FA 3FXRA 3QIMA 1FTMA 1NV7A 1JEUA 2DWIA 3FXQA 3ISPA 3HCQA 4YMAA 3T9XB 3E78A 1YCJA 4NWDA 3O29A 4EXLA 2UVJA 3MZ1A 3RPWA 3OO6A 2RC7A 1UTBA 1MXWA 3RTFB 1B46A 3HFUA 4M4GA 5M2VA 3U1OA 3A3UA 3U94A 1YTVA 4P56A 4NF8A 2V3UA 4UA8A 2YJPA 1RDYA 2FVZA 5DT6A 5AA4A 1NNTA 1AMFA 5L9MA 5ISUA 4U1ZA 1MPDA 4DI3D 4G8HA 3MVZA 1B3LA 1SW5A 2I48A 3IK6B 1LSTA 5CMBA 2E1SA 2E0SA 5ELVA 1XOCA 2OWTA 1QUIA 1N84A 4NF5A 4OENA 1VE4A 4HE1A 4F18A 2A5SA 5EQAA 4N6DA 3BFTA 4XKPA 5KCJB 3TKDA 3K1MA 4X1BA 4ZZEA 4PAKA 5FHNA 3N94A 5EQ7A 2Y5KA 4C0RA 3QSLA 4KPTA 4OETA 1QUJA 1NV1A 5LDZA 4BDQA 1URDA 3IB1A 4HE2A 2CMOA 3S9LC 4QBAA 4MAGA 1IXCA 1FTJA 3MP1A 2Q2CA 3MZBA 2WX9A 4TLLB 4G61A 3V89B 3D4GA 4AQ4A 4G8NA 3EHUA 1URSA 2QS2A 3KJTA 2BJJX 3C35A 3TPAA 4EUOA 5CRYA 3KBZA 2HXWA 1Y9UA 4HCYA 4PFRA 4X9TA 3LUYA 2F3BA 2H99A 2UVHA 2ZNSA 2QMWA 4LN5A 4KYDA 1CE2A 3MJNA 2B4LA 2Q2AA 1MQGA 4OXVA 4MCOA 3CR9A 2XWKA 3TDJA 1NNFA 3KN3A 4PFBA 4PFIA 2B3BA 2GFEA 2I0BA 3GLBA 4OZ9A 4WKMA 2X7QA 4MFIA 1PEBA 1WODA 3P7IA 4R6YA 4FJPA 4IB2A 3EHTA 4OERA 4DXCA 4P8BA 2VP1A 1A40A 1IUDA 3TTLA 4H6DA 3N6UA 3PD9A 3LC8A 1IXIA 3MP6A 3T96B 1H44A 3PUVE 5DW8A 2PT2A 4GL0A 2OZZA 2QRYA 2OX3A 2Y7PA 2L5VA 5EYGA 5IGAA 4AB6A 4JSDA 3W9VA 4RYAA 1P1WA 3S2VA 5I56B 3FIRA 4YKPA 2LAOA 4DXBA 1BP5A 4FAJA 1KZ8A 3RPLB 2QL3A 3IOWA 1YAEA 3TUSA 3MWBA 4OFLA 4YKKA 4IR8A 4LQ2A 3FVOA 3TTMA 4OVSA 2D5WA 4RNSA 1OQHA 4F1YA 2UVGA 3PU5A 4OVPA 4NN3A 4N4UA 3FVNA 2THIA 2OJTA 4GL8A 1FTAA 1A8FA 5F24A 2CZLA 2VD2A 4NF4B 1EZOA 4KYEA 4MBPA 4H8JA 1EYIA 4H65A 3O97A 2V4CA 5IM2A 4F39A 2HQ0A 4KD5A 2FIXA 3B50A 4KCDA 1JP4A 3K1NA 1I6AA 3B6TA 1UIVA 3KN7A 1B3EA 1FPDA 1TWYA 3IFCA 1IIWA 3TELA 1FQEA 2DE2A 2Y7WA 3TODA 4GXSB 1T0KA 3OELA 2R71A 3UORA 4GBVA 4MNPA 1JNFA 3D1RA 1RYXA 4YMBA 1MQDA 2XX7A 3BIGA 5J1DA 1B3FA 3IOUA 3DELB 4RK9A 4DXUA 2ZXTA 3RY3A 4QFKA 4F3GA 3ZSFA 1NMUA 1KA1A 4U1OA 2HZLA 3K6XA 3H7MA 1IQ7A 2FNCA 2H5YA 4N8GA 4X48A 4TLMB 3JZJA 5CBRA 5KDTA 4ZDMA 1CB6A 1AOVA 4PDDA 4QFPA 5EQ9A 3T9UA 3OXNA 4PETA 4MNCA 2F7AA 5HPQA 2I6EA 2XXUA 1VFDA 3C31A 1URGA 4MLVA 3SETA 4GIZA 4IO6A 4JWYA 3MPLA 4OEVA 3IB0A 4ZEDA 1S7YA 2QJEA 3TYHA 1R9LA 3C9HA 3BIHA 4OVQA 5TPAB 1NH8A 4OMBA 3FBPA 3EN3A 2WEFA 1KWHA 2ZYOA 5CMCA 3GZGA 3PMWA 1AL3A 5IKBA 2V84A 2NVUB 1LBYA 4DIGA 1B51A 1XI6A 3K2DA 1B5IA 4XXUA 1B7HA 5DEXA 4OA4A 2PT1A 2DP8A 2QMXA 4Q30B 4DZ1A 1MQJA 3GXAA 5I2NB 4RJZA 1PDAA 2RKMA 4YB6A 4OVRA 1B9JA 2PFZA 5IZZA 1UTBB 4HE0A 1FPBA 3IX1A 3IR1A 1NV6A 4QF9A 3LSLA 3BBRA 1POTA 1B6HA 2I4CA 2OCUA 1BTJA 2ZYMA 1FBPA 4LATA 4QRZA 4KI0E 4C1TA 4OTEA 4XF5A 1VSOA 4HXVA 4NTLA 3IORA 2PCRA 5KZTA 3TCGA 4N6PA 3RGYA 1ZLQA 3OSQA 1FBGA 4NGUA 5ITOA 1D9QA 4OVJA 4JVCA 4JVIA 4YB5A 3DM0A 2P3VA 4ISUA 4NF6B 2XWOA 5EHMA 2JJKA 1I69A 3MPKA 1MY2A 4F2OA 2I0CA 1I6QA 3IL1B 3LBSA 1MQIA 4GWSA 2Z23A 3V8XB 4LUBA 3RYDA 4DE8A 2WBBA 1US4A 4F29A 4ND9A 4GF8A 1G0HA 4I8CA 4OQOA 2PVUA 3H06B 1SYHA 1B32A 1MH3A 1QVSA 4ZE9A 3UK4A 1SYIA 3RTWB 5I58A 2QSXA 1US5A 4F1UA 3G7WA 3CHGA 3HN0A 4QFNA 4GBWA 3R26A 4GFRA 1NV5A 3TQWA 1OLCA 5JEIA 2DVCA 3M3KA 3BKIB 4P1EA 1B7ZA 1QJMA 2G93A 4JB7A 2YLNA 2ZYKA 1N7XA 3KG2A 5I2KB 3HHFA 4HW8A 1A99A 4DLDA 1LBXA 5ET6A 3E13X 4JVDA 3RLFE 4AS5A 1GTKA 3CVGA 4HS7A 5DVIA 4YB7A 2ABHA 3C33A 1M5CA 2XXWA 4LZ7A 2FYIA 3TMGA 3PPPA 1FQFA 5H8NA 3SEXA 3B8BA 5A5XA 1AIVA 1B5JA 4UACA 1RDZA 1XC1A 4ECFA 3RUMA 3M3FA 2F36A 1B4ZA 4U23A 1FPIA 3HV1A 4KQPA 4O3AA 4YKJA 1GV8A 3T66A 2WYPA 3KFMA 4PAIA 5ET8A 1FQDA 2RCAA 1BIYA 2DWHA 4MNIA 2F7CA 1GGGA 1I6BA 2FA7A 1JEVA 1ELJA 3LV0A 4EXKA 4H0WA 4ZEKA 2Z22A 4BLAA 5H8SA 2Q8MA 5CMMA 1DTZA 5FBPA 1NV3A 4MH5A 4YZZA 1LBZA 1XVXA 4PE5B 4MJOA 3TZAA 1B40A 5L9OA 3FZVA 4GWOA 4FEBA 4PC9A 2V25A 1NNKA 2X26A 1LGBC 1A55A 5JK4A 2QFLA 3OO9A 3QUFA 1IZ1A 4GWYA 1AWBA 1HSEA 3PGFA 3FJ7A 1Z7NE 2PFYA 2I4BA 1MQHA 2P1SA 2RC9A 2H98A 2M8CA 4QSCA 1P99A 1EZ9A 4FECA 4PFTA 1XS5A 1VFEA 4E0WA 3R7XA 5JTYA 2DOJA 2VT5A 3OMBA 2HPGA 1Y1ZA 3G3GA 4FEDA 4PGNA 3QK6A 3H3GA 3FXUA 3KBRA 3EF7A 1R9QA 1NH7A 4BDMA 1EYKA 4NX1A 4G68A 2O1LA 3Q26A 2HAVA 1SPIA 3PD8A 1EU8A 2P3NA 1UTHA 4P11A 4PF6A 4FATA 1IXHA 3KC0A 4BDNA 2QS1A 2XXTA 3TTKA 2BJIA 3M8UA 3OEKA 1LAGE 2XD2A 3VVDA 4BDRA 1TFDA 2Y5LA 4H5FA 3M3LA 1FQCA 3ZS6A 3K0VA 1PB7A 2CEXA 2R9JA 4O7MA 3DP6A 1KA0A 4NF8B 4BDLA 1DPEA 3E4RA 2PMSA 2D3IA 5LTCA 2DS9A 4DCYA 4PFYA 4OYVA 1POY1 3Q27A 2GQ1A 1M5DA 5DVJA 5H8HA 4RXLA 5H8QB 4FBPA 3QXMA 4ELQA 1DCUA 1EH3A 5ICQA 2H4IA 5L9SA 2XHDA 4LONB 1WDNA 5IZ3A 2O6AA 1MXUA 2CEYA 4PAFA 3CFXA 5H8QA 1Q1KA 2ALUA 4O94A 4QFOA 3OSRA 1Z7ME 1MY1A 1FPFA 1PC3A 1NV0A 3FVKA 2ONSA 1K9YA 3PMVA 4OANA 4LP2B 4JBZA 1FTOA 1DBZA 4P3LA 3PUYE 1XHYA 2VHAA 2Q88A 3IOTA 1N04A 2HZKA 4LA9A 4THIA 4I62A 1B1HA 1B2HA 4QHQA 2VPOA 4KXPA 3EHSA 1DOTA 1DK4A 3GBAA 1SW2A 2I3VA 4U2RA 3TQLA 3T0JA 3SZPA 1MY0A 3FV1A 3FJMA 3MP8A 4JWXA 4ZEBA 4U4SA 3MBPA 2UYEA 3ECRA 1B0HA 3LR1A 2MKZA 2XWVA 2GHAA 4FIMA 4RA1A 4QSEA 4NAPA 1LFIA 2NOOA 1QULA 4GXAA 2DVZA 4P47A 4R75A 3QUJA 1IMFA 1FQAA 1YYZA 4GWXA 3JV9A 2Z8FA 4ZZAA 2I49A 1A54A 4NF0A 3A3CA 3ZKLA 1O64A 3TCHA 1MG1A 3O6IA 4NEDA 5I56A 3NOHA 1SW4A 3JYRA 4YICA 4QSDA 4IGTA 1FBHA 3LSXA 1B0LA 1P1QA 4LZ5A 1GVCA 4XKRA 3TEPA 3F11A 2ZMBA 3PMXA 1OMPA 4PE3A 4I40A 4ESWA 4GX6A 4N81A 5K2YA 3G3KA 1B4HA 5I2NA 1IMEA 1FSAA 3UP9A 1ZTYA 4OWDA 2Q8JA 2KQZA 1JQFA 1MM6A 4M1VA 1PBQA 1NUYA 2A5TB 1R1NA 2O7IA 4XTCQ 2V93A 3K6VA 1EZPA 4O8MA 4RK2A 3U65A 1Y3QA 2F7BA 2O7UA 2DYXA 3G3JA 2XX9A 2F35A 4EF2A 5CM6A 2XXQA 1P1UA 2ONRA 4U4XA 1FPEA 4GWUA 3FJGA 1MPBA 2F3DA 4I3YA 1FJ9A 4NHBA 4R6KA 4JXIA 2O84X 1P1OA 4JWOA 3LUZA 2HCAA 1N3WA 2ZNTA 3PPNA 4IO3A 3FASA 2FBPA 3FUZA 4N13A 2WKYA 4R2FA 3GYYA 1R6ZA 5I57B 3RN8A 1MXXA 2XXRA 3ODBA 1ZJLA 2G29A 2XXVA 3Q25A 4C1UA 5BUUA 3E79A 5ITPA 3KZGA 2RCBA 1LFHA 2DXRA 1H3DA 1TXFA 5EHSA 4O3CA 5F1QA 1OQGA 4IO2A 3MW0A 4PQJA 2H25A 2OK2A 3K4UA 4G77A 2PYYA 1GR2A 2H9BA 2HHMA 1VR5A 4XEQA 1JVYA 3W15C 2CZHA 2CZIA 4R2BA 4XKNA 3KSJA 3O66A 4DDDA 4YKIA 4FORA 2F34A 3EPEA 1VDWA 4AB5A 2I58A 2RINA 4EQ9A 3G3IA 5FTIA 3O28A 3OOAA 3UIFA 3MSTA 1Q9DA 1Y3NA 5T3JA 4JDFA 3DP8A 4P9KA 4IO4A 1LAFE 1NUZA 4NE4A 4G68B 2DWJA 3K01A 1MXVA 2AIXA 2X7PA 3SEWA 5A5XB 5ET7A 1UTHB 3G3HA 2UVIA 5DVFA 1QW0A 3WAFA 3SESA 4LZ8A 2FHYA 4R72A 3USDA 1M5FA 4KYSA 3H4ZA 1SDXA 3CIJA 4PFWA 2HFBA 3TAJA 3D4CA 4GWZA 4N8YA 2I3WA 1DTGA 1MXZA 4ZEFA 2KLFA 3PPQA 3IOVA 4NG7A 4KFQA 1ZU0A 4N07A 3N26A 3TCFA 1FBCA 1LBVA 2DWAA 1H43A 4H46A 4NF6A 3K6WA 3I6VA 1B5HA 1A7LA 3DLNA 3VXBA 4EF1A 1FCKA 1NV2A 4POXA 3KN8A 2XXKA 4PF8A 4MHFA 1MY3A 1RYOA 1MM7A 2B65A 3Q28A 4GRKA 5BWJA 4NQ8A 3H03A 2DQVA 1JVXA 3C32A 3V5AA 1NUWA 1DPPA 5EYHA 4P0GA 1SVXB 1XVYA 3UN6A 3CSGA 4OESA 2Y84A 3IAZA 3B6QA 2VPNA 3WAEA 4UABA 4IY5A 3QMFA 1SBPA 4IY6A 1YXIA 1MDP1 5B7DA 1INPA 4LQ5A 3DP4A 1M5BA 4TOZA 5ICTA 3S9EA 3CFLA 3KEIA 3K00A 2DXYA 4WEPA 3T9HB 1LCFA 1HSJA 1B7UA 1NL5A 1M5EA 2OBGA 4G8MA 5I84A 1PB9A 2OWSA 1MXYA 3H6UA 3A09A 2O51A 4EDPA 4G2ZA 3OD7A 4N6KA 3U93A 5AE4A 1OLAA 3LSWA 4OHNA 3H6WA 3RT6B 4U21A 1OVBA 4R6HA 2ZZVA 1Y3PA 3VDFA 3MUQA 4PP0A 5CBSA 2AL4A 5H8NB 2QVUA 4PTKA 2VD3A 4EQBA 4OFJA 4PCDA 1O63A 2P0SA 2XXHA 1IMAA 4PGPA 4IO5A 3PUWE 1LBBA 4GX4A 1BKAA 3LSFB 4I9DA 5H8HB 4KR5A 4R74A 5AA4B 3GBBA 5FTHA 1DSNA 1FTKA 2F5XA 3SEYA 5EQ8A 2GHBA 3IJXB 3R6UA 4F31B 1Y4CA 3EQ1A 4JSOA 2REJA 3C36A 2KR0A 1L5TA 2UYFA 1P1NA 4Q8RA 4NF5B 3FV2A 2O68A 4ONYA 1A8EA 4F22A 3QYTA 4ZE8A 1NKXA 2GH9A 4IGRA 1RKMA 2QVVA 3VXCA 4H67A 3FD3A 4YAHX 1JW4A 5DYHA 3TTNA 4P1LA 2P2AA 3N5LA 5HM4B 1USYE 3S9NC 5KCJA 3AXFA 4BDOA 2QS4A 4PFUA 4GQOA 2B4MA 1LBCA 4F2QA 3C4MA 1K9ZA 2XWIA 3T22A 3PUXE 4TQUQ 1SD3A 5TU0A 2OWZA 4I1DA 1FPGA 1YZ0A 1NFTA 2CZKA 4RY1A 3UGWA 5DTBA 1IEJA 5TP9B 1N7WA 2XD3A 5AA3A 3VV5A 5AA2D 2XX8A 1TFAA 3MYUA 1QGXA 1LFGA 2F97A 4F3PA 5ET5A 3TTRA 3CSBA 4F19A 4F3SA 1SI0A 1MY4A 3TFLA 4Q0CA 3VLVA 1EYJA 1D9YA 3ONMA 1LBWA 1FJ6A 3SDFA 1B1XA 2Q9TA 1HSLA 2VOZA 1H45A 3KOTA 3PV0E 2ZZWA 2WBDA 3KSXA 1O7TA 2ESNA 4Q5TA 4O3BA 1NNPA 4U22A 1SW1A 3W9WA 1D3KA 2PBWA 1BLFA 1F9BA 1B58A 2O1MA 4DCXA 3MAMA 5H8FA 3T1BA 2Y7IA 1IMCA 3CI8A 1S50A 4YU0A 1MS7A 4ZECA 2Y7RA 3FATA 3MZ9A 4X1DA 2V3TA 2NWJA 3RT8A 3MVWA 5FHOA 3FXBA 5ESYA 4WEDA 2AYSA 4OEUA 4MEVA 4HTGA 1ZBMA 4R73A 3O6GA 1JW1A 1PB8A 3KOSA 1ATGA 4AS4A 3T93B 3B7DA 1ZIUA 3K02A 5TPAA 3KC1A 4EQ7A 1FBEA 4WXJA 2OLBA 3O2AA 4PDHA 3MVXA 2XXXA 2NXOA 3I3VA 3RPLA 3SEUA 3V83A 5I3SA 4POWA 2A5TA 2Q74A 2RF1A 1FTLA 1NV4A 3VLUA 5AA1A 2RC8A 2DE4A 2B3FA 4R9GA 1UIUA 3MVYA 1LLSA 2ANJA 2ZYNA 1Q35A 4GVOA 4L17A 4GLIA 3A29A 3U8QA 1IMDA 5IZ3B 2ONKE 1CNQA 2VGQA 4NF4A 5DEXB 3CG1A 3IJOB 3HO7A 4E0XA 1YPNA 1D4NA 3CG3A 1FPKA 3U72A 4GD5A 1LCTA 1B05A 3O6HA 4X8RA 4QXDA 4OVTA 5IZ1A 5EYFA 2PX1A 3OEMA 3S9MC 2R6GE 2QPQA 1ANFA 3FVGA 5FHMA 1Y4TA 1FBFA 3SEVA 4O7IA 4FE8A 2REGA 3CFZA 3N6TA 4P0IA 4Z7EA 3O9PA 3UA8A 2F8DA 4MMPA 2O69A 3RNNA 3SERA 1OVTA 3VVEA 2IEEA 4GWWA 5CC2A 5LOMA 4XIGQ 1WVJA 1MDQA 2QVRA 3T9VA 3SKPA 1II5A 5KDTB 5B70A 4H5GA 2NUVA 4H45A 3KGCA 3U92A 1NUXA 1ZMGA 5H8FB 5I59A 1LB8A 1B52A 4IO7A 4ELOA 4LVQA 2XXYA 4MIJA 4Z0IA 2DDKA 4XFEA 2Z8EA 5AA2B 5I58B 4ZS9A 3IO6A 4K3FA 2UXAA 1S9TA 1AH5A 3OO7A 5K2XA 4RPNA 1FQBA 3VLWA 2DSFA 2YPNA 4X04A 1USYH 4N15A 2QS3A 3HHGA 4H8IA 5AA2A 1FPLA 1MH4A 4KHZE 1LAXA 4MLQA 2AL5A 3IO4A 4GOTA 4G68C 3B6WA 1QKAA 5I2KA 3FGSA 1FRPA 4NWCA 4ELRA 3E3KA 1NI9A 5F7VA 5L8DA 3E9XA 3PPRA 3S4UA 3OO8A 2D21A 1FW0A 1OIBA 3ROJA 4KCCA 3QAXA 3L6HA 3K1PA 1TT1A 4OFOA 3EKIA 4G4PA 1J1NA 4ELPA 1QUKA 1IITA 3IFAA 4MX6A 5IAIA 1H76A 3VFJA 1IMBA 3PPOA 3PUZE 1Y1MA 3THIA 3HSTA 1FPJA 4ZEIA 2GRVA 5I5PA 1DMBA 2F6PA 2Y7KA 1IXGA 1B3HA 4GX3A 2XXIA 3K6UA 1LAHE 2W7YA 3BFUA 3ILUB 1N3XA 1Y20A 2WYKA 1RDXA 4XKQA 2XA5A 4RPOA 2Z8DA 1N76A 1PBPA 4NMYA 3RQTA 2Q89A 2FIEA 1ZKBA 1XT8A 1BK4A 3ILTB 2HXRA 3KJ7A 1B3GA 5I59B 3I5OA 3VVFA 1FBDA 5I57A 4PBQA 4PBHA 3OENA 3C34A 3MC2A 1MPCA 2F6GA 4HCWA 1JETA 3PTYA 2XXPA 4DI4B 2HAUA 1LB9A 2HEUA 3HPIA 2F78A 5CMKA 2IA4A 1SQYA 1D9VA 4I3EA 3ZKKA 3H6TA 4F1VA 4ESXA 2ZZXA 1UQWA 3IB2A 3VE1B 4N91A 1JW5A 3H6VA 1SI1A 2DE3A 1LEVA 2V3QA 4MF3A 3Q29A 4F3BA 3CRBA 4H1XA 5JTYB 5J16A 5TP9A 5I7IA 1G0IA 4QFLA 5HBCA 5CI5A 4N17A 4R9FA 3MQ9A 5A5LA 3L6GA 1N0TA 2R8TA 2ZNUA 1QKBA
chains in the Genus database with same CATH topology
1MRPA 3G3FA 3FXRA 4YAHX 4N6PA 3QIMA 1JW4A 1ZLQA 1FTMA 3OSQA 5DYHA 1JEUA 3RGYA 3TTNA 2DWIA 5ITOA 2P2AA 3N5LA 4R75A 5HM4B 1USYE 4OVJA 3S9NC 3FXQA 5CBSA 3QUJA 5KCJA 3AXFA 4BDOA 2QS4A 1FQAA 3HCQA 3JV9A 4PFUA 2Z8FA 4GQOA 4YB5A 3DM0A 4ZZAA 1LBCA 4ISUA 4NF6B 4YMAA 5EHMA 2I49A 4F2QA 1A54A 3T9XB 1I69A 3A3CA 3C4MA 3ZKLA 1O64A 3MPKA 1YCJA 4NWDA 3T22A 1MY2A 3PUXE 4TQUQ 3TCHA 2I0CA 1MG1A 3O6IA 4F2OA 1SD3A 4NEDA 4I1DA 1I6QA 5TU0A 3O29A 4EXLA 3TEPA 1NFTA 3IL1B 5I56A 2UVJA 3MZ1A 1SW4A 3RPWA 3LBSA 3JYRA 1MQIA 4RY1A 3UGWA 3OO6A 2RC7A 2Z23A 1UTBA 4YICA 1MXWA 4QSDA 5DTBA 3V8XB 4IGTA 1B46A 1IEJA 3RTFB 5TP9B 3LSXA 1B0LA 1N7WA 1P1QA 2XD3A 4LZ5A 4M4GA 5M2VA 1GVCA 4LUBA 4XKRA 3U1OA 3A3UA 3VV5A 4DE8A 5AA3A 2XX8A 3F11A 1TFAA 1YTVA 2ZMBA 3U94A 5AA2D 3PMXA 1OMPA 1US4A 4F29A 4NF8A 4ND9A 2V3UA 4UA8A 1LFGA 2F97A 2YJPA 4ESWA 4F3PA 4GF8A 5DT6A 5AA4A 4I8CA 1NNTA 4OQOA 1AMFA 5L9MA 3TTRA 3CSBA 5EYFA 5K2YA 1SI0A 4F19A 3G3KA 1B4HA 4U1ZA 4F3SA 1MY4A 3TFLA 5I2NA 1MPDA 2PVUA 3H06B 4G8HA 3UP9A 4Q0CA 3VLVA 1SYHA 1D9YA 1ZTYA 4OWDA 2Q8JA 1B32A 1MH3A 3MVZA 1B3LA 1QVSA 3ONMA 1JQFA 1MM6A 4M1VA 1PBQA 4ZE9A 1SW5A 3UK4A 1SYIA 3RTWB 3SDFA 5I58A 2A5TB 1R1NA 1B1XA 2QSXA 1US5A 2I48A 3IK6B 2O7IA 1LSTA 5CMBA 4F1UA 2E1SA 2Q9TA 4XTCQ 3G7WA 1HSLA 2E0SA 2VOZA 5ELVA 2V93A 3K6VA 1H45A 3KOTA 1EZPA 3PV0E 4RK2A 3HN0A 3KSXA 2ESNA 1O7TA 1Y3QA 4O3BA 4Q5TA 1XOCA 2F7BA 1QUIA 2O7UA 2OWTA 4QFNA 3R26A 1N84A 4GFRA 1NNPA 2DYXA 3TQWA 3G3JA 2XX9A 4U22A 2F35A 4NF5A 1VE4A 4OENA 4EF2A 4F18A 1SW1A 5CM6A 2A5SA 2XXQA 3W9WA 1OLCA 5JEIA 1P1UA 2DVCA 2ONRA 3BFTA 1D3KA 2PBWA 3BKIB 3M3KA 4XKPA 3TKDA 5KCJB 1BLFA 1F9BA 1B58A 2O1MA 3K1MA 4U4XA 4X1BA 4ZZEA 4DCXA 3MAMA 5H8FA 5FHNA 1B7ZA 1QJMA 2G93A 2Y7IA 3CI8A 1S50A 3N94A 1MS7A 4JB7A 4YU0A 2YLNA 4ZECA 2ZYKA 1N7XA 2Y7RA 3FJGA 3FATA 1MPBA 3KG2A 3MZ9A 5I2KB 4R6KA 4X1DA 2V3TA 2NWJA 3RT8A 3MVWA 4C0RA 3QSLA 4JXIA 4KPTA 5FHOA 3HHFA 2O84X 4OETA 4HW8A 1P1OA 4JWOA 1QUJA 2HCAA 1N3WA 2ZNTA 3PPNA 4IO3A 3FASA 4BDQA 4WEDA 3FUZA 1URDA 3IB1A 1A99A 2AYSA 2WKYA 4N13A 4OEUA 4R2FA 4HTGA 2CMOA 4DLDA 1R6ZA 1ZBMA 4R73A 3O6GA 3S9LC 1JW1A 1PB8A 5I57B 3KOSA 3E13X 1ATGA 3RN8A 3T93B 1IXCA 3B7DA 1FTJA 1MXXA 1ZIUA 3K02A 3MP1A 5TPAA 3RLFE 2Q2CA 3MZBA 2XXRA 1GTKA 3CVGA 3ODBA 4EQ7A 1ZJLA 4HS7A 2G29A 2XXVA 4YB7A 2ABHA 3C33A 4TLLB 1M5CA 4WXJA 3TCGA 2XXWA 3Q25A 2FYIA 4LZ7A 3TMGA 4C1UA 2OLBA 5BUUA 3PPPA 3O2AA 3MVXA 1FQFA 3V89B 5H8NA 2XXXA 3D4GA 2NXOA 3SEXA 5ITPA 4AQ4A 3I3VA 3KZGA 4G8NA 3EHUA 2RCBA 3SEUA 3V83A 1URSA 2QS2A 3KJTA 5A5XA 1LFHA 1AIVA 1B5JA 4UACA 2BJJX 2DXRA 3C35A 1H3DA 4POWA 2A5TA 3TPAA 1TXFA 1XC1A 2RF1A 1FTLA 4O3CA 5EHSA 4ECFA 4EUOA 3RUMA 3M3FA 5CRYA 3VLUA 2F36A 1B4ZA 2HXWA 1Y9UA 5F1QA 1OQGA 5AA1A 4IO2A 2RC8A 3MW0A 4U23A 4HCYA 2DE4A 3HV1A 4KQPA 4O3AA 2B3FA 4PQJA 2H25A 4X9TA 3LUYA 4YKJA 4R9GA 1UIUA 3T66A 3MVYA 3KFMA 1LLSA 2ANJA 2H99A 1FQDA 2RCAA 2UVHA 1Q35A 2ZNSA 2ZYNA 4GVOA 4L17A 1BIYA 2DWHA 2QMWA 4GLIA 2OK2A 3K4UA 3U8QA 4G77A 4KYDA 2ONKE 2VGQA 4NF4A 1CE2A 5DEXB 2PYYA 2F7CA 1GR2A 3MJNA 2H9BA 1GGGA 3CG1A 3IJOB 1I6BA 2FA7A 3HO7A 4E0XA 2Q2AA 1MQGA 1YPNA 1JEVA 4OXVA 1D4NA 1ELJA 1VR5A 3CG3A 3CR9A 3U72A 4EXKA 4GD5A 1JVYA 4H0WA 4ZEKA 3TDJA 2Z22A 1LCTA 3W15C 1NNFA 1B05A 3KN3A 3O6HA 5H8SA 4R2BA 4BLAA 5CMMA 4XKNA 3KSJA 3O66A 2B3BA 1DTZA 2GFEA 2I0BA 3GLBA 4YKIA 2PX1A 4FORA 3OEMA 2F34A 2R6GE 4MH5A 2QPQA 2X7QA 4OZ9A 4WKMA 1ANFA 3FVGA 4YZZA 3EPEA 4MFIA 1XVXA 5FHMA 1PEBA 1WODA 3P7IA 4PE5B 4AB5A 2I58A 5DVIA 3TZAA 1Y4TA 1B40A 4R6YA 2RINA 3SEVA 4EQ9A 5L9OA 4FE8A 4FJPA 4IB2A 2REGA 3EHTA 3FZVA 3CFZA 2VP1A 3G3IA 1A40A 3N6TA 4FEBA 2V25A 1NNKA 3O28A 3OOAA 3O9PA 4P0IA 5FTIA 4Z7EA 3UA8A 3UIFA 1IUDA 2F8DA 1Y3NA 2X26A 3TTLA 4H6DA 1LGBC 1A55A 2O69A 3RNNA 5JK4A 3SERA 1OVTA 4JDFA 3N6UA 3OO9A 3VVEA 3QUFA 1IZ1A 3DP8A 3LC8A 3PD9A 1IXIA 2IEEA 3MP6A 5CC2A 5LOMA 1HSEA 4IO4A 4XIGQ 3PGFA 3T96B 3FJ7A 1WVJA 1LAFE 1H44A 1MDQA 1Z7NE 3PUVE 2I4BA 2PT2A 4G68B 4GL0A 2OZZA 4NE4A 1MQHA 3T9VA 2P1SA 2QRYA 2RC9A 2H98A 2DWJA 2M8CA 2Y7PA 1MXVA 2AIXA 3K01A 2X7PA 4QSCA 3SEWA 3SKPA 1P99A 5A5XB 4AB6A 1UTHB 3G3HA 4JSDA 3W9VA 4DXCA 1EZ9A 4FECA 4PFTA 1P1WA 1XS5A 1II5A 2UVIA 4RYAA 5DVFA 3S2VA 5KDTB 1VFEA 1QW0A 5B70A 3WAFA 3FIRA 5I56B 4H5GA 3SESA 2NUVA 4LZ8A 4R72A 3USDA 1M5FA 3KGCA 4YKPA 3R7XA 3U92A 4E0WA 5JTYA 2DOJA 2LAOA 4DXBA 1BP5A 4FAJA 1ZMGA 3OMBA 4KYSA 1Y1ZA 3G3GA 4FEDA 2QL3A 3H4ZA 5H8FB 5I59A 1LB8A 1SDXA 5ISUA 3QK6A 3CIJA 4PFWA 2HFBA 3TAJA 3IOWA 1YAEA 3H3GA 3D4CA 2I3WA 1DTGA 3FXUA 1B52A 3TUSA 4IO7A 3KBRA 3MWBA 1MXZA 4OFLA 4YKKA 4ZEFA 3EF7A 4LVQA 2KLFA 4ELOA 1R9QA 3PPQA 4LQ2A 1NH7A 3FVOA 3TTMA 4BDMA 3IOVA 2D5WA 4RNSA 1OQHA 4KFQA 4F1YA 1ZU0A 4N07A 2XXYA 4G68A 2UVGA 2O1LA 3N26A 3PU5A 3TCFA 3Q26A 3FVNA 2DWAA 2HAVA 1H43A 2OJTA 2THIA 4GL8A 4Z0IA 1A8FA 2Z8EA 3PD8A 1EU8A 4NF6A 2CZLA 2VD2A 3K6WA 4NF4B 1EZOA 1UTHA 4KYEA 4MBPA 4H8JA 3I6VA 4P11A 5AA2B 5I58B 4ZS9A 3IO6A 1B5HA 4K3FA 2UXAA 1S9TA 3O97A 4H65A 1A7LA 1AH5A 4FATA 1IXHA 3DLNA 3OO7A 4F39A 5K2XA 4BDNA 3VXBA 2HQ0A 2QS1A 4KD5A 4EF1A 1FCKA 2XXTA 1FQBA 4RPNA 3VLWA 2DSFA 4KCDA 3TTKA 2YPNA 4POXA 3K1NA 3KN8A 1I6AA 3B6TA 1USYH 3M8UA 1UIVA 3KN7A 1MY3A 2QS3A 1RYOA 1B3EA 3OEKA 1MM7A 2B65A 3HHGA 1LAGE 1TWYA 2XD2A 3Q28A 4GRKA 4H8IA 3VVDA 4BDRA 5BWJA 1TFDA 1IIWA 3H03A 3TELA 2DQVA 1JVXA 3C32A 3V5AA 5AA2A 1FQEA 3M3LA 1FQCA 1DPPA 4H5FA 1MH4A 2DE2A 4KHZE 4P0GA 3ZS6A 1LAXA 1SVXB 4GWOA 2Y7WA 4MLQA 2AL5A 3IO4A 3K0VA 1XVYA 1PB7A 4GXSB 3TODA 2R9JA 4GOTA 4G68C 3UN6A 3B6WA 1QKAA 3CSGA 4OESA 3FGSA 5I2KA 1T0KA 2Y84A 3IAZA 3OELA 4NWCA 2R71A 4ELRA 3E3KA 3UORA 3B6QA 3WAEA 3DP6A 5F7VA 1JNFA 3E9XA 4NF8B 5L8DA 1DPEA 1RYXA 3E4RA 3PPRA 3S4UA 4BDLA 2PMSA 1MQDA 3OO8A 4IY5A 4YMBA 2XX7A 2D21A 2D3IA 1FW0A 4DDDA 1OIBA 5J1DA 1B3FA 4KCCA 2DS9A 3IOUA 4DCYA 1SBPA 3DELB 4IY6A 3QAXA 4PFYA 3L6HA 3K1PA 4RK9A 4OYVA 4DXUA 2ZXTA 1TT1A 1MDP1 4OFOA 1GV8A 1POY1 3Q27A 3RY3A 4G4PA 4QFKA 5B7DA 1J1NA 4F3GA 4ELPA 3ZSFA 1M5DA 1QUKA 1IITA 4LQ5A 5DVJA 3DP4A 1M5BA 4TOZA 1NMUA 5H8HA 5ICTA 4U1OA 4RXLA 5H8QB 3S9EA 3CFLA 2HZLA 5IAIA 3KEIA 1H76A 3K00A 3QXMA 2DXYA 4WEPA 3VFJA 4ELQA 3K6XA 3PPOA 3H7MA 1EH3A 1IQ7A 3PUZE 3T9HB 4OERA 1Y1MA 1LCFA 5ICQA 2H4IA 2FNCA 3HSTA 3THIA 1HSJA 1B7UA 1NL5A 1M5EA 2H5YA 2OBGA 5L9SA 2XHDA 4LONB 4ZEIA 1WDNA 2GRVA 4X48A 4TLMB 2O6AA 4G8MA 5I84A 1DMBA 1PB9A 2F6PA 2OWSA 2Y7KA 3JZJA 5CBRA 1MXUA 1MXYA 3H6UA 3A09A 1IXGA 5KDTA 2O51A 4EDPA 4ZDMA 1CB6A 1B3HA 3CFXA 4G2ZA 2XXIA 3K6UA 3OD7A 1AOVA 5H8QA 1LAHE 2W7YA 4QFPA 3U93A 5AE4A 1OLAA 3T9UA 3LSWA 1Q1KA 3BFUA 3ILUB 1N3XA 1Y20A 2ALUA 3OXNA 3H6WA 4OHNA 4QFOA 3RT6B 3OSRA 4PETA 4U21A 1Z7ME 4GXAA 1MY1A 1OVBA 2F7AA 4XKQA 5HPQA 2I6EA 4RPOA 2Z8DA 1N76A 1PBPA 4NMYA 4R6HA 1PC3A 2XXUA 1VFDA 2Q89A 3C31A 3RQTA 3FVKA 1URGA 1ZKBA 2ONSA 3PMVA 1Y3PA 1XT8A 3VDFA 4MLVA 3ILTB 3MUQA 3SETA 4PP0A 3KJ7A 4GIZA 4IO6A 1FTOA 2AL4A 4JBZA 4JWYA 4LP2B 3MPLA 4H67A 4OEVA 5H8NB 3PUYE 1XHYA 2VHAA 1B3GA 2VD3A 4EQBA 2Q88A 3IB0A 4OFJA 3I5OA 1O63A 4ZEDA 5I59B 1S7YA 3VVFA 2QJEA 1N04A 3IOTA 5I57A 3TYHA 1R9LA 3C9HA 2P0SA 2HZKA 2XXHA 5TPAB 1NH8A 4OMBA 3OENA 4LA9A 3C34A 4THIA 3EN3A 3MC2A 1KWHA 2ZYOA 1MPCA 4IO5A 5CMCA 4I62A 3PUWE 2F6GA 3GZGA 4HCWA 1LBBA 3PMWA 1AL3A 1B1HA 1JETA 1BKAA 2XXPA 5IKBA 2HAUA 2V84A 1LB9A 2NVUB 2HEUA 4DIGA 1B51A 3HPIA 3LSFB 2F78A 1B2HA 5CMKA 3K2DA 4I9DA 4QHQA 5H8HB 2IA4A 4KR5A 1B5IA 4XXUA 1B7HA 5DEXA 1SQYA 3EHSA 1D9VA 1DOTA 3GBAA 4R74A 3ZKKA 1SW2A 2I3VA 2PT1A 2DP8A 2QMXA 3GBBA 3H6TA 4U2RA 5FTHA 1DSNA 4ESXA 4F1VA 5AA4B 1FTKA 2F5XA 4Q30B 3SEYA 1UQWA 4DZ1A 1MQJA 3GXAA 3TQLA 3IB2A 3VE1B 5I2NB 2GHBA 1JW5A 3IJXB 3H6VA 3R6UA 4RJZA 1MY0A 4F31B 3FV1A 3FJMA 1Y4CA 1PDAA 2RKMA 3MP8A 4YB6A 3EQ1A 4JSOA 2REJA 3C36A 1SI1A 2DE3A 4JWXA 1B9JA 1L5TA 2V3QA 2UYFA 4MF3A 4ZEBA 1P1NA 3Q29A 4U4SA 4NF5B 3MBPA 4F3BA 4Q8RA 3FV2A 2UYEA 3ECRA 3CRBA 1B0HA 2O68A 3LR1A 1UTBB 4H1XA 5JTYB 3IX1A 3IR1A 5TP9A 4ONYA 2GHAA 4FIMA 4QF9A 4RA1A 4QSEA 3LSLA 3BBRA 4QFLA 1POTA 1B6HA 2I4CA 2OCUA 1A8EA 1BTJA 2ZYMA 4LATA 3QYTA 4QRZA 4F22A 4KI0E 5HBCA 1NKXA 2GH9A 4ZE8A 4OTEA 4C1TA 1VSOA 1LFIA 4IGRA 4R9FA 1RKMA 5CI5A 3MQ9A 4NTLA 3S9MC 2NOOA 3IORA 3L6GA 1N0TA 1QULA 3VXCA 2ZNUA 5KZTA 1QKBA 3FD3A 2DVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MRP A;  3G3F A;  3FXR A;  4YAH X;  4N6P A;  3QIM A;  1JW4 A;  1ZLQ A;  1FTM A;  3OSQ A;  5DYH A;  1JEU A;  3RGY A;  3TTN A;  2DWI A;  5ITO A;  2P2A A;  3N5L A;  4R75 A;  5HM4 B;  1USY E;  4OVJ A;  3S9N C;  3FXQ A;  5CBS A;  3QUJ A;  5KCJ A;  3AXF A;  4BDO A;  2QS4 A;  1FQA A;  3HCQ A;  3JV9 A;  4PFU A;  2Z8F A;  4GQO A;  4YB5 A;  3DM0 A;  4ZZA A;  1LBC A;  4ISU A;  4NF6 B;  4YMA A;  5EHM A;  2I49 A;  4F2Q A;  1A54 A;  3T9X B;  1I69 A;  3A3C A;  3C4M A;  3ZKL A;  1O64 A;  3MPK A;  1YCJ A;  4NWD A;  3T22 A;  1MY2 A;  3PUX E;  4TQU Q;  3TCH A;  2I0C A;  1MG1 A;  3O6I A;  4F2O A;  1SD3 A;  4NED A;  4I1D A;  1I6Q A;  5TU0 A;  3O29 A;  4EXL A;  3TEP A;  1NFT A;  3IL1 B;  5I56 A;  2UVJ A;  3MZ1 A;  1SW4 A;  3RPW A;  3LBS A;  3JYR A;  1MQI A;  4RY1 A;  3UGW A;  3OO6 A;  2RC7 A;  2Z23 A;  1UTB A;  4YIC A;  1MXW A;  4QSD A;  5DTB A;  3V8X B;  4IGT A;  1B46 A;  1IEJ A;  3RTF B;  5TP9 B;  3LSX A;  1B0L A;  1N7W A;  1P1Q A;  2XD3 A;  4LZ5 A;  4M4G A;  5M2V A;  1GVC A;  4LUB A;  4XKR A;  3U1O A;  3A3U A;  3VV5 A;  4DE8 A;  5AA3 A;  2XX8 A;  3F11 A;  1TFA A;  1YTV A;  2ZMB A;  3U94 A;  5AA2 D;  3PMX A;  1OMP A;  1US4 A;  4F29 A;  4NF8 A;  4ND9 A;  2V3U A;  4UA8 A;  1LFG A;  2F97 A;  2YJP A;  4ESW A;  4F3P A;  4GF8 A;  5DT6 A;  5AA4 A;  4I8C A;  1NNT A;  4OQO A;  1AMF A;  5L9M A;  3TTR A;  3CSB A;  5EYF A;  5K2Y A;  1SI0 A;  4F19 A;  3G3K A;  1B4H A;  4U1Z A;  4F3S A;  1MY4 A;  3TFL A;  5I2N A;  1MPD A;  2PVU A;  3H06 B;  4G8H A;  3UP9 A;  4Q0C A;  3VLV A;  1SYH A;  1D9Y A;  1ZTY A;  4OWD A;  2Q8J A;  1B32 A;  1MH3 A;  3MVZ A;  1B3L A;  1QVS A;  3ONM A;  1JQF A;  1MM6 A;  4M1V A;  1PBQ A;  4ZE9 A;  1SW5 A;  3UK4 A;  1SYI A;  3RTW B;  3SDF A;  5I58 A;  2A5T B;  1R1N A;  1B1X A;  2QSX A;  1US5 A;  2I48 A;  3IK6 B;  2O7I A;  1LST A;  5CMB A;  4F1U A;  2E1S A;  2Q9T A;  4XTC Q;  3G7W A;  1HSL A;  2E0S A;  2VOZ A;  5ELV A;  2V93 A;  3K6V A;  1H45 A;  3KOT A;  1EZP A;  3PV0 E;  4RK2 A;  3HN0 A;  3KSX A;  2ESN A;  1O7T A;  1Y3Q A;  4O3B A;  4Q5T A;  1XOC A;  2F7B A;  1QUI A;  2O7U A;  2OWT A;  4QFN A;  3R26 A;  1N84 A;  4GFR A;  1NNP A;  2DYX A;  3TQW A;  3G3J A;  2XX9 A;  4U22 A;  2F35 A;  4NF5 A;  1VE4 A;  4OEN A;  4EF2 A;  4F18 A;  1SW1 A;  5CM6 A;  2A5S A;  2XXQ A;  3W9W A;  1OLC A;  5JEI A;  1P1U A;  2DVC A;  2ONR A;  3BFT A;  1D3K A;  2PBW A;  3BKI B;  3M3K A;  4XKP A;  3TKD A;  5KCJ B;  1BLF A;  1F9B A;  1B58 A;  2O1M A;  3K1M A;  4U4X A;  4X1B A;  4ZZE A;  4DCX A;  3MAM A;  5H8F A;  5FHN A;  1B7Z A;  1QJM A;  2G93 A;  2Y7I A;  3CI8 A;  1S50 A;  3N94 A;  1MS7 A;  4JB7 A;  4YU0 A;  2YLN A;  4ZEC A;  2ZYK A;  1N7X A;  2Y7R A;  3FJG A;  3FAT A;  1MPB A;  3KG2 A;  3MZ9 A;  5I2K B;  4R6K A;  4X1D A;  2V3T A;  2NWJ A;  3RT8 A;  3MVW A;  4C0R A;  3QSL A;  4JXI A;  4KPT A;  5FHO A;  3HHF A;  2O84 X;  4OET A;  4HW8 A;  1P1O A;  4JWO A;  1QUJ A;  2HCA A;  1N3W A;  2ZNT A;  3PPN A;  4IO3 A;  3FAS A;  4BDQ A;  4WED A;  3FUZ A;  1URD A;  3IB1 A;  1A99 A;  2AYS A;  2WKY A;  4N13 A;  4OEU A;  4R2F A;  4HTG A;  2CMO A;  4DLD A;  1R6Z A;  1ZBM A;  4R73 A;  3O6G A;  3S9L C;  1JW1 A;  1PB8 A;  5I57 B;  3KOS A;  3E13 X;  1ATG A;  3RN8 A;  3T93 B;  1IXC A;  3B7D A;  1FTJ A;  1MXX A;  1ZIU A;  3K02 A;  3MP1 A;  5TPA A;  3RLF E;  2Q2C A;  3MZB A;  2XXR A;  1GTK A;  3CVG A;  3ODB A;  4EQ7 A;  1ZJL A;  4HS7 A;  2G29 A;  2XXV A;  4YB7 A;  2ABH A;  3C33 A;  4TLL B;  1M5C A;  4WXJ A;  3TCG A;  2XXW A;  3Q25 A;  2FYI A;  4LZ7 A;  3TMG A;  4C1U A;  2OLB A;  5BUU A;  3PPP A;  3O2A A;  3MVX A;  1FQF A;  3V89 B;  5H8N A;  2XXX A;  3D4G A;  2NXO A;  3SEX A;  5ITP A;  4AQ4 A;  3I3V A;  3KZG A;  4G8N A;  3EHU A;  2RCB A;  3SEU A;  3V83 A;  1URS A;  2QS2 A;  3KJT A;  5A5X A;  1LFH A;  1AIV A;  1B5J A;  4UAC A;  2BJJ X;  2DXR A;  3C35 A;  1H3D A;  4POW A;  2A5T A;  3TPA A;  1TXF A;  1XC1 A;  2RF1 A;  1FTL A;  4O3C A;  5EHS A;  4ECF A;  4EUO A;  3RUM A;  3M3F A;  5CRY A;  3VLU A;  2F36 A;  1B4Z A;  2HXW A;  1Y9U A;  5F1Q A;  1OQG A;  5AA1 A;  4IO2 A;  2RC8 A;  3MW0 A;  4U23 A;  4HCY A;  2DE4 A;  3HV1 A;  4KQP A;  4O3A A;  2B3F A;  4PQJ A;  2H25 A;  4X9T A;  3LUY A;  4YKJ A;  4R9G A;  1UIU A;  3T66 A;  3MVY A;  3KFM A;  1LLS A;  2ANJ A;  2H99 A;  1FQD A;  2RCA A;  2UVH A;  1Q35 A;  2ZNS A;  2ZYN A;  4GVO A;  4L17 A;  1BIY A;  2DWH A;  2QMW A;  4GLI A;  2OK2 A;  3K4U A;  3U8Q A;  4G77 A;  4KYD A;  2ONK E;  2VGQ A;  4NF4 A;  1CE2 A;  5DEX B;  2PYY A;  2F7C A;  1GR2 A;  3MJN A;  2H9B A;  1GGG A;  3CG1 A;  3IJO B;  1I6B A;  2FA7 A;  3HO7 A;  4E0X A;  2Q2A A;  1MQG A;  1YPN A;  1JEV A;  4OXV A;  1D4N A;  1ELJ A;  1VR5 A;  3CG3 A;  3CR9 A;  3U72 A;  4EXK A;  4GD5 A;  1JVY A;  4H0W A;  4ZEK A;  3TDJ A;  2Z22 A;  1LCT A;  3W15 C;  1NNF A;  1B05 A;  3KN3 A;  3O6H A;  5H8S A;  4R2B A;  4BLA A;  5CMM A;  4XKN A;  3KSJ A;  3O66 A;  2B3B A;  1DTZ A;  2GFE A;  2I0B A;  3GLB A;  4YKI A;  2PX1 A;  4FOR A;  3OEM A;  2F34 A;  2R6G E;  4MH5 A;  2QPQ A;  2X7Q A;  4OZ9 A;  4WKM A;  1ANF A;  3FVG A;  4YZZ A;  3EPE A;  4MFI A;  1XVX A;  5FHM A;  1PEB A;  1WOD A;  3P7I A;  4PE5 B;  4AB5 A;  2I58 A;  5DVI A;  3TZA A;  1Y4T A;  1B40 A;  4R6Y A;  2RIN A;  3SEV A;  4EQ9 A;  5L9O A;  4FE8 A;  4FJP A;  4IB2 A;  2REG A;  3EHT A;  3FZV A;  3CFZ A;  2VP1 A;  3G3I A;  1A40 A;  3N6T A;  4FEB A;  2V25 A;  1NNK A;  3O28 A;  3OOA A;  3O9P A;  4P0I A;  5FTI A;  4Z7E A;  3UA8 A;  3UIF A;  1IUD A;  2F8D A;  1Y3N A;  2X26 A;  3TTL A;  4H6D A;  1LGB C;  1A55 A;  2O69 A;  3RNN A;  5JK4 A;  3SER A;  1OVT A;  4JDF A;  3N6U A;  3OO9 A;  3VVE A;  3QUF A;  1IZ1 A;  3DP8 A;  3LC8 A;  3PD9 A;  1IXI A;  2IEE A;  3MP6 A;  5CC2 A;  5LOM A;  1HSE A;  4IO4 A;  4XIG Q;  3PGF A;  3T96 B;  3FJ7 A;  1WVJ A;  1LAF E;  1H44 A;  1MDQ A;  1Z7N E;  3PUV E;  2I4B A;  2PT2 A;  4G68 B;  4GL0 A;  2OZZ A;  4NE4 A;  1MQH A;  3T9V A;  2P1S A;  2QRY A;  2RC9 A;  2H98 A;  2DWJ A;  2M8C A;  2Y7P A;  1MXV A;  2AIX A;  3K01 A;  2X7P A;  4QSC A;  3SEW A;  3SKP A;  1P99 A;  5A5X B;  4AB6 A;  1UTH B;  3G3H A;  4JSD A;  3W9V A;  4DXC A;  1EZ9 A;  4FEC A;  4PFT A;  1P1W A;  1XS5 A;  1II5 A;  2UVI A;  4RYA A;  5DVF A;  3S2V A;  5KDT B;  1VFE A;  1QW0 A;  5B70 A;  3WAF A;  3FIR A;  5I56 B;  4H5G A;  3SES A;  2NUV A;  4LZ8 A;  4R72 A;  3USD A;  1M5F A;  3KGC A;  4YKP A;  3R7X A;  3U92 A;  4E0W A;  5JTY A;  2DOJ A;  2LAO A;  4DXB A;  1BP5 A;  4FAJ A;  1ZMG A;  3OMB A;  4KYS A;  1Y1Z A;  3G3G A;  4FED A;  2QL3 A;  3H4Z A;  5H8F B;  5I59 A;  1LB8 A;  1SDX A;  5ISU A;  3QK6 A;  3CIJ A;  4PFW A;  2HFB A;  3TAJ A;  3IOW A;  1YAE A;  3H3G A;  3D4C A;  2I3W A;  1DTG A;  3FXU A;  1B52 A;  3TUS A;  4IO7 A;  3KBR A;  3MWB A;  1MXZ A;  4OFL A;  4YKK A;  4ZEF A;  3EF7 A;  4LVQ A;  2KLF A;  4ELO A;  1R9Q A;  3PPQ A;  4LQ2 A;  1NH7 A;  3FVO A;  3TTM A;  4BDM A;  3IOV A;  2D5W A;  4RNS A;  1OQH A;  4KFQ A;  4F1Y A;  1ZU0 A;  4N07 A;  2XXY A;  4G68 A;  2UVG A;  2O1L A;  3N26 A;  3PU5 A;  3TCF A;  3Q26 A;  3FVN A;  2DWA A;  2HAV A;  1H43 A;  2OJT A;  2THI A;  4GL8 A;  4Z0I A;  1A8F A;  2Z8E A;  3PD8 A;  1EU8 A;  4NF6 A;  2CZL A;  2VD2 A;  3K6W A;  4NF4 B;  1EZO A;  1UTH A;  4KYE A;  4MBP A;  4H8J A;  3I6V A;  4P11 A;  5AA2 B;  5I58 B;  4ZS9 A;  3IO6 A;  1B5H A;  4K3F A;  2UXA A;  1S9T A;  3O97 A;  4H65 A;  1A7L A;  1AH5 A;  4FAT A;  1IXH A;  3DLN A;  3OO7 A;  4F39 A;  5K2X A;  4BDN A;  3VXB A;  2HQ0 A;  2QS1 A;  4KD5 A;  4EF1 A;  1FCK A;  2XXT A;  1FQB A;  4RPN A;  3VLW A;  2DSF A;  4KCD A;  3TTK A;  2YPN A;  4POX A;  3K1N A;  3KN8 A;  1I6A A;  3B6T A;  1USY H;  3M8U A;  1UIV A;  3KN7 A;  1MY3 A;  2QS3 A;  1RYO A;  1B3E A;  3OEK A;  1MM7 A;  2B65 A;  3HHG A;  1LAG E;  1TWY A;  2XD2 A;  3Q28 A;  4GRK A;  4H8I A;  3VVD A;  4BDR A;  5BWJ A;  1TFD A;  1IIW A;  3H03 A;  3TEL A;  2DQV A;  1JVX A;  3C32 A;  3V5A A;  5AA2 A;  1FQE A;  3M3L A;  1FQC A;  1DPP A;  4H5F A;  1MH4 A;  2DE2 A;  4KHZ E;  4P0G A;  3ZS6 A;  1LAX A;  1SVX B;  4GWO A;  2Y7W A;  4MLQ A;  2AL5 A;  3IO4 A;  3K0V A;  1XVY A;  1PB7 A;  4GXS B;  3TOD A;  2R9J A;  4GOT A;  4G68 C;  3UN6 A;  3B6W A;  1QKA A;  3CSG A;  4OES A;  3FGS A;  5I2K A;  1T0K A;  2Y84 A;  3IAZ A;  3OEL A;  4NWC A;  2R71 A;  4ELR A;  3E3K A;  3UOR A;  3B6Q A;  3WAE A;  3DP6 A;  5F7V A;  1JNF A;  3E9X A;  4NF8 B;  5L8D A;  1DPE A;  1RYX A;  3E4R A;  3PPR A;  3S4U A;  4BDL A;  2PMS A;  1MQD A;  3OO8 A;  4IY5 A;  4YMB A;  2XX7 A;  2D21 A;  2D3I A;  1FW0 A;  4DDD A;  1OIB A;  5J1D A;  1B3F A;  4KCC A;  2DS9 A;  3IOU A;  4DCY A;  1SBP A;  3DEL B;  4IY6 A;  3QAX A;  4PFY A;  3L6H A;  3K1P A;  4RK9 A;  4OYV A;  4DXU A;  2ZXT A;  1TT1 A;  1MDP 1;  4OFO A;  1GV8 A;  1POY 1;  3Q27 A;  3RY3 A;  4G4P A;  4QFK A;  5B7D A;  1J1N A;  4F3G A;  4ELP A;  3ZSF A;  1M5D A;  1QUK A;  1IIT A;  4LQ5 A;  5DVJ A;  3DP4 A;  1M5B A;  4TOZ A;  1NMU A;  5H8H A;  5ICT A;  4U1O A;  4RXL A;  5H8Q B;  3S9E A;  3CFL A;  2HZL A;  5IAI A;  3KEI A;  1H76 A;  3K00 A;  3QXM A;  2DXY A;  4WEP A;  3VFJ A;  4ELQ A;  3K6X A;  3PPO A;  3H7M A;  1EH3 A;  1IQ7 A;  3PUZ E;  3T9H B;  4OER A;  1Y1M A;  1LCF A;  5ICQ A;  2H4I A;  2FNC A;  3HST A;  3THI A;  1HSJ A;  1B7U A;  1NL5 A;  1M5E A;  2H5Y A;  2OBG A;  5L9S A;  2XHD A;  4LON B;  4ZEI A;  1WDN A;  2GRV A;  4X48 A;  4TLM B;  2O6A A;  4G8M A;  5I84 A;  1DMB A;  1PB9 A;  2F6P A;  2OWS A;  2Y7K A;  3JZJ A;  5CBR A;  1MXU A;  1MXY A;  3H6U A;  3A09 A;  1IXG A;  5KDT A;  2O51 A;  4EDP A;  4ZDM A;  1CB6 A;  1B3H A;  3CFX A;  4G2Z A;  2XXI A;  3K6U A;  3OD7 A;  1AOV A;  5H8Q A;  1LAH E;  2W7Y A;  4QFP A;  3U93 A;  5AE4 A;  1OLA A;  3T9U A;  3LSW A;  1Q1K A;  3BFU A;  3ILU B;  1N3X A;  1Y20 A;  2ALU A;  3OXN A;  3H6W A;  4OHN A;  4QFO A;  3RT6 B;  3OSR A;  4PET A;  4U21 A;  1Z7M E;  4GXA A;  1MY1 A;  1OVB A;  2F7A A;  4XKQ A;  5HPQ A;  2I6E A;  4RPO A;  2Z8D A;  1N76 A;  1PBP A;  4NMY A;  4R6H A;  1PC3 A;  2XXU A;  1VFD A;  2Q89 A;  3C31 A;  3RQT A;  3FVK A;  1URG A;  1ZKB A;  2ONS A;  3PMV A;  1Y3P A;  1XT8 A;  3VDF A;  4MLV A;  3ILT B;  3MUQ A;  3SET A;  4PP0 A;  3KJ7 A;  4GIZ A;  4IO6 A;  1FTO A;  2AL4 A;  4JBZ A;  4JWY A;  4LP2 B;  3MPL A;  4H67 A;  4OEV A;  5H8N B;  3PUY E;  1XHY A;  2VHA A;  1B3G A;  2VD3 A;  4EQB A;  2Q88 A;  3IB0 A;  4OFJ A;  3I5O A;  1O63 A;  4ZED A;  5I59 B;  1S7Y A;  3VVF A;  2QJE A;  1N04 A;  3IOT A;  5I57 A;  3TYH A;  1R9L A;  3C9H A;  2P0S A;  2HZK A;  2XXH A;  5TPA B;  1NH8 A;  4OMB A;  3OEN A;  4LA9 A;  3C34 A;  4THI A;  3EN3 A;  3MC2 A;  1KWH A;  2ZYO A;  1MPC A;  4IO5 A;  5CMC A;  4I62 A;  3PUW E;  2F6G A;  3GZG A;  4HCW A;  1LBB A;  3PMW A;  1AL3 A;  1B1H A;  1JET A;  1BKA A;  2XXP A;  5IKB A;  2HAU A;  2V84 A;  1LB9 A;  2NVU B;  2HEU A;  4DIG A;  1B51 A;  3HPI A;  3LSF B;  2F78 A;  1B2H A;  5CMK A;  3K2D A;  4I9D A;  4QHQ A;  5H8H B;  2IA4 A;  4KR5 A;  1B5I A;  4XXU A;  1B7H A;  5DEX A;  1SQY A;  3EHS A;  1D9V A;  1DOT A;  3GBA A;  4R74 A;  3ZKK A;  1SW2 A;  2I3V A;  2PT1 A;  2DP8 A;  2QMX A;  3GBB A;  3H6T A;  4U2R A;  5FTH A;  1DSN A;  4ESX A;  4F1V A;  5AA4 B;  1FTK A;  2F5X A;  4Q30 B;  3SEY A;  1UQW A;  4DZ1 A;  1MQJ A;  3GXA A;  3TQL A;  3IB2 A;  3VE1 B;  5I2N B;  2GHB A;  1JW5 A;  3IJX B;  3H6V A;  3R6U A;  4RJZ A;  1MY0 A;  4F31 B;  3FV1 A;  3FJM A;  1Y4C A;  1PDA A;  2RKM A;  3MP8 A;  4YB6 A;  3EQ1 A;  4JSO A;  2REJ A;  3C36 A;  1SI1 A;  2DE3 A;  4JWX A;  1B9J A;  1L5T A;  2V3Q A;  2UYF A;  4MF3 A;  4ZEB A;  1P1N A;  3Q29 A;  4U4S A;  4NF5 B;  3MBP A;  4F3B A;  4Q8R A;  3FV2 A;  2UYE A;  3ECR A;  3CRB A;  1B0H A;  2O68 A;  3LR1 A;  1UTB B;  4H1X A;  5JTY B;  3IX1 A;  3IR1 A;  5TP9 A;  4ONY A;  2GHA A;  4FIM A;  4QF9 A;  4RA1 A;  4QSE A;  3LSL A;  3BBR A;  4QFL A;  1POT A;  1B6H A;  2I4C A;  2OCU A;  1A8E A;  1BTJ A;  2ZYM A;  4LAT A;  3QYT A;  4QRZ A;  4F22 A;  4KI0 E;  5HBC A;  1NKX A;  2GH9 A;  4ZE8 A;  4OTE A;  4C1T A;  1VSO A;  1LFI A;  4IGR A;  4R9F A;  1RKM A;  5CI5 A;  3MQ9 A;  4NTL A;  3S9M C;  2NOO A;  3IOR A;  3L6G A;  1N0T A;  1QUL A;  3VXC A;  2ZNU A;  5KZT A;  1QKB A;  3FD3 A;  2DVZ A; 
#chains in the Genus database with same CATH topology
 1MRP A;  3G3F A;  3FXR A;  3QIM A;  1FTM A;  1NV7 A;  1JEU A;  2DWI A;  3FXQ A;  3ISP A;  3HCQ A;  4YMA A;  3T9X B;  3E78 A;  1YCJ A;  4NWD A;  3O29 A;  4EXL A;  2UVJ A;  3MZ1 A;  3RPW A;  3OO6 A;  2RC7 A;  1UTB A;  1MXW A;  3RTF B;  1B46 A;  3HFU A;  4M4G A;  5M2V A;  3U1O A;  3A3U A;  3U94 A;  1YTV A;  4P56 A;  4NF8 A;  2V3U A;  4UA8 A;  2YJP A;  1RDY A;  2FVZ A;  5DT6 A;  5AA4 A;  1NNT A;  1AMF A;  5L9M A;  5ISU A;  4U1Z A;  1MPD A;  4DI3 D;  4G8H A;  3MVZ A;  1B3L A;  1SW5 A;  2I48 A;  3IK6 B;  1LST A;  5CMB A;  2E1S A;  2E0S A;  5ELV A;  1XOC A;  2OWT A;  1QUI A;  1N84 A;  4NF5 A;  4OEN A;  1VE4 A;  4HE1 A;  4F18 A;  2A5S A;  5EQA A;  4N6D A;  3BFT A;  4XKP A;  5KCJ B;  3TKD A;  3K1M A;  4X1B A;  4ZZE A;  4PAK A;  5FHN A;  3N94 A;  5EQ7 A;  2Y5K A;  4C0R A;  3QSL A;  4KPT A;  4OET A;  1QUJ A;  1NV1 A;  5LDZ A;  4BDQ A;  1URD A;  3IB1 A;  4HE2 A;  2CMO A;  3S9L C;  4QBA A;  4MAG A;  1IXC A;  1FTJ A;  3MP1 A;  2Q2C A;  3MZB A;  2WX9 A;  4TLL B;  4G61 A;  3V89 B;  3D4G A;  4AQ4 A;  4G8N A;  3EHU A;  1URS A;  2QS2 A;  3KJT A;  2BJJ X;  3C35 A;  3TPA A;  4EUO A;  5CRY A;  3KBZ A;  2HXW A;  1Y9U A;  4HCY A;  4PFR A;  4X9T A;  3LUY A;  2F3B A;  2H99 A;  2UVH A;  2ZNS A;  2QMW A;  4LN5 A;  4KYD A;  1CE2 A;  3MJN A;  2B4L A;  2Q2A A;  1MQG A;  4OXV A;  4MCO A;  3CR9 A;  2XWK A;  3TDJ A;  1NNF A;  3KN3 A;  4PFB A;  4PFI A;  2B3B A;  2GFE A;  2I0B A;  3GLB A;  4OZ9 A;  4WKM A;  2X7Q A;  4MFI A;  1PEB A;  1WOD A;  3P7I A;  4R6Y A;  4FJP A;  4IB2 A;  3EHT A;  4OER A;  4DXC A;  4P8B A;  2VP1 A;  1A40 A;  1IUD A;  3TTL A;  4H6D A;  3N6U A;  3PD9 A;  3LC8 A;  1IXI A;  3MP6 A;  3T96 B;  1H44 A;  3PUV E;  5DW8 A;  2PT2 A;  4GL0 A;  2OZZ A;  2QRY A;  2OX3 A;  2Y7P A;  2L5V A;  5EYG A;  5IGA A;  4AB6 A;  4JSD A;  3W9V A;  4RYA A;  1P1W A;  3S2V A;  5I56 B;  3FIR A;  4YKP A;  2LAO A;  4DXB A;  1BP5 A;  4FAJ A;  1KZ8 A;  3RPL B;  2QL3 A;  3IOW A;  1YAE A;  3TUS A;  3MWB A;  4OFL A;  4YKK A;  4IR8 A;  4LQ2 A;  3FVO A;  3TTM A;  4OVS A;  2D5W A;  4RNS A;  1OQH A;  4F1Y A;  2UVG A;  3PU5 A;  4OVP A;  4NN3 A;  4N4U A;  3FVN A;  2THI A;  2OJT A;  4GL8 A;  1FTA A;  1A8F A;  5F24 A;  2CZL A;  2VD2 A;  4NF4 B;  1EZO A;  4KYE A;  4MBP A;  4H8J A;  1EYI A;  4H65 A;  3O97 A;  2V4C A;  5IM2 A;  4F39 A;  2HQ0 A;  4KD5 A;  2FIX A;  3B50 A;  4KCD A;  1JP4 A;  3K1N A;  1I6A A;  3B6T A;  1UIV A;  3KN7 A;  1B3E A;  1FPD A;  1TWY A;  3IFC A;  1IIW A;  3TEL A;  1FQE A;  2DE2 A;  2Y7W A;  3TOD A;  4GXS B;  1T0K A;  3OEL A;  2R71 A;  3UOR A;  4GBV A;  4MNP A;  1JNF A;  3D1R A;  1RYX A;  4YMB A;  1MQD A;  2XX7 A;  3BIG A;  5J1D A;  1B3F A;  3IOU A;  3DEL B;  4RK9 A;  4DXU A;  2ZXT A;  3RY3 A;  4QFK A;  4F3G A;  3ZSF A;  1NMU A;  1KA1 A;  4U1O A;  2HZL A;  3K6X A;  3H7M A;  1IQ7 A;  2FNC A;  2H5Y A;  4N8G A;  4X48 A;  4TLM B;  3JZJ A;  5CBR A;  5KDT A;  4ZDM A;  1CB6 A;  1AOV A;  4PDD A;  4QFP A;  5EQ9 A;  3T9U A;  3OXN A;  4PET A;  4MNC A;  2F7A A;  5HPQ A;  2I6E A;  2XXU A;  1VFD A;  3C31 A;  1URG A;  4MLV A;  3SET A;  4GIZ A;  4IO6 A;  4JWY A;  3MPL A;  4OEV A;  3IB0 A;  4ZED A;  1S7Y A;  2QJE A;  3TYH A;  1R9L A;  3C9H A;  3BIH A;  4OVQ A;  5TPA B;  1NH8 A;  4OMB A;  3FBP A;  3EN3 A;  2WEF A;  1KWH A;  2ZYO A;  5CMC A;  3GZG A;  3PMW A;  1AL3 A;  5IKB A;  2V84 A;  2NVU B;  1LBY A;  4DIG A;  1B51 A;  1XI6 A;  3K2D A;  1B5I A;  4XXU A;  1B7H A;  5DEX A;  4OA4 A;  2PT1 A;  2DP8 A;  2QMX A;  4Q30 B;  4DZ1 A;  1MQJ A;  3GXA A;  5I2N B;  4RJZ A;  1PDA A;  2RKM A;  4YB6 A;  4OVR A;  1B9J A;  2PFZ A;  5IZZ A;  1UTB B;  4HE0 A;  1FPB A;  3IX1 A;  3IR1 A;  1NV6 A;  4QF9 A;  3LSL A;  3BBR A;  1POT A;  1B6H A;  2I4C A;  2OCU A;  1BTJ A;  2ZYM A;  1FBP A;  4LAT A;  4QRZ A;  4KI0 E;  4C1T A;  4OTE A;  4XF5 A;  1VSO A;  4HXV A;  4NTL A;  3IOR A;  2PCR A;  5KZT A;  3TCG A;  4N6P A;  3RGY A;  1ZLQ A;  3OSQ A;  1FBG A;  4NGU A;  5ITO A;  1D9Q A;  4OVJ A;  4JVC A;  4JVI A;  4YB5 A;  3DM0 A;  2P3V A;  4ISU A;  4NF6 B;  2XWO A;  5EHM A;  2JJK A;  1I69 A;  3MPK A;  1MY2 A;  4F2O A;  2I0C A;  1I6Q A;  3IL1 B;  3LBS A;  1MQI A;  4GWS A;  2Z23 A;  3V8X B;  4LUB A;  3RYD A;  4DE8 A;  2WBB A;  1US4 A;  4F29 A;  4ND9 A;  4GF8 A;  1G0H A;  4I8C A;  4OQO A;  2PVU A;  3H06 B;  1SYH A;  1B32 A;  1MH3 A;  1QVS A;  4ZE9 A;  3UK4 A;  1SYI A;  3RTW B;  5I58 A;  2QSX A;  1US5 A;  4F1U A;  3G7W A;  3CHG A;  3HN0 A;  4QFN A;  4GBW A;  3R26 A;  4GFR A;  1NV5 A;  3TQW A;  1OLC A;  5JEI A;  2DVC A;  3M3K A;  3BKI B;  4P1E A;  1B7Z A;  1QJM A;  2G93 A;  4JB7 A;  2YLN A;  2ZYK A;  1N7X A;  3KG2 A;  5I2K B;  3HHF A;  4HW8 A;  1A99 A;  4DLD A;  1LBX A;  5ET6 A;  3E13 X;  4JVD A;  3RLF E;  4AS5 A;  1GTK A;  3CVG A;  4HS7 A;  5DVI A;  4YB7 A;  2ABH A;  3C33 A;  1M5C A;  2XXW A;  4LZ7 A;  2FYI A;  3TMG A;  3PPP A;  1FQF A;  5H8N A;  3SEX A;  3B8B A;  5A5X A;  1AIV A;  1B5J A;  4UAC A;  1RDZ A;  1XC1 A;  4ECF A;  3RUM A;  3M3F A;  2F36 A;  1B4Z A;  4U23 A;  1FPI A;  3HV1 A;  4KQP A;  4O3A A;  4YKJ A;  1GV8 A;  3T66 A;  2WYP A;  3KFM A;  4PAI A;  5ET8 A;  1FQD A;  2RCA A;  1BIY A;  2DWH A;  4MNI A;  2F7C A;  1GGG A;  1I6B A;  2FA7 A;  1JEV A;  1ELJ A;  3LV0 A;  4EXK A;  4H0W A;  4ZEK A;  2Z22 A;  4BLA A;  5H8S A;  2Q8M A;  5CMM A;  1DTZ A;  5FBP A;  1NV3 A;  4MH5 A;  4YZZ A;  1LBZ A;  1XVX A;  4PE5 B;  4MJO A;  3TZA A;  1B40 A;  5L9O A;  3FZV A;  4GWO A;  4FEB A;  4PC9 A;  2V25 A;  1NNK A;  2X26 A;  1LGB C;  1A55 A;  5JK4 A;  2QFL A;  3OO9 A;  3QUF A;  1IZ1 A;  4GWY A;  1AWB A;  1HSE A;  3PGF A;  3FJ7 A;  1Z7N E;  2PFY A;  2I4B A;  1MQH A;  2P1S A;  2RC9 A;  2H98 A;  2M8C A;  4QSC A;  1P99 A;  1EZ9 A;  4FEC A;  4PFT A;  1XS5 A;  1VFE A;  4E0W A;  3R7X A;  5JTY A;  2DOJ A;  2VT5 A;  3OMB A;  2HPG A;  1Y1Z A;  3G3G A;  4FED A;  4PGN A;  3QK6 A;  3H3G A;  3FXU A;  3KBR A;  3EF7 A;  1R9Q A;  1NH7 A;  4BDM A;  1EYK A;  4NX1 A;  4G68 A;  2O1L A;  3Q26 A;  2HAV A;  1SPI A;  3PD8 A;  1EU8 A;  2P3N A;  1UTH A;  4P11 A;  4PF6 A;  4FAT A;  1IXH A;  3KC0 A;  4BDN A;  2QS1 A;  2XXT A;  3TTK A;  2BJI A;  3M8U A;  3OEK A;  1LAG E;  2XD2 A;  3VVD A;  4BDR A;  1TFD A;  2Y5L A;  4H5F A;  3M3L A;  1FQC A;  3ZS6 A;  3K0V A;  1PB7 A;  2CEX A;  2R9J A;  4O7M A;  3DP6 A;  1KA0 A;  4NF8 B;  4BDL A;  1DPE A;  3E4R A;  2PMS A;  2D3I A;  5LTC A;  2DS9 A;  4DCY A;  4PFY A;  4OYV A;  1POY 1;  3Q27 A;  2GQ1 A;  1M5D A;  5DVJ A;  5H8H A;  4RXL A;  5H8Q B;  4FBP A;  3QXM A;  4ELQ A;  1DCU A;  1EH3 A;  5ICQ A;  2H4I A;  5L9S A;  2XHD A;  4LON B;  1WDN A;  5IZ3 A;  2O6A A;  1MXU A;  2CEY A;  4PAF A;  3CFX A;  5H8Q A;  1Q1K A;  2ALU A;  4O94 A;  4QFO A;  3OSR A;  1Z7M E;  1MY1 A;  1FPF A;  1PC3 A;  1NV0 A;  3FVK A;  2ONS A;  1K9Y A;  3PMV A;  4OAN A;  4LP2 B;  4JBZ A;  1FTO A;  1DBZ A;  4P3L A;  3PUY E;  1XHY A;  2VHA A;  2Q88 A;  3IOT A;  1N04 A;  2HZK A;  4LA9 A;  4THI A;  4I62 A;  1B1H A;  1B2H A;  4QHQ A;  2VPO A;  4KXP A;  3EHS A;  1DOT A;  1DK4 A;  3GBA A;  1SW2 A;  2I3V A;  4U2R A;  3TQL A;  3T0J A;  3SZP A;  1MY0 A;  3FV1 A;  3FJM A;  3MP8 A;  4JWX A;  4ZEB A;  4U4S A;  3MBP A;  2UYE A;  3ECR A;  1B0H A;  3LR1 A;  2MKZ A;  2XWV A;  2GHA A;  4FIM A;  4RA1 A;  4QSE A;  4NAP A;  1LFI A;  2NOO A;  1QUL A;  4GXA A;  2DVZ A;  4P47 A;  4R75 A;  3QUJ A;  1IMF A;  1FQA A;  1YYZ A;  4GWX A;  3JV9 A;  2Z8F A;  4ZZA A;  2I49 A;  1A54 A;  4NF0 A;  3A3C A;  3ZKL A;  1O64 A;  3TCH A;  1MG1 A;  3O6I A;  4NED A;  5I56 A;  3NOH A;  1SW4 A;  3JYR A;  4YIC A;  4QSD A;  4IGT A;  1FBH A;  3LSX A;  1B0L A;  1P1Q A;  4LZ5 A;  1GVC A;  4XKR A;  3TEP A;  3F11 A;  2ZMB A;  3PMX A;  1OMP A;  4PE3 A;  4I40 A;  4ESW A;  4GX6 A;  4N81 A;  5K2Y A;  3G3K A;  1B4H A;  5I2N A;  1IME A;  1FSA A;  3UP9 A;  1ZTY A;  4OWD A;  2Q8J A;  2KQZ A;  1JQF A;  1MM6 A;  4M1V A;  1PBQ A;  1NUY A;  2A5T B;  1R1N A;  2O7I A;  4XTC Q;  2V93 A;  3K6V A;  1EZP A;  4O8M A;  4RK2 A;  3U65 A;  1Y3Q A;  2F7B A;  2O7U A;  2DYX A;  3G3J A;  2XX9 A;  2F35 A;  4EF2 A;  5CM6 A;  2XXQ A;  1P1U A;  2ONR A;  4U4X A;  1FPE A;  4GWU A;  3FJG A;  1MPB A;  2F3D A;  4I3Y A;  1FJ9 A;  4NHB A;  4R6K A;  4JXI A;  2O84 X;  1P1O A;  4JWO A;  3LUZ A;  2HCA A;  1N3W A;  2ZNT A;  3PPN A;  4IO3 A;  3FAS A;  2FBP A;  3FUZ A;  4N13 A;  2WKY A;  4R2F A;  3GYY A;  1R6Z A;  5I57 B;  3RN8 A;  1MXX A;  2XXR A;  3ODB A;  1ZJL A;  2G29 A;  2XXV A;  3Q25 A;  4C1U A;  5BUU A;  3E79 A;  5ITP A;  3KZG A;  2RCB A;  1LFH A;  2DXR A;  1H3D A;  1TXF A;  5EHS A;  4O3C A;  5F1Q A;  1OQG A;  4IO2 A;  3MW0 A;  4PQJ A;  2H25 A;  2OK2 A;  3K4U A;  4G77 A;  2PYY A;  1GR2 A;  2H9B A;  2HHM A;  1VR5 A;  4XEQ A;  1JVY A;  3W15 C;  2CZH A;  2CZI A;  4R2B A;  4XKN A;  3KSJ A;  3O66 A;  4DDD A;  4YKI A;  4FOR A;  2F34 A;  3EPE A;  1VDW A;  4AB5 A;  2I58 A;  2RIN A;  4EQ9 A;  3G3I A;  5FTI A;  3O28 A;  3OOA A;  3UIF A;  3MST A;  1Q9D A;  1Y3N A;  5T3J A;  4JDF A;  3DP8 A;  4P9K A;  4IO4 A;  1LAF E;  1NUZ A;  4NE4 A;  4G68 B;  2DWJ A;  3K01 A;  1MXV A;  2AIX A;  2X7P A;  3SEW A;  5A5X B;  5ET7 A;  1UTH B;  3G3H A;  2UVI A;  5DVF A;  1QW0 A;  3WAF A;  3SES A;  4LZ8 A;  2FHY A;  4R72 A;  3USD A;  1M5F A;  4KYS A;  3H4Z A;  1SDX A;  3CIJ A;  4PFW A;  2HFB A;  3TAJ A;  3D4C A;  4GWZ A;  4N8Y A;  2I3W A;  1DTG A;  1MXZ A;  4ZEF A;  2KLF A;  3PPQ A;  3IOV A;  4NG7 A;  4KFQ A;  1ZU0 A;  4N07 A;  3N26 A;  3TCF A;  1FBC A;  1LBV A;  2DWA A;  1H43 A;  4H46 A;  4NF6 A;  3K6W A;  3I6V A;  1B5H A;  1A7L A;  3DLN A;  3VXB A;  4EF1 A;  1FCK A;  1NV2 A;  4POX A;  3KN8 A;  2XXK A;  4PF8 A;  4MHF A;  1MY3 A;  1RYO A;  1MM7 A;  2B65 A;  3Q28 A;  4GRK A;  5BWJ A;  4NQ8 A;  3H03 A;  2DQV A;  1JVX A;  3C32 A;  3V5A A;  1NUW A;  1DPP A;  5EYH A;  4P0G A;  1SVX B;  1XVY A;  3UN6 A;  3CSG A;  4OES A;  2Y84 A;  3IAZ A;  3B6Q A;  2VPN A;  3WAE A;  4UAB A;  4IY5 A;  3QMF A;  1SBP A;  4IY6 A;  1YXI A;  1MDP 1;  5B7D A;  1INP A;  4LQ5 A;  3DP4 A;  1M5B A;  4TOZ A;  5ICT A;  3S9E A;  3CFL A;  3KEI A;  3K00 A;  2DXY A;  4WEP A;  3T9H B;  1LCF A;  1HSJ A;  1B7U A;  1NL5 A;  1M5E A;  2OBG A;  4G8M A;  5I84 A;  1PB9 A;  2OWS A;  1MXY A;  3H6U A;  3A09 A;  2O51 A;  4EDP A;  4G2Z A;  3OD7 A;  4N6K A;  3U93 A;  5AE4 A;  1OLA A;  3LSW A;  4OHN A;  3H6W A;  3RT6 B;  4U21 A;  1OVB A;  4R6H A;  2ZZV A;  1Y3P A;  3VDF A;  3MUQ A;  4PP0 A;  5CBS A;  2AL4 A;  5H8N B;  2QVU A;  4PTK A;  2VD3 A;  4EQB A;  4OFJ A;  4PCD A;  1O63 A;  2P0S A;  2XXH A;  1IMA A;  4PGP A;  4IO5 A;  3PUW E;  1LBB A;  4GX4 A;  1BKA A;  3LSF B;  4I9D A;  5H8H B;  4KR5 A;  4R74 A;  5AA4 B;  3GBB A;  5FTH A;  1DSN A;  1FTK A;  2F5X A;  3SEY A;  5EQ8 A;  2GHB A;  3IJX B;  3R6U A;  4F31 B;  1Y4C A;  3EQ1 A;  4JSO A;  2REJ A;  3C36 A;  2KR0 A;  1L5T A;  2UYF A;  1P1N A;  4Q8R A;  4NF5 B;  3FV2 A;  2O68 A;  4ONY A;  1A8E A;  4F22 A;  3QYT A;  4ZE8 A;  1NKX A;  2GH9 A;  4IGR A;  1RKM A;  2QVV A;  3VXC A;  4H67 A;  3FD3 A;  4YAH X;  1JW4 A;  5DYH A;  3TTN A;  4P1L A;  2P2A A;  3N5L A;  5HM4 B;  1USY E;  3S9N C;  5KCJ A;  3AXF A;  4BDO A;  2QS4 A;  4PFU A;  4GQO A;  2B4M A;  1LBC A;  4F2Q A;  3C4M A;  1K9Z A;  2XWI A;  3T22 A;  3PUX E;  4TQU Q;  1SD3 A;  5TU0 A;  2OWZ A;  4I1D A;  1FPG A;  1YZ0 A;  1NFT A;  2CZK A;  4RY1 A;  3UGW A;  5DTB A;  1IEJ A;  5TP9 B;  1N7W A;  2XD3 A;  5AA3 A;  3VV5 A;  5AA2 D;  2XX8 A;  1TFA A;  3MYU A;  1QGX A;  1LFG A;  2F97 A;  4F3P A;  5ET5 A;  3TTR A;  3CSB A;  4F19 A;  4F3S A;  1SI0 A;  1MY4 A;  3TFL A;  4Q0C A;  3VLV A;  1EYJ A;  1D9Y A;  3ONM A;  1LBW A;  1FJ6 A;  3SDF A;  1B1X A;  2Q9T A;  1HSL A;  2VOZ A;  1H45 A;  3KOT A;  3PV0 E;  2ZZW A;  2WBD A;  3KSX A;  1O7T A;  2ESN A;  4Q5T A;  4O3B A;  1NNP A;  4U22 A;  1SW1 A;  3W9W A;  1D3K A;  2PBW A;  1BLF A;  1F9B A;  1B58 A;  2O1M A;  4DCX A;  3MAM A;  5H8F A;  3T1B A;  2Y7I A;  1IMC A;  3CI8 A;  1S50 A;  4YU0 A;  1MS7 A;  4ZEC A;  2Y7R A;  3FAT A;  3MZ9 A;  4X1D A;  2V3T A;  2NWJ A;  3RT8 A;  3MVW A;  5FHO A;  3FXB A;  5ESY A;  4WED A;  2AYS A;  4OEU A;  4MEV A;  4HTG A;  1ZBM A;  4R73 A;  3O6G A;  1JW1 A;  1PB8 A;  3KOS A;  1ATG A;  4AS4 A;  3T93 B;  3B7D A;  1ZIU A;  3K02 A;  5TPA A;  3KC1 A;  4EQ7 A;  1FBE A;  4WXJ A;  2OLB A;  3O2A A;  4PDH A;  3MVX A;  2XXX A;  2NXO A;  3I3V A;  3RPL A;  3SEU A;  3V83 A;  5I3S A;  4POW A;  2A5T A;  2Q74 A;  2RF1 A;  1FTL A;  1NV4 A;  3VLU A;  5AA1 A;  2RC8 A;  2DE4 A;  2B3F A;  4R9G A;  1UIU A;  3MVY A;  1LLS A;  2ANJ A;  2ZYN A;  1Q35 A;  4GVO A;  4L17 A;  4GLI A;  3A29 A;  3U8Q A;  1IMD A;  5IZ3 B;  2ONK E;  1CNQ A;  2VGQ A;  4NF4 A;  5DEX B;  3CG1 A;  3IJO B;  3HO7 A;  4E0X A;  1YPN A;  1D4N A;  3CG3 A;  1FPK A;  3U72 A;  4GD5 A;  1LCT A;  1B05 A;  3O6H A;  4X8R A;  4QXD A;  4OVT A;  5IZ1 A;  5EYF A;  2PX1 A;  3OEM A;  3S9M C;  2R6G E;  2QPQ A;  1ANF A;  3FVG A;  5FHM A;  1Y4T A;  1FBF A;  3SEV A;  4O7I A;  4FE8 A;  2REG A;  3CFZ A;  3N6T A;  4P0I A;  4Z7E A;  3O9P A;  3UA8 A;  2F8D A;  4MMP A;  2O69 A;  3RNN A;  3SER A;  1OVT A;  3VVE A;  2IEE A;  4GWW A;  5CC2 A;  5LOM A;  4XIG Q;  1WVJ A;  1MDQ A;  2QVR A;  3T9V A;  3SKP A;  1II5 A;  5KDT B;  5B70 A;  4H5G A;  2NUV A;  4H45 A;  3KGC A;  3U92 A;  1NUX A;  1ZMG A;  5H8F B;  5I59 A;  1LB8 A;  1B52 A;  4IO7 A;  4ELO A;  4LVQ A;  2XXY A;  4MIJ A;  4Z0I A;  2DDK A;  4XFE A;  2Z8E A;  5AA2 B;  5I58 B;  4ZS9 A;  3IO6 A;  4K3F A;  2UXA A;  1S9T A;  1AH5 A;  3OO7 A;  5K2X A;  4RPN A;  1FQB A;  3VLW A;  2DSF A;  2YPN A;  4X04 A;  1USY H;  4N15 A;  2QS3 A;  3HHG A;  4H8I A;  5AA2 A;  1FPL A;  1MH4 A;  4KHZ E;  1LAX A;  4MLQ A;  2AL5 A;  3IO4 A;  4GOT A;  4G68 C;  3B6W A;  1QKA A;  5I2K A;  3FGS A;  1FRP A;  4NWC A;  4ELR A;  3E3K A;  1NI9 A;  5F7V A;  5L8D A;  3E9X A;  3PPR A;  3S4U A;  3OO8 A;  2D21 A;  1FW0 A;  1OIB A;  3ROJ A;  4KCC A;  3QAX A;  3L6H A;  3K1P A;  1TT1 A;  4OFO A;  3EKI A;  4G4P A;  1J1N A;  4ELP A;  1QUK A;  1IIT A;  3IFA A;  4MX6 A;  5IAI A;  1H76 A;  3VFJ A;  1IMB A;  3PPO A;  3PUZ E;  1Y1M A;  3THI A;  3HST A;  1FPJ A;  4ZEI A;  2GRV A;  5I5P A;  1DMB A;  2F6P A;  2Y7K A;  1IXG A;  1B3H A;  4GX3 A;  2XXI A;  3K6U A;  1LAH E;  2W7Y A;  3BFU A;  3ILU B;  1N3X A;  1Y20 A;  2WYK A;  1RDX A;  4XKQ A;  2XA5 A;  4RPO A;  2Z8D A;  1N76 A;  1PBP A;  4NMY A;  3RQT A;  2Q89 A;  2FIE A;  1ZKB A;  1XT8 A;  1BK4 A;  3ILT B;  2HXR A;  3KJ7 A;  1B3G A;  5I59 B;  3I5O A;  3VVF A;  1FBD A;  5I57 A;  4PBQ A;  4PBH A;  3OEN A;  3C34 A;  3MC2 A;  1MPC A;  2F6G A;  4HCW A;  1JET A;  3PTY A;  2XXP A;  4DI4 B;  2HAU A;  1LB9 A;  2HEU A;  3HPI A;  2F78 A;  5CMK A;  2IA4 A;  1SQY A;  1D9V A;  4I3E A;  3ZKK A;  3H6T A;  4F1V A;  4ESX A;  2ZZX A;  1UQW A;  3IB2 A;  3VE1 B;  4N91 A;  1JW5 A;  3H6V A;  1SI1 A;  2DE3 A;  1LEV A;  2V3Q A;  4MF3 A;  3Q29 A;  4F3B A;  3CRB A;  4H1X A;  5JTY B;  5J16 A;  5TP9 A;  5I7I A;  1G0I A;  4QFL A;  5HBC A;  5CI5 A;  4N17 A;  4R9F A;  3MQ9 A;  5A5L A;  3L6G A;  1N0T A;  2R8T A;  2ZNU A;  1QKB A; 
#chains in the Genus database with same CATH homology
 1MRP A;  3G3F A;  3FXR A;  4YAH X;  4N6P A;  3QIM A;  1JW4 A;  1ZLQ A;  1FTM A;  3OSQ A;  5DYH A;  1JEU A;  3RGY A;  3TTN A;  2DWI A;  5ITO A;  2P2A A;  3N5L A;  4R75 A;  5HM4 B;  1USY E;  4OVJ A;  3S9N C;  3FXQ A;  5CBS A;  3QUJ A;  5KCJ A;  3AXF A;  4BDO A;  2QS4 A;  1FQA A;  3HCQ A;  3JV9 A;  4PFU A;  2Z8F A;  4GQO A;  4YB5 A;  3DM0 A;  4ZZA A;  1LBC A;  4ISU A;  4NF6 B;  4YMA A;  5EHM A;  2I49 A;  4F2Q A;  1A54 A;  3T9X B;  1I69 A;  3A3C A;  3C4M A;  3ZKL A;  1O64 A;  3MPK A;  1YCJ A;  4NWD A;  3T22 A;  1MY2 A;  3PUX E;  4TQU Q;  3TCH A;  2I0C A;  1MG1 A;  3O6I A;  4F2O A;  1SD3 A;  4NED A;  4I1D A;  1I6Q A;  5TU0 A;  3O29 A;  4EXL A;  3TEP A;  1NFT A;  3IL1 B;  5I56 A;  2UVJ A;  3MZ1 A;  1SW4 A;  3RPW A;  3LBS A;  3JYR A;  1MQI A;  4RY1 A;  3UGW A;  3OO6 A;  2RC7 A;  2Z23 A;  1UTB A;  4YIC A;  1MXW A;  4QSD A;  5DTB A;  3V8X B;  4IGT A;  1B46 A;  1IEJ A;  3RTF B;  5TP9 B;  3LSX A;  1B0L A;  1N7W A;  1P1Q A;  2XD3 A;  4LZ5 A;  4M4G A;  5M2V A;  1GVC A;  4LUB A;  4XKR A;  3U1O A;  3A3U A;  3VV5 A;  4DE8 A;  5AA3 A;  2XX8 A;  3F11 A;  1TFA A;  1YTV A;  2ZMB A;  3U94 A;  5AA2 D;  3PMX A;  1OMP A;  1US4 A;  4F29 A;  4NF8 A;  4ND9 A;  2V3U A;  4UA8 A;  1LFG A;  2F97 A;  2YJP A;  4ESW A;  4F3P A;  4GF8 A;  5DT6 A;  5AA4 A;  4I8C A;  1NNT A;  4OQO A;  1AMF A;  5L9M A;  3TTR A;  3CSB A;  5EYF A;  5K2Y A;  1SI0 A;  4F19 A;  3G3K A;  1B4H A;  4U1Z A;  4F3S A;  1MY4 A;  3TFL A;  5I2N A;  1MPD A;  2PVU A;  3H06 B;  4G8H A;  3UP9 A;  4Q0C A;  3VLV A;  1SYH A;  1D9Y A;  1ZTY A;  4OWD A;  2Q8J A;  1B32 A;  1MH3 A;  3MVZ A;  1B3L A;  1QVS A;  3ONM A;  1JQF A;  1MM6 A;  4M1V A;  1PBQ A;  4ZE9 A;  1SW5 A;  3UK4 A;  1SYI A;  3RTW B;  3SDF A;  5I58 A;  2A5T B;  1R1N A;  1B1X A;  2QSX A;  1US5 A;  2I48 A;  3IK6 B;  2O7I A;  1LST A;  5CMB A;  4F1U A;  2E1S A;  2Q9T A;  4XTC Q;  3G7W A;  1HSL A;  2E0S A;  2VOZ A;  5ELV A;  2V93 A;  3K6V A;  1H45 A;  3KOT A;  1EZP A;  3PV0 E;  4RK2 A;  3HN0 A;  3KSX A;  2ESN A;  1O7T A;  1Y3Q A;  4O3B A;  4Q5T A;  1XOC A;  2F7B A;  1QUI A;  2O7U A;  2OWT A;  4QFN A;  3R26 A;  1N84 A;  4GFR A;  1NNP A;  2DYX A;  3TQW A;  3G3J A;  2XX9 A;  4U22 A;  2F35 A;  4NF5 A;  1VE4 A;  4OEN A;  4EF2 A;  4F18 A;  1SW1 A;  5CM6 A;  2A5S A;  2XXQ A;  3W9W A;  1OLC A;  5JEI A;  1P1U A;  2DVC A;  2ONR A;  3BFT A;  1D3K A;  2PBW A;  3BKI B;  3M3K A;  4XKP A;  3TKD A;  5KCJ B;  1BLF A;  1F9B A;  1B58 A;  2O1M A;  3K1M A;  4U4X A;  4X1B A;  4ZZE A;  4DCX A;  3MAM A;  5H8F A;  5FHN A;  1B7Z A;  1QJM A;  2G93 A;  2Y7I A;  3CI8 A;  1S50 A;  3N94 A;  1MS7 A;  4JB7 A;  4YU0 A;  2YLN A;  4ZEC A;  2ZYK A;  1N7X A;  2Y7R A;  3FJG A;  3FAT A;  1MPB A;  3KG2 A;  3MZ9 A;  5I2K B;  4R6K A;  4X1D A;  2V3T A;  2NWJ A;  3RT8 A;  3MVW A;  4C0R A;  3QSL A;  4JXI A;  4KPT A;  5FHO A;  3HHF A;  2O84 X;  4OET A;  4HW8 A;  1P1O A;  4JWO A;  1QUJ A;  2HCA A;  1N3W A;  2ZNT A;  3PPN A;  4IO3 A;  3FAS A;  4BDQ A;  4WED A;  3FUZ A;  1URD A;  3IB1 A;  1A99 A;  2AYS A;  2WKY A;  4N13 A;  4OEU A;  4R2F A;  4HTG A;  2CMO A;  4DLD A;  1R6Z A;  1ZBM A;  4R73 A;  3O6G A;  3S9L C;  1JW1 A;  1PB8 A;  5I57 B;  3KOS A;  3E13 X;  1ATG A;  3RN8 A;  3T93 B;  1IXC A;  3B7D A;  1FTJ A;  1MXX A;  1ZIU A;  3K02 A;  3MP1 A;  5TPA A;  3RLF E;  2Q2C A;  3MZB A;  2XXR A;  1GTK A;  3CVG A;  3ODB A;  4EQ7 A;  1ZJL A;  4HS7 A;  2G29 A;  2XXV A;  4YB7 A;  2ABH A;  3C33 A;  4TLL B;  1M5C A;  4WXJ A;  3TCG A;  2XXW A;  3Q25 A;  2FYI A;  4LZ7 A;  3TMG A;  4C1U A;  2OLB A;  5BUU A;  3PPP A;  3O2A A;  3MVX A;  1FQF A;  3V89 B;  5H8N A;  2XXX A;  3D4G A;  2NXO A;  3SEX A;  5ITP A;  4AQ4 A;  3I3V A;  3KZG A;  4G8N A;  3EHU A;  2RCB A;  3SEU A;  3V83 A;  1URS A;  2QS2 A;  3KJT A;  5A5X A;  1LFH A;  1AIV A;  1B5J A;  4UAC A;  2BJJ X;  2DXR A;  3C35 A;  1H3D A;  4POW A;  2A5T A;  3TPA A;  1TXF A;  1XC1 A;  2RF1 A;  1FTL A;  4O3C A;  5EHS A;  4ECF A;  4EUO A;  3RUM A;  3M3F A;  5CRY A;  3VLU A;  2F36 A;  1B4Z A;  2HXW A;  1Y9U A;  5F1Q A;  1OQG A;  5AA1 A;  4IO2 A;  2RC8 A;  3MW0 A;  4U23 A;  4HCY A;  2DE4 A;  3HV1 A;  4KQP A;  4O3A A;  2B3F A;  4PQJ A;  2H25 A;  4X9T A;  3LUY A;  4YKJ A;  4R9G A;  1UIU A;  3T66 A;  3MVY A;  3KFM A;  1LLS A;  2ANJ A;  2H99 A;  1FQD A;  2RCA A;  2UVH A;  1Q35 A;  2ZNS A;  2ZYN A;  4GVO A;  4L17 A;  1BIY A;  2DWH A;  2QMW A;  4GLI A;  2OK2 A;  3K4U A;  3U8Q A;  4G77 A;  4KYD A;  2ONK E;  2VGQ A;  4NF4 A;  1CE2 A;  5DEX B;  2PYY A;  2F7C A;  1GR2 A;  3MJN A;  2H9B A;  1GGG A;  3CG1 A;  3IJO B;  1I6B A;  2FA7 A;  3HO7 A;  4E0X A;  2Q2A A;  1MQG A;  1YPN A;  1JEV A;  4OXV A;  1D4N A;  1ELJ A;  1VR5 A;  3CG3 A;  3CR9 A;  3U72 A;  4EXK A;  4GD5 A;  1JVY A;  4H0W A;  4ZEK A;  3TDJ A;  2Z22 A;  1LCT A;  3W15 C;  1NNF A;  1B05 A;  3KN3 A;  3O6H A;  5H8S A;  4R2B A;  4BLA A;  5CMM A;  4XKN A;  3KSJ A;  3O66 A;  2B3B A;  1DTZ A;  2GFE A;  2I0B A;  3GLB A;  4YKI A;  2PX1 A;  4FOR A;  3OEM A;  2F34 A;  2R6G E;  4MH5 A;  2QPQ A;  2X7Q A;  4OZ9 A;  4WKM A;  1ANF A;  3FVG A;  4YZZ A;  3EPE A;  4MFI A;  1XVX A;  5FHM A;  1PEB A;  1WOD A;  3P7I A;  4PE5 B;  4AB5 A;  2I58 A;  5DVI A;  3TZA A;  1Y4T A;  1B40 A;  4R6Y A;  2RIN A;  3SEV A;  4EQ9 A;  5L9O A;  4FE8 A;  4FJP A;  4IB2 A;  2REG A;  3EHT A;  3FZV A;  3CFZ A;  2VP1 A;  3G3I A;  1A40 A;  3N6T A;  4FEB A;  2V25 A;  1NNK A;  3O28 A;  3OOA A;  3O9P A;  4P0I A;  5FTI A;  4Z7E A;  3UA8 A;  3UIF A;  1IUD A;  2F8D A;  1Y3N A;  2X26 A;  3TTL A;  4H6D A;  1LGB C;  1A55 A;  2O69 A;  3RNN A;  5JK4 A;  3SER A;  1OVT A;  4JDF A;  3N6U A;  3OO9 A;  3VVE A;  3QUF A;  1IZ1 A;  3DP8 A;  3LC8 A;  3PD9 A;  1IXI A;  2IEE A;  3MP6 A;  5CC2 A;  5LOM A;  1HSE A;  4IO4 A;  4XIG Q;  3PGF A;  3T96 B;  3FJ7 A;  1WVJ A;  1LAF E;  1H44 A;  1MDQ A;  1Z7N E;  3PUV E;  2I4B A;  2PT2 A;  4G68 B;  4GL0 A;  2OZZ A;  4NE4 A;  1MQH A;  3T9V A;  2P1S A;  2QRY A;  2RC9 A;  2H98 A;  2DWJ A;  2M8C A;  2Y7P A;  1MXV A;  2AIX A;  3K01 A;  2X7P A;  4QSC A;  3SEW A;  3SKP A;  1P99 A;  5A5X B;  4AB6 A;  1UTH B;  3G3H A;  4JSD A;  3W9V A;  4DXC A;  1EZ9 A;  4FEC A;  4PFT A;  1P1W A;  1XS5 A;  1II5 A;  2UVI A;  4RYA A;  5DVF A;  3S2V A;  5KDT B;  1VFE A;  1QW0 A;  5B70 A;  3WAF A;  3FIR A;  5I56 B;  4H5G A;  3SES A;  2NUV A;  4LZ8 A;  4R72 A;  3USD A;  1M5F A;  3KGC A;  4YKP A;  3R7X A;  3U92 A;  4E0W A;  5JTY A;  2DOJ A;  2LAO A;  4DXB A;  1BP5 A;  4FAJ A;  1ZMG A;  3OMB A;  4KYS A;  1Y1Z A;  3G3G A;  4FED A;  2QL3 A;  3H4Z A;  5H8F B;  5I59 A;  1LB8 A;  1SDX A;  5ISU A;  3QK6 A;  3CIJ A;  4PFW A;  2HFB A;  3TAJ A;  3IOW A;  1YAE A;  3H3G A;  3D4C A;  2I3W A;  1DTG A;  3FXU A;  1B52 A;  3TUS A;  4IO7 A;  3KBR A;  3MWB A;  1MXZ A;  4OFL A;  4YKK A;  4ZEF A;  3EF7 A;  4LVQ A;  2KLF A;  4ELO A;  1R9Q A;  3PPQ A;  4LQ2 A;  1NH7 A;  3FVO A;  3TTM A;  4BDM A;  3IOV A;  2D5W A;  4RNS A;  1OQH A;  4KFQ A;  4F1Y A;  1ZU0 A;  4N07 A;  2XXY A;  4G68 A;  2UVG A;  2O1L A;  3N26 A;  3PU5 A;  3TCF A;  3Q26 A;  3FVN A;  2DWA A;  2HAV A;  1H43 A;  2OJT A;  2THI A;  4GL8 A;  4Z0I A;  1A8F A;  2Z8E A;  3PD8 A;  1EU8 A;  4NF6 A;  2CZL A;  2VD2 A;  3K6W A;  4NF4 B;  1EZO A;  1UTH A;  4KYE A;  4MBP A;  4H8J A;  3I6V A;  4P11 A;  5AA2 B;  5I58 B;  4ZS9 A;  3IO6 A;  1B5H A;  4K3F A;  2UXA A;  1S9T A;  3O97 A;  4H65 A;  1A7L A;  1AH5 A;  4FAT A;  1IXH A;  3DLN A;  3OO7 A;  4F39 A;  5K2X A;  4BDN A;  3VXB A;  2HQ0 A;  2QS1 A;  4KD5 A;  4EF1 A;  1FCK A;  2XXT A;  1FQB A;  4RPN A;  3VLW A;  2DSF A;  4KCD A;  3TTK A;  2YPN A;  4POX A;  3K1N A;  3KN8 A;  1I6A A;  3B6T A;  1USY H;  3M8U A;  1UIV A;  3KN7 A;  1MY3 A;  2QS3 A;  1RYO A;  1B3E A;  3OEK A;  1MM7 A;  2B65 A;  3HHG A;  1LAG E;  1TWY A;  2XD2 A;  3Q28 A;  4GRK A;  4H8I A;  3VVD A;  4BDR A;  5BWJ A;  1TFD A;  1IIW A;  3H03 A;  3TEL A;  2DQV A;  1JVX A;  3C32 A;  3V5A A;  5AA2 A;  1FQE A;  3M3L A;  1FQC A;  1DPP A;  4H5F A;  1MH4 A;  2DE2 A;  4KHZ E;  4P0G A;  3ZS6 A;  1LAX A;  1SVX B;  4GWO A;  2Y7W A;  4MLQ A;  2AL5 A;  3IO4 A;  3K0V A;  1XVY A;  1PB7 A;  4GXS B;  3TOD A;  2R9J A;  4GOT A;  4G68 C;  3UN6 A;  3B6W A;  1QKA A;  3CSG A;  4OES A;  3FGS A;  5I2K A;  1T0K A;  2Y84 A;  3IAZ A;  3OEL A;  4NWC A;  2R71 A;  4ELR A;  3E3K A;  3UOR A;  3B6Q A;  3WAE A;  3DP6 A;  5F7V A;  1JNF A;  3E9X A;  4NF8 B;  5L8D A;  1DPE A;  1RYX A;  3E4R A;  3PPR A;  3S4U A;  4BDL A;  2PMS A;  1MQD A;  3OO8 A;  4IY5 A;  4YMB A;  2XX7 A;  2D21 A;  2D3I A;  1FW0 A;  4DDD A;  1OIB A;  5J1D A;  1B3F A;  4KCC A;  2DS9 A;  3IOU A;  4DCY A;  1SBP A;  3DEL B;  4IY6 A;  3QAX A;  4PFY A;  3L6H A;  3K1P A;  4RK9 A;  4OYV A;  4DXU A;  2ZXT A;  1TT1 A;  1MDP 1;  4OFO A;  1GV8 A;  1POY 1;  3Q27 A;  3RY3 A;  4G4P A;  4QFK A;  5B7D A;  1J1N A;  4F3G A;  4ELP A;  3ZSF A;  1M5D A;  1QUK A;  1IIT A;  4LQ5 A;  5DVJ A;  3DP4 A;  1M5B A;  4TOZ A;  1NMU A;  5H8H A;  5ICT A;  4U1O A;  4RXL A;  5H8Q B;  3S9E A;  3CFL A;  2HZL A;  5IAI A;  3KEI A;  1H76 A;  3K00 A;  3QXM A;  2DXY A;  4WEP A;  3VFJ A;  4ELQ A;  3K6X A;  3PPO A;  3H7M A;  1EH3 A;  1IQ7 A;  3PUZ E;  3T9H B;  4OER A;  1Y1M A;  1LCF A;  5ICQ A;  2H4I A;  2FNC A;  3HST A;  3THI A;  1HSJ A;  1B7U A;  1NL5 A;  1M5E A;  2H5Y A;  2OBG A;  5L9S A;  2XHD A;  4LON B;  4ZEI A;  1WDN A;  2GRV A;  4X48 A;  4TLM B;  2O6A A;  4G8M A;  5I84 A;  1DMB A;  1PB9 A;  2F6P A;  2OWS A;  2Y7K A;  3JZJ A;  5CBR A;  1MXU A;  1MXY A;  3H6U A;  3A09 A;  1IXG A;  5KDT A;  2O51 A;  4EDP A;  4ZDM A;  1CB6 A;  1B3H A;  3CFX A;  4G2Z A;  2XXI A;  3K6U A;  3OD7 A;  1AOV A;  5H8Q A;  1LAH E;  2W7Y A;  4QFP A;  3U93 A;  5AE4 A;  1OLA A;  3T9U A;  3LSW A;  1Q1K A;  3BFU A;  3ILU B;  1N3X A;  1Y20 A;  2ALU A;  3OXN A;  3H6W A;  4OHN A;  4QFO A;  3RT6 B;  3OSR A;  4PET A;  4U21 A;  1Z7M E;  4GXA A;  1MY1 A;  1OVB A;  2F7A A;  4XKQ A;  5HPQ A;  2I6E A;  4RPO A;  2Z8D A;  1N76 A;  1PBP A;  4NMY A;  4R6H A;  1PC3 A;  2XXU A;  1VFD A;  2Q89 A;  3C31 A;  3RQT A;  3FVK A;  1URG A;  1ZKB A;  2ONS A;  3PMV A;  1Y3P A;  1XT8 A;  3VDF A;  4MLV A;  3ILT B;  3MUQ A;  3SET A;  4PP0 A;  3KJ7 A;  4GIZ A;  4IO6 A;  1FTO A;  2AL4 A;  4JBZ A;  4JWY A;  4LP2 B;  3MPL A;  4H67 A;  4OEV A;  5H8N B;  3PUY E;  1XHY A;  2VHA A;  1B3G A;  2VD3 A;  4EQB A;  2Q88 A;  3IB0 A;  4OFJ A;  3I5O A;  1O63 A;  4ZED A;  5I59 B;  1S7Y A;  3VVF A;  2QJE A;  1N04 A;  3IOT A;  5I57 A;  3TYH A;  1R9L A;  3C9H A;  2P0S A;  2HZK A;  2XXH A;  5TPA B;  1NH8 A;  4OMB A;  3OEN A;  4LA9 A;  3C34 A;  4THI A;  3EN3 A;  3MC2 A;  1KWH A;  2ZYO A;  1MPC A;  4IO5 A;  5CMC A;  4I62 A;  3PUW E;  2F6G A;  3GZG A;  4HCW A;  1LBB A;  3PMW A;  1AL3 A;  1B1H A;  1JET A;  1BKA A;  2XXP A;  5IKB A;  2HAU A;  2V84 A;  1LB9 A;  2NVU B;  2HEU A;  4DIG A;  1B51 A;  3HPI A;  3LSF B;  2F78 A;  1B2H A;  5CMK A;  3K2D A;  4I9D A;  4QHQ A;  5H8H B;  2IA4 A;  4KR5 A;  1B5I A;  4XXU A;  1B7H A;  5DEX A;  1SQY A;  3EHS A;  1D9V A;  1DOT A;  3GBA A;  4R74 A;  3ZKK A;  1SW2 A;  2I3V A;  2PT1 A;  2DP8 A;  2QMX A;  3GBB A;  3H6T A;  4U2R A;  5FTH A;  1DSN A;  4ESX A;  4F1V A;  5AA4 B;  1FTK A;  2F5X A;  4Q30 B;  3SEY A;  1UQW A;  4DZ1 A;  1MQJ A;  3GXA A;  3TQL A;  3IB2 A;  3VE1 B;  5I2N B;  2GHB A;  1JW5 A;  3IJX B;  3H6V A;  3R6U A;  4RJZ A;  1MY0 A;  4F31 B;  3FV1 A;  3FJM A;  1Y4C A;  1PDA A;  2RKM A;  3MP8 A;  4YB6 A;  3EQ1 A;  4JSO A;  2REJ A;  3C36 A;  1SI1 A;  2DE3 A;  4JWX A;  1B9J A;  1L5T A;  2V3Q A;  2UYF A;  4MF3 A;  4ZEB A;  1P1N A;  3Q29 A;  4U4S A;  4NF5 B;  3MBP A;  4F3B A;  4Q8R A;  3FV2 A;  2UYE A;  3ECR A;  3CRB A;  1B0H A;  2O68 A;  3LR1 A;  1UTB B;  4H1X A;  5JTY B;  3IX1 A;  3IR1 A;  5TP9 A;  4ONY A;  2GHA A;  4FIM A;  4QF9 A;  4RA1 A;  4QSE A;  3LSL A;  3BBR A;  4QFL A;  1POT A;  1B6H A;  2I4C A;  2OCU A;  1A8E A;  1BTJ A;  2ZYM A;  4LAT A;  3QYT A;  4QRZ A;  4F22 A;  4KI0 E;  5HBC A;  1NKX A;  2GH9 A;  4ZE8 A;  4OTE A;  4C1T A;  1VSO A;  1LFI A;  4IGR A;  4R9F A;  1RKM A;  5CI5 A;  3MQ9 A;  4NTL A;  3S9M C;  2NOO A;  3IOR A;  3L6G A;  1N0T A;  1QUL A;  3VXC A;  2ZNU A;  5KZT A;  1QKB A;  3FD3 A;  2DVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...