3A3CA

Crystal structure of tim40/mia40 fusing mbp, c296s and c298s mutant
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
451
structure length
451
Chain Sequence
EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSVPGRGSIEGRPEFAYNPDTGEINWDSPSLGGMAHGPCGEEFKSAFSCFVYSEAEPKGIDCVEKFQHMQDCFRKYPEHYAEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of yeast Tim40/Mia40 as an oxidative translocator in the mitochondrial intermembrane space.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein transport
molecule keywords Maltose-binding periplasmic protein, LINKER, Mitochondrial i
total genus 122
structure length 451
sequence length 451
ec nomenclature
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF06747 CHCH CHCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3a3cA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3a3cA01
1B0LA 3KEIA 3TFLA 3UK4A 4F22A 2VHAA 2XX9A 3R26A 4YICA 3ZS6A 1SW1A 3VLVA 2Z22A 2XXVA 3Q25A 4F2QA 4DDDA 5I2KA 4AB5A 1USYE 1B5HA 1PB8A 1T0KA 2AL4A 2X7QA 4RJZA 4YB6A 4ESWA 1FTJA 5L9SA 2F7BA 5AA2B 2UVGA 3OELA 2ZNTA 2O69A 2I0BA 4M1VA 1LFHA 1B1XA 4IB2A 1XHYA 5EYFA 2O1MA 2F5XA 1B4ZA 2LAOA 4G68A 2DVZA 2P1SA 1B6HA 1ZKBA 3GBAA 2Q88A 2V93A 1URDA 3IB2A 3MVWA 3M3KA 4KI0E 3V8XB 5HM4B 4F2OA 1OMPA 2F7AA 1UIVA 3PUWE 1FQDA 2YLNA 3PD9A 1UTHB 5TU0A 3CI8A 3KZGA 3K6VA 3PPNA 3H7MA 3U72A 1WVJA 1LBCA 2Z8FA 3LSFB 4MH5A 3SEXA 1JW1A 3OSRA 4NE4A 4OETA 4X48A 5FTHA 2DSFA 2ALUA 1MXUA 1ZJLA 2Q89A 2UVHA 2ZYNA 3UN6A 1O63A 1LAXA 3OO6A 2QS2A 2F35A 2RINA 3K1NA 3QXMA 4FEDA 1B4HA 1DTGA 1LSTA 1SQYA 1Y1MA 3IK6B 4ZEBA 5J1DA 2Q9TA 1D9VA 1POTA 3FJ7A 4ZZEA 1ZLQA 3CSBA 2BJJX 4ZEFA 1B1HA 3TMGA 2ZYOA 3DLNA 2ONKE 2HXWA 2R9JA 2O6AA 1R1NA 4NWCA 3THIA 1VSOA 1LAGE 1QUIA 5F1QA 1O7TA 3ZSFA 1R9LA 3E3KA 2GHBA 4ESXA 3PV0E 4HS7A 2Z8EA 3PMWA 5DTBA 1OVBA 1A55A 3VE1B 5F7VA 4YMAA 3FVKA 5H8NB 4LQ5A 3LC8A 3M8UA 3QIMA 3TTKA 1VFEA 2FNCA 3MAMA 2AL5A 3SDFA 3U93A 4YB7A 3O6GA 2RKMA 3LSLA 5I57A 1N04A 4JWXA 1US5A 2NXOA 3UORA 1NH8A 1MM7A 2QSXA 2Q2AA 3C33A 4OWDA 4RXLA 3SERA 5BWJA 4ISUA 1JEUA 3JV9A 3R6UA 3OO8A 2OWTA 2M8CA 4POWA 3PGFA 1S7YA 3DP4A 2D5WA 2Q8JA 3K6WA 4OXVA 4C1TA 5DVFA 4ELRA 3G3IA 4LA9A 1OQGA 1Y20A 2V84A 4H5FA 5I58A 4O3AA 3LSXA 3GZGA 4LP2B 2NWJA 5AA2D 3S9EA 2O68A 1ZTYA 2ONSA 1L5TA 1N3XA 2ZXTA 1JNFA 3HV1A 3MZ9A 3WAFA 5TPAB 5KCJB 2OWSA 1B3LA 2R6GE 2DOJA 3D4GA 1FTKA 1PDAA 3VXBA 1DPEA 3FUZA 1B51A 2UYEA 4GFRA 4OVJA 2DE3A 3V5AA 1URSA 2F78A 5I57B 4BDLA 4FJPA 3KGCA 4JSDA 4GL0A 4YKPA 4DCYA 4EF2A 2Z23A 1MH4A 4GOTA 2PX1A 1JETA 3RNNA 4H0WA 2RF1A 1NFTA 2UYFA 1URGA 4F3SA 5CC2A 3FV1A 3PMXA 1MDP1 4R6HA 2RC7A 2Y7KA 4NWDA 3OO7A 4GF8A 5H8QB 3TODA 4QFKA 2O84X 2P0SA 2O7IA 1YTVA 3A3UA 1NNTA 4GWOA 1B58A 4QFLA 1IXHA 4YKKA 4Q8RA 2XXQA 3CFLA 3N94A 1DSNA 4R9GA 5I2KB 3VVFA 3CSGA 3T93B 3T9HB 1H44A 4QFNA 4KD5A 2H25A 4H5GA 3AXFA 4TLMB 4P0IA 1VR5A 4F1YA 1QW0A 1TFDA 1LGBC 4OEVA 3BFUA 3EHSA 2F6PA 3RT6B 2ESNA 3EN3A 4FORA 3RTFB 3SETA 2DVCA 4K3FA 1KWHA 3ZKKA 4I1DA 4DLDA 3V83A 3I3VA 2XXYA 4JDFA 4DXBA 1MQIA 1LB9A 5L9MA 2ANJA 2RCBA 1IXIA 1S50A 3SESA 4KPTA 2XXWA 4R6YA 1SD3A 1D3KA 4U1OA 4DXCA 2THIA 4NF6B 1USYH 5H8FB 3BFTA 3SEYA 4KFQA 3EQ1A 4BDMA 1I6AA 4XKNA 1LB8A 1P1QA 4G77A 2OJTA 3L6GA 5CI5A 2QL3A 4PQJA 5TP9B 4ELPA 3MBPA 3MVYA 1N7WA 4EXLA 2B3FA 1UIUA 2I4CA 2HEUA 3KOSA 2AIXA 3UP9A 3K1MA 4X9TA 4G4PA 3GLBA 4IY6A 1DOTA 1B32A 4MLVA 2F8DA 4I9DA 2A5SA 2O7UA 3FXQA 1B05A 1LCFA 5FTIA 4F1UA 3W9WA 3KN7A 2IEEA 3G7WA 3KSXA 2QS4A 1Q35A 4U22A 3T9VA 3TELA 4ELOA 3RGYA 1MQHA 2FA7A 3S9LC 3IO6A 4R6KA 2QRYA 1B9JA 2XX8A 3MPLA 3OOAA 3A3CA 3OXNA 3PUZE 4PFUA 3U8QA 1Y4TA 3EHUA 2O1LA 1OIBA 4KQPA 1BLFA 1NNFA 1P1UA 3H4ZA 2DE2A 4IO7A 4R74A 5FHOA 3VLWA 1A7LA 1MH3A 1PB7A 3OO9A 4H8JA 4KR5A 3V89B 1FTLA 2H9BA 4NTLA 2PT1A 4PFYA 2DXRA 4LONB 1TFAA 2DP8A 4KYEA 4R73A 2I4BA 4G8NA 3B7DA 3TPAA 4HCWA 4OFLA 4ZEKA 2H99A 3GBBA 3K0VA 5CMKA 3C36A 1ZIUA 3MVXA 1B2HA 2PYYA 5CMBA 4U4SA 3KFMA 4N13A 3PPPA 5EHSA 4XIGQ 4NF5A 2XXHA 2HFBA 3K4UA 4IGTA 3PUVE 4H6DA 3T9XB 1WDNA 3MP6A 1PEBA 2Y7RA 5CBRA 1BTJA 2QMWA 2DXYA 3MP8A 4HW8A 5LOMA 3TTMA 1NL5A 1DPPA 3KBRA 4LZ5A 1DTZA 3G3KA 1MPBA 4G8HA 4HCYA 2F6GA 3PPRA 3UIFA 5CM6A 3TCGA 3DP6A 3DM0A 3FZVA 4EQBA 1XT8A 1D4NA 3U92A 5DEXB 2VD2A 2X26A 1EH3A 2D3IA 4FEBA 1IEJA 2YJPA 3MQ9A 4R75A 1JQFA 2QS3A 2XD3A 4PFTA 4AQ4A 2D21A 2I49A 4IO4A 1BKAA 4ZE9A 4GQOA 4OENA 4QSEA 1R6ZA 5K2XA 3VDFA 4NF5B 3OMBA 3BBRA 1CE2A 4U1ZA 3TUSA 3OENA 5ITOA 1EU8A 3L6HA 3O29A 3GXAA 1B7ZA 2I48A 1MY0A 1LLSA 2VD3A 2V3UA 1QUKA 2DQVA 3HSTA 3IJXB 1MG1A 2ONRA 3B6WA 3KG2A 4OYVA 3F11A 5I2NB 1B52A 5AA4A 1EZPA 5BUUA 3T96B 4IY5A 1LFIA 4LUBA 2B65A 1UTBB 3B6QA 1MPDA 4F18A 4G8MA 2QPQA 1MPCA 1GVCA 4PETA 4RY1A 4C1UA 4JWYA 1GTKA 1PB9A 3FJGA 1OQHA 4IO3A 4OZ9A 4U21A 3O97A 4P0GA 1Q1KA 3KJTA 3TTLA 1XC1A 2PT2A 3IB0A 1FW0A 3FVOA 4I62A 2I58A 3E4RA 3K01A 4FECA 4QF9A 3KN8A 3KJ7A 1TWYA 1N7XA 2DWAA 2HQ0A 1Y9UA 4YU0A 5CMMA 2V25A 1H76A 4DIGA 1JVXA 1NMUA 3PD8A 1M5FA 1SI0A 2QS1A 3E9XA 3N6TA 4OEUA 3S4UA 4YMBA 1DMBA 1S9TA 3RLFE 5KDTA 4QRZA 1P1NA 2ZYMA 2KLFA 3QUFA 3M3LA 5TP9A 3TQLA 3K1PA 1UTHA 1UTBA 2VP1A 4IO6A 1JEVA 4RK2A 3TDJA 4TQUQ 5H8FA 5I59A 3N6UA 4MBPA 2GHAA 5H8SA 1H3DA 3MVZA 2GRVA 5M2VA 1AMFA 3MC2A 3H06B 4Q5TA 3HCQA 4I8CA 1NKXA 3CR9A 4KCDA 2ZMBA 4Q30B 1BP5A 4RA1A 4DXUA 2ABHA 4JBZA 2PBWA 3IR1A 5HPQA 2R71A 3LBSA 1VFDA 1N0TA 3VVEA 4RPOA 3OEKA 1HSEA 3G3FA 4WKMA 1FQAA 1B40A 3PUYE 4LZ7A 5H8QA 3TCFA 1MQJA 4IO5A 5KZTA 1AIVA 1SI1A 1B7UA 2Z8DA 2RC8A 3VLUA 1MXXA 2V3QA 1LBBA 2XX7A 3FXUA 2XXPA 3Q28A 4THIA 3H6TA 4ONYA 3ONMA 5H8HA 3RY3A 3CIJA 4XKQA 4F39A 3MW0A 1US4A 4IGRA 3S2VA 4ZEIA 4E0XA 3W9VA 5HBCA 5I56B 4GVOA 2GFEA 1MXYA 2E0SA 1NNKA 1B7HA 3O6HA 3FGSA 2GH9A 3MPKA 4LQ2A 3LUYA 4NF6A 3TEPA 1Y3NA 3CFXA 3I5OA 2G29A 3KOTA 5B70A 1Z7ME 4MLQA 3K02A 2DS9A 3P7IA 1PBQA 1EZOA 3T66A 3MZ1A 3IOWA 2FYIA 3K6XA 4F31B 1O64A 1MXWA 1MXVA 1OLCA 1ZMGA 4R9FA 1ANFA 3QUJA 1N84A 4NF8A 4G68C 4XKPA 2QMXA 3SEVA 3IORA 2I6EA 2UVJA 3CG3A 3FATA 4JXIA 4TOZA 3CFZA 4C0RA 3OD7A 3VVDA 3A09A 4NF8B 3E13X 4R72A 4ZZAA 4GXSB 4Z0IA 2W7YA 1IITA 1IXCA 1WODA 4H65A 1LFGA 3EF7A 2PVUA 3O9PA 4EUOA 3U94A 2IA4A 3PPOA 4QHQA 1JVYA 4ZECA 5JK4A 1ZU0A 4U23A 3H6UA 1MQDA 3I6VA 3R7XA 1NNPA 3TAJA 5I58B 5DVJA 2F36A 4BDOA 4ZE8A 5DEXA 1II5A 4GD5A 5A5XB 1A54A 3K00A 4UACA 1B0HA 2DWHA 2P2AA 1H45A 2XXIA 4PFWA 3QK6A 1P99A 4O3CA 1MQGA 1QUJA 1Y3QA 4HTGA 2UVIA 3Q29A 5L9OA 1MY1A 3PUXE 4LZ8A 4R2FA 1CB6A 2ZYKA 4NEDA 4QFPA 1YAEA 3C9HA 1GR2A 1QULA 3DP8A 1LAFE 4H1XA 2RCAA 4YZZA 3FVNA 3B6TA 4TLLB 1OVTA 1POY1 1SYHA 3MJNA 5CBSA 4POXA 5K2YA 2Y7WA 3O2AA 5FHMA 1MY3A 3SEUA 3W15C 3C35A 1B3GA 4WEDA 4EXKA 5ICQA 4DCXA 2F34A 3IL1B 4GL8A 4RPNA 3IAZA 3LSWA 4X1DA 4YAHX 4YKJA 3ZKLA 3RTWB 4F3PA 3LR1A 3S9MC 4Z7EA 5H8NA 3IOVA 3H6VA 2OBGA 3QYTA 4ND9A 3IX1A 5I56A 1ZBMA 5AA2A 3N5LA 1PC3A 5JTYA 2E1SA 3D4CA 3EHTA 3FIRA 3HHGA 2B3BA 4FIMA 4JSOA 5H8HB 2OK2A 2V3TA 1N76A 3UA8A 4ZEDA 3IO4A 4F29A 1XS5A 2HAUA 1FQEA 2XD2A 3IOUA 5EHMA 2X7PA 4YKIA 1Y4CA 4EDPA 4PE5B 2AYSA 3OEMA 4G2ZA 1F9BA 1ATGA 1N3WA 5IKBA 4ECFA 3H3GA 3CG1A 2H98A 1XVXA 2XXTA 4L17A 1D9YA 1OLAA 4GLIA 4RNSA 4WEPA 3FJMA 3K2DA 2Y7IA 2XXRA 4BDRA 3FD3A 2DWJA 3ODBA 4E0WA 1QKBA 3KN3A 4OQOA 3M3FA 4H67A 4DE8A 4ELQA 4QSCA 5JTYB 4F3BA 3PU5A 1A8FA 3C31A 1B3HA 3TCHA 4AB6A 1HSLA 4BLAA 1ELJA 4XTCQ 1FQBA 1LAHE 4MF3A 4NMYA 5AA4B 2NOOA 1JW4A 1M5BA 2A5TB 2I3WA 3QAXA 1B5JA 4KYSA 3SKPA 3U1OA 5CMCA 5I59B 5I2NA 5ICTA 3CVGA 4UA8A 4JB7A 1YPNA 4N6PA 1AL3A 2XXXA 3Q27A 2OLBA 4F19A 1AOVA 1IXGA 3HHFA 3MUQA 1Z7NE 2I0CA 3H03A 4LVQA 5B7DA 3VV5A 4OESA 5KDTB 2Y84A 1FCKA 2HAVA 5L8DA 3N26A 2OZZA 1IZ1A 1XVYA 1Y1ZA 1SW4A 3IOTA 4NF4A 3TTRA 1TT1A 3CRBA 3USDA 3WAEA 4GRKA 1A99A 1A8EA 2HZLA 3KSJA 1RKMA 2VOZA 3FV2A 3IB1A 4P11A 5FHNA 1R9QA 2Y7PA 4BDNA 1I69A 2QJEA 3C34A 3ECRA 3QSLA 4JWOA 4WXJA 1FTOA 4PP0A 1B46A 1A40A 1RYOA 1JW5A 4FAJA 1QJMA 2PMSA 1MDQA 4R2BA 1GV8A 3S9NC 5IAIA 1YCJA 3T22A 5AA3A 3G3JA 1I6BA 1SDXA 5TPAA 3MP1A 3O66A 5KCJA 5ISUA 4U2RA 3JZJA 1AH5A 4QFOA 2I3VA 4OTEA 1I6QA 5A5XA 3MWBA 3MZBA 4GIZA 3FASA 2REGA 3G3HA 3FXRA 2DE4A 4FE8A 2F97A 1MY4A 2RC9A 4LATA 1TXFA 4Q0CA 4ZS9A 3UGWA 1MS7A 3RPWA 3G3GA 1HSJA 1BIYA 1FQCA 4OFOA 4OERA 1EZ9A 1SW2A 1QKAA 2YPNA 3H6WA 5AA1A 4KCCA 1H43A 3EPEA 3IJOB 3DELB 4M4GA 4KYDA 2Q2CA 2UXAA 3BKIB 4RYAA 3HN0A 4QSDA 1M5DA 2H4IA 3O6IA 3PPQA 1XOCA 2VGQA 1GGGA 2DYXA 2ZNUA 4N07A 4X1BA 1UQWA 1SW5A 3K6UA 2WKYA 1MXZA 4OFJA 1RYXA 3T9UA 4OHNA 2HZKA 2CMOA 5DT6A 1PBPA 3TKDA 3ILTB 1MM6A 1MY2A 2DWIA 2HCAA 5DVIA 4EF1A 4H8IA 5CRYA 2OCUA 4XXUA 3PMVA 4GXAA 1VE4A 3SEWA 1LCTA 2NVUB 5ITPA 1IQ7A 2CZLA 1J1NA 1FTMA 1Y3PA 1B3EA 1IUDA 4U4XA 3TTNA 3VFJA 3Q26A 1IIWA 4O3BA 4MFIA 1M5EA 3OSQA 4KHZE 3TYHA 2O51A 2ZNSA 4ZDMA 4OMBA 4YB5A 1FQFA 1P1WA 1SYIA 2G93A 2NUVA 3FVGA 3HPIA 2XHDA 3JYRA 5DYHA 3RQTA 4FATA 1B3FA 3C32A 3O28A 4IO2A 1P1OA 3TZAA 4EQ7A 4F3GA 1MRPA 2XXUA 1B5IA 2REJA 4EQ9A 1NH7A 5I84A 3RT8A 3C4MA 3RUMA 1QVSA 5JEIA 4XKRA 4NF4B 3ILUB 1M5CA 2F7CA 3RN8A 4F1VA 4RK9A 4G68B 4BDQA 3TQWA 2A5TA 3HO7A 1SBPA 5AE4A 1SVXB 2H5YA 5ELVA 4DZ1A 3VXCA
chains in the Genus database with same CATH superfamily
3UK4A 2XX9A 2Z22A 2B4LA 4DDDA 1PB8A 5L9SA 2F7BA 5AA2B 2UVGA 4M1VA 2O69A 2FBPA 1B1XA 1G0IA 4MX6A 1B4ZA 2DVZA 2P1SA 1URDA 4KI0E 3M3KA 1UIVA 5TU0A 3SEXA 4P3LA 1NUYA 2ALUA 3UN6A 1ZJLA 3OO6A 3QXMA 4N17A 2P3VA 3CSBA 2WEFA 3THIA 2CEYA 1O7TA 1OVBA 3VE1B 5F7VA 3M8UA 2FNCA 3O6GA 4MJOA 3UORA 1NUWA 4RXLA 2Q2AA 3C33A 3SERA 5BWJA 3R6UA 3OO8A 2M8CA 1S7YA 1OQGA 4H5FA 3LSXA 2NWJA 2O68A 2ONSA 3HV1A 1JNFA 3MZ9A 5KCJB 3D4GA 1DPEA 3FUZA 3V5AA 2F78A 4JVDA 4GOTA 1MH4A 3RNNA 4H0WA 5IZ3A 1URGA 4R6HA 2RC7A 2JJKA 4GF8A 3TODA 2O84X 4MCOA 2O7IA 3A3UA 4GWXA 4QFLA 1IXHA 2PCRA 3CFLA 3N94A 3T93B 2F6PA 2ESNA 5I7IA 3SETA 4K3FA 3ZKKA 3I3VA 2XXYA 4HE0A 1LB9A 4R6YA 4U1OA 4NF6B 3SEYA 1I6AA 1LB8A 2QL3A 1LBWA 4ELPA 2XWOA 4EXLA 3KOSA 3K1MA 1DOTA 3CHGA 2VPOA 3FXQA 1B05A 4F1UA 1IMCA 2QS4A 5IZZA 1MQHA 2FA7A 4R6KA 3MPLA 3OOAA 3A3CA 3PUZE 3U8QA 3EHUA 1P1UA 1SPIA 2DE2A 4R74A 1A7LA 1MH3A 2XA5A 1FTLA 3B8BA 4NTLA 1TFAA 3TPAA 4HCWA 2H99A 3C36A 3MVXA 1CNQA 4IGTA 4NX1A 3KBRA 3KC1A 4G8HA 3DP6A 4MNPA 4EQBA 3U92A 2VD2A 1IEJA 2YJPA 2I49A 3B50A 4I40A 2CEXA 5K2XA 4NF5B 3BBRA 1CE2A 3O29A 2VD3A 4OYVA 1MG1A 2ONRA 3B6WA 1UTBB 1FSAA 4G8MA 1MPCA 4C1UA 2FHYA 4IO3A 4P0GA 1IMFA 1Q1KA 2PT2A 4QF9A 3E4RA 3KN8A 1NMUA 1DMBA 4QRZA 1P1NA 5F24A 2KLFA 3M3LA 3K1PA 2VP1A 4MBPA 3MVZA 5M2VA 1AMFA 3MC2A 2FIEA 3HCQA 4KCDA 3CR9A 4Q30B 4PAIA 4JBZA 3IR1A 1D9QA 2QVUA 3OEKA 1HSEA 1B40A 4OVSA 4IO5A 4XFEA 1LBBA 2XXPA 4THIA 3H6TA 3ONMA 4XKQA 4IGRA 4ZEIA 3W9VA 4GVOA 2GFEA 2E0SA 3LUYA 1KA1A 1Y3NA 3KOTA 5IM2A 2FYIA 2HXRA 4R9FA 1OLCA 1ZMGA 3QUJA 1N84A 3FBPA 3SEVA 2UVJA 3CG3A 4JXIA 3CFZA 4C0RA 4NF8B 4ZZAA 2QFLA 3PPOA 5DVJA 4ZE8A 1B0HA 1H45A 2XXIA 1P99A 4HTGA 3Q29A 5L9OA 3PUXE 4LZ8A 4R2FA 4MNCA 4NEDA 1YAEA 2L5VA 4I3YA 4PFBA 4TLLB 1OVTA 1POY1 3MJNA 4GWZA 3O2AA 1B3GA 5ICQA 2F34A 4GL8A 4YAHX 5H8NA 3E78A 3QYTA 3IX1A 1ZBMA 5AA2A 3N5LA 5JTYA 2E1SA 3HHGA 2B3BA 2V3TA 2P3NA 3IO4A 3IOUA 4EDPA 1F9BA 1N3WA 5IKBA 4L17A 4MIJA 2XXRA 2DWJA 4ELQA 4OQOA 4QSCA 3PU5A 1A8FA 1B3HA 4BLAA 4MF3A 5AA4B 1JW4A 2A5TB 1B5JA 5CMCA 4UA8A 4JB7A 1YPNA 4XF5A 3Q27A 2OLBA 1AOVA 1Z7NE 3VV5A 2HAVA 1XVYA 4AS4A 1Y1ZA 3USDA 3CRBA 3WAEA 1A8EA 2HZLA 2VOZA 3FV2A 5FHNA 2Y7PA 4BDNA 1I69A 3ECRA 1B46A 2KQZA 4AS5A 2PMSA 4R2BA 5IAIA 5TPAA 1SDXA 5ISUA 1AH5A 4OTEA 1I6QA 3MZBA 4GIZA 3G3HA 2DE4A 2F97A 1MY4A 4Q0CA 3RPWA 1BIYA 4OFOA 1NV6A 4QSDA 5EQ8A 3O6IA 1GGGA 2DDKA 2DYXA 1UQWA 1MXZA 1G0HA 2CMOA 1MM6A 4EF1A 2OCUA 3PMVA 1FTMA 3E79A 4O3BA 1M5EA 4KHZE 4YB5A 2FVZA 1P1WA 2NUVA 3FVGA 3JYRA 3RQTA 3C32A 1MRPA 2XXUA 2REJA 2WYKA 5LTCA 3RT8A 5I5PA 4G68B 4GX6A 3VXCA 1B0LA 3KEIA 5EQAA 2VHAA 4YICA 2XXVA 3Q25A 4F2QA 5I2KA 4AB5A 1USYE 4RJZA 2ZNTA 1LFHA 1ZKBA 3MVWA 3V8XB 1OMPA 2YLNA 3K6VA 3PPNA 2B4MA 4PBHA 2UVHA 1EYJA 5IZ3B 1O63A 4P9KA 2QS2A 2F35A 2RINA 4N4UA 1B4HA 1LSTA 1SQYA 4ZEBA 3IK6B 1D9VA 4ZZEA 1ZLQA 2BJJX 2WX9A 1FBEA 1LAGE 5F1QA 3E3KA 2CZIA 2GHBA 4ESXA 3PV0E 4HS7A 5H8NB 3FVKA 5EQ7A 3MAMA 2AL5A 4P56A 1US5A 2NXOA 4P1LA 1NH8A 1MM7A 2QSXA 4OWDA 3JV9A 2OWTA 3PGFA 4O8MA 2Q8JA 4C1TA 5DVFA 4ELRA 4NG7A 4LA9A 3RYDA 5I58A 1Y20A 2V84A 3GZGA 4H46A 4LP2B 2ZXTA 5ET7A 3WAFA 1FTKA 4GX4A 4GFRA 4OVJA 3A29A 3KGCA 3IFAA 4GL0A 4DCYA 3ISPA 2PX1A 2RF1A 4PF6A 4F3SA 3FV1A 3PMXA 3T1BA 4QFKA 1YZ0A 4Q8RA 1B58A 4R9GA 1BK4A 3T9HB 1H44A 2H25A 4TLMB 3AXFA 1VR5A 4F1YA 1TFDA 4MEVA 3EHSA 4OEVA 4FORA 1KWHA 1FBGA 1MQIA 5L9MA 4N15A 1LBXA 2XXWA 1SD3A 1D3KA 2THIA 3BFTA 4G77A 1P1QA 5AA3A 3MBPA 3MVYA 1N7WA 2B3FA 2I4CA 2HEUA 3T0JA 3UP9A 1AWBA 2HPGA 3GLBA 2F8DA 3W9WA 3T9VA 4PFUA 1K9YA 1KA0A 4OVRA 2O1LA 1NNFA 3H4ZA 1PB7A 4H8JA 2H9BA 4PFYA 2DXRA 4KYEA 1FPFA 5CMKA 2PFYA 3GBBA 5CMBA 4U4SA 3KFMA 2R8TA 2XXHA 2Q8MA 3K4UA 4PE3A 1PEBA 2Y7RA 3MP8A 3TTMA 1NL5A 4LZ5A 2F6GA 3TCGA 1D4NA 2QS3A 2XD3A 4PFTA 4ZE9A 2D21A 2ZZXA 1BKAA 4GQOA 4HXVA 4QSEA 5FBPA 5ET6A 4U1ZA 3TUSA 5ITOA 3GXAA 2I48A 1LLSA 5EYHA 3HSTA 1B52A 2CZHA 1EZPA 1LFIA 3B6QA 4F18A 2QPQA 1GVCA 4PDDA 4PETA 1GTKA 2FIXA 1OQHA 3FJGA 3MSTA 3KJTA 1FPJA 3TTLA 1XC1A 3IB0A 1FW0A 3FVOA 2I58A 4YU0A 3KJ7A 1N7XA 3KBZA 3PD8A 1M5FA 4YMBA 3RLFE 5KDTA 1JEVA 5H8FA 2GHAA 5H8SA 1H3DA 2GRVA 3H06B 4I8CA 4NN3A 2R71A 4NHBA 4MNIA 3VVEA 5H8QA 1FQAA 4LZ7A 3TCFA 2Z8DA 1MXXA 3RY3A 3CIJA 4F39A 3MW0A 5I56B 1NNKA 3O6HA 4LQ2A 4GBVA 1EZOA 3T66A 3IOWA 4F31B 1O64A 4NQ8A 1ANFA 3FATA 4TOZA 1FJ6A 4R72A 2OX3A 1IITA 1WODA 3EF7A 4EUOA 4OVQA 4ZECA 1JVYA 5JK4A 1MQDA 3R7XA 1NNPA 2F36A 1II5A 4GD5A 1A54A 2Y5KA 3K00A 4UACA 2DWHA 2P2AA 1Y3QA 2UVIA 1MY1A 1CB6A 2ZYKA 4QFPA 3C9HA 1QULA 4PFIA 1LAFE 4YZZA 2RCAA 1SYHA 4MAGA 5K2YA 3SEUA 3W15C 3C35A 4YKJA 4F3PA 3IAZA 3S9MC 3QMFA 3RTWB 3LR1A 2OBGA 4ND9A 5I56A 3D4CA 3UA8A 4JSOA 2XD2A 2X7PA 4YKIA 4PE5B 3OEMA 4ECFA 3H3GA 4QBAA 3CG1A 1XVXA 4GLIA 4RNSA 3FJMA 4BDRA 4H45A 4DE8A 5CM6A 4F3BA 1FPKA 4P1EA 4AB6A 4N91A 1ELJA 1DCUA 5I2NA 5ICTA 4N6PA 4GWSA 1IXGA 5B7DA 4OESA 1NV0A 3N26A 1IZ1A 4NF4A 1TT1A 4GRKA 4P11A 1RKMA 2HHMA 1R9QA 4N6KA 4PP0A 1JW5A 1MDQA 4PTKA 1I6BA 3MP1A 4FE8A 3FXRA 4ZS9A 3RPLB 3G3GA 1FQCA 4OERA 1EZ9A 1FBFA 5AA1A 1H43A 3IJOB 3RPLA 2UXAA 2H4IA 4N07A 1SW5A 2WKYA 3T9UA 2HZKA 5DT6A 1MY2A 2HCAA 4XXUA 4GXAA 1VE4A 3SEWA 1LCTA 1IQ7A 1J1NA 1Y3PA 1IUDA 1QGXA 3OSQA 4HE1A 2ZNSA 4ZDMA 1FQFA 1SYIA 4FATA 1B3FA 4IO2A 1P1OA 4F3GA 1NH7A 1FPBA 3BIHA 3FXBA 1M5CA 2F7CA 4RK9A 3HO7A 1SVXB 5ELVA 3TFLA 3ZS6A 4OA4A 2X7QA 4YB6A 4ESWA 2I0BA 4IB2A 2O1MA 5ET5A 2F5XA 4G68A 1B6HA 3GBAA 3IB2A 4F2OA 3PUWE 4GBWA 5T3JA 1UTHB 3U72A 3KZGA 1WVJA 1LBCA 2Z8FA 4X48A 3OSRA 4NE4A 5FTHA 1MXUA 2ZYNA 4DCXA 5J1DA 2Q9TA 1POTA 2ZYOA 2ONKE 2HXWA 2R9JA 2O6AA 4NWCA 1VSOA 1QUIA 3PMWA 4O94A 4LQ5A 2F3BA 3TTKA 1VFEA 1XI6A 3SDFA 3U93A 4YB7A 2RKMA 3LSLA 1N04A 2D5WA 4OXVA 3G3IA 3MYUA 4O3AA 5AA2D 3LV0A 1N3XA 5TPAB 2DOJA 2OWZA 1PDAA 2WYPA 2UYEA 2DE3A 4BDLA 2XWKA 4JSDA 2GQ1A 2UYFA 5CC2A 5LDZA 3OO7A 5H8QB 2QVRA 1YTVA 4YKKA 1DSNA 3VVFA 4PAKA 3HFUA 4P0IA 1LGBC 3BFUA 3RT6B 3RTFB 2DVCA 4DLDA 1IMDA 5EQ9A 3KC0A 4PGNA 4JDFA 3ROJA 2ANJA 1IXIA 1S50A 1USYH 3EQ1A 4PGPA 4BDMA 5CI5A 5TP9B 2OJTA 3L6GA 4PQJA 1UIUA 2AIXA 4X9TA 4G4PA 4MLVA 1B32A 4OVTA 2A5SA 2O7UA 5FTIA 3KN7A 3LUZA 3G7WA 3KSXA 3TELA 1Q35A 4U22A 3RGYA 2QRYA 3OXNA 1Y4TA 4P47A 1OIBA 4IO7A 1K9ZA 3VLWA 3OO9A 2VPNA 2CZKA 2PT1A 4LONB 2DP8A 4R73A 3D1RA 4G8NA 3B7DA 4ZEKA 1B2HA 1IMAA 4N13A 3PPPA 5EHSA 4NF5A 3PUVE 4H6DA 5CBRA 2QMWA 2DXYA 5LOMA 1DTZA 3G3KA 4HCYA 3PPRA 3DM0A 1FBDA 1XT8A 5DEXB 2X26A 4FEBA 3MQ9A 1JQFA 4QXDA 4AQ4A 4IO4A 2ZZVA 4OENA 1R6ZA 3VDFA 3OMBA 1RDZA 1EU8A 3L6HA 1LEVA 1MY0A 4N81A 2V3UA 1QUKA 3IJXB 5I2NB 3GYYA 2MKZA 5BUUA 4IY5A 2B65A 1MPDA 4JWYA 5IZ1A 4DI3D 3O97A 4I62A 4FECA 3K01A 1TWYA 3EKIA 1FPIA 1Y9UA 5CMMA 4DIGA 1JVXA 3S4UA 3N6TA 2QS1A 4GWWA 2ZYMA 4N6DA 1UTHA 4TQUQ 1FRPA 4PBQA 1NKXA 4RA1A 4DXUA 1BP5A 2ABHA 2PBWA 5HPQA 3LBSA 1N0TA 4WKMA 3PUYE 5I3SA 1MQJA 5KZTA 2XWIA 4X04A 1SI1A 3FXUA 3Q28A 4ONYA 4E0XA 1B7HA 3FGSA 3MPKA 4JVIA 3CFXA 1RDXA 2G29A 1LBYA 1EYIA 3K02A 1Q9DA 2DS9A 3P7IA 1NUXA 3K6XA 1MXWA 1MXVA 4GX3A 4NF8A 4G68C 2QMXA 3OD7A 1YYZA 3E13X 4GXSB 4H65A 3O9PA 2PVUA 3U94A 2IA4A 4QHQA 1ZU0A 3I6VA 1NV1A 4MMPA 1NV2A 1MQGA 1QUJA 4DI4B 1GR2A 3DP8A 4H1XA 5EYGA 3ZKLA 4RPNA 3LSWA 4X1DA 4Z7EA 3H6VA 3EHTA 3FIRA 4FIMA 5H8HB 2OK2A 1N76A 4ZEDA 2HAUA 1FQEA 5EHMA 1Y4CA 2AYSA 4O7IA 1ATGA 1D9YA 1OLAA 3FD3A 4E0WA 1QKBA 4UABA 4H67A 5JTYB 3TCHA 3C31A 1DBZA 1FQBA 1LAHE 4NMYA 2NOOA 1M5BA 2I3WA 5I59B 1AL3A 3HHFA 3H03A 5KDTB 2Y84A 4PDHA 4MHFA 3TTRA 1A99A 1FBHA 4JWOA 3QSLA 5J16A 1A40A 1RYOA 1QJMA 5DW8A 3T22A 5KCJA 3JZJA 4QFOA 2I3VA 1NI9A 2VT5A 3FASA 2REGA 4LATA 2RC9A 3UGWA 1TXFA 4N8GA 1HSJA 3H6WA 1QKAA 2YPNA 1IMEA 4KCCA 3EPEA 2Q2CA 3SZPA 4RYAA 3HN0A 1M5DA 3PPQA 2ZNUA 3K6UA 1RYXA 4OHNA 3TKDA 2DWIA 4H8IA 5CRYA 2CZLA 1B3EA 3Q26A 3TYHA 2O51A 4OMBA 5ESYA 2G93A 5I59A 2XHDA 5DYHA 3TZAA 4EQ7A 1B5IA 2F3DA 1NV5A 4N8YA 3C4MA 1QVSA 4NF4B 3ILUB 4BDQA 3TQWA 2A5TA 5AE4A 3IFCA 2H5YA 4DZ1A 1FBCA 4F22A 1EYKA 3R26A 1SW1A 3VLVA 1B5HA 1T0KA 2AL4A 1FTJA 3OELA 1XHYA 5EYFA 2BJIA 2LAOA 2Q88A 2V93A 5HM4B 4O7MA 2F7AA 1FQDA 3PD9A 3CI8A 3H7MA 3LSFB 4MH5A 1JW1A 4OETA 1RDYA 2DSFA 2Q89A 1LAXA 3K1NA 4FEDA 1DTGA 1Y1MA 3TMGA 3FJ7A 4ZEFA 1B1HA 3DLNA 1R1NA 3ZSFA 1R9LA 5DTBA 2Z8EA 4G61A 1A55A 4YMAA 4P8BA 3LC8A 3QIMA 2XXKA 5I57A 4JWXA 3BIGA 4OANA 2ZZWA 4ISUA 1JEUA 4POWA 3DP4A 3K6WA 4PAFA 2Q74A 4KXPA 3S9EA 1ZTYA 1L5TA 2OWSA 1B3LA 2R6GE 3VXBA 3NOHA 1B51A 4PCDA 5I57B 1URSA 4NAPA 4FJPA 4YKPA 4EF2A 2Z23A 4PFRA 1JETA 4NGUA 1NFTA 1MDP1 2Y7KA 4NWDA 2XWVA 2P0SA 1NNTA 4GWOA 2XXQA 5I2KB 3CSGA 4QFNA 4KD5A 4H5GA 1QW0A 3EN3A 4I1DA 3V83A 4DXBA 2RCBA 1FTAA 3SESA 4KPTA 5H8FB 4KFQA 2QVVA 4XKNA 4DXCA 4IY6A 4I9DA 1LCFA 2IEEA 4ELOA 3S9LC 3IO6A 2XX8A 1B9JA 4KQPA 1BLFA 4I3EA 5FHOA 3V89B 4KR5A 2I4BA 4OFLA 3K0VA 1ZIUA 5IGAA 2PYYA 4XIGQ 2KR0A 2HFBA 3T9XB 1WDNA 3MP6A 1BTJA 4HW8A 1DPPA 1MPBA 3UIFA 3FZVA 1EH3A 2D3IA 4R75A 4PF8A 1NV3A 3OENA 1B7ZA 4GWYA 2DQVA 3KG2A 3F11A 5AA4A 3T96B 4LUBA 1IMBA 3PTYA 4RY1A 1PB9A 4U21A 4OZ9A 4NF6A 2DWAA 1FPGA 2HQ0A 2PFZA 1FPDA 1H76A 2V25A 3TAJA 3E9XA 1SI0A 4OEUA 1FPEA 1S9TA 1NV7A 3QUFA 3TQLA 5TP9A 4XEQA 4RK2A 1UTBA 4IO6A 3TDJA 3N6UA 4Q5TA 2ZMBA 1VFDA 4NF0A 4RPOA 3G3FA 1VDWA 1AIVA 1LBVA 5ET8A 1B7UA 1LBZA 1NV4A 2RC8A 3VLUA 2V3QA 2XX7A 5H8HA 1US4A 3S2VA 5HBCA 4PC9A 1MXYA 3TEPA 2GH9A 3I5OA 5B70A 1Z7ME 4MLQA 1PBQA 1FBPA 3MZ1A 1KZ8A 2Y5LA 4XKPA 4LN5A 3IORA 2I6EA 3VVDA 3A09A 4Z0IA 2W7YA 1IXCA 1LFGA 5A5LA 4U23A 3H6UA 5I58B 4BDOA 5DEXA 5A5XB 4PFWA 3QK6A 4O3CA 2WBDA 3FVNA 3B6TA 4JVCA 5CBSA 4POXA 2Y7WA 5FHMA 1MY3A 4WEDA 4EXKA 3IL1B 3IOVA 1PC3A 4F29A 1XS5A 1FPLA 4G2ZA 2H98A 4WEPA 2XXTA 3K2DA 2Y7IA 3ODBA 3KN3A 3M3FA 1DK4A 1HSLA 4XTCQ 4KYSA 3QAXA 3SKPA 3U1OA 3CVGA 2XXXA 4F19A 3MUQA 2I0CA 4LVQA 1FCKA 5L8DA 3U65A 2OZZA 1SW4A 3IOTA 3KSJA 3IB1A 4GWUA 2QJEA 4WXJA 3C34A 1FTOA 4FAJA 3S9NC 1GV8A 1YCJA 3G3JA 3O66A 4U2RA 5A5XA 3MWBA 2V4CA 1MS7A 4HE2A 1SW2A 4M4GA 3DELB 4KYDA 3BKIB 1YXIA 2WBBA 1XOCA 2VGQA 4X1BA 4OFJA 1JP4A 1PBPA 3ILTB 5DVIA 2NVUB 5ITPA 4U4XA 3TTNA 3VFJA 1IIWA 4MFIA 3HPIA 3O28A 4FBPA 4EQ9A 5I84A 3RUMA 5JEIA 4IR8A 4XKRA 4X8RA 3RN8A 1FJ9A 4F1VA 1SBPA 1INPA 1NUZA 4OVPA
chains in the Genus database with same CATH topology
1B0LA 3KEIA 3TFLA 3UK4A 4F22A 2VHAA 2XX9A 3R26A 4YICA 3ZS6A 1SW1A 3VLVA 2Z22A 2XXVA 3Q25A 4F2QA 4DDDA 5I2KA 4AB5A 1USYE 1B5HA 1PB8A 1T0KA 2AL4A 2X7QA 4RJZA 4YB6A 4ESWA 1FTJA 5L9SA 2F7BA 5AA2B 2UVGA 3OELA 2ZNTA 2O69A 2I0BA 4M1VA 1LFHA 1B1XA 4IB2A 1XHYA 5EYFA 2O1MA 2F5XA 1B4ZA 2LAOA 4G68A 2DVZA 2P1SA 1B6HA 1ZKBA 3GBAA 2Q88A 2V93A 1URDA 3IB2A 3MVWA 3M3KA 4KI0E 3V8XB 5HM4B 4F2OA 1OMPA 2F7AA 1UIVA 3PUWE 1FQDA 2YLNA 3PD9A 1UTHB 5TU0A 3CI8A 3KZGA 3K6VA 3PPNA 3H7MA 3U72A 1WVJA 1LBCA 2Z8FA 3LSFB 4MH5A 3SEXA 1JW1A 3OSRA 4NE4A 4OETA 4X48A 5FTHA 2DSFA 2ALUA 1MXUA 1ZJLA 2Q89A 2UVHA 2ZYNA 3UN6A 1O63A 1LAXA 3OO6A 2QS2A 2F35A 2RINA 3K1NA 3QXMA 4FEDA 1B4HA 1DTGA 1LSTA 1SQYA 1Y1MA 3IK6B 4ZEBA 5J1DA 2Q9TA 1D9VA 1POTA 3FJ7A 4ZZEA 1ZLQA 3CSBA 2BJJX 4ZEFA 1B1HA 3TMGA 2ZYOA 3DLNA 2ONKE 2HXWA 2R9JA 2O6AA 1R1NA 4NWCA 3THIA 1VSOA 1LAGE 1QUIA 5F1QA 1O7TA 3ZSFA 1R9LA 3E3KA 2GHBA 4ESXA 3PV0E 4HS7A 2Z8EA 3PMWA 5DTBA 1OVBA 1A55A 3VE1B 5F7VA 4YMAA 3FVKA 5H8NB 4LQ5A 3LC8A 3M8UA 3QIMA 3TTKA 1VFEA 2FNCA 3MAMA 2AL5A 3SDFA 3U93A 4YB7A 3O6GA 2RKMA 3LSLA 5I57A 1N04A 4JWXA 1US5A 2NXOA 3UORA 1NH8A 1MM7A 2QSXA 2Q2AA 3C33A 4OWDA 4RXLA 3SERA 5BWJA 4ISUA 1JEUA 3JV9A 3R6UA 3OO8A 2OWTA 2M8CA 4POWA 3PGFA 1S7YA 3DP4A 2D5WA 2Q8JA 3K6WA 4OXVA 4C1TA 5DVFA 4ELRA 3G3IA 4LA9A 1OQGA 1Y20A 2V84A 4H5FA 5I58A 4O3AA 3LSXA 3GZGA 4LP2B 2NWJA 5AA2D 3S9EA 2O68A 1ZTYA 2ONSA 1L5TA 1N3XA 2ZXTA 1JNFA 3HV1A 3MZ9A 3WAFA 5TPAB 5KCJB 2OWSA 1B3LA 2R6GE 2DOJA 3D4GA 1FTKA 1PDAA 3VXBA 1DPEA 3FUZA 1B51A 2UYEA 4GFRA 4OVJA 2DE3A 3V5AA 1URSA 2F78A 5I57B 4BDLA 4FJPA 3KGCA 4JSDA 4GL0A 4YKPA 4DCYA 4EF2A 2Z23A 1MH4A 4GOTA 2PX1A 1JETA 3RNNA 4H0WA 2RF1A 1NFTA 2UYFA 1URGA 4F3SA 5CC2A 3FV1A 3PMXA 1MDP1 4R6HA 2RC7A 2Y7KA 4NWDA 3OO7A 4GF8A 5H8QB 3TODA 4QFKA 2O84X 2P0SA 2O7IA 1YTVA 3A3UA 1NNTA 4GWOA 1B58A 4QFLA 1IXHA 4YKKA 4Q8RA 2XXQA 3CFLA 3N94A 1DSNA 4R9GA 5I2KB 3VVFA 3CSGA 3T93B 3T9HB 1H44A 4QFNA 4KD5A 2H25A 4H5GA 3AXFA 4TLMB 4P0IA 1VR5A 4F1YA 1QW0A 1TFDA 1LGBC 4OEVA 3BFUA 3EHSA 2F6PA 3RT6B 2ESNA 3EN3A 4FORA 3RTFB 3SETA 2DVCA 4K3FA 1KWHA 3ZKKA 4I1DA 4DLDA 3V83A 3I3VA 2XXYA 4JDFA 4DXBA 1MQIA 1LB9A 5L9MA 2ANJA 2RCBA 1IXIA 1S50A 3SESA 4KPTA 2XXWA 4R6YA 1SD3A 1D3KA 4U1OA 4DXCA 2THIA 4NF6B 1USYH 5H8FB 3BFTA 3SEYA 4KFQA 3EQ1A 4BDMA 1I6AA 4XKNA 1LB8A 1P1QA 4G77A 2OJTA 3L6GA 5CI5A 2QL3A 4PQJA 5TP9B 4ELPA 3MBPA 3MVYA 1N7WA 4EXLA 2B3FA 1UIUA 2I4CA 2HEUA 3KOSA 2AIXA 3UP9A 3K1MA 4X9TA 4G4PA 3GLBA 4IY6A 1DOTA 1B32A 4MLVA 2F8DA 4I9DA 2A5SA 2O7UA 3FXQA 1B05A 1LCFA 5FTIA 4F1UA 3W9WA 3KN7A 2IEEA 3G7WA 3KSXA 2QS4A 1Q35A 4U22A 3T9VA 3TELA 4ELOA 3RGYA 1MQHA 2FA7A 3S9LC 3IO6A 4R6KA 2QRYA 1B9JA 2XX8A 3MPLA 3OOAA 3A3CA 3OXNA 3PUZE 4PFUA 3U8QA 1Y4TA 3EHUA 2O1LA 1OIBA 4KQPA 1BLFA 1NNFA 1P1UA 3H4ZA 2DE2A 4IO7A 4R74A 5FHOA 3VLWA 1A7LA 1MH3A 1PB7A 3OO9A 4H8JA 4KR5A 3V89B 1FTLA 2H9BA 4NTLA 2PT1A 4PFYA 2DXRA 4LONB 1TFAA 2DP8A 4KYEA 4R73A 2I4BA 4G8NA 3B7DA 3TPAA 4HCWA 4OFLA 4ZEKA 2H99A 3GBBA 3K0VA 5CMKA 3C36A 1ZIUA 3MVXA 1B2HA 2PYYA 5CMBA 4U4SA 3KFMA 4N13A 3PPPA 5EHSA 4XIGQ 4NF5A 2XXHA 2HFBA 3K4UA 4IGTA 3PUVE 4H6DA 3T9XB 1WDNA 3MP6A 1PEBA 2Y7RA 5CBRA 1BTJA 2QMWA 2DXYA 3MP8A 4HW8A 5LOMA 3TTMA 1NL5A 1DPPA 3KBRA 4LZ5A 1DTZA 3G3KA 1MPBA 4G8HA 4HCYA 2F6GA 3PPRA 3UIFA 5CM6A 3TCGA 3DP6A 3DM0A 3FZVA 4EQBA 1XT8A 1D4NA 3U92A 5DEXB 2VD2A 2X26A 1EH3A 2D3IA 4FEBA 1IEJA 2YJPA 3MQ9A 4R75A 1JQFA 2QS3A 2XD3A 4PFTA 4AQ4A 2D21A 2I49A 4IO4A 1BKAA 4ZE9A 4GQOA 4OENA 4QSEA 1R6ZA 5K2XA 3VDFA 4NF5B 3OMBA 3BBRA 1CE2A 4U1ZA 3TUSA 3OENA 5ITOA 1EU8A 3L6HA 3O29A 3GXAA 1B7ZA 2I48A 1MY0A 1LLSA 2VD3A 2V3UA 1QUKA 2DQVA 3HSTA 3IJXB 1MG1A 2ONRA 3B6WA 3KG2A 4OYVA 3F11A 5I2NB 1B52A 5AA4A 1EZPA 5BUUA 3T96B 4IY5A 1LFIA 4LUBA 2B65A 1UTBB 3B6QA 1MPDA 4F18A 4G8MA 2QPQA 1MPCA 1GVCA 4PETA 4RY1A 4C1UA 4JWYA 1GTKA 1PB9A 3FJGA 1OQHA 4IO3A 4OZ9A 4U21A 3O97A 4P0GA 1Q1KA 3KJTA 3TTLA 1XC1A 2PT2A 3IB0A 1FW0A 3FVOA 4I62A 2I58A 3E4RA 3K01A 4FECA 4QF9A 3KN8A 3KJ7A 1TWYA 1N7XA 2DWAA 2HQ0A 1Y9UA 4YU0A 5CMMA 2V25A 1H76A 4DIGA 1JVXA 1NMUA 3PD8A 1M5FA 1SI0A 2QS1A 3E9XA 3N6TA 4OEUA 3S4UA 4YMBA 1DMBA 1S9TA 3RLFE 5KDTA 4QRZA 1P1NA 2ZYMA 2KLFA 3QUFA 3M3LA 5TP9A 3TQLA 3K1PA 1UTHA 1UTBA 2VP1A 4IO6A 1JEVA 4RK2A 3TDJA 4TQUQ 5H8FA 5I59A 3N6UA 4MBPA 2GHAA 5H8SA 1H3DA 3MVZA 2GRVA 5M2VA 1AMFA 3MC2A 3H06B 4Q5TA 3HCQA 4I8CA 1NKXA 3CR9A 4KCDA 2ZMBA 4Q30B 1BP5A 4RA1A 4DXUA 2ABHA 4JBZA 2PBWA 3IR1A 5HPQA 2R71A 3LBSA 1VFDA 1N0TA 3VVEA 4RPOA 3OEKA 1HSEA 3G3FA 4WKMA 1FQAA 1B40A 3PUYE 4LZ7A 5H8QA 3TCFA 1MQJA 4IO5A 5KZTA 1AIVA 1SI1A 1B7UA 2Z8DA 2RC8A 3VLUA 1MXXA 2V3QA 1LBBA 2XX7A 3FXUA 2XXPA 3Q28A 4THIA 3H6TA 4ONYA 3ONMA 5H8HA 3RY3A 3CIJA 4XKQA 4F39A 3MW0A 1US4A 4IGRA 3S2VA 4ZEIA 4E0XA 3W9VA 5HBCA 5I56B 4GVOA 2GFEA 1MXYA 2E0SA 1NNKA 1B7HA 3O6HA 3FGSA 2GH9A 3MPKA 4LQ2A 3LUYA 4NF6A 3TEPA 1Y3NA 3CFXA 3I5OA 2G29A 3KOTA 5B70A 1Z7ME 4MLQA 3K02A 2DS9A 3P7IA 1PBQA 1EZOA 3T66A 3MZ1A 3IOWA 2FYIA 3K6XA 4F31B 1O64A 1MXWA 1MXVA 1OLCA 1ZMGA 4R9FA 1ANFA 3QUJA 1N84A 4NF8A 4G68C 4XKPA 2QMXA 3SEVA 3IORA 2I6EA 2UVJA 3CG3A 3FATA 4JXIA 4TOZA 3CFZA 4C0RA 3OD7A 3VVDA 3A09A 4NF8B 3E13X 4R72A 4ZZAA 4GXSB 4Z0IA 2W7YA 1IITA 1IXCA 1WODA 4H65A 1LFGA 3EF7A 2PVUA 3O9PA 4EUOA 3U94A 2IA4A 3PPOA 4QHQA 1JVYA 4ZECA 5JK4A 1ZU0A 4U23A 3H6UA 1MQDA 3I6VA 3R7XA 1NNPA 3TAJA 5I58B 5DVJA 2F36A 4BDOA 4ZE8A 5DEXA 1II5A 4GD5A 5A5XB 1A54A 3K00A 4UACA 1B0HA 2DWHA 2P2AA 1H45A 2XXIA 4PFWA 3QK6A 1P99A 4O3CA 1MQGA 1QUJA 1Y3QA 4HTGA 2UVIA 3Q29A 5L9OA 1MY1A 3PUXE 4LZ8A 4R2FA 1CB6A 2ZYKA 4NEDA 4QFPA 1YAEA 3C9HA 1GR2A 1QULA 3DP8A 1LAFE 4H1XA 2RCAA 4YZZA 3FVNA 3B6TA 4TLLB 1OVTA 1POY1 1SYHA 3MJNA 5CBSA 4POXA 5K2YA 2Y7WA 3O2AA 5FHMA 1MY3A 3SEUA 3W15C 3C35A 1B3GA 4WEDA 4EXKA 5ICQA 4DCXA 2F34A 3IL1B 4GL8A 4RPNA 3IAZA 3LSWA 4X1DA 4YAHX 4YKJA 3ZKLA 3RTWB 4F3PA 3LR1A 3S9MC 4Z7EA 5H8NA 3IOVA 3H6VA 2OBGA 3QYTA 4ND9A 3IX1A 5I56A 1ZBMA 5AA2A 3N5LA 1PC3A 5JTYA 2E1SA 3D4CA 3EHTA 3FIRA 3HHGA 2B3BA 4FIMA 4JSOA 5H8HB 2OK2A 2V3TA 1N76A 3UA8A 4ZEDA 3IO4A 4F29A 1XS5A 2HAUA 1FQEA 2XD2A 3IOUA 5EHMA 2X7PA 4YKIA 1Y4CA 4EDPA 4PE5B 2AYSA 3OEMA 4G2ZA 1F9BA 1ATGA 1N3WA 5IKBA 4ECFA 3H3GA 3CG1A 2H98A 1XVXA 2XXTA 4L17A 1D9YA 1OLAA 4GLIA 4RNSA 4WEPA 3FJMA 3K2DA 2Y7IA 2XXRA 4BDRA 3FD3A 2DWJA 3ODBA 4E0WA 1QKBA 3KN3A 4OQOA 3M3FA 4H67A 4DE8A 4ELQA 4QSCA 5JTYB 4F3BA 3PU5A 1A8FA 3C31A 1B3HA 3TCHA 4AB6A 1HSLA 4BLAA 1ELJA 4XTCQ 1FQBA 1LAHE 4MF3A 4NMYA 5AA4B 2NOOA 1JW4A 1M5BA 2A5TB 2I3WA 3QAXA 1B5JA 4KYSA 3SKPA 3U1OA 5CMCA 5I59B 5I2NA 5ICTA 3CVGA 4UA8A 4JB7A 1YPNA 4N6PA 1AL3A 2XXXA 3Q27A 2OLBA 4F19A 1AOVA 1IXGA 3HHFA 3MUQA 1Z7NE 2I0CA 3H03A 4LVQA 5B7DA 3VV5A 4OESA 5KDTB 2Y84A 1FCKA 2HAVA 5L8DA 3N26A 2OZZA 1IZ1A 1XVYA 1Y1ZA 1SW4A 3IOTA 4NF4A 3TTRA 1TT1A 3CRBA 3USDA 3WAEA 4GRKA 1A99A 1A8EA 2HZLA 3KSJA 1RKMA 2VOZA 3FV2A 3IB1A 4P11A 5FHNA 1R9QA 2Y7PA 4BDNA 1I69A 2QJEA 3C34A 3ECRA 3QSLA 4JWOA 4WXJA 1FTOA 4PP0A 1B46A 1A40A 1RYOA 1JW5A 4FAJA 1QJMA 2PMSA 1MDQA 4R2BA 1GV8A 3S9NC 5IAIA 1YCJA 3T22A 5AA3A 3G3JA 1I6BA 1SDXA 5TPAA 3MP1A 3O66A 5KCJA 5ISUA 4U2RA 3JZJA 1AH5A 4QFOA 2I3VA 4OTEA 1I6QA 5A5XA 3MWBA 3MZBA 4GIZA 3FASA 2REGA 3G3HA 3FXRA 2DE4A 4FE8A 2F97A 1MY4A 2RC9A 4LATA 1TXFA 4Q0CA 4ZS9A 3UGWA 1MS7A 3RPWA 3G3GA 1HSJA 1BIYA 1FQCA 4OFOA 4OERA 1EZ9A 1SW2A 1QKAA 2YPNA 3H6WA 5AA1A 4KCCA 1H43A 3EPEA 3IJOB 3DELB 4M4GA 4KYDA 2Q2CA 2UXAA 3BKIB 4RYAA 3HN0A 4QSDA 1M5DA 2H4IA 3O6IA 3PPQA 1XOCA 2VGQA 1GGGA 2DYXA 2ZNUA 4N07A 4X1BA 1UQWA 1SW5A 3K6UA 2WKYA 1MXZA 4OFJA 1RYXA 3T9UA 4OHNA 2HZKA 2CMOA 5DT6A 1PBPA 3TKDA 3ILTB 1MM6A 1MY2A 2DWIA 2HCAA 5DVIA 4EF1A 4H8IA 5CRYA 2OCUA 4XXUA 3PMVA 4GXAA 1VE4A 3SEWA 1LCTA 2NVUB 5ITPA 1IQ7A 2CZLA 1J1NA 1FTMA 1Y3PA 1B3EA 1IUDA 4U4XA 3TTNA 3VFJA 3Q26A 1IIWA 4O3BA 4MFIA 1M5EA 3OSQA 4KHZE 3TYHA 2O51A 2ZNSA 4ZDMA 4OMBA 4YB5A 1FQFA 1P1WA 1SYIA 2G93A 2NUVA 3FVGA 3HPIA 2XHDA 3JYRA 5DYHA 3RQTA 4FATA 1B3FA 3C32A 3O28A 4IO2A 1P1OA 3TZAA 4EQ7A 4F3GA 1MRPA 2XXUA 1B5IA 2REJA 4EQ9A 1NH7A 5I84A 3RT8A 3C4MA 3RUMA 1QVSA 5JEIA 4XKRA 4NF4B 3ILUB 1M5CA 2F7CA 3RN8A 4F1VA 4RK9A 4G68B 4BDQA 3TQWA 2A5TA 3HO7A 1SBPA 5AE4A 1SVXB 2H5YA 5ELVA 4DZ1A 3VXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B0L A;  3KEI A;  3TFL A;  3UK4 A;  4F22 A;  2VHA A;  2XX9 A;  3R26 A;  4YIC A;  3ZS6 A;  1SW1 A;  3VLV A;  2Z22 A;  2XXV A;  3Q25 A;  4F2Q A;  4DDD A;  5I2K A;  4AB5 A;  1USY E;  1B5H A;  1PB8 A;  1T0K A;  2AL4 A;  2X7Q A;  4RJZ A;  4YB6 A;  4ESW A;  1FTJ A;  5L9S A;  2F7B A;  5AA2 B;  2UVG A;  3OEL A;  2ZNT A;  2O69 A;  2I0B A;  4M1V A;  1LFH A;  1B1X A;  4IB2 A;  1XHY A;  5EYF A;  2O1M A;  2F5X A;  1B4Z A;  2LAO A;  4G68 A;  2DVZ A;  2P1S A;  1B6H A;  1ZKB A;  3GBA A;  2Q88 A;  2V93 A;  1URD A;  3IB2 A;  3MVW A;  3M3K A;  4KI0 E;  3V8X B;  5HM4 B;  4F2O A;  1OMP A;  2F7A A;  1UIV A;  3PUW E;  1FQD A;  2YLN A;  3PD9 A;  1UTH B;  5TU0 A;  3CI8 A;  3KZG A;  3K6V A;  3PPN A;  3H7M A;  3U72 A;  1WVJ A;  1LBC A;  2Z8F A;  3LSF B;  4MH5 A;  3SEX A;  1JW1 A;  3OSR A;  4NE4 A;  4OET A;  4X48 A;  5FTH A;  2DSF A;  2ALU A;  1MXU A;  1ZJL A;  2Q89 A;  2UVH A;  2ZYN A;  3UN6 A;  1O63 A;  1LAX A;  3OO6 A;  2QS2 A;  2F35 A;  2RIN A;  3K1N A;  3QXM A;  4FED A;  1B4H A;  1DTG A;  1LST A;  1SQY A;  1Y1M A;  3IK6 B;  4ZEB A;  5J1D A;  2Q9T A;  1D9V A;  1POT A;  3FJ7 A;  4ZZE A;  1ZLQ A;  3CSB A;  2BJJ X;  4ZEF A;  1B1H A;  3TMG A;  2ZYO A;  3DLN A;  2ONK E;  2HXW A;  2R9J A;  2O6A A;  1R1N A;  4NWC A;  3THI A;  1VSO A;  1LAG E;  1QUI A;  5F1Q A;  1O7T A;  3ZSF A;  1R9L A;  3E3K A;  2GHB A;  4ESX A;  3PV0 E;  4HS7 A;  2Z8E A;  3PMW A;  5DTB A;  1OVB A;  1A55 A;  3VE1 B;  5F7V A;  4YMA A;  3FVK A;  5H8N B;  4LQ5 A;  3LC8 A;  3M8U A;  3QIM A;  3TTK A;  1VFE A;  2FNC A;  3MAM A;  2AL5 A;  3SDF A;  3U93 A;  4YB7 A;  3O6G A;  2RKM A;  3LSL A;  5I57 A;  1N04 A;  4JWX A;  1US5 A;  2NXO A;  3UOR A;  1NH8 A;  1MM7 A;  2QSX A;  2Q2A A;  3C33 A;  4OWD A;  4RXL A;  3SER A;  5BWJ A;  4ISU A;  1JEU A;  3JV9 A;  3R6U A;  3OO8 A;  2OWT A;  2M8C A;  4POW A;  3PGF A;  1S7Y A;  3DP4 A;  2D5W A;  2Q8J A;  3K6W A;  4OXV A;  4C1T A;  5DVF A;  4ELR A;  3G3I A;  4LA9 A;  1OQG A;  1Y20 A;  2V84 A;  4H5F A;  5I58 A;  4O3A A;  3LSX A;  3GZG A;  4LP2 B;  2NWJ A;  5AA2 D;  3S9E A;  2O68 A;  1ZTY A;  2ONS A;  1L5T A;  1N3X A;  2ZXT A;  1JNF A;  3HV1 A;  3MZ9 A;  3WAF A;  5TPA B;  5KCJ B;  2OWS A;  1B3L A;  2R6G E;  2DOJ A;  3D4G A;  1FTK A;  1PDA A;  3VXB A;  1DPE A;  3FUZ A;  1B51 A;  2UYE A;  4GFR A;  4OVJ A;  2DE3 A;  3V5A A;  1URS A;  2F78 A;  5I57 B;  4BDL A;  4FJP A;  3KGC A;  4JSD A;  4GL0 A;  4YKP A;  4DCY A;  4EF2 A;  2Z23 A;  1MH4 A;  4GOT A;  2PX1 A;  1JET A;  3RNN A;  4H0W A;  2RF1 A;  1NFT A;  2UYF A;  1URG A;  4F3S A;  5CC2 A;  3FV1 A;  3PMX A;  1MDP 1;  4R6H A;  2RC7 A;  2Y7K A;  4NWD A;  3OO7 A;  4GF8 A;  5H8Q B;  3TOD A;  4QFK A;  2O84 X;  2P0S A;  2O7I A;  1YTV A;  3A3U A;  1NNT A;  4GWO A;  1B58 A;  4QFL A;  1IXH A;  4YKK A;  4Q8R A;  2XXQ A;  3CFL A;  3N94 A;  1DSN A;  4R9G A;  5I2K B;  3VVF A;  3CSG A;  3T93 B;  3T9H B;  1H44 A;  4QFN A;  4KD5 A;  2H25 A;  4H5G A;  3AXF A;  4TLM B;  4P0I A;  1VR5 A;  4F1Y A;  1QW0 A;  1TFD A;  1LGB C;  4OEV A;  3BFU A;  3EHS A;  2F6P A;  3RT6 B;  2ESN A;  3EN3 A;  4FOR A;  3RTF B;  3SET A;  2DVC A;  4K3F A;  1KWH A;  3ZKK A;  4I1D A;  4DLD A;  3V83 A;  3I3V A;  2XXY A;  4JDF A;  4DXB A;  1MQI A;  1LB9 A;  5L9M A;  2ANJ A;  2RCB A;  1IXI A;  1S50 A;  3SES A;  4KPT A;  2XXW A;  4R6Y A;  1SD3 A;  1D3K A;  4U1O A;  4DXC A;  2THI A;  4NF6 B;  1USY H;  5H8F B;  3BFT A;  3SEY A;  4KFQ A;  3EQ1 A;  4BDM A;  1I6A A;  4XKN A;  1LB8 A;  1P1Q A;  4G77 A;  2OJT A;  3L6G A;  5CI5 A;  2QL3 A;  4PQJ A;  5TP9 B;  4ELP A;  3MBP A;  3MVY A;  1N7W A;  4EXL A;  2B3F A;  1UIU A;  2I4C A;  2HEU A;  3KOS A;  2AIX A;  3UP9 A;  3K1M A;  4X9T A;  4G4P A;  3GLB A;  4IY6 A;  1DOT A;  1B32 A;  4MLV A;  2F8D A;  4I9D A;  2A5S A;  2O7U A;  3FXQ A;  1B05 A;  1LCF A;  5FTI A;  4F1U A;  3W9W A;  3KN7 A;  2IEE A;  3G7W A;  3KSX A;  2QS4 A;  1Q35 A;  4U22 A;  3T9V A;  3TEL A;  4ELO A;  3RGY A;  1MQH A;  2FA7 A;  3S9L C;  3IO6 A;  4R6K A;  2QRY A;  1B9J A;  2XX8 A;  3MPL A;  3OOA A;  3A3C A;  3OXN A;  3PUZ E;  4PFU A;  3U8Q A;  1Y4T A;  3EHU A;  2O1L A;  1OIB A;  4KQP A;  1BLF A;  1NNF A;  1P1U A;  3H4Z A;  2DE2 A;  4IO7 A;  4R74 A;  5FHO A;  3VLW A;  1A7L A;  1MH3 A;  1PB7 A;  3OO9 A;  4H8J A;  4KR5 A;  3V89 B;  1FTL A;  2H9B A;  4NTL A;  2PT1 A;  4PFY A;  2DXR A;  4LON B;  1TFA A;  2DP8 A;  4KYE A;  4R73 A;  2I4B A;  4G8N A;  3B7D A;  3TPA A;  4HCW A;  4OFL A;  4ZEK A;  2H99 A;  3GBB A;  3K0V A;  5CMK A;  3C36 A;  1ZIU A;  3MVX A;  1B2H A;  2PYY A;  5CMB A;  4U4S A;  3KFM A;  4N13 A;  3PPP A;  5EHS A;  4XIG Q;  4NF5 A;  2XXH A;  2HFB A;  3K4U A;  4IGT A;  3PUV E;  4H6D A;  3T9X B;  1WDN A;  3MP6 A;  1PEB A;  2Y7R A;  5CBR A;  1BTJ A;  2QMW A;  2DXY A;  3MP8 A;  4HW8 A;  5LOM A;  3TTM A;  1NL5 A;  1DPP A;  3KBR A;  4LZ5 A;  1DTZ A;  3G3K A;  1MPB A;  4G8H A;  4HCY A;  2F6G A;  3PPR A;  3UIF A;  5CM6 A;  3TCG A;  3DP6 A;  3DM0 A;  3FZV A;  4EQB A;  1XT8 A;  1D4N A;  3U92 A;  5DEX B;  2VD2 A;  2X26 A;  1EH3 A;  2D3I A;  4FEB A;  1IEJ A;  2YJP A;  3MQ9 A;  4R75 A;  1JQF A;  2QS3 A;  2XD3 A;  4PFT A;  4AQ4 A;  2D21 A;  2I49 A;  4IO4 A;  1BKA A;  4ZE9 A;  4GQO A;  4OEN A;  4QSE A;  1R6Z A;  5K2X A;  3VDF A;  4NF5 B;  3OMB A;  3BBR A;  1CE2 A;  4U1Z A;  3TUS A;  3OEN A;  5ITO A;  1EU8 A;  3L6H A;  3O29 A;  3GXA A;  1B7Z A;  2I48 A;  1MY0 A;  1LLS A;  2VD3 A;  2V3U A;  1QUK A;  2DQV A;  3HST A;  3IJX B;  1MG1 A;  2ONR A;  3B6W A;  3KG2 A;  4OYV A;  3F11 A;  5I2N B;  1B52 A;  5AA4 A;  1EZP A;  5BUU A;  3T96 B;  4IY5 A;  1LFI A;  4LUB A;  2B65 A;  1UTB B;  3B6Q A;  1MPD A;  4F18 A;  4G8M A;  2QPQ A;  1MPC A;  1GVC A;  4PET A;  4RY1 A;  4C1U A;  4JWY A;  1GTK A;  1PB9 A;  3FJG A;  1OQH A;  4IO3 A;  4OZ9 A;  4U21 A;  3O97 A;  4P0G A;  1Q1K A;  3KJT A;  3TTL A;  1XC1 A;  2PT2 A;  3IB0 A;  1FW0 A;  3FVO A;  4I62 A;  2I58 A;  3E4R A;  3K01 A;  4FEC A;  4QF9 A;  3KN8 A;  3KJ7 A;  1TWY A;  1N7X A;  2DWA A;  2HQ0 A;  1Y9U A;  4YU0 A;  5CMM A;  2V25 A;  1H76 A;  4DIG A;  1JVX A;  1NMU A;  3PD8 A;  1M5F A;  1SI0 A;  2QS1 A;  3E9X A;  3N6T A;  4OEU A;  3S4U A;  4YMB A;  1DMB A;  1S9T A;  3RLF E;  5KDT A;  4QRZ A;  1P1N A;  2ZYM A;  2KLF A;  3QUF A;  3M3L A;  5TP9 A;  3TQL A;  3K1P A;  1UTH A;  1UTB A;  2VP1 A;  4IO6 A;  1JEV A;  4RK2 A;  3TDJ A;  4TQU Q;  5H8F A;  5I59 A;  3N6U A;  4MBP A;  2GHA A;  5H8S A;  1H3D A;  3MVZ A;  2GRV A;  5M2V A;  1AMF A;  3MC2 A;  3H06 B;  4Q5T A;  3HCQ A;  4I8C A;  1NKX A;  3CR9 A;  4KCD A;  2ZMB A;  4Q30 B;  1BP5 A;  4RA1 A;  4DXU A;  2ABH A;  4JBZ A;  2PBW A;  3IR1 A;  5HPQ A;  2R71 A;  3LBS A;  1VFD A;  1N0T A;  3VVE A;  4RPO A;  3OEK A;  1HSE A;  3G3F A;  4WKM A;  1FQA A;  1B40 A;  3PUY E;  4LZ7 A;  5H8Q A;  3TCF A;  1MQJ A;  4IO5 A;  5KZT A;  1AIV A;  1SI1 A;  1B7U A;  2Z8D A;  2RC8 A;  3VLU A;  1MXX A;  2V3Q A;  1LBB A;  2XX7 A;  3FXU A;  2XXP A;  3Q28 A;  4THI A;  3H6T A;  4ONY A;  3ONM A;  5H8H A;  3RY3 A;  3CIJ A;  4XKQ A;  4F39 A;  3MW0 A;  1US4 A;  4IGR A;  3S2V A;  4ZEI A;  4E0X A;  3W9V A;  5HBC A;  5I56 B;  4GVO A;  2GFE A;  1MXY A;  2E0S A;  1NNK A;  1B7H A;  3O6H A;  3FGS A;  2GH9 A;  3MPK A;  4LQ2 A;  3LUY A;  4NF6 A;  3TEP A;  1Y3N A;  3CFX A;  3I5O A;  2G29 A;  3KOT A;  5B70 A;  1Z7M E;  4MLQ A;  3K02 A;  2DS9 A;  3P7I A;  1PBQ A;  1EZO A;  3T66 A;  3MZ1 A;  3IOW A;  2FYI A;  3K6X A;  4F31 B;  1O64 A;  1MXW A;  1MXV A;  1OLC A;  1ZMG A;  4R9F A;  1ANF A;  3QUJ A;  1N84 A;  4NF8 A;  4G68 C;  4XKP A;  2QMX A;  3SEV A;  3IOR A;  2I6E A;  2UVJ A;  3CG3 A;  3FAT A;  4JXI A;  4TOZ A;  3CFZ A;  4C0R A;  3OD7 A;  3VVD A;  3A09 A;  4NF8 B;  3E13 X;  4R72 A;  4ZZA A;  4GXS B;  4Z0I A;  2W7Y A;  1IIT A;  1IXC A;  1WOD A;  4H65 A;  1LFG A;  3EF7 A;  2PVU A;  3O9P A;  4EUO A;  3U94 A;  2IA4 A;  3PPO A;  4QHQ A;  1JVY A;  4ZEC A;  5JK4 A;  1ZU0 A;  4U23 A;  3H6U A;  1MQD A;  3I6V A;  3R7X A;  1NNP A;  3TAJ A;  5I58 B;  5DVJ A;  2F36 A;  4BDO A;  4ZE8 A;  5DEX A;  1II5 A;  4GD5 A;  5A5X B;  1A54 A;  3K00 A;  4UAC A;  1B0H A;  2DWH A;  2P2A A;  1H45 A;  2XXI A;  4PFW A;  3QK6 A;  1P99 A;  4O3C A;  1MQG A;  1QUJ A;  1Y3Q A;  4HTG A;  2UVI A;  3Q29 A;  5L9O A;  1MY1 A;  3PUX E;  4LZ8 A;  4R2F A;  1CB6 A;  2ZYK A;  4NED A;  4QFP A;  1YAE A;  3C9H A;  1GR2 A;  1QUL A;  3DP8 A;  1LAF E;  4H1X A;  2RCA A;  4YZZ A;  3FVN A;  3B6T A;  4TLL B;  1OVT A;  1POY 1;  1SYH A;  3MJN A;  5CBS A;  4POX A;  5K2Y A;  2Y7W A;  3O2A A;  5FHM A;  1MY3 A;  3SEU A;  3W15 C;  3C35 A;  1B3G A;  4WED A;  4EXK A;  5ICQ A;  4DCX A;  2F34 A;  3IL1 B;  4GL8 A;  4RPN A;  3IAZ A;  3LSW A;  4X1D A;  4YAH X;  4YKJ A;  3ZKL A;  3RTW B;  4F3P A;  3LR1 A;  3S9M C;  4Z7E A;  5H8N A;  3IOV A;  3H6V A;  2OBG A;  3QYT A;  4ND9 A;  3IX1 A;  5I56 A;  1ZBM A;  5AA2 A;  3N5L A;  1PC3 A;  5JTY A;  2E1S A;  3D4C A;  3EHT A;  3FIR A;  3HHG A;  2B3B A;  4FIM A;  4JSO A;  5H8H B;  2OK2 A;  2V3T A;  1N76 A;  3UA8 A;  4ZED A;  3IO4 A;  4F29 A;  1XS5 A;  2HAU A;  1FQE A;  2XD2 A;  3IOU A;  5EHM A;  2X7P A;  4YKI A;  1Y4C A;  4EDP A;  4PE5 B;  2AYS A;  3OEM A;  4G2Z A;  1F9B A;  1ATG A;  1N3W A;  5IKB A;  4ECF A;  3H3G A;  3CG1 A;  2H98 A;  1XVX A;  2XXT A;  4L17 A;  1D9Y A;  1OLA A;  4GLI A;  4RNS A;  4WEP A;  3FJM A;  3K2D A;  2Y7I A;  2XXR A;  4BDR A;  3FD3 A;  2DWJ A;  3ODB A;  4E0W A;  1QKB A;  3KN3 A;  4OQO A;  3M3F A;  4H67 A;  4DE8 A;  4ELQ A;  4QSC A;  5JTY B;  4F3B A;  3PU5 A;  1A8F A;  3C31 A;  1B3H A;  3TCH A;  4AB6 A;  1HSL A;  4BLA A;  1ELJ A;  4XTC Q;  1FQB A;  1LAH E;  4MF3 A;  4NMY A;  5AA4 B;  2NOO A;  1JW4 A;  1M5B A;  2A5T B;  2I3W A;  3QAX A;  1B5J A;  4KYS A;  3SKP A;  3U1O A;  5CMC A;  5I59 B;  5I2N A;  5ICT A;  3CVG A;  4UA8 A;  4JB7 A;  1YPN A;  4N6P A;  1AL3 A;  2XXX A;  3Q27 A;  2OLB A;  4F19 A;  1AOV A;  1IXG A;  3HHF A;  3MUQ A;  1Z7N E;  2I0C A;  3H03 A;  4LVQ A;  5B7D A;  3VV5 A;  4OES A;  5KDT B;  2Y84 A;  1FCK A;  2HAV A;  5L8D A;  3N26 A;  2OZZ A;  1IZ1 A;  1XVY A;  1Y1Z A;  1SW4 A;  3IOT A;  4NF4 A;  3TTR A;  1TT1 A;  3CRB A;  3USD A;  3WAE A;  4GRK A;  1A99 A;  1A8E A;  2HZL A;  3KSJ A;  1RKM A;  2VOZ A;  3FV2 A;  3IB1 A;  4P11 A;  5FHN A;  1R9Q A;  2Y7P A;  4BDN A;  1I69 A;  2QJE A;  3C34 A;  3ECR A;  3QSL A;  4JWO A;  4WXJ A;  1FTO A;  4PP0 A;  1B46 A;  1A40 A;  1RYO A;  1JW5 A;  4FAJ A;  1QJM A;  2PMS A;  1MDQ A;  4R2B A;  1GV8 A;  3S9N C;  5IAI A;  1YCJ A;  3T22 A;  5AA3 A;  3G3J A;  1I6B A;  1SDX A;  5TPA A;  3MP1 A;  3O66 A;  5KCJ A;  5ISU A;  4U2R A;  3JZJ A;  1AH5 A;  4QFO A;  2I3V A;  4OTE A;  1I6Q A;  5A5X A;  3MWB A;  3MZB A;  4GIZ A;  3FAS A;  2REG A;  3G3H A;  3FXR A;  2DE4 A;  4FE8 A;  2F97 A;  1MY4 A;  2RC9 A;  4LAT A;  1TXF A;  4Q0C A;  4ZS9 A;  3UGW A;  1MS7 A;  3RPW A;  3G3G A;  1HSJ A;  1BIY A;  1FQC A;  4OFO A;  4OER A;  1EZ9 A;  1SW2 A;  1QKA A;  2YPN A;  3H6W A;  5AA1 A;  4KCC A;  1H43 A;  3EPE A;  3IJO B;  3DEL B;  4M4G A;  4KYD A;  2Q2C A;  2UXA A;  3BKI B;  4RYA A;  3HN0 A;  4QSD A;  1M5D A;  2H4I A;  3O6I A;  3PPQ A;  1XOC A;  2VGQ A;  1GGG A;  2DYX A;  2ZNU A;  4N07 A;  4X1B A;  1UQW A;  1SW5 A;  3K6U A;  2WKY A;  1MXZ A;  4OFJ A;  1RYX A;  3T9U A;  4OHN A;  2HZK A;  2CMO A;  5DT6 A;  1PBP A;  3TKD A;  3ILT B;  1MM6 A;  1MY2 A;  2DWI A;  2HCA A;  5DVI A;  4EF1 A;  4H8I A;  5CRY A;  2OCU A;  4XXU A;  3PMV A;  4GXA A;  1VE4 A;  3SEW A;  1LCT A;  2NVU B;  5ITP A;  1IQ7 A;  2CZL A;  1J1N A;  1FTM A;  1Y3P A;  1B3E A;  1IUD A;  4U4X A;  3TTN A;  3VFJ A;  3Q26 A;  1IIW A;  4O3B A;  4MFI A;  1M5E A;  3OSQ A;  4KHZ E;  3TYH A;  2O51 A;  2ZNS A;  4ZDM A;  4OMB A;  4YB5 A;  1FQF A;  1P1W A;  1SYI A;  2G93 A;  2NUV A;  3FVG A;  3HPI A;  2XHD A;  3JYR A;  5DYH A;  3RQT A;  4FAT A;  1B3F A;  3C32 A;  3O28 A;  4IO2 A;  1P1O A;  3TZA A;  4EQ7 A;  4F3G A;  1MRP A;  2XXU A;  1B5I A;  2REJ A;  4EQ9 A;  1NH7 A;  5I84 A;  3RT8 A;  3C4M A;  3RUM A;  1QVS A;  5JEI A;  4XKR A;  4NF4 B;  3ILU B;  1M5C A;  2F7C A;  3RN8 A;  4F1V A;  4RK9 A;  4G68 B;  4BDQ A;  3TQW A;  2A5T A;  3HO7 A;  1SBP A;  5AE4 A;  1SVX B;  2H5Y A;  5ELV A;  4DZ1 A;  3VXC A; 
#chains in the Genus database with same CATH topology
 3UK4 A;  2XX9 A;  2Z22 A;  2B4L A;  4DDD A;  1PB8 A;  5L9S A;  2F7B A;  5AA2 B;  2UVG A;  4M1V A;  2O69 A;  2FBP A;  1B1X A;  1G0I A;  4MX6 A;  1B4Z A;  2DVZ A;  2P1S A;  1URD A;  4KI0 E;  3M3K A;  1UIV A;  5TU0 A;  3SEX A;  4P3L A;  1NUY A;  2ALU A;  3UN6 A;  1ZJL A;  3OO6 A;  3QXM A;  4N17 A;  2P3V A;  3CSB A;  2WEF A;  3THI A;  2CEY A;  1O7T A;  1OVB A;  3VE1 B;  5F7V A;  3M8U A;  2FNC A;  3O6G A;  4MJO A;  3UOR A;  1NUW A;  4RXL A;  2Q2A A;  3C33 A;  3SER A;  5BWJ A;  3R6U A;  3OO8 A;  2M8C A;  1S7Y A;  1OQG A;  4H5F A;  3LSX A;  2NWJ A;  2O68 A;  2ONS A;  3HV1 A;  1JNF A;  3MZ9 A;  5KCJ B;  3D4G A;  1DPE A;  3FUZ A;  3V5A A;  2F78 A;  4JVD A;  4GOT A;  1MH4 A;  3RNN A;  4H0W A;  5IZ3 A;  1URG A;  4R6H A;  2RC7 A;  2JJK A;  4GF8 A;  3TOD A;  2O84 X;  4MCO A;  2O7I A;  3A3U A;  4GWX A;  4QFL A;  1IXH A;  2PCR A;  3CFL A;  3N94 A;  3T93 B;  2F6P A;  2ESN A;  5I7I A;  3SET A;  4K3F A;  3ZKK A;  3I3V A;  2XXY A;  4HE0 A;  1LB9 A;  4R6Y A;  4U1O A;  4NF6 B;  3SEY A;  1I6A A;  1LB8 A;  2QL3 A;  1LBW A;  4ELP A;  2XWO A;  4EXL A;  3KOS A;  3K1M A;  1DOT A;  3CHG A;  2VPO A;  3FXQ A;  1B05 A;  4F1U A;  1IMC A;  2QS4 A;  5IZZ A;  1MQH A;  2FA7 A;  4R6K A;  3MPL A;  3OOA A;  3A3C A;  3PUZ E;  3U8Q A;  3EHU A;  1P1U A;  1SPI A;  2DE2 A;  4R74 A;  1A7L A;  1MH3 A;  2XA5 A;  1FTL A;  3B8B A;  4NTL A;  1TFA A;  3TPA A;  4HCW A;  2H99 A;  3C36 A;  3MVX A;  1CNQ A;  4IGT A;  4NX1 A;  3KBR A;  3KC1 A;  4G8H A;  3DP6 A;  4MNP A;  4EQB A;  3U92 A;  2VD2 A;  1IEJ A;  2YJP A;  2I49 A;  3B50 A;  4I40 A;  2CEX A;  5K2X A;  4NF5 B;  3BBR A;  1CE2 A;  3O29 A;  2VD3 A;  4OYV A;  1MG1 A;  2ONR A;  3B6W A;  1UTB B;  1FSA A;  4G8M A;  1MPC A;  4C1U A;  2FHY A;  4IO3 A;  4P0G A;  1IMF A;  1Q1K A;  2PT2 A;  4QF9 A;  3E4R A;  3KN8 A;  1NMU A;  1DMB A;  4QRZ A;  1P1N A;  5F24 A;  2KLF A;  3M3L A;  3K1P A;  2VP1 A;  4MBP A;  3MVZ A;  5M2V A;  1AMF A;  3MC2 A;  2FIE A;  3HCQ A;  4KCD A;  3CR9 A;  4Q30 B;  4PAI A;  4JBZ A;  3IR1 A;  1D9Q A;  2QVU A;  3OEK A;  1HSE A;  1B40 A;  4OVS A;  4IO5 A;  4XFE A;  1LBB A;  2XXP A;  4THI A;  3H6T A;  3ONM A;  4XKQ A;  4IGR A;  4ZEI A;  3W9V A;  4GVO A;  2GFE A;  2E0S A;  3LUY A;  1KA1 A;  1Y3N A;  3KOT A;  5IM2 A;  2FYI A;  2HXR A;  4R9F A;  1OLC A;  1ZMG A;  3QUJ A;  1N84 A;  3FBP A;  3SEV A;  2UVJ A;  3CG3 A;  4JXI A;  3CFZ A;  4C0R A;  4NF8 B;  4ZZA A;  2QFL A;  3PPO A;  5DVJ A;  4ZE8 A;  1B0H A;  1H45 A;  2XXI A;  1P99 A;  4HTG A;  3Q29 A;  5L9O A;  3PUX E;  4LZ8 A;  4R2F A;  4MNC A;  4NED A;  1YAE A;  2L5V A;  4I3Y A;  4PFB A;  4TLL B;  1OVT A;  1POY 1;  3MJN A;  4GWZ A;  3O2A A;  1B3G A;  5ICQ A;  2F34 A;  4GL8 A;  4YAH X;  5H8N A;  3E78 A;  3QYT A;  3IX1 A;  1ZBM A;  5AA2 A;  3N5L A;  5JTY A;  2E1S A;  3HHG A;  2B3B A;  2V3T A;  2P3N A;  3IO4 A;  3IOU A;  4EDP A;  1F9B A;  1N3W A;  5IKB A;  4L17 A;  4MIJ A;  2XXR A;  2DWJ A;  4ELQ A;  4OQO A;  4QSC A;  3PU5 A;  1A8F A;  1B3H A;  4BLA A;  4MF3 A;  5AA4 B;  1JW4 A;  2A5T B;  1B5J A;  5CMC A;  4UA8 A;  4JB7 A;  1YPN A;  4XF5 A;  3Q27 A;  2OLB A;  1AOV A;  1Z7N E;  3VV5 A;  2HAV A;  1XVY A;  4AS4 A;  1Y1Z A;  3USD A;  3CRB A;  3WAE A;  1A8E A;  2HZL A;  2VOZ A;  3FV2 A;  5FHN A;  2Y7P A;  4BDN A;  1I69 A;  3ECR A;  1B46 A;  2KQZ A;  4AS5 A;  2PMS A;  4R2B A;  5IAI A;  5TPA A;  1SDX A;  5ISU A;  1AH5 A;  4OTE A;  1I6Q A;  3MZB A;  4GIZ A;  3G3H A;  2DE4 A;  2F97 A;  1MY4 A;  4Q0C A;  3RPW A;  1BIY A;  4OFO A;  1NV6 A;  4QSD A;  5EQ8 A;  3O6I A;  1GGG A;  2DDK A;  2DYX A;  1UQW A;  1MXZ A;  1G0H A;  2CMO A;  1MM6 A;  4EF1 A;  2OCU A;  3PMV A;  1FTM A;  3E79 A;  4O3B A;  1M5E A;  4KHZ E;  4YB5 A;  2FVZ A;  1P1W A;  2NUV A;  3FVG A;  3JYR A;  3RQT A;  3C32 A;  1MRP A;  2XXU A;  2REJ A;  2WYK A;  5LTC A;  3RT8 A;  5I5P A;  4G68 B;  4GX6 A;  3VXC A;  1B0L A;  3KEI A;  5EQA A;  2VHA A;  4YIC A;  2XXV A;  3Q25 A;  4F2Q A;  5I2K A;  4AB5 A;  1USY E;  4RJZ A;  2ZNT A;  1LFH A;  1ZKB A;  3MVW A;  3V8X B;  1OMP A;  2YLN A;  3K6V A;  3PPN A;  2B4M A;  4PBH A;  2UVH A;  1EYJ A;  5IZ3 B;  1O63 A;  4P9K A;  2QS2 A;  2F35 A;  2RIN A;  4N4U A;  1B4H A;  1LST A;  1SQY A;  4ZEB A;  3IK6 B;  1D9V A;  4ZZE A;  1ZLQ A;  2BJJ X;  2WX9 A;  1FBE A;  1LAG E;  5F1Q A;  3E3K A;  2CZI A;  2GHB A;  4ESX A;  3PV0 E;  4HS7 A;  5H8N B;  3FVK A;  5EQ7 A;  3MAM A;  2AL5 A;  4P56 A;  1US5 A;  2NXO A;  4P1L A;  1NH8 A;  1MM7 A;  2QSX A;  4OWD A;  3JV9 A;  2OWT A;  3PGF A;  4O8M A;  2Q8J A;  4C1T A;  5DVF A;  4ELR A;  4NG7 A;  4LA9 A;  3RYD A;  5I58 A;  1Y20 A;  2V84 A;  3GZG A;  4H46 A;  4LP2 B;  2ZXT A;  5ET7 A;  3WAF A;  1FTK A;  4GX4 A;  4GFR A;  4OVJ A;  3A29 A;  3KGC A;  3IFA A;  4GL0 A;  4DCY A;  3ISP A;  2PX1 A;  2RF1 A;  4PF6 A;  4F3S A;  3FV1 A;  3PMX A;  3T1B A;  4QFK A;  1YZ0 A;  4Q8R A;  1B58 A;  4R9G A;  1BK4 A;  3T9H B;  1H44 A;  2H25 A;  4TLM B;  3AXF A;  1VR5 A;  4F1Y A;  1TFD A;  4MEV A;  3EHS A;  4OEV A;  4FOR A;  1KWH A;  1FBG A;  1MQI A;  5L9M A;  4N15 A;  1LBX A;  2XXW A;  1SD3 A;  1D3K A;  2THI A;  3BFT A;  4G77 A;  1P1Q A;  5AA3 A;  3MBP A;  3MVY A;  1N7W A;  2B3F A;  2I4C A;  2HEU A;  3T0J A;  3UP9 A;  1AWB A;  2HPG A;  3GLB A;  2F8D A;  3W9W A;  3T9V A;  4PFU A;  1K9Y A;  1KA0 A;  4OVR A;  2O1L A;  1NNF A;  3H4Z A;  1PB7 A;  4H8J A;  2H9B A;  4PFY A;  2DXR A;  4KYE A;  1FPF A;  5CMK A;  2PFY A;  3GBB A;  5CMB A;  4U4S A;  3KFM A;  2R8T A;  2XXH A;  2Q8M A;  3K4U A;  4PE3 A;  1PEB A;  2Y7R A;  3MP8 A;  3TTM A;  1NL5 A;  4LZ5 A;  2F6G A;  3TCG A;  1D4N A;  2QS3 A;  2XD3 A;  4PFT A;  4ZE9 A;  2D21 A;  2ZZX A;  1BKA A;  4GQO A;  4HXV A;  4QSE A;  5FBP A;  5ET6 A;  4U1Z A;  3TUS A;  5ITO A;  3GXA A;  2I48 A;  1LLS A;  5EYH A;  3HST A;  1B52 A;  2CZH A;  1EZP A;  1LFI A;  3B6Q A;  4F18 A;  2QPQ A;  1GVC A;  4PDD A;  4PET A;  1GTK A;  2FIX A;  1OQH A;  3FJG A;  3MST A;  3KJT A;  1FPJ A;  3TTL A;  1XC1 A;  3IB0 A;  1FW0 A;  3FVO A;  2I58 A;  4YU0 A;  3KJ7 A;  1N7X A;  3KBZ A;  3PD8 A;  1M5F A;  4YMB A;  3RLF E;  5KDT A;  1JEV A;  5H8F A;  2GHA A;  5H8S A;  1H3D A;  2GRV A;  3H06 B;  4I8C A;  4NN3 A;  2R71 A;  4NHB A;  4MNI A;  3VVE A;  5H8Q A;  1FQA A;  4LZ7 A;  3TCF A;  2Z8D A;  1MXX A;  3RY3 A;  3CIJ A;  4F39 A;  3MW0 A;  5I56 B;  1NNK A;  3O6H A;  4LQ2 A;  4GBV A;  1EZO A;  3T66 A;  3IOW A;  4F31 B;  1O64 A;  4NQ8 A;  1ANF A;  3FAT A;  4TOZ A;  1FJ6 A;  4R72 A;  2OX3 A;  1IIT A;  1WOD A;  3EF7 A;  4EUO A;  4OVQ A;  4ZEC A;  1JVY A;  5JK4 A;  1MQD A;  3R7X A;  1NNP A;  2F36 A;  1II5 A;  4GD5 A;  1A54 A;  2Y5K A;  3K00 A;  4UAC A;  2DWH A;  2P2A A;  1Y3Q A;  2UVI A;  1MY1 A;  1CB6 A;  2ZYK A;  4QFP A;  3C9H A;  1QUL A;  4PFI A;  1LAF E;  4YZZ A;  2RCA A;  1SYH A;  4MAG A;  5K2Y A;  3SEU A;  3W15 C;  3C35 A;  4YKJ A;  4F3P A;  3IAZ A;  3S9M C;  3QMF A;  3RTW B;  3LR1 A;  2OBG A;  4ND9 A;  5I56 A;  3D4C A;  3UA8 A;  4JSO A;  2XD2 A;  2X7P A;  4YKI A;  4PE5 B;  3OEM A;  4ECF A;  3H3G A;  4QBA A;  3CG1 A;  1XVX A;  4GLI A;  4RNS A;  3FJM A;  4BDR A;  4H45 A;  4DE8 A;  5CM6 A;  4F3B A;  1FPK A;  4P1E A;  4AB6 A;  4N91 A;  1ELJ A;  1DCU A;  5I2N A;  5ICT A;  4N6P A;  4GWS A;  1IXG A;  5B7D A;  4OES A;  1NV0 A;  3N26 A;  1IZ1 A;  4NF4 A;  1TT1 A;  4GRK A;  4P11 A;  1RKM A;  2HHM A;  1R9Q A;  4N6K A;  4PP0 A;  1JW5 A;  1MDQ A;  4PTK A;  1I6B A;  3MP1 A;  4FE8 A;  3FXR A;  4ZS9 A;  3RPL B;  3G3G A;  1FQC A;  4OER A;  1EZ9 A;  1FBF A;  5AA1 A;  1H43 A;  3IJO B;  3RPL A;  2UXA A;  2H4I A;  4N07 A;  1SW5 A;  2WKY A;  3T9U A;  2HZK A;  5DT6 A;  1MY2 A;  2HCA A;  4XXU A;  4GXA A;  1VE4 A;  3SEW A;  1LCT A;  1IQ7 A;  1J1N A;  1Y3P A;  1IUD A;  1QGX A;  3OSQ A;  4HE1 A;  2ZNS A;  4ZDM A;  1FQF A;  1SYI A;  4FAT A;  1B3F A;  4IO2 A;  1P1O A;  4F3G A;  1NH7 A;  1FPB A;  3BIH A;  3FXB A;  1M5C A;  2F7C A;  4RK9 A;  3HO7 A;  1SVX B;  5ELV A;  3TFL A;  3ZS6 A;  4OA4 A;  2X7Q A;  4YB6 A;  4ESW A;  2I0B A;  4IB2 A;  2O1M A;  5ET5 A;  2F5X A;  4G68 A;  1B6H A;  3GBA A;  3IB2 A;  4F2O A;  3PUW E;  4GBW A;  5T3J A;  1UTH B;  3U72 A;  3KZG A;  1WVJ A;  1LBC A;  2Z8F A;  4X48 A;  3OSR A;  4NE4 A;  5FTH A;  1MXU A;  2ZYN A;  4DCX A;  5J1D A;  2Q9T A;  1POT A;  2ZYO A;  2ONK E;  2HXW A;  2R9J A;  2O6A A;  4NWC A;  1VSO A;  1QUI A;  3PMW A;  4O94 A;  4LQ5 A;  2F3B A;  3TTK A;  1VFE A;  1XI6 A;  3SDF A;  3U93 A;  4YB7 A;  2RKM A;  3LSL A;  1N04 A;  2D5W A;  4OXV A;  3G3I A;  3MYU A;  4O3A A;  5AA2 D;  3LV0 A;  1N3X A;  5TPA B;  2DOJ A;  2OWZ A;  1PDA A;  2WYP A;  2UYE A;  2DE3 A;  4BDL A;  2XWK A;  4JSD A;  2GQ1 A;  2UYF A;  5CC2 A;  5LDZ A;  3OO7 A;  5H8Q B;  2QVR A;  1YTV A;  4YKK A;  1DSN A;  3VVF A;  4PAK A;  3HFU A;  4P0I A;  1LGB C;  3BFU A;  3RT6 B;  3RTF B;  2DVC A;  4DLD A;  1IMD A;  5EQ9 A;  3KC0 A;  4PGN A;  4JDF A;  3ROJ A;  2ANJ A;  1IXI A;  1S50 A;  1USY H;  3EQ1 A;  4PGP A;  4BDM A;  5CI5 A;  5TP9 B;  2OJT A;  3L6G A;  4PQJ A;  1UIU A;  2AIX A;  4X9T A;  4G4P A;  4MLV A;  1B32 A;  4OVT A;  2A5S A;  2O7U A;  5FTI A;  3KN7 A;  3LUZ A;  3G7W A;  3KSX A;  3TEL A;  1Q35 A;  4U22 A;  3RGY A;  2QRY A;  3OXN A;  1Y4T A;  4P47 A;  1OIB A;  4IO7 A;  1K9Z A;  3VLW A;  3OO9 A;  2VPN A;  2CZK A;  2PT1 A;  4LON B;  2DP8 A;  4R73 A;  3D1R A;  4G8N A;  3B7D A;  4ZEK A;  1B2H A;  1IMA A;  4N13 A;  3PPP A;  5EHS A;  4NF5 A;  3PUV E;  4H6D A;  5CBR A;  2QMW A;  2DXY A;  5LOM A;  1DTZ A;  3G3K A;  4HCY A;  3PPR A;  3DM0 A;  1FBD A;  1XT8 A;  5DEX B;  2X26 A;  4FEB A;  3MQ9 A;  1JQF A;  4QXD A;  4AQ4 A;  4IO4 A;  2ZZV A;  4OEN A;  1R6Z A;  3VDF A;  3OMB A;  1RDZ A;  1EU8 A;  3L6H A;  1LEV A;  1MY0 A;  4N81 A;  2V3U A;  1QUK A;  3IJX B;  5I2N B;  3GYY A;  2MKZ A;  5BUU A;  4IY5 A;  2B65 A;  1MPD A;  4JWY A;  5IZ1 A;  4DI3 D;  3O97 A;  4I62 A;  4FEC A;  3K01 A;  1TWY A;  3EKI A;  1FPI A;  1Y9U A;  5CMM A;  4DIG A;  1JVX A;  3S4U A;  3N6T A;  2QS1 A;  4GWW A;  2ZYM A;  4N6D A;  1UTH A;  4TQU Q;  1FRP A;  4PBQ A;  1NKX A;  4RA1 A;  4DXU A;  1BP5 A;  2ABH A;  2PBW A;  5HPQ A;  3LBS A;  1N0T A;  4WKM A;  3PUY E;  5I3S A;  1MQJ A;  5KZT A;  2XWI A;  4X04 A;  1SI1 A;  3FXU A;  3Q28 A;  4ONY A;  4E0X A;  1B7H A;  3FGS A;  3MPK A;  4JVI A;  3CFX A;  1RDX A;  2G29 A;  1LBY A;  1EYI A;  3K02 A;  1Q9D A;  2DS9 A;  3P7I A;  1NUX A;  3K6X A;  1MXW A;  1MXV A;  4GX3 A;  4NF8 A;  4G68 C;  2QMX A;  3OD7 A;  1YYZ A;  3E13 X;  4GXS B;  4H65 A;  3O9P A;  2PVU A;  3U94 A;  2IA4 A;  4QHQ A;  1ZU0 A;  3I6V A;  1NV1 A;  4MMP A;  1NV2 A;  1MQG A;  1QUJ A;  4DI4 B;  1GR2 A;  3DP8 A;  4H1X A;  5EYG A;  3ZKL A;  4RPN A;  3LSW A;  4X1D A;  4Z7E A;  3H6V A;  3EHT A;  3FIR A;  4FIM A;  5H8H B;  2OK2 A;  1N76 A;  4ZED A;  2HAU A;  1FQE A;  5EHM A;  1Y4C A;  2AYS A;  4O7I A;  1ATG A;  1D9Y A;  1OLA A;  3FD3 A;  4E0W A;  1QKB A;  4UAB A;  4H67 A;  5JTY B;  3TCH A;  3C31 A;  1DBZ A;  1FQB A;  1LAH E;  4NMY A;  2NOO A;  1M5B A;  2I3W A;  5I59 B;  1AL3 A;  3HHF A;  3H03 A;  5KDT B;  2Y84 A;  4PDH A;  4MHF A;  3TTR A;  1A99 A;  1FBH A;  4JWO A;  3QSL A;  5J16 A;  1A40 A;  1RYO A;  1QJM A;  5DW8 A;  3T22 A;  5KCJ A;  3JZJ A;  4QFO A;  2I3V A;  1NI9 A;  2VT5 A;  3FAS A;  2REG A;  4LAT A;  2RC9 A;  3UGW A;  1TXF A;  4N8G A;  1HSJ A;  3H6W A;  1QKA A;  2YPN A;  1IME A;  4KCC A;  3EPE A;  2Q2C A;  3SZP A;  4RYA A;  3HN0 A;  1M5D A;  3PPQ A;  2ZNU A;  3K6U A;  1RYX A;  4OHN A;  3TKD A;  2DWI A;  4H8I A;  5CRY A;  2CZL A;  1B3E A;  3Q26 A;  3TYH A;  2O51 A;  4OMB A;  5ESY A;  2G93 A;  5I59 A;  2XHD A;  5DYH A;  3TZA A;  4EQ7 A;  1B5I A;  2F3D A;  1NV5 A;  4N8Y A;  3C4M A;  1QVS A;  4NF4 B;  3ILU B;  4BDQ A;  3TQW A;  2A5T A;  5AE4 A;  3IFC A;  2H5Y A;  4DZ1 A;  1FBC A;  4F22 A;  1EYK A;  3R26 A;  1SW1 A;  3VLV A;  1B5H A;  1T0K A;  2AL4 A;  1FTJ A;  3OEL A;  1XHY A;  5EYF A;  2BJI A;  2LAO A;  2Q88 A;  2V93 A;  5HM4 B;  4O7M A;  2F7A A;  1FQD A;  3PD9 A;  3CI8 A;  3H7M A;  3LSF B;  4MH5 A;  1JW1 A;  4OET A;  1RDY A;  2DSF A;  2Q89 A;  1LAX A;  3K1N A;  4FED A;  1DTG A;  1Y1M A;  3TMG A;  3FJ7 A;  4ZEF A;  1B1H A;  3DLN A;  1R1N A;  3ZSF A;  1R9L A;  5DTB A;  2Z8E A;  4G61 A;  1A55 A;  4YMA A;  4P8B A;  3LC8 A;  3QIM A;  2XXK A;  5I57 A;  4JWX A;  3BIG A;  4OAN A;  2ZZW A;  4ISU A;  1JEU A;  4POW A;  3DP4 A;  3K6W A;  4PAF A;  2Q74 A;  4KXP A;  3S9E A;  1ZTY A;  1L5T A;  2OWS A;  1B3L A;  2R6G E;  3VXB A;  3NOH A;  1B51 A;  4PCD A;  5I57 B;  1URS A;  4NAP A;  4FJP A;  4YKP A;  4EF2 A;  2Z23 A;  4PFR A;  1JET A;  4NGU A;  1NFT A;  1MDP 1;  2Y7K A;  4NWD A;  2XWV A;  2P0S A;  1NNT A;  4GWO A;  2XXQ A;  5I2K B;  3CSG A;  4QFN A;  4KD5 A;  4H5G A;  1QW0 A;  3EN3 A;  4I1D A;  3V83 A;  4DXB A;  2RCB A;  1FTA A;  3SES A;  4KPT A;  5H8F B;  4KFQ A;  2QVV A;  4XKN A;  4DXC A;  4IY6 A;  4I9D A;  1LCF A;  2IEE A;  4ELO A;  3S9L C;  3IO6 A;  2XX8 A;  1B9J A;  4KQP A;  1BLF A;  4I3E A;  5FHO A;  3V89 B;  4KR5 A;  2I4B A;  4OFL A;  3K0V A;  1ZIU A;  5IGA A;  2PYY A;  4XIG Q;  2KR0 A;  2HFB A;  3T9X B;  1WDN A;  3MP6 A;  1BTJ A;  4HW8 A;  1DPP A;  1MPB A;  3UIF A;  3FZV A;  1EH3 A;  2D3I A;  4R75 A;  4PF8 A;  1NV3 A;  3OEN A;  1B7Z A;  4GWY A;  2DQV A;  3KG2 A;  3F11 A;  5AA4 A;  3T96 B;  4LUB A;  1IMB A;  3PTY A;  4RY1 A;  1PB9 A;  4U21 A;  4OZ9 A;  4NF6 A;  2DWA A;  1FPG A;  2HQ0 A;  2PFZ A;  1FPD A;  1H76 A;  2V25 A;  3TAJ A;  3E9X A;  1SI0 A;  4OEU A;  1FPE A;  1S9T A;  1NV7 A;  3QUF A;  3TQL A;  5TP9 A;  4XEQ A;  4RK2 A;  1UTB A;  4IO6 A;  3TDJ A;  3N6U A;  4Q5T A;  2ZMB A;  1VFD A;  4NF0 A;  4RPO A;  3G3F A;  1VDW A;  1AIV A;  1LBV A;  5ET8 A;  1B7U A;  1LBZ A;  1NV4 A;  2RC8 A;  3VLU A;  2V3Q A;  2XX7 A;  5H8H A;  1US4 A;  3S2V A;  5HBC A;  4PC9 A;  1MXY A;  3TEP A;  2GH9 A;  3I5O A;  5B70 A;  1Z7M E;  4MLQ A;  1PBQ A;  1FBP A;  3MZ1 A;  1KZ8 A;  2Y5L A;  4XKP A;  4LN5 A;  3IOR A;  2I6E A;  3VVD A;  3A09 A;  4Z0I A;  2W7Y A;  1IXC A;  1LFG A;  5A5L A;  4U23 A;  3H6U A;  5I58 B;  4BDO A;  5DEX A;  5A5X B;  4PFW A;  3QK6 A;  4O3C A;  2WBD A;  3FVN A;  3B6T A;  4JVC A;  5CBS A;  4POX A;  2Y7W A;  5FHM A;  1MY3 A;  4WED A;  4EXK A;  3IL1 B;  3IOV A;  1PC3 A;  4F29 A;  1XS5 A;  1FPL A;  4G2Z A;  2H98 A;  4WEP A;  2XXT A;  3K2D A;  2Y7I A;  3ODB A;  3KN3 A;  3M3F A;  1DK4 A;  1HSL A;  4XTC Q;  4KYS A;  3QAX A;  3SKP A;  3U1O A;  3CVG A;  2XXX A;  4F19 A;  3MUQ A;  2I0C A;  4LVQ A;  1FCK A;  5L8D A;  3U65 A;  2OZZ A;  1SW4 A;  3IOT A;  3KSJ A;  3IB1 A;  4GWU A;  2QJE A;  4WXJ A;  3C34 A;  1FTO A;  4FAJ A;  3S9N C;  1GV8 A;  1YCJ A;  3G3J A;  3O66 A;  4U2R A;  5A5X A;  3MWB A;  2V4C A;  1MS7 A;  4HE2 A;  1SW2 A;  4M4G A;  3DEL B;  4KYD A;  3BKI B;  1YXI A;  2WBB A;  1XOC A;  2VGQ A;  4X1B A;  4OFJ A;  1JP4 A;  1PBP A;  3ILT B;  5DVI A;  2NVU B;  5ITP A;  4U4X A;  3TTN A;  3VFJ A;  1IIW A;  4MFI A;  3HPI A;  3O28 A;  4FBP A;  4EQ9 A;  5I84 A;  3RUM A;  5JEI A;  4IR8 A;  4XKR A;  4X8R A;  3RN8 A;  1FJ9 A;  4F1V A;  1SBP A;  1INP A;  1NUZ A;  4OVP A; 
#chains in the Genus database with same CATH homology
 1B0L A;  3KEI A;  3TFL A;  3UK4 A;  4F22 A;  2VHA A;  2XX9 A;  3R26 A;  4YIC A;  3ZS6 A;  1SW1 A;  3VLV A;  2Z22 A;  2XXV A;  3Q25 A;  4F2Q A;  4DDD A;  5I2K A;  4AB5 A;  1USY E;  1B5H A;  1PB8 A;  1T0K A;  2AL4 A;  2X7Q A;  4RJZ A;  4YB6 A;  4ESW A;  1FTJ A;  5L9S A;  2F7B A;  5AA2 B;  2UVG A;  3OEL A;  2ZNT A;  2O69 A;  2I0B A;  4M1V A;  1LFH A;  1B1X A;  4IB2 A;  1XHY A;  5EYF A;  2O1M A;  2F5X A;  1B4Z A;  2LAO A;  4G68 A;  2DVZ A;  2P1S A;  1B6H A;  1ZKB A;  3GBA A;  2Q88 A;  2V93 A;  1URD A;  3IB2 A;  3MVW A;  3M3K A;  4KI0 E;  3V8X B;  5HM4 B;  4F2O A;  1OMP A;  2F7A A;  1UIV A;  3PUW E;  1FQD A;  2YLN A;  3PD9 A;  1UTH B;  5TU0 A;  3CI8 A;  3KZG A;  3K6V A;  3PPN A;  3H7M A;  3U72 A;  1WVJ A;  1LBC A;  2Z8F A;  3LSF B;  4MH5 A;  3SEX A;  1JW1 A;  3OSR A;  4NE4 A;  4OET A;  4X48 A;  5FTH A;  2DSF A;  2ALU A;  1MXU A;  1ZJL A;  2Q89 A;  2UVH A;  2ZYN A;  3UN6 A;  1O63 A;  1LAX A;  3OO6 A;  2QS2 A;  2F35 A;  2RIN A;  3K1N A;  3QXM A;  4FED A;  1B4H A;  1DTG A;  1LST A;  1SQY A;  1Y1M A;  3IK6 B;  4ZEB A;  5J1D A;  2Q9T A;  1D9V A;  1POT A;  3FJ7 A;  4ZZE A;  1ZLQ A;  3CSB A;  2BJJ X;  4ZEF A;  1B1H A;  3TMG A;  2ZYO A;  3DLN A;  2ONK E;  2HXW A;  2R9J A;  2O6A A;  1R1N A;  4NWC A;  3THI A;  1VSO A;  1LAG E;  1QUI A;  5F1Q A;  1O7T A;  3ZSF A;  1R9L A;  3E3K A;  2GHB A;  4ESX A;  3PV0 E;  4HS7 A;  2Z8E A;  3PMW A;  5DTB A;  1OVB A;  1A55 A;  3VE1 B;  5F7V A;  4YMA A;  3FVK A;  5H8N B;  4LQ5 A;  3LC8 A;  3M8U A;  3QIM A;  3TTK A;  1VFE A;  2FNC A;  3MAM A;  2AL5 A;  3SDF A;  3U93 A;  4YB7 A;  3O6G A;  2RKM A;  3LSL A;  5I57 A;  1N04 A;  4JWX A;  1US5 A;  2NXO A;  3UOR A;  1NH8 A;  1MM7 A;  2QSX A;  2Q2A A;  3C33 A;  4OWD A;  4RXL A;  3SER A;  5BWJ A;  4ISU A;  1JEU A;  3JV9 A;  3R6U A;  3OO8 A;  2OWT A;  2M8C A;  4POW A;  3PGF A;  1S7Y A;  3DP4 A;  2D5W A;  2Q8J A;  3K6W A;  4OXV A;  4C1T A;  5DVF A;  4ELR A;  3G3I A;  4LA9 A;  1OQG A;  1Y20 A;  2V84 A;  4H5F A;  5I58 A;  4O3A A;  3LSX A;  3GZG A;  4LP2 B;  2NWJ A;  5AA2 D;  3S9E A;  2O68 A;  1ZTY A;  2ONS A;  1L5T A;  1N3X A;  2ZXT A;  1JNF A;  3HV1 A;  3MZ9 A;  3WAF A;  5TPA B;  5KCJ B;  2OWS A;  1B3L A;  2R6G E;  2DOJ A;  3D4G A;  1FTK A;  1PDA A;  3VXB A;  1DPE A;  3FUZ A;  1B51 A;  2UYE A;  4GFR A;  4OVJ A;  2DE3 A;  3V5A A;  1URS A;  2F78 A;  5I57 B;  4BDL A;  4FJP A;  3KGC A;  4JSD A;  4GL0 A;  4YKP A;  4DCY A;  4EF2 A;  2Z23 A;  1MH4 A;  4GOT A;  2PX1 A;  1JET A;  3RNN A;  4H0W A;  2RF1 A;  1NFT A;  2UYF A;  1URG A;  4F3S A;  5CC2 A;  3FV1 A;  3PMX A;  1MDP 1;  4R6H A;  2RC7 A;  2Y7K A;  4NWD A;  3OO7 A;  4GF8 A;  5H8Q B;  3TOD A;  4QFK A;  2O84 X;  2P0S A;  2O7I A;  1YTV A;  3A3U A;  1NNT A;  4GWO A;  1B58 A;  4QFL A;  1IXH A;  4YKK A;  4Q8R A;  2XXQ A;  3CFL A;  3N94 A;  1DSN A;  4R9G A;  5I2K B;  3VVF A;  3CSG A;  3T93 B;  3T9H B;  1H44 A;  4QFN A;  4KD5 A;  2H25 A;  4H5G A;  3AXF A;  4TLM B;  4P0I A;  1VR5 A;  4F1Y A;  1QW0 A;  1TFD A;  1LGB C;  4OEV A;  3BFU A;  3EHS A;  2F6P A;  3RT6 B;  2ESN A;  3EN3 A;  4FOR A;  3RTF B;  3SET A;  2DVC A;  4K3F A;  1KWH A;  3ZKK A;  4I1D A;  4DLD A;  3V83 A;  3I3V A;  2XXY A;  4JDF A;  4DXB A;  1MQI A;  1LB9 A;  5L9M A;  2ANJ A;  2RCB A;  1IXI A;  1S50 A;  3SES A;  4KPT A;  2XXW A;  4R6Y A;  1SD3 A;  1D3K A;  4U1O A;  4DXC A;  2THI A;  4NF6 B;  1USY H;  5H8F B;  3BFT A;  3SEY A;  4KFQ A;  3EQ1 A;  4BDM A;  1I6A A;  4XKN A;  1LB8 A;  1P1Q A;  4G77 A;  2OJT A;  3L6G A;  5CI5 A;  2QL3 A;  4PQJ A;  5TP9 B;  4ELP A;  3MBP A;  3MVY A;  1N7W A;  4EXL A;  2B3F A;  1UIU A;  2I4C A;  2HEU A;  3KOS A;  2AIX A;  3UP9 A;  3K1M A;  4X9T A;  4G4P A;  3GLB A;  4IY6 A;  1DOT A;  1B32 A;  4MLV A;  2F8D A;  4I9D A;  2A5S A;  2O7U A;  3FXQ A;  1B05 A;  1LCF A;  5FTI A;  4F1U A;  3W9W A;  3KN7 A;  2IEE A;  3G7W A;  3KSX A;  2QS4 A;  1Q35 A;  4U22 A;  3T9V A;  3TEL A;  4ELO A;  3RGY A;  1MQH A;  2FA7 A;  3S9L C;  3IO6 A;  4R6K A;  2QRY A;  1B9J A;  2XX8 A;  3MPL A;  3OOA A;  3A3C A;  3OXN A;  3PUZ E;  4PFU A;  3U8Q A;  1Y4T A;  3EHU A;  2O1L A;  1OIB A;  4KQP A;  1BLF A;  1NNF A;  1P1U A;  3H4Z A;  2DE2 A;  4IO7 A;  4R74 A;  5FHO A;  3VLW A;  1A7L A;  1MH3 A;  1PB7 A;  3OO9 A;  4H8J A;  4KR5 A;  3V89 B;  1FTL A;  2H9B A;  4NTL A;  2PT1 A;  4PFY A;  2DXR A;  4LON B;  1TFA A;  2DP8 A;  4KYE A;  4R73 A;  2I4B A;  4G8N A;  3B7D A;  3TPA A;  4HCW A;  4OFL A;  4ZEK A;  2H99 A;  3GBB A;  3K0V A;  5CMK A;  3C36 A;  1ZIU A;  3MVX A;  1B2H A;  2PYY A;  5CMB A;  4U4S A;  3KFM A;  4N13 A;  3PPP A;  5EHS A;  4XIG Q;  4NF5 A;  2XXH A;  2HFB A;  3K4U A;  4IGT A;  3PUV E;  4H6D A;  3T9X B;  1WDN A;  3MP6 A;  1PEB A;  2Y7R A;  5CBR A;  1BTJ A;  2QMW A;  2DXY A;  3MP8 A;  4HW8 A;  5LOM A;  3TTM A;  1NL5 A;  1DPP A;  3KBR A;  4LZ5 A;  1DTZ A;  3G3K A;  1MPB A;  4G8H A;  4HCY A;  2F6G A;  3PPR A;  3UIF A;  5CM6 A;  3TCG A;  3DP6 A;  3DM0 A;  3FZV A;  4EQB A;  1XT8 A;  1D4N A;  3U92 A;  5DEX B;  2VD2 A;  2X26 A;  1EH3 A;  2D3I A;  4FEB A;  1IEJ A;  2YJP A;  3MQ9 A;  4R75 A;  1JQF A;  2QS3 A;  2XD3 A;  4PFT A;  4AQ4 A;  2D21 A;  2I49 A;  4IO4 A;  1BKA A;  4ZE9 A;  4GQO A;  4OEN A;  4QSE A;  1R6Z A;  5K2X A;  3VDF A;  4NF5 B;  3OMB A;  3BBR A;  1CE2 A;  4U1Z A;  3TUS A;  3OEN A;  5ITO A;  1EU8 A;  3L6H A;  3O29 A;  3GXA A;  1B7Z A;  2I48 A;  1MY0 A;  1LLS A;  2VD3 A;  2V3U A;  1QUK A;  2DQV A;  3HST A;  3IJX B;  1MG1 A;  2ONR A;  3B6W A;  3KG2 A;  4OYV A;  3F11 A;  5I2N B;  1B52 A;  5AA4 A;  1EZP A;  5BUU A;  3T96 B;  4IY5 A;  1LFI A;  4LUB A;  2B65 A;  1UTB B;  3B6Q A;  1MPD A;  4F18 A;  4G8M A;  2QPQ A;  1MPC A;  1GVC A;  4PET A;  4RY1 A;  4C1U A;  4JWY A;  1GTK A;  1PB9 A;  3FJG A;  1OQH A;  4IO3 A;  4OZ9 A;  4U21 A;  3O97 A;  4P0G A;  1Q1K A;  3KJT A;  3TTL A;  1XC1 A;  2PT2 A;  3IB0 A;  1FW0 A;  3FVO A;  4I62 A;  2I58 A;  3E4R A;  3K01 A;  4FEC A;  4QF9 A;  3KN8 A;  3KJ7 A;  1TWY A;  1N7X A;  2DWA A;  2HQ0 A;  1Y9U A;  4YU0 A;  5CMM A;  2V25 A;  1H76 A;  4DIG A;  1JVX A;  1NMU A;  3PD8 A;  1M5F A;  1SI0 A;  2QS1 A;  3E9X A;  3N6T A;  4OEU A;  3S4U A;  4YMB A;  1DMB A;  1S9T A;  3RLF E;  5KDT A;  4QRZ A;  1P1N A;  2ZYM A;  2KLF A;  3QUF A;  3M3L A;  5TP9 A;  3TQL A;  3K1P A;  1UTH A;  1UTB A;  2VP1 A;  4IO6 A;  1JEV A;  4RK2 A;  3TDJ A;  4TQU Q;  5H8F A;  5I59 A;  3N6U A;  4MBP A;  2GHA A;  5H8S A;  1H3D A;  3MVZ A;  2GRV A;  5M2V A;  1AMF A;  3MC2 A;  3H06 B;  4Q5T A;  3HCQ A;  4I8C A;  1NKX A;  3CR9 A;  4KCD A;  2ZMB A;  4Q30 B;  1BP5 A;  4RA1 A;  4DXU A;  2ABH A;  4JBZ A;  2PBW A;  3IR1 A;  5HPQ A;  2R71 A;  3LBS A;  1VFD A;  1N0T A;  3VVE A;  4RPO A;  3OEK A;  1HSE A;  3G3F A;  4WKM A;  1FQA A;  1B40 A;  3PUY E;  4LZ7 A;  5H8Q A;  3TCF A;  1MQJ A;  4IO5 A;  5KZT A;  1AIV A;  1SI1 A;  1B7U A;  2Z8D A;  2RC8 A;  3VLU A;  1MXX A;  2V3Q A;  1LBB A;  2XX7 A;  3FXU A;  2XXP A;  3Q28 A;  4THI A;  3H6T A;  4ONY A;  3ONM A;  5H8H A;  3RY3 A;  3CIJ A;  4XKQ A;  4F39 A;  3MW0 A;  1US4 A;  4IGR A;  3S2V A;  4ZEI A;  4E0X A;  3W9V A;  5HBC A;  5I56 B;  4GVO A;  2GFE A;  1MXY A;  2E0S A;  1NNK A;  1B7H A;  3O6H A;  3FGS A;  2GH9 A;  3MPK A;  4LQ2 A;  3LUY A;  4NF6 A;  3TEP A;  1Y3N A;  3CFX A;  3I5O A;  2G29 A;  3KOT A;  5B70 A;  1Z7M E;  4MLQ A;  3K02 A;  2DS9 A;  3P7I A;  1PBQ A;  1EZO A;  3T66 A;  3MZ1 A;  3IOW A;  2FYI A;  3K6X A;  4F31 B;  1O64 A;  1MXW A;  1MXV A;  1OLC A;  1ZMG A;  4R9F A;  1ANF A;  3QUJ A;  1N84 A;  4NF8 A;  4G68 C;  4XKP A;  2QMX A;  3SEV A;  3IOR A;  2I6E A;  2UVJ A;  3CG3 A;  3FAT A;  4JXI A;  4TOZ A;  3CFZ A;  4C0R A;  3OD7 A;  3VVD A;  3A09 A;  4NF8 B;  3E13 X;  4R72 A;  4ZZA A;  4GXS B;  4Z0I A;  2W7Y A;  1IIT A;  1IXC A;  1WOD A;  4H65 A;  1LFG A;  3EF7 A;  2PVU A;  3O9P A;  4EUO A;  3U94 A;  2IA4 A;  3PPO A;  4QHQ A;  1JVY A;  4ZEC A;  5JK4 A;  1ZU0 A;  4U23 A;  3H6U A;  1MQD A;  3I6V A;  3R7X A;  1NNP A;  3TAJ A;  5I58 B;  5DVJ A;  2F36 A;  4BDO A;  4ZE8 A;  5DEX A;  1II5 A;  4GD5 A;  5A5X B;  1A54 A;  3K00 A;  4UAC A;  1B0H A;  2DWH A;  2P2A A;  1H45 A;  2XXI A;  4PFW A;  3QK6 A;  1P99 A;  4O3C A;  1MQG A;  1QUJ A;  1Y3Q A;  4HTG A;  2UVI A;  3Q29 A;  5L9O A;  1MY1 A;  3PUX E;  4LZ8 A;  4R2F A;  1CB6 A;  2ZYK A;  4NED A;  4QFP A;  1YAE A;  3C9H A;  1GR2 A;  1QUL A;  3DP8 A;  1LAF E;  4H1X A;  2RCA A;  4YZZ A;  3FVN A;  3B6T A;  4TLL B;  1OVT A;  1POY 1;  1SYH A;  3MJN A;  5CBS A;  4POX A;  5K2Y A;  2Y7W A;  3O2A A;  5FHM A;  1MY3 A;  3SEU A;  3W15 C;  3C35 A;  1B3G A;  4WED A;  4EXK A;  5ICQ A;  4DCX A;  2F34 A;  3IL1 B;  4GL8 A;  4RPN A;  3IAZ A;  3LSW A;  4X1D A;  4YAH X;  4YKJ A;  3ZKL A;  3RTW B;  4F3P A;  3LR1 A;  3S9M C;  4Z7E A;  5H8N A;  3IOV A;  3H6V A;  2OBG A;  3QYT A;  4ND9 A;  3IX1 A;  5I56 A;  1ZBM A;  5AA2 A;  3N5L A;  1PC3 A;  5JTY A;  2E1S A;  3D4C A;  3EHT A;  3FIR A;  3HHG A;  2B3B A;  4FIM A;  4JSO A;  5H8H B;  2OK2 A;  2V3T A;  1N76 A;  3UA8 A;  4ZED A;  3IO4 A;  4F29 A;  1XS5 A;  2HAU A;  1FQE A;  2XD2 A;  3IOU A;  5EHM A;  2X7P A;  4YKI A;  1Y4C A;  4EDP A;  4PE5 B;  2AYS A;  3OEM A;  4G2Z A;  1F9B A;  1ATG A;  1N3W A;  5IKB A;  4ECF A;  3H3G A;  3CG1 A;  2H98 A;  1XVX A;  2XXT A;  4L17 A;  1D9Y A;  1OLA A;  4GLI A;  4RNS A;  4WEP A;  3FJM A;  3K2D A;  2Y7I A;  2XXR A;  4BDR A;  3FD3 A;  2DWJ A;  3ODB A;  4E0W A;  1QKB A;  3KN3 A;  4OQO A;  3M3F A;  4H67 A;  4DE8 A;  4ELQ A;  4QSC A;  5JTY B;  4F3B A;  3PU5 A;  1A8F A;  3C31 A;  1B3H A;  3TCH A;  4AB6 A;  1HSL A;  4BLA A;  1ELJ A;  4XTC Q;  1FQB A;  1LAH E;  4MF3 A;  4NMY A;  5AA4 B;  2NOO A;  1JW4 A;  1M5B A;  2A5T B;  2I3W A;  3QAX A;  1B5J A;  4KYS A;  3SKP A;  3U1O A;  5CMC A;  5I59 B;  5I2N A;  5ICT A;  3CVG A;  4UA8 A;  4JB7 A;  1YPN A;  4N6P A;  1AL3 A;  2XXX A;  3Q27 A;  2OLB A;  4F19 A;  1AOV A;  1IXG A;  3HHF A;  3MUQ A;  1Z7N E;  2I0C A;  3H03 A;  4LVQ A;  5B7D A;  3VV5 A;  4OES A;  5KDT B;  2Y84 A;  1FCK A;  2HAV A;  5L8D A;  3N26 A;  2OZZ A;  1IZ1 A;  1XVY A;  1Y1Z A;  1SW4 A;  3IOT A;  4NF4 A;  3TTR A;  1TT1 A;  3CRB A;  3USD A;  3WAE A;  4GRK A;  1A99 A;  1A8E A;  2HZL A;  3KSJ A;  1RKM A;  2VOZ A;  3FV2 A;  3IB1 A;  4P11 A;  5FHN A;  1R9Q A;  2Y7P A;  4BDN A;  1I69 A;  2QJE A;  3C34 A;  3ECR A;  3QSL A;  4JWO A;  4WXJ A;  1FTO A;  4PP0 A;  1B46 A;  1A40 A;  1RYO A;  1JW5 A;  4FAJ A;  1QJM A;  2PMS A;  1MDQ A;  4R2B A;  1GV8 A;  3S9N C;  5IAI A;  1YCJ A;  3T22 A;  5AA3 A;  3G3J A;  1I6B A;  1SDX A;  5TPA A;  3MP1 A;  3O66 A;  5KCJ A;  5ISU A;  4U2R A;  3JZJ A;  1AH5 A;  4QFO A;  2I3V A;  4OTE A;  1I6Q A;  5A5X A;  3MWB A;  3MZB A;  4GIZ A;  3FAS A;  2REG A;  3G3H A;  3FXR A;  2DE4 A;  4FE8 A;  2F97 A;  1MY4 A;  2RC9 A;  4LAT A;  1TXF A;  4Q0C A;  4ZS9 A;  3UGW A;  1MS7 A;  3RPW A;  3G3G A;  1HSJ A;  1BIY A;  1FQC A;  4OFO A;  4OER A;  1EZ9 A;  1SW2 A;  1QKA A;  2YPN A;  3H6W A;  5AA1 A;  4KCC A;  1H43 A;  3EPE A;  3IJO B;  3DEL B;  4M4G A;  4KYD A;  2Q2C A;  2UXA A;  3BKI B;  4RYA A;  3HN0 A;  4QSD A;  1M5D A;  2H4I A;  3O6I A;  3PPQ A;  1XOC A;  2VGQ A;  1GGG A;  2DYX A;  2ZNU A;  4N07 A;  4X1B A;  1UQW A;  1SW5 A;  3K6U A;  2WKY A;  1MXZ A;  4OFJ A;  1RYX A;  3T9U A;  4OHN A;  2HZK A;  2CMO A;  5DT6 A;  1PBP A;  3TKD A;  3ILT B;  1MM6 A;  1MY2 A;  2DWI A;  2HCA A;  5DVI A;  4EF1 A;  4H8I A;  5CRY A;  2OCU A;  4XXU A;  3PMV A;  4GXA A;  1VE4 A;  3SEW A;  1LCT A;  2NVU B;  5ITP A;  1IQ7 A;  2CZL A;  1J1N A;  1FTM A;  1Y3P A;  1B3E A;  1IUD A;  4U4X A;  3TTN A;  3VFJ A;  3Q26 A;  1IIW A;  4O3B A;  4MFI A;  1M5E A;  3OSQ A;  4KHZ E;  3TYH A;  2O51 A;  2ZNS A;  4ZDM A;  4OMB A;  4YB5 A;  1FQF A;  1P1W A;  1SYI A;  2G93 A;  2NUV A;  3FVG A;  3HPI A;  2XHD A;  3JYR A;  5DYH A;  3RQT A;  4FAT A;  1B3F A;  3C32 A;  3O28 A;  4IO2 A;  1P1O A;  3TZA A;  4EQ7 A;  4F3G A;  1MRP A;  2XXU A;  1B5I A;  2REJ A;  4EQ9 A;  1NH7 A;  5I84 A;  3RT8 A;  3C4M A;  3RUM A;  1QVS A;  5JEI A;  4XKR A;  4NF4 B;  3ILU B;  1M5C A;  2F7C A;  3RN8 A;  4F1V A;  4RK9 A;  4G68 B;  4BDQ A;  3TQW A;  2A5T A;  3HO7 A;  1SBP A;  5AE4 A;  1SVX B;  2H5Y A;  5ELV A;  4DZ1 A;  3VXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...