3N26A

Cpn0482 : the arginine binding protein from the periplasm of chlamydia pneumoniae
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
231
structure length
231
Chain Sequence
DRNRIWIVGTNATYPPFEYVDAQGEVVGFDIDLAKAISEKLGKQLEVREFAFDALILNLKKHRIDAILAGMSITPSRQKEIALLPYYGDEVQELMVVSKRSLETPVLPLTQHSSVAVQTGTFQEHYLLSQPGICVRSFDSTLEVIMEVRYGKSPVAVLEPSVGRVVLKDFPNLVATRLELPPECWVLGCGLGVAKDRPEEIQTIQQAITDLKSEGVIQSLTKKWQLSEVAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Amino acid ABC transporter, periplasmic amino acid-binding p
publication title Exploiting antigenic diversity for vaccine design: the Chlamydia ArtJ paradigm.
pubmed doi rcsb
source organism Chlamydophila pneumoniae
total genus 65
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n26A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n26A02
4RYAA 3K02A 1PB8A 5AA4A 1BLFA 1IZ1A 3DP6A 1XC1A 1B3HA 2VP1A 2H9BA 3TMGA 4C1TA 3TUSA 3WAEA 2QMXA 2G29A 3DELB 2RC9A 3PPPA 4ONYA 4EQBA 4QRZA 4GIZA 1US5A 3FXRA 1MH3A 3A3UA 1MQGA 4LA9A 2F34A 3UK4A 4R9FA 2R6GE 4Z7EA 4H5FA 4RXLA 3V83A 4U1OA 3C33A 4NWDA 3MJNA 2Q2AA 3DLNA 3S4UA 3ILTB 4TLMB 2HZKA 3Q26A 1MXVA 3TTMA 3B6QA 3PUYE 2I0BA 2OCUA 3C36A 2UVGA 3FJMA 3C9HA 2H5YA 1XS5A 5ISUA 2O69A 2D21A 2F36A 4O3CA 2DS9A 4ECFA 2HXWA 3O66A 3FVKA 3G3KA 3GLBA 3PPOA 4IO6A 4EUOA 3FD3A 5A5XA 1JW1A 1D9YA 1NFTA 4MBPA 3C35A 3T93B 3PUWE 2HQ0A 5BUUA 2QJEA 1B5JA 1US4A 2I49A 3TTRA 5I57B 3V5AA 4F1UA 4XXUA 1URDA 3O29A 3K2DA 3RNNA 2F97A 2A5TB 2XXTA 4NMYA 4P0GA 4F18A 1Y9UA 4JSOA 1B0LA 3IR1A 3CG1A 2DE4A 4JSDA 1NL5A 2H99A 5I56A 4EXLA 1DPPA 4JDFA 4ESWA 2X7QA 3CRBA 4ESXA 2VD2A 2X7PA 4ND9A 5EHSA 2OLBA 3MZBA 2F7BA 1N7XA 4JBZA 4XIGQ 3QIMA 3MWBA 4XKPA 4DLDA 4F31B 3HSTA 3PMXA 3VFJA 3MP8A 4KCDA 4JXIA 1OVBA 2DVCA 4E0XA 3SKPA 1KWHA 3QXMA 3PPQA 4Q30B 1SW2A 5H8QB 2RF1A 3H06B 3G3GA 4LQ5A 1MXXA 3EHTA 3W9VA 2M8CA 3FVNA 1ATGA 2ZXTA 3VE1B 3DP8A 5DEXB 4BDOA 5H8HB 2DQVA 4ZE8A 3OMBA 4FE8A 1H44A 2GHAA 5DTBA 3EF7A 2Q2CA 3K4UA 5I2NA 2XX9A 3K0VA 1SI1A 1DTGA 3JV9A 1VFEA 2HAVA 4JB7A 4OFOA 5TPAA 3VVFA 1LAXA 3HPIA 5AA1A 4GF8A 3FIRA 3S9NC 2XXPA 3UGWA 1JQFA 3BBRA 3T9XB 3KFMA 4NWCA 4U21A 2XXWA 4QFKA 4GXSB 3RTWB 1UQWA 3MZ9A 1P1UA 4DXCA 2PMSA 2THIA 4U2RA 3LC8A 3H6UA 3ILUB 3MBPA 2PT2A 3T9UA 5H8FB 3W9WA 3U92A 2OWSA 5TP9A 2F7AA 3DP4A 2O1LA 3IOWA 2FA7A 4F2OA 4QFNA 2ABHA 3EN3A 5DVFA 3MVYA 1LLSA 1B3LA 4K3FA 3RN8A 4WEDA 5DVIA 2ZNSA 5TPAB 1QW0A 5F1QA 1MM6A 1II5A 3Q25A 4X9TA 1B7HA 3C34A 4RPOA 3PU5A 1XHYA 4DXBA 1NNPA 2Z8DA 1JEUA 3KSXA 5CRYA 3UORA 2DXYA 1IXIA 1NH7A 1LFIA 4YKIA 5ITPA 3PD9A 3TFLA 4POXA 5I58A 5ELVA 1TT1A 4IO4A 4RK2A 4YICA 3E13X 4THIA 4IO7A 2VGQA 5AA3A 4F29A 1H3DA 3JZJA 3CSGA 1SW1A 2P0SA 3FATA 3N5LA 2RC7A 5ICTA 1P1NA 1IXCA 5KZTA 1Y3NA 4JWYA 4GL8A 3FUZA 4Q5TA 4M1VA 5JK4A 4OTEA 5I59A 2Y7RA 4G8NA 2PBWA 5L9OA 1JETA 1GTKA 1DSNA 5JEIA 3CFXA 4AQ4A 1QVSA 1ZLQA 1ZIUA 2UVHA 4X48A 3K6XA 2QS1A 4GRKA 3OSRA 1LB9A 3SEYA 5I58B 4EF2A 3KN7A 4ZECA 4POWA 3TQWA 3O28A 2ZMBA 2R71A 3VLUA 2DWJA 3MZ1A 3HO7A 3PPNA 4OENA 5CMMA 1OLAA 5FTIA 1B3FA 4ZS9A 3MW0A 3S9EA 4LZ8A 2O6AA 1QJMA 5F7VA 3KEIA 2I0CA 4R73A 2DE3A 5I59B 1T0KA 1MY1A 2Y7PA 2ESNA 4H67A 2PVUA 3U1OA 4R74A 1SYIA 4PFTA 2XD2A 1SW4A 5I84A 4QSCA 4X1BA 3IOUA 5JTYB 3OO9A 2ZNTA 3T96B 1IIWA 2Y7IA 2UVJA 1Y1MA 3H6TA 1A8FA 4C0RA 5CBRA 1LAGE 3FVOA 3CVGA 4IB2A 3H6WA 4LQ2A 1PC3A 1MPCA 3PMWA 1SI0A 1LBBA 1USYH 3RGYA 3SETA 1POY1 1B2HA 4LATA 1AIVA 3CFLA 3K01A 3S2VA 4BDNA 1IXHA 3IJXB 1LB8A 4F2QA 4G2ZA 4R6YA 2ZYNA 3HCQA 2XXRA 3GBBA 4IGRA 4R75A 4EDPA 1Z7ME 3SDFA 2QRYA 3VVDA 1BKAA 5H8NA 3IOVA 4F3SA 2HAUA 2ZYMA 3A3CA 4XTCQ 5AA4B 4F19A 1B0HA 3W15C 3C4MA 3G3IA 1D3KA 3N6TA 2REGA 1R9QA 1GVCA 2Z8FA 4QHQA 3SEVA 2NVUB 5DYHA 1UTBA 1MDQA 1POTA 1LCTA 4H0WA 3QSLA 2WKYA 3LSXA 1Y20A 3SEWA 3VLVA 1TWYA 1FTMA 4YAHX 2XXVA 4TLLB 3IL1B 5EYFA 4GL0A 4WKMA 4PFYA 2F5XA 3O6HA 4OFJA 3PUVE 3PPRA 1B05A 4ZEFA 2ONSA 3HHFA 1SVXB 3RUMA 1MG1A 3OEMA 3H3GA 1B51A 5H8NB 4QSDA 4ELRA 1N3WA 4HTGA 3IX1A 4I62A 4KR5A 3T66A 5HM4B 3G3JA 5EHMA 1IQ7A 1FTLA 3H03A 1ZBMA 4PFWA 1QULA 3JYRA 1MH4A 2AL5A 4IO2A 2P1SA 1IEJA 3M8UA 2Z8EA 1UTBB 3USDA 3PMVA 1OMPA 4GVOA 4QFPA 4OQOA 3RT6B 4U23A 4MF3A 2RCAA 3C32A 4F3BA 4FECA 5A5XB 4JWOA 4E0WA 4H1XA 4QF9A 4P11A 1EH3A 1GV8A 3MUQA 3O2AA 1A8EA 4NF8A 2IEEA 1NNTA 2NWJA 2YLNA 3TCGA 1Q1KA 3D4GA 4RK9A 3QUJA 3IB1A 2V3TA 2F35A 1H45A 2UYFA 5FHOA 3THIA 1O63A 3G3FA 4BLAA 3GBAA 3MQ9A 1B4HA 3R6UA 4GD5A 4YU0A 4QSEA 4YMAA 3H7MA 1HSLA 2VOZA 4NF6A 4RA1A 2OJTA 1LSTA 3VXCA 4GQOA 3KN3A 5CMCA 1ELJA 3UIFA 1B5HA 3OOAA 3L6GA 5DVJA 5I56B 1B3GA 2DSFA 1QUJA 3S9MC 5KCJA 1IITA 2QMWA 5AE4A 3KOSA 3HN0A 3U72A 1N3XA 3FJ7A 4NF8B 4H8IA 3GZGA 1O7TA 1A55A 3DM0A 2XX7A 3EHSA 4FEDA 2Q89A 4N6PA 2AIXA 4UACA 4H8JA 1A54A 3LUYA 3FV1A 3CI8A 1QUIA 3IAZA 3IJOB 4G8HA 3RPWA 3CR9A 5IAIA 1YTVA 1PEBA 3B6TA 1UIVA 5KDTA 1EU8A 4NF6B 3M3FA 3FVGA 3MP1A 3IB2A 4IO3A 5I2KA 1B32A 4HW8A 2NUVA 1FQAA 1P99A 3IO4A 4F1YA 2V25A 2V3QA 3QAXA 1I6AA 4PP0A 3ZKKA 5KCJB 2GFEA 5HPQA 1AOVA 4OVJA 4LP2B 1AMFA 1CE2A 2Q8JA 2ZNUA 2QL3A 5I2NB 3OO8A 2H98A 3K6VA 3TTKA 4KHZE 3M3LA 3OELA 3PD8A 4FIMA 1NH8A 3RY3A 3TCFA 3ONMA 1Y3QA 1JW5A 1NKXA 4F22A 3R26A 1SQYA 2I58A 4F1VA 4WXJA 5KDTB 2R9JA 3MVZA 1LAHE 1MQIA 4N07A 4G77A 4IGTA 1F9BA 1VFDA 3MVXA 3PUZE 2DWIA 5CBSA 3FV2A 1MXYA 2F6GA 2ONRA 4F39A 4BDQA 2UVIA 3FASA 5TP9B 1EZ9A 3KJTA 2I3VA 4KYEA 4FAJA 3O9PA 4YKPA 1TFAA 4O3BA 4YB6A 2DYXA 3KG2A 1JEVA 4H65A 4ELPA 5L9MA 3CIJA 3Q28A 1PBQA 3SEXA 4YKKA 2ALUA 4BDMA 4L17A 4R9GA 1AH5A 4PE5B 4R6HA 1IUDA 4FATA 5TU0A 4QFOA 4I8CA 3I5OA 3OO6A 2XXXA 3HHGA 4ELOA 2XXQA 4UA8A 1M5FA 1TFDA 1FQFA 2LAOA 3PV0E 3CSBA 1B1HA 2QPQA 1FTJA 2O1MA 3RT8A 5AA2A 1QKBA 3BFUA 3CFZA 4DDDA 4EXKA 1O64A 4R6KA 3RQTA 1MY0A 2I48A 3TYHA 1MXUA 4ZDMA 4F3GA 1H76A 2NOOA 4NEDA 1SDXA 1OLCA 4R2BA 1I6BA 1B4ZA 2YJPA 1B1XA 4IO5A 3U93A 3FGSA 1XVXA 1Z7NE 5B7DA 1M5EA 3F11A 2CMOA 2CZLA 4OEUA 4U4XA 1EZPA 3QUFA 2PT1A 3ZS6A 5AA2D 2O68A 1LGBC 3B6WA 1S50A 3RTFB 1L5TA 3H4ZA 3IO6A 3S9LC 2IA4A 2XXYA 4YMBA 3N26A 3E4RA 4I1DA 2XXHA 1S9TA 1PBPA 3O6GA 4OERA 4GLIA 5CMBA 3ECRA 4JWXA 1OQGA 3P7IA 3G3HA 2QSXA 1A40A 3PUXE 3I3VA 1B7UA 3TTNA 2ZYKA 4EF1A 4YKJA 1H43A 3IOTA 1SD3A 2ZYOA 3TAJA 4FJPA 1FQBA 1FTKA 1M5CA 4NF5A 2O7UA 3K1NA 4GWOA 1R9LA 4MLVA 1MQJA 4EQ7A 4QFLA 4R2FA 1XOCA 4U4SA 4LUBA 3E9XA 3KN8A 2XXUA 1MDP1 1URSA 4XKQA 3BFTA 4EQ9A 1VE4A 3T9VA 1HSJA 2YPNA 2G93A 4X1DA 3D4CA 3TODA 2E0SA 2D3IA 3B7DA 5I57A 2E1SA 3Q29A 2PYYA 1A99A 4M4GA 4NF5B 3EQ1A 2A5TA 1NNKA 4RY1A 3VLWA 1MY4A 4KFQA 1I6QA 4IY5A 4NTLA 2I4BA 4P0IA 4LZ5A 3E3KA 3KZGA 2XX8A 3MC2A 1PB9A 4XKRA 3TELA 1B7ZA 2V93A 1JVYA 3H6VA 3OO7A 3TDJA 4DIGA 5CC2A 4ZEIA 1B40A 2OWTA 2RCBA 3MPKA 2A5SA 2UYEA 4G68A 4ZZEA 1OVTA 2F6PA 1YCJA 1B58A 1MS7A 2DP8A 4RPNA 5BWJA 1PDAA 1MXWA 2F78A 2V3UA 3TZAA 1DTZA 2QS4A 1R6ZA 4Q0CA 1ZMGA 1BP5A 2XD3A 4OHNA 1ZJLA 5LOMA 1M5BA 1ANFA 4NE4A 2I6EA 4KPTA 1QUKA 2VHAA 5H8QA 1NNFA 1MRPA 1FQEA 3QK6A 2Q9TA 3ZKLA 5CI5A 1M5DA 3TPAA 2HEUA 3GXAA 1RYXA 4PFUA 4FORA 1MQHA 1ZKBA 1LAFE 3SERA 5CMKA 1OIBA 5K2XA 5DEXA 2RC8A 1P1OA 1RKMA 5H8HA 3M3KA 4H5GA 3IK6B 1MPDA 1VSOA 2OZZA 5HBCA 4C1UA 5FHNA 1MY3A 2BJJX 4G68B 2D5WA 1D4NA 1FQCA 5ITOA 1SYHA 1OQHA 2FNCA 3OD7A 4OMBA 1R1NA 4HCYA 4HS7A 3FZVA 4YB7A 1NMUA 4GXAA 3K6WA 3LSFB 3LR1A 4G68C 4GOTA 3N94A 3SEUA 2OK2A 5IKBA 1MY2A 1LBCA 3T22A 2GH9A 3N6UA 2PX1A 1MM7A 4MLQA 1S7YA 2KLFA 3QYTA 1JNFA 1USYE 1UIUA 4YZZA 2QS2A 4ISUA 3T9HB 1UTHA 3TKDA 5H8FA 3CG3A 1BTJA 1XT8A 4DCYA 4F3PA 1FW0A 5CM6A 2Y7KA 2F7CA 4DCXA 1P1WA 4DZ1A 2AYSA 4GFRA 1DPEA 5FTHA 3RLFE 3FJGA 5K2YA 3VVEA 3IB0A 4ZEKA 4NF4A 1QKAA 3MAMA 4TOZA 2O7IA 3KJ7A 3KOTA 2F8DA 4OYVA 2Z22A 3KGCA 3PGFA 5B70A 3OENA 3K00A 3ZSFA 1TXFA 4RJZA 3UA8A 4WEPA 3V8XB 1GR2A 5L9SA 4TQUQ 3HV1A 2VD3A 4AB5A 2UXAA 2XHDA 4R72A 3BKIB 1UTHB 3U94A 1JVXA 1N84A 1RYOA 2W7YA 3TTLA 1FTOA 3LBSA 2OBGA 1HSEA 1I69A 1B46A 2HCAA 5L8DA 4KI0E 3Q27A 3C31A 2Q88A 2ANJA 3MPLA 4ELQA 4ZEDA 2REJA 3FXQA 1B6HA 3LSLA 3VV5A 3K1PA 3O97A 3UN6A 1JW4A 4NF4B 4N13A 1CB6A 5I2KB 4I9DA 4HCWA 3MP6A 3U8QA 3VDFA 1LCFA 2RINA 1PB7A 3G7WA 1ZU0A 4OWDA 2I4CA 4OESA 4LVQA 5J1DA 2X26A 2B3BA 4OETA 1Y3PA 1N76A 4OEVA 5ICQA 4Q8RA 1IXGA 1N04A 4KYSA 1SW5A 1SBPA 3OEKA 3L6HA 3LSWA 2B3FA 4KCCA 1BIYA 1MXZA 5H8SA 3OSQA 3O6IA 2HZLA 4ZEBA 2DWHA 4G4PA 1LFHA 1FQDA 3OXNA 4LZ7A 1YPNA 4YB5A 2Y84A 1B52A 3EHUA 1Q35A 4O3AA 4ZE9A 2RKMA 2QS3A 2NXOA 4PQJA 2V84A 1D9VA 4RNSA 3EPEA 2XXIA 3TEPA 5FHMA 4KQPA 1A7LA 4Z0IA 4PETA 4MFIA 1URGA 3A09A 4AB6A 2DE2A 1YAEA 1N7WA 4IY6A 3TCHA 4FEBA 1J1NA 4OXVA 4U1ZA 3UP9A 2H4IA 2P2AA 3K6UA 5JTYA 4BDLA 2I3WA 3ODBA 1AL3A 2H25A 1Y4CA 1DOTA 3KSJA 1Y4TA 2O84X 3I6VA 1WDNA 1N0TA 1FCKA 2DWAA 4DE8A 4ZZAA 1MQDA 3SESA 1Y1ZA 3V89B 3KBRA 2B65A 1WVJA 4OZ9A 3K1MA 4H6DA 2Y7WA 1VR5A 5DT6A 1ZTYA 1MPBA 1B3EA 2AL4A 4BDRA 1EZOA 2DOJA 2DXRA 1LFGA 3IORA 3WAFA 4LONB 4MH5A 4KD5A 1B5IA 2ONKE 3FXUA 5AA2B 1DMBA 2Z23A 2DVZA 4U22A 4DXUA 1GGGA 3TQLA 2O51A 1B9JA 2FYIA 1P1QA 1WODA 4XKNA 2GRVA 2GHBA 2HFBA 4KYDA 3VXBA 4OFLA 4G8MA 3AXFA 5M2VA 1XVYA 3MVWA 3R7XA
chains in the Genus database with same CATH superfamily
2XA5A 4RYAA 3K02A 1PB8A 5AA4A 1BLFA 1IZ1A 3DP6A 1XC1A 3B8BA 1B3HA 2VP1A 2H9BA 3TMGA 4C1TA 1LBXA 4OVRA 2P3VA 3TUSA 3WAEA 2QMXA 2G29A 3DELB 2RC9A 3PPPA 4ONYA 4EQBA 4QRZA 4GIZA 1US5A 4GWZA 3FXRA 1CNQA 2MKZA 1MH3A 3A3UA 1MQGA 1NV7A 4LA9A 4MJOA 2F34A 3UK4A 4R9FA 4IR8A 2R6GE 4Z7EA 4H5FA 1VDWA 4RXLA 3V83A 4U1OA 2ZZXA 3C33A 4NWDA 3MJNA 2Q2AA 3DLNA 3S4UA 3ILTB 4TLMB 2HZKA 3Q26A 1MXVA 3TTMA 3B6QA 1FBHA 3PUYE 2I0BA 2OCUA 3C36A 2UVGA 3FJMA 3C9HA 2H5YA 1XS5A 5ISUA 4OVQA 2O69A 2D21A 2F36A 4O3CA 3GYYA 2DS9A 4ECFA 2HXWA 3O66A 3FVKA 3G3KA 3GLBA 3PPOA 4IO6A 4EUOA 3FD3A 5A5XA 1JW1A 1D9YA 1NFTA 4MBPA 3C35A 3T93B 3PUWE 2HQ0A 5BUUA 2QJEA 1B5JA 1US4A 2I49A 3TTRA 5I57B 4PC9A 2WEFA 3V5AA 4GWSA 2VPOA 4F1UA 4XXUA 1URDA 3O29A 2PFYA 2CZIA 3K2DA 1DBZA 3RNNA 2F97A 2A5TB 2XXTA 4NMYA 4P0GA 4F18A 1Y9UA 4JSOA 1B0LA 3IR1A 1FBPA 3CG1A 2DE4A 4JSDA 1NL5A 2GQ1A 2H99A 5I56A 4EXLA 1DPPA 4PAIA 4JDFA 2B4MA 4ESWA 2X7QA 3CRBA 5LTCA 4ESXA 2VD2A 2X7PA 4ND9A 5EHSA 2OLBA 3MZBA 2F7BA 1N7XA 4JBZA 4XIGQ 3QIMA 4QBAA 3MWBA 4XKPA 4DLDA 3HSTA 3PMXA 4F31B 3VFJA 3MP8A 5ESYA 3BIGA 4KCDA 4JXIA 1G0IA 1IMBA 1OVBA 2DVCA 4E0XA 3SKPA 1KWHA 3QXMA 3PPQA 4Q30B 1SW2A 5H8QB 2RF1A 3H06B 3G3GA 4OVPA 4LQ5A 1MXXA 3EHTA 3W9VA 2M8CA 5ET6A 5EYGA 1XI6A 3FVNA 1ATGA 2ZXTA 3VE1B 3DP8A 5DEXB 4BDOA 5H8HB 5I7IA 2DQVA 4P47A 4ZE8A 3OMBA 4FE8A 1H44A 2GHAA 4GWWA 5DTBA 3EF7A 2Q2CA 3K4UA 5I2NA 4MMPA 1NI9A 4UABA 2XX9A 3K0VA 1SI1A 1DTGA 3JV9A 1VFEA 2F3DA 2HAVA 4JB7A 4I40A 4OFOA 5TPAA 3VVFA 1LAXA 3HPIA 5AA1A 4PBQA 4GF8A 3FIRA 3S9NC 2XXPA 3UGWA 1JQFA 3BBRA 2WBDA 3E78A 3T9XB 5ET8A 3KFMA 4NWCA 4U21A 2XXWA 4QFKA 4GXSB 3RTWB 1UQWA 3MZ9A 1P1UA 4DXCA 2PMSA 2THIA 4U2RA 3LC8A 3H6UA 3ILUB 3MBPA 2PT2A 3T9UA 1FPDA 2Y5LA 5H8FB 3W9WA 3U92A 4N8GA 4OVSA 2OWSA 2PCRA 5TP9A 2F7AA 3DP4A 2O1LA 4AS4A 1K9ZA 3IOWA 2FA7A 4F2OA 4QFNA 4MNCA 2ABHA 3EN3A 5DVFA 3MVYA 1LLSA 1B3LA 4K3FA 4NGUA 3RN8A 4WEDA 5DVIA 2ZNSA 5TPAB 1QW0A 5F1QA 1MM6A 1II5A 3Q25A 4X9TA 1B7HA 3C34A 4RPOA 4MEVA 5EQ8A 3PU5A 1QGXA 2XXKA 1FPLA 1XHYA 4PAFA 4DXBA 1NNPA 2Z8DA 1JEUA 3KSXA 5CRYA 3UORA 2DXYA 1IXIA 1NH7A 1D9QA 1LFIA 4YKIA 5ITPA 4GX4A 3PD9A 3TFLA 4POXA 4PFBA 5I58A 5ELVA 4OA4A 1TT1A 4IO4A 3CHGA 4RK2A 4YICA 3E13X 2HPGA 4THIA 4IO7A 2VGQA 1FPJA 5AA3A 4F29A 1H3DA 3JZJA 3CSGA 1SW1A 2P0SA 3FATA 3N5LA 2RC7A 5ICTA 1P1NA 5A5LA 4N6DA 1IXCA 5KZTA 1Y3NA 4JWYA 4GL8A 1FPEA 3FUZA 4Q5TA 4M1VA 1FPKA 5JK4A 4N17A 4OTEA 5I59A 5EQ7A 2Y7RA 4G8NA 2PBWA 1FBDA 5L9OA 1JETA 1GTKA 1DSNA 2VT5A 5JEIA 3CFXA 4AQ4A 1QVSA 1ZLQA 1ZIUA 2UVHA 5T3JA 4X48A 3K6XA 2QS1A 4GRKA 3OSRA 1LB9A 3SEYA 5I58B 4EF2A 1IMDA 3KN7A 4ZECA 4POWA 3TQWA 3O28A 1IMCA 2ZMBA 2R71A 3VLUA 2DWJA 3MZ1A 5FBPA 3HO7A 3PPNA 4OENA 5CMMA 1NV4A 1OLAA 5FTIA 1B3FA 1DK4A 1YXIA 4ZS9A 3MW0A 3S9EA 4LZ8A 2O6AA 1QJMA 5F7VA 3KEIA 1NV6A 4PFRA 2I0CA 4R73A 2DE3A 5I59B 1T0KA 1MY1A 1YYZA 2Y7PA 2ESNA 4PF8A 1KA1A 4H67A 2CEXA 2PVUA 3U1OA 4R74A 1SYIA 4PFTA 2XD2A 1SW4A 5I84A 4QSCA 4X1BA 3IOUA 1FBFA 5JTYB 3OO9A 3FBPA 2ZNTA 3T96B 1IIWA 4MAGA 2Y7IA 2UVJA 4NG7A 4OANA 2Y5KA 1Y1MA 3H6TA 1A8FA 4C0RA 4GWUA 5CBRA 1LAGE 4MCOA 3FVOA 1NUWA 3CVGA 3MYUA 4IB2A 5EYHA 3H6WA 2QVVA 4LQ2A 4FBPA 1PC3A 1MPCA 3PMWA 5IZ3A 1SI0A 1LBBA 1USYH 3RGYA 3SETA 4PAKA 4PDHA 1POY1 1B2HA 4LATA 1EYIA 1AIVA 3CFLA 3K01A 4AS5A 3S2VA 4BDNA 1IXHA 2XWIA 3IJXB 1LB8A 4F2QA 4G2ZA 4R6YA 2ZYNA 3RPLB 1NUZA 4PE3A 3HCQA 2XXRA 3ROJA 3GBBA 4IGRA 4R75A 4EDPA 1Z7ME 3SDFA 2QRYA 3VVDA 1BKAA 5H8NA 3IOVA 4F3SA 2HAUA 1NV1A 2ZYMA 3A3CA 4XTCQ 2HXRA 5AA4B 3LUZA 1INPA 2FIEA 4H45A 4F19A 1B0HA 3W15C 3C4MA 3G3IA 1D3KA 3N6TA 4GX3A 2REGA 1R9QA 1GVCA 2Z8FA 4QHQA 3SEVA 2NVUB 5DYHA 1UTBA 1MDQA 1POTA 1LCTA 4H0WA 3QSLA 2WKYA 2CZKA 3LSXA 1Y20A 5IM2A 3SEWA 3VLVA 1TWYA 4O8MA 1FTMA 2Q74A 4YAHX 2XXVA 4TLLB 4NN3A 3IL1B 5EYFA 4GL0A 4WKMA 4PFYA 2F5XA 3O6HA 3B50A 4OFJA 3PUVE 5I5PA 1NUXA 3PPRA 4GX6A 1B05A 4ZEFA 2ONSA 3HHFA 1SVXB 1LBZA 3RUMA 1MG1A 3OEMA 3H3GA 1B51A 5H8NB 4QSDA 1LBYA 4ELRA 1N3WA 1RDZA 4HTGA 3IX1A 4I62A 4KR5A 3T66A 5HM4B 3G3JA 5EHMA 1IQ7A 1FTLA 3H03A 1ZBMA 4PFWA 1QULA 3JYRA 2VPNA 1MH4A 2AL5A 4IO2A 2ZZVA 2P1SA 1IEJA 3M8UA 2Z8EA 5ET7A 1UTBB 3USDA 3PMVA 1OMPA 4GVOA 4QFPA 4I3EA 4OQOA 3RT6B 4XFEA 4U23A 4MF3A 2RCAA 3C32A 4F3BA 4FECA 5EQAA 4JWOA 4E0WA 5A5XB 3QMFA 4H1XA 3T0JA 4QF9A 4P11A 1EH3A 1GV8A 3MUQA 3O2AA 1A8EA 4KXPA 4NF8A 2IEEA 1NNTA 2NWJA 2YLNA 3TCGA 1Q1KA 3D4GA 4RK9A 3QUJA 3IB1A 2V3TA 2F35A 1H45A 2UYFA 2P3NA 5FHOA 3THIA 1O63A 3G3FA 4BLAA 1Q9DA 3GBAA 3MQ9A 1B4HA 2WX9A 3R6UA 4GD5A 4YU0A 4PCDA 4O7IA 4QSEA 4YMAA 3H7MA 1HSLA 4HE1A 2VOZA 4NF6A 4RA1A 2OJTA 1LSTA 3VXCA 4GQOA 3KN3A 4QXDA 5CMCA 1ELJA 3EKIA 1B5HA 3OOAA 3UIFA 3L6GA 5DVJA 5I56B 1B3GA 2DSFA 1QUJA 3S9MC 5KCJA 1IITA 2QMWA 4N81A 5AE4A 3KOSA 3HN0A 3U72A 1N3XA 3FJ7A 4NF8B 4H8IA 3GZGA 1O7TA 3PTYA 1A55A 3DM0A 3E79A 2XX7A 3EHSA 4FEDA 2Q89A 4N6PA 2AIXA 4UACA 4H8JA 1A54A 3LUYA 3FV1A 3CI8A 1QUIA 3IAZA 3IJOB 4G8HA 3RPWA 3CR9A 5IAIA 1YTVA 1PEBA 1IMEA 3B6TA 1UIVA 5KDTA 1EU8A 4NF6B 3M3FA 3FVGA 1FJ9A 3MP1A 1SPIA 3IB2A 4IO3A 5I2KA 1B32A 4HW8A 4MNIA 2B4LA 2NUVA 1FQAA 1P99A 4NF0A 2F3BA 3IO4A 4F1YA 2V25A 2V3QA 3QAXA 1I6AA 4PP0A 3KC0A 3ZKKA 5KCJB 2GFEA 5HPQA 1AOVA 4OVJA 4LP2B 1AMFA 1CE2A 2Q8JA 2ZNUA 2QL3A 5I2NB 3OO8A 2H98A 1NV0A 3K6VA 3TTKA 4KHZE 3M3LA 3OELA 3PD8A 4FIMA 2L5VA 4P8BA 1NH8A 3RY3A 3TCFA 1IMFA 3KBZA 3ONMA 1Y3QA 1JW5A 1EYJA 1NKXA 4F22A 3R26A 1SQYA 2I58A 4F1VA 4WXJA 5KDTB 2R9JA 3MVZA 1LAHE 1MQIA 1K9YA 4N07A 4G77A 3T1BA 4IGTA 4GBVA 4GWXA 1F9BA 1VFDA 3MVXA 3PUZE 2DWIA 5CBSA 3FV2A 1MXYA 2DDKA 2KQZA 2F6GA 2ONRA 4F39A 4BDQA 2FIXA 4HE2A 2UVIA 3FASA 5TP9B 1EZ9A 4HXVA 3KJTA 2I3VA 4KYEA 5EQ9A 4FAJA 3O9PA 4YKPA 1TFAA 4O3BA 4YB6A 2DYXA 3KG2A 1JEVA 4H65A 1FPBA 4ELPA 5L9MA 3CIJA 3Q28A 1PBQA 2WYPA 3SEXA 4YKKA 2ALUA 4BDMA 4L17A 3BIHA 4R9GA 1AH5A 4PE5B 4R6HA 1IUDA 4FATA 5TU0A 4QFOA 4I8CA 5LDZA 3I5OA 3OO6A 4P1LA 3FXBA 2XXXA 3HHGA 4ELOA 2XXQA 4UA8A 1M5FA 1TFDA 1FQFA 2LAOA 3PV0E 3CSBA 1B1HA 5IGAA 2QPQA 1FTJA 2O1MA 3RT8A 5AA2A 1QKBA 3BFUA 3CFZA 4DDDA 4EXKA 1O64A 4R6KA 3RQTA 1MY0A 2I48A 3TYHA 1MXUA 4PF6A 4ZDMA 4F3GA 1H76A 4NHBA 2NOOA 4NEDA 1SDXA 1OLCA 4R2BA 1I6BA 1B4ZA 2YJPA 1B1XA 4IO5A 3U93A 3FGSA 1XVXA 1Z7NE 1M5EA 3F11A 5B7DA 2CMOA 2CZLA 4OEUA 4U4XA 1EZPA 3QUFA 2PT1A 3ZS6A 2Q8MA 5AA2D 2O68A 1LGBC 3B6WA 1S50A 3RTFB 1L5TA 3H4ZA 3IO6A 4MNPA 3S9LC 2IA4A 2XXYA 4YMBA 3N26A 3E4RA 4I1DA 1FBGA 2XXHA 1S9TA 1PBPA 3O6GA 4OERA 4GLIA 5CMBA 3ECRA 4JWXA 4NX1A 1OQGA 3P7IA 3G3HA 2QSXA 2KR0A 1A40A 3PUXE 1EYKA 2ZZWA 3A29A 3I3VA 1B7UA 3TTNA 1FBCA 2ZYKA 4EF1A 4YKJA 1H43A 3IOTA 1SD3A 2ZYOA 3TAJA 4FJPA 4LN5A 1FQBA 1FTKA 1M5CA 4NF5A 4HE0A 2O7UA 3K1NA 4GWOA 1R9LA 5ET5A 4MLVA 1MQJA 4R2FA 4QFLA 4EQ7A 1XOCA 4DI4B 4U4SA 4LUBA 4MHFA 3E9XA 3KN8A 1JP4A 3IFCA 2XXUA 1MDP1 1URSA 4XKQA 3BFTA 4EQ9A 1VE4A 3T9VA 1HSJA 1LBWA 1KA0A 2YPNA 4X04A 2G93A 4X1DA 3D4CA 1FBEA 3TODA 2BJIA 2E0SA 2XWVA 2D3IA 3B7DA 4NQ8A 2HHMA 5I57A 4I3YA 2R8TA 5IZ3B 2E1SA 3Q29A 2PYYA 1A99A 4M4GA 4NF5B 3EQ1A 2A5TA 1NNKA 4RY1A 4X8RA 3VLWA 5IZZA 1MY4A 4PDDA 4KFQA 1I6QA 4IY5A 4NTLA 2I4BA 4P0IA 4LZ5A 3E3KA 3KZGA 2CEYA 4O7MA 2XX8A 3MC2A 1PB9A 4XKRA 3TELA 1B7ZA 2V93A 1JVYA 3H6VA 3OO7A 3TDJA 4DIGA 5CC2A 4ZEIA 1B40A 2OWTA 2RCBA 3MPKA 2A5SA 2UYEA 4G68A 4ZZEA 1OVTA 2F6PA 1DCUA 1YCJA 1B58A 1MS7A 2DP8A 4H46A 4RPNA 1PDAA 5BWJA 1MXWA 2F78A 2JJKA 2V3UA 3TZAA 4N4UA 1DTZA 2QS4A 1R6ZA 4Q0CA 1ZMGA 3SZPA 1BP5A 2XD3A 4OHNA 1ZJLA 5LOMA 1M5BA 1IMAA 1ANFA 4NE4A 2I6EA 4KPTA 1QUKA 1NV5A 2OWZA 2VHAA 5H8QA 1NNFA 4P1EA 1MRPA 1FQEA 3QK6A 2Q9TA 3ZKLA 1FRPA 5CI5A 1M5DA 3TPAA 2HEUA 3GXAA 1RYXA 4PFUA 4FORA 1MQHA 1ZKBA 1LAFE 4PTKA 3SERA 5CMKA 1OIBA 5K2XA 5DEXA 2RC8A 2OX3A 4G61A 1P1OA 1RKMA 5H8HA 3M3KA 4H5GA 3IK6B 1MPDA 1VSOA 2OZZA 5HBCA 4C1UA 3NOHA 5FHNA 1MY3A 2BJJX 3LV0A 4G68B 2D5WA 4P56A 1D4NA 1FQCA 5ITOA 1SYHA 5J16A 3IFAA 1OQHA 2FNCA 1LBVA 3OD7A 4O94A 4OMBA 1R1NA 4N15A 4HCYA 4HS7A 3FZVA 4YB7A 1NV3A 1NMUA 4GXAA 4P3LA 3K6WA 3LSFB 3LR1A 4G68C 4GOTA 1NUYA 3N94A 3SEUA 2OK2A 5IKBA 1MY2A 1LBCA 5I3SA 3T22A 2GH9A 3N6UA 2PX1A 1MM7A 4MLQA 1S7YA 2KLFA 3QYTA 1JNFA 1USYE 1UIUA 4YZZA 2QS2A 4ISUA 3T9HB 1UTHA 3TKDA 4MIJA 5H8FA 3CG3A 1BTJA 1XT8A 4DCYA 4F3PA 1FW0A 5CM6A 2Y7KA 2F7CA 1AWBA 4DCXA 1YZ0A 3HFUA 1P1WA 3KC1A 4DZ1A 2AYSA 4GFRA 1DPEA 5FTHA 3RLFE 3FJGA 5K2YA 3ISPA 3VVEA 3IB0A 4ZEKA 4NF4A 4P9KA 1QKAA 3MAMA 4TOZA 2O7IA 3KJ7A 3KOTA 2F8DA 2WYKA 4OYVA 2Z22A 2XWKA 3KGCA 3PGFA 5B70A 3OENA 2XWOA 3K00A 3ZSFA 1TXFA 4RJZA 3UA8A 4WEPA 3V8XB 1GR2A 5L9SA 4TQUQ 5F24A 3HV1A 2VD3A 4AB5A 2CZHA 2UXAA 1FPIA 2XHDA 4R72A 3BKIB 1UTHB 3U94A 1JVXA 2FBPA 1N84A 3RYDA 1RYOA 2W7YA 3TTLA 1FTOA 3LBSA 2OBGA 1HSEA 1I69A 1B46A 1G0HA 2HCAA 5L8DA 4KI0E 3Q27A 3C31A 1LEVA 4DI3D 2PFZA 2Q88A 2ANJA 3MPLA 4ELQA 4ZEDA 2REJA 3FXQA 1B6HA 1FTAA 3LSLA 3VV5A 3K1PA 3O97A 3UN6A 1JW4A 4GWYA 1RDYA 4NF4B 4N13A 1CB6A 5I2KB 4I9DA 4HCWA 3MP6A 4N91A 3U8QA 3VDFA 1LCFA 2RINA 1PB7A 3G7WA 1ZU0A 4OWDA 2I4CA 4OESA 1FJ6A 4LVQA 5J1DA 2X26A 3U65A 2B3BA 4OETA 1Y3PA 1N76A 4OEVA 5ICQA 2QVUA 4Q8RA 2FHYA 1IXGA 1N04A 4KYSA 1SW5A 4JVDA 1SBPA 3OEKA 3L6HA 3LSWA 2B3FA 2V4CA 4KCCA 1BIYA 4MX6A 1MXZA 3OSQA 5H8SA 3O6IA 2HZLA 4ZEBA 2DWHA 4G4PA 1LFHA 1FQDA 3OXNA 4LZ7A 1YPNA 4YB5A 4JVIA 2Y84A 2WBBA 4XEQA 1B52A 3EHUA 1Q35A 4O3AA 4ZE9A 2RKMA 2QS3A 2NXOA 4PQJA 4PGPA 2V84A 1D9VA 4RNSA 3EPEA 2XXIA 1FPFA 3TEPA 5FHMA 1FSAA 4KQPA 4PFIA 1A7LA 4Z0IA 2FVZA 4PETA 4MFIA 1URGA 3A09A 4AB6A 2DE2A 1YAEA 5DW8A 1N7WA 3D1RA 4IY6A 3TCHA 4FEBA 1J1NA 4OXVA 4U1ZA 3UP9A 1NV2A 4XF5A 2H4IA 2P2AA 3K6UA 4GBWA 5JTYA 4BDLA 2I3WA 3ODBA 1AL3A 2H25A 1Y4CA 4PGNA 1DOTA 3KSJA 1Y4TA 2O84X 3I6VA 1WDNA 1N0TA 4PBHA 1FCKA 2DWAA 4DE8A 4ZZAA 1MQDA 3SESA 1Y1ZA 3V89B 3KBRA 2B65A 1WVJA 4OZ9A 3K1MA 4H6DA 2Y7WA 4N6KA 1VR5A 5DT6A 1ZTYA 1MPBA 1B3EA 2QVRA 2AL4A 4BDRA 1EZOA 2QFLA 4OVTA 2DOJA 2DXRA 1LFGA 3IORA 4NAPA 3WAFA 4LONB 3MSTA 4MH5A 4KD5A 1B5IA 2ONKE 1FPGA 3FXUA 4N8YA 5AA2B 3RPLA 1DMBA 2Z23A 2DVZA 4U22A 4DXUA 1GGGA 3TQLA 2O51A 1B9JA 1KZ8A 1P1QA 1RDXA 1WODA 2FYIA 1BK4A 4JVCA 4XKNA 2GRVA 2GHBA 2HFBA 4KYDA 5IZ1A 3VXBA 4OFLA 4G8MA 3AXFA 5M2VA 1XVYA 3MVWA 3R7XA
chains in the Genus database with same CATH topology
4RYAA 3K02A 1PB8A 5AA4A 1BLFA 1IZ1A 3DP6A 1XC1A 1B3HA 2VP1A 2H9BA 3TMGA 4C1TA 3TUSA 3WAEA 2QMXA 2G29A 3DELB 2RC9A 3PPPA 4ONYA 4EQBA 4QRZA 4GIZA 1US5A 3FXRA 1MH3A 3A3UA 1MQGA 4LA9A 2F34A 3UK4A 4R9FA 2R6GE 4Z7EA 4H5FA 4RXLA 3V83A 4U1OA 3C33A 4NWDA 3MJNA 2Q2AA 3DLNA 3S4UA 3ILTB 4TLMB 2HZKA 3Q26A 1MXVA 3TTMA 3B6QA 3PUYE 2I0BA 2OCUA 3C36A 2UVGA 3FJMA 3C9HA 2H5YA 1XS5A 5ISUA 2O69A 2D21A 2F36A 4O3CA 2DS9A 4ECFA 2HXWA 3O66A 3FVKA 3G3KA 3GLBA 3PPOA 4IO6A 4EUOA 3FD3A 5A5XA 1JW1A 1D9YA 1NFTA 4MBPA 3C35A 3T93B 3PUWE 2HQ0A 5BUUA 2QJEA 1B5JA 1US4A 2I49A 3TTRA 5I57B 3V5AA 4F1UA 4XXUA 1URDA 3O29A 3K2DA 3RNNA 2F97A 2A5TB 2XXTA 4NMYA 4P0GA 4F18A 1Y9UA 4JSOA 1B0LA 3IR1A 3CG1A 2DE4A 4JSDA 1NL5A 2H99A 5I56A 4EXLA 1DPPA 4JDFA 4ESWA 2X7QA 3CRBA 4ESXA 2VD2A 2X7PA 4ND9A 5EHSA 2OLBA 3MZBA 2F7BA 1N7XA 4JBZA 4XIGQ 3QIMA 3MWBA 4XKPA 4DLDA 4F31B 3HSTA 3PMXA 3VFJA 3MP8A 4KCDA 4JXIA 1OVBA 2DVCA 4E0XA 3SKPA 1KWHA 3QXMA 3PPQA 4Q30B 1SW2A 5H8QB 2RF1A 3H06B 3G3GA 4LQ5A 1MXXA 3EHTA 3W9VA 2M8CA 3FVNA 1ATGA 2ZXTA 3VE1B 3DP8A 5DEXB 4BDOA 5H8HB 2DQVA 4ZE8A 3OMBA 4FE8A 1H44A 2GHAA 5DTBA 3EF7A 2Q2CA 3K4UA 5I2NA 2XX9A 3K0VA 1SI1A 1DTGA 3JV9A 1VFEA 2HAVA 4JB7A 4OFOA 5TPAA 3VVFA 1LAXA 3HPIA 5AA1A 4GF8A 3FIRA 3S9NC 2XXPA 3UGWA 1JQFA 3BBRA 3T9XB 3KFMA 4NWCA 4U21A 2XXWA 4QFKA 4GXSB 3RTWB 1UQWA 3MZ9A 1P1UA 4DXCA 2PMSA 2THIA 4U2RA 3LC8A 3H6UA 3ILUB 3MBPA 2PT2A 3T9UA 5H8FB 3W9WA 3U92A 2OWSA 5TP9A 2F7AA 3DP4A 2O1LA 3IOWA 2FA7A 4F2OA 4QFNA 2ABHA 3EN3A 5DVFA 3MVYA 1LLSA 1B3LA 4K3FA 3RN8A 4WEDA 5DVIA 2ZNSA 5TPAB 1QW0A 5F1QA 1MM6A 1II5A 3Q25A 4X9TA 1B7HA 3C34A 4RPOA 3PU5A 1XHYA 4DXBA 1NNPA 2Z8DA 1JEUA 3KSXA 5CRYA 3UORA 2DXYA 1IXIA 1NH7A 1LFIA 4YKIA 5ITPA 3PD9A 3TFLA 4POXA 5I58A 5ELVA 1TT1A 4IO4A 4RK2A 4YICA 3E13X 4THIA 4IO7A 2VGQA 5AA3A 4F29A 1H3DA 3JZJA 3CSGA 1SW1A 2P0SA 3FATA 3N5LA 2RC7A 5ICTA 1P1NA 1IXCA 5KZTA 1Y3NA 4JWYA 4GL8A 3FUZA 4Q5TA 4M1VA 5JK4A 4OTEA 5I59A 2Y7RA 4G8NA 2PBWA 5L9OA 1JETA 1GTKA 1DSNA 5JEIA 3CFXA 4AQ4A 1QVSA 1ZLQA 1ZIUA 2UVHA 4X48A 3K6XA 2QS1A 4GRKA 3OSRA 1LB9A 3SEYA 5I58B 4EF2A 3KN7A 4ZECA 4POWA 3TQWA 3O28A 2ZMBA 2R71A 3VLUA 2DWJA 3MZ1A 3HO7A 3PPNA 4OENA 5CMMA 1OLAA 5FTIA 1B3FA 4ZS9A 3MW0A 3S9EA 4LZ8A 2O6AA 1QJMA 5F7VA 3KEIA 2I0CA 4R73A 2DE3A 5I59B 1T0KA 1MY1A 2Y7PA 2ESNA 4H67A 2PVUA 3U1OA 4R74A 1SYIA 4PFTA 2XD2A 1SW4A 5I84A 4QSCA 4X1BA 3IOUA 5JTYB 3OO9A 2ZNTA 3T96B 1IIWA 2Y7IA 2UVJA 1Y1MA 3H6TA 1A8FA 4C0RA 5CBRA 1LAGE 3FVOA 3CVGA 4IB2A 3H6WA 4LQ2A 1PC3A 1MPCA 3PMWA 1SI0A 1LBBA 1USYH 3RGYA 3SETA 1POY1 1B2HA 4LATA 1AIVA 3CFLA 3K01A 3S2VA 4BDNA 1IXHA 3IJXB 1LB8A 4F2QA 4G2ZA 4R6YA 2ZYNA 3HCQA 2XXRA 3GBBA 4IGRA 4R75A 4EDPA 1Z7ME 3SDFA 2QRYA 3VVDA 1BKAA 5H8NA 3IOVA 4F3SA 2HAUA 2ZYMA 3A3CA 4XTCQ 5AA4B 4F19A 1B0HA 3W15C 3C4MA 3G3IA 1D3KA 3N6TA 2REGA 1R9QA 1GVCA 2Z8FA 4QHQA 3SEVA 2NVUB 5DYHA 1UTBA 1MDQA 1POTA 1LCTA 4H0WA 3QSLA 2WKYA 3LSXA 1Y20A 3SEWA 3VLVA 1TWYA 1FTMA 4YAHX 2XXVA 4TLLB 3IL1B 5EYFA 4GL0A 4WKMA 4PFYA 2F5XA 3O6HA 4OFJA 3PUVE 3PPRA 1B05A 4ZEFA 2ONSA 3HHFA 1SVXB 3RUMA 1MG1A 3OEMA 3H3GA 1B51A 5H8NB 4QSDA 4ELRA 1N3WA 4HTGA 3IX1A 4I62A 4KR5A 3T66A 5HM4B 3G3JA 5EHMA 1IQ7A 1FTLA 3H03A 1ZBMA 4PFWA 1QULA 3JYRA 1MH4A 2AL5A 4IO2A 2P1SA 1IEJA 3M8UA 2Z8EA 1UTBB 3USDA 3PMVA 1OMPA 4GVOA 4QFPA 4OQOA 3RT6B 4U23A 4MF3A 2RCAA 3C32A 4F3BA 4FECA 5A5XB 4JWOA 4E0WA 4H1XA 4QF9A 4P11A 1EH3A 1GV8A 3MUQA 3O2AA 1A8EA 4NF8A 2IEEA 1NNTA 2NWJA 2YLNA 3TCGA 1Q1KA 3D4GA 4RK9A 3QUJA 3IB1A 2V3TA 2F35A 1H45A 2UYFA 5FHOA 3THIA 1O63A 3G3FA 4BLAA 3GBAA 3MQ9A 1B4HA 3R6UA 4GD5A 4YU0A 4QSEA 4YMAA 3H7MA 1HSLA 2VOZA 4NF6A 4RA1A 2OJTA 1LSTA 3VXCA 4GQOA 3KN3A 5CMCA 1ELJA 3UIFA 1B5HA 3OOAA 3L6GA 5DVJA 5I56B 1B3GA 2DSFA 1QUJA 3S9MC 5KCJA 1IITA 2QMWA 5AE4A 3KOSA 3HN0A 3U72A 1N3XA 3FJ7A 4NF8B 4H8IA 3GZGA 1O7TA 1A55A 3DM0A 2XX7A 3EHSA 4FEDA 2Q89A 4N6PA 2AIXA 4UACA 4H8JA 1A54A 3LUYA 3FV1A 3CI8A 1QUIA 3IAZA 3IJOB 4G8HA 3RPWA 3CR9A 5IAIA 1YTVA 1PEBA 3B6TA 1UIVA 5KDTA 1EU8A 4NF6B 3M3FA 3FVGA 3MP1A 3IB2A 4IO3A 5I2KA 1B32A 4HW8A 2NUVA 1FQAA 1P99A 3IO4A 4F1YA 2V25A 2V3QA 3QAXA 1I6AA 4PP0A 3ZKKA 5KCJB 2GFEA 5HPQA 1AOVA 4OVJA 4LP2B 1AMFA 1CE2A 2Q8JA 2ZNUA 2QL3A 5I2NB 3OO8A 2H98A 3K6VA 3TTKA 4KHZE 3M3LA 3OELA 3PD8A 4FIMA 1NH8A 3RY3A 3TCFA 3ONMA 1Y3QA 1JW5A 1NKXA 4F22A 3R26A 1SQYA 2I58A 4F1VA 4WXJA 5KDTB 2R9JA 3MVZA 1LAHE 1MQIA 4N07A 4G77A 4IGTA 1F9BA 1VFDA 3MVXA 3PUZE 2DWIA 5CBSA 3FV2A 1MXYA 2F6GA 2ONRA 4F39A 4BDQA 2UVIA 3FASA 5TP9B 1EZ9A 3KJTA 2I3VA 4KYEA 4FAJA 3O9PA 4YKPA 1TFAA 4O3BA 4YB6A 2DYXA 3KG2A 1JEVA 4H65A 4ELPA 5L9MA 3CIJA 3Q28A 1PBQA 3SEXA 4YKKA 2ALUA 4BDMA 4L17A 4R9GA 1AH5A 4PE5B 4R6HA 1IUDA 4FATA 5TU0A 4QFOA 4I8CA 3I5OA 3OO6A 2XXXA 3HHGA 4ELOA 2XXQA 4UA8A 1M5FA 1TFDA 1FQFA 2LAOA 3PV0E 3CSBA 1B1HA 2QPQA 1FTJA 2O1MA 3RT8A 5AA2A 1QKBA 3BFUA 3CFZA 4DDDA 4EXKA 1O64A 4R6KA 3RQTA 1MY0A 2I48A 3TYHA 1MXUA 4ZDMA 4F3GA 1H76A 2NOOA 4NEDA 1SDXA 1OLCA 4R2BA 1I6BA 1B4ZA 2YJPA 1B1XA 4IO5A 3U93A 3FGSA 1XVXA 1Z7NE 5B7DA 1M5EA 3F11A 2CMOA 2CZLA 4OEUA 4U4XA 1EZPA 3QUFA 2PT1A 3ZS6A 5AA2D 2O68A 1LGBC 3B6WA 1S50A 3RTFB 1L5TA 3H4ZA 3IO6A 3S9LC 2IA4A 2XXYA 4YMBA 3N26A 3E4RA 4I1DA 2XXHA 1S9TA 1PBPA 3O6GA 4OERA 4GLIA 5CMBA 3ECRA 4JWXA 1OQGA 3P7IA 3G3HA 2QSXA 1A40A 3PUXE 3I3VA 1B7UA 3TTNA 2ZYKA 4EF1A 4YKJA 1H43A 3IOTA 1SD3A 2ZYOA 3TAJA 4FJPA 1FQBA 1FTKA 1M5CA 4NF5A 2O7UA 3K1NA 4GWOA 1R9LA 4MLVA 1MQJA 4EQ7A 4QFLA 4R2FA 1XOCA 4U4SA 4LUBA 3E9XA 3KN8A 2XXUA 1MDP1 1URSA 4XKQA 3BFTA 4EQ9A 1VE4A 3T9VA 1HSJA 2YPNA 2G93A 4X1DA 3D4CA 3TODA 2E0SA 2D3IA 3B7DA 5I57A 2E1SA 3Q29A 2PYYA 1A99A 4M4GA 4NF5B 3EQ1A 2A5TA 1NNKA 4RY1A 3VLWA 1MY4A 4KFQA 1I6QA 4IY5A 4NTLA 2I4BA 4P0IA 4LZ5A 3E3KA 3KZGA 2XX8A 3MC2A 1PB9A 4XKRA 3TELA 1B7ZA 2V93A 1JVYA 3H6VA 3OO7A 3TDJA 4DIGA 5CC2A 4ZEIA 1B40A 2OWTA 2RCBA 3MPKA 2A5SA 2UYEA 4G68A 4ZZEA 1OVTA 2F6PA 1YCJA 1B58A 1MS7A 2DP8A 4RPNA 5BWJA 1PDAA 1MXWA 2F78A 2V3UA 3TZAA 1DTZA 2QS4A 1R6ZA 4Q0CA 1ZMGA 1BP5A 2XD3A 4OHNA 1ZJLA 5LOMA 1M5BA 1ANFA 4NE4A 2I6EA 4KPTA 1QUKA 2VHAA 5H8QA 1NNFA 1MRPA 1FQEA 3QK6A 2Q9TA 3ZKLA 5CI5A 1M5DA 3TPAA 2HEUA 3GXAA 1RYXA 4PFUA 4FORA 1MQHA 1ZKBA 1LAFE 3SERA 5CMKA 1OIBA 5K2XA 5DEXA 2RC8A 1P1OA 1RKMA 5H8HA 3M3KA 4H5GA 3IK6B 1MPDA 1VSOA 2OZZA 5HBCA 4C1UA 5FHNA 1MY3A 2BJJX 4G68B 2D5WA 1D4NA 1FQCA 5ITOA 1SYHA 1OQHA 2FNCA 3OD7A 4OMBA 1R1NA 4HCYA 4HS7A 3FZVA 4YB7A 1NMUA 4GXAA 3K6WA 3LSFB 3LR1A 4G68C 4GOTA 3N94A 3SEUA 2OK2A 5IKBA 1MY2A 1LBCA 3T22A 2GH9A 3N6UA 2PX1A 1MM7A 4MLQA 1S7YA 2KLFA 3QYTA 1JNFA 1USYE 1UIUA 4YZZA 2QS2A 4ISUA 3T9HB 1UTHA 3TKDA 5H8FA 3CG3A 1BTJA 1XT8A 4DCYA 4F3PA 1FW0A 5CM6A 2Y7KA 2F7CA 4DCXA 1P1WA 4DZ1A 2AYSA 4GFRA 1DPEA 5FTHA 3RLFE 3FJGA 5K2YA 3VVEA 3IB0A 4ZEKA 4NF4A 1QKAA 3MAMA 4TOZA 2O7IA 3KJ7A 3KOTA 2F8DA 4OYVA 2Z22A 3KGCA 3PGFA 5B70A 3OENA 3K00A 3ZSFA 1TXFA 4RJZA 3UA8A 4WEPA 3V8XB 1GR2A 5L9SA 4TQUQ 3HV1A 2VD3A 4AB5A 2UXAA 2XHDA 4R72A 3BKIB 1UTHB 3U94A 1JVXA 1N84A 1RYOA 2W7YA 3TTLA 1FTOA 3LBSA 2OBGA 1HSEA 1I69A 1B46A 2HCAA 5L8DA 4KI0E 3Q27A 3C31A 2Q88A 2ANJA 3MPLA 4ELQA 4ZEDA 2REJA 3FXQA 1B6HA 3LSLA 3VV5A 3K1PA 3O97A 3UN6A 1JW4A 4NF4B 4N13A 1CB6A 5I2KB 4I9DA 4HCWA 3MP6A 3U8QA 3VDFA 1LCFA 2RINA 1PB7A 3G7WA 1ZU0A 4OWDA 2I4CA 4OESA 4LVQA 5J1DA 2X26A 2B3BA 4OETA 1Y3PA 1N76A 4OEVA 5ICQA 4Q8RA 1IXGA 1N04A 4KYSA 1SW5A 1SBPA 3OEKA 3L6HA 3LSWA 2B3FA 4KCCA 1BIYA 1MXZA 5H8SA 3OSQA 3O6IA 2HZLA 4ZEBA 2DWHA 4G4PA 1LFHA 1FQDA 3OXNA 4LZ7A 1YPNA 4YB5A 2Y84A 1B52A 3EHUA 1Q35A 4O3AA 4ZE9A 2RKMA 2QS3A 2NXOA 4PQJA 2V84A 1D9VA 4RNSA 3EPEA 2XXIA 3TEPA 5FHMA 4KQPA 1A7LA 4Z0IA 4PETA 4MFIA 1URGA 3A09A 4AB6A 2DE2A 1YAEA 1N7WA 4IY6A 3TCHA 4FEBA 1J1NA 4OXVA 4U1ZA 3UP9A 2H4IA 2P2AA 3K6UA 5JTYA 4BDLA 2I3WA 3ODBA 1AL3A 2H25A 1Y4CA 1DOTA 3KSJA 1Y4TA 2O84X 3I6VA 1WDNA 1N0TA 1FCKA 2DWAA 4DE8A 4ZZAA 1MQDA 3SESA 1Y1ZA 3V89B 3KBRA 2B65A 1WVJA 4OZ9A 3K1MA 4H6DA 2Y7WA 1VR5A 5DT6A 1ZTYA 1MPBA 1B3EA 2AL4A 4BDRA 1EZOA 2DOJA 2DXRA 1LFGA 3IORA 3WAFA 4LONB 4MH5A 4KD5A 1B5IA 2ONKE 3FXUA 5AA2B 1DMBA 2Z23A 2DVZA 4U22A 4DXUA 1GGGA 3TQLA 2O51A 1B9JA 2FYIA 1P1QA 1WODA 4XKNA 2GRVA 2GHBA 2HFBA 4KYDA 3VXBA 4OFLA 4G8MA 3AXFA 5M2VA 1XVYA 3MVWA 3R7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RYA A;  3K02 A;  1PB8 A;  5AA4 A;  1BLF A;  1IZ1 A;  3DP6 A;  1XC1 A;  1B3H A;  2VP1 A;  2H9B A;  3TMG A;  4C1T A;  3TUS A;  3WAE A;  2QMX A;  2G29 A;  3DEL B;  2RC9 A;  3PPP A;  4ONY A;  4EQB A;  4QRZ A;  4GIZ A;  1US5 A;  3FXR A;  1MH3 A;  3A3U A;  1MQG A;  4LA9 A;  2F34 A;  3UK4 A;  4R9F A;  2R6G E;  4Z7E A;  4H5F A;  4RXL A;  3V83 A;  4U1O A;  3C33 A;  4NWD A;  3MJN A;  2Q2A A;  3DLN A;  3S4U A;  3ILT B;  4TLM B;  2HZK A;  3Q26 A;  1MXV A;  3TTM A;  3B6Q A;  3PUY E;  2I0B A;  2OCU A;  3C36 A;  2UVG A;  3FJM A;  3C9H A;  2H5Y A;  1XS5 A;  5ISU A;  2O69 A;  2D21 A;  2F36 A;  4O3C A;  2DS9 A;  4ECF A;  2HXW A;  3O66 A;  3FVK A;  3G3K A;  3GLB A;  3PPO A;  4IO6 A;  4EUO A;  3FD3 A;  5A5X A;  1JW1 A;  1D9Y A;  1NFT A;  4MBP A;  3C35 A;  3T93 B;  3PUW E;  2HQ0 A;  5BUU A;  2QJE A;  1B5J A;  1US4 A;  2I49 A;  3TTR A;  5I57 B;  3V5A A;  4F1U A;  4XXU A;  1URD A;  3O29 A;  3K2D A;  3RNN A;  2F97 A;  2A5T B;  2XXT A;  4NMY A;  4P0G A;  4F18 A;  1Y9U A;  4JSO A;  1B0L A;  3IR1 A;  3CG1 A;  2DE4 A;  4JSD A;  1NL5 A;  2H99 A;  5I56 A;  4EXL A;  1DPP A;  4JDF A;  4ESW A;  2X7Q A;  3CRB A;  4ESX A;  2VD2 A;  2X7P A;  4ND9 A;  5EHS A;  2OLB A;  3MZB A;  2F7B A;  1N7X A;  4JBZ A;  4XIG Q;  3QIM A;  3MWB A;  4XKP A;  4DLD A;  4F31 B;  3HST A;  3PMX A;  3VFJ A;  3MP8 A;  4KCD A;  4JXI A;  1OVB A;  2DVC A;  4E0X A;  3SKP A;  1KWH A;  3QXM A;  3PPQ A;  4Q30 B;  1SW2 A;  5H8Q B;  2RF1 A;  3H06 B;  3G3G A;  4LQ5 A;  1MXX A;  3EHT A;  3W9V A;  2M8C A;  3FVN A;  1ATG A;  2ZXT A;  3VE1 B;  3DP8 A;  5DEX B;  4BDO A;  5H8H B;  2DQV A;  4ZE8 A;  3OMB A;  4FE8 A;  1H44 A;  2GHA A;  5DTB A;  3EF7 A;  2Q2C A;  3K4U A;  5I2N A;  2XX9 A;  3K0V A;  1SI1 A;  1DTG A;  3JV9 A;  1VFE A;  2HAV A;  4JB7 A;  4OFO A;  5TPA A;  3VVF A;  1LAX A;  3HPI A;  5AA1 A;  4GF8 A;  3FIR A;  3S9N C;  2XXP A;  3UGW A;  1JQF A;  3BBR A;  3T9X B;  3KFM A;  4NWC A;  4U21 A;  2XXW A;  4QFK A;  4GXS B;  3RTW B;  1UQW A;  3MZ9 A;  1P1U A;  4DXC A;  2PMS A;  2THI A;  4U2R A;  3LC8 A;  3H6U A;  3ILU B;  3MBP A;  2PT2 A;  3T9U A;  5H8F B;  3W9W A;  3U92 A;  2OWS A;  5TP9 A;  2F7A A;  3DP4 A;  2O1L A;  3IOW A;  2FA7 A;  4F2O A;  4QFN A;  2ABH A;  3EN3 A;  5DVF A;  3MVY A;  1LLS A;  1B3L A;  4K3F A;  3RN8 A;  4WED A;  5DVI A;  2ZNS A;  5TPA B;  1QW0 A;  5F1Q A;  1MM6 A;  1II5 A;  3Q25 A;  4X9T A;  1B7H A;  3C34 A;  4RPO A;  3PU5 A;  1XHY A;  4DXB A;  1NNP A;  2Z8D A;  1JEU A;  3KSX A;  5CRY A;  3UOR A;  2DXY A;  1IXI A;  1NH7 A;  1LFI A;  4YKI A;  5ITP A;  3PD9 A;  3TFL A;  4POX A;  5I58 A;  5ELV A;  1TT1 A;  4IO4 A;  4RK2 A;  4YIC A;  3E13 X;  4THI A;  4IO7 A;  2VGQ A;  5AA3 A;  4F29 A;  1H3D A;  3JZJ A;  3CSG A;  1SW1 A;  2P0S A;  3FAT A;  3N5L A;  2RC7 A;  5ICT A;  1P1N A;  1IXC A;  5KZT A;  1Y3N A;  4JWY A;  4GL8 A;  3FUZ A;  4Q5T A;  4M1V A;  5JK4 A;  4OTE A;  5I59 A;  2Y7R A;  4G8N A;  2PBW A;  5L9O A;  1JET A;  1GTK A;  1DSN A;  5JEI A;  3CFX A;  4AQ4 A;  1QVS A;  1ZLQ A;  1ZIU A;  2UVH A;  4X48 A;  3K6X A;  2QS1 A;  4GRK A;  3OSR A;  1LB9 A;  3SEY A;  5I58 B;  4EF2 A;  3KN7 A;  4ZEC A;  4POW A;  3TQW A;  3O28 A;  2ZMB A;  2R71 A;  3VLU A;  2DWJ A;  3MZ1 A;  3HO7 A;  3PPN A;  4OEN A;  5CMM A;  1OLA A;  5FTI A;  1B3F A;  4ZS9 A;  3MW0 A;  3S9E A;  4LZ8 A;  2O6A A;  1QJM A;  5F7V A;  3KEI A;  2I0C A;  4R73 A;  2DE3 A;  5I59 B;  1T0K A;  1MY1 A;  2Y7P A;  2ESN A;  4H67 A;  2PVU A;  3U1O A;  4R74 A;  1SYI A;  4PFT A;  2XD2 A;  1SW4 A;  5I84 A;  4QSC A;  4X1B A;  3IOU A;  5JTY B;  3OO9 A;  2ZNT A;  3T96 B;  1IIW A;  2Y7I A;  2UVJ A;  1Y1M A;  3H6T A;  1A8F A;  4C0R A;  5CBR A;  1LAG E;  3FVO A;  3CVG A;  4IB2 A;  3H6W A;  4LQ2 A;  1PC3 A;  1MPC A;  3PMW A;  1SI0 A;  1LBB A;  1USY H;  3RGY A;  3SET A;  1POY 1;  1B2H A;  4LAT A;  1AIV A;  3CFL A;  3K01 A;  3S2V A;  4BDN A;  1IXH A;  3IJX B;  1LB8 A;  4F2Q A;  4G2Z A;  4R6Y A;  2ZYN A;  3HCQ A;  2XXR A;  3GBB A;  4IGR A;  4R75 A;  4EDP A;  1Z7M E;  3SDF A;  2QRY A;  3VVD A;  1BKA A;  5H8N A;  3IOV A;  4F3S A;  2HAU A;  2ZYM A;  3A3C A;  4XTC Q;  5AA4 B;  4F19 A;  1B0H A;  3W15 C;  3C4M A;  3G3I A;  1D3K A;  3N6T A;  2REG A;  1R9Q A;  1GVC A;  2Z8F A;  4QHQ A;  3SEV A;  2NVU B;  5DYH A;  1UTB A;  1MDQ A;  1POT A;  1LCT A;  4H0W A;  3QSL A;  2WKY A;  3LSX A;  1Y20 A;  3SEW A;  3VLV A;  1TWY A;  1FTM A;  4YAH X;  2XXV A;  4TLL B;  3IL1 B;  5EYF A;  4GL0 A;  4WKM A;  4PFY A;  2F5X A;  3O6H A;  4OFJ A;  3PUV E;  3PPR A;  1B05 A;  4ZEF A;  2ONS A;  3HHF A;  1SVX B;  3RUM A;  1MG1 A;  3OEM A;  3H3G A;  1B51 A;  5H8N B;  4QSD A;  4ELR A;  1N3W A;  4HTG A;  3IX1 A;  4I62 A;  4KR5 A;  3T66 A;  5HM4 B;  3G3J A;  5EHM A;  1IQ7 A;  1FTL A;  3H03 A;  1ZBM A;  4PFW A;  1QUL A;  3JYR A;  1MH4 A;  2AL5 A;  4IO2 A;  2P1S A;  1IEJ A;  3M8U A;  2Z8E A;  1UTB B;  3USD A;  3PMV A;  1OMP A;  4GVO A;  4QFP A;  4OQO A;  3RT6 B;  4U23 A;  4MF3 A;  2RCA A;  3C32 A;  4F3B A;  4FEC A;  5A5X B;  4JWO A;  4E0W A;  4H1X A;  4QF9 A;  4P11 A;  1EH3 A;  1GV8 A;  3MUQ A;  3O2A A;  1A8E A;  4NF8 A;  2IEE A;  1NNT A;  2NWJ A;  2YLN A;  3TCG A;  1Q1K A;  3D4G A;  4RK9 A;  3QUJ A;  3IB1 A;  2V3T A;  2F35 A;  1H45 A;  2UYF A;  5FHO A;  3THI A;  1O63 A;  3G3F A;  4BLA A;  3GBA A;  3MQ9 A;  1B4H A;  3R6U A;  4GD5 A;  4YU0 A;  4QSE A;  4YMA A;  3H7M A;  1HSL A;  2VOZ A;  4NF6 A;  4RA1 A;  2OJT A;  1LST A;  3VXC A;  4GQO A;  3KN3 A;  5CMC A;  1ELJ A;  3UIF A;  1B5H A;  3OOA A;  3L6G A;  5DVJ A;  5I56 B;  1B3G A;  2DSF A;  1QUJ A;  3S9M C;  5KCJ A;  1IIT A;  2QMW A;  5AE4 A;  3KOS A;  3HN0 A;  3U72 A;  1N3X A;  3FJ7 A;  4NF8 B;  4H8I A;  3GZG A;  1O7T A;  1A55 A;  3DM0 A;  2XX7 A;  3EHS A;  4FED A;  2Q89 A;  4N6P A;  2AIX A;  4UAC A;  4H8J A;  1A54 A;  3LUY A;  3FV1 A;  3CI8 A;  1QUI A;  3IAZ A;  3IJO B;  4G8H A;  3RPW A;  3CR9 A;  5IAI A;  1YTV A;  1PEB A;  3B6T A;  1UIV A;  5KDT A;  1EU8 A;  4NF6 B;  3M3F A;  3FVG A;  3MP1 A;  3IB2 A;  4IO3 A;  5I2K A;  1B32 A;  4HW8 A;  2NUV A;  1FQA A;  1P99 A;  3IO4 A;  4F1Y A;  2V25 A;  2V3Q A;  3QAX A;  1I6A A;  4PP0 A;  3ZKK A;  5KCJ B;  2GFE A;  5HPQ A;  1AOV A;  4OVJ A;  4LP2 B;  1AMF A;  1CE2 A;  2Q8J A;  2ZNU A;  2QL3 A;  5I2N B;  3OO8 A;  2H98 A;  3K6V A;  3TTK A;  4KHZ E;  3M3L A;  3OEL A;  3PD8 A;  4FIM A;  1NH8 A;  3RY3 A;  3TCF A;  3ONM A;  1Y3Q A;  1JW5 A;  1NKX A;  4F22 A;  3R26 A;  1SQY A;  2I58 A;  4F1V A;  4WXJ A;  5KDT B;  2R9J A;  3MVZ A;  1LAH E;  1MQI A;  4N07 A;  4G77 A;  4IGT A;  1F9B A;  1VFD A;  3MVX A;  3PUZ E;  2DWI A;  5CBS A;  3FV2 A;  1MXY A;  2F6G A;  2ONR A;  4F39 A;  4BDQ A;  2UVI A;  3FAS A;  5TP9 B;  1EZ9 A;  3KJT A;  2I3V A;  4KYE A;  4FAJ A;  3O9P A;  4YKP A;  1TFA A;  4O3B A;  4YB6 A;  2DYX A;  3KG2 A;  1JEV A;  4H65 A;  4ELP A;  5L9M A;  3CIJ A;  3Q28 A;  1PBQ A;  3SEX A;  4YKK A;  2ALU A;  4BDM A;  4L17 A;  4R9G A;  1AH5 A;  4PE5 B;  4R6H A;  1IUD A;  4FAT A;  5TU0 A;  4QFO A;  4I8C A;  3I5O A;  3OO6 A;  2XXX A;  3HHG A;  4ELO A;  2XXQ A;  4UA8 A;  1M5F A;  1TFD A;  1FQF A;  2LAO A;  3PV0 E;  3CSB A;  1B1H A;  2QPQ A;  1FTJ A;  2O1M A;  3RT8 A;  5AA2 A;  1QKB A;  3BFU A;  3CFZ A;  4DDD A;  4EXK A;  1O64 A;  4R6K A;  3RQT A;  1MY0 A;  2I48 A;  3TYH A;  1MXU A;  4ZDM A;  4F3G A;  1H76 A;  2NOO A;  4NED A;  1SDX A;  1OLC A;  4R2B A;  1I6B A;  1B4Z A;  2YJP A;  1B1X A;  4IO5 A;  3U93 A;  3FGS A;  1XVX A;  1Z7N E;  5B7D A;  1M5E A;  3F11 A;  2CMO A;  2CZL A;  4OEU A;  4U4X A;  1EZP A;  3QUF A;  2PT1 A;  3ZS6 A;  5AA2 D;  2O68 A;  1LGB C;  3B6W A;  1S50 A;  3RTF B;  1L5T A;  3H4Z A;  3IO6 A;  3S9L C;  2IA4 A;  2XXY A;  4YMB A;  3N26 A;  3E4R A;  4I1D A;  2XXH A;  1S9T A;  1PBP A;  3O6G A;  4OER A;  4GLI A;  5CMB A;  3ECR A;  4JWX A;  1OQG A;  3P7I A;  3G3H A;  2QSX A;  1A40 A;  3PUX E;  3I3V A;  1B7U A;  3TTN A;  2ZYK A;  4EF1 A;  4YKJ A;  1H43 A;  3IOT A;  1SD3 A;  2ZYO A;  3TAJ A;  4FJP A;  1FQB A;  1FTK A;  1M5C A;  4NF5 A;  2O7U A;  3K1N A;  4GWO A;  1R9L A;  4MLV A;  1MQJ A;  4EQ7 A;  4QFL A;  4R2F A;  1XOC A;  4U4S A;  4LUB A;  3E9X A;  3KN8 A;  2XXU A;  1MDP 1;  1URS A;  4XKQ A;  3BFT A;  4EQ9 A;  1VE4 A;  3T9V A;  1HSJ A;  2YPN A;  2G93 A;  4X1D A;  3D4C A;  3TOD A;  2E0S A;  2D3I A;  3B7D A;  5I57 A;  2E1S A;  3Q29 A;  2PYY A;  1A99 A;  4M4G A;  4NF5 B;  3EQ1 A;  2A5T A;  1NNK A;  4RY1 A;  3VLW A;  1MY4 A;  4KFQ A;  1I6Q A;  4IY5 A;  4NTL A;  2I4B A;  4P0I A;  4LZ5 A;  3E3K A;  3KZG A;  2XX8 A;  3MC2 A;  1PB9 A;  4XKR A;  3TEL A;  1B7Z A;  2V93 A;  1JVY A;  3H6V A;  3OO7 A;  3TDJ A;  4DIG A;  5CC2 A;  4ZEI A;  1B40 A;  2OWT A;  2RCB A;  3MPK A;  2A5S A;  2UYE A;  4G68 A;  4ZZE A;  1OVT A;  2F6P A;  1YCJ A;  1B58 A;  1MS7 A;  2DP8 A;  4RPN A;  5BWJ A;  1PDA A;  1MXW A;  2F78 A;  2V3U A;  3TZA A;  1DTZ A;  2QS4 A;  1R6Z A;  4Q0C A;  1ZMG A;  1BP5 A;  2XD3 A;  4OHN A;  1ZJL A;  5LOM A;  1M5B A;  1ANF A;  4NE4 A;  2I6E A;  4KPT A;  1QUK A;  2VHA A;  5H8Q A;  1NNF A;  1MRP A;  1FQE A;  3QK6 A;  2Q9T A;  3ZKL A;  5CI5 A;  1M5D A;  3TPA A;  2HEU A;  3GXA A;  1RYX A;  4PFU A;  4FOR A;  1MQH A;  1ZKB A;  1LAF E;  3SER A;  5CMK A;  1OIB A;  5K2X A;  5DEX A;  2RC8 A;  1P1O A;  1RKM A;  5H8H A;  3M3K A;  4H5G A;  3IK6 B;  1MPD A;  1VSO A;  2OZZ A;  5HBC A;  4C1U A;  5FHN A;  1MY3 A;  2BJJ X;  4G68 B;  2D5W A;  1D4N A;  1FQC A;  5ITO A;  1SYH A;  1OQH A;  2FNC A;  3OD7 A;  4OMB A;  1R1N A;  4HCY A;  4HS7 A;  3FZV A;  4YB7 A;  1NMU A;  4GXA A;  3K6W A;  3LSF B;  3LR1 A;  4G68 C;  4GOT A;  3N94 A;  3SEU A;  2OK2 A;  5IKB A;  1MY2 A;  1LBC A;  3T22 A;  2GH9 A;  3N6U A;  2PX1 A;  1MM7 A;  4MLQ A;  1S7Y A;  2KLF A;  3QYT A;  1JNF A;  1USY E;  1UIU A;  4YZZ A;  2QS2 A;  4ISU A;  3T9H B;  1UTH A;  3TKD A;  5H8F A;  3CG3 A;  1BTJ A;  1XT8 A;  4DCY A;  4F3P A;  1FW0 A;  5CM6 A;  2Y7K A;  2F7C A;  4DCX A;  1P1W A;  4DZ1 A;  2AYS A;  4GFR A;  1DPE A;  5FTH A;  3RLF E;  3FJG A;  5K2Y A;  3VVE A;  3IB0 A;  4ZEK A;  4NF4 A;  1QKA A;  3MAM A;  4TOZ A;  2O7I A;  3KJ7 A;  3KOT A;  2F8D A;  4OYV A;  2Z22 A;  3KGC A;  3PGF A;  5B70 A;  3OEN A;  3K00 A;  3ZSF A;  1TXF A;  4RJZ A;  3UA8 A;  4WEP A;  3V8X B;  1GR2 A;  5L9S A;  4TQU Q;  3HV1 A;  2VD3 A;  4AB5 A;  2UXA A;  2XHD A;  4R72 A;  3BKI B;  1UTH B;  3U94 A;  1JVX A;  1N84 A;  1RYO A;  2W7Y A;  3TTL A;  1FTO A;  3LBS A;  2OBG A;  1HSE A;  1I69 A;  1B46 A;  2HCA A;  5L8D A;  4KI0 E;  3Q27 A;  3C31 A;  2Q88 A;  2ANJ A;  3MPL A;  4ELQ A;  4ZED A;  2REJ A;  3FXQ A;  1B6H A;  3LSL A;  3VV5 A;  3K1P A;  3O97 A;  3UN6 A;  1JW4 A;  4NF4 B;  4N13 A;  1CB6 A;  5I2K B;  4I9D A;  4HCW A;  3MP6 A;  3U8Q A;  3VDF A;  1LCF A;  2RIN A;  1PB7 A;  3G7W A;  1ZU0 A;  4OWD A;  2I4C A;  4OES A;  4LVQ A;  5J1D A;  2X26 A;  2B3B A;  4OET A;  1Y3P A;  1N76 A;  4OEV A;  5ICQ A;  4Q8R A;  1IXG A;  1N04 A;  4KYS A;  1SW5 A;  1SBP A;  3OEK A;  3L6H A;  3LSW A;  2B3F A;  4KCC A;  1BIY A;  1MXZ A;  5H8S A;  3OSQ A;  3O6I A;  2HZL A;  4ZEB A;  2DWH A;  4G4P A;  1LFH A;  1FQD A;  3OXN A;  4LZ7 A;  1YPN A;  4YB5 A;  2Y84 A;  1B52 A;  3EHU A;  1Q35 A;  4O3A A;  4ZE9 A;  2RKM A;  2QS3 A;  2NXO A;  4PQJ A;  2V84 A;  1D9V A;  4RNS A;  3EPE A;  2XXI A;  3TEP A;  5FHM A;  4KQP A;  1A7L A;  4Z0I A;  4PET A;  4MFI A;  1URG A;  3A09 A;  4AB6 A;  2DE2 A;  1YAE A;  1N7W A;  4IY6 A;  3TCH A;  4FEB A;  1J1N A;  4OXV A;  4U1Z A;  3UP9 A;  2H4I A;  2P2A A;  3K6U A;  5JTY A;  4BDL A;  2I3W A;  3ODB A;  1AL3 A;  2H25 A;  1Y4C A;  1DOT A;  3KSJ A;  1Y4T A;  2O84 X;  3I6V A;  1WDN A;  1N0T A;  1FCK A;  2DWA A;  4DE8 A;  4ZZA A;  1MQD A;  3SES A;  1Y1Z A;  3V89 B;  3KBR A;  2B65 A;  1WVJ A;  4OZ9 A;  3K1M A;  4H6D A;  2Y7W A;  1VR5 A;  5DT6 A;  1ZTY A;  1MPB A;  1B3E A;  2AL4 A;  4BDR A;  1EZO A;  2DOJ A;  2DXR A;  1LFG A;  3IOR A;  3WAF A;  4LON B;  4MH5 A;  4KD5 A;  1B5I A;  2ONK E;  3FXU A;  5AA2 B;  1DMB A;  2Z23 A;  2DVZ A;  4U22 A;  4DXU A;  1GGG A;  3TQL A;  2O51 A;  1B9J A;  2FYI A;  1P1Q A;  1WOD A;  4XKN A;  2GRV A;  2GHB A;  2HFB A;  4KYD A;  3VXB A;  4OFL A;  4G8M A;  3AXF A;  5M2V A;  1XVY A;  3MVW A;  3R7X A; 
#chains in the Genus database with same CATH topology
 2XA5 A;  4RYA A;  3K02 A;  1PB8 A;  5AA4 A;  1BLF A;  1IZ1 A;  3DP6 A;  1XC1 A;  3B8B A;  1B3H A;  2VP1 A;  2H9B A;  3TMG A;  4C1T A;  1LBX A;  4OVR A;  2P3V A;  3TUS A;  3WAE A;  2QMX A;  2G29 A;  3DEL B;  2RC9 A;  3PPP A;  4ONY A;  4EQB A;  4QRZ A;  4GIZ A;  1US5 A;  4GWZ A;  3FXR A;  1CNQ A;  2MKZ A;  1MH3 A;  3A3U A;  1MQG A;  1NV7 A;  4LA9 A;  4MJO A;  2F34 A;  3UK4 A;  4R9F A;  4IR8 A;  2R6G E;  4Z7E A;  4H5F A;  1VDW A;  4RXL A;  3V83 A;  4U1O A;  2ZZX A;  3C33 A;  4NWD A;  3MJN A;  2Q2A A;  3DLN A;  3S4U A;  3ILT B;  4TLM B;  2HZK A;  3Q26 A;  1MXV A;  3TTM A;  3B6Q A;  1FBH A;  3PUY E;  2I0B A;  2OCU A;  3C36 A;  2UVG A;  3FJM A;  3C9H A;  2H5Y A;  1XS5 A;  5ISU A;  4OVQ A;  2O69 A;  2D21 A;  2F36 A;  4O3C A;  3GYY A;  2DS9 A;  4ECF A;  2HXW A;  3O66 A;  3FVK A;  3G3K A;  3GLB A;  3PPO A;  4IO6 A;  4EUO A;  3FD3 A;  5A5X A;  1JW1 A;  1D9Y A;  1NFT A;  4MBP A;  3C35 A;  3T93 B;  3PUW E;  2HQ0 A;  5BUU A;  2QJE A;  1B5J A;  1US4 A;  2I49 A;  3TTR A;  5I57 B;  4PC9 A;  2WEF A;  3V5A A;  4GWS A;  2VPO A;  4F1U A;  4XXU A;  1URD A;  3O29 A;  2PFY A;  2CZI A;  3K2D A;  1DBZ A;  3RNN A;  2F97 A;  2A5T B;  2XXT A;  4NMY A;  4P0G A;  4F18 A;  1Y9U A;  4JSO A;  1B0L A;  3IR1 A;  1FBP A;  3CG1 A;  2DE4 A;  4JSD A;  1NL5 A;  2GQ1 A;  2H99 A;  5I56 A;  4EXL A;  1DPP A;  4PAI A;  4JDF A;  2B4M A;  4ESW A;  2X7Q A;  3CRB A;  5LTC A;  4ESX A;  2VD2 A;  2X7P A;  4ND9 A;  5EHS A;  2OLB A;  3MZB A;  2F7B A;  1N7X A;  4JBZ A;  4XIG Q;  3QIM A;  4QBA A;  3MWB A;  4XKP A;  4DLD A;  3HST A;  3PMX A;  4F31 B;  3VFJ A;  3MP8 A;  5ESY A;  3BIG A;  4KCD A;  4JXI A;  1G0I A;  1IMB A;  1OVB A;  2DVC A;  4E0X A;  3SKP A;  1KWH A;  3QXM A;  3PPQ A;  4Q30 B;  1SW2 A;  5H8Q B;  2RF1 A;  3H06 B;  3G3G A;  4OVP A;  4LQ5 A;  1MXX A;  3EHT A;  3W9V A;  2M8C A;  5ET6 A;  5EYG A;  1XI6 A;  3FVN A;  1ATG A;  2ZXT A;  3VE1 B;  3DP8 A;  5DEX B;  4BDO A;  5H8H B;  5I7I A;  2DQV A;  4P47 A;  4ZE8 A;  3OMB A;  4FE8 A;  1H44 A;  2GHA A;  4GWW A;  5DTB A;  3EF7 A;  2Q2C A;  3K4U A;  5I2N A;  4MMP A;  1NI9 A;  4UAB A;  2XX9 A;  3K0V A;  1SI1 A;  1DTG A;  3JV9 A;  1VFE A;  2F3D A;  2HAV A;  4JB7 A;  4I40 A;  4OFO A;  5TPA A;  3VVF A;  1LAX A;  3HPI A;  5AA1 A;  4PBQ A;  4GF8 A;  3FIR A;  3S9N C;  2XXP A;  3UGW A;  1JQF A;  3BBR A;  2WBD A;  3E78 A;  3T9X B;  5ET8 A;  3KFM A;  4NWC A;  4U21 A;  2XXW A;  4QFK A;  4GXS B;  3RTW B;  1UQW A;  3MZ9 A;  1P1U A;  4DXC A;  2PMS A;  2THI A;  4U2R A;  3LC8 A;  3H6U A;  3ILU B;  3MBP A;  2PT2 A;  3T9U A;  1FPD A;  2Y5L A;  5H8F B;  3W9W A;  3U92 A;  4N8G A;  4OVS A;  2OWS A;  2PCR A;  5TP9 A;  2F7A A;  3DP4 A;  2O1L A;  4AS4 A;  1K9Z A;  3IOW A;  2FA7 A;  4F2O A;  4QFN A;  4MNC A;  2ABH A;  3EN3 A;  5DVF A;  3MVY A;  1LLS A;  1B3L A;  4K3F A;  4NGU A;  3RN8 A;  4WED A;  5DVI A;  2ZNS A;  5TPA B;  1QW0 A;  5F1Q A;  1MM6 A;  1II5 A;  3Q25 A;  4X9T A;  1B7H A;  3C34 A;  4RPO A;  4MEV A;  5EQ8 A;  3PU5 A;  1QGX A;  2XXK A;  1FPL A;  1XHY A;  4PAF A;  4DXB A;  1NNP A;  2Z8D A;  1JEU A;  3KSX A;  5CRY A;  3UOR A;  2DXY A;  1IXI A;  1NH7 A;  1D9Q A;  1LFI A;  4YKI A;  5ITP A;  4GX4 A;  3PD9 A;  3TFL A;  4POX A;  4PFB A;  5I58 A;  5ELV A;  4OA4 A;  1TT1 A;  4IO4 A;  3CHG A;  4RK2 A;  4YIC A;  3E13 X;  2HPG A;  4THI A;  4IO7 A;  2VGQ A;  1FPJ A;  5AA3 A;  4F29 A;  1H3D A;  3JZJ A;  3CSG A;  1SW1 A;  2P0S A;  3FAT A;  3N5L A;  2RC7 A;  5ICT A;  1P1N A;  5A5L A;  4N6D A;  1IXC A;  5KZT A;  1Y3N A;  4JWY A;  4GL8 A;  1FPE A;  3FUZ A;  4Q5T A;  4M1V A;  1FPK A;  5JK4 A;  4N17 A;  4OTE A;  5I59 A;  5EQ7 A;  2Y7R A;  4G8N A;  2PBW A;  1FBD A;  5L9O A;  1JET A;  1GTK A;  1DSN A;  2VT5 A;  5JEI A;  3CFX A;  4AQ4 A;  1QVS A;  1ZLQ A;  1ZIU A;  2UVH A;  5T3J A;  4X48 A;  3K6X A;  2QS1 A;  4GRK A;  3OSR A;  1LB9 A;  3SEY A;  5I58 B;  4EF2 A;  1IMD A;  3KN7 A;  4ZEC A;  4POW A;  3TQW A;  3O28 A;  1IMC A;  2ZMB A;  2R71 A;  3VLU A;  2DWJ A;  3MZ1 A;  5FBP A;  3HO7 A;  3PPN A;  4OEN A;  5CMM A;  1NV4 A;  1OLA A;  5FTI A;  1B3F A;  1DK4 A;  1YXI A;  4ZS9 A;  3MW0 A;  3S9E A;  4LZ8 A;  2O6A A;  1QJM A;  5F7V A;  3KEI A;  1NV6 A;  4PFR A;  2I0C A;  4R73 A;  2DE3 A;  5I59 B;  1T0K A;  1MY1 A;  1YYZ A;  2Y7P A;  2ESN A;  4PF8 A;  1KA1 A;  4H67 A;  2CEX A;  2PVU A;  3U1O A;  4R74 A;  1SYI A;  4PFT A;  2XD2 A;  1SW4 A;  5I84 A;  4QSC A;  4X1B A;  3IOU A;  1FBF A;  5JTY B;  3OO9 A;  3FBP A;  2ZNT A;  3T96 B;  1IIW A;  4MAG A;  2Y7I A;  2UVJ A;  4NG7 A;  4OAN A;  2Y5K A;  1Y1M A;  3H6T A;  1A8F A;  4C0R A;  4GWU A;  5CBR A;  1LAG E;  4MCO A;  3FVO A;  1NUW A;  3CVG A;  3MYU A;  4IB2 A;  5EYH A;  3H6W A;  2QVV A;  4LQ2 A;  4FBP A;  1PC3 A;  1MPC A;  3PMW A;  5IZ3 A;  1SI0 A;  1LBB A;  1USY H;  3RGY A;  3SET A;  4PAK A;  4PDH A;  1POY 1;  1B2H A;  4LAT A;  1EYI A;  1AIV A;  3CFL A;  3K01 A;  4AS5 A;  3S2V A;  4BDN A;  1IXH A;  2XWI A;  3IJX B;  1LB8 A;  4F2Q A;  4G2Z A;  4R6Y A;  2ZYN A;  3RPL B;  1NUZ A;  4PE3 A;  3HCQ A;  2XXR A;  3ROJ A;  3GBB A;  4IGR A;  4R75 A;  4EDP A;  1Z7M E;  3SDF A;  2QRY A;  3VVD A;  1BKA A;  5H8N A;  3IOV A;  4F3S A;  2HAU A;  1NV1 A;  2ZYM A;  3A3C A;  4XTC Q;  2HXR A;  5AA4 B;  3LUZ A;  1INP A;  2FIE A;  4H45 A;  4F19 A;  1B0H A;  3W15 C;  3C4M A;  3G3I A;  1D3K A;  3N6T A;  4GX3 A;  2REG A;  1R9Q A;  1GVC A;  2Z8F A;  4QHQ A;  3SEV A;  2NVU B;  5DYH A;  1UTB A;  1MDQ A;  1POT A;  1LCT A;  4H0W A;  3QSL A;  2WKY A;  2CZK A;  3LSX A;  1Y20 A;  5IM2 A;  3SEW A;  3VLV A;  1TWY A;  4O8M A;  1FTM A;  2Q74 A;  4YAH X;  2XXV A;  4TLL B;  4NN3 A;  3IL1 B;  5EYF A;  4GL0 A;  4WKM A;  4PFY A;  2F5X A;  3O6H A;  3B50 A;  4OFJ A;  3PUV E;  5I5P A;  1NUX A;  3PPR A;  4GX6 A;  1B05 A;  4ZEF A;  2ONS A;  3HHF A;  1SVX B;  1LBZ A;  3RUM A;  1MG1 A;  3OEM A;  3H3G A;  1B51 A;  5H8N B;  4QSD A;  1LBY A;  4ELR A;  1N3W A;  1RDZ A;  4HTG A;  3IX1 A;  4I62 A;  4KR5 A;  3T66 A;  5HM4 B;  3G3J A;  5EHM A;  1IQ7 A;  1FTL A;  3H03 A;  1ZBM A;  4PFW A;  1QUL A;  3JYR A;  2VPN A;  1MH4 A;  2AL5 A;  4IO2 A;  2ZZV A;  2P1S A;  1IEJ A;  3M8U A;  2Z8E A;  5ET7 A;  1UTB B;  3USD A;  3PMV A;  1OMP A;  4GVO A;  4QFP A;  4I3E A;  4OQO A;  3RT6 B;  4XFE A;  4U23 A;  4MF3 A;  2RCA A;  3C32 A;  4F3B A;  4FEC A;  5EQA A;  4JWO A;  4E0W A;  5A5X B;  3QMF A;  4H1X A;  3T0J A;  4QF9 A;  4P11 A;  1EH3 A;  1GV8 A;  3MUQ A;  3O2A A;  1A8E A;  4KXP A;  4NF8 A;  2IEE A;  1NNT A;  2NWJ A;  2YLN A;  3TCG A;  1Q1K A;  3D4G A;  4RK9 A;  3QUJ A;  3IB1 A;  2V3T A;  2F35 A;  1H45 A;  2UYF A;  2P3N A;  5FHO A;  3THI A;  1O63 A;  3G3F A;  4BLA A;  1Q9D A;  3GBA A;  3MQ9 A;  1B4H A;  2WX9 A;  3R6U A;  4GD5 A;  4YU0 A;  4PCD A;  4O7I A;  4QSE A;  4YMA A;  3H7M A;  1HSL A;  4HE1 A;  2VOZ A;  4NF6 A;  4RA1 A;  2OJT A;  1LST A;  3VXC A;  4GQO A;  3KN3 A;  4QXD A;  5CMC A;  1ELJ A;  3EKI A;  1B5H A;  3OOA A;  3UIF A;  3L6G A;  5DVJ A;  5I56 B;  1B3G A;  2DSF A;  1QUJ A;  3S9M C;  5KCJ A;  1IIT A;  2QMW A;  4N81 A;  5AE4 A;  3KOS A;  3HN0 A;  3U72 A;  1N3X A;  3FJ7 A;  4NF8 B;  4H8I A;  3GZG A;  1O7T A;  3PTY A;  1A55 A;  3DM0 A;  3E79 A;  2XX7 A;  3EHS A;  4FED A;  2Q89 A;  4N6P A;  2AIX A;  4UAC A;  4H8J A;  1A54 A;  3LUY A;  3FV1 A;  3CI8 A;  1QUI A;  3IAZ A;  3IJO B;  4G8H A;  3RPW A;  3CR9 A;  5IAI A;  1YTV A;  1PEB A;  1IME A;  3B6T A;  1UIV A;  5KDT A;  1EU8 A;  4NF6 B;  3M3F A;  3FVG A;  1FJ9 A;  3MP1 A;  1SPI A;  3IB2 A;  4IO3 A;  5I2K A;  1B32 A;  4HW8 A;  4MNI A;  2B4L A;  2NUV A;  1FQA A;  1P99 A;  4NF0 A;  2F3B A;  3IO4 A;  4F1Y A;  2V25 A;  2V3Q A;  3QAX A;  1I6A A;  4PP0 A;  3KC0 A;  3ZKK A;  5KCJ B;  2GFE A;  5HPQ A;  1AOV A;  4OVJ A;  4LP2 B;  1AMF A;  1CE2 A;  2Q8J A;  2ZNU A;  2QL3 A;  5I2N B;  3OO8 A;  2H98 A;  1NV0 A;  3K6V A;  3TTK A;  4KHZ E;  3M3L A;  3OEL A;  3PD8 A;  4FIM A;  2L5V A;  4P8B A;  1NH8 A;  3RY3 A;  3TCF A;  1IMF A;  3KBZ A;  3ONM A;  1Y3Q A;  1JW5 A;  1EYJ A;  1NKX A;  4F22 A;  3R26 A;  1SQY A;  2I58 A;  4F1V A;  4WXJ A;  5KDT B;  2R9J A;  3MVZ A;  1LAH E;  1MQI A;  1K9Y A;  4N07 A;  4G77 A;  3T1B A;  4IGT A;  4GBV A;  4GWX A;  1F9B A;  1VFD A;  3MVX A;  3PUZ E;  2DWI A;  5CBS A;  3FV2 A;  1MXY A;  2DDK A;  2KQZ A;  2F6G A;  2ONR A;  4F39 A;  4BDQ A;  2FIX A;  4HE2 A;  2UVI A;  3FAS A;  5TP9 B;  1EZ9 A;  4HXV A;  3KJT A;  2I3V A;  4KYE A;  5EQ9 A;  4FAJ A;  3O9P A;  4YKP A;  1TFA A;  4O3B A;  4YB6 A;  2DYX A;  3KG2 A;  1JEV A;  4H65 A;  1FPB A;  4ELP A;  5L9M A;  3CIJ A;  3Q28 A;  1PBQ A;  2WYP A;  3SEX A;  4YKK A;  2ALU A;  4BDM A;  4L17 A;  3BIH A;  4R9G A;  1AH5 A;  4PE5 B;  4R6H A;  1IUD A;  4FAT A;  5TU0 A;  4QFO A;  4I8C A;  5LDZ A;  3I5O A;  3OO6 A;  4P1L A;  3FXB A;  2XXX A;  3HHG A;  4ELO A;  2XXQ A;  4UA8 A;  1M5F A;  1TFD A;  1FQF A;  2LAO A;  3PV0 E;  3CSB A;  1B1H A;  5IGA A;  2QPQ A;  1FTJ A;  2O1M A;  3RT8 A;  5AA2 A;  1QKB A;  3BFU A;  3CFZ A;  4DDD A;  4EXK A;  1O64 A;  4R6K A;  3RQT A;  1MY0 A;  2I48 A;  3TYH A;  1MXU A;  4PF6 A;  4ZDM A;  4F3G A;  1H76 A;  4NHB A;  2NOO A;  4NED A;  1SDX A;  1OLC A;  4R2B A;  1I6B A;  1B4Z A;  2YJP A;  1B1X A;  4IO5 A;  3U93 A;  3FGS A;  1XVX A;  1Z7N E;  1M5E A;  3F11 A;  5B7D A;  2CMO A;  2CZL A;  4OEU A;  4U4X A;  1EZP A;  3QUF A;  2PT1 A;  3ZS6 A;  2Q8M A;  5AA2 D;  2O68 A;  1LGB C;  3B6W A;  1S50 A;  3RTF B;  1L5T A;  3H4Z A;  3IO6 A;  4MNP A;  3S9L C;  2IA4 A;  2XXY A;  4YMB A;  3N26 A;  3E4R A;  4I1D A;  1FBG A;  2XXH A;  1S9T A;  1PBP A;  3O6G A;  4OER A;  4GLI A;  5CMB A;  3ECR A;  4JWX A;  4NX1 A;  1OQG A;  3P7I A;  3G3H A;  2QSX A;  2KR0 A;  1A40 A;  3PUX E;  1EYK A;  2ZZW A;  3A29 A;  3I3V A;  1B7U A;  3TTN A;  1FBC A;  2ZYK A;  4EF1 A;  4YKJ A;  1H43 A;  3IOT A;  1SD3 A;  2ZYO A;  3TAJ A;  4FJP A;  4LN5 A;  1FQB A;  1FTK A;  1M5C A;  4NF5 A;  4HE0 A;  2O7U A;  3K1N A;  4GWO A;  1R9L A;  5ET5 A;  4MLV A;  1MQJ A;  4R2F A;  4QFL A;  4EQ7 A;  1XOC A;  4DI4 B;  4U4S A;  4LUB A;  4MHF A;  3E9X A;  3KN8 A;  1JP4 A;  3IFC A;  2XXU A;  1MDP 1;  1URS A;  4XKQ A;  3BFT A;  4EQ9 A;  1VE4 A;  3T9V A;  1HSJ A;  1LBW A;  1KA0 A;  2YPN A;  4X04 A;  2G93 A;  4X1D A;  3D4C A;  1FBE A;  3TOD A;  2BJI A;  2E0S A;  2XWV A;  2D3I A;  3B7D A;  4NQ8 A;  2HHM A;  5I57 A;  4I3Y A;  2R8T A;  5IZ3 B;  2E1S A;  3Q29 A;  2PYY A;  1A99 A;  4M4G A;  4NF5 B;  3EQ1 A;  2A5T A;  1NNK A;  4RY1 A;  4X8R A;  3VLW A;  5IZZ A;  1MY4 A;  4PDD A;  4KFQ A;  1I6Q A;  4IY5 A;  4NTL A;  2I4B A;  4P0I A;  4LZ5 A;  3E3K A;  3KZG A;  2CEY A;  4O7M A;  2XX8 A;  3MC2 A;  1PB9 A;  4XKR A;  3TEL A;  1B7Z A;  2V93 A;  1JVY A;  3H6V A;  3OO7 A;  3TDJ A;  4DIG A;  5CC2 A;  4ZEI A;  1B40 A;  2OWT A;  2RCB A;  3MPK A;  2A5S A;  2UYE A;  4G68 A;  4ZZE A;  1OVT A;  2F6P A;  1DCU A;  1YCJ A;  1B58 A;  1MS7 A;  2DP8 A;  4H46 A;  4RPN A;  1PDA A;  5BWJ A;  1MXW A;  2F78 A;  2JJK A;  2V3U A;  3TZA A;  4N4U A;  1DTZ A;  2QS4 A;  1R6Z A;  4Q0C A;  1ZMG A;  3SZP A;  1BP5 A;  2XD3 A;  4OHN A;  1ZJL A;  5LOM A;  1M5B A;  1IMA A;  1ANF A;  4NE4 A;  2I6E A;  4KPT A;  1QUK A;  1NV5 A;  2OWZ A;  2VHA A;  5H8Q A;  1NNF A;  4P1E A;  1MRP A;  1FQE A;  3QK6 A;  2Q9T A;  3ZKL A;  1FRP A;  5CI5 A;  1M5D A;  3TPA A;  2HEU A;  3GXA A;  1RYX A;  4PFU A;  4FOR A;  1MQH A;  1ZKB A;  1LAF E;  4PTK A;  3SER A;  5CMK A;  1OIB A;  5K2X A;  5DEX A;  2RC8 A;  2OX3 A;  4G61 A;  1P1O A;  1RKM A;  5H8H A;  3M3K A;  4H5G A;  3IK6 B;  1MPD A;  1VSO A;  2OZZ A;  5HBC A;  4C1U A;  3NOH A;  5FHN A;  1MY3 A;  2BJJ X;  3LV0 A;  4G68 B;  2D5W A;  4P56 A;  1D4N A;  1FQC A;  5ITO A;  1SYH A;  5J16 A;  3IFA A;  1OQH A;  2FNC A;  1LBV A;  3OD7 A;  4O94 A;  4OMB A;  1R1N A;  4N15 A;  4HCY A;  4HS7 A;  3FZV A;  4YB7 A;  1NV3 A;  1NMU A;  4GXA A;  4P3L A;  3K6W A;  3LSF B;  3LR1 A;  4G68 C;  4GOT A;  1NUY A;  3N94 A;  3SEU A;  2OK2 A;  5IKB A;  1MY2 A;  1LBC A;  5I3S A;  3T22 A;  2GH9 A;  3N6U A;  2PX1 A;  1MM7 A;  4MLQ A;  1S7Y A;  2KLF A;  3QYT A;  1JNF A;  1USY E;  1UIU A;  4YZZ A;  2QS2 A;  4ISU A;  3T9H B;  1UTH A;  3TKD A;  4MIJ A;  5H8F A;  3CG3 A;  1BTJ A;  1XT8 A;  4DCY A;  4F3P A;  1FW0 A;  5CM6 A;  2Y7K A;  2F7C A;  1AWB A;  4DCX A;  1YZ0 A;  3HFU A;  1P1W A;  3KC1 A;  4DZ1 A;  2AYS A;  4GFR A;  1DPE A;  5FTH A;  3RLF E;  3FJG A;  5K2Y A;  3ISP A;  3VVE A;  3IB0 A;  4ZEK A;  4NF4 A;  4P9K A;  1QKA A;  3MAM A;  4TOZ A;  2O7I A;  3KJ7 A;  3KOT A;  2F8D A;  2WYK A;  4OYV A;  2Z22 A;  2XWK A;  3KGC A;  3PGF A;  5B70 A;  3OEN A;  2XWO A;  3K00 A;  3ZSF A;  1TXF A;  4RJZ A;  3UA8 A;  4WEP A;  3V8X B;  1GR2 A;  5L9S A;  4TQU Q;  5F24 A;  3HV1 A;  2VD3 A;  4AB5 A;  2CZH A;  2UXA A;  1FPI A;  2XHD A;  4R72 A;  3BKI B;  1UTH B;  3U94 A;  1JVX A;  2FBP A;  1N84 A;  3RYD A;  1RYO A;  2W7Y A;  3TTL A;  1FTO A;  3LBS A;  2OBG A;  1HSE A;  1I69 A;  1B46 A;  1G0H A;  2HCA A;  5L8D A;  4KI0 E;  3Q27 A;  3C31 A;  1LEV A;  4DI3 D;  2PFZ A;  2Q88 A;  2ANJ A;  3MPL A;  4ELQ A;  4ZED A;  2REJ A;  3FXQ A;  1B6H A;  1FTA A;  3LSL A;  3VV5 A;  3K1P A;  3O97 A;  3UN6 A;  1JW4 A;  4GWY A;  1RDY A;  4NF4 B;  4N13 A;  1CB6 A;  5I2K B;  4I9D A;  4HCW A;  3MP6 A;  4N91 A;  3U8Q A;  3VDF A;  1LCF A;  2RIN A;  1PB7 A;  3G7W A;  1ZU0 A;  4OWD A;  2I4C A;  4OES A;  1FJ6 A;  4LVQ A;  5J1D A;  2X26 A;  3U65 A;  2B3B A;  4OET A;  1Y3P A;  1N76 A;  4OEV A;  5ICQ A;  2QVU A;  4Q8R A;  2FHY A;  1IXG A;  1N04 A;  4KYS A;  1SW5 A;  4JVD A;  1SBP A;  3OEK A;  3L6H A;  3LSW A;  2B3F A;  2V4C A;  4KCC A;  1BIY A;  4MX6 A;  1MXZ A;  3OSQ A;  5H8S A;  3O6I A;  2HZL A;  4ZEB A;  2DWH A;  4G4P A;  1LFH A;  1FQD A;  3OXN A;  4LZ7 A;  1YPN A;  4YB5 A;  4JVI A;  2Y84 A;  2WBB A;  4XEQ A;  1B52 A;  3EHU A;  1Q35 A;  4O3A A;  4ZE9 A;  2RKM A;  2QS3 A;  2NXO A;  4PQJ A;  4PGP A;  2V84 A;  1D9V A;  4RNS A;  3EPE A;  2XXI A;  1FPF A;  3TEP A;  5FHM A;  1FSA A;  4KQP A;  4PFI A;  1A7L A;  4Z0I A;  2FVZ A;  4PET A;  4MFI A;  1URG A;  3A09 A;  4AB6 A;  2DE2 A;  1YAE A;  5DW8 A;  1N7W A;  3D1R A;  4IY6 A;  3TCH A;  4FEB A;  1J1N A;  4OXV A;  4U1Z A;  3UP9 A;  1NV2 A;  4XF5 A;  2H4I A;  2P2A A;  3K6U A;  4GBW A;  5JTY A;  4BDL A;  2I3W A;  3ODB A;  1AL3 A;  2H25 A;  1Y4C A;  4PGN A;  1DOT A;  3KSJ A;  1Y4T A;  2O84 X;  3I6V A;  1WDN A;  1N0T A;  4PBH A;  1FCK A;  2DWA A;  4DE8 A;  4ZZA A;  1MQD A;  3SES A;  1Y1Z A;  3V89 B;  3KBR A;  2B65 A;  1WVJ A;  4OZ9 A;  3K1M A;  4H6D A;  2Y7W A;  4N6K A;  1VR5 A;  5DT6 A;  1ZTY A;  1MPB A;  1B3E A;  2QVR A;  2AL4 A;  4BDR A;  1EZO A;  2QFL A;  4OVT A;  2DOJ A;  2DXR A;  1LFG A;  3IOR A;  4NAP A;  3WAF A;  4LON B;  3MST A;  4MH5 A;  4KD5 A;  1B5I A;  2ONK E;  1FPG A;  3FXU A;  4N8Y A;  5AA2 B;  3RPL A;  1DMB A;  2Z23 A;  2DVZ A;  4U22 A;  4DXU A;  1GGG A;  3TQL A;  2O51 A;  1B9J A;  1KZ8 A;  1P1Q A;  1RDX A;  1WOD A;  2FYI A;  1BK4 A;  4JVC A;  4XKN A;  2GRV A;  2GHB A;  2HFB A;  4KYD A;  5IZ1 A;  3VXB A;  4OFL A;  4G8M A;  3AXF A;  5M2V A;  1XVY A;  3MVW A;  3R7X A; 
#chains in the Genus database with same CATH homology
 4RYA A;  3K02 A;  1PB8 A;  5AA4 A;  1BLF A;  1IZ1 A;  3DP6 A;  1XC1 A;  1B3H A;  2VP1 A;  2H9B A;  3TMG A;  4C1T A;  3TUS A;  3WAE A;  2QMX A;  2G29 A;  3DEL B;  2RC9 A;  3PPP A;  4ONY A;  4EQB A;  4QRZ A;  4GIZ A;  1US5 A;  3FXR A;  1MH3 A;  3A3U A;  1MQG A;  4LA9 A;  2F34 A;  3UK4 A;  4R9F A;  2R6G E;  4Z7E A;  4H5F A;  4RXL A;  3V83 A;  4U1O A;  3C33 A;  4NWD A;  3MJN A;  2Q2A A;  3DLN A;  3S4U A;  3ILT B;  4TLM B;  2HZK A;  3Q26 A;  1MXV A;  3TTM A;  3B6Q A;  3PUY E;  2I0B A;  2OCU A;  3C36 A;  2UVG A;  3FJM A;  3C9H A;  2H5Y A;  1XS5 A;  5ISU A;  2O69 A;  2D21 A;  2F36 A;  4O3C A;  2DS9 A;  4ECF A;  2HXW A;  3O66 A;  3FVK A;  3G3K A;  3GLB A;  3PPO A;  4IO6 A;  4EUO A;  3FD3 A;  5A5X A;  1JW1 A;  1D9Y A;  1NFT A;  4MBP A;  3C35 A;  3T93 B;  3PUW E;  2HQ0 A;  5BUU A;  2QJE A;  1B5J A;  1US4 A;  2I49 A;  3TTR A;  5I57 B;  3V5A A;  4F1U A;  4XXU A;  1URD A;  3O29 A;  3K2D A;  3RNN A;  2F97 A;  2A5T B;  2XXT A;  4NMY A;  4P0G A;  4F18 A;  1Y9U A;  4JSO A;  1B0L A;  3IR1 A;  3CG1 A;  2DE4 A;  4JSD A;  1NL5 A;  2H99 A;  5I56 A;  4EXL A;  1DPP A;  4JDF A;  4ESW A;  2X7Q A;  3CRB A;  4ESX A;  2VD2 A;  2X7P A;  4ND9 A;  5EHS A;  2OLB A;  3MZB A;  2F7B A;  1N7X A;  4JBZ A;  4XIG Q;  3QIM A;  3MWB A;  4XKP A;  4DLD A;  4F31 B;  3HST A;  3PMX A;  3VFJ A;  3MP8 A;  4KCD A;  4JXI A;  1OVB A;  2DVC A;  4E0X A;  3SKP A;  1KWH A;  3QXM A;  3PPQ A;  4Q30 B;  1SW2 A;  5H8Q B;  2RF1 A;  3H06 B;  3G3G A;  4LQ5 A;  1MXX A;  3EHT A;  3W9V A;  2M8C A;  3FVN A;  1ATG A;  2ZXT A;  3VE1 B;  3DP8 A;  5DEX B;  4BDO A;  5H8H B;  2DQV A;  4ZE8 A;  3OMB A;  4FE8 A;  1H44 A;  2GHA A;  5DTB A;  3EF7 A;  2Q2C A;  3K4U A;  5I2N A;  2XX9 A;  3K0V A;  1SI1 A;  1DTG A;  3JV9 A;  1VFE A;  2HAV A;  4JB7 A;  4OFO A;  5TPA A;  3VVF A;  1LAX A;  3HPI A;  5AA1 A;  4GF8 A;  3FIR A;  3S9N C;  2XXP A;  3UGW A;  1JQF A;  3BBR A;  3T9X B;  3KFM A;  4NWC A;  4U21 A;  2XXW A;  4QFK A;  4GXS B;  3RTW B;  1UQW A;  3MZ9 A;  1P1U A;  4DXC A;  2PMS A;  2THI A;  4U2R A;  3LC8 A;  3H6U A;  3ILU B;  3MBP A;  2PT2 A;  3T9U A;  5H8F B;  3W9W A;  3U92 A;  2OWS A;  5TP9 A;  2F7A A;  3DP4 A;  2O1L A;  3IOW A;  2FA7 A;  4F2O A;  4QFN A;  2ABH A;  3EN3 A;  5DVF A;  3MVY A;  1LLS A;  1B3L A;  4K3F A;  3RN8 A;  4WED A;  5DVI A;  2ZNS A;  5TPA B;  1QW0 A;  5F1Q A;  1MM6 A;  1II5 A;  3Q25 A;  4X9T A;  1B7H A;  3C34 A;  4RPO A;  3PU5 A;  1XHY A;  4DXB A;  1NNP A;  2Z8D A;  1JEU A;  3KSX A;  5CRY A;  3UOR A;  2DXY A;  1IXI A;  1NH7 A;  1LFI A;  4YKI A;  5ITP A;  3PD9 A;  3TFL A;  4POX A;  5I58 A;  5ELV A;  1TT1 A;  4IO4 A;  4RK2 A;  4YIC A;  3E13 X;  4THI A;  4IO7 A;  2VGQ A;  5AA3 A;  4F29 A;  1H3D A;  3JZJ A;  3CSG A;  1SW1 A;  2P0S A;  3FAT A;  3N5L A;  2RC7 A;  5ICT A;  1P1N A;  1IXC A;  5KZT A;  1Y3N A;  4JWY A;  4GL8 A;  3FUZ A;  4Q5T A;  4M1V A;  5JK4 A;  4OTE A;  5I59 A;  2Y7R A;  4G8N A;  2PBW A;  5L9O A;  1JET A;  1GTK A;  1DSN A;  5JEI A;  3CFX A;  4AQ4 A;  1QVS A;  1ZLQ A;  1ZIU A;  2UVH A;  4X48 A;  3K6X A;  2QS1 A;  4GRK A;  3OSR A;  1LB9 A;  3SEY A;  5I58 B;  4EF2 A;  3KN7 A;  4ZEC A;  4POW A;  3TQW A;  3O28 A;  2ZMB A;  2R71 A;  3VLU A;  2DWJ A;  3MZ1 A;  3HO7 A;  3PPN A;  4OEN A;  5CMM A;  1OLA A;  5FTI A;  1B3F A;  4ZS9 A;  3MW0 A;  3S9E A;  4LZ8 A;  2O6A A;  1QJM A;  5F7V A;  3KEI A;  2I0C A;  4R73 A;  2DE3 A;  5I59 B;  1T0K A;  1MY1 A;  2Y7P A;  2ESN A;  4H67 A;  2PVU A;  3U1O A;  4R74 A;  1SYI A;  4PFT A;  2XD2 A;  1SW4 A;  5I84 A;  4QSC A;  4X1B A;  3IOU A;  5JTY B;  3OO9 A;  2ZNT A;  3T96 B;  1IIW A;  2Y7I A;  2UVJ A;  1Y1M A;  3H6T A;  1A8F A;  4C0R A;  5CBR A;  1LAG E;  3FVO A;  3CVG A;  4IB2 A;  3H6W A;  4LQ2 A;  1PC3 A;  1MPC A;  3PMW A;  1SI0 A;  1LBB A;  1USY H;  3RGY A;  3SET A;  1POY 1;  1B2H A;  4LAT A;  1AIV A;  3CFL A;  3K01 A;  3S2V A;  4BDN A;  1IXH A;  3IJX B;  1LB8 A;  4F2Q A;  4G2Z A;  4R6Y A;  2ZYN A;  3HCQ A;  2XXR A;  3GBB A;  4IGR A;  4R75 A;  4EDP A;  1Z7M E;  3SDF A;  2QRY A;  3VVD A;  1BKA A;  5H8N A;  3IOV A;  4F3S A;  2HAU A;  2ZYM A;  3A3C A;  4XTC Q;  5AA4 B;  4F19 A;  1B0H A;  3W15 C;  3C4M A;  3G3I A;  1D3K A;  3N6T A;  2REG A;  1R9Q A;  1GVC A;  2Z8F A;  4QHQ A;  3SEV A;  2NVU B;  5DYH A;  1UTB A;  1MDQ A;  1POT A;  1LCT A;  4H0W A;  3QSL A;  2WKY A;  3LSX A;  1Y20 A;  3SEW A;  3VLV A;  1TWY A;  1FTM A;  4YAH X;  2XXV A;  4TLL B;  3IL1 B;  5EYF A;  4GL0 A;  4WKM A;  4PFY A;  2F5X A;  3O6H A;  4OFJ A;  3PUV E;  3PPR A;  1B05 A;  4ZEF A;  2ONS A;  3HHF A;  1SVX B;  3RUM A;  1MG1 A;  3OEM A;  3H3G A;  1B51 A;  5H8N B;  4QSD A;  4ELR A;  1N3W A;  4HTG A;  3IX1 A;  4I62 A;  4KR5 A;  3T66 A;  5HM4 B;  3G3J A;  5EHM A;  1IQ7 A;  1FTL A;  3H03 A;  1ZBM A;  4PFW A;  1QUL A;  3JYR A;  1MH4 A;  2AL5 A;  4IO2 A;  2P1S A;  1IEJ A;  3M8U A;  2Z8E A;  1UTB B;  3USD A;  3PMV A;  1OMP A;  4GVO A;  4QFP A;  4OQO A;  3RT6 B;  4U23 A;  4MF3 A;  2RCA A;  3C32 A;  4F3B A;  4FEC A;  5A5X B;  4JWO A;  4E0W A;  4H1X A;  4QF9 A;  4P11 A;  1EH3 A;  1GV8 A;  3MUQ A;  3O2A A;  1A8E A;  4NF8 A;  2IEE A;  1NNT A;  2NWJ A;  2YLN A;  3TCG A;  1Q1K A;  3D4G A;  4RK9 A;  3QUJ A;  3IB1 A;  2V3T A;  2F35 A;  1H45 A;  2UYF A;  5FHO A;  3THI A;  1O63 A;  3G3F A;  4BLA A;  3GBA A;  3MQ9 A;  1B4H A;  3R6U A;  4GD5 A;  4YU0 A;  4QSE A;  4YMA A;  3H7M A;  1HSL A;  2VOZ A;  4NF6 A;  4RA1 A;  2OJT A;  1LST A;  3VXC A;  4GQO A;  3KN3 A;  5CMC A;  1ELJ A;  3UIF A;  1B5H A;  3OOA A;  3L6G A;  5DVJ A;  5I56 B;  1B3G A;  2DSF A;  1QUJ A;  3S9M C;  5KCJ A;  1IIT A;  2QMW A;  5AE4 A;  3KOS A;  3HN0 A;  3U72 A;  1N3X A;  3FJ7 A;  4NF8 B;  4H8I A;  3GZG A;  1O7T A;  1A55 A;  3DM0 A;  2XX7 A;  3EHS A;  4FED A;  2Q89 A;  4N6P A;  2AIX A;  4UAC A;  4H8J A;  1A54 A;  3LUY A;  3FV1 A;  3CI8 A;  1QUI A;  3IAZ A;  3IJO B;  4G8H A;  3RPW A;  3CR9 A;  5IAI A;  1YTV A;  1PEB A;  3B6T A;  1UIV A;  5KDT A;  1EU8 A;  4NF6 B;  3M3F A;  3FVG A;  3MP1 A;  3IB2 A;  4IO3 A;  5I2K A;  1B32 A;  4HW8 A;  2NUV A;  1FQA A;  1P99 A;  3IO4 A;  4F1Y A;  2V25 A;  2V3Q A;  3QAX A;  1I6A A;  4PP0 A;  3ZKK A;  5KCJ B;  2GFE A;  5HPQ A;  1AOV A;  4OVJ A;  4LP2 B;  1AMF A;  1CE2 A;  2Q8J A;  2ZNU A;  2QL3 A;  5I2N B;  3OO8 A;  2H98 A;  3K6V A;  3TTK A;  4KHZ E;  3M3L A;  3OEL A;  3PD8 A;  4FIM A;  1NH8 A;  3RY3 A;  3TCF A;  3ONM A;  1Y3Q A;  1JW5 A;  1NKX A;  4F22 A;  3R26 A;  1SQY A;  2I58 A;  4F1V A;  4WXJ A;  5KDT B;  2R9J A;  3MVZ A;  1LAH E;  1MQI A;  4N07 A;  4G77 A;  4IGT A;  1F9B A;  1VFD A;  3MVX A;  3PUZ E;  2DWI A;  5CBS A;  3FV2 A;  1MXY A;  2F6G A;  2ONR A;  4F39 A;  4BDQ A;  2UVI A;  3FAS A;  5TP9 B;  1EZ9 A;  3KJT A;  2I3V A;  4KYE A;  4FAJ A;  3O9P A;  4YKP A;  1TFA A;  4O3B A;  4YB6 A;  2DYX A;  3KG2 A;  1JEV A;  4H65 A;  4ELP A;  5L9M A;  3CIJ A;  3Q28 A;  1PBQ A;  3SEX A;  4YKK A;  2ALU A;  4BDM A;  4L17 A;  4R9G A;  1AH5 A;  4PE5 B;  4R6H A;  1IUD A;  4FAT A;  5TU0 A;  4QFO A;  4I8C A;  3I5O A;  3OO6 A;  2XXX A;  3HHG A;  4ELO A;  2XXQ A;  4UA8 A;  1M5F A;  1TFD A;  1FQF A;  2LAO A;  3PV0 E;  3CSB A;  1B1H A;  2QPQ A;  1FTJ A;  2O1M A;  3RT8 A;  5AA2 A;  1QKB A;  3BFU A;  3CFZ A;  4DDD A;  4EXK A;  1O64 A;  4R6K A;  3RQT A;  1MY0 A;  2I48 A;  3TYH A;  1MXU A;  4ZDM A;  4F3G A;  1H76 A;  2NOO A;  4NED A;  1SDX A;  1OLC A;  4R2B A;  1I6B A;  1B4Z A;  2YJP A;  1B1X A;  4IO5 A;  3U93 A;  3FGS A;  1XVX A;  1Z7N E;  5B7D A;  1M5E A;  3F11 A;  2CMO A;  2CZL A;  4OEU A;  4U4X A;  1EZP A;  3QUF A;  2PT1 A;  3ZS6 A;  5AA2 D;  2O68 A;  1LGB C;  3B6W A;  1S50 A;  3RTF B;  1L5T A;  3H4Z A;  3IO6 A;  3S9L C;  2IA4 A;  2XXY A;  4YMB A;  3N26 A;  3E4R A;  4I1D A;  2XXH A;  1S9T A;  1PBP A;  3O6G A;  4OER A;  4GLI A;  5CMB A;  3ECR A;  4JWX A;  1OQG A;  3P7I A;  3G3H A;  2QSX A;  1A40 A;  3PUX E;  3I3V A;  1B7U A;  3TTN A;  2ZYK A;  4EF1 A;  4YKJ A;  1H43 A;  3IOT A;  1SD3 A;  2ZYO A;  3TAJ A;  4FJP A;  1FQB A;  1FTK A;  1M5C A;  4NF5 A;  2O7U A;  3K1N A;  4GWO A;  1R9L A;  4MLV A;  1MQJ A;  4EQ7 A;  4QFL A;  4R2F A;  1XOC A;  4U4S A;  4LUB A;  3E9X A;  3KN8 A;  2XXU A;  1MDP 1;  1URS A;  4XKQ A;  3BFT A;  4EQ9 A;  1VE4 A;  3T9V A;  1HSJ A;  2YPN A;  2G93 A;  4X1D A;  3D4C A;  3TOD A;  2E0S A;  2D3I A;  3B7D A;  5I57 A;  2E1S A;  3Q29 A;  2PYY A;  1A99 A;  4M4G A;  4NF5 B;  3EQ1 A;  2A5T A;  1NNK A;  4RY1 A;  3VLW A;  1MY4 A;  4KFQ A;  1I6Q A;  4IY5 A;  4NTL A;  2I4B A;  4P0I A;  4LZ5 A;  3E3K A;  3KZG A;  2XX8 A;  3MC2 A;  1PB9 A;  4XKR A;  3TEL A;  1B7Z A;  2V93 A;  1JVY A;  3H6V A;  3OO7 A;  3TDJ A;  4DIG A;  5CC2 A;  4ZEI A;  1B40 A;  2OWT A;  2RCB A;  3MPK A;  2A5S A;  2UYE A;  4G68 A;  4ZZE A;  1OVT A;  2F6P A;  1YCJ A;  1B58 A;  1MS7 A;  2DP8 A;  4RPN A;  5BWJ A;  1PDA A;  1MXW A;  2F78 A;  2V3U A;  3TZA A;  1DTZ A;  2QS4 A;  1R6Z A;  4Q0C A;  1ZMG A;  1BP5 A;  2XD3 A;  4OHN A;  1ZJL A;  5LOM A;  1M5B A;  1ANF A;  4NE4 A;  2I6E A;  4KPT A;  1QUK A;  2VHA A;  5H8Q A;  1NNF A;  1MRP A;  1FQE A;  3QK6 A;  2Q9T A;  3ZKL A;  5CI5 A;  1M5D A;  3TPA A;  2HEU A;  3GXA A;  1RYX A;  4PFU A;  4FOR A;  1MQH A;  1ZKB A;  1LAF E;  3SER A;  5CMK A;  1OIB A;  5K2X A;  5DEX A;  2RC8 A;  1P1O A;  1RKM A;  5H8H A;  3M3K A;  4H5G A;  3IK6 B;  1MPD A;  1VSO A;  2OZZ A;  5HBC A;  4C1U A;  5FHN A;  1MY3 A;  2BJJ X;  4G68 B;  2D5W A;  1D4N A;  1FQC A;  5ITO A;  1SYH A;  1OQH A;  2FNC A;  3OD7 A;  4OMB A;  1R1N A;  4HCY A;  4HS7 A;  3FZV A;  4YB7 A;  1NMU A;  4GXA A;  3K6W A;  3LSF B;  3LR1 A;  4G68 C;  4GOT A;  3N94 A;  3SEU A;  2OK2 A;  5IKB A;  1MY2 A;  1LBC A;  3T22 A;  2GH9 A;  3N6U A;  2PX1 A;  1MM7 A;  4MLQ A;  1S7Y A;  2KLF A;  3QYT A;  1JNF A;  1USY E;  1UIU A;  4YZZ A;  2QS2 A;  4ISU A;  3T9H B;  1UTH A;  3TKD A;  5H8F A;  3CG3 A;  1BTJ A;  1XT8 A;  4DCY A;  4F3P A;  1FW0 A;  5CM6 A;  2Y7K A;  2F7C A;  4DCX A;  1P1W A;  4DZ1 A;  2AYS A;  4GFR A;  1DPE A;  5FTH A;  3RLF E;  3FJG A;  5K2Y A;  3VVE A;  3IB0 A;  4ZEK A;  4NF4 A;  1QKA A;  3MAM A;  4TOZ A;  2O7I A;  3KJ7 A;  3KOT A;  2F8D A;  4OYV A;  2Z22 A;  3KGC A;  3PGF A;  5B70 A;  3OEN A;  3K00 A;  3ZSF A;  1TXF A;  4RJZ A;  3UA8 A;  4WEP A;  3V8X B;  1GR2 A;  5L9S A;  4TQU Q;  3HV1 A;  2VD3 A;  4AB5 A;  2UXA A;  2XHD A;  4R72 A;  3BKI B;  1UTH B;  3U94 A;  1JVX A;  1N84 A;  1RYO A;  2W7Y A;  3TTL A;  1FTO A;  3LBS A;  2OBG A;  1HSE A;  1I69 A;  1B46 A;  2HCA A;  5L8D A;  4KI0 E;  3Q27 A;  3C31 A;  2Q88 A;  2ANJ A;  3MPL A;  4ELQ A;  4ZED A;  2REJ A;  3FXQ A;  1B6H A;  3LSL A;  3VV5 A;  3K1P A;  3O97 A;  3UN6 A;  1JW4 A;  4NF4 B;  4N13 A;  1CB6 A;  5I2K B;  4I9D A;  4HCW A;  3MP6 A;  3U8Q A;  3VDF A;  1LCF A;  2RIN A;  1PB7 A;  3G7W A;  1ZU0 A;  4OWD A;  2I4C A;  4OES A;  4LVQ A;  5J1D A;  2X26 A;  2B3B A;  4OET A;  1Y3P A;  1N76 A;  4OEV A;  5ICQ A;  4Q8R A;  1IXG A;  1N04 A;  4KYS A;  1SW5 A;  1SBP A;  3OEK A;  3L6H A;  3LSW A;  2B3F A;  4KCC A;  1BIY A;  1MXZ A;  5H8S A;  3OSQ A;  3O6I A;  2HZL A;  4ZEB A;  2DWH A;  4G4P A;  1LFH A;  1FQD A;  3OXN A;  4LZ7 A;  1YPN A;  4YB5 A;  2Y84 A;  1B52 A;  3EHU A;  1Q35 A;  4O3A A;  4ZE9 A;  2RKM A;  2QS3 A;  2NXO A;  4PQJ A;  2V84 A;  1D9V A;  4RNS A;  3EPE A;  2XXI A;  3TEP A;  5FHM A;  4KQP A;  1A7L A;  4Z0I A;  4PET A;  4MFI A;  1URG A;  3A09 A;  4AB6 A;  2DE2 A;  1YAE A;  1N7W A;  4IY6 A;  3TCH A;  4FEB A;  1J1N A;  4OXV A;  4U1Z A;  3UP9 A;  2H4I A;  2P2A A;  3K6U A;  5JTY A;  4BDL A;  2I3W A;  3ODB A;  1AL3 A;  2H25 A;  1Y4C A;  1DOT A;  3KSJ A;  1Y4T A;  2O84 X;  3I6V A;  1WDN A;  1N0T A;  1FCK A;  2DWA A;  4DE8 A;  4ZZA A;  1MQD A;  3SES A;  1Y1Z A;  3V89 B;  3KBR A;  2B65 A;  1WVJ A;  4OZ9 A;  3K1M A;  4H6D A;  2Y7W A;  1VR5 A;  5DT6 A;  1ZTY A;  1MPB A;  1B3E A;  2AL4 A;  4BDR A;  1EZO A;  2DOJ A;  2DXR A;  1LFG A;  3IOR A;  3WAF A;  4LON B;  4MH5 A;  4KD5 A;  1B5I A;  2ONK E;  3FXU A;  5AA2 B;  1DMB A;  2Z23 A;  2DVZ A;  4U22 A;  4DXU A;  1GGG A;  3TQL A;  2O51 A;  1B9J A;  2FYI A;  1P1Q A;  1WOD A;  4XKN A;  2GRV A;  2GHB A;  2HFB A;  4KYD A;  3VXB A;  4OFL A;  4G8M A;  3AXF A;  5M2V A;  1XVY A;  3MVW A;  3R7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...