3N26A

Cpn0482 : the arginine binding protein from the periplasm of chlamydia pneumoniae
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
231
structure length
231
Chain Sequence
DRNRIWIVGTNATYPPFEYVDAQGEVVGFDIDLAKAISEKLGKQLEVREFAFDALILNLKKHRIDAILAGMSITPSRQKEIALLPYYGDEVQELMVVSKRSLETPVLPLTQHSSVAVQTGTFQEHYLLSQPGICVRSFDSTLEVIMEVRYGKSPVAVLEPSVGRVVLKDFPNLVATRLELPPECWVLGCGLGVAKDRPEEIQTIQQAITDLKSEGVIQSLTKKWQLSEVAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting antigenic diversity for vaccine design: the Chlamydia ArtJ paradigm.
pubmed doi rcsb
source organism Chlamydophila pneumoniae
molecule tags Transport protein
molecule keywords Amino acid ABC transporter, periplasmic amino acid-binding p
total genus 65
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n26A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n26A02
4ECFA 3D4GA 4BDLA 3E4RA 1IXIA 2QS1A 4RJZA 3OEKA 2FYIA 3L6HA 1B3LA 1IEJA 3PPOA 4GWOA 3EPEA 4JSOA 4LA9A 4BDNA 4ZEBA 4H8IA 2Q88A 1B4HA 1OLCA 2V3TA 2DOJA 3E13X 3MAMA 1MY0A 3MVWA 4JSDA 5DYHA 4F3PA 2DXYA 1QVSA 4G8NA 1O64A 2PMSA 3G3HA 3OOAA 4JB7A 2Z8DA 1POY1 5DEXA 5AE4A 3TCFA 3FUZA 1S7YA 3H6VA 1UIUA 1XVXA 5I2KB 2F7BA 1SW2A 2HCAA 3C9HA 1F9BA 3M8UA 1VR5A 3OMBA 1PBPA 4PFWA 4IO2A 3MW0A 4OEUA 4EXLA 2GFEA 3O6HA 3FIRA 2ONRA 3IJOB 1SVXB 4QSDA 4IO4A 2Q89A 4YAHX 3TODA 3K2DA 4RPNA 1LLSA 4GRKA 3KOTA 4NF6A 3CFLA 3FJGA 3T9UA 2F34A 4O3BA 1PB9A 1Z7NE 2ZYNA 3WAFA 4NF5A 1MY1A 5BWJA 1AH5A 1Q35A 3KN3A 1NFTA 3M3KA 5DEXB 1XC1A 4Q0CA 4IGRA 1FQCA 4KD5A 1SI1A 1Z7ME 2VP1A 3FGSA 1IIWA 1B7HA 3LSLA 2GH9A 3MZBA 4OHNA 5H8FB 2RF1A 4F2QA 3MVZA 4GVOA 4OFLA 5KZTA 3HO7A 3C4MA 1TWYA 3CG3A 1B9JA 5AA4A 3LSFB 4HCYA 1ZIUA 4NF8B 1JW4A 1US5A 1MPBA 3K6WA 3MP6A 3N6TA 3GBAA 5H8QB 3V5AA 3BFTA 1LB8A 4QHQA 1Y3QA 2VOZA 4FEBA 1QKAA 1B52A 1NNFA 4H1XA 4IO7A 2A5TB 5H8NA 5ITOA 5IAIA 1BTJA 3RY3A 4L17A 3PPPA 5KDTA 3CG1A 3PUYE 4KQPA 1S9TA 3ONMA 4R72A 1MQIA 3IO4A 2Q9TA 3MP1A 3Q25A 3SETA 1M5EA 4LQ5A 3LBSA 3MWBA 1QUKA 3HSTA 3G3KA 3KEIA 1NKXA 2A5TA 5KCJA 2PX1A 2DQVA 3LC8A 4N13A 2PYYA 1B1XA 5EYFA 4YMBA 2F6PA 3C33A 4QFLA 1N0TA 3VV5A 1FQBA 4YKPA 4H67A 1MQGA 3DP8A 3FVOA 1RYOA 2HEUA 3GXAA 5H8SA 1CB6A 1LB9A 3DP6A 3S2VA 4EQ7A 4HW8A 4G8HA 4YB6A 1LCFA 2CMOA 4ZDMA 2XX7A 3MBPA 4NWDA 1M5DA 4IGTA 4IY5A 1UTBB 3T9VA 1R1NA 3RTWB 2YJPA 4R6YA 4QFPA 1N7XA 4FEDA 1MY2A 4BDRA 5H8HB 3IORA 3M3LA 5ELVA 3K0VA 4U1ZA 2OBGA 4IO6A 5F1QA 5AA2A 1N3WA 5DVIA 1P1WA 3HN0A 3G3JA 4LZ5A 1T0KA 3H06B 1II5A 1IZ1A 2THIA 1N7WA 4MFIA 4P11A 2AL4A 2ALUA 5CMMA 2NVUB 3SESA 3U72A 1JVYA 1US4A 3MC2A 3ECRA 4XKPA 5F7VA 1SYIA 1N84A 4OVJA 1Y1MA 4XTCQ 4DXCA 5TP9A 3FV2A 2F78A 3EQ1A 3JYRA 4ND9A 1SW1A 4YKIA 2QRYA 2RCAA 5AA2D 1MQDA 1LFGA 3OO9A 5JK4A 3QYTA 4PFYA 4BDQA 3K01A 1QUJA 4FATA 2IA4A 2H99A 4AB5A 3FJ7A 3IL1B 2DE2A 1JEUA 1H45A 3D4CA 1Y4CA 2QMWA 3TTRA 3K6UA 3VVFA 1H44A 1OIBA 3KOSA 4G8MA 3CFZA 1QULA 2W7YA 4LP2B 1URGA 4IB2A 1MXVA 4JWXA 2O69A 4H8JA 2OWSA 2XXXA 3DELB 4KR5A 4XKNA 3TFLA 3Q26A 3IB2A 3O66A 1MXWA 5JTYB 3TMGA 1UTHB 2DVZA 4I62A 2FA7A 4ZS9A 1A8EA 4TOZA 3KGCA 3OSRA 1B5IA 3I5OA 2XXHA 1BIYA 2QS3A 2I48A 3KJ7A 3KG2A 3OD7A 1ELJA 4G77A 4GL8A 2V3UA 4OENA 1FTOA 1GV8A 1MQJA 2RKMA 4F1VA 1B46A 1MPCA 3TQLA 5CC2A 1B05A 3B6QA 1LFIA 4F3SA 2AL5A 5I56B 4ISUA 2H98A 3TTMA 4DIGA 4U4XA 3WAEA 2Y7RA 2QJEA 1N3XA 1LBBA 5TU0A 3BBRA 3TAJA 2XXVA 5CI5A 4JDFA 4N07A 1EZPA 3H03A 3V8XB 2RC7A 1HSEA 3MUQA 1QJMA 1SI0A 1D4NA 2O84X 2ONKE 3GBBA 1BP5A 5I2NB 3E9XA 1EZ9A 1DTGA 3TYHA 4DXBA 3HHFA 2ZNSA 1UTBA 1VE4A 3Q29A 3SEYA 4EF2A 1MXXA 2QPQA 2Y84A 1H43A 3IOVA 4H5GA 4NTLA 4EXKA 4EQBA 2XXQA 1MXYA 4RXLA 4OEVA 1D9VA 2YLNA 4F31B 2GHBA 4C1UA 4KCDA 2V3QA 1MY4A 3TZAA 2V25A 2R71A 4DCXA 2XXYA 1FQAA 1AMFA 5ISUA 4P0IA 3JV9A 4X9TA 2F97A 2DWAA 4LZ8A 3CFXA 1NL5A 1FQFA 4YICA 3QAXA 1ZJLA 4ZEKA 3TDJA 2Z8FA 1AIVA 3K1MA 3FXUA 4OZ9A 2PT2A 2M8CA 1DSNA 2ZYOA 3Q27A 4E0XA 4OETA 3T66A 4AQ4A 4ELQA 1JETA 4POXA 4ZZAA 4GF8A 3PMWA 2RC9A 4E0WA 2HZLA 2I3WA 4DXUA 1MQHA 3ZSFA 1B5HA 2DWIA 4JXIA 3VE1B 1JEVA 4RNSA 1MXZA 1N76A 1MH3A 1D3KA 1FTLA 3U8QA 3IK6B 3VVDA 5ICTA 3QK6A 3RGYA 1B0HA 2Z8EA 2OK2A 4BDMA 4R6KA 1MDQA 4UACA 3I6VA 4NF4B 5CMKA 2I0BA 3PPNA 2DE4A 3VLWA 1B4ZA 1MDP1 5HM4B 5JEIA 1D9YA 3KZGA 5L9OA 2PVUA 1YTVA 1LAGE 2I0CA 2REGA 2UYFA 3MZ9A 4H65A 3UGWA 2Y7PA 1B5JA 3FD3A 2A5SA 1I6AA 3FJMA 4I9DA 2UVHA 4IO5A 4I8CA 1DTZA 4GLIA 2PT1A 2F7AA 4QFNA 4NF4A 2NXOA 3QIMA 1TT1A 4TLLB 3KFMA 4WKMA 1JVXA 1A40A 1RYXA 5M2VA 5H8HA 3IR1A 4BLAA 1OVBA 1QKBA 3CI8A 3K1NA 4HTGA 4GOTA 2REJA 3LR1A 4R6HA 1MM7A 3UA8A 1SQYA 1Y3PA 1YAEA 3U94A 4QFKA 1Y20A 4OXVA 1B3FA 4R2BA 3Q28A 1KWHA 5JTYA 1ZMGA 5BUUA 1A8FA 4PFUA 3UP9A 1B1HA 1LGBC 2LAOA 3U1OA 4FIMA 3W9VA 1SBPA 2F6GA 4KYDA 4LUBA 4TQUQ 3OSQA 1ATGA 3IOUA 2Z22A 4X1BA 4ZE9A 1A99A 1MXUA 4YKJA 3RT8A 4RK9A 4U21A 5HBCA 3RQTA 4G68C 3ZKKA 2WKYA 2PBWA 1PBQA 2DVCA 4ZEIA 4ZEDA 4OESA 1FQDA 1PEBA 4WEDA 3TELA 1JW5A 3RNNA 3RPWA 2I6EA 1DOTA 1PC3A 2XXUA 3MPLA 2I4BA 4R75A 1VSOA 1XT8A 5TP9B 2F35A 2O7IA 1PB7A 2B3FA 2F7CA 3OO8A 1I6BA 5KDTB 1TXFA 3PU5A 1EH3A 2VD3A 3PGFA 4F2OA 2H5YA 3EHSA 1ZLQA 3MVXA 2NWJA 4U22A 1A7LA 1DPPA 2XD3A 4MLVA 3TKDA 4DLDA 4GFRA 3GZGA 3OENA 3SDFA 5CMBA 3TTNA 5AA2B 2QS2A 2B65A 1NH7A 1JNFA 4AB6A 3RT6B 2OCUA 4MF3A 1O7TA 4NWCA 4G68B 4WXJA 3N6UA 5EHSA 3B6WA 4LVQA 4DDDA 4KYEA 4EDPA 4OYVA 2O51A 4I1DA 3VVEA 5TPAB 4KYSA 4FAJA 1OQGA 2XXWA 2O1LA 3O6GA 1JW1A 1WODA 5ITPA 3CIJA 2XXRA 1XHYA 2O7UA 4G68A 4Q8RA 3S9EA 3VXCA 1MG1A 4YMAA 4GQOA 2UXAA 5HPQA 1HSLA 1B2HA 1SYHA 1TFDA 1URSA 4H0WA 2CZLA 4POWA 4QFOA 3R7XA 3TTKA 3U93A 3VLVA 1MM6A 1A54A 1B0LA 4Z7EA 2I58A 1IQ7A 1B58A 1USYH 4M1VA 2XD2A 1ZKBA 2VGQA 3R6UA 4R74A 1P1QA 1UQWA 2DYXA 1MPDA 3H7MA 4LZ7A 3O28A 3PUVE 4MH5A 3U92A 5K2XA 2QSXA 2X26A 4H6DA 1HSJA 1R9LA 2XX9A 3QUJA 4M4GA 4YZZA 3W9WA 1UIVA 2DSFA 3FASA 4C1TA 3N26A 3UORA 4LQ2A 1DMBA 3IAZA 2ANJA 1EU8A 1FTKA 2AYSA 2HZKA 2Y7IA 3W15C 1GGGA 2O6AA 4Z0IA 4RY1A 2YPNA 3K6VA 4DZ1A 3L6GA 5H8FA 3IOWA 2ONSA 2HXWA 3PD8A 4ZEFA 4UA8A 3M3FA 3BKIB 3MQ9A 2ABHA 2NOOA 4GXAA 3O6IA 2O1MA 3SEUA 4R73A 3SEWA 5A5XA 1OVTA 1M5BA 4NF5B 1NNPA 2H9BA 4QSCA 4ONYA 1B51A 4RPOA 1SW4A 3CSBA 3SERA 3TUSA 4R2FA 1LAXA 1B3EA 3PUWE 4X48A 4ELPA 2D3IA 1Y9UA 2FNCA 1LAHE 3LUYA 3ODBA 3DLNA 3PUXE 3SEVA 3TTLA 4F3BA 3LSXA 2Q2AA 1L5TA 1MS7A 3PMXA 4PFTA 3H6UA 1N04A 5FHOA 5I58A 1LFHA 3H3GA 1Y4TA 2DS9A 4JBZA 4QRZA 3OO6A 5I2KA 2OLBA 2DP8A 4MBPA 3G7WA 4BDOA 4F39A 5AA4B 1B7ZA 4ZECA 2H4IA 4PQJA 2GHAA 2RCBA 3KSJA 3K00A 3RLFE 3K6XA 2O68A 4OWDA 3B7DA 3KJTA 1P1NA 4U23A 4KI0E 4OTEA 1ZU0A 3SKPA 5CMCA 4TLMB 3HV1A 3QSLA 4QF9A 5B7DA 4ZZEA 1USYE 1IXCA 5IKBA 1B3GA 1BKAA 2Y7KA 3EHTA 4DE8A 3OELA 1I69A 4HCWA 2P0SA 1H3DA 1Q1KA 4HS7A 5FTIA 1MY3A 4FORA 4NF6B 3PPQA 5TPAA 1M5CA 1YCJA 3N94A 1MRPA 3A3UA 5I57A 4KFQA 5L8DA 5DTBA 4FJPA 3H4ZA 3PMVA 1GR2A 3MZ1A 1IUDA 2H25A 2E0SA 2VHAA 5DT6A 4QSEA 3VFJA 3V83A 2OJTA 2HAUA 2QS4A 4U4SA 2DWHA 2ZMBA 4GD5A 3OEMA 5I57B 1SDXA 4NF8A 5H8QA 4F22A 3IJXB 3S9LC 4C0RA 2P2AA 4G2ZA 1FQEA 2G93A 1NH8A 3FV1A 3N5LA 5EHMA 3ILUB 5ICQA 3EF7A 2VD2A 3R26A 2R9JA 2XXIA 4G4PA 4IO3A 4R9GA 3T9XB 4FECA 5DVJA 3ZS6A 4PE5B 3S9NC 4ZE8A 4U2RA 4EUOA 3MVYA 4EQ9A 2UVJA 1M5FA 4K3FA 3MJNA 2X7QA 3S4UA 1EZOA 2V93A 1B40A 3VLUA 5K2YA 1NNKA 1YPNA 2AIXA 4LATA 4P0GA 3G3IA 4RA1A 3FVNA 3QXMA 4R9FA 2ZYKA 3CSGA 2ZYMA 1A55A 2I3VA 3G3GA 3E3KA 3ZKLA 4OMBA 3RUMA 5I59B 5I2NA 1URDA 2OWTA 2P1SA 3DM0A 4XXUA 1NNTA 2ZNTA 3IO6A 3O9PA 4NMYA 4THIA 3T9HB 5I56A 2UYEA 1FW0A 4FE8A 3VDFA 4F18A 1P1OA 3P7IA 2Z23A 3H6WA 5CBSA 5CM6A 3FZVA 1P99A 4ELRA 2ZXTA 2R6GE 2B3BA 2F8DA 2HAVA 2QMXA 3G3FA 4YB5A 1R6ZA 3IB1A 4OQOA 3UIFA 3C34A 4EF1A 4ELOA 5J1DA 3CVGA 3K1PA 1ZTYA 1J1NA 2I49A 2IEEA 1QW0A 1UTHA 1P1UA 3PPRA 4RK2A 3FVGA 4WEPA 1AOVA 2V84A 3T93B 3TQWA 1PB8A 2ZNUA 4O3CA 1PDAA 2GRVA 2RC8A 3TEPA 1GVCA 3C31A 5FTHA 4F3GA 3PV0E 3H6TA 3JZJA 4YKKA 3C36A 1Y1ZA 1Y3NA 2UVGA 1B3HA 2G29A 4F1YA 1OMPA 1RKMA 3VXBA 5FHMA 2Q2CA 3EN3A 3EHUA 1XVYA 1S50A 2BJJX 3S9MC 3HCQA 1FTJA 3LSWA 4DCYA 1OQHA 4YU0A 3F11A 1OLAA 4GXSB 2D21A 4PP0A 2XHDA 4KCCA 2I4CA 3PUZE 2F5XA 4F1UA 3IB0A 1GTKA 4U1OA 3MP8A 5CRYA 1IITA 4XKQA 4F19A 4JWOA 4KHZE 3O97A 2E1SA 4GL0A 2DWJA 1LSTA 3THIA 3TPAA 3B6TA 1ANFA 3HPIA 5H8NB 2OZZA 3V89B 3MPKA 4MLQA 1BLFA 3GLBA 3IOTA 4GIZA 1AL3A 4LONB 3IX1A 1JQFA 4ESWA 4NEDA 1R9QA 2XXPA 5I59A 3FVKA 4N6PA 3T96B 1SD3A 3KN8A 3OO7A 3CRBA 3KBRA 3UK4A 2ESNA 5CBRA 3TCHA 2DE3A 1XOCA 2DXRA 3K4UA 2HFBA 4H5FA 4IY6A 3KSXA 2HQ0A 3ILTB 3AXFA 3O29A 4JWYA 1TFAA 4XIGQ 5DVFA 3RN8A 3SEXA 3RTFB 3A3CA 3FXQA 1WVJA 3KN7A 4OERA 1QUIA 1VFDA 3FXRA 2NUVA 4OFOA 3PD9A 3A09A 4YB7A 4X1DA 5FHNA 2RINA 2XX8A 1IXGA 4Q30B 3TCGA 1FCKA 3HHGA 1LCTA 1LAFE 4Q5TA 1NMUA 3UN6A 4XKRA 1VFEA 2XXTA 5I58B 1B7UA 5AA3A 1LBCA 2KLFA 2D5WA 4NE4A 4PETA 3USDA 5AA1A 3OXNA 2QL3A 2UVIA 3BFUA 5KCJB 3I3VA 2Y7WA 3CR9A 1H76A 2Q8JA 3T22A 5L9SA 1SW5A 1XS5A 1B6HA 3QUFA 4O3AA 3O2AA 1DPEA 5L9MA 4F29A 1I6QA 5A5XB 3FATA 1B32A 3K02A 1FTMA 5I84A 3DP4A 4ESXA 1O63A 5B70A 4KPTA 1MH4A 4OFJA 1WDNA 1ZBMA 2X7PA 4RYAA 5LOMA 2F36A 1CE2A 1IXHA 3C32A 1POTA 3C35A
chains in the Genus database with same CATH superfamily
3LV0A 5EQ7A 4O8MA 2QS1A 2V3TA 5DYHA 4F3PA 2DXYA 1O64A 2PMSA 3OOAA 3TCFA 3C9HA 1F9BA 4EXLA 4IO2A 4QSDA 2ONRA 1SVXB 3BIHA 4O3BA 1Z7NE 5EYHA 1MY1A 5DEXB 1Q35A 3M3KA 1XC1A 3ISPA 2VP1A 2P3NA 1QGXA 4NQ8A 2R8TA 3MVZA 4GVOA 5KZTA 3C4MA 3LSFB 1ZIUA 5H8QB 1JW4A 3MP6A 1YZ0A 3BFTA 3S9LC 4GWWA 1QKAA 1B52A 3RY3A 4L17A 3PPPA 1NV6A 1S9TA 4PE3A 3IO4A 4O7IA 4LQ5A 2KQZA 3LBSA 3G3KA 5FBPA 2A5TA 2DQVA 3LC8A 4N13A 2CZHA 5EYFA 1N0TA 1NV1A 3U65A 1CB6A 4EQ7A 4HW8A 1IMCA 4G8HA 2CMOA 1KA1A 2XX7A 3MBPA 4NWDA 4IGTA 4QFPA 2FHYA 4QBAA 1N3WA 2ZZXA 4LZ5A 1IZ1A 1N7WA 3SESA 4XEQA 1N84A 1Y1MA 3JYRA 4ND9A 1MQDA 3OO9A 3QYTA 4PFYA 1QUJA 2H99A 3IL1B 2DE2A 1Y4CA 3TTRA 3K6UA 1URGA 1MXVA 4JWXA 3TFLA 4XKNA 5JTYB 1UTHB 2FA7A 4OVQA 5DW8A 4PFIA 1B5IA 2QS3A 2DDKA 2I48A 3KG2A 3UP9A 1ELJA 4OENA 1FTOA 1MPCA 2XA5A 1B05A 1LFIA 4ISUA 4U4XA 5TU0A 1XI6A 3V8XB 2RC7A 1D4NA 3GBBA 5I2NB 1DTGA 5ET6A 1UTBA 1VE4A 1H43A 3IOVA 4MHFA 4NTLA 5IZ3B 4EQBA 4F31B 2QVVA 4N8YA 2R71A 1FQAA 5ISUA 4P0IA 3CFXA 4YICA 1FQFA 4N91A 1ZJLA 3K1MA 1DSNA 2ZYOA 5F24A 4DXUA 2DWIA 4JXIA 1FTLA 3QK6A 5I2NA 4R6KA 3PPNA 3VLWA 5JEIA 1D9YA 2REGA 2I0CA 4MNCA 3E78A 3UGWA 4IO5A 1B5JA 3KBZA 2PT1A 2F7AA 4WKMA 3QIMA 5B7DA 3KFMA 1JVXA 1A40A 1NV0A 1OVBA 3K1NA 4NX1A 1IMEA 4R6HA 1SQYA 4JVIA 4OXVA 1B3FA 2ZZVA 5JTYA 1KWHA 2XWVA 1ZMGA 1FPIA 2LAOA 1SBPA 4TQUQ 3OSQA 2PFYA 3ZKKA 3BIGA 4IR8A 3RNNA 2XXUA 4I40A 1PB7A 1I6BA 3SZPA 4F2OA 1FBDA 2NWJA 2Y5LA 1A7LA 3TKDA 5EQAA 3OENA 4AS5A 3TTNA 3RT6B 2OCUA 4MF3A 5I7IA 3N6UA 5EHSA 3B6WA 4FAJA 2XXWA 2O1LA 3O6GA 4G68A 3VXCA 4YMAA 1HSLA 3R7XA 1B0LA 2ZZWA 4Z7EA 1IQ7A 1USYH 3R6UA 4R74A 4GX6A 2X26A 2XX9A 4M4GA 1UIVA 4PC9A 1EU8A 2WYPA 1FTKA 2AYSA 2PFZA 4RY1A 3K6VA 5H8FA 3L6GA 3IOWA 2ONSA 3PD8A 3BKIB 2NOOA 3O6IA 2O1MA 4R73A 3SEWA 1OVTA 4NF5B 2CZKA 2H9BA 1SW4A 3TUSA 4R2FA 1LAXA 2D3IA 2FNCA 4MMPA 3SEVA 3LUYA 3LSXA 1MS7A 3PMXA 5I58A 4JBZA 3OO6A 4F39A 4ZECA 2RCBA 3K00A 3K6XA 1P1NA 4OTEA 3QSLA 4G61A 1B3GA 3EHTA 4DE8A 4HCWA 1H3DA 4XFEA 4FORA 3PPQA 3A3UA 4PAIA 5IZZA 5DT6A 3V83A 2OJTA 2QS4A 4NF0A 1SDXA 3ROJA 2P2AA 3FV1A 2V4CA 3N5LA 5ICQA 2VD2A 2XXIA 4R9GA 5DVJA 4U2RA 4JVDA 3MJNA 5K2YA 5IGAA 3CSGA 4OVPA 3G3GA 1FTAA 1NNTA 2WX9A 4THIA 5LTCA 1FW0A 1P1OA 3P7IA 3FZVA 2QMXA 3G3FA 4YB5A 4ELOA 3C34A 3CVGA 3K1PA 2I49A 2V84A 4O3CA 2GRVA 3PV0E 3H6TA 3JZJA 3C36A 2Q2CA 3HCQA 1OQHA 4PP0A 3QMFA 4KCCA 3PUZE 3IB0A 5CRYA 3MP8A 2E1SA 2DWJA 2PCRA 3HPIA 5H8NB 3IOTA 1K9YA 1AL3A 3IX1A 1JQFA 1R9QA 3T96B 4N6PA 1SD3A 3OO7A 1YXIA 1SPIA 2ESNA 3TCHA 2DE3A 2HFBA 4IY6A 2HQ0A 3O29A 1TFAA 1QUIA 4OFOA 3FXRA 2RINA 1LAFE 5I58B 1EYKA 1B7UA 5AA3A 2KLFA 4PETA 5AA1A 3GYYA 5KCJB 3I3VA 3T22A 1Q9DA 4O3AA 3O2AA 1DPEA 3K02A 1K9ZA 1FTMA 3DP4A 5B70A 1IMFA 3NOHA 4OFJA 1WDNA 2X7PA 2Y5KA 4GFRA 4BDLA 4RJZA 3OEKA 2FYIA 3L6HA 4JSOA 4Q8RA 3EPEA 4ZEBA 4GWSA 3MAMA 4G8NA 3G3HA 4JB7A 3H6VA 1SW2A 2HCAA 3OMBA 1VR5A 1PBPA 4OEUA 3TODA 4P47A 2Q89A 4GRKA 3CFLA 2F34A 1PB9A 2ZYNA 1AH5A 4PTKA 4IGRA 4KD5A 1SI1A 3FGSA 3MZBA 4F2QA 4NF8B 1US5A 3N6TA 3GBAA 3FXBA 1LB8A 1NV4A 2VOZA 5KDTA 4R72A 1MQIA 2Q9TA 3Q25A 3SETA 1FPJA 1NKXA 2KR0A 4MNIA 2HXRA 2F6PA 4NAPA 4H67A 1MQGA 5H8SA 1LB9A 3S2VA 4ZDMA 1M5DA 4IY5A 1R1NA 3RTWB 4R6YA 1N7XA 4FEDA 5H8HB 3IORA 5ELVA 4U1ZA 5AA2A 4HE1A 5DVIA 1P1WA 3G3JA 1II5A 2ALUA 3MC2A 4HXVA 1FBPA 4XTCQ 4H46A 2F78A 3EQ1A 1SW1A 4BDQA 3K01A 2IA4A 4AB5A 3FJ7A 1JEUA 3D4CA 3VVFA 1OIBA 3KOSA 3CFZA 2W7YA 5IM2A 4H8JA 2XXXA 3DELB 4KR5A 3O66A 3TMGA 1MXWA 1A8EA 3OSRA 4GBWA 2XXHA 3OD7A 2V3UA 3TQLA 3B6QA 3RPLB 1FJ9A 4F3SA 2H98A 2QJEA 1DCUA 4N6KA 2XXVA 3H03A 1SI0A 5ET8A 3E9XA 1EZ9A 2WBBA 4NG7A 3Q29A 4MAGA 1LBWA 1MXXA 4H5GA 4EXKA 4RXLA 1D9VA 2YLNA 2GHBA 2V3QA 4DCXA 3TZAA 2WYKA 4X8RA 1AMFA 2F97A 2DWAA 2HHMA 3TDJA 2Z8FA 3FXUA 4OZ9A 2PT2A 4E0XA 3T66A 3ZSFA 3VE1B 1JEVA 1NUYA 4RNSA 3T0JA 3U8QA 5ICTA 1B0HA 2I0BA 1B4ZA 1MDP1 5HM4B 3KZGA 2PVUA 2UYFA 4H65A 4P8BA 4I8CA 1TT1A 1RYXA 3IR1A 4HTGA 1FPFA 3IFAA 4GOTA 1MM7A 1Y3PA 1Y20A 3Q28A 1A8FA 4FIMA 4X1BA 4LUBA 4YKJA 3RT8A 4RK9A 4G68C 2PBWA 3CHGA 4ZEDA 1FQDA 4WEDA 4PF8A 2I6EA 1PC3A 4R75A 5TP9B 2F35A 2B3FA 2F7CA 2QVRA 2VD3A 5J16A 5EQ9A 4I3YA 2H5YA 1DPPA 4MLVA 4MCOA 1O7TA 4NWCA 4LVQA 4DDDA 4JVCA 1FPDA 4KYSA 1OQGA 4PGPA 1XHYA 4GX3A 4HE0A 4GQOA 3RPLA 1URSA 3TTKA 3VLVA 1MM6A 1A54A 4M1VA 3U92A 1MPDA 3PUVE 5K2XA 4C1TA 3N26A 3UORA 4LQ2A 4N81A 3IAZA 2ANJA 2Y7IA 4DZ1A 2HXWA 4ZEFA 2JJKA 2ABHA 3SEUA 1KZ8A 1M5BA 2P3VA 4RPOA 3SERA 3PUWE 1Y9UA 1LAHE 3ODBA 3PUXE 4F3BA 2Q2AA 2CEXA 5FHOA 1LFHA 2FVZA 5I2KA 4MBPA 2GHAA 2O68A 3KJTA 5CMCA 4ZZEA 1USYE 1IXCA 3KC0A 3OELA 2P0SA 1Q1KA 1MRPA 5DTBA 3PMVA 4GBVA 1GR2A 1IUDA 4NHBA 2E0SA 4QSEA 4P56A 2DWHA 4NF8A 3IJXB 4G2ZA 3ILUB 4N17A 3T9XB 3S9NC 2X7QA 2V93A 1B40A 4LATA 4P0GA 3G3IA 3QXMA 2ZYKA 1A55A 2XWKA 2I3VA 3ZKLA 3RUMA 5I59B 1URDA 2P1SA 3DM0A 4OVRA 4XXUA 3O9PA 3VDFA 4FE8A 5CBSA 1P99A 2ZXTA 1R6ZA 3IB1A 3UIFA 1FRPA 1ZTYA 2IEEA 3PPRA 4RK2A 1P1UA 4WEPA 3FVGA 1AOVA 3TQWA 2ZNUA 3TEPA 3C31A 2UVGA 2G29A 5FHMA 3EN3A 1S50A 4YU0A 2D21A 4PFBA 4U1OA 4F1UA 4KHZE 3V89B 4MLQA 1BLFA 4LONB 2XXPA 3KN8A 3CRBA 3KBRA 1XOCA 4H5FA 5DVFA 3AXFA 4JWYA 1INPA 4OERA 4X1DA 4Q30B 5T3JA 2D5WA 2QFLA 2Y7WA 3CR9A 1H76A 3KC1A 4I3EA 5L9MA 1I6QA 3FATA 5I84A 4ESXA 5LOMA 5TPAB 1IXHA 4OA4A 3PPOA 4GWOA 1B3LA 1IEJA 4LA9A 4BDNA 1NUWA 1FPBA 1QVSA 5AE4A 3FUZA 1S7YA 1UIUA 3PTYA 2GFEA 4YAHX 3FIRA 3IJOB 4IO4A 3K2DA 3HFUA 4RPNA 4P1LA 3T9UA 2FIXA 1NV2A 3WAFA 4GWUA 5BWJA 1NFTA 1IMDA 3LSLA 4OFLA 3HO7A 1B9JA 4HCYA 1MPBA 3FBPA 4QHQA 4FEBA 1NNFA 2A5TB 5IAIA 1BTJA 2VPOA 4PF6A 3CG1A 1FPEA 3MWBA 1QUKA 5KCJA 2PYYA 4YMBA 1FBFA 3C33A 3FVOA 2HEUA 3GXAA 1UTBB 3K0VA 3MSTA 4IO6A 5F1QA 3HN0A 2THIA 4MFIA 2AL4A 2XXKA 5CMMA 1JVYA 3ECRA 4XKPA 5F7VA 1SYIA 1RDZA 4OVJA 5TP9A 4YKIA 5AA2D 4P9KA 1H45A 2QMWA 1QULA 4LP2B 2O69A 2OWSA 3V5AA 3IB2A 4ZS9A 2Q8MA 3I5OA 1BIYA 3KJ7A 2CZIA 1GV8A 1MQJA 5CC2A 4DIGA 3TTMA 3WAEA 2Y7RA 1N3XA 3BBRA 3TAJA 5CI5A 4JDFA 4N07A 3LUZA 1HSEA 1QJMA 2O84X 4DI4B 1BP5A 4N6DA 3TYHA 4EF2A 2QPQA 2XXQA 4FBPA 4C1UA 2V25A 3JV9A 4MIJA 3QAXA 4ZEKA 2M8CA 3Q27A 4ELQA 4POXA 4GF8A 3PMWA 2RC9A 1CNQA 1MQHA 2WEFA 1D3KA 2Z8EA 2OK2A 4BDMA 4UACA 3I6VA 1LBZA 4OVSA 1YTVA 1LAGE 3MZ9A 2QVUA 3T1BA 3FD3A 1I6AA 4I9DA 4GLIA 4QXDA 1LBXA 1QKBA 3CI8A 2OWZA 2REJA 3LR1A 1BK4A 1YAEA 4HE2A 1NV7A 3MYUA 5BUUA 1B1HA 3W9VA 3U1OA 4KYDA 2F6GA 1ATGA 3IOUA 3B8BA 4U21A 2DVCA 4ZEIA 4OESA 3TELA 3MPLA 1VSOA 1XT8A 2O7IA 1G0IA 1TXFA 5ET5A 3PU5A 2F3BA 3MVXA 4U22A 3GZGA 3SDFA 5AA2B 2B65A 1JNFA 4PAKA 4WXJA 4G68B 4KYEA 2O51A 4I1DA 1JW1A 5LDZA 2O7UA 3S9EA 1DBZA 1MG1A 5HPQA 1EYJA 1SYHA 4POWA 3U93A 2I58A 2XD2A 1ZKBA 2VGQA 1FBGA 1P1QA 1UQWA 3H7MA 4LZ7A 3O28A 2WBDA 4H6DA 1R9LA 3QUJA 4YZZA 2DSFA 1DMBA 2VPNA 2HZKA 5EQ8A 4P3LA 2CEYA 3M3FA 3MQ9A 5A5XA 4ONYA 3CSBA 1B3EA 4X48A 3DLNA 1L5TA 2GQ1A 4PFTA 3H6UA 2XWIA 2DS9A 4QRZA 2DP8A 2F3DA 1RDXA 2OX3A 1B7ZA 2H4IA 4PQJA 3B7DA 5A5LA 4KI0E 1IMBA 3HV1A 5TPAA 5ET7A 4OVTA 1M5CA 1YCJA 4PDDA 4X04A 5I57A 5L8DA 3H4ZA 3MZ1A 2VHAA 3VFJA 4N15A 4U4SA 1NUXA 3OEMA 5H8QA 4PGNA 1FQEA 1NH8A 4IO3A 4FECA 3ZS6A 4EUOA 4EQ9A 2UVJA 1M5FA 1EZOA 3VLUA 2VT5A 1YPNA 2AIXA 3FVNA 4R9FA 4GWZA 3E3KA 4OMBA 3T9HB 2ZNTA 2UYEA 3H6WA 4ELRA 2F8DA 4OQOA 4AB6A 1QW0A 1UTHA 1PB8A 5ESYA 1PDAA 1GVCA 1JP4A 4YKKA 1Y1ZA 1B3HA 4F1YA 1OMPA 3EHUA 3S9MC 4DCYA 1FTJA 3LSWA 3F11A 1OLAA 2XHDA 2F5XA 1IITA 4XKQA 4F19A 3O97A 1LSTA 1ANFA 2OZZA 3D1RA 3MPKA 4ESWA 5I59A 3FVKA 3B50A 4PBQA 3UK4A 5CBRA 1NV3A 2DXRA 3K4UA 4XIGQ 3RN8A 3SEXA 3RTFB 3A3CA 3S4UA 1VFDA 2NUVA 3PD9A 3A09A 5FHNA 3TCGA 1FCKA 1LCTA 1NMUA 3UN6A 2XXTA 4NE4A 3USDA 2UVIA 1D9QA 5L9SA 1SW5A 1XS5A 1B6HA 3QUFA 4F29A 1G0HA 5A5XB 4OANA 1NV5A 1ZBMA 2F36A 1CE2A 1J1NA 3C35A 1FBHA 3D4GA 4ECFA 3E4RA 1IXIA 4H8IA 2Q88A 1B4HA 1OLCA 2DOJA 3E13X 1MY0A 3MVWA 4JSDA 1DK4A 5DEXA 2FIEA 2Z8DA 1POY1 1XVXA 5I2KB 2F7BA 4PDHA 3M8UA 4LN5A 4PFWA 3MW0A 3O6HA 1LLSA 3KOTA 4NF6A 3FJGA 5IZ3A 4NF5A 4MX6A 3KN3A 4Q0CA 1FQCA 1Z7ME 1IIWA 1B7HA 2GH9A 4OHNA 5H8FB 2RF1A 3CG3A 1TWYA 5AA4A 3K6WA 1Y3QA 4H1XA 4IO7A 5H8NA 5ITOA 1FPLA 3PUYE 4KQPA 3ONMA 3MP1A 1M5EA 3RYDA 3HSTA 3KEIA 2PX1A 2MKZA 1B1XA 4QFLA 1KA0A 3VV5A 1FQBA 3A29A 4YKPA 3DP8A 1RYOA 5I5PA 3DP6A 2L5VA 4YB6A 1LCFA 3T9VA 2YJPA 1EYIA 4BDRA 1MY2A 3M3LA 2OBGA 4H45A 1T0KA 3H06B 4P11A 2NVUB 3U72A 1LBYA 1US4A 4DXCA 3FV2A 5EYGA 2QRYA 2RCAA 5JK4A 1LFGA 4FATA 4PCDA 1H44A 4G8MA 2BJIA 4MEVA 4IB2A 3Q26A 1NI9A 2DVZA 4I62A 4TOZA 3KGCA 4G77A 4GL8A 3EKIA 2RKMA 4F1VA 1B46A 2AL5A 5I56B 1LBBA 1EZPA 3MUQA 2ONKE 4DXBA 3HHFA 2ZNSA 1FSAA 3SEYA 2Y84A 1MXYA 4OEVA 4O94A 4KCDA 1MY4A 2XXYA 4GWXA 4PFRA 2HPGA 4X9TA 4LZ8A 1NL5A 1AIVA 4P1EA 4OETA 4AQ4A 1JETA 4GWYA 4ZZAA 4E0WA 2HZLA 2I3WA 4DI3D 1B5HA 1MXZA 1N76A 1MH3A 3VVDA 3IK6B 3RGYA 1MDQA 4NF4B 5CMKA 4KXPA 2DE4A 5L9OA 1FPKA 2Y7PA 3FJMA 2A5SA 2UVHA 1DTZA 4QFNA 4NF4A 2NXOA 4TLLB 1VDWA 5M2VA 5H8HA 4BLAA 3UA8A 3U94A 4QFKA 4R2BA 4NGUA 4PFUA 1LGBC 4ZE9A 2Z22A 1A99A 1MXUA 5HBCA 3RQTA 2WKYA 1PBQA 4PAFA 4N4UA 1PEBA 1FJ6A 1JW5A 3RPWA 1DOTA 3E79A 2I4BA 3OO8A 3IFCA 5KDTB 1EH3A 3PGFA 1LBVA 1ZLQA 3EHSA 2XD3A 4DLDA 5CMBA 2QS2A 1NH7A 4EDPA 4OYVA 3VVEA 4UABA 1WODA 5ITPA 3CIJA 2XXRA 1FPGA 2UXAA 1B2HA 1TFDA 4H0WA 4QFOA 2CZLA 5I3SA 1B58A 2DYXA 4MH5A 2QSXA 1HSJA 3W9WA 3FASA 3W15C 1GGGA 2O6AA 4Z0IA 2FBPA 2YPNA 4UA8A 4GXAA 1NNPA 4N8GA 4QSCA 1B51A 4ELPA 3TTLA 1AWBA 1N04A 3H3GA 1FBEA 1Y4TA 2OLBA 2XWOA 3G7WA 4BDOA 5AA4B 3KSJA 3RLFE 1RDYA 4OWDA 4U23A 2B4LA 1ZU0A 3SKPA 4TLMB 4QF9A 5IKBA 1BKAA 2Y7KA 5FTIA 1I69A 4HS7A 1MY3A 4NF6B 3N94A 4KFQA 4PBHA 4AS4A 4FJPA 2H25A 4NN3A 2HAUA 2ZMBA 4GD5A 5I57B 4F22A 4C0RA 2G93A 4MNPA 5EHMA 3EF7A 2B4MA 3R26A 2R9JA 4G4PA 4PE5B 4ZE8A 3MVYA 4K3FA 1NNKA 4RA1A 1LEVA 2ZYMA 4O7MA 2Q74A 2OWTA 5I56A 3IO6A 4NMYA 4F18A 1IMAA 2Z23A 5CM6A 2R6GE 2B3BA 2HAVA 5IZ1A 5J1DA 4EF1A 3T93B 2RC8A 5FTHA 4F3GA 1FBCA 1YYZA 1Y3NA 1RKMA 3VXBA 1XVYA 2BJJX 4GXSB 2I4CA 1GTKA 4MJOA 4JWOA 4GL0A 3THIA 3TPAA 3B6TA 3GLBA 4GIZA 1NUZA 4NEDA 4GX4A 3KSXA 3ILTB 3FXQA 1WVJA 3KN7A 4YB7A 2XX8A 1IXGA 3HHGA 4Q5TA 4XKRA 1VFEA 1LBCA 3OXNA 2QL3A 3BFUA 2Q8JA 4XF5A 1B32A 1O63A 4KPTA 1MH4A 4RYAA 3C32A 1POTA
chains in the Genus database with same CATH topology
4ECFA 3D4GA 4BDLA 3E4RA 1IXIA 2QS1A 4RJZA 3OEKA 2FYIA 3L6HA 1B3LA 1IEJA 3PPOA 4GWOA 3EPEA 4JSOA 4LA9A 4BDNA 4ZEBA 4H8IA 2Q88A 1B4HA 1OLCA 2V3TA 2DOJA 3E13X 3MAMA 1MY0A 3MVWA 4JSDA 5DYHA 4F3PA 2DXYA 1QVSA 4G8NA 1O64A 2PMSA 3G3HA 3OOAA 4JB7A 2Z8DA 1POY1 5DEXA 5AE4A 3TCFA 3FUZA 1S7YA 3H6VA 1UIUA 1XVXA 5I2KB 2F7BA 1SW2A 2HCAA 3C9HA 1F9BA 3M8UA 1VR5A 3OMBA 1PBPA 4PFWA 4IO2A 3MW0A 4OEUA 4EXLA 2GFEA 3O6HA 3FIRA 2ONRA 3IJOB 1SVXB 4QSDA 4IO4A 2Q89A 4YAHX 3TODA 3K2DA 4RPNA 1LLSA 4GRKA 3KOTA 4NF6A 3CFLA 3FJGA 3T9UA 2F34A 4O3BA 1PB9A 1Z7NE 2ZYNA 3WAFA 4NF5A 1MY1A 5BWJA 1AH5A 1Q35A 3KN3A 1NFTA 3M3KA 5DEXB 1XC1A 4Q0CA 4IGRA 1FQCA 4KD5A 1SI1A 1Z7ME 2VP1A 3FGSA 1IIWA 1B7HA 3LSLA 2GH9A 3MZBA 4OHNA 5H8FB 2RF1A 4F2QA 3MVZA 4GVOA 4OFLA 5KZTA 3HO7A 3C4MA 1TWYA 3CG3A 1B9JA 5AA4A 3LSFB 4HCYA 1ZIUA 4NF8B 1JW4A 1US5A 1MPBA 3K6WA 3MP6A 3N6TA 3GBAA 5H8QB 3V5AA 3BFTA 1LB8A 4QHQA 1Y3QA 2VOZA 4FEBA 1QKAA 1B52A 1NNFA 4H1XA 4IO7A 2A5TB 5H8NA 5ITOA 5IAIA 1BTJA 3RY3A 4L17A 3PPPA 5KDTA 3CG1A 3PUYE 4KQPA 1S9TA 3ONMA 4R72A 1MQIA 3IO4A 2Q9TA 3MP1A 3Q25A 3SETA 1M5EA 4LQ5A 3LBSA 3MWBA 1QUKA 3HSTA 3G3KA 3KEIA 1NKXA 2A5TA 5KCJA 2PX1A 2DQVA 3LC8A 4N13A 2PYYA 1B1XA 5EYFA 4YMBA 2F6PA 3C33A 4QFLA 1N0TA 3VV5A 1FQBA 4YKPA 4H67A 1MQGA 3DP8A 3FVOA 1RYOA 2HEUA 3GXAA 5H8SA 1CB6A 1LB9A 3DP6A 3S2VA 4EQ7A 4HW8A 4G8HA 4YB6A 1LCFA 2CMOA 4ZDMA 2XX7A 3MBPA 4NWDA 1M5DA 4IGTA 4IY5A 1UTBB 3T9VA 1R1NA 3RTWB 2YJPA 4R6YA 4QFPA 1N7XA 4FEDA 1MY2A 4BDRA 5H8HB 3IORA 3M3LA 5ELVA 3K0VA 4U1ZA 2OBGA 4IO6A 5F1QA 5AA2A 1N3WA 5DVIA 1P1WA 3HN0A 3G3JA 4LZ5A 1T0KA 3H06B 1II5A 1IZ1A 2THIA 1N7WA 4MFIA 4P11A 2AL4A 2ALUA 5CMMA 2NVUB 3SESA 3U72A 1JVYA 1US4A 3MC2A 3ECRA 4XKPA 5F7VA 1SYIA 1N84A 4OVJA 1Y1MA 4XTCQ 4DXCA 5TP9A 3FV2A 2F78A 3EQ1A 3JYRA 4ND9A 1SW1A 4YKIA 2QRYA 2RCAA 5AA2D 1MQDA 1LFGA 3OO9A 5JK4A 3QYTA 4PFYA 4BDQA 3K01A 1QUJA 4FATA 2IA4A 2H99A 4AB5A 3FJ7A 3IL1B 2DE2A 1JEUA 1H45A 3D4CA 1Y4CA 2QMWA 3TTRA 3K6UA 3VVFA 1H44A 1OIBA 3KOSA 4G8MA 3CFZA 1QULA 2W7YA 4LP2B 1URGA 4IB2A 1MXVA 4JWXA 2O69A 4H8JA 2OWSA 2XXXA 3DELB 4KR5A 4XKNA 3TFLA 3Q26A 3IB2A 3O66A 1MXWA 5JTYB 3TMGA 1UTHB 2DVZA 4I62A 2FA7A 4ZS9A 1A8EA 4TOZA 3KGCA 3OSRA 1B5IA 3I5OA 2XXHA 1BIYA 2QS3A 2I48A 3KJ7A 3KG2A 3OD7A 1ELJA 4G77A 4GL8A 2V3UA 4OENA 1FTOA 1GV8A 1MQJA 2RKMA 4F1VA 1B46A 1MPCA 3TQLA 5CC2A 1B05A 3B6QA 1LFIA 4F3SA 2AL5A 5I56B 4ISUA 2H98A 3TTMA 4DIGA 4U4XA 3WAEA 2Y7RA 2QJEA 1N3XA 1LBBA 5TU0A 3BBRA 3TAJA 2XXVA 5CI5A 4JDFA 4N07A 1EZPA 3H03A 3V8XB 2RC7A 1HSEA 3MUQA 1QJMA 1SI0A 1D4NA 2O84X 2ONKE 3GBBA 1BP5A 5I2NB 3E9XA 1EZ9A 1DTGA 3TYHA 4DXBA 3HHFA 2ZNSA 1UTBA 1VE4A 3Q29A 3SEYA 4EF2A 1MXXA 2QPQA 2Y84A 1H43A 3IOVA 4H5GA 4NTLA 4EXKA 4EQBA 2XXQA 1MXYA 4RXLA 4OEVA 1D9VA 2YLNA 4F31B 2GHBA 4C1UA 4KCDA 2V3QA 1MY4A 3TZAA 2V25A 2R71A 4DCXA 2XXYA 1FQAA 1AMFA 5ISUA 4P0IA 3JV9A 4X9TA 2F97A 2DWAA 4LZ8A 3CFXA 1NL5A 1FQFA 4YICA 3QAXA 1ZJLA 4ZEKA 3TDJA 2Z8FA 1AIVA 3K1MA 3FXUA 4OZ9A 2PT2A 2M8CA 1DSNA 2ZYOA 3Q27A 4E0XA 4OETA 3T66A 4AQ4A 4ELQA 1JETA 4POXA 4ZZAA 4GF8A 3PMWA 2RC9A 4E0WA 2HZLA 2I3WA 4DXUA 1MQHA 3ZSFA 1B5HA 2DWIA 4JXIA 3VE1B 1JEVA 4RNSA 1MXZA 1N76A 1MH3A 1D3KA 1FTLA 3U8QA 3IK6B 3VVDA 5ICTA 3QK6A 3RGYA 1B0HA 2Z8EA 2OK2A 4BDMA 4R6KA 1MDQA 4UACA 3I6VA 4NF4B 5CMKA 2I0BA 3PPNA 2DE4A 3VLWA 1B4ZA 1MDP1 5HM4B 5JEIA 1D9YA 3KZGA 5L9OA 2PVUA 1YTVA 1LAGE 2I0CA 2REGA 2UYFA 3MZ9A 4H65A 3UGWA 2Y7PA 1B5JA 3FD3A 2A5SA 1I6AA 3FJMA 4I9DA 2UVHA 4IO5A 4I8CA 1DTZA 4GLIA 2PT1A 2F7AA 4QFNA 4NF4A 2NXOA 3QIMA 1TT1A 4TLLB 3KFMA 4WKMA 1JVXA 1A40A 1RYXA 5M2VA 5H8HA 3IR1A 4BLAA 1OVBA 1QKBA 3CI8A 3K1NA 4HTGA 4GOTA 2REJA 3LR1A 4R6HA 1MM7A 3UA8A 1SQYA 1Y3PA 1YAEA 3U94A 4QFKA 1Y20A 4OXVA 1B3FA 4R2BA 3Q28A 1KWHA 5JTYA 1ZMGA 5BUUA 1A8FA 4PFUA 3UP9A 1B1HA 1LGBC 2LAOA 3U1OA 4FIMA 3W9VA 1SBPA 2F6GA 4KYDA 4LUBA 4TQUQ 3OSQA 1ATGA 3IOUA 2Z22A 4X1BA 4ZE9A 1A99A 1MXUA 4YKJA 3RT8A 4RK9A 4U21A 5HBCA 3RQTA 4G68C 3ZKKA 2WKYA 2PBWA 1PBQA 2DVCA 4ZEIA 4ZEDA 4OESA 1FQDA 1PEBA 4WEDA 3TELA 1JW5A 3RNNA 3RPWA 2I6EA 1DOTA 1PC3A 2XXUA 3MPLA 2I4BA 4R75A 1VSOA 1XT8A 5TP9B 2F35A 2O7IA 1PB7A 2B3FA 2F7CA 3OO8A 1I6BA 5KDTB 1TXFA 3PU5A 1EH3A 2VD3A 3PGFA 4F2OA 2H5YA 3EHSA 1ZLQA 3MVXA 2NWJA 4U22A 1A7LA 1DPPA 2XD3A 4MLVA 3TKDA 4DLDA 4GFRA 3GZGA 3OENA 3SDFA 5CMBA 3TTNA 5AA2B 2QS2A 2B65A 1NH7A 1JNFA 4AB6A 3RT6B 2OCUA 4MF3A 1O7TA 4NWCA 4G68B 4WXJA 3N6UA 5EHSA 3B6WA 4LVQA 4DDDA 4KYEA 4EDPA 4OYVA 2O51A 4I1DA 3VVEA 5TPAB 4KYSA 4FAJA 1OQGA 2XXWA 2O1LA 3O6GA 1JW1A 1WODA 5ITPA 3CIJA 2XXRA 1XHYA 2O7UA 4G68A 4Q8RA 3S9EA 3VXCA 1MG1A 4YMAA 4GQOA 2UXAA 5HPQA 1HSLA 1B2HA 1SYHA 1TFDA 1URSA 4H0WA 2CZLA 4POWA 4QFOA 3R7XA 3TTKA 3U93A 3VLVA 1MM6A 1A54A 1B0LA 4Z7EA 2I58A 1IQ7A 1B58A 1USYH 4M1VA 2XD2A 1ZKBA 2VGQA 3R6UA 4R74A 1P1QA 1UQWA 2DYXA 1MPDA 3H7MA 4LZ7A 3O28A 3PUVE 4MH5A 3U92A 5K2XA 2QSXA 2X26A 4H6DA 1HSJA 1R9LA 2XX9A 3QUJA 4M4GA 4YZZA 3W9WA 1UIVA 2DSFA 3FASA 4C1TA 3N26A 3UORA 4LQ2A 1DMBA 3IAZA 2ANJA 1EU8A 1FTKA 2AYSA 2HZKA 2Y7IA 3W15C 1GGGA 2O6AA 4Z0IA 4RY1A 2YPNA 3K6VA 4DZ1A 3L6GA 5H8FA 3IOWA 2ONSA 2HXWA 3PD8A 4ZEFA 4UA8A 3M3FA 3BKIB 3MQ9A 2ABHA 2NOOA 4GXAA 3O6IA 2O1MA 3SEUA 4R73A 3SEWA 5A5XA 1OVTA 1M5BA 4NF5B 1NNPA 2H9BA 4QSCA 4ONYA 1B51A 4RPOA 1SW4A 3CSBA 3SERA 3TUSA 4R2FA 1LAXA 1B3EA 3PUWE 4X48A 4ELPA 2D3IA 1Y9UA 2FNCA 1LAHE 3LUYA 3ODBA 3DLNA 3PUXE 3SEVA 3TTLA 4F3BA 3LSXA 2Q2AA 1L5TA 1MS7A 3PMXA 4PFTA 3H6UA 1N04A 5FHOA 5I58A 1LFHA 3H3GA 1Y4TA 2DS9A 4JBZA 4QRZA 3OO6A 5I2KA 2OLBA 2DP8A 4MBPA 3G7WA 4BDOA 4F39A 5AA4B 1B7ZA 4ZECA 2H4IA 4PQJA 2GHAA 2RCBA 3KSJA 3K00A 3RLFE 3K6XA 2O68A 4OWDA 3B7DA 3KJTA 1P1NA 4U23A 4KI0E 4OTEA 1ZU0A 3SKPA 5CMCA 4TLMB 3HV1A 3QSLA 4QF9A 5B7DA 4ZZEA 1USYE 1IXCA 5IKBA 1B3GA 1BKAA 2Y7KA 3EHTA 4DE8A 3OELA 1I69A 4HCWA 2P0SA 1H3DA 1Q1KA 4HS7A 5FTIA 1MY3A 4FORA 4NF6B 3PPQA 5TPAA 1M5CA 1YCJA 3N94A 1MRPA 3A3UA 5I57A 4KFQA 5L8DA 5DTBA 4FJPA 3H4ZA 3PMVA 1GR2A 3MZ1A 1IUDA 2H25A 2E0SA 2VHAA 5DT6A 4QSEA 3VFJA 3V83A 2OJTA 2HAUA 2QS4A 4U4SA 2DWHA 2ZMBA 4GD5A 3OEMA 5I57B 1SDXA 4NF8A 5H8QA 4F22A 3IJXB 3S9LC 4C0RA 2P2AA 4G2ZA 1FQEA 2G93A 1NH8A 3FV1A 3N5LA 5EHMA 3ILUB 5ICQA 3EF7A 2VD2A 3R26A 2R9JA 2XXIA 4G4PA 4IO3A 4R9GA 3T9XB 4FECA 5DVJA 3ZS6A 4PE5B 3S9NC 4ZE8A 4U2RA 4EUOA 3MVYA 4EQ9A 2UVJA 1M5FA 4K3FA 3MJNA 2X7QA 3S4UA 1EZOA 2V93A 1B40A 3VLUA 5K2YA 1NNKA 1YPNA 2AIXA 4LATA 4P0GA 3G3IA 4RA1A 3FVNA 3QXMA 4R9FA 2ZYKA 3CSGA 2ZYMA 1A55A 2I3VA 3G3GA 3E3KA 3ZKLA 4OMBA 3RUMA 5I59B 5I2NA 1URDA 2OWTA 2P1SA 3DM0A 4XXUA 1NNTA 2ZNTA 3IO6A 3O9PA 4NMYA 4THIA 3T9HB 5I56A 2UYEA 1FW0A 4FE8A 3VDFA 4F18A 1P1OA 3P7IA 2Z23A 3H6WA 5CBSA 5CM6A 3FZVA 1P99A 4ELRA 2ZXTA 2R6GE 2B3BA 2F8DA 2HAVA 2QMXA 3G3FA 4YB5A 1R6ZA 3IB1A 4OQOA 3UIFA 3C34A 4EF1A 4ELOA 5J1DA 3CVGA 3K1PA 1ZTYA 1J1NA 2I49A 2IEEA 1QW0A 1UTHA 1P1UA 3PPRA 4RK2A 3FVGA 4WEPA 1AOVA 2V84A 3T93B 3TQWA 1PB8A 2ZNUA 4O3CA 1PDAA 2GRVA 2RC8A 3TEPA 1GVCA 3C31A 5FTHA 4F3GA 3PV0E 3H6TA 3JZJA 4YKKA 3C36A 1Y1ZA 1Y3NA 2UVGA 1B3HA 2G29A 4F1YA 1OMPA 1RKMA 3VXBA 5FHMA 2Q2CA 3EN3A 3EHUA 1XVYA 1S50A 2BJJX 3S9MC 3HCQA 1FTJA 3LSWA 4DCYA 1OQHA 4YU0A 3F11A 1OLAA 4GXSB 2D21A 4PP0A 2XHDA 4KCCA 2I4CA 3PUZE 2F5XA 4F1UA 3IB0A 1GTKA 4U1OA 3MP8A 5CRYA 1IITA 4XKQA 4F19A 4JWOA 4KHZE 3O97A 2E1SA 4GL0A 2DWJA 1LSTA 3THIA 3TPAA 3B6TA 1ANFA 3HPIA 5H8NB 2OZZA 3V89B 3MPKA 4MLQA 1BLFA 3GLBA 3IOTA 4GIZA 1AL3A 4LONB 3IX1A 1JQFA 4ESWA 4NEDA 1R9QA 2XXPA 5I59A 3FVKA 4N6PA 3T96B 1SD3A 3KN8A 3OO7A 3CRBA 3KBRA 3UK4A 2ESNA 5CBRA 3TCHA 2DE3A 1XOCA 2DXRA 3K4UA 2HFBA 4H5FA 4IY6A 3KSXA 2HQ0A 3ILTB 3AXFA 3O29A 4JWYA 1TFAA 4XIGQ 5DVFA 3RN8A 3SEXA 3RTFB 3A3CA 3FXQA 1WVJA 3KN7A 4OERA 1QUIA 1VFDA 3FXRA 2NUVA 4OFOA 3PD9A 3A09A 4YB7A 4X1DA 5FHNA 2RINA 2XX8A 1IXGA 4Q30B 3TCGA 1FCKA 3HHGA 1LCTA 1LAFE 4Q5TA 1NMUA 3UN6A 4XKRA 1VFEA 2XXTA 5I58B 1B7UA 5AA3A 1LBCA 2KLFA 2D5WA 4NE4A 4PETA 3USDA 5AA1A 3OXNA 2QL3A 2UVIA 3BFUA 5KCJB 3I3VA 2Y7WA 3CR9A 1H76A 2Q8JA 3T22A 5L9SA 1SW5A 1XS5A 1B6HA 3QUFA 4O3AA 3O2AA 1DPEA 5L9MA 4F29A 1I6QA 5A5XB 3FATA 1B32A 3K02A 1FTMA 5I84A 3DP4A 4ESXA 1O63A 5B70A 4KPTA 1MH4A 4OFJA 1WDNA 1ZBMA 2X7PA 4RYAA 5LOMA 2F36A 1CE2A 1IXHA 3C32A 1POTA 3C35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ECF A;  3D4G A;  4BDL A;  3E4R A;  1IXI A;  2QS1 A;  4RJZ A;  3OEK A;  2FYI A;  3L6H A;  1B3L A;  1IEJ A;  3PPO A;  4GWO A;  3EPE A;  4JSO A;  4LA9 A;  4BDN A;  4ZEB A;  4H8I A;  2Q88 A;  1B4H A;  1OLC A;  2V3T A;  2DOJ A;  3E13 X;  3MAM A;  1MY0 A;  3MVW A;  4JSD A;  5DYH A;  4F3P A;  2DXY A;  1QVS A;  4G8N A;  1O64 A;  2PMS A;  3G3H A;  3OOA A;  4JB7 A;  2Z8D A;  1POY 1;  5DEX A;  5AE4 A;  3TCF A;  3FUZ A;  1S7Y A;  3H6V A;  1UIU A;  1XVX A;  5I2K B;  2F7B A;  1SW2 A;  2HCA A;  3C9H A;  1F9B A;  3M8U A;  1VR5 A;  3OMB A;  1PBP A;  4PFW A;  4IO2 A;  3MW0 A;  4OEU A;  4EXL A;  2GFE A;  3O6H A;  3FIR A;  2ONR A;  3IJO B;  1SVX B;  4QSD A;  4IO4 A;  2Q89 A;  4YAH X;  3TOD A;  3K2D A;  4RPN A;  1LLS A;  4GRK A;  3KOT A;  4NF6 A;  3CFL A;  3FJG A;  3T9U A;  2F34 A;  4O3B A;  1PB9 A;  1Z7N E;  2ZYN A;  3WAF A;  4NF5 A;  1MY1 A;  5BWJ A;  1AH5 A;  1Q35 A;  3KN3 A;  1NFT A;  3M3K A;  5DEX B;  1XC1 A;  4Q0C A;  4IGR A;  1FQC A;  4KD5 A;  1SI1 A;  1Z7M E;  2VP1 A;  3FGS A;  1IIW A;  1B7H A;  3LSL A;  2GH9 A;  3MZB A;  4OHN A;  5H8F B;  2RF1 A;  4F2Q A;  3MVZ A;  4GVO A;  4OFL A;  5KZT A;  3HO7 A;  3C4M A;  1TWY A;  3CG3 A;  1B9J A;  5AA4 A;  3LSF B;  4HCY A;  1ZIU A;  4NF8 B;  1JW4 A;  1US5 A;  1MPB A;  3K6W A;  3MP6 A;  3N6T A;  3GBA A;  5H8Q B;  3V5A A;  3BFT A;  1LB8 A;  4QHQ A;  1Y3Q A;  2VOZ A;  4FEB A;  1QKA A;  1B52 A;  1NNF A;  4H1X A;  4IO7 A;  2A5T B;  5H8N A;  5ITO A;  5IAI A;  1BTJ A;  3RY3 A;  4L17 A;  3PPP A;  5KDT A;  3CG1 A;  3PUY E;  4KQP A;  1S9T A;  3ONM A;  4R72 A;  1MQI A;  3IO4 A;  2Q9T A;  3MP1 A;  3Q25 A;  3SET A;  1M5E A;  4LQ5 A;  3LBS A;  3MWB A;  1QUK A;  3HST A;  3G3K A;  3KEI A;  1NKX A;  2A5T A;  5KCJ A;  2PX1 A;  2DQV A;  3LC8 A;  4N13 A;  2PYY A;  1B1X A;  5EYF A;  4YMB A;  2F6P A;  3C33 A;  4QFL A;  1N0T A;  3VV5 A;  1FQB A;  4YKP A;  4H67 A;  1MQG A;  3DP8 A;  3FVO A;  1RYO A;  2HEU A;  3GXA A;  5H8S A;  1CB6 A;  1LB9 A;  3DP6 A;  3S2V A;  4EQ7 A;  4HW8 A;  4G8H A;  4YB6 A;  1LCF A;  2CMO A;  4ZDM A;  2XX7 A;  3MBP A;  4NWD A;  1M5D A;  4IGT A;  4IY5 A;  1UTB B;  3T9V A;  1R1N A;  3RTW B;  2YJP A;  4R6Y A;  4QFP A;  1N7X A;  4FED A;  1MY2 A;  4BDR A;  5H8H B;  3IOR A;  3M3L A;  5ELV A;  3K0V A;  4U1Z A;  2OBG A;  4IO6 A;  5F1Q A;  5AA2 A;  1N3W A;  5DVI A;  1P1W A;  3HN0 A;  3G3J A;  4LZ5 A;  1T0K A;  3H06 B;  1II5 A;  1IZ1 A;  2THI A;  1N7W A;  4MFI A;  4P11 A;  2AL4 A;  2ALU A;  5CMM A;  2NVU B;  3SES A;  3U72 A;  1JVY A;  1US4 A;  3MC2 A;  3ECR A;  4XKP A;  5F7V A;  1SYI A;  1N84 A;  4OVJ A;  1Y1M A;  4XTC Q;  4DXC A;  5TP9 A;  3FV2 A;  2F78 A;  3EQ1 A;  3JYR A;  4ND9 A;  1SW1 A;  4YKI A;  2QRY A;  2RCA A;  5AA2 D;  1MQD A;  1LFG A;  3OO9 A;  5JK4 A;  3QYT A;  4PFY A;  4BDQ A;  3K01 A;  1QUJ A;  4FAT A;  2IA4 A;  2H99 A;  4AB5 A;  3FJ7 A;  3IL1 B;  2DE2 A;  1JEU A;  1H45 A;  3D4C A;  1Y4C A;  2QMW A;  3TTR A;  3K6U A;  3VVF A;  1H44 A;  1OIB A;  3KOS A;  4G8M A;  3CFZ A;  1QUL A;  2W7Y A;  4LP2 B;  1URG A;  4IB2 A;  1MXV A;  4JWX A;  2O69 A;  4H8J A;  2OWS A;  2XXX A;  3DEL B;  4KR5 A;  4XKN A;  3TFL A;  3Q26 A;  3IB2 A;  3O66 A;  1MXW A;  5JTY B;  3TMG A;  1UTH B;  2DVZ A;  4I62 A;  2FA7 A;  4ZS9 A;  1A8E A;  4TOZ A;  3KGC A;  3OSR A;  1B5I A;  3I5O A;  2XXH A;  1BIY A;  2QS3 A;  2I48 A;  3KJ7 A;  3KG2 A;  3OD7 A;  1ELJ A;  4G77 A;  4GL8 A;  2V3U A;  4OEN A;  1FTO A;  1GV8 A;  1MQJ A;  2RKM A;  4F1V A;  1B46 A;  1MPC A;  3TQL A;  5CC2 A;  1B05 A;  3B6Q A;  1LFI A;  4F3S A;  2AL5 A;  5I56 B;  4ISU A;  2H98 A;  3TTM A;  4DIG A;  4U4X A;  3WAE A;  2Y7R A;  2QJE A;  1N3X A;  1LBB A;  5TU0 A;  3BBR A;  3TAJ A;  2XXV A;  5CI5 A;  4JDF A;  4N07 A;  1EZP A;  3H03 A;  3V8X B;  2RC7 A;  1HSE A;  3MUQ A;  1QJM A;  1SI0 A;  1D4N A;  2O84 X;  2ONK E;  3GBB A;  1BP5 A;  5I2N B;  3E9X A;  1EZ9 A;  1DTG A;  3TYH A;  4DXB A;  3HHF A;  2ZNS A;  1UTB A;  1VE4 A;  3Q29 A;  3SEY A;  4EF2 A;  1MXX A;  2QPQ A;  2Y84 A;  1H43 A;  3IOV A;  4H5G A;  4NTL A;  4EXK A;  4EQB A;  2XXQ A;  1MXY A;  4RXL A;  4OEV A;  1D9V A;  2YLN A;  4F31 B;  2GHB A;  4C1U A;  4KCD A;  2V3Q A;  1MY4 A;  3TZA A;  2V25 A;  2R71 A;  4DCX A;  2XXY A;  1FQA A;  1AMF A;  5ISU A;  4P0I A;  3JV9 A;  4X9T A;  2F97 A;  2DWA A;  4LZ8 A;  3CFX A;  1NL5 A;  1FQF A;  4YIC A;  3QAX A;  1ZJL A;  4ZEK A;  3TDJ A;  2Z8F A;  1AIV A;  3K1M A;  3FXU A;  4OZ9 A;  2PT2 A;  2M8C A;  1DSN A;  2ZYO A;  3Q27 A;  4E0X A;  4OET A;  3T66 A;  4AQ4 A;  4ELQ A;  1JET A;  4POX A;  4ZZA A;  4GF8 A;  3PMW A;  2RC9 A;  4E0W A;  2HZL A;  2I3W A;  4DXU A;  1MQH A;  3ZSF A;  1B5H A;  2DWI A;  4JXI A;  3VE1 B;  1JEV A;  4RNS A;  1MXZ A;  1N76 A;  1MH3 A;  1D3K A;  1FTL A;  3U8Q A;  3IK6 B;  3VVD A;  5ICT A;  3QK6 A;  3RGY A;  1B0H A;  2Z8E A;  2OK2 A;  4BDM A;  4R6K A;  1MDQ A;  4UAC A;  3I6V A;  4NF4 B;  5CMK A;  2I0B A;  3PPN A;  2DE4 A;  3VLW A;  1B4Z A;  1MDP 1;  5HM4 B;  5JEI A;  1D9Y A;  3KZG A;  5L9O A;  2PVU A;  1YTV A;  1LAG E;  2I0C A;  2REG A;  2UYF A;  3MZ9 A;  4H65 A;  3UGW A;  2Y7P A;  1B5J A;  3FD3 A;  2A5S A;  1I6A A;  3FJM A;  4I9D A;  2UVH A;  4IO5 A;  4I8C A;  1DTZ A;  4GLI A;  2PT1 A;  2F7A A;  4QFN A;  4NF4 A;  2NXO A;  3QIM A;  1TT1 A;  4TLL B;  3KFM A;  4WKM A;  1JVX A;  1A40 A;  1RYX A;  5M2V A;  5H8H A;  3IR1 A;  4BLA A;  1OVB A;  1QKB A;  3CI8 A;  3K1N A;  4HTG A;  4GOT A;  2REJ A;  3LR1 A;  4R6H A;  1MM7 A;  3UA8 A;  1SQY A;  1Y3P A;  1YAE A;  3U94 A;  4QFK A;  1Y20 A;  4OXV A;  1B3F A;  4R2B A;  3Q28 A;  1KWH A;  5JTY A;  1ZMG A;  5BUU A;  1A8F A;  4PFU A;  3UP9 A;  1B1H A;  1LGB C;  2LAO A;  3U1O A;  4FIM A;  3W9V A;  1SBP A;  2F6G A;  4KYD A;  4LUB A;  4TQU Q;  3OSQ A;  1ATG A;  3IOU A;  2Z22 A;  4X1B A;  4ZE9 A;  1A99 A;  1MXU A;  4YKJ A;  3RT8 A;  4RK9 A;  4U21 A;  5HBC A;  3RQT A;  4G68 C;  3ZKK A;  2WKY A;  2PBW A;  1PBQ A;  2DVC A;  4ZEI A;  4ZED A;  4OES A;  1FQD A;  1PEB A;  4WED A;  3TEL A;  1JW5 A;  3RNN A;  3RPW A;  2I6E A;  1DOT A;  1PC3 A;  2XXU A;  3MPL A;  2I4B A;  4R75 A;  1VSO A;  1XT8 A;  5TP9 B;  2F35 A;  2O7I A;  1PB7 A;  2B3F A;  2F7C A;  3OO8 A;  1I6B A;  5KDT B;  1TXF A;  3PU5 A;  1EH3 A;  2VD3 A;  3PGF A;  4F2O A;  2H5Y A;  3EHS A;  1ZLQ A;  3MVX A;  2NWJ A;  4U22 A;  1A7L A;  1DPP A;  2XD3 A;  4MLV A;  3TKD A;  4DLD A;  4GFR A;  3GZG A;  3OEN A;  3SDF A;  5CMB A;  3TTN A;  5AA2 B;  2QS2 A;  2B65 A;  1NH7 A;  1JNF A;  4AB6 A;  3RT6 B;  2OCU A;  4MF3 A;  1O7T A;  4NWC A;  4G68 B;  4WXJ A;  3N6U A;  5EHS A;  3B6W A;  4LVQ A;  4DDD A;  4KYE A;  4EDP A;  4OYV A;  2O51 A;  4I1D A;  3VVE A;  5TPA B;  4KYS A;  4FAJ A;  1OQG A;  2XXW A;  2O1L A;  3O6G A;  1JW1 A;  1WOD A;  5ITP A;  3CIJ A;  2XXR A;  1XHY A;  2O7U A;  4G68 A;  4Q8R A;  3S9E A;  3VXC A;  1MG1 A;  4YMA A;  4GQO A;  2UXA A;  5HPQ A;  1HSL A;  1B2H A;  1SYH A;  1TFD A;  1URS A;  4H0W A;  2CZL A;  4POW A;  4QFO A;  3R7X A;  3TTK A;  3U93 A;  3VLV A;  1MM6 A;  1A54 A;  1B0L A;  4Z7E A;  2I58 A;  1IQ7 A;  1B58 A;  1USY H;  4M1V A;  2XD2 A;  1ZKB A;  2VGQ A;  3R6U A;  4R74 A;  1P1Q A;  1UQW A;  2DYX A;  1MPD A;  3H7M A;  4LZ7 A;  3O28 A;  3PUV E;  4MH5 A;  3U92 A;  5K2X A;  2QSX A;  2X26 A;  4H6D A;  1HSJ A;  1R9L A;  2XX9 A;  3QUJ A;  4M4G A;  4YZZ A;  3W9W A;  1UIV A;  2DSF A;  3FAS A;  4C1T A;  3N26 A;  3UOR A;  4LQ2 A;  1DMB A;  3IAZ A;  2ANJ A;  1EU8 A;  1FTK A;  2AYS A;  2HZK A;  2Y7I A;  3W15 C;  1GGG A;  2O6A A;  4Z0I A;  4RY1 A;  2YPN A;  3K6V A;  4DZ1 A;  3L6G A;  5H8F A;  3IOW A;  2ONS A;  2HXW A;  3PD8 A;  4ZEF A;  4UA8 A;  3M3F A;  3BKI B;  3MQ9 A;  2ABH A;  2NOO A;  4GXA A;  3O6I A;  2O1M A;  3SEU A;  4R73 A;  3SEW A;  5A5X A;  1OVT A;  1M5B A;  4NF5 B;  1NNP A;  2H9B A;  4QSC A;  4ONY A;  1B51 A;  4RPO A;  1SW4 A;  3CSB A;  3SER A;  3TUS A;  4R2F A;  1LAX A;  1B3E A;  3PUW E;  4X48 A;  4ELP A;  2D3I A;  1Y9U A;  2FNC A;  1LAH E;  3LUY A;  3ODB A;  3DLN A;  3PUX E;  3SEV A;  3TTL A;  4F3B A;  3LSX A;  2Q2A A;  1L5T A;  1MS7 A;  3PMX A;  4PFT A;  3H6U A;  1N04 A;  5FHO A;  5I58 A;  1LFH A;  3H3G A;  1Y4T A;  2DS9 A;  4JBZ A;  4QRZ A;  3OO6 A;  5I2K A;  2OLB A;  2DP8 A;  4MBP A;  3G7W A;  4BDO A;  4F39 A;  5AA4 B;  1B7Z A;  4ZEC A;  2H4I A;  4PQJ A;  2GHA A;  2RCB A;  3KSJ A;  3K00 A;  3RLF E;  3K6X A;  2O68 A;  4OWD A;  3B7D A;  3KJT A;  1P1N A;  4U23 A;  4KI0 E;  4OTE A;  1ZU0 A;  3SKP A;  5CMC A;  4TLM B;  3HV1 A;  3QSL A;  4QF9 A;  5B7D A;  4ZZE A;  1USY E;  1IXC A;  5IKB A;  1B3G A;  1BKA A;  2Y7K A;  3EHT A;  4DE8 A;  3OEL A;  1I69 A;  4HCW A;  2P0S A;  1H3D A;  1Q1K A;  4HS7 A;  5FTI A;  1MY3 A;  4FOR A;  4NF6 B;  3PPQ A;  5TPA A;  1M5C A;  1YCJ A;  3N94 A;  1MRP A;  3A3U A;  5I57 A;  4KFQ A;  5L8D A;  5DTB A;  4FJP A;  3H4Z A;  3PMV A;  1GR2 A;  3MZ1 A;  1IUD A;  2H25 A;  2E0S A;  2VHA A;  5DT6 A;  4QSE A;  3VFJ A;  3V83 A;  2OJT A;  2HAU A;  2QS4 A;  4U4S A;  2DWH A;  2ZMB A;  4GD5 A;  3OEM A;  5I57 B;  1SDX A;  4NF8 A;  5H8Q A;  4F22 A;  3IJX B;  3S9L C;  4C0R A;  2P2A A;  4G2Z A;  1FQE A;  2G93 A;  1NH8 A;  3FV1 A;  3N5L A;  5EHM A;  3ILU B;  5ICQ A;  3EF7 A;  2VD2 A;  3R26 A;  2R9J A;  2XXI A;  4G4P A;  4IO3 A;  4R9G A;  3T9X B;  4FEC A;  5DVJ A;  3ZS6 A;  4PE5 B;  3S9N C;  4ZE8 A;  4U2R A;  4EUO A;  3MVY A;  4EQ9 A;  2UVJ A;  1M5F A;  4K3F A;  3MJN A;  2X7Q A;  3S4U A;  1EZO A;  2V93 A;  1B40 A;  3VLU A;  5K2Y A;  1NNK A;  1YPN A;  2AIX A;  4LAT A;  4P0G A;  3G3I A;  4RA1 A;  3FVN A;  3QXM A;  4R9F A;  2ZYK A;  3CSG A;  2ZYM A;  1A55 A;  2I3V A;  3G3G A;  3E3K A;  3ZKL A;  4OMB A;  3RUM A;  5I59 B;  5I2N A;  1URD A;  2OWT A;  2P1S A;  3DM0 A;  4XXU A;  1NNT A;  2ZNT A;  3IO6 A;  3O9P A;  4NMY A;  4THI A;  3T9H B;  5I56 A;  2UYE A;  1FW0 A;  4FE8 A;  3VDF A;  4F18 A;  1P1O A;  3P7I A;  2Z23 A;  3H6W A;  5CBS A;  5CM6 A;  3FZV A;  1P99 A;  4ELR A;  2ZXT A;  2R6G E;  2B3B A;  2F8D A;  2HAV A;  2QMX A;  3G3F A;  4YB5 A;  1R6Z A;  3IB1 A;  4OQO A;  3UIF A;  3C34 A;  4EF1 A;  4ELO A;  5J1D A;  3CVG A;  3K1P A;  1ZTY A;  1J1N A;  2I49 A;  2IEE A;  1QW0 A;  1UTH A;  1P1U A;  3PPR A;  4RK2 A;  3FVG A;  4WEP A;  1AOV A;  2V84 A;  3T93 B;  3TQW A;  1PB8 A;  2ZNU A;  4O3C A;  1PDA A;  2GRV A;  2RC8 A;  3TEP A;  1GVC A;  3C31 A;  5FTH A;  4F3G A;  3PV0 E;  3H6T A;  3JZJ A;  4YKK A;  3C36 A;  1Y1Z A;  1Y3N A;  2UVG A;  1B3H A;  2G29 A;  4F1Y A;  1OMP A;  1RKM A;  3VXB A;  5FHM A;  2Q2C A;  3EN3 A;  3EHU A;  1XVY A;  1S50 A;  2BJJ X;  3S9M C;  3HCQ A;  1FTJ A;  3LSW A;  4DCY A;  1OQH A;  4YU0 A;  3F11 A;  1OLA A;  4GXS B;  2D21 A;  4PP0 A;  2XHD A;  4KCC A;  2I4C A;  3PUZ E;  2F5X A;  4F1U A;  3IB0 A;  1GTK A;  4U1O A;  3MP8 A;  5CRY A;  1IIT A;  4XKQ A;  4F19 A;  4JWO A;  4KHZ E;  3O97 A;  2E1S A;  4GL0 A;  2DWJ A;  1LST A;  3THI A;  3TPA A;  3B6T A;  1ANF A;  3HPI A;  5H8N B;  2OZZ A;  3V89 B;  3MPK A;  4MLQ A;  1BLF A;  3GLB A;  3IOT A;  4GIZ A;  1AL3 A;  4LON B;  3IX1 A;  1JQF A;  4ESW A;  4NED A;  1R9Q A;  2XXP A;  5I59 A;  3FVK A;  4N6P A;  3T96 B;  1SD3 A;  3KN8 A;  3OO7 A;  3CRB A;  3KBR A;  3UK4 A;  2ESN A;  5CBR A;  3TCH A;  2DE3 A;  1XOC A;  2DXR A;  3K4U A;  2HFB A;  4H5F A;  4IY6 A;  3KSX A;  2HQ0 A;  3ILT B;  3AXF A;  3O29 A;  4JWY A;  1TFA A;  4XIG Q;  5DVF A;  3RN8 A;  3SEX A;  3RTF B;  3A3C A;  3FXQ A;  1WVJ A;  3KN7 A;  4OER A;  1QUI A;  1VFD A;  3FXR A;  2NUV A;  4OFO A;  3PD9 A;  3A09 A;  4YB7 A;  4X1D A;  5FHN A;  2RIN A;  2XX8 A;  1IXG A;  4Q30 B;  3TCG A;  1FCK A;  3HHG A;  1LCT A;  1LAF E;  4Q5T A;  1NMU A;  3UN6 A;  4XKR A;  1VFE A;  2XXT A;  5I58 B;  1B7U A;  5AA3 A;  1LBC A;  2KLF A;  2D5W A;  4NE4 A;  4PET A;  3USD A;  5AA1 A;  3OXN A;  2QL3 A;  2UVI A;  3BFU A;  5KCJ B;  3I3V A;  2Y7W A;  3CR9 A;  1H76 A;  2Q8J A;  3T22 A;  5L9S A;  1SW5 A;  1XS5 A;  1B6H A;  3QUF A;  4O3A A;  3O2A A;  1DPE A;  5L9M A;  4F29 A;  1I6Q A;  5A5X B;  3FAT A;  1B32 A;  3K02 A;  1FTM A;  5I84 A;  3DP4 A;  4ESX A;  1O63 A;  5B70 A;  4KPT A;  1MH4 A;  4OFJ A;  1WDN A;  1ZBM A;  2X7P A;  4RYA A;  5LOM A;  2F36 A;  1CE2 A;  1IXH A;  3C32 A;  1POT A;  3C35 A; 
#chains in the Genus database with same CATH topology
 3LV0 A;  5EQ7 A;  4O8M A;  2QS1 A;  2V3T A;  5DYH A;  4F3P A;  2DXY A;  1O64 A;  2PMS A;  3OOA A;  3TCF A;  3C9H A;  1F9B A;  4EXL A;  4IO2 A;  4QSD A;  2ONR A;  1SVX B;  3BIH A;  4O3B A;  1Z7N E;  5EYH A;  1MY1 A;  5DEX B;  1Q35 A;  3M3K A;  1XC1 A;  3ISP A;  2VP1 A;  2P3N A;  1QGX A;  4NQ8 A;  2R8T A;  3MVZ A;  4GVO A;  5KZT A;  3C4M A;  3LSF B;  1ZIU A;  5H8Q B;  1JW4 A;  3MP6 A;  1YZ0 A;  3BFT A;  3S9L C;  4GWW A;  1QKA A;  1B52 A;  3RY3 A;  4L17 A;  3PPP A;  1NV6 A;  1S9T A;  4PE3 A;  3IO4 A;  4O7I A;  4LQ5 A;  2KQZ A;  3LBS A;  3G3K A;  5FBP A;  2A5T A;  2DQV A;  3LC8 A;  4N13 A;  2CZH A;  5EYF A;  1N0T A;  1NV1 A;  3U65 A;  1CB6 A;  4EQ7 A;  4HW8 A;  1IMC A;  4G8H A;  2CMO A;  1KA1 A;  2XX7 A;  3MBP A;  4NWD A;  4IGT A;  4QFP A;  2FHY A;  4QBA A;  1N3W A;  2ZZX A;  4LZ5 A;  1IZ1 A;  1N7W A;  3SES A;  4XEQ A;  1N84 A;  1Y1M A;  3JYR A;  4ND9 A;  1MQD A;  3OO9 A;  3QYT A;  4PFY A;  1QUJ A;  2H99 A;  3IL1 B;  2DE2 A;  1Y4C A;  3TTR A;  3K6U A;  1URG A;  1MXV A;  4JWX A;  3TFL A;  4XKN A;  5JTY B;  1UTH B;  2FA7 A;  4OVQ A;  5DW8 A;  4PFI A;  1B5I A;  2QS3 A;  2DDK A;  2I48 A;  3KG2 A;  3UP9 A;  1ELJ A;  4OEN A;  1FTO A;  1MPC A;  2XA5 A;  1B05 A;  1LFI A;  4ISU A;  4U4X A;  5TU0 A;  1XI6 A;  3V8X B;  2RC7 A;  1D4N A;  3GBB A;  5I2N B;  1DTG A;  5ET6 A;  1UTB A;  1VE4 A;  1H43 A;  3IOV A;  4MHF A;  4NTL A;  5IZ3 B;  4EQB A;  4F31 B;  2QVV A;  4N8Y A;  2R71 A;  1FQA A;  5ISU A;  4P0I A;  3CFX A;  4YIC A;  1FQF A;  4N91 A;  1ZJL A;  3K1M A;  1DSN A;  2ZYO A;  5F24 A;  4DXU A;  2DWI A;  4JXI A;  1FTL A;  3QK6 A;  5I2N A;  4R6K A;  3PPN A;  3VLW A;  5JEI A;  1D9Y A;  2REG A;  2I0C A;  4MNC A;  3E78 A;  3UGW A;  4IO5 A;  1B5J A;  3KBZ A;  2PT1 A;  2F7A A;  4WKM A;  3QIM A;  5B7D A;  3KFM A;  1JVX A;  1A40 A;  1NV0 A;  1OVB A;  3K1N A;  4NX1 A;  1IME A;  4R6H A;  1SQY A;  4JVI A;  4OXV A;  1B3F A;  2ZZV A;  5JTY A;  1KWH A;  2XWV A;  1ZMG A;  1FPI A;  2LAO A;  1SBP A;  4TQU Q;  3OSQ A;  2PFY A;  3ZKK A;  3BIG A;  4IR8 A;  3RNN A;  2XXU A;  4I40 A;  1PB7 A;  1I6B A;  3SZP A;  4F2O A;  1FBD A;  2NWJ A;  2Y5L A;  1A7L A;  3TKD A;  5EQA A;  3OEN A;  4AS5 A;  3TTN A;  3RT6 B;  2OCU A;  4MF3 A;  5I7I A;  3N6U A;  5EHS A;  3B6W A;  4FAJ A;  2XXW A;  2O1L A;  3O6G A;  4G68 A;  3VXC A;  4YMA A;  1HSL A;  3R7X A;  1B0L A;  2ZZW A;  4Z7E A;  1IQ7 A;  1USY H;  3R6U A;  4R74 A;  4GX6 A;  2X26 A;  2XX9 A;  4M4G A;  1UIV A;  4PC9 A;  1EU8 A;  2WYP A;  1FTK A;  2AYS A;  2PFZ A;  4RY1 A;  3K6V A;  5H8F A;  3L6G A;  3IOW A;  2ONS A;  3PD8 A;  3BKI B;  2NOO A;  3O6I A;  2O1M A;  4R73 A;  3SEW A;  1OVT A;  4NF5 B;  2CZK A;  2H9B A;  1SW4 A;  3TUS A;  4R2F A;  1LAX A;  2D3I A;  2FNC A;  4MMP A;  3SEV A;  3LUY A;  3LSX A;  1MS7 A;  3PMX A;  5I58 A;  4JBZ A;  3OO6 A;  4F39 A;  4ZEC A;  2RCB A;  3K00 A;  3K6X A;  1P1N A;  4OTE A;  3QSL A;  4G61 A;  1B3G A;  3EHT A;  4DE8 A;  4HCW A;  1H3D A;  4XFE A;  4FOR A;  3PPQ A;  3A3U A;  4PAI A;  5IZZ A;  5DT6 A;  3V83 A;  2OJT A;  2QS4 A;  4NF0 A;  1SDX A;  3ROJ A;  2P2A A;  3FV1 A;  2V4C A;  3N5L A;  5ICQ A;  2VD2 A;  2XXI A;  4R9G A;  5DVJ A;  4U2R A;  4JVD A;  3MJN A;  5K2Y A;  5IGA A;  3CSG A;  4OVP A;  3G3G A;  1FTA A;  1NNT A;  2WX9 A;  4THI A;  5LTC A;  1FW0 A;  1P1O A;  3P7I A;  3FZV A;  2QMX A;  3G3F A;  4YB5 A;  4ELO A;  3C34 A;  3CVG A;  3K1P A;  2I49 A;  2V84 A;  4O3C A;  2GRV A;  3PV0 E;  3H6T A;  3JZJ A;  3C36 A;  2Q2C A;  3HCQ A;  1OQH A;  4PP0 A;  3QMF A;  4KCC A;  3PUZ E;  3IB0 A;  5CRY A;  3MP8 A;  2E1S A;  2DWJ A;  2PCR A;  3HPI A;  5H8N B;  3IOT A;  1K9Y A;  1AL3 A;  3IX1 A;  1JQF A;  1R9Q A;  3T96 B;  4N6P A;  1SD3 A;  3OO7 A;  1YXI A;  1SPI A;  2ESN A;  3TCH A;  2DE3 A;  2HFB A;  4IY6 A;  2HQ0 A;  3O29 A;  1TFA A;  1QUI A;  4OFO A;  3FXR A;  2RIN A;  1LAF E;  5I58 B;  1EYK A;  1B7U A;  5AA3 A;  2KLF A;  4PET A;  5AA1 A;  3GYY A;  5KCJ B;  3I3V A;  3T22 A;  1Q9D A;  4O3A A;  3O2A A;  1DPE A;  3K02 A;  1K9Z A;  1FTM A;  3DP4 A;  5B70 A;  1IMF A;  3NOH A;  4OFJ A;  1WDN A;  2X7P A;  2Y5K A;  4GFR A;  4BDL A;  4RJZ A;  3OEK A;  2FYI A;  3L6H A;  4JSO A;  4Q8R A;  3EPE A;  4ZEB A;  4GWS A;  3MAM A;  4G8N A;  3G3H A;  4JB7 A;  3H6V A;  1SW2 A;  2HCA A;  3OMB A;  1VR5 A;  1PBP A;  4OEU A;  3TOD A;  4P47 A;  2Q89 A;  4GRK A;  3CFL A;  2F34 A;  1PB9 A;  2ZYN A;  1AH5 A;  4PTK A;  4IGR A;  4KD5 A;  1SI1 A;  3FGS A;  3MZB A;  4F2Q A;  4NF8 B;  1US5 A;  3N6T A;  3GBA A;  3FXB A;  1LB8 A;  1NV4 A;  2VOZ A;  5KDT A;  4R72 A;  1MQI A;  2Q9T A;  3Q25 A;  3SET A;  1FPJ A;  1NKX A;  2KR0 A;  4MNI A;  2HXR A;  2F6P A;  4NAP A;  4H67 A;  1MQG A;  5H8S A;  1LB9 A;  3S2V A;  4ZDM A;  1M5D A;  4IY5 A;  1R1N A;  3RTW B;  4R6Y A;  1N7X A;  4FED A;  5H8H B;  3IOR A;  5ELV A;  4U1Z A;  5AA2 A;  4HE1 A;  5DVI A;  1P1W A;  3G3J A;  1II5 A;  2ALU A;  3MC2 A;  4HXV A;  1FBP A;  4XTC Q;  4H46 A;  2F78 A;  3EQ1 A;  1SW1 A;  4BDQ A;  3K01 A;  2IA4 A;  4AB5 A;  3FJ7 A;  1JEU A;  3D4C A;  3VVF A;  1OIB A;  3KOS A;  3CFZ A;  2W7Y A;  5IM2 A;  4H8J A;  2XXX A;  3DEL B;  4KR5 A;  3O66 A;  3TMG A;  1MXW A;  1A8E A;  3OSR A;  4GBW A;  2XXH A;  3OD7 A;  2V3U A;  3TQL A;  3B6Q A;  3RPL B;  1FJ9 A;  4F3S A;  2H98 A;  2QJE A;  1DCU A;  4N6K A;  2XXV A;  3H03 A;  1SI0 A;  5ET8 A;  3E9X A;  1EZ9 A;  2WBB A;  4NG7 A;  3Q29 A;  4MAG A;  1LBW A;  1MXX A;  4H5G A;  4EXK A;  4RXL A;  1D9V A;  2YLN A;  2GHB A;  2V3Q A;  4DCX A;  3TZA A;  2WYK A;  4X8R A;  1AMF A;  2F97 A;  2DWA A;  2HHM A;  3TDJ A;  2Z8F A;  3FXU A;  4OZ9 A;  2PT2 A;  4E0X A;  3T66 A;  3ZSF A;  3VE1 B;  1JEV A;  1NUY A;  4RNS A;  3T0J A;  3U8Q A;  5ICT A;  1B0H A;  2I0B A;  1B4Z A;  1MDP 1;  5HM4 B;  3KZG A;  2PVU A;  2UYF A;  4H65 A;  4P8B A;  4I8C A;  1TT1 A;  1RYX A;  3IR1 A;  4HTG A;  1FPF A;  3IFA A;  4GOT A;  1MM7 A;  1Y3P A;  1Y20 A;  3Q28 A;  1A8F A;  4FIM A;  4X1B A;  4LUB A;  4YKJ A;  3RT8 A;  4RK9 A;  4G68 C;  2PBW A;  3CHG A;  4ZED A;  1FQD A;  4WED A;  4PF8 A;  2I6E A;  1PC3 A;  4R75 A;  5TP9 B;  2F35 A;  2B3F A;  2F7C A;  2QVR A;  2VD3 A;  5J16 A;  5EQ9 A;  4I3Y A;  2H5Y A;  1DPP A;  4MLV A;  4MCO A;  1O7T A;  4NWC A;  4LVQ A;  4DDD A;  4JVC A;  1FPD A;  4KYS A;  1OQG A;  4PGP A;  1XHY A;  4GX3 A;  4HE0 A;  4GQO A;  3RPL A;  1URS A;  3TTK A;  3VLV A;  1MM6 A;  1A54 A;  4M1V A;  3U92 A;  1MPD A;  3PUV E;  5K2X A;  4C1T A;  3N26 A;  3UOR A;  4LQ2 A;  4N81 A;  3IAZ A;  2ANJ A;  2Y7I A;  4DZ1 A;  2HXW A;  4ZEF A;  2JJK A;  2ABH A;  3SEU A;  1KZ8 A;  1M5B A;  2P3V A;  4RPO A;  3SER A;  3PUW E;  1Y9U A;  1LAH E;  3ODB A;  3PUX E;  4F3B A;  2Q2A A;  2CEX A;  5FHO A;  1LFH A;  2FVZ A;  5I2K A;  4MBP A;  2GHA A;  2O68 A;  3KJT A;  5CMC A;  4ZZE A;  1USY E;  1IXC A;  3KC0 A;  3OEL A;  2P0S A;  1Q1K A;  1MRP A;  5DTB A;  3PMV A;  4GBV A;  1GR2 A;  1IUD A;  4NHB A;  2E0S A;  4QSE A;  4P56 A;  2DWH A;  4NF8 A;  3IJX B;  4G2Z A;  3ILU B;  4N17 A;  3T9X B;  3S9N C;  2X7Q A;  2V93 A;  1B40 A;  4LAT A;  4P0G A;  3G3I A;  3QXM A;  2ZYK A;  1A55 A;  2XWK A;  2I3V A;  3ZKL A;  3RUM A;  5I59 B;  1URD A;  2P1S A;  3DM0 A;  4OVR A;  4XXU A;  3O9P A;  3VDF A;  4FE8 A;  5CBS A;  1P99 A;  2ZXT A;  1R6Z A;  3IB1 A;  3UIF A;  1FRP A;  1ZTY A;  2IEE A;  3PPR A;  4RK2 A;  1P1U A;  4WEP A;  3FVG A;  1AOV A;  3TQW A;  2ZNU A;  3TEP A;  3C31 A;  2UVG A;  2G29 A;  5FHM A;  3EN3 A;  1S50 A;  4YU0 A;  2D21 A;  4PFB A;  4U1O A;  4F1U A;  4KHZ E;  3V89 B;  4MLQ A;  1BLF A;  4LON B;  2XXP A;  3KN8 A;  3CRB A;  3KBR A;  1XOC A;  4H5F A;  5DVF A;  3AXF A;  4JWY A;  1INP A;  4OER A;  4X1D A;  4Q30 B;  5T3J A;  2D5W A;  2QFL A;  2Y7W A;  3CR9 A;  1H76 A;  3KC1 A;  4I3E A;  5L9M A;  1I6Q A;  3FAT A;  5I84 A;  4ESX A;  5LOM A;  5TPA B;  1IXH A;  4OA4 A;  3PPO A;  4GWO A;  1B3L A;  1IEJ A;  4LA9 A;  4BDN A;  1NUW A;  1FPB A;  1QVS A;  5AE4 A;  3FUZ A;  1S7Y A;  1UIU A;  3PTY A;  2GFE A;  4YAH X;  3FIR A;  3IJO B;  4IO4 A;  3K2D A;  3HFU A;  4RPN A;  4P1L A;  3T9U A;  2FIX A;  1NV2 A;  3WAF A;  4GWU A;  5BWJ A;  1NFT A;  1IMD A;  3LSL A;  4OFL A;  3HO7 A;  1B9J A;  4HCY A;  1MPB A;  3FBP A;  4QHQ A;  4FEB A;  1NNF A;  2A5T B;  5IAI A;  1BTJ A;  2VPO A;  4PF6 A;  3CG1 A;  1FPE A;  3MWB A;  1QUK A;  5KCJ A;  2PYY A;  4YMB A;  1FBF A;  3C33 A;  3FVO A;  2HEU A;  3GXA A;  1UTB B;  3K0V A;  3MST A;  4IO6 A;  5F1Q A;  3HN0 A;  2THI A;  4MFI A;  2AL4 A;  2XXK A;  5CMM A;  1JVY A;  3ECR A;  4XKP A;  5F7V A;  1SYI A;  1RDZ A;  4OVJ A;  5TP9 A;  4YKI A;  5AA2 D;  4P9K A;  1H45 A;  2QMW A;  1QUL A;  4LP2 B;  2O69 A;  2OWS A;  3V5A A;  3IB2 A;  4ZS9 A;  2Q8M A;  3I5O A;  1BIY A;  3KJ7 A;  2CZI A;  1GV8 A;  1MQJ A;  5CC2 A;  4DIG A;  3TTM A;  3WAE A;  2Y7R A;  1N3X A;  3BBR A;  3TAJ A;  5CI5 A;  4JDF A;  4N07 A;  3LUZ A;  1HSE A;  1QJM A;  2O84 X;  4DI4 B;  1BP5 A;  4N6D A;  3TYH A;  4EF2 A;  2QPQ A;  2XXQ A;  4FBP A;  4C1U A;  2V25 A;  3JV9 A;  4MIJ A;  3QAX A;  4ZEK A;  2M8C A;  3Q27 A;  4ELQ A;  4POX A;  4GF8 A;  3PMW A;  2RC9 A;  1CNQ A;  1MQH A;  2WEF A;  1D3K A;  2Z8E A;  2OK2 A;  4BDM A;  4UAC A;  3I6V A;  1LBZ A;  4OVS A;  1YTV A;  1LAG E;  3MZ9 A;  2QVU A;  3T1B A;  3FD3 A;  1I6A A;  4I9D A;  4GLI A;  4QXD A;  1LBX A;  1QKB A;  3CI8 A;  2OWZ A;  2REJ A;  3LR1 A;  1BK4 A;  1YAE A;  4HE2 A;  1NV7 A;  3MYU A;  5BUU A;  1B1H A;  3W9V A;  3U1O A;  4KYD A;  2F6G A;  1ATG A;  3IOU A;  3B8B A;  4U21 A;  2DVC A;  4ZEI A;  4OES A;  3TEL A;  3MPL A;  1VSO A;  1XT8 A;  2O7I A;  1G0I A;  1TXF A;  5ET5 A;  3PU5 A;  2F3B A;  3MVX A;  4U22 A;  3GZG A;  3SDF A;  5AA2 B;  2B65 A;  1JNF A;  4PAK A;  4WXJ A;  4G68 B;  4KYE A;  2O51 A;  4I1D A;  1JW1 A;  5LDZ A;  2O7U A;  3S9E A;  1DBZ A;  1MG1 A;  5HPQ A;  1EYJ A;  1SYH A;  4POW A;  3U93 A;  2I58 A;  2XD2 A;  1ZKB A;  2VGQ A;  1FBG A;  1P1Q A;  1UQW A;  3H7M A;  4LZ7 A;  3O28 A;  2WBD A;  4H6D A;  1R9L A;  3QUJ A;  4YZZ A;  2DSF A;  1DMB A;  2VPN A;  2HZK A;  5EQ8 A;  4P3L A;  2CEY A;  3M3F A;  3MQ9 A;  5A5X A;  4ONY A;  3CSB A;  1B3E A;  4X48 A;  3DLN A;  1L5T A;  2GQ1 A;  4PFT A;  3H6U A;  2XWI A;  2DS9 A;  4QRZ A;  2DP8 A;  2F3D A;  1RDX A;  2OX3 A;  1B7Z A;  2H4I A;  4PQJ A;  3B7D A;  5A5L A;  4KI0 E;  1IMB A;  3HV1 A;  5TPA A;  5ET7 A;  4OVT A;  1M5C A;  1YCJ A;  4PDD A;  4X04 A;  5I57 A;  5L8D A;  3H4Z A;  3MZ1 A;  2VHA A;  3VFJ A;  4N15 A;  4U4S A;  1NUX A;  3OEM A;  5H8Q A;  4PGN A;  1FQE A;  1NH8 A;  4IO3 A;  4FEC A;  3ZS6 A;  4EUO A;  4EQ9 A;  2UVJ A;  1M5F A;  1EZO A;  3VLU A;  2VT5 A;  1YPN A;  2AIX A;  3FVN A;  4R9F A;  4GWZ A;  3E3K A;  4OMB A;  3T9H B;  2ZNT A;  2UYE A;  3H6W A;  4ELR A;  2F8D A;  4OQO A;  4AB6 A;  1QW0 A;  1UTH A;  1PB8 A;  5ESY A;  1PDA A;  1GVC A;  1JP4 A;  4YKK A;  1Y1Z A;  1B3H A;  4F1Y A;  1OMP A;  3EHU A;  3S9M C;  4DCY A;  1FTJ A;  3LSW A;  3F11 A;  1OLA A;  2XHD A;  2F5X A;  1IIT A;  4XKQ A;  4F19 A;  3O97 A;  1LST A;  1ANF A;  2OZZ A;  3D1R A;  3MPK A;  4ESW A;  5I59 A;  3FVK A;  3B50 A;  4PBQ A;  3UK4 A;  5CBR A;  1NV3 A;  2DXR A;  3K4U A;  4XIG Q;  3RN8 A;  3SEX A;  3RTF B;  3A3C A;  3S4U A;  1VFD A;  2NUV A;  3PD9 A;  3A09 A;  5FHN A;  3TCG A;  1FCK A;  1LCT A;  1NMU A;  3UN6 A;  2XXT A;  4NE4 A;  3USD A;  2UVI A;  1D9Q A;  5L9S A;  1SW5 A;  1XS5 A;  1B6H A;  3QUF A;  4F29 A;  1G0H A;  5A5X B;  4OAN A;  1NV5 A;  1ZBM A;  2F36 A;  1CE2 A;  1J1N A;  3C35 A;  1FBH A;  3D4G A;  4ECF A;  3E4R A;  1IXI A;  4H8I A;  2Q88 A;  1B4H A;  1OLC A;  2DOJ A;  3E13 X;  1MY0 A;  3MVW A;  4JSD A;  1DK4 A;  5DEX A;  2FIE A;  2Z8D A;  1POY 1;  1XVX A;  5I2K B;  2F7B A;  4PDH A;  3M8U A;  4LN5 A;  4PFW A;  3MW0 A;  3O6H A;  1LLS A;  3KOT A;  4NF6 A;  3FJG A;  5IZ3 A;  4NF5 A;  4MX6 A;  3KN3 A;  4Q0C A;  1FQC A;  1Z7M E;  1IIW A;  1B7H A;  2GH9 A;  4OHN A;  5H8F B;  2RF1 A;  3CG3 A;  1TWY A;  5AA4 A;  3K6W A;  1Y3Q A;  4H1X A;  4IO7 A;  5H8N A;  5ITO A;  1FPL A;  3PUY E;  4KQP A;  3ONM A;  3MP1 A;  1M5E A;  3RYD A;  3HST A;  3KEI A;  2PX1 A;  2MKZ A;  1B1X A;  4QFL A;  1KA0 A;  3VV5 A;  1FQB A;  3A29 A;  4YKP A;  3DP8 A;  1RYO A;  5I5P A;  3DP6 A;  2L5V A;  4YB6 A;  1LCF A;  3T9V A;  2YJP A;  1EYI A;  4BDR A;  1MY2 A;  3M3L A;  2OBG A;  4H45 A;  1T0K A;  3H06 B;  4P11 A;  2NVU B;  3U72 A;  1LBY A;  1US4 A;  4DXC A;  3FV2 A;  5EYG A;  2QRY A;  2RCA A;  5JK4 A;  1LFG A;  4FAT A;  4PCD A;  1H44 A;  4G8M A;  2BJI A;  4MEV A;  4IB2 A;  3Q26 A;  1NI9 A;  2DVZ A;  4I62 A;  4TOZ A;  3KGC A;  4G77 A;  4GL8 A;  3EKI A;  2RKM A;  4F1V A;  1B46 A;  2AL5 A;  5I56 B;  1LBB A;  1EZP A;  3MUQ A;  2ONK E;  4DXB A;  3HHF A;  2ZNS A;  1FSA A;  3SEY A;  2Y84 A;  1MXY A;  4OEV A;  4O94 A;  4KCD A;  1MY4 A;  2XXY A;  4GWX A;  4PFR A;  2HPG A;  4X9T A;  4LZ8 A;  1NL5 A;  1AIV A;  4P1E A;  4OET A;  4AQ4 A;  1JET A;  4GWY A;  4ZZA A;  4E0W A;  2HZL A;  2I3W A;  4DI3 D;  1B5H A;  1MXZ A;  1N76 A;  1MH3 A;  3VVD A;  3IK6 B;  3RGY A;  1MDQ A;  4NF4 B;  5CMK A;  4KXP A;  2DE4 A;  5L9O A;  1FPK A;  2Y7P A;  3FJM A;  2A5S A;  2UVH A;  1DTZ A;  4QFN A;  4NF4 A;  2NXO A;  4TLL B;  1VDW A;  5M2V A;  5H8H A;  4BLA A;  3UA8 A;  3U94 A;  4QFK A;  4R2B A;  4NGU A;  4PFU A;  1LGB C;  4ZE9 A;  2Z22 A;  1A99 A;  1MXU A;  5HBC A;  3RQT A;  2WKY A;  1PBQ A;  4PAF A;  4N4U A;  1PEB A;  1FJ6 A;  1JW5 A;  3RPW A;  1DOT A;  3E79 A;  2I4B A;  3OO8 A;  3IFC A;  5KDT B;  1EH3 A;  3PGF A;  1LBV A;  1ZLQ A;  3EHS A;  2XD3 A;  4DLD A;  5CMB A;  2QS2 A;  1NH7 A;  4EDP A;  4OYV A;  3VVE A;  4UAB A;  1WOD A;  5ITP A;  3CIJ A;  2XXR A;  1FPG A;  2UXA A;  1B2H A;  1TFD A;  4H0W A;  4QFO A;  2CZL A;  5I3S A;  1B58 A;  2DYX A;  4MH5 A;  2QSX A;  1HSJ A;  3W9W A;  3FAS A;  3W15 C;  1GGG A;  2O6A A;  4Z0I A;  2FBP A;  2YPN A;  4UA8 A;  4GXA A;  1NNP A;  4N8G A;  4QSC A;  1B51 A;  4ELP A;  3TTL A;  1AWB A;  1N04 A;  3H3G A;  1FBE A;  1Y4T A;  2OLB A;  2XWO A;  3G7W A;  4BDO A;  5AA4 B;  3KSJ A;  3RLF E;  1RDY A;  4OWD A;  4U23 A;  2B4L A;  1ZU0 A;  3SKP A;  4TLM B;  4QF9 A;  5IKB A;  1BKA A;  2Y7K A;  5FTI A;  1I69 A;  4HS7 A;  1MY3 A;  4NF6 B;  3N94 A;  4KFQ A;  4PBH A;  4AS4 A;  4FJP A;  2H25 A;  4NN3 A;  2HAU A;  2ZMB A;  4GD5 A;  5I57 B;  4F22 A;  4C0R A;  2G93 A;  4MNP A;  5EHM A;  3EF7 A;  2B4M A;  3R26 A;  2R9J A;  4G4P A;  4PE5 B;  4ZE8 A;  3MVY A;  4K3F A;  1NNK A;  4RA1 A;  1LEV A;  2ZYM A;  4O7M A;  2Q74 A;  2OWT A;  5I56 A;  3IO6 A;  4NMY A;  4F18 A;  1IMA A;  2Z23 A;  5CM6 A;  2R6G E;  2B3B A;  2HAV A;  5IZ1 A;  5J1D A;  4EF1 A;  3T93 B;  2RC8 A;  5FTH A;  4F3G A;  1FBC A;  1YYZ A;  1Y3N A;  1RKM A;  3VXB A;  1XVY A;  2BJJ X;  4GXS B;  2I4C A;  1GTK A;  4MJO A;  4JWO A;  4GL0 A;  3THI A;  3TPA A;  3B6T A;  3GLB A;  4GIZ A;  1NUZ A;  4NED A;  4GX4 A;  3KSX A;  3ILT B;  3FXQ A;  1WVJ A;  3KN7 A;  4YB7 A;  2XX8 A;  1IXG A;  3HHG A;  4Q5T A;  4XKR A;  1VFE A;  1LBC A;  3OXN A;  2QL3 A;  3BFU A;  2Q8J A;  4XF5 A;  1B32 A;  1O63 A;  4KPT A;  1MH4 A;  4RYA A;  3C32 A;  1POT A; 
#chains in the Genus database with same CATH homology
 4ECF A;  3D4G A;  4BDL A;  3E4R A;  1IXI A;  2QS1 A;  4RJZ A;  3OEK A;  2FYI A;  3L6H A;  1B3L A;  1IEJ A;  3PPO A;  4GWO A;  3EPE A;  4JSO A;  4LA9 A;  4BDN A;  4ZEB A;  4H8I A;  2Q88 A;  1B4H A;  1OLC A;  2V3T A;  2DOJ A;  3E13 X;  3MAM A;  1MY0 A;  3MVW A;  4JSD A;  5DYH A;  4F3P A;  2DXY A;  1QVS A;  4G8N A;  1O64 A;  2PMS A;  3G3H A;  3OOA A;  4JB7 A;  2Z8D A;  1POY 1;  5DEX A;  5AE4 A;  3TCF A;  3FUZ A;  1S7Y A;  3H6V A;  1UIU A;  1XVX A;  5I2K B;  2F7B A;  1SW2 A;  2HCA A;  3C9H A;  1F9B A;  3M8U A;  1VR5 A;  3OMB A;  1PBP A;  4PFW A;  4IO2 A;  3MW0 A;  4OEU A;  4EXL A;  2GFE A;  3O6H A;  3FIR A;  2ONR A;  3IJO B;  1SVX B;  4QSD A;  4IO4 A;  2Q89 A;  4YAH X;  3TOD A;  3K2D A;  4RPN A;  1LLS A;  4GRK A;  3KOT A;  4NF6 A;  3CFL A;  3FJG A;  3T9U A;  2F34 A;  4O3B A;  1PB9 A;  1Z7N E;  2ZYN A;  3WAF A;  4NF5 A;  1MY1 A;  5BWJ A;  1AH5 A;  1Q35 A;  3KN3 A;  1NFT A;  3M3K A;  5DEX B;  1XC1 A;  4Q0C A;  4IGR A;  1FQC A;  4KD5 A;  1SI1 A;  1Z7M E;  2VP1 A;  3FGS A;  1IIW A;  1B7H A;  3LSL A;  2GH9 A;  3MZB A;  4OHN A;  5H8F B;  2RF1 A;  4F2Q A;  3MVZ A;  4GVO A;  4OFL A;  5KZT A;  3HO7 A;  3C4M A;  1TWY A;  3CG3 A;  1B9J A;  5AA4 A;  3LSF B;  4HCY A;  1ZIU A;  4NF8 B;  1JW4 A;  1US5 A;  1MPB A;  3K6W A;  3MP6 A;  3N6T A;  3GBA A;  5H8Q B;  3V5A A;  3BFT A;  1LB8 A;  4QHQ A;  1Y3Q A;  2VOZ A;  4FEB A;  1QKA A;  1B52 A;  1NNF A;  4H1X A;  4IO7 A;  2A5T B;  5H8N A;  5ITO A;  5IAI A;  1BTJ A;  3RY3 A;  4L17 A;  3PPP A;  5KDT A;  3CG1 A;  3PUY E;  4KQP A;  1S9T A;  3ONM A;  4R72 A;  1MQI A;  3IO4 A;  2Q9T A;  3MP1 A;  3Q25 A;  3SET A;  1M5E A;  4LQ5 A;  3LBS A;  3MWB A;  1QUK A;  3HST A;  3G3K A;  3KEI A;  1NKX A;  2A5T A;  5KCJ A;  2PX1 A;  2DQV A;  3LC8 A;  4N13 A;  2PYY A;  1B1X A;  5EYF A;  4YMB A;  2F6P A;  3C33 A;  4QFL A;  1N0T A;  3VV5 A;  1FQB A;  4YKP A;  4H67 A;  1MQG A;  3DP8 A;  3FVO A;  1RYO A;  2HEU A;  3GXA A;  5H8S A;  1CB6 A;  1LB9 A;  3DP6 A;  3S2V A;  4EQ7 A;  4HW8 A;  4G8H A;  4YB6 A;  1LCF A;  2CMO A;  4ZDM A;  2XX7 A;  3MBP A;  4NWD A;  1M5D A;  4IGT A;  4IY5 A;  1UTB B;  3T9V A;  1R1N A;  3RTW B;  2YJP A;  4R6Y A;  4QFP A;  1N7X A;  4FED A;  1MY2 A;  4BDR A;  5H8H B;  3IOR A;  3M3L A;  5ELV A;  3K0V A;  4U1Z A;  2OBG A;  4IO6 A;  5F1Q A;  5AA2 A;  1N3W A;  5DVI A;  1P1W A;  3HN0 A;  3G3J A;  4LZ5 A;  1T0K A;  3H06 B;  1II5 A;  1IZ1 A;  2THI A;  1N7W A;  4MFI A;  4P11 A;  2AL4 A;  2ALU A;  5CMM A;  2NVU B;  3SES A;  3U72 A;  1JVY A;  1US4 A;  3MC2 A;  3ECR A;  4XKP A;  5F7V A;  1SYI A;  1N84 A;  4OVJ A;  1Y1M A;  4XTC Q;  4DXC A;  5TP9 A;  3FV2 A;  2F78 A;  3EQ1 A;  3JYR A;  4ND9 A;  1SW1 A;  4YKI A;  2QRY A;  2RCA A;  5AA2 D;  1MQD A;  1LFG A;  3OO9 A;  5JK4 A;  3QYT A;  4PFY A;  4BDQ A;  3K01 A;  1QUJ A;  4FAT A;  2IA4 A;  2H99 A;  4AB5 A;  3FJ7 A;  3IL1 B;  2DE2 A;  1JEU A;  1H45 A;  3D4C A;  1Y4C A;  2QMW A;  3TTR A;  3K6U A;  3VVF A;  1H44 A;  1OIB A;  3KOS A;  4G8M A;  3CFZ A;  1QUL A;  2W7Y A;  4LP2 B;  1URG A;  4IB2 A;  1MXV A;  4JWX A;  2O69 A;  4H8J A;  2OWS A;  2XXX A;  3DEL B;  4KR5 A;  4XKN A;  3TFL A;  3Q26 A;  3IB2 A;  3O66 A;  1MXW A;  5JTY B;  3TMG A;  1UTH B;  2DVZ A;  4I62 A;  2FA7 A;  4ZS9 A;  1A8E A;  4TOZ A;  3KGC A;  3OSR A;  1B5I A;  3I5O A;  2XXH A;  1BIY A;  2QS3 A;  2I48 A;  3KJ7 A;  3KG2 A;  3OD7 A;  1ELJ A;  4G77 A;  4GL8 A;  2V3U A;  4OEN A;  1FTO A;  1GV8 A;  1MQJ A;  2RKM A;  4F1V A;  1B46 A;  1MPC A;  3TQL A;  5CC2 A;  1B05 A;  3B6Q A;  1LFI A;  4F3S A;  2AL5 A;  5I56 B;  4ISU A;  2H98 A;  3TTM A;  4DIG A;  4U4X A;  3WAE A;  2Y7R A;  2QJE A;  1N3X A;  1LBB A;  5TU0 A;  3BBR A;  3TAJ A;  2XXV A;  5CI5 A;  4JDF A;  4N07 A;  1EZP A;  3H03 A;  3V8X B;  2RC7 A;  1HSE A;  3MUQ A;  1QJM A;  1SI0 A;  1D4N A;  2O84 X;  2ONK E;  3GBB A;  1BP5 A;  5I2N B;  3E9X A;  1EZ9 A;  1DTG A;  3TYH A;  4DXB A;  3HHF A;  2ZNS A;  1UTB A;  1VE4 A;  3Q29 A;  3SEY A;  4EF2 A;  1MXX A;  2QPQ A;  2Y84 A;  1H43 A;  3IOV A;  4H5G A;  4NTL A;  4EXK A;  4EQB A;  2XXQ A;  1MXY A;  4RXL A;  4OEV A;  1D9V A;  2YLN A;  4F31 B;  2GHB A;  4C1U A;  4KCD A;  2V3Q A;  1MY4 A;  3TZA A;  2V25 A;  2R71 A;  4DCX A;  2XXY A;  1FQA A;  1AMF A;  5ISU A;  4P0I A;  3JV9 A;  4X9T A;  2F97 A;  2DWA A;  4LZ8 A;  3CFX A;  1NL5 A;  1FQF A;  4YIC A;  3QAX A;  1ZJL A;  4ZEK A;  3TDJ A;  2Z8F A;  1AIV A;  3K1M A;  3FXU A;  4OZ9 A;  2PT2 A;  2M8C A;  1DSN A;  2ZYO A;  3Q27 A;  4E0X A;  4OET A;  3T66 A;  4AQ4 A;  4ELQ A;  1JET A;  4POX A;  4ZZA A;  4GF8 A;  3PMW A;  2RC9 A;  4E0W A;  2HZL A;  2I3W A;  4DXU A;  1MQH A;  3ZSF A;  1B5H A;  2DWI A;  4JXI A;  3VE1 B;  1JEV A;  4RNS A;  1MXZ A;  1N76 A;  1MH3 A;  1D3K A;  1FTL A;  3U8Q A;  3IK6 B;  3VVD A;  5ICT A;  3QK6 A;  3RGY A;  1B0H A;  2Z8E A;  2OK2 A;  4BDM A;  4R6K A;  1MDQ A;  4UAC A;  3I6V A;  4NF4 B;  5CMK A;  2I0B A;  3PPN A;  2DE4 A;  3VLW A;  1B4Z A;  1MDP 1;  5HM4 B;  5JEI A;  1D9Y A;  3KZG A;  5L9O A;  2PVU A;  1YTV A;  1LAG E;  2I0C A;  2REG A;  2UYF A;  3MZ9 A;  4H65 A;  3UGW A;  2Y7P A;  1B5J A;  3FD3 A;  2A5S A;  1I6A A;  3FJM A;  4I9D A;  2UVH A;  4IO5 A;  4I8C A;  1DTZ A;  4GLI A;  2PT1 A;  2F7A A;  4QFN A;  4NF4 A;  2NXO A;  3QIM A;  1TT1 A;  4TLL B;  3KFM A;  4WKM A;  1JVX A;  1A40 A;  1RYX A;  5M2V A;  5H8H A;  3IR1 A;  4BLA A;  1OVB A;  1QKB A;  3CI8 A;  3K1N A;  4HTG A;  4GOT A;  2REJ A;  3LR1 A;  4R6H A;  1MM7 A;  3UA8 A;  1SQY A;  1Y3P A;  1YAE A;  3U94 A;  4QFK A;  1Y20 A;  4OXV A;  1B3F A;  4R2B A;  3Q28 A;  1KWH A;  5JTY A;  1ZMG A;  5BUU A;  1A8F A;  4PFU A;  3UP9 A;  1B1H A;  1LGB C;  2LAO A;  3U1O A;  4FIM A;  3W9V A;  1SBP A;  2F6G A;  4KYD A;  4LUB A;  4TQU Q;  3OSQ A;  1ATG A;  3IOU A;  2Z22 A;  4X1B A;  4ZE9 A;  1A99 A;  1MXU A;  4YKJ A;  3RT8 A;  4RK9 A;  4U21 A;  5HBC A;  3RQT A;  4G68 C;  3ZKK A;  2WKY A;  2PBW A;  1PBQ A;  2DVC A;  4ZEI A;  4ZED A;  4OES A;  1FQD A;  1PEB A;  4WED A;  3TEL A;  1JW5 A;  3RNN A;  3RPW A;  2I6E A;  1DOT A;  1PC3 A;  2XXU A;  3MPL A;  2I4B A;  4R75 A;  1VSO A;  1XT8 A;  5TP9 B;  2F35 A;  2O7I A;  1PB7 A;  2B3F A;  2F7C A;  3OO8 A;  1I6B A;  5KDT B;  1TXF A;  3PU5 A;  1EH3 A;  2VD3 A;  3PGF A;  4F2O A;  2H5Y A;  3EHS A;  1ZLQ A;  3MVX A;  2NWJ A;  4U22 A;  1A7L A;  1DPP A;  2XD3 A;  4MLV A;  3TKD A;  4DLD A;  4GFR A;  3GZG A;  3OEN A;  3SDF A;  5CMB A;  3TTN A;  5AA2 B;  2QS2 A;  2B65 A;  1NH7 A;  1JNF A;  4AB6 A;  3RT6 B;  2OCU A;  4MF3 A;  1O7T A;  4NWC A;  4G68 B;  4WXJ A;  3N6U A;  5EHS A;  3B6W A;  4LVQ A;  4DDD A;  4KYE A;  4EDP A;  4OYV A;  2O51 A;  4I1D A;  3VVE A;  5TPA B;  4KYS A;  4FAJ A;  1OQG A;  2XXW A;  2O1L A;  3O6G A;  1JW1 A;  1WOD A;  5ITP A;  3CIJ A;  2XXR A;  1XHY A;  2O7U A;  4G68 A;  4Q8R A;  3S9E A;  3VXC A;  1MG1 A;  4YMA A;  4GQO A;  2UXA A;  5HPQ A;  1HSL A;  1B2H A;  1SYH A;  1TFD A;  1URS A;  4H0W A;  2CZL A;  4POW A;  4QFO A;  3R7X A;  3TTK A;  3U93 A;  3VLV A;  1MM6 A;  1A54 A;  1B0L A;  4Z7E A;  2I58 A;  1IQ7 A;  1B58 A;  1USY H;  4M1V A;  2XD2 A;  1ZKB A;  2VGQ A;  3R6U A;  4R74 A;  1P1Q A;  1UQW A;  2DYX A;  1MPD A;  3H7M A;  4LZ7 A;  3O28 A;  3PUV E;  4MH5 A;  3U92 A;  5K2X A;  2QSX A;  2X26 A;  4H6D A;  1HSJ A;  1R9L A;  2XX9 A;  3QUJ A;  4M4G A;  4YZZ A;  3W9W A;  1UIV A;  2DSF A;  3FAS A;  4C1T A;  3N26 A;  3UOR A;  4LQ2 A;  1DMB A;  3IAZ A;  2ANJ A;  1EU8 A;  1FTK A;  2AYS A;  2HZK A;  2Y7I A;  3W15 C;  1GGG A;  2O6A A;  4Z0I A;  4RY1 A;  2YPN A;  3K6V A;  4DZ1 A;  3L6G A;  5H8F A;  3IOW A;  2ONS A;  2HXW A;  3PD8 A;  4ZEF A;  4UA8 A;  3M3F A;  3BKI B;  3MQ9 A;  2ABH A;  2NOO A;  4GXA A;  3O6I A;  2O1M A;  3SEU A;  4R73 A;  3SEW A;  5A5X A;  1OVT A;  1M5B A;  4NF5 B;  1NNP A;  2H9B A;  4QSC A;  4ONY A;  1B51 A;  4RPO A;  1SW4 A;  3CSB A;  3SER A;  3TUS A;  4R2F A;  1LAX A;  1B3E A;  3PUW E;  4X48 A;  4ELP A;  2D3I A;  1Y9U A;  2FNC A;  1LAH E;  3LUY A;  3ODB A;  3DLN A;  3PUX E;  3SEV A;  3TTL A;  4F3B A;  3LSX A;  2Q2A A;  1L5T A;  1MS7 A;  3PMX A;  4PFT A;  3H6U A;  1N04 A;  5FHO A;  5I58 A;  1LFH A;  3H3G A;  1Y4T A;  2DS9 A;  4JBZ A;  4QRZ A;  3OO6 A;  5I2K A;  2OLB A;  2DP8 A;  4MBP A;  3G7W A;  4BDO A;  4F39 A;  5AA4 B;  1B7Z A;  4ZEC A;  2H4I A;  4PQJ A;  2GHA A;  2RCB A;  3KSJ A;  3K00 A;  3RLF E;  3K6X A;  2O68 A;  4OWD A;  3B7D A;  3KJT A;  1P1N A;  4U23 A;  4KI0 E;  4OTE A;  1ZU0 A;  3SKP A;  5CMC A;  4TLM B;  3HV1 A;  3QSL A;  4QF9 A;  5B7D A;  4ZZE A;  1USY E;  1IXC A;  5IKB A;  1B3G A;  1BKA A;  2Y7K A;  3EHT A;  4DE8 A;  3OEL A;  1I69 A;  4HCW A;  2P0S A;  1H3D A;  1Q1K A;  4HS7 A;  5FTI A;  1MY3 A;  4FOR A;  4NF6 B;  3PPQ A;  5TPA A;  1M5C A;  1YCJ A;  3N94 A;  1MRP A;  3A3U A;  5I57 A;  4KFQ A;  5L8D A;  5DTB A;  4FJP A;  3H4Z A;  3PMV A;  1GR2 A;  3MZ1 A;  1IUD A;  2H25 A;  2E0S A;  2VHA A;  5DT6 A;  4QSE A;  3VFJ A;  3V83 A;  2OJT A;  2HAU A;  2QS4 A;  4U4S A;  2DWH A;  2ZMB A;  4GD5 A;  3OEM A;  5I57 B;  1SDX A;  4NF8 A;  5H8Q A;  4F22 A;  3IJX B;  3S9L C;  4C0R A;  2P2A A;  4G2Z A;  1FQE A;  2G93 A;  1NH8 A;  3FV1 A;  3N5L A;  5EHM A;  3ILU B;  5ICQ A;  3EF7 A;  2VD2 A;  3R26 A;  2R9J A;  2XXI A;  4G4P A;  4IO3 A;  4R9G A;  3T9X B;  4FEC A;  5DVJ A;  3ZS6 A;  4PE5 B;  3S9N C;  4ZE8 A;  4U2R A;  4EUO A;  3MVY A;  4EQ9 A;  2UVJ A;  1M5F A;  4K3F A;  3MJN A;  2X7Q A;  3S4U A;  1EZO A;  2V93 A;  1B40 A;  3VLU A;  5K2Y A;  1NNK A;  1YPN A;  2AIX A;  4LAT A;  4P0G A;  3G3I A;  4RA1 A;  3FVN A;  3QXM A;  4R9F A;  2ZYK A;  3CSG A;  2ZYM A;  1A55 A;  2I3V A;  3G3G A;  3E3K A;  3ZKL A;  4OMB A;  3RUM A;  5I59 B;  5I2N A;  1URD A;  2OWT A;  2P1S A;  3DM0 A;  4XXU A;  1NNT A;  2ZNT A;  3IO6 A;  3O9P A;  4NMY A;  4THI A;  3T9H B;  5I56 A;  2UYE A;  1FW0 A;  4FE8 A;  3VDF A;  4F18 A;  1P1O A;  3P7I A;  2Z23 A;  3H6W A;  5CBS A;  5CM6 A;  3FZV A;  1P99 A;  4ELR A;  2ZXT A;  2R6G E;  2B3B A;  2F8D A;  2HAV A;  2QMX A;  3G3F A;  4YB5 A;  1R6Z A;  3IB1 A;  4OQO A;  3UIF A;  3C34 A;  4EF1 A;  4ELO A;  5J1D A;  3CVG A;  3K1P A;  1ZTY A;  1J1N A;  2I49 A;  2IEE A;  1QW0 A;  1UTH A;  1P1U A;  3PPR A;  4RK2 A;  3FVG A;  4WEP A;  1AOV A;  2V84 A;  3T93 B;  3TQW A;  1PB8 A;  2ZNU A;  4O3C A;  1PDA A;  2GRV A;  2RC8 A;  3TEP A;  1GVC A;  3C31 A;  5FTH A;  4F3G A;  3PV0 E;  3H6T A;  3JZJ A;  4YKK A;  3C36 A;  1Y1Z A;  1Y3N A;  2UVG A;  1B3H A;  2G29 A;  4F1Y A;  1OMP A;  1RKM A;  3VXB A;  5FHM A;  2Q2C A;  3EN3 A;  3EHU A;  1XVY A;  1S50 A;  2BJJ X;  3S9M C;  3HCQ A;  1FTJ A;  3LSW A;  4DCY A;  1OQH A;  4YU0 A;  3F11 A;  1OLA A;  4GXS B;  2D21 A;  4PP0 A;  2XHD A;  4KCC A;  2I4C A;  3PUZ E;  2F5X A;  4F1U A;  3IB0 A;  1GTK A;  4U1O A;  3MP8 A;  5CRY A;  1IIT A;  4XKQ A;  4F19 A;  4JWO A;  4KHZ E;  3O97 A;  2E1S A;  4GL0 A;  2DWJ A;  1LST A;  3THI A;  3TPA A;  3B6T A;  1ANF A;  3HPI A;  5H8N B;  2OZZ A;  3V89 B;  3MPK A;  4MLQ A;  1BLF A;  3GLB A;  3IOT A;  4GIZ A;  1AL3 A;  4LON B;  3IX1 A;  1JQF A;  4ESW A;  4NED A;  1R9Q A;  2XXP A;  5I59 A;  3FVK A;  4N6P A;  3T96 B;  1SD3 A;  3KN8 A;  3OO7 A;  3CRB A;  3KBR A;  3UK4 A;  2ESN A;  5CBR A;  3TCH A;  2DE3 A;  1XOC A;  2DXR A;  3K4U A;  2HFB A;  4H5F A;  4IY6 A;  3KSX A;  2HQ0 A;  3ILT B;  3AXF A;  3O29 A;  4JWY A;  1TFA A;  4XIG Q;  5DVF A;  3RN8 A;  3SEX A;  3RTF B;  3A3C A;  3FXQ A;  1WVJ A;  3KN7 A;  4OER A;  1QUI A;  1VFD A;  3FXR A;  2NUV A;  4OFO A;  3PD9 A;  3A09 A;  4YB7 A;  4X1D A;  5FHN A;  2RIN A;  2XX8 A;  1IXG A;  4Q30 B;  3TCG A;  1FCK A;  3HHG A;  1LCT A;  1LAF E;  4Q5T A;  1NMU A;  3UN6 A;  4XKR A;  1VFE A;  2XXT A;  5I58 B;  1B7U A;  5AA3 A;  1LBC A;  2KLF A;  2D5W A;  4NE4 A;  4PET A;  3USD A;  5AA1 A;  3OXN A;  2QL3 A;  2UVI A;  3BFU A;  5KCJ B;  3I3V A;  2Y7W A;  3CR9 A;  1H76 A;  2Q8J A;  3T22 A;  5L9S A;  1SW5 A;  1XS5 A;  1B6H A;  3QUF A;  4O3A A;  3O2A A;  1DPE A;  5L9M A;  4F29 A;  1I6Q A;  5A5X B;  3FAT A;  1B32 A;  3K02 A;  1FTM A;  5I84 A;  3DP4 A;  4ESX A;  1O63 A;  5B70 A;  4KPT A;  1MH4 A;  4OFJ A;  1WDN A;  1ZBM A;  2X7P A;  4RYA A;  5LOM A;  2F36 A;  1CE2 A;  1IXH A;  3C32 A;  1POT A;  3C35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...