2HZKA

Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its open form
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
334
structure length
334
Chain Sequence
VTWRLASSFPKSLDTIFGGAEVLSKMLSEATDGNFQIQVFSAGELVPGLQAADAVTEGTVECCHTVGYYYWGKDPTFALAAAVPFSLSARGINAWHYHGGGIDLYNEFLSQHNIVAFPGGNTGVQMGGWFRREINTVADMQGLKMRVGGFAGKVMERLGVVPQQIAGGDIYPALEKGTIDATEWVGPYDDEKLGFFKVAPYYYYPGWWEGGPTVHFMFNKSAYEGLTPTYQSLLRTACHAADANMLQLYDWKNPTAIKSLVAQGTQLRPFSPEILQACFEAANEVYAEMEASNPAFKKIWDSIKAFRSEHYTWAQIAEYNYDTFMMVQQNAGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding, transport protein
molecule keywords TRAP-T family sorbitol/mannitol transporter, periplasmic bin
publication title Crystal structures of an Extracytoplasmic Solute Receptor from a TRAP transporter in its open and closed forms reveal a helix-swapped dimer requiring a cation for alpha-keto acid binding.
pubmed doi rcsb
source organism Rhodobacter sphaeroides 2.4.1
total genus 116
structure length 334
sequence length 334
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2hzkA02
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2hzkA01
1HSEA 1B7ZA 1Y3QA 3PD9A 2XXYA 4JSDA 1PEBA 4GLIA 4BLAA 1XVYA 1O7TA 2I3WA 2Z8FA 1MY1A 4LP2B 4TLLB 2RKMA 3QUFA 3S9NC 4POXA 1T0KA 4IO4A 5B70A 4PFTA 4UA8A 3Q29A 2DVZA 3Q28A 2UVGA 1Y4CA 4FIMA 2O68A 4AB6A 1S7YA 1ZU0A 4MLQA 4M4GA 3PPOA 5I5PA 3UP9A 3QIMA 3U8QA 3MZBA 1Y3NA 1ELJA 5H8FA 3FV1A 4LVQA 5I84A 1ZKBA 3GZGA 4OVTA 5DYHA 4RK2A 3U72A 5HPQA 1PB7A 4YMAA 1TFAA 2VD3A 3H7MA 1MDQA 4IY5A 1JVYA 4OENA 3W9VA 4X1BA 3PPPA 4ESWA 3O97A 1H43A 3LSWA 1MH4A 2PT1A 4OMBA 5A5XA 3RT8A 1IEJA 3R6UA 4ELQA 3KJ7A 5TU0A 1ATGA 4AQ4A 3PUZE 3PGFA 1BLFA 2BJJX 4OEVA 1OLAA 2V3UA 5KDTB 1EZ9A 2O84X 2F36A 2XD2A 3VFJA 3MQ9A 3O6IA 3LC8A 3MC2A 5L9SA 3SETA 4JSOA 4BDMA 1N7XA 1IXIA 3E3KA 3MP6A 4PE3A 3RPWA 4PCDA 5ISUA 4RA1A 4YU0A 2ONKE 4PP0A 4U23A 3ILTB 1SI0A 4ZEFA 3B50A 1QKAA 5DEXA 4F3BA 4R2FA 4G8HA 1UTBA 5I57B 3DELB 5FTIA 5H8SA 3BBRA 3GBAA 1O63A 4KCDA 3GLBA 3MW0A 3KOSA 2OWTA 2XXQA 2XXTA 2QMWA 3TEPA 4NF5B 3RUMA 3MVZA 4EDPA 1CE2A 4JDFA 4R73A 4F19A 2GH9A 2V93A 2IEEA 3RT6B 1M5CA 4WXJA 1L5TA 4F2QA 3TODA 4DLDA 3R7XA 3PUWE 3PUVE 3KEIA 4N6KA 1ANFA 1YPNA 3O6GA 3SERA 2FA7A 4PDHA 5LTCA 4NF6B 3K6WA 4PBQA 2F78A 4NWDA 4XXUA 2O1LA 1XVXA 3U92A 3TUSA 2PYYA 1NH8A 2CEXA 4N6DA 1LAXA 3L6GA 4AB5A 1D9YA 4OA4A 2OWSA 4YKIA 3MVYA 4KI0E 2Q8JA 4XIGQ 1B9JA 4N15A 1B3HA 5IGAA 3K1PA 1F9BA 3G3IA 1B3EA 4U1OA 5I2KB 4IO6A 1B32A 1ZLQA 3O66A 1P1UA 2B3FA 2W7YA 5TP9B 3R26A 4OEUA 4NX1A 1B3GA 4I1DA 4OYVA 3H6VA 4ONYA 4N17A 3MZ1A 1JEUA 2ZNSA 3OEMA 4H67A 4DXBA 1MPCA 4QFLA 4P0GA 5I58A 2O1MA 1IITA 1BTJA 3FJ7A 3UA8A 4YB5A 4XKRA 2YLNA 2DWJA 2VPNA 1KWHA 3GXAA 4HS7A 3U1OA 1YAEA 4OVSA 4R6KA 2ZNUA 1N76A 4G2ZA 4DI3D 4FAJA 1WDNA 1M5EA 4F1UA 4DCXA 4P56A 3OO6A 2H5YA 3EF7A 3PU5A 5BUUA 1LFIA 1MQHA 4F3PA 1RKMA 4UACA 1B5HA 4X48A 2H4IA 4JB7A 3EN3A 3G7WA 1MPDA 4PQJA 3TTRA 3DP8A 2HZLA 2DOJA 2Y7RA 1JETA 3FJMA 1I69A 4MAGA 3LSLA 2ZZWA 3P7IA 3VXCA 3TPAA 1B5JA 1B3FA 2DXRA 2DE3A 4H8IA 1URGA 2D21A 2PFYA 4OVJA 4GL8A 2THIA 4ZS9A 1B7UA 4KHZE 1NKXA 4MMPA 2H98A 5AA2B 2QMXA 1MQDA 1R9LA 1B4ZA 4MNIA 3CG1A 3VVFA 4OZ9A 2PT2A 4L17A 4ZEBA 1GTKA 3PUYE 1B1HA 3OXNA 3V8XB 4RPNA 4YMBA 5HBCA 2F34A 1UTHB 3HHFA 4E0XA 5ICTA 4WEDA 4YKJA 3TELA 3QYTA 3DLNA 5AA2D 1H44A 2P2AA 2RC8A 5HM4B 1OVBA 3SEWA 3TQWA 4H5GA 5H8QA 1UQWA 1SW1A 3EQ1A 4LONB 4LZ7A 5AA3A 3K6UA 3HHGA 4IY6A 3FD3A 3LR1A 2NUVA 4F22A 5KZTA 2RC9A 3PPNA 2LAOA 4NWCA 1ZTYA 2R9JA 4PBHA 3HCQA 1B7HA 2HPGA 1FTJA 3K00A 2B65A 4GFRA 4E0WA 4NAPA 2DVCA 3H06B 1FQDA 2UYFA 3RNNA 5H8FB 2H99A 1VR5A 3USDA 1A40A 1SYIA 4F1VA 3MPKA 5IM2A 5TPAA 1B58A 4EF2A 1O64A 1FQEA 5FTHA 4YB7A 4R9FA 2D5WA 5JTYA 1MY4A 2XXIA 4R72A 2A5SA 3C9HA 1A55A 2VD2A 4ISUA 3B6TA 5A5XB 1SW2A 2Q88A 5BWJA 2I0BA 4P0IA 2Q2CA 4QSEA 1NNPA 2GRVA 4I9DA 4U1ZA 4F29A 3TTNA 1USYE 4IGTA 2ZYKA 1AH5A 3SEUA 3FASA 3E13X 4Q0CA 3K01A 4MNPA 3K1MA 5JEIA 2HAUA 4MEVA 3FXUA 4LZ8A 1B46A 1R1NA 2Z22A 4DXUA 2XXRA 3ONMA 1JVXA 1MDP1 4MX6A 2HEUA 4DE8A 5H8HA 1LB9A 1PB9A 1ZJLA 3KOTA 2OK2A 1II5A 5DTBA 1B52A 4GD5A 5DEXB 3IO4A 3U65A 1XC1A 1I6BA 4BDOA 1UTBB 3TQLA 2F6GA 3ECRA 3C36A 3I3VA 1PB8A 3C4MA 1MH3A 4NF0A 3M3FA 5K2XA 1I6AA 5AA1A 3RTWB 2Q9TA 1OLCA 3TZAA 3OO7A 4IO3A 4OVRA 4R9GA 1B6HA 2F7BA 1OQHA 3MZ9A 3TTMA 2PBWA 3OELA 4ZDMA 3TTKA 3KBRA 3U93A 1N3XA 3IK6B 4K3FA 3VXBA 3G3FA 3H6WA 5IAIA 4ECFA 4RXLA 1VFEA 4RPOA 1SVXB 3I6VA 3TFLA 1DTZA 1B3LA 4N4UA 1VFDA 1FTMA 1B1XA 3ZKLA 2R6GE 1N0TA 1DMBA 2ESNA 3H6TA 3KJTA 4XFEA 4RJZA 2V3TA 4P3LA 2A5TA 1XHYA 3FGSA 3WAFA 3TKDA 3ILUB 3TCFA 3M3KA 1USYH 4EUOA 3C31A 4G4PA 3G3GA 2O6AA 1NNKA 4KQPA 3OSRA 1VSOA 4DXCA 4PGPA 3FJGA 3PPRA 4H0WA 1QJMA 2V25A 4GVOA 3T9XB 3SKPA 5DVJA 1H45A 4N07A 4N13A 4JXIA 4O3CA 3IO6A 4M1VA 5I58B 1LAGE 3LUYA 3SEXA 1SYHA 4ZEDA 4FORA 2I4BA 5CBRA 1LAHE 2F35A 1NL5A 4GL0A 4Z0IA 1D4NA 2NWJA 2F5XA 1NMUA 4DDDA 1MXXA 1B05A 2WX9A 1QUKA 4DIGA 4O3AA 3VLWA 3G3KA 1MY0A 2I48A 1N3WA 4F39A 3QUJA 5KCJA 3TYHA 2F8DA 4BDQA 3V5AA 2DXYA 1AMFA 2REJA 4LQ5A 4P1EA 2NVUB 1BP5A 1MXUA 4ELRA 5I59A 4P1LA 2VGQA 1MXZA 2VHAA 4EQ9A 1Y9UA 4C1UA 4OANA 3C35A 2F7CA 1MRPA 3QSLA 3KN3A 2F97A 4XKNA 2OJTA 3DP4A 2PFZA 1B40A 1EZPA 2Z8EA 3K1NA 1LFHA 2DWHA 1POY1 3OO8A 1LSTA 4X04A 3LBSA 3KG2A 3OENA 2Q89A 3QXMA 4MIJA 1SQYA 5B7DA 3IB1A 4BDLA 3TTLA 4RY1A 3THIA 5IZZA 2QSXA 2CZLA 1R9QA 2DWIA 3VV5A 1FQFA 3MUQA 3N5LA 4XTCQ 1DPPA 4H6DA 1SW5A 2V84A 5I2NA 2H9BA 2ZYMA 1H76A 2Z8DA 4O94A 4ELOA 4OTEA 3UN6A 1FTOA 3IOUA 3TCHA 3Q27A 4EXKA 2I0CA 3D4GA 3E9XA 5FHNA 5K2YA 2GHAA 3TMGA 5CMBA 1GVCA 2CEYA 5F7VA 1EZOA 5H8QB 1YTVA 3IOVA 3KN8A 3OOAA 4XEQA 4GXAA 2QS1A 3C34A 1HSLA 4KYEA 5M2VA 4PAKA 3TDJA 3RLFE 4ZZEA 1IZ1A 4XKPA 5ELVA 4WEPA 3Q25A 2Y7IA 3RN8A 3SDFA 3MJNA 3N6UA 1XS5A 3UORA 2B3BA 3OD7A 4TQUQ 4Q5TA 2DQVA 3F11A 1Q1KA 3OSQA 3QAXA 4NHBA 4H65A 3T9HB 3GYYA 4X8RA 1TT1A 3TCGA 1XT8A 4OESA 3FV2A 2VOZA 2ABHA 4EQ7A 1EH3A 5TPAB 4WKMA 4MHFA 3O9PA 4PGNA 1TXFA 3G3JA 4R74A 5JTYB 5LOMA 4MNCA 4F3SA 4H1XA 1M5FA 1M5DA 3KSXA 1DSNA 2DE4A 5DVIA 5CC2A 1P1OA 3T93B 3MVXA 3O2AA 3JV9A 2FNCA 4NEDA 4NF4A 2XXVA 1P1NA 3K6VA 4Q30B 1DPEA 4I62A 4KCCA 1EU8A 2AIXA 1H3DA 4ZZAA 2QPQA 4U21A 2QS2A 3V89B 2HFBA 4FE8A 4IGRA 2XX8A 2OZZA 2P0SA 4KYSA 2DP8A 3EHUA 1XOCA 4YZZA 1SD3A 5DT6A 3BFUA 4POWA 1OMPA 3KGCA 2XWKA 5H8HB 1J1NA 4KR5A 1NFTA 2XXUA 1IXHA 4FEDA 4ZECA 5CI5A 3K4UA 1QKBA 2WYKA 2HCAA 4F18A 1ZMGA 2DS9A 4OWDA 4N6PA 3VE1B 2ALUA 5I56A 4ZE8A 2XXKA 2X7QA 1LB8A 4FEBA 4F3GA 3MBPA 3O28A 1S9TA 1MQJA 1URDA 4NF8A 5L9OA 1US5A 3N6TA 3KN7A 2XA5A 1Z7NE 3MWBA 2RC7A 3KFMA 4OERA 3T66A 5JK4A 4LQ2A 1P99A 4DI4B 3K0VA 3HV1A 3BFTA 3Q26A 4F2OA 3SESA 4G68A 4U4SA 1RYOA 4G68C 4JWXA 4FJPA 4MFIA 3MVWA 4HW8A 3H6UA 1B0LA 1IQ7A 1UIVA 4R2BA 1FW0A 1SBPA 1QULA 4G8MA 2Y7PA 4OFJA 3O29A 3FXQA 1Y3PA 1Y20A 2A5TB 4PFWA 2FYIA 4KFQA 3PMVA 2XD3A 3CG3A 4LUBA 3VDFA 1LLSA 4I8CA 5FHOA 3E4RA 3S2VA 1AOVA 2XX9A 5AA4A 2O51A 4PETA 1QUJA 2V3QA 1LAFE 4P9KA 3UIFA 3T22A 4KYDA 3FATA 3S4UA 3CFZA 2VPOA 1SI1A 3O6HA 3ZKKA 3K2DA 4EQBA 4N8GA 1GGGA 2ONRA 3VVDA 2QJEA 1S50A 2XXWA 2G29A 3GBBA 4QFOA 2PMSA 3OMBA 1A54A 1JQFA 5ITOA 2F6PA 4PC9A 1NNTA 4N8YA 3U94A 2HAVA 3M3LA 3ZS6A 5DVFA 1JW1A 4GWOA 1N84A 3IORA 4OFOA 5L9MA 4QSDA 4LA9A 4C0RA 2DYXA 4DCYA 1JEVA 3SEYA 5KCJB 1AL3A 1POTA 4NTLA 2DE2A 2REGA 2Y7KA 1JW4A 4OVQA 4JWYA 2H25A 3K6XA 2ZXTA 4YKPA 1VE4A 3W15C 3PMXA 5EHMA 5I59B 3EHSA 1Q35A 3RGYA 1B5IA 1MS7A 1ZIUA 4YB6A 3PD8A 4FATA 1QW0A 1MY2A 1BIYA 1MXWA 4U4XA 4NQ8A 5H8NA 1LFGA 4LATA 1IUDA 2I4CA 2UVIA 4MF3A 3B6WA 2QRYA 3S9MC 1GR2A 2VP1A 1Y1ZA 1DOTA 3FXRA 3S9EA 1YCJA 4QSCA 2I6EA 4NN3A 1MQGA 4ZEKA 1A7LA 4XF5A 3UGWA 4O8MA 4QFKA 4DZ1A 3FIRA 4YAHX 2RCAA 4PFIA 1SDXA 1IXGA 4OVPA 4NMYA 4LN5A 2F7AA 5CM6A 5I2NB 1TWYA 2Y84A 2R71A 2OBGA 4KD5A 3OEKA 4R6YA 2QL3A 2QS4A 4OXVA 3WAEA 2UXAA 3MP1A 4NE4A 3PUXE 1FCKA 4QFNA 2I49A 3H4ZA 1P1WA 2ANJA 3MPLA 2XWIA 3IJOB 4HCYA 3UK4A 4PAIA 4GF8A 2OLBA 2RINA 1WVJA 4OFLA 2O69A 3PMWA 2RCBA 3ZSFA 3A09A 4QFPA 3T9UA 4RNSA 4MLVA 5I7IA 3IB0A 4G8NA 1Y4TA 2ZYOA 4F1YA 3IB2A 3S9LC 1FTLA 2YJPA 1MY3A 3H3GA 4TOZA 3T9VA 5CRYA 5L8DA 4EF1A 3CSGA 1FQCA 4PF6A 4MBPA 2KLFA 3RY3A 1A8FA 2ZMBA 4MCOA 5CMKA 4PE5B 4Z7EA 1R6ZA 2XXXA 2NOOA 2XXPA 1MM7A 4ND9A 3K02A 2GFEA 3VVEA 1B2HA 2XX7A 4R75A 2Z23A 5ITPA 1MG1A 5KDTA 4H8JA 4NGUA 2Q2AA 5CMCA 3CI8A 3HSTA 4PDDA 1JNFA 4ESXA 1MM6A 1BKAA 1LBCA 3B7DA 3C32A 2AL4A 4NF4B 3A3UA 2HZKA 3JYRA 1MQIA 4XKQA 2X26A 4N91A 3N94A 1N7WA 3HPIA 4QRZA 1MPBA 1MXVA 3B6QA 3SEVA 4MH5A 5EYFA 3D4CA 4JWOA 3G3HA 3FUZA 3DP6A 2UVJA 3FZVA 1IXCA 1UIUA 3KZGA 2V4CA 1WODA 4GQOA 5I57A 2WYPA 2O7IA 4FECA 1QUIA 1NH7A 5F1QA 4GOTA 1PC3A 2UVHA 1ZBMA 2P1SA 2GHBA 4PF8A 4U2RA 3IR1A 2ZYNA 3IX1A 4NF5A 5J1DA 4EXLA 3CRBA 4ELPA 4LZ5A 3L6HA 1D3KA 1I6QA 3RQTA 5I56B 1LCTA 2UYEA 3CFLA 1LGBC 3A3CA 4THIA 3I5OA 3QK6A 3BKIB 1B4HA 5EHSA 1RYXA 1FQAA 4P11A 2O7UA 3HN0A 4NF8B 4IO7A 3VLVA 4GRKA 3H03A 2G93A 3OO9A 4NF6A 2M8CA 4OHNA 2WKYA 5IKBA 3IOTA 4ZEIA 2ZNTA 4IO5A 1P1QA 4X9TA 3V83A 4G68B 2DSFA 4C1TA 1HSJA 1Z7ME 3CFXA 4O7MA 1PDAA 2PVUA 2AL5A 1PBQA 2XHDA 4R6HA 4UABA 2IA4A 3IJXB 2XWOA 2ONSA 2Y7WA 1TFDA 2OCUA 5I2KA 1MXYA 5TP9A 4IO2A 1A99A 5FHMA 2XXHA 3VLUA 4PFBA 2ZZXA 3EPEA 1Y1MA 3FVKA 1QVSA 3RTFB 4RYAA 4P47A 5ICQA 1LCFA 1PBPA 3FXBA 5AA4B 3HO7A 2CMOA 3EHTA 4ZE9A 1FQBA 1LBBA 2XWVA 3CSBA 3DM0A 2E1SA 3M8UA 1FTKA 1N04A 4G77A 4YICA 5CBSA 4PFUA 2D3IA 4OETA 4GIZA 4BDRA 3PV0E 4IB2A 1OVTA 3ODBA 1OIBA 1AIVA 3T96B 4H5FA 4O3BA 1IIWA 3JZJA 2YPNA 3TAJA 3LSXA 2I3VA 3W9WA 2NXOA 4RK9A 1GV8A 1DTGA 4YKKA 4HTGA 1NNFA 3CIJA 3MP8A 4Q8RA 2X7PA 2AYSA 1B51A 3IOWA 4PAFA 1OQGA 3FVNA 4PFRA 2ZZVA 4U22A 2HXWA 2DWAA 2PX1A 5H8NB 3CVGA 4HCWA 4OQOA 3C33A 2QS3A 4KPTA 3PPQA 2E0SA 3FVGA 4QF9A 5CMMA 1CB6A 5AA2A 2RF1A 4GXSB 3CR9A 1M5BA 1JW5A 1US4A 3IL1B 3KSJA 3MAMA 4PFYA 1A8EA 4QHQA 4X1DA 5AE4A 3FVOA 1D9VA 3IAZA 4F31B 2I58A 1B0HA 4JBZA 1SW4A 4TLMB 1UTHA 3N26A 4NG7A 2HQ0A 3LSFB 3AXFA 1URSA 4BDNA 4P8BA
chains in the Genus database with same CATH superfamily
1HSEA 1B7ZA 1Y3QA 3PD9A 1KA0A 2XXYA 1INPA 4JSDA 1PEBA 4GLIA 4BLAA 1XVYA 1O7TA 2I3WA 2Z8FA 1MY1A 4LP2B 4TLLB 2RKMA 3QUFA 3S9NC 4H45A 4POXA 1T0KA 4IO4A 1IMAA 5B70A 1G0HA 4PFTA 1RDXA 4UA8A 3Q29A 2DVZA 3Q28A 2UVGA 1Y4CA 4FIMA 2O68A 5EQ7A 4AB6A 1S7YA 1ZU0A 5ET5A 4MLQA 4M4GA 3PPOA 5I5PA 3UP9A 3QIMA 3U8QA 3MZBA 1Y3NA 1ELJA 5H8FA 3FV1A 4LVQA 5I84A 1ZKBA 3GZGA 4OVTA 5DYHA 4RK2A 3U72A 5HPQA 1PB7A 4YMAA 1TFAA 2VD3A 3H7MA 1MDQA 4IY5A 1JVYA 4OENA 3W9VA 4X1BA 3PPPA 4ESWA 3O97A 1H43A 3LSWA 1MH4A 2PT1A 5DW8A 4OMBA 5A5XA 2QVVA 5ET7A 3RT8A 1IEJA 3R6UA 4ELQA 3KJ7A 5TU0A 1ATGA 4AQ4A 1FPEA 3PUZE 3PGFA 1BLFA 2BJJX 4OEVA 1OLAA 2V3UA 5KDTB 1FPLA 1EZ9A 2O84X 2F36A 2XD2A 4GWZA 3VFJA 3MQ9A 3O6IA 1NV3A 3LC8A 3MC2A 5L9SA 3SETA 4JSOA 4BDMA 1N7XA 1IXIA 3MSTA 3E3KA 3MP6A 1FBFA 4PE3A 3RPWA 4PCDA 5ISUA 4RA1A 4YU0A 2ONKE 2Y5LA 4PP0A 4U23A 3ILTB 1SI0A 4ZEFA 3B50A 1QKAA 5DEXA 4F3BA 1IMFA 4R2FA 4G8HA 1UTBA 5I57B 3DELB 5FTIA 5H8SA 3BBRA 3GBAA 1O63A 4KCDA 3GLBA 3MW0A 3KOSA 3ISPA 2OWTA 2XXQA 2XXTA 2QMWA 3TEPA 4NF5B 3RUMA 3MVZA 4EDPA 1CE2A 3FBPA 4JDFA 4R73A 1FPJA 4F19A 2GH9A 2V93A 2IEEA 2WEFA 3RT6B 1M5CA 4WXJA 1L5TA 4F2QA 3TODA 4DLDA 3R7XA 3PUWE 3PUVE 3KEIA 4N6KA 1ANFA 1YPNA 3O6GA 3SERA 2FA7A 4PDHA 5LTCA 4NF6B 3K6WA 4PBQA 2F78A 4NWDA 4XXUA 2O1LA 1XVXA 4IR8A 1FBGA 3U92A 3TUSA 4G61A 2PYYA 2CZIA 1NH8A 2CEXA 4N6DA 1LAXA 3L6GA 4AB5A 1D9YA 1NUYA 4OA4A 4I40A 2OWSA 4YKIA 3MVYA 4KI0E 2Q8JA 4XIGQ 3T0JA 1B9JA 4N15A 1B3HA 5IGAA 3K1PA 1F9BA 3G3IA 1B3EA 4U1OA 5I2KB 4IO6A 2F3DA 1B32A 1ZLQA 3O66A 1P1UA 2B3FA 2W7YA 5TP9B 3R26A 4OEUA 4NX1A 1Q9DA 1B3GA 4I1DA 4OYVA 3H6VA 5LDZA 4ONYA 4N17A 3MZ1A 1JEUA 2ZNSA 3OEMA 4H67A 4DXBA 1MPCA 4QFLA 1IMBA 4P0GA 5I58A 2O1MA 5A5LA 1IITA 1BTJA 3FJ7A 3UA8A 3RPLA 4YB5A 4XKRA 2YLNA 2DWJA 2VPNA 1KWHA 3GXAA 2Y5KA 2HXRA 4HS7A 3U1OA 1YAEA 4OVSA 4R6KA 2ZNUA 1N76A 4G2ZA 4DI3D 4FAJA 1WDNA 1M5EA 4F1UA 4DCXA 4P56A 3OO6A 1KZ8A 2H5YA 3EF7A 3PU5A 5BUUA 1LFIA 1MQHA 4F3PA 1RKMA 4UACA 4HE0A 1B5HA 4X48A 2H4IA 4JB7A 3EN3A 3G7WA 1MPDA 4PQJA 3TTRA 3DP8A 2HZLA 2DOJA 2Y7RA 2GQ1A 1JETA 3FJMA 1I69A 4MAGA 3LSLA 2ZZWA 3P7IA 3VXCA 3TPAA 1B5JA 1B3FA 2DXRA 2DE3A 2VT5A 4H8IA 1URGA 2D21A 2PFYA 1NV7A 4OVJA 4GL8A 2THIA 4ZS9A 1B7UA 1VDWA 4KHZE 1NKXA 4MMPA 2H98A 4GX6A 2QMXA 5AA2B 1MQDA 1R9LA 1B4ZA 4MNIA 3CG1A 3VVFA 4OZ9A 2PT2A 4L17A 1LBVA 4ZEBA 1GTKA 1KA1A 3PUYE 3LV0A 1B1HA 3OXNA 3V8XB 1NUZA 4RPNA 4YMBA 5IZ1A 5HBCA 1IMDA 2F34A 1UTHB 1AWBA 3HHFA 4E0XA 1NV0A 5ICTA 4WEDA 4YKJA 3TELA 3QYTA 2R8TA 3DLNA 5AA2D 1H44A 2P2AA 2RC8A 5HM4B 1OVBA 3SEWA 3TQWA 4H5GA 2MKZA 5EQAA 5H8QA 1UQWA 1SW1A 3EQ1A 4LONB 4LZ7A 5AA3A 3K6UA 3HHGA 4IY6A 3FD3A 3LR1A 2NUVA 4F22A 5KZTA 2RC9A 3PPNA 2LAOA 4NWCA 1ZTYA 2R9JA 4FBPA 3HCQA 4PBHA 1FBDA 1B7HA 2HPGA 1FTJA 3K00A 2B65A 4GFRA 4E0WA 4AS5A 4JVDA 4NAPA 2DVCA 3H06B 4QXDA 1FQDA 2UYFA 3RNNA 5H8FB 1SPIA 2H99A 1NUWA 1VR5A 3USDA 1A40A 1SYIA 4F1VA 3MPKA 5IM2A 5TPAA 1B58A 4EF2A 1O64A 1FQEA 5FTHA 4YB7A 1EYKA 4R9FA 2D5WA 5JTYA 2CZKA 1MY4A 2XXIA 4R72A 2A5SA 3C9HA 1A55A 2VD2A 4ISUA 3B6TA 5A5XB 1SW2A 2Q88A 5BWJA 2I0BA 4P0IA 2Q2CA 4QSEA 1NNPA 2GRVA 4I9DA 4U1ZA 4F29A 3TTNA 1USYE 4IGTA 2ZYKA 1AH5A 3SEUA 3FASA 3E13X 4Q0CA 3K01A 4HXVA 4MNPA 3K1MA 5JEIA 2HAUA 4MEVA 4GWXA 3FXUA 4LZ8A 1B46A 1R1NA 2Z22A 4DXUA 2XXRA 3ONMA 1JVXA 1MDP1 4MX6A 2HEUA 4DE8A 2DDKA 5H8HA 3HFUA 1LB9A 1PB9A 1ZJLA 3KOTA 2OK2A 5IZ3A 1K9ZA 1II5A 5DTBA 1B52A 4GD5A 5DEXB 3IO4A 1K9YA 3U65A 1XC1A 1I6BA 4BDOA 1UTBB 3TQLA 2F6GA 3ECRA 3C36A 3I3VA 3CHGA 1PB8A 2B4LA 3C4MA 3KC1A 1MH3A 4NF0A 3M3FA 5K2XA 1I6AA 5AA1A 2Q74A 3RYDA 3RTWB 2Q9TA 1OLCA 3TZAA 3OO7A 4IO3A 4OVRA 4R9GA 1RDYA 1B6HA 2F7BA 1OQHA 3MZ9A 3TTMA 2PBWA 3OELA 4ZDMA 3TTKA 3T1BA 3KBRA 3U93A 1N3XA 3IK6B 4K3FA 3VXBA 3G3FA 3H6WA 1QGXA 5IAIA 4ECFA 4RXLA 1VFEA 1FPBA 4RPOA 1SVXB 3I6VA 3TFLA 5EQ8A 1DTZA 1B3LA 4N4UA 1VFDA 1FTMA 3BIHA 1B1XA 3ZKLA 4AS4A 2R6GE 1N0TA 1DMBA 2ESNA 3H6TA 3KJTA 4XFEA 2Q8MA 4RJZA 2V3TA 4P3LA 2A5TA 1XHYA 3FGSA 3WAFA 3TKDA 3ILUB 3TCFA 3M3KA 1USYH 4EUOA 3C31A 4G4PA 3G3GA 2O6AA 1NNKA 5FBPA 3E79A 4KQPA 1EYJA 3OSRA 1VSOA 4DXCA 4PGPA 3FJGA 3PPRA 4H0WA 1QJMA 2V25A 4GVOA 3T9XB 3SKPA 2KR0A 5DVJA 1H45A 4N07A 2OWZA 4N13A 1NV2A 2OX3A 4H46A 1D9QA 4JXIA 4O3CA 3IO6A 2F3BA 4M1VA 5I58B 1LAGE 3RPLB 3LUYA 3SEXA 1SYHA 4ZEDA 4FORA 2I4BA 4GBWA 5CBRA 1LAHE 2F35A 1NL5A 4GL0A 4Z0IA 1D4NA 2NWJA 2F5XA 1NMUA 4DDDA 1MXXA 1B05A 2WX9A 1QUKA 4GWYA 4DIGA 4O3AA 3VLWA 3G3KA 1MY0A 2I48A 1N3WA 4F39A 3QUJA 5J16A 5KCJA 3TYHA 2F8DA 4BDQA 3V5AA 2DXYA 1AMFA 2REJA 4LQ5A 4P1EA 2NVUB 1BP5A 1MXUA 4I3EA 4P1LA 4ELRA 5I59A 2VGQA 1MXZA 2VHAA 4EQ9A 1Y9UA 4GX3A 4OANA 4C1UA 3C35A 2F7CA 1MRPA 3QSLA 1DK4A 3KN3A 3LUZA 2F97A 3B8BA 4XKNA 2OJTA 3DP4A 2PFZA 1B40A 1EZPA 2Z8EA 3K1NA 1LFHA 2DWHA 1POY1 3OO8A 4JVCA 1LSTA 4X04A 3LBSA 3KG2A 3OENA 3D1RA 2Q89A 3QXMA 4MIJA 1SQYA 5B7DA 1NV6A 3IB1A 4BDLA 3TTLA 4RY1A 3THIA 5IZZA 2QSXA 2CZLA 4KXPA 1R9QA 2DWIA 3VV5A 1FQFA 3MUQA 3N5LA 4XTCQ 1DPPA 4H6DA 1SW5A 2V84A 5I2NA 1FBHA 2P3NA 2H9BA 2ZYMA 1H76A 2Z8DA 1FPGA 4O94A 4QBAA 4ELOA 4OTEA 3UN6A 1FPIA 1FTOA 3IOUA 3TCHA 3Q27A 4EXKA 2I0CA 3D4GA 3E9XA 5FHNA 5K2YA 2L5VA 5EYGA 2KQZA 2GHAA 3TMGA 5CMBA 1GVCA 2CEYA 5F7VA 4HE1A 4HE2A 1EZOA 2WBBA 5H8QB 1YTVA 3IOVA 3KN8A 3OOAA 4XEQA 4GXAA 2QS1A 3C34A 1HSLA 1FPFA 4KYEA 5M2VA 2FVZA 1FTAA 4PAKA 3TDJA 3RLFE 3BIGA 4ZZEA 1IZ1A 4XKPA 5ELVA 4WEPA 3Q25A 2Y7IA 3RN8A 3SDFA 3MJNA 3N6UA 1XS5A 3UORA 2B3BA 3OD7A 4TQUQ 4Q5TA 2DQVA 3F11A 1Q1KA 1FJ6A 3OSQA 3QAXA 4NHBA 4H65A 4X8RA 3GYYA 3T9HB 4GWWA 1TT1A 3TCGA 1XT8A 4OESA 3FV2A 2VOZA 2ABHA 4EQ7A 1EH3A 5TPAB 4WKMA 4MHFA 3QMFA 3O9PA 4PGNA 1TXFA 3G3JA 4R74A 5ESYA 5JTYB 4MNCA 5LOMA 4F3SA 4H1XA 2QVUA 1M5FA 1M5DA 3KSXA 1DSNA 2DE4A 5DVIA 5CC2A 1P1OA 3T93B 3MVXA 3O2AA 3JV9A 2FNCA 4NEDA 4NF4A 2XXVA 1P1NA 3K6VA 4Q30B 1DPEA 4I62A 4KCCA 1EU8A 2AIXA 1H3DA 4ZZAA 2QPQA 4U21A 2QS2A 3V89B 2HFBA 4FE8A 4IGRA 2XX8A 5T3JA 2OZZA 1G0IA 2P0SA 4KYSA 2DP8A 3EHUA 1NV5A 1XOCA 4GBVA 4YZZA 1SD3A 3EKIA 5DT6A 3BFUA 4POWA 1OMPA 3KGCA 2XWKA 5H8HB 1J1NA 4KR5A 4GWUA 5IZ3B 1FJ9A 1NFTA 2XXUA 1IXHA 4FEDA 4ZECA 5CI5A 3K4UA 1QKBA 2WYKA 2HCAA 4F18A 2HHMA 1ZMGA 2DS9A 4OWDA 4N6PA 3VE1B 2ALUA 2XXKA 4ZE8A 5I56A 2X7QA 1LB8A 4FEBA 4F3GA 3MBPA 3O28A 1S9TA 1MQJA 3IFCA 1URDA 4NF8A 5L9OA 1US5A 3N6TA 3KN7A 1DCUA 2XA5A 1Z7NE 3MWBA 2RC7A 3KFMA 4OERA 3T66A 5JK4A 4LQ2A 1P99A 4DI4B 3K0VA 3HV1A 3BFTA 3Q26A 4F2OA 3SESA 4G68A 4U4SA 1RYOA 4G68C 4JWXA 4FJPA 4MFIA 3MVWA 4HW8A 3H6UA 1B0LA 1IQ7A 2JJKA 1UIVA 1EYIA 2PCRA 4R2BA 1FW0A 1SBPA 1QULA 4G8MA 2Y7PA 4OFJA 3O29A 3FXQA 1Y3PA 1Y20A 2A5TB 4PFWA 2FYIA 4KFQA 3PMVA 2XD3A 3CG3A 4LUBA 3VDFA 1LLSA 4I8CA 5FHOA 3E4RA 3S2VA 1AOVA 2XX9A 5AA4A 2O51A 4PETA 1FBCA 1QUJA 2V3QA 1IMEA 1NI9A 1LAFE 4P9KA 3UIFA 3T22A 4KYDA 4GX4A 3FATA 3S4UA 3CFZA 2QFLA 2VPOA 1SI1A 1FBPA 3O6HA 3ZKKA 3K2DA 4N8GA 4EQBA 1GGGA 2ONRA 3IFAA 3VVDA 2QJEA 1S50A 2XXWA 2G29A 3GBBA 4QFOA 2PMSA 3OMBA 1A54A 1JQFA 5ITOA 2F6PA 4PC9A 1NNTA 4I3YA 4N8YA 3U94A 2HAVA 1NV1A 3M3LA 3ZS6A 5DVFA 1JW1A 1NUXA 4GWOA 1N84A 3IORA 4OFOA 5L9MA 4QSDA 4LA9A 4C0RA 2DYXA 4DCYA 1JEVA 3SEYA 5KCJB 1AL3A 1POTA 4NTLA 1YXIA 2DE2A 2REGA 2Y7KA 1JW4A 4OVQA 4O7IA 1IMCA 4JWYA 2H25A 3K6XA 2ZXTA 4YKPA 1VE4A 3W15C 3PMXA 5EHMA 3E78A 5I59B 3EHSA 1Q35A 3RGYA 1B5IA 1MS7A 1LEVA 1ZIUA 4YB6A 3PD8A 4FATA 1QW0A 1MY2A 1RDZA 1BIYA 1MXWA 4U4XA 4NQ8A 2P3VA 5H8NA 1LFGA 4LATA 1IUDA 2I4CA 2UVIA 4MF3A 3B6WA 2QRYA 3S9MC 2FIEA 1GR2A 2VP1A 1LBXA 1Y1ZA 3ROJA 1DOTA 3FXRA 3S9EA 1YCJA 4QSCA 4JVIA 2I6EA 4NN3A 1MQGA 4ZEKA 1A7LA 4XF5A 3UGWA 4O8MA 4QFKA 4DZ1A 3FIRA 4YAHX 2RCAA 4PFIA 1SDXA 1IXGA 4MJOA 5I3SA 4GWSA 4OVPA 4NMYA 4LN5A 4N81A 2F7AA 5CM6A 5I2NB 1TWYA 2Y84A 2R71A 2OBGA 4KD5A 3OEKA 4R6YA 2QL3A 2QS4A 4OXVA 3WAEA 2UXAA 1FPDA 3MP1A 4NE4A 3PUXE 1FCKA 4QFNA 2I49A 3H4ZA 1YYZA 1P1WA 2ANJA 2XWIA 3MPLA 3IJOB 4HCYA 3UK4A 4PAIA 4GF8A 2OLBA 2RINA 4PTKA 1WVJA 4OFLA 2O69A 3KBZA 3PMWA 2RCBA 3ZSFA 3A09A 4QFPA 3T9UA 4RNSA 1CNQA 4MLVA 5I7IA 3IB0A 4G8NA 1YZ0A 1Y4TA 2FHYA 2ZYOA 4F1YA 3IB2A 3S9LC 1FTLA 2YJPA 1LBYA 1MY3A 3H3GA 4TOZA 3T9VA 5CRYA 5EYHA 5L8DA 4EF1A 2WBDA 3CSGA 3NOHA 1FQCA 4PF6A 4MBPA 2KLFA 3RY3A 1A8FA 2ZMBA 4MCOA 5CMKA 4PE5B 4Z7EA 1R6ZA 2XXXA 2NOOA 2XXPA 1MM7A 3A29A 3K02A 2GFEA 4ND9A 5F24A 3VVEA 2FIXA 1B2HA 2XX7A 4R75A 2Z23A 5ITPA 1MG1A 5KDTA 4H8JA 4NGUA 2Q2AA 5CMCA 3CI8A 3HSTA 4PDDA 1JNFA 4ESXA 1MM6A 1BKAA 1LBCA 3B7DA 3C32A 2AL4A 4NF4B 3A3UA 2FBPA 2HZKA 3JYRA 1MQIA 4XKQA 2X26A 4N91A 3N94A 1N7WA 3HPIA 4QRZA 1MPBA 1MXVA 3B6QA 3SEVA 4MH5A 5EYFA 3D4CA 4JWOA 3G3HA 2QVRA 3FUZA 3DP6A 2UVJA 3FZVA 1IXCA 1UIUA 3KZGA 2V4CA 1WODA 4GQOA 5I57A 2WYPA 2O7IA 4FECA 1QUIA 1NH7A 5F1QA 4GOTA 1PC3A 2UVHA 1ZBMA 2P1SA 2GHBA 4PF8A 4U2RA 3IR1A 2ZYNA 3IX1A 4NF5A 5J1DA 4EXLA 3CRBA 4ELPA 4LZ5A 3L6HA 1D3KA 1I6QA 3RQTA 5I56B 1LCTA 1LBZA 2UYEA 3CFLA 1LGBC 3A3CA 4THIA 3I5OA 3QK6A 3PTYA 3BKIB 1B4HA 5EHSA 1RYXA 1FQAA 4P11A 2O7UA 3HN0A 4NF8B 4IO7A 3VLVA 4GRKA 3H03A 2G93A 3OO9A 1NV4A 4NF6A 2M8CA 4OHNA 2WKYA 5IKBA 3IOTA 4ZEIA 2ZNTA 4IO5A 1P1QA 4X9TA 5EQ9A 3V83A 4G68B 2DSFA 4C1TA 1HSJA 1Z7ME 3CFXA 4O7MA 1PDAA 2PVUA 2AL5A 2CZHA 1PBQA 2XHDA 5ET6A 4R6HA 1LBWA 2IA4A 4UABA 3IJXB 2XWOA 2ONSA 3MYUA 2Y7WA 1TFDA 2OCUA 5I2KA 1MXYA 5TP9A 4IO2A 1A99A 1FSAA 5FHMA 2XXHA 3VLUA 4PFBA 2ZZXA 3EPEA 1Y1MA 3FVKA 1QVSA 3RTFB 4RYAA 4P47A 5ICQA 1LCFA 1PBPA 3FXBA 1FBEA 5AA4B 3HO7A 2CMOA 3EHTA 4ZE9A 1FQBA 1LBBA 2XWVA 1FRPA 3CSBA 3DM0A 2E1SA 3M8UA 1FTKA 1N04A 4G77A 4YICA 1BK4A 5CBSA 4PFUA 2D3IA 4OETA 4GIZA 4BDRA 3PV0E 4IB2A 1OVTA 3ODBA 1OIBA 1AIVA 3T96B 4H5FA 4O3BA 2BJIA 1IIWA 3JZJA 2YPNA 3TAJA 3LSXA 2I3VA 3W9WA 2NXOA 4RK9A 1GV8A 1FPKA 1DTGA 4YKKA 4HTGA 1NNFA 3KC0A 3CIJA 3MP8A 4Q8RA 2X7PA 2AYSA 1B51A 3IOWA 4PAFA 1OQGA 3FVNA 4PFRA 2ZZVA 4U22A 2B4MA 2HXWA 2DWAA 2PX1A 5H8NB 3CVGA 4HCWA 4OQOA 3C33A 2QS3A 4KPTA 3PPQA 2E0SA 1DBZA 3FVGA 4QF9A 5CMMA 1CB6A 5AA2A 2RF1A 4GXSB 3CR9A 1M5BA 1JW5A 1US4A 3IL1B 3KSJA 3MAMA 4PFYA 1A8EA 1JP4A 5ET8A 4QHQA 4X1DA 5AE4A 3FVOA 1D9VA 3IAZA 4F31B 2I58A 1B0HA 4JBZA 1SW4A 4TLMB 1XI6A 1UTHA 3N26A 4NG7A 2HQ0A 3LSFB 3AXFA 1URSA 3SZPA 4BDNA 4P8BA
chains in the Genus database with same CATH topology
1HSEA 1B7ZA 1Y3QA 3PD9A 1KA0A 2XXYA 1INPA 4JSDA 1PEBA 4GLIA 4BLAA 1XVYA 1O7TA 2I3WA 2Z8FA 1MY1A 4LP2B 4TLLB 2RKMA 3QUFA 3S9NC 4POXA 4H45A 1T0KA 4IO4A 1IMAA 5B70A 1G0HA 4PFTA 1RDXA 4UA8A 3Q29A 2DVZA 3Q28A 2UVGA 1Y4CA 4FIMA 2O68A 5EQ7A 4AB6A 1S7YA 1ZU0A 5ET5A 4MLQA 4M4GA 3PPOA 5I5PA 3UP9A 3QIMA 3U8QA 3MZBA 1Y3NA 1ELJA 5H8FA 3FV1A 4LVQA 5I84A 1ZKBA 3GZGA 4OVTA 5DYHA 4RK2A 3U72A 5HPQA 1PB7A 4YMAA 1TFAA 2VD3A 3H7MA 1MDQA 4IY5A 1JVYA 4OENA 3W9VA 4X1BA 3PPPA 4ESWA 3O97A 1H43A 3LSWA 1MH4A 2PT1A 5DW8A 4OMBA 5A5XA 2QVVA 5ET7A 3RT8A 1IEJA 3R6UA 4ELQA 3KJ7A 5TU0A 1ATGA 4AQ4A 1FPEA 3PUZE 3PGFA 1BLFA 2BJJX 4OEVA 1OLAA 2V3UA 5KDTB 1FPLA 1EZ9A 2O84X 2F36A 2XD2A 4GWZA 3VFJA 3MQ9A 3O6IA 1NV3A 3LC8A 3MC2A 5L9SA 3SETA 4JSOA 4BDMA 1N7XA 1IXIA 3MSTA 3E3KA 3MP6A 1FBFA 4PE3A 3RPWA 4PCDA 5ISUA 4RA1A 4YU0A 2ONKE 4PP0A 4U23A 2Y5LA 3ILTB 1SI0A 4ZEFA 3B50A 1QKAA 5DEXA 4F3BA 1IMFA 4R2FA 4G8HA 1UTBA 5I57B 3DELB 5FTIA 5H8SA 3BBRA 3GBAA 1O63A 4KCDA 3GLBA 3MW0A 3KOSA 3ISPA 2OWTA 2XXQA 2XXTA 2QMWA 3TEPA 4NF5B 3RUMA 3MVZA 4EDPA 1CE2A 3FBPA 4JDFA 4R73A 1FPJA 4F19A 2GH9A 2V93A 2IEEA 3RT6B 2WEFA 1M5CA 4WXJA 1L5TA 4F2QA 3TODA 4DLDA 3R7XA 3PUWE 3PUVE 3KEIA 4N6KA 1ANFA 1YPNA 3O6GA 3SERA 2FA7A 4PDHA 5LTCA 4NF6B 3K6WA 4PBQA 2F78A 4NWDA 4XXUA 2O1LA 1XVXA 4IR8A 1FBGA 3U92A 3TUSA 4G61A 2PYYA 2CZIA 1NH8A 2CEXA 4N6DA 1LAXA 3L6GA 4AB5A 1D9YA 1NUYA 4OA4A 4I40A 2OWSA 4YKIA 3MVYA 4KI0E 2Q8JA 4XIGQ 3T0JA 1B9JA 4N15A 1B3HA 5IGAA 3K1PA 1F9BA 3G3IA 1B3EA 4U1OA 5I2KB 4IO6A 2F3DA 1B32A 1ZLQA 3O66A 1P1UA 2B3FA 2W7YA 5TP9B 3R26A 4OEUA 4NX1A 1Q9DA 1B3GA 4I1DA 4OYVA 3H6VA 5LDZA 4ONYA 4N17A 3MZ1A 1JEUA 2ZNSA 3OEMA 4H67A 4DXBA 1MPCA 4QFLA 1IMBA 4P0GA 5I58A 2O1MA 5A5LA 1IITA 1BTJA 3FJ7A 3UA8A 3RPLA 4YB5A 4XKRA 2YLNA 2DWJA 2VPNA 1KWHA 3GXAA 2Y5KA 2HXRA 4HS7A 3U1OA 1YAEA 4OVSA 4R6KA 2ZNUA 1N76A 4G2ZA 4DI3D 4FAJA 1WDNA 1M5EA 4F1UA 4DCXA 4P56A 3OO6A 1KZ8A 2H5YA 3EF7A 3PU5A 5BUUA 1LFIA 1MQHA 4F3PA 1RKMA 4UACA 4HE0A 1B5HA 4X48A 2H4IA 4JB7A 3EN3A 3G7WA 1MPDA 4PQJA 3TTRA 3DP8A 2HZLA 2DOJA 2Y7RA 2GQ1A 1JETA 3FJMA 1I69A 4MAGA 3LSLA 2ZZWA 3P7IA 3VXCA 3TPAA 1B5JA 1B3FA 2DXRA 2DE3A 2VT5A 4H8IA 1URGA 2D21A 2PFYA 1NV7A 4OVJA 4GL8A 2THIA 4ZS9A 1B7UA 1VDWA 4KHZE 1NKXA 4MMPA 2H98A 5AA2B 2QMXA 4GX6A 1MQDA 1R9LA 1B4ZA 4MNIA 3CG1A 3VVFA 4OZ9A 2PT2A 4L17A 1LBVA 4ZEBA 1GTKA 3PUYE 1KA1A 3LV0A 1B1HA 3OXNA 3V8XB 1NUZA 4RPNA 4YMBA 5IZ1A 5HBCA 1IMDA 2F34A 1UTHB 3HHFA 4E0XA 1AWBA 1NV0A 5ICTA 4WEDA 4YKJA 3TELA 3QYTA 2R8TA 3DLNA 5AA2D 1H44A 2P2AA 2RC8A 5HM4B 1OVBA 3SEWA 3TQWA 4H5GA 2MKZA 5EQAA 5H8QA 1UQWA 1SW1A 3EQ1A 4LONB 4LZ7A 5AA3A 3K6UA 3HHGA 4IY6A 3FD3A 3LR1A 2NUVA 4F22A 5KZTA 2RC9A 3PPNA 2LAOA 4NWCA 1ZTYA 2R9JA 4FBPA 3HCQA 4PBHA 1FBDA 1B7HA 2HPGA 1FTJA 3K00A 2B65A 4GFRA 4E0WA 4AS5A 4JVDA 4NAPA 2DVCA 3H06B 4QXDA 1FQDA 2UYFA 3RNNA 5H8FB 2H99A 1SPIA 1NUWA 1VR5A 3USDA 1A40A 1SYIA 4F1VA 3MPKA 5IM2A 5TPAA 1B58A 4EF2A 1O64A 1FQEA 5FTHA 4YB7A 1EYKA 4R9FA 2D5WA 5JTYA 2CZKA 1MY4A 2XXIA 4R72A 2A5SA 3C9HA 1A55A 2VD2A 4ISUA 3B6TA 5A5XB 1SW2A 2Q88A 5BWJA 2I0BA 4P0IA 2Q2CA 4QSEA 1NNPA 2GRVA 4I9DA 4U1ZA 4F29A 3TTNA 1USYE 4IGTA 2ZYKA 1AH5A 3SEUA 3FASA 3E13X 4Q0CA 3K01A 4HXVA 4MNPA 3K1MA 5JEIA 2HAUA 4MEVA 4GWXA 3FXUA 4LZ8A 1B46A 1R1NA 2Z22A 4DXUA 2XXRA 3ONMA 1JVXA 1MDP1 4MX6A 2HEUA 4DE8A 2DDKA 5H8HA 3HFUA 1LB9A 1PB9A 1ZJLA 3KOTA 2OK2A 5IZ3A 1K9ZA 1II5A 5DTBA 1B52A 4GD5A 5DEXB 3IO4A 1K9YA 3U65A 1XC1A 1I6BA 4BDOA 1UTBB 3TQLA 2F6GA 3ECRA 3C36A 3I3VA 3CHGA 1PB8A 2B4LA 3C4MA 3KC1A 1MH3A 4NF0A 3M3FA 5K2XA 1I6AA 5AA1A 2Q74A 3RYDA 3RTWB 2Q9TA 1OLCA 3TZAA 3OO7A 4IO3A 4OVRA 4R9GA 1RDYA 1B6HA 2F7BA 1OQHA 3MZ9A 3TTMA 2PBWA 3OELA 4ZDMA 3TTKA 3T1BA 3KBRA 3U93A 1N3XA 3IK6B 4K3FA 3VXBA 3G3FA 3H6WA 1QGXA 5IAIA 4ECFA 4RXLA 1VFEA 4RPOA 1FPBA 1SVXB 3I6VA 3TFLA 5EQ8A 1DTZA 1B3LA 4N4UA 1VFDA 1FTMA 3BIHA 1B1XA 3ZKLA 4AS4A 2R6GE 1N0TA 1DMBA 2ESNA 3H6TA 3KJTA 4XFEA 2Q8MA 4RJZA 2V3TA 4P3LA 2A5TA 1XHYA 3FGSA 3WAFA 3TKDA 3ILUB 3TCFA 3M3KA 1USYH 4EUOA 3C31A 4G4PA 3G3GA 2O6AA 1NNKA 5FBPA 3E79A 4KQPA 1EYJA 3OSRA 1VSOA 4DXCA 4PGPA 3FJGA 3PPRA 4H0WA 1QJMA 2V25A 4GVOA 3T9XB 3SKPA 2KR0A 5DVJA 1H45A 4N07A 2OWZA 4N13A 1NV2A 2OX3A 4H46A 4JXIA 1D9QA 4O3CA 3IO6A 2F3BA 4M1VA 5I58B 1LAGE 3RPLB 3LUYA 3SEXA 1SYHA 4ZEDA 4FORA 2I4BA 4GBWA 5CBRA 1LAHE 2F35A 1NL5A 4GL0A 4Z0IA 1D4NA 2NWJA 2F5XA 1NMUA 4DDDA 1MXXA 1B05A 2WX9A 1QUKA 4DIGA 4GWYA 4O3AA 3VLWA 3G3KA 1MY0A 2I48A 1N3WA 4F39A 3QUJA 5KCJA 5J16A 3TYHA 2F8DA 4BDQA 3V5AA 2DXYA 1AMFA 2REJA 4LQ5A 4P1EA 2NVUB 1BP5A 1MXUA 4I3EA 4ELRA 5I59A 4P1LA 2VGQA 1MXZA 2VHAA 4EQ9A 1Y9UA 4GX3A 4C1UA 4OANA 3C35A 2F7CA 1MRPA 3QSLA 3KN3A 1DK4A 3LUZA 2F97A 3B8BA 4XKNA 2OJTA 3DP4A 2PFZA 1B40A 1EZPA 2Z8EA 3K1NA 1LFHA 2DWHA 1POY1 3OO8A 4JVCA 1LSTA 4X04A 3LBSA 3KG2A 3OENA 3D1RA 2Q89A 3QXMA 4MIJA 1SQYA 5B7DA 1NV6A 3IB1A 4BDLA 3TTLA 4RY1A 3THIA 5IZZA 2QSXA 2CZLA 4KXPA 1R9QA 2DWIA 3VV5A 1FQFA 3MUQA 3N5LA 4XTCQ 1DPPA 4H6DA 1SW5A 2V84A 5I2NA 1FBHA 2P3NA 2H9BA 2ZYMA 1H76A 2Z8DA 1FPGA 4O94A 4QBAA 4ELOA 4OTEA 3UN6A 1FPIA 1FTOA 3IOUA 3TCHA 3Q27A 4EXKA 2I0CA 3D4GA 3E9XA 5FHNA 5K2YA 2L5VA 5EYGA 2KQZA 2GHAA 3TMGA 5CMBA 1GVCA 2CEYA 5F7VA 4HE1A 4HE2A 1EZOA 2WBBA 5H8QB 1YTVA 3IOVA 3KN8A 3OOAA 4XEQA 4GXAA 2QS1A 3C34A 1HSLA 4KYEA 1FPFA 5M2VA 2FVZA 1FTAA 3TDJA 4PAKA 3RLFE 3BIGA 4ZZEA 1IZ1A 4XKPA 5ELVA 4WEPA 3Q25A 2Y7IA 3RN8A 3SDFA 3MJNA 3N6UA 1XS5A 3UORA 2B3BA 3OD7A 4TQUQ 4Q5TA 2DQVA 3F11A 1Q1KA 3OSQA 3QAXA 1FJ6A 4NHBA 4H65A 3T9HB 3GYYA 4X8RA 4GWWA 1TT1A 3TCGA 1XT8A 4OESA 3FV2A 2VOZA 2ABHA 4EQ7A 1EH3A 5TPAB 4WKMA 4MHFA 3QMFA 3O9PA 4PGNA 1TXFA 3G3JA 4R74A 5ESYA 5JTYB 5LOMA 4MNCA 4F3SA 4H1XA 2QVUA 1M5FA 1M5DA 3KSXA 1DSNA 2DE4A 5DVIA 5CC2A 1P1OA 3T93B 3MVXA 3O2AA 3JV9A 2FNCA 4NEDA 4NF4A 2XXVA 1P1NA 3K6VA 4Q30B 1DPEA 4I62A 4KCCA 1EU8A 2AIXA 1H3DA 4ZZAA 2QPQA 4U21A 2QS2A 3V89B 2HFBA 4FE8A 4IGRA 2XX8A 5T3JA 2OZZA 1G0IA 2P0SA 4KYSA 2DP8A 3EHUA 1NV5A 1XOCA 4GBVA 4YZZA 1SD3A 3EKIA 5DT6A 3BFUA 4POWA 1OMPA 3KGCA 2XWKA 5H8HB 1J1NA 4KR5A 4GWUA 5IZ3B 1NFTA 1FJ9A 2XXUA 1IXHA 4FEDA 4ZECA 5CI5A 3K4UA 1QKBA 2WYKA 2HCAA 4F18A 2HHMA 1ZMGA 2DS9A 4OWDA 4N6PA 3VE1B 2ALUA 5I56A 4ZE8A 2XXKA 2X7QA 1LB8A 4FEBA 4F3GA 3MBPA 3O28A 1S9TA 1MQJA 3IFCA 1URDA 4NF8A 5L9OA 1US5A 3N6TA 3KN7A 1DCUA 2XA5A 1Z7NE 3MWBA 2RC7A 3KFMA 4OERA 3T66A 5JK4A 4LQ2A 1P99A 4DI4B 3K0VA 3HV1A 3BFTA 3Q26A 4F2OA 3SESA 4G68A 4U4SA 1RYOA 4G68C 4JWXA 4FJPA 4MFIA 3MVWA 4HW8A 3H6UA 1B0LA 1IQ7A 2JJKA 1UIVA 1EYIA 2PCRA 4R2BA 1FW0A 1SBPA 1QULA 4G8MA 2Y7PA 4OFJA 3O29A 3FXQA 1Y3PA 1Y20A 2A5TB 4PFWA 2FYIA 4KFQA 3PMVA 2XD3A 3CG3A 4LUBA 3VDFA 1LLSA 4I8CA 5FHOA 3E4RA 3S2VA 1AOVA 2XX9A 5AA4A 2O51A 4PETA 1FBCA 1QUJA 2V3QA 1IMEA 1NI9A 1LAFE 4P9KA 3UIFA 3T22A 4KYDA 4GX4A 3FATA 3S4UA 3CFZA 2QFLA 2VPOA 1SI1A 1FBPA 3O6HA 3ZKKA 3K2DA 4EQBA 4N8GA 1GGGA 2ONRA 3VVDA 3IFAA 2QJEA 1S50A 2XXWA 2G29A 3GBBA 4QFOA 2PMSA 3OMBA 1A54A 1JQFA 5ITOA 2F6PA 4PC9A 1NNTA 4I3YA 4N8YA 3U94A 2HAVA 1NV1A 3M3LA 3ZS6A 5DVFA 1JW1A 4GWOA 1NUXA 1N84A 3IORA 4OFOA 5L9MA 4QSDA 4LA9A 4C0RA 2DYXA 4DCYA 1JEVA 3SEYA 5KCJB 1AL3A 1POTA 4NTLA 1YXIA 2DE2A 2REGA 2Y7KA 1JW4A 4OVQA 4O7IA 1IMCA 4JWYA 2H25A 3K6XA 2ZXTA 4YKPA 1VE4A 3W15C 3PMXA 5EHMA 3E78A 5I59B 3EHSA 1Q35A 3RGYA 1B5IA 1MS7A 1LEVA 1ZIUA 4YB6A 3PD8A 4FATA 1QW0A 1MY2A 1RDZA 1BIYA 1MXWA 4U4XA 4NQ8A 2P3VA 5H8NA 1LFGA 4LATA 1IUDA 2I4CA 2UVIA 4MF3A 3B6WA 2QRYA 3S9MC 2FIEA 1GR2A 2VP1A 1LBXA 1Y1ZA 3ROJA 1DOTA 3FXRA 3S9EA 1YCJA 4QSCA 4JVIA 2I6EA 4NN3A 1MQGA 4ZEKA 1A7LA 4XF5A 3UGWA 4O8MA 4QFKA 4DZ1A 3FIRA 4YAHX 2RCAA 4PFIA 1SDXA 1IXGA 4MJOA 5I3SA 4GWSA 4OVPA 4NMYA 4LN5A 4N81A 2F7AA 5CM6A 5I2NB 1TWYA 2Y84A 2R71A 2OBGA 4KD5A 3OEKA 4R6YA 2QL3A 2QS4A 4OXVA 3WAEA 2UXAA 3MP1A 1FPDA 4NE4A 3PUXE 1FCKA 4QFNA 2I49A 3H4ZA 1YYZA 1P1WA 2ANJA 3MPLA 2XWIA 3IJOB 4HCYA 3UK4A 4PAIA 4GF8A 2OLBA 2RINA 4PTKA 1WVJA 4OFLA 2O69A 3KBZA 3PMWA 2RCBA 3ZSFA 3A09A 4QFPA 3T9UA 4RNSA 1CNQA 4MLVA 5I7IA 3IB0A 4G8NA 1YZ0A 1Y4TA 2FHYA 2ZYOA 4F1YA 3IB2A 3S9LC 1FTLA 2YJPA 1LBYA 1MY3A 3H3GA 4TOZA 3T9VA 5CRYA 5L8DA 4EF1A 5EYHA 2WBDA 3CSGA 3NOHA 1FQCA 4PF6A 4MBPA 2KLFA 3RY3A 1A8FA 2ZMBA 4MCOA 5CMKA 4PE5B 4Z7EA 1R6ZA 2XXXA 2NOOA 2XXPA 1MM7A 4ND9A 3K02A 2GFEA 3A29A 5F24A 3VVEA 2FIXA 1B2HA 2XX7A 4R75A 2Z23A 5ITPA 1MG1A 5KDTA 4H8JA 4NGUA 2Q2AA 5CMCA 3CI8A 3HSTA 4PDDA 1JNFA 4ESXA 1MM6A 1BKAA 1LBCA 3B7DA 3C32A 2AL4A 4NF4B 3A3UA 2FBPA 2HZKA 3JYRA 1MQIA 4XKQA 2X26A 4N91A 3N94A 1N7WA 3HPIA 4QRZA 1MPBA 1MXVA 3B6QA 3SEVA 4MH5A 5EYFA 3D4CA 4JWOA 3G3HA 3FUZA 2QVRA 3DP6A 2UVJA 3FZVA 1IXCA 1UIUA 3KZGA 2V4CA 1WODA 4GQOA 5I57A 2WYPA 2O7IA 4FECA 1QUIA 1NH7A 5F1QA 4GOTA 1PC3A 2UVHA 1ZBMA 2P1SA 2GHBA 4PF8A 4U2RA 3IR1A 2ZYNA 3IX1A 4NF5A 5J1DA 4EXLA 3CRBA 4ELPA 4LZ5A 3L6HA 1D3KA 1I6QA 3RQTA 5I56B 1LCTA 1LBZA 2UYEA 3CFLA 1LGBC 3A3CA 4THIA 3I5OA 3QK6A 3PTYA 3BKIB 1B4HA 5EHSA 1RYXA 1FQAA 4P11A 2O7UA 3HN0A 4NF8B 4IO7A 3VLVA 4GRKA 3H03A 2G93A 3OO9A 1NV4A 4NF6A 2M8CA 4OHNA 2WKYA 5IKBA 3IOTA 4ZEIA 2ZNTA 4IO5A 1P1QA 4X9TA 3V83A 5EQ9A 4G68B 2DSFA 4C1TA 1HSJA 1Z7ME 3CFXA 4O7MA 1PDAA 2PVUA 2AL5A 2CZHA 1PBQA 2XHDA 5ET6A 4R6HA 1LBWA 2IA4A 4UABA 3IJXB 2XWOA 2ONSA 3MYUA 2Y7WA 1TFDA 2OCUA 5I2KA 1MXYA 5TP9A 4IO2A 1A99A 5FHMA 1FSAA 2XXHA 3VLUA 4PFBA 2ZZXA 3EPEA 1Y1MA 3FVKA 1QVSA 3RTFB 4RYAA 4P47A 5ICQA 1LCFA 1PBPA 3FXBA 1FBEA 5AA4B 3HO7A 2CMOA 3EHTA 4ZE9A 1FQBA 1LBBA 2XWVA 1FRPA 3CSBA 3DM0A 2E1SA 3M8UA 1FTKA 1N04A 4G77A 4YICA 1BK4A 5CBSA 4PFUA 2D3IA 4OETA 4GIZA 4BDRA 3PV0E 4IB2A 1OVTA 3ODBA 1OIBA 1AIVA 3T96B 4H5FA 4O3BA 2BJIA 1IIWA 3JZJA 2YPNA 3TAJA 3LSXA 2I3VA 3W9WA 2NXOA 4RK9A 1GV8A 1FPKA 1DTGA 4YKKA 4HTGA 1NNFA 3KC0A 3CIJA 3MP8A 4Q8RA 2X7PA 2AYSA 1B51A 3IOWA 4PAFA 1OQGA 3FVNA 4PFRA 2ZZVA 4U22A 2B4MA 2HXWA 2DWAA 2PX1A 5H8NB 3CVGA 4HCWA 4OQOA 3C33A 2QS3A 4KPTA 3PPQA 2E0SA 1DBZA 3FVGA 4QF9A 5CMMA 1CB6A 5AA2A 2RF1A 4GXSB 3CR9A 1M5BA 1JW5A 1US4A 3IL1B 3KSJA 3MAMA 4PFYA 1A8EA 1JP4A 5ET8A 4QHQA 4X1DA 5AE4A 3FVOA 1D9VA 3IAZA 4F31B 2I58A 1B0HA 4JBZA 1SW4A 4TLMB 1XI6A 1UTHA 3N26A 4NG7A 2HQ0A 3LSFB 3AXFA 1URSA 3SZPA 4BDNA 4P8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HSE A;  1B7Z A;  1Y3Q A;  3PD9 A;  2XXY A;  4JSD A;  1PEB A;  4GLI A;  4BLA A;  1XVY A;  1O7T A;  2I3W A;  2Z8F A;  1MY1 A;  4LP2 B;  4TLL B;  2RKM A;  3QUF A;  3S9N C;  4POX A;  1T0K A;  4IO4 A;  5B70 A;  4PFT A;  4UA8 A;  3Q29 A;  2DVZ A;  3Q28 A;  2UVG A;  1Y4C A;  4FIM A;  2O68 A;  4AB6 A;  1S7Y A;  1ZU0 A;  4MLQ A;  4M4G A;  3PPO A;  5I5P A;  3UP9 A;  3QIM A;  3U8Q A;  3MZB A;  1Y3N A;  1ELJ A;  5H8F A;  3FV1 A;  4LVQ A;  5I84 A;  1ZKB A;  3GZG A;  4OVT A;  5DYH A;  4RK2 A;  3U72 A;  5HPQ A;  1PB7 A;  4YMA A;  1TFA A;  2VD3 A;  3H7M A;  1MDQ A;  4IY5 A;  1JVY A;  4OEN A;  3W9V A;  4X1B A;  3PPP A;  4ESW A;  3O97 A;  1H43 A;  3LSW A;  1MH4 A;  2PT1 A;  4OMB A;  5A5X A;  3RT8 A;  1IEJ A;  3R6U A;  4ELQ A;  3KJ7 A;  5TU0 A;  1ATG A;  4AQ4 A;  3PUZ E;  3PGF A;  1BLF A;  2BJJ X;  4OEV A;  1OLA A;  2V3U A;  5KDT B;  1EZ9 A;  2O84 X;  2F36 A;  2XD2 A;  3VFJ A;  3MQ9 A;  3O6I A;  3LC8 A;  3MC2 A;  5L9S A;  3SET A;  4JSO A;  4BDM A;  1N7X A;  1IXI A;  3E3K A;  3MP6 A;  4PE3 A;  3RPW A;  4PCD A;  5ISU A;  4RA1 A;  4YU0 A;  2ONK E;  4PP0 A;  4U23 A;  3ILT B;  1SI0 A;  4ZEF A;  3B50 A;  1QKA A;  5DEX A;  4F3B A;  4R2F A;  4G8H A;  1UTB A;  5I57 B;  3DEL B;  5FTI A;  5H8S A;  3BBR A;  3GBA A;  1O63 A;  4KCD A;  3GLB A;  3MW0 A;  3KOS A;  2OWT A;  2XXQ A;  2XXT A;  2QMW A;  3TEP A;  4NF5 B;  3RUM A;  3MVZ A;  4EDP A;  1CE2 A;  4JDF A;  4R73 A;  4F19 A;  2GH9 A;  2V93 A;  2IEE A;  3RT6 B;  1M5C A;  4WXJ A;  1L5T A;  4F2Q A;  3TOD A;  4DLD A;  3R7X A;  3PUW E;  3PUV E;  3KEI A;  4N6K A;  1ANF A;  1YPN A;  3O6G A;  3SER A;  2FA7 A;  4PDH A;  5LTC A;  4NF6 B;  3K6W A;  4PBQ A;  2F78 A;  4NWD A;  4XXU A;  2O1L A;  1XVX A;  3U92 A;  3TUS A;  2PYY A;  1NH8 A;  2CEX A;  4N6D A;  1LAX A;  3L6G A;  4AB5 A;  1D9Y A;  4OA4 A;  2OWS A;  4YKI A;  3MVY A;  4KI0 E;  2Q8J A;  4XIG Q;  1B9J A;  4N15 A;  1B3H A;  5IGA A;  3K1P A;  1F9B A;  3G3I A;  1B3E A;  4U1O A;  5I2K B;  4IO6 A;  1B32 A;  1ZLQ A;  3O66 A;  1P1U A;  2B3F A;  2W7Y A;  5TP9 B;  3R26 A;  4OEU A;  4NX1 A;  1B3G A;  4I1D A;  4OYV A;  3H6V A;  4ONY A;  4N17 A;  3MZ1 A;  1JEU A;  2ZNS A;  3OEM A;  4H67 A;  4DXB A;  1MPC A;  4QFL A;  4P0G A;  5I58 A;  2O1M A;  1IIT A;  1BTJ A;  3FJ7 A;  3UA8 A;  4YB5 A;  4XKR A;  2YLN A;  2DWJ A;  2VPN A;  1KWH A;  3GXA A;  4HS7 A;  3U1O A;  1YAE A;  4OVS A;  4R6K A;  2ZNU A;  1N76 A;  4G2Z A;  4DI3 D;  4FAJ A;  1WDN A;  1M5E A;  4F1U A;  4DCX A;  4P56 A;  3OO6 A;  2H5Y A;  3EF7 A;  3PU5 A;  5BUU A;  1LFI A;  1MQH A;  4F3P A;  1RKM A;  4UAC A;  1B5H A;  4X48 A;  2H4I A;  4JB7 A;  3EN3 A;  3G7W A;  1MPD A;  4PQJ A;  3TTR A;  3DP8 A;  2HZL A;  2DOJ A;  2Y7R A;  1JET A;  3FJM A;  1I69 A;  4MAG A;  3LSL A;  2ZZW A;  3P7I A;  3VXC A;  3TPA A;  1B5J A;  1B3F A;  2DXR A;  2DE3 A;  4H8I A;  1URG A;  2D21 A;  2PFY A;  4OVJ A;  4GL8 A;  2THI A;  4ZS9 A;  1B7U A;  4KHZ E;  1NKX A;  4MMP A;  2H98 A;  5AA2 B;  2QMX A;  1MQD A;  1R9L A;  1B4Z A;  4MNI A;  3CG1 A;  3VVF A;  4OZ9 A;  2PT2 A;  4L17 A;  4ZEB A;  1GTK A;  3PUY E;  1B1H A;  3OXN A;  3V8X B;  4RPN A;  4YMB A;  5HBC A;  2F34 A;  1UTH B;  3HHF A;  4E0X A;  5ICT A;  4WED A;  4YKJ A;  3TEL A;  3QYT A;  3DLN A;  5AA2 D;  1H44 A;  2P2A A;  2RC8 A;  5HM4 B;  1OVB A;  3SEW A;  3TQW A;  4H5G A;  5H8Q A;  1UQW A;  1SW1 A;  3EQ1 A;  4LON B;  4LZ7 A;  5AA3 A;  3K6U A;  3HHG A;  4IY6 A;  3FD3 A;  3LR1 A;  2NUV A;  4F22 A;  5KZT A;  2RC9 A;  3PPN A;  2LAO A;  4NWC A;  1ZTY A;  2R9J A;  4PBH A;  3HCQ A;  1B7H A;  2HPG A;  1FTJ A;  3K00 A;  2B65 A;  4GFR A;  4E0W A;  4NAP A;  2DVC A;  3H06 B;  1FQD A;  2UYF A;  3RNN A;  5H8F B;  2H99 A;  1VR5 A;  3USD A;  1A40 A;  1SYI A;  4F1V A;  3MPK A;  5IM2 A;  5TPA A;  1B58 A;  4EF2 A;  1O64 A;  1FQE A;  5FTH A;  4YB7 A;  4R9F A;  2D5W A;  5JTY A;  1MY4 A;  2XXI A;  4R72 A;  2A5S A;  3C9H A;  1A55 A;  2VD2 A;  4ISU A;  3B6T A;  5A5X B;  1SW2 A;  2Q88 A;  5BWJ A;  2I0B A;  4P0I A;  2Q2C A;  4QSE A;  1NNP A;  2GRV A;  4I9D A;  4U1Z A;  4F29 A;  3TTN A;  1USY E;  4IGT A;  2ZYK A;  1AH5 A;  3SEU A;  3FAS A;  3E13 X;  4Q0C A;  3K01 A;  4MNP A;  3K1M A;  5JEI A;  2HAU A;  4MEV A;  3FXU A;  4LZ8 A;  1B46 A;  1R1N A;  2Z22 A;  4DXU A;  2XXR A;  3ONM A;  1JVX A;  1MDP 1;  4MX6 A;  2HEU A;  4DE8 A;  5H8H A;  1LB9 A;  1PB9 A;  1ZJL A;  3KOT A;  2OK2 A;  1II5 A;  5DTB A;  1B52 A;  4GD5 A;  5DEX B;  3IO4 A;  3U65 A;  1XC1 A;  1I6B A;  4BDO A;  1UTB B;  3TQL A;  2F6G A;  3ECR A;  3C36 A;  3I3V A;  1PB8 A;  3C4M A;  1MH3 A;  4NF0 A;  3M3F A;  5K2X A;  1I6A A;  5AA1 A;  3RTW B;  2Q9T A;  1OLC A;  3TZA A;  3OO7 A;  4IO3 A;  4OVR A;  4R9G A;  1B6H A;  2F7B A;  1OQH A;  3MZ9 A;  3TTM A;  2PBW A;  3OEL A;  4ZDM A;  3TTK A;  3KBR A;  3U93 A;  1N3X A;  3IK6 B;  4K3F A;  3VXB A;  3G3F A;  3H6W A;  5IAI A;  4ECF A;  4RXL A;  1VFE A;  4RPO A;  1SVX B;  3I6V A;  3TFL A;  1DTZ A;  1B3L A;  4N4U A;  1VFD A;  1FTM A;  1B1X A;  3ZKL A;  2R6G E;  1N0T A;  1DMB A;  2ESN A;  3H6T A;  3KJT A;  4XFE A;  4RJZ A;  2V3T A;  4P3L A;  2A5T A;  1XHY A;  3FGS A;  3WAF A;  3TKD A;  3ILU B;  3TCF A;  3M3K A;  1USY H;  4EUO A;  3C31 A;  4G4P A;  3G3G A;  2O6A A;  1NNK A;  4KQP A;  3OSR A;  1VSO A;  4DXC A;  4PGP A;  3FJG A;  3PPR A;  4H0W A;  1QJM A;  2V25 A;  4GVO A;  3T9X B;  3SKP A;  5DVJ A;  1H45 A;  4N07 A;  4N13 A;  4JXI A;  4O3C A;  3IO6 A;  4M1V A;  5I58 B;  1LAG E;  3LUY A;  3SEX A;  1SYH A;  4ZED A;  4FOR A;  2I4B A;  5CBR A;  1LAH E;  2F35 A;  1NL5 A;  4GL0 A;  4Z0I A;  1D4N A;  2NWJ A;  2F5X A;  1NMU A;  4DDD A;  1MXX A;  1B05 A;  2WX9 A;  1QUK A;  4DIG A;  4O3A A;  3VLW A;  3G3K A;  1MY0 A;  2I48 A;  1N3W A;  4F39 A;  3QUJ A;  5KCJ A;  3TYH A;  2F8D A;  4BDQ A;  3V5A A;  2DXY A;  1AMF A;  2REJ A;  4LQ5 A;  4P1E A;  2NVU B;  1BP5 A;  1MXU A;  4ELR A;  5I59 A;  4P1L A;  2VGQ A;  1MXZ A;  2VHA A;  4EQ9 A;  1Y9U A;  4C1U A;  4OAN A;  3C35 A;  2F7C A;  1MRP A;  3QSL A;  3KN3 A;  2F97 A;  4XKN A;  2OJT A;  3DP4 A;  2PFZ A;  1B40 A;  1EZP A;  2Z8E A;  3K1N A;  1LFH A;  2DWH A;  1POY 1;  3OO8 A;  1LST A;  4X04 A;  3LBS A;  3KG2 A;  3OEN A;  2Q89 A;  3QXM A;  4MIJ A;  1SQY A;  5B7D A;  3IB1 A;  4BDL A;  3TTL A;  4RY1 A;  3THI A;  5IZZ A;  2QSX A;  2CZL A;  1R9Q A;  2DWI A;  3VV5 A;  1FQF A;  3MUQ A;  3N5L A;  4XTC Q;  1DPP A;  4H6D A;  1SW5 A;  2V84 A;  5I2N A;  2H9B A;  2ZYM A;  1H76 A;  2Z8D A;  4O94 A;  4ELO A;  4OTE A;  3UN6 A;  1FTO A;  3IOU A;  3TCH A;  3Q27 A;  4EXK A;  2I0C A;  3D4G A;  3E9X A;  5FHN A;  5K2Y A;  2GHA A;  3TMG A;  5CMB A;  1GVC A;  2CEY A;  5F7V A;  1EZO A;  5H8Q B;  1YTV A;  3IOV A;  3KN8 A;  3OOA A;  4XEQ A;  4GXA A;  2QS1 A;  3C34 A;  1HSL A;  4KYE A;  5M2V A;  4PAK A;  3TDJ A;  3RLF E;  4ZZE A;  1IZ1 A;  4XKP A;  5ELV A;  4WEP A;  3Q25 A;  2Y7I A;  3RN8 A;  3SDF A;  3MJN A;  3N6U A;  1XS5 A;  3UOR A;  2B3B A;  3OD7 A;  4TQU Q;  4Q5T A;  2DQV A;  3F11 A;  1Q1K A;  3OSQ A;  3QAX A;  4NHB A;  4H65 A;  3T9H B;  3GYY A;  4X8R A;  1TT1 A;  3TCG A;  1XT8 A;  4OES A;  3FV2 A;  2VOZ A;  2ABH A;  4EQ7 A;  1EH3 A;  5TPA B;  4WKM A;  4MHF A;  3O9P A;  4PGN A;  1TXF A;  3G3J A;  4R74 A;  5JTY B;  5LOM A;  4MNC A;  4F3S A;  4H1X A;  1M5F A;  1M5D A;  3KSX A;  1DSN A;  2DE4 A;  5DVI A;  5CC2 A;  1P1O A;  3T93 B;  3MVX A;  3O2A A;  3JV9 A;  2FNC A;  4NED A;  4NF4 A;  2XXV A;  1P1N A;  3K6V A;  4Q30 B;  1DPE A;  4I62 A;  4KCC A;  1EU8 A;  2AIX A;  1H3D A;  4ZZA A;  2QPQ A;  4U21 A;  2QS2 A;  3V89 B;  2HFB A;  4FE8 A;  4IGR A;  2XX8 A;  2OZZ A;  2P0S A;  4KYS A;  2DP8 A;  3EHU A;  1XOC A;  4YZZ A;  1SD3 A;  5DT6 A;  3BFU A;  4POW A;  1OMP A;  3KGC A;  2XWK A;  5H8H B;  1J1N A;  4KR5 A;  1NFT A;  2XXU A;  1IXH A;  4FED A;  4ZEC A;  5CI5 A;  3K4U A;  1QKB A;  2WYK A;  2HCA A;  4F18 A;  1ZMG A;  2DS9 A;  4OWD A;  4N6P A;  3VE1 B;  2ALU A;  5I56 A;  4ZE8 A;  2XXK A;  2X7Q A;  1LB8 A;  4FEB A;  4F3G A;  3MBP A;  3O28 A;  1S9T A;  1MQJ A;  1URD A;  4NF8 A;  5L9O A;  1US5 A;  3N6T A;  3KN7 A;  2XA5 A;  1Z7N E;  3MWB A;  2RC7 A;  3KFM A;  4OER A;  3T66 A;  5JK4 A;  4LQ2 A;  1P99 A;  4DI4 B;  3K0V A;  3HV1 A;  3BFT A;  3Q26 A;  4F2O A;  3SES A;  4G68 A;  4U4S A;  1RYO A;  4G68 C;  4JWX A;  4FJP A;  4MFI A;  3MVW A;  4HW8 A;  3H6U A;  1B0L A;  1IQ7 A;  1UIV A;  4R2B A;  1FW0 A;  1SBP A;  1QUL A;  4G8M A;  2Y7P A;  4OFJ A;  3O29 A;  3FXQ A;  1Y3P A;  1Y20 A;  2A5T B;  4PFW A;  2FYI A;  4KFQ A;  3PMV A;  2XD3 A;  3CG3 A;  4LUB A;  3VDF A;  1LLS A;  4I8C A;  5FHO A;  3E4R A;  3S2V A;  1AOV A;  2XX9 A;  5AA4 A;  2O51 A;  4PET A;  1QUJ A;  2V3Q A;  1LAF E;  4P9K A;  3UIF A;  3T22 A;  4KYD A;  3FAT A;  3S4U A;  3CFZ A;  2VPO A;  1SI1 A;  3O6H A;  3ZKK A;  3K2D A;  4EQB A;  4N8G A;  1GGG A;  2ONR A;  3VVD A;  2QJE A;  1S50 A;  2XXW A;  2G29 A;  3GBB A;  4QFO A;  2PMS A;  3OMB A;  1A54 A;  1JQF A;  5ITO A;  2F6P A;  4PC9 A;  1NNT A;  4N8Y A;  3U94 A;  2HAV A;  3M3L A;  3ZS6 A;  5DVF A;  1JW1 A;  4GWO A;  1N84 A;  3IOR A;  4OFO A;  5L9M A;  4QSD A;  4LA9 A;  4C0R A;  2DYX A;  4DCY A;  1JEV A;  3SEY A;  5KCJ B;  1AL3 A;  1POT A;  4NTL A;  2DE2 A;  2REG A;  2Y7K A;  1JW4 A;  4OVQ A;  4JWY A;  2H25 A;  3K6X A;  2ZXT A;  4YKP A;  1VE4 A;  3W15 C;  3PMX A;  5EHM A;  5I59 B;  3EHS A;  1Q35 A;  3RGY A;  1B5I A;  1MS7 A;  1ZIU A;  4YB6 A;  3PD8 A;  4FAT A;  1QW0 A;  1MY2 A;  1BIY A;  1MXW A;  4U4X A;  4NQ8 A;  5H8N A;  1LFG A;  4LAT A;  1IUD A;  2I4C A;  2UVI A;  4MF3 A;  3B6W A;  2QRY A;  3S9M C;  1GR2 A;  2VP1 A;  1Y1Z A;  1DOT A;  3FXR A;  3S9E A;  1YCJ A;  4QSC A;  2I6E A;  4NN3 A;  1MQG A;  4ZEK A;  1A7L A;  4XF5 A;  3UGW A;  4O8M A;  4QFK A;  4DZ1 A;  3FIR A;  4YAH X;  2RCA A;  4PFI A;  1SDX A;  1IXG A;  4OVP A;  4NMY A;  4LN5 A;  2F7A A;  5CM6 A;  5I2N B;  1TWY A;  2Y84 A;  2R71 A;  2OBG A;  4KD5 A;  3OEK A;  4R6Y A;  2QL3 A;  2QS4 A;  4OXV A;  3WAE A;  2UXA A;  3MP1 A;  4NE4 A;  3PUX E;  1FCK A;  4QFN A;  2I49 A;  3H4Z A;  1P1W A;  2ANJ A;  3MPL A;  2XWI A;  3IJO B;  4HCY A;  3UK4 A;  4PAI A;  4GF8 A;  2OLB A;  2RIN A;  1WVJ A;  4OFL A;  2O69 A;  3PMW A;  2RCB A;  3ZSF A;  3A09 A;  4QFP A;  3T9U A;  4RNS A;  4MLV A;  5I7I A;  3IB0 A;  4G8N A;  1Y4T A;  2ZYO A;  4F1Y A;  3IB2 A;  3S9L C;  1FTL A;  2YJP A;  1MY3 A;  3H3G A;  4TOZ A;  3T9V A;  5CRY A;  5L8D A;  4EF1 A;  3CSG A;  1FQC A;  4PF6 A;  4MBP A;  2KLF A;  3RY3 A;  1A8F A;  2ZMB A;  4MCO A;  5CMK A;  4PE5 B;  4Z7E A;  1R6Z A;  2XXX A;  2NOO A;  2XXP A;  1MM7 A;  4ND9 A;  3K02 A;  2GFE A;  3VVE A;  1B2H A;  2XX7 A;  4R75 A;  2Z23 A;  5ITP A;  1MG1 A;  5KDT A;  4H8J A;  4NGU A;  2Q2A A;  5CMC A;  3CI8 A;  3HST A;  4PDD A;  1JNF A;  4ESX A;  1MM6 A;  1BKA A;  1LBC A;  3B7D A;  3C32 A;  2AL4 A;  4NF4 B;  3A3U A;  2HZK A;  3JYR A;  1MQI A;  4XKQ A;  2X26 A;  4N91 A;  3N94 A;  1N7W A;  3HPI A;  4QRZ A;  1MPB A;  1MXV A;  3B6Q A;  3SEV A;  4MH5 A;  5EYF A;  3D4C A;  4JWO A;  3G3H A;  3FUZ A;  3DP6 A;  2UVJ A;  3FZV A;  1IXC A;  1UIU A;  3KZG A;  2V4C A;  1WOD A;  4GQO A;  5I57 A;  2WYP A;  2O7I A;  4FEC A;  1QUI A;  1NH7 A;  5F1Q A;  4GOT A;  1PC3 A;  2UVH A;  1ZBM A;  2P1S A;  2GHB A;  4PF8 A;  4U2R A;  3IR1 A;  2ZYN A;  3IX1 A;  4NF5 A;  5J1D A;  4EXL A;  3CRB A;  4ELP A;  4LZ5 A;  3L6H A;  1D3K A;  1I6Q A;  3RQT A;  5I56 B;  1LCT A;  2UYE A;  3CFL A;  1LGB C;  3A3C A;  4THI A;  3I5O A;  3QK6 A;  3BKI B;  1B4H A;  5EHS A;  1RYX A;  1FQA A;  4P11 A;  2O7U A;  3HN0 A;  4NF8 B;  4IO7 A;  3VLV A;  4GRK A;  3H03 A;  2G93 A;  3OO9 A;  4NF6 A;  2M8C A;  4OHN A;  2WKY A;  5IKB A;  3IOT A;  4ZEI A;  2ZNT A;  4IO5 A;  1P1Q A;  4X9T A;  3V83 A;  4G68 B;  2DSF A;  4C1T A;  1HSJ A;  1Z7M E;  3CFX A;  4O7M A;  1PDA A;  2PVU A;  2AL5 A;  1PBQ A;  2XHD A;  4R6H A;  4UAB A;  2IA4 A;  3IJX B;  2XWO A;  2ONS A;  2Y7W A;  1TFD A;  2OCU A;  5I2K A;  1MXY A;  5TP9 A;  4IO2 A;  1A99 A;  5FHM A;  2XXH A;  3VLU A;  4PFB A;  2ZZX A;  3EPE A;  1Y1M A;  3FVK A;  1QVS A;  3RTF B;  4RYA A;  4P47 A;  5ICQ A;  1LCF A;  1PBP A;  3FXB A;  5AA4 B;  3HO7 A;  2CMO A;  3EHT A;  4ZE9 A;  1FQB A;  1LBB A;  2XWV A;  3CSB A;  3DM0 A;  2E1S A;  3M8U A;  1FTK A;  1N04 A;  4G77 A;  4YIC A;  5CBS A;  4PFU A;  2D3I A;  4OET A;  4GIZ A;  4BDR A;  3PV0 E;  4IB2 A;  1OVT A;  3ODB A;  1OIB A;  1AIV A;  3T96 B;  4H5F A;  4O3B A;  1IIW A;  3JZJ A;  2YPN A;  3TAJ A;  3LSX A;  2I3V A;  3W9W A;  2NXO A;  4RK9 A;  1GV8 A;  1DTG A;  4YKK A;  4HTG A;  1NNF A;  3CIJ A;  3MP8 A;  4Q8R A;  2X7P A;  2AYS A;  1B51 A;  3IOW A;  4PAF A;  1OQG A;  3FVN A;  4PFR A;  2ZZV A;  4U22 A;  2HXW A;  2DWA A;  2PX1 A;  5H8N B;  3CVG A;  4HCW A;  4OQO A;  3C33 A;  2QS3 A;  4KPT A;  3PPQ A;  2E0S A;  3FVG A;  4QF9 A;  5CMM A;  1CB6 A;  5AA2 A;  2RF1 A;  4GXS B;  3CR9 A;  1M5B A;  1JW5 A;  1US4 A;  3IL1 B;  3KSJ A;  3MAM A;  4PFY A;  1A8E A;  4QHQ A;  4X1D A;  5AE4 A;  3FVO A;  1D9V A;  3IAZ A;  4F31 B;  2I58 A;  1B0H A;  4JBZ A;  1SW4 A;  4TLM B;  1UTH A;  3N26 A;  4NG7 A;  2HQ0 A;  3LSF B;  3AXF A;  1URS A;  4BDN A;  4P8B A; 
#chains in the Genus database with same CATH topology
 1HSE A;  1B7Z A;  1Y3Q A;  3PD9 A;  1KA0 A;  2XXY A;  1INP A;  4JSD A;  1PEB A;  4GLI A;  4BLA A;  1XVY A;  1O7T A;  2I3W A;  2Z8F A;  1MY1 A;  4LP2 B;  4TLL B;  2RKM A;  3QUF A;  3S9N C;  4H45 A;  4POX A;  1T0K A;  4IO4 A;  1IMA A;  5B70 A;  1G0H A;  4PFT A;  1RDX A;  4UA8 A;  3Q29 A;  2DVZ A;  3Q28 A;  2UVG A;  1Y4C A;  4FIM A;  2O68 A;  5EQ7 A;  4AB6 A;  1S7Y A;  1ZU0 A;  5ET5 A;  4MLQ A;  4M4G A;  3PPO A;  5I5P A;  3UP9 A;  3QIM A;  3U8Q A;  3MZB A;  1Y3N A;  1ELJ A;  5H8F A;  3FV1 A;  4LVQ A;  5I84 A;  1ZKB A;  3GZG A;  4OVT A;  5DYH A;  4RK2 A;  3U72 A;  5HPQ A;  1PB7 A;  4YMA A;  1TFA A;  2VD3 A;  3H7M A;  1MDQ A;  4IY5 A;  1JVY A;  4OEN A;  3W9V A;  4X1B A;  3PPP A;  4ESW A;  3O97 A;  1H43 A;  3LSW A;  1MH4 A;  2PT1 A;  5DW8 A;  4OMB A;  5A5X A;  2QVV A;  5ET7 A;  3RT8 A;  1IEJ A;  3R6U A;  4ELQ A;  3KJ7 A;  5TU0 A;  1ATG A;  4AQ4 A;  1FPE A;  3PUZ E;  3PGF A;  1BLF A;  2BJJ X;  4OEV A;  1OLA A;  2V3U A;  5KDT B;  1FPL A;  1EZ9 A;  2O84 X;  2F36 A;  2XD2 A;  4GWZ A;  3VFJ A;  3MQ9 A;  3O6I A;  1NV3 A;  3LC8 A;  3MC2 A;  5L9S A;  3SET A;  4JSO A;  4BDM A;  1N7X A;  1IXI A;  3MST A;  3E3K A;  3MP6 A;  1FBF A;  4PE3 A;  3RPW A;  4PCD A;  5ISU A;  4RA1 A;  4YU0 A;  2ONK E;  2Y5L A;  4PP0 A;  4U23 A;  3ILT B;  1SI0 A;  4ZEF A;  3B50 A;  1QKA A;  5DEX A;  4F3B A;  1IMF A;  4R2F A;  4G8H A;  1UTB A;  5I57 B;  3DEL B;  5FTI A;  5H8S A;  3BBR A;  3GBA A;  1O63 A;  4KCD A;  3GLB A;  3MW0 A;  3KOS A;  3ISP A;  2OWT A;  2XXQ A;  2XXT A;  2QMW A;  3TEP A;  4NF5 B;  3RUM A;  3MVZ A;  4EDP A;  1CE2 A;  3FBP A;  4JDF A;  4R73 A;  1FPJ A;  4F19 A;  2GH9 A;  2V93 A;  2IEE A;  2WEF A;  3RT6 B;  1M5C A;  4WXJ A;  1L5T A;  4F2Q A;  3TOD A;  4DLD A;  3R7X A;  3PUW E;  3PUV E;  3KEI A;  4N6K A;  1ANF A;  1YPN A;  3O6G A;  3SER A;  2FA7 A;  4PDH A;  5LTC A;  4NF6 B;  3K6W A;  4PBQ A;  2F78 A;  4NWD A;  4XXU A;  2O1L A;  1XVX A;  4IR8 A;  1FBG A;  3U92 A;  3TUS A;  4G61 A;  2PYY A;  2CZI A;  1NH8 A;  2CEX A;  4N6D A;  1LAX A;  3L6G A;  4AB5 A;  1D9Y A;  1NUY A;  4OA4 A;  4I40 A;  2OWS A;  4YKI A;  3MVY A;  4KI0 E;  2Q8J A;  4XIG Q;  3T0J A;  1B9J A;  4N15 A;  1B3H A;  5IGA A;  3K1P A;  1F9B A;  3G3I A;  1B3E A;  4U1O A;  5I2K B;  4IO6 A;  2F3D A;  1B32 A;  1ZLQ A;  3O66 A;  1P1U A;  2B3F A;  2W7Y A;  5TP9 B;  3R26 A;  4OEU A;  4NX1 A;  1Q9D A;  1B3G A;  4I1D A;  4OYV A;  3H6V A;  5LDZ A;  4ONY A;  4N17 A;  3MZ1 A;  1JEU A;  2ZNS A;  3OEM A;  4H67 A;  4DXB A;  1MPC A;  4QFL A;  1IMB A;  4P0G A;  5I58 A;  2O1M A;  5A5L A;  1IIT A;  1BTJ A;  3FJ7 A;  3UA8 A;  3RPL A;  4YB5 A;  4XKR A;  2YLN A;  2DWJ A;  2VPN A;  1KWH A;  3GXA A;  2Y5K A;  2HXR A;  4HS7 A;  3U1O A;  1YAE A;  4OVS A;  4R6K A;  2ZNU A;  1N76 A;  4G2Z A;  4DI3 D;  4FAJ A;  1WDN A;  1M5E A;  4F1U A;  4DCX A;  4P56 A;  3OO6 A;  1KZ8 A;  2H5Y A;  3EF7 A;  3PU5 A;  5BUU A;  1LFI A;  1MQH A;  4F3P A;  1RKM A;  4UAC A;  4HE0 A;  1B5H A;  4X48 A;  2H4I A;  4JB7 A;  3EN3 A;  3G7W A;  1MPD A;  4PQJ A;  3TTR A;  3DP8 A;  2HZL A;  2DOJ A;  2Y7R A;  2GQ1 A;  1JET A;  3FJM A;  1I69 A;  4MAG A;  3LSL A;  2ZZW A;  3P7I A;  3VXC A;  3TPA A;  1B5J A;  1B3F A;  2DXR A;  2DE3 A;  2VT5 A;  4H8I A;  1URG A;  2D21 A;  2PFY A;  1NV7 A;  4OVJ A;  4GL8 A;  2THI A;  4ZS9 A;  1B7U A;  1VDW A;  4KHZ E;  1NKX A;  4MMP A;  2H98 A;  4GX6 A;  2QMX A;  5AA2 B;  1MQD A;  1R9L A;  1B4Z A;  4MNI A;  3CG1 A;  3VVF A;  4OZ9 A;  2PT2 A;  4L17 A;  1LBV A;  4ZEB A;  1GTK A;  1KA1 A;  3PUY E;  3LV0 A;  1B1H A;  3OXN A;  3V8X B;  1NUZ A;  4RPN A;  4YMB A;  5IZ1 A;  5HBC A;  1IMD A;  2F34 A;  1UTH B;  1AWB A;  3HHF A;  4E0X A;  1NV0 A;  5ICT A;  4WED A;  4YKJ A;  3TEL A;  3QYT A;  2R8T A;  3DLN A;  5AA2 D;  1H44 A;  2P2A A;  2RC8 A;  5HM4 B;  1OVB A;  3SEW A;  3TQW A;  4H5G A;  2MKZ A;  5EQA A;  5H8Q A;  1UQW A;  1SW1 A;  3EQ1 A;  4LON B;  4LZ7 A;  5AA3 A;  3K6U A;  3HHG A;  4IY6 A;  3FD3 A;  3LR1 A;  2NUV A;  4F22 A;  5KZT A;  2RC9 A;  3PPN A;  2LAO A;  4NWC A;  1ZTY A;  2R9J A;  4FBP A;  3HCQ A;  4PBH A;  1FBD A;  1B7H A;  2HPG A;  1FTJ A;  3K00 A;  2B65 A;  4GFR A;  4E0W A;  4AS5 A;  4JVD A;  4NAP A;  2DVC A;  3H06 B;  4QXD A;  1FQD A;  2UYF A;  3RNN A;  5H8F B;  1SPI A;  2H99 A;  1NUW A;  1VR5 A;  3USD A;  1A40 A;  1SYI A;  4F1V A;  3MPK A;  5IM2 A;  5TPA A;  1B58 A;  4EF2 A;  1O64 A;  1FQE A;  5FTH A;  4YB7 A;  1EYK A;  4R9F A;  2D5W A;  5JTY A;  2CZK A;  1MY4 A;  2XXI A;  4R72 A;  2A5S A;  3C9H A;  1A55 A;  2VD2 A;  4ISU A;  3B6T A;  5A5X B;  1SW2 A;  2Q88 A;  5BWJ A;  2I0B A;  4P0I A;  2Q2C A;  4QSE A;  1NNP A;  2GRV A;  4I9D A;  4U1Z A;  4F29 A;  3TTN A;  1USY E;  4IGT A;  2ZYK A;  1AH5 A;  3SEU A;  3FAS A;  3E13 X;  4Q0C A;  3K01 A;  4HXV A;  4MNP A;  3K1M A;  5JEI A;  2HAU A;  4MEV A;  4GWX A;  3FXU A;  4LZ8 A;  1B46 A;  1R1N A;  2Z22 A;  4DXU A;  2XXR A;  3ONM A;  1JVX A;  1MDP 1;  4MX6 A;  2HEU A;  4DE8 A;  2DDK A;  5H8H A;  3HFU A;  1LB9 A;  1PB9 A;  1ZJL A;  3KOT A;  2OK2 A;  5IZ3 A;  1K9Z A;  1II5 A;  5DTB A;  1B52 A;  4GD5 A;  5DEX B;  3IO4 A;  1K9Y A;  3U65 A;  1XC1 A;  1I6B A;  4BDO A;  1UTB B;  3TQL A;  2F6G A;  3ECR A;  3C36 A;  3I3V A;  3CHG A;  1PB8 A;  2B4L A;  3C4M A;  3KC1 A;  1MH3 A;  4NF0 A;  3M3F A;  5K2X A;  1I6A A;  5AA1 A;  2Q74 A;  3RYD A;  3RTW B;  2Q9T A;  1OLC A;  3TZA A;  3OO7 A;  4IO3 A;  4OVR A;  4R9G A;  1RDY A;  1B6H A;  2F7B A;  1OQH A;  3MZ9 A;  3TTM A;  2PBW A;  3OEL A;  4ZDM A;  3TTK A;  3T1B A;  3KBR A;  3U93 A;  1N3X A;  3IK6 B;  4K3F A;  3VXB A;  3G3F A;  3H6W A;  1QGX A;  5IAI A;  4ECF A;  4RXL A;  1VFE A;  1FPB A;  4RPO A;  1SVX B;  3I6V A;  3TFL A;  5EQ8 A;  1DTZ A;  1B3L A;  4N4U A;  1VFD A;  1FTM A;  3BIH A;  1B1X A;  3ZKL A;  4AS4 A;  2R6G E;  1N0T A;  1DMB A;  2ESN A;  3H6T A;  3KJT A;  4XFE A;  2Q8M A;  4RJZ A;  2V3T A;  4P3L A;  2A5T A;  1XHY A;  3FGS A;  3WAF A;  3TKD A;  3ILU B;  3TCF A;  3M3K A;  1USY H;  4EUO A;  3C31 A;  4G4P A;  3G3G A;  2O6A A;  1NNK A;  5FBP A;  3E79 A;  4KQP A;  1EYJ A;  3OSR A;  1VSO A;  4DXC A;  4PGP A;  3FJG A;  3PPR A;  4H0W A;  1QJM A;  2V25 A;  4GVO A;  3T9X B;  3SKP A;  2KR0 A;  5DVJ A;  1H45 A;  4N07 A;  2OWZ A;  4N13 A;  1NV2 A;  2OX3 A;  4H46 A;  1D9Q A;  4JXI A;  4O3C A;  3IO6 A;  2F3B A;  4M1V A;  5I58 B;  1LAG E;  3RPL B;  3LUY A;  3SEX A;  1SYH A;  4ZED A;  4FOR A;  2I4B A;  4GBW A;  5CBR A;  1LAH E;  2F35 A;  1NL5 A;  4GL0 A;  4Z0I A;  1D4N A;  2NWJ A;  2F5X A;  1NMU A;  4DDD A;  1MXX A;  1B05 A;  2WX9 A;  1QUK A;  4GWY A;  4DIG A;  4O3A A;  3VLW A;  3G3K A;  1MY0 A;  2I48 A;  1N3W A;  4F39 A;  3QUJ A;  5J16 A;  5KCJ A;  3TYH A;  2F8D A;  4BDQ A;  3V5A A;  2DXY A;  1AMF A;  2REJ A;  4LQ5 A;  4P1E A;  2NVU B;  1BP5 A;  1MXU A;  4I3E A;  4P1L A;  4ELR A;  5I59 A;  2VGQ A;  1MXZ A;  2VHA A;  4EQ9 A;  1Y9U A;  4GX3 A;  4OAN A;  4C1U A;  3C35 A;  2F7C A;  1MRP A;  3QSL A;  1DK4 A;  3KN3 A;  3LUZ A;  2F97 A;  3B8B A;  4XKN A;  2OJT A;  3DP4 A;  2PFZ A;  1B40 A;  1EZP A;  2Z8E A;  3K1N A;  1LFH A;  2DWH A;  1POY 1;  3OO8 A;  4JVC A;  1LST A;  4X04 A;  3LBS A;  3KG2 A;  3OEN A;  3D1R A;  2Q89 A;  3QXM A;  4MIJ A;  1SQY A;  5B7D A;  1NV6 A;  3IB1 A;  4BDL A;  3TTL A;  4RY1 A;  3THI A;  5IZZ A;  2QSX A;  2CZL A;  4KXP A;  1R9Q A;  2DWI A;  3VV5 A;  1FQF A;  3MUQ A;  3N5L A;  4XTC Q;  1DPP A;  4H6D A;  1SW5 A;  2V84 A;  5I2N A;  1FBH A;  2P3N A;  2H9B A;  2ZYM A;  1H76 A;  2Z8D A;  1FPG A;  4O94 A;  4QBA A;  4ELO A;  4OTE A;  3UN6 A;  1FPI A;  1FTO A;  3IOU A;  3TCH A;  3Q27 A;  4EXK A;  2I0C A;  3D4G A;  3E9X A;  5FHN A;  5K2Y A;  2L5V A;  5EYG A;  2KQZ A;  2GHA A;  3TMG A;  5CMB A;  1GVC A;  2CEY A;  5F7V A;  4HE1 A;  4HE2 A;  1EZO A;  2WBB A;  5H8Q B;  1YTV A;  3IOV A;  3KN8 A;  3OOA A;  4XEQ A;  4GXA A;  2QS1 A;  3C34 A;  1HSL A;  1FPF A;  4KYE A;  5M2V A;  2FVZ A;  1FTA A;  4PAK A;  3TDJ A;  3RLF E;  3BIG A;  4ZZE A;  1IZ1 A;  4XKP A;  5ELV A;  4WEP A;  3Q25 A;  2Y7I A;  3RN8 A;  3SDF A;  3MJN A;  3N6U A;  1XS5 A;  3UOR A;  2B3B A;  3OD7 A;  4TQU Q;  4Q5T A;  2DQV A;  3F11 A;  1Q1K A;  1FJ6 A;  3OSQ A;  3QAX A;  4NHB A;  4H65 A;  4X8R A;  3GYY A;  3T9H B;  4GWW A;  1TT1 A;  3TCG A;  1XT8 A;  4OES A;  3FV2 A;  2VOZ A;  2ABH A;  4EQ7 A;  1EH3 A;  5TPA B;  4WKM A;  4MHF A;  3QMF A;  3O9P A;  4PGN A;  1TXF A;  3G3J A;  4R74 A;  5ESY A;  5JTY B;  4MNC A;  5LOM A;  4F3S A;  4H1X A;  2QVU A;  1M5F A;  1M5D A;  3KSX A;  1DSN A;  2DE4 A;  5DVI A;  5CC2 A;  1P1O A;  3T93 B;  3MVX A;  3O2A A;  3JV9 A;  2FNC A;  4NED A;  4NF4 A;  2XXV A;  1P1N A;  3K6V A;  4Q30 B;  1DPE A;  4I62 A;  4KCC A;  1EU8 A;  2AIX A;  1H3D A;  4ZZA A;  2QPQ A;  4U21 A;  2QS2 A;  3V89 B;  2HFB A;  4FE8 A;  4IGR A;  2XX8 A;  5T3J A;  2OZZ A;  1G0I A;  2P0S A;  4KYS A;  2DP8 A;  3EHU A;  1NV5 A;  1XOC A;  4GBV A;  4YZZ A;  1SD3 A;  3EKI A;  5DT6 A;  3BFU A;  4POW A;  1OMP A;  3KGC A;  2XWK A;  5H8H B;  1J1N A;  4KR5 A;  4GWU A;  5IZ3 B;  1FJ9 A;  1NFT A;  2XXU A;  1IXH A;  4FED A;  4ZEC A;  5CI5 A;  3K4U A;  1QKB A;  2WYK A;  2HCA A;  4F18 A;  2HHM A;  1ZMG A;  2DS9 A;  4OWD A;  4N6P A;  3VE1 B;  2ALU A;  2XXK A;  4ZE8 A;  5I56 A;  2X7Q A;  1LB8 A;  4FEB A;  4F3G A;  3MBP A;  3O28 A;  1S9T A;  1MQJ A;  3IFC A;  1URD A;  4NF8 A;  5L9O A;  1US5 A;  3N6T A;  3KN7 A;  1DCU A;  2XA5 A;  1Z7N E;  3MWB A;  2RC7 A;  3KFM A;  4OER A;  3T66 A;  5JK4 A;  4LQ2 A;  1P99 A;  4DI4 B;  3K0V A;  3HV1 A;  3BFT A;  3Q26 A;  4F2O A;  3SES A;  4G68 A;  4U4S A;  1RYO A;  4G68 C;  4JWX A;  4FJP A;  4MFI A;  3MVW A;  4HW8 A;  3H6U A;  1B0L A;  1IQ7 A;  2JJK A;  1UIV A;  1EYI A;  2PCR A;  4R2B A;  1FW0 A;  1SBP A;  1QUL A;  4G8M A;  2Y7P A;  4OFJ A;  3O29 A;  3FXQ A;  1Y3P A;  1Y20 A;  2A5T B;  4PFW A;  2FYI A;  4KFQ A;  3PMV A;  2XD3 A;  3CG3 A;  4LUB A;  3VDF A;  1LLS A;  4I8C A;  5FHO A;  3E4R A;  3S2V A;  1AOV A;  2XX9 A;  5AA4 A;  2O51 A;  4PET A;  1FBC A;  1QUJ A;  2V3Q A;  1IME A;  1NI9 A;  1LAF E;  4P9K A;  3UIF A;  3T22 A;  4KYD A;  4GX4 A;  3FAT A;  3S4U A;  3CFZ A;  2QFL A;  2VPO A;  1SI1 A;  1FBP A;  3O6H A;  3ZKK A;  3K2D A;  4N8G A;  4EQB A;  1GGG A;  2ONR A;  3IFA A;  3VVD A;  2QJE A;  1S50 A;  2XXW A;  2G29 A;  3GBB A;  4QFO A;  2PMS A;  3OMB A;  1A54 A;  1JQF A;  5ITO A;  2F6P A;  4PC9 A;  1NNT A;  4I3Y A;  4N8Y A;  3U94 A;  2HAV A;  1NV1 A;  3M3L A;  3ZS6 A;  5DVF A;  1JW1 A;  1NUX A;  4GWO A;  1N84 A;  3IOR A;  4OFO A;  5L9M A;  4QSD A;  4LA9 A;  4C0R A;  2DYX A;  4DCY A;  1JEV A;  3SEY A;  5KCJ B;  1AL3 A;  1POT A;  4NTL A;  1YXI A;  2DE2 A;  2REG A;  2Y7K A;  1JW4 A;  4OVQ A;  4O7I A;  1IMC A;  4JWY A;  2H25 A;  3K6X A;  2ZXT A;  4YKP A;  1VE4 A;  3W15 C;  3PMX A;  5EHM A;  3E78 A;  5I59 B;  3EHS A;  1Q35 A;  3RGY A;  1B5I A;  1MS7 A;  1LEV A;  1ZIU A;  4YB6 A;  3PD8 A;  4FAT A;  1QW0 A;  1MY2 A;  1RDZ A;  1BIY A;  1MXW A;  4U4X A;  4NQ8 A;  2P3V A;  5H8N A;  1LFG A;  4LAT A;  1IUD A;  2I4C A;  2UVI A;  4MF3 A;  3B6W A;  2QRY A;  3S9M C;  2FIE A;  1GR2 A;  2VP1 A;  1LBX A;  1Y1Z A;  3ROJ A;  1DOT A;  3FXR A;  3S9E A;  1YCJ A;  4QSC A;  4JVI A;  2I6E A;  4NN3 A;  1MQG A;  4ZEK A;  1A7L A;  4XF5 A;  3UGW A;  4O8M A;  4QFK A;  4DZ1 A;  3FIR A;  4YAH X;  2RCA A;  4PFI A;  1SDX A;  1IXG A;  4MJO A;  5I3S A;  4GWS A;  4OVP A;  4NMY A;  4LN5 A;  4N81 A;  2F7A A;  5CM6 A;  5I2N B;  1TWY A;  2Y84 A;  2R71 A;  2OBG A;  4KD5 A;  3OEK A;  4R6Y A;  2QL3 A;  2QS4 A;  4OXV A;  3WAE A;  2UXA A;  1FPD A;  3MP1 A;  4NE4 A;  3PUX E;  1FCK A;  4QFN A;  2I49 A;  3H4Z A;  1YYZ A;  1P1W A;  2ANJ A;  2XWI A;  3MPL A;  3IJO B;  4HCY A;  3UK4 A;  4PAI A;  4GF8 A;  2OLB A;  2RIN A;  4PTK A;  1WVJ A;  4OFL A;  2O69 A;  3KBZ A;  3PMW A;  2RCB A;  3ZSF A;  3A09 A;  4QFP A;  3T9U A;  4RNS A;  1CNQ A;  4MLV A;  5I7I A;  3IB0 A;  4G8N A;  1YZ0 A;  1Y4T A;  2FHY A;  2ZYO A;  4F1Y A;  3IB2 A;  3S9L C;  1FTL A;  2YJP A;  1LBY A;  1MY3 A;  3H3G A;  4TOZ A;  3T9V A;  5CRY A;  5EYH A;  5L8D A;  4EF1 A;  2WBD A;  3CSG A;  3NOH A;  1FQC A;  4PF6 A;  4MBP A;  2KLF A;  3RY3 A;  1A8F A;  2ZMB A;  4MCO A;  5CMK A;  4PE5 B;  4Z7E A;  1R6Z A;  2XXX A;  2NOO A;  2XXP A;  1MM7 A;  3A29 A;  3K02 A;  2GFE A;  4ND9 A;  5F24 A;  3VVE A;  2FIX A;  1B2H A;  2XX7 A;  4R75 A;  2Z23 A;  5ITP A;  1MG1 A;  5KDT A;  4H8J A;  4NGU A;  2Q2A A;  5CMC A;  3CI8 A;  3HST A;  4PDD A;  1JNF A;  4ESX A;  1MM6 A;  1BKA A;  1LBC A;  3B7D A;  3C32 A;  2AL4 A;  4NF4 B;  3A3U A;  2FBP A;  2HZK A;  3JYR A;  1MQI A;  4XKQ A;  2X26 A;  4N91 A;  3N94 A;  1N7W A;  3HPI A;  4QRZ A;  1MPB A;  1MXV A;  3B6Q A;  3SEV A;  4MH5 A;  5EYF A;  3D4C A;  4JWO A;  3G3H A;  2QVR A;  3FUZ A;  3DP6 A;  2UVJ A;  3FZV A;  1IXC A;  1UIU A;  3KZG A;  2V4C A;  1WOD A;  4GQO A;  5I57 A;  2WYP A;  2O7I A;  4FEC A;  1QUI A;  1NH7 A;  5F1Q A;  4GOT A;  1PC3 A;  2UVH A;  1ZBM A;  2P1S A;  2GHB A;  4PF8 A;  4U2R A;  3IR1 A;  2ZYN A;  3IX1 A;  4NF5 A;  5J1D A;  4EXL A;  3CRB A;  4ELP A;  4LZ5 A;  3L6H A;  1D3K A;  1I6Q A;  3RQT A;  5I56 B;  1LCT A;  1LBZ A;  2UYE A;  3CFL A;  1LGB C;  3A3C A;  4THI A;  3I5O A;  3QK6 A;  3PTY A;  3BKI B;  1B4H A;  5EHS A;  1RYX A;  1FQA A;  4P11 A;  2O7U A;  3HN0 A;  4NF8 B;  4IO7 A;  3VLV A;  4GRK A;  3H03 A;  2G93 A;  3OO9 A;  1NV4 A;  4NF6 A;  2M8C A;  4OHN A;  2WKY A;  5IKB A;  3IOT A;  4ZEI A;  2ZNT A;  4IO5 A;  1P1Q A;  4X9T A;  5EQ9 A;  3V83 A;  4G68 B;  2DSF A;  4C1T A;  1HSJ A;  1Z7M E;  3CFX A;  4O7M A;  1PDA A;  2PVU A;  2AL5 A;  2CZH A;  1PBQ A;  2XHD A;  5ET6 A;  4R6H A;  1LBW A;  2IA4 A;  4UAB A;  3IJX B;  2XWO A;  2ONS A;  3MYU A;  2Y7W A;  1TFD A;  2OCU A;  5I2K A;  1MXY A;  5TP9 A;  4IO2 A;  1A99 A;  1FSA A;  5FHM A;  2XXH A;  3VLU A;  4PFB A;  2ZZX A;  3EPE A;  1Y1M A;  3FVK A;  1QVS A;  3RTF B;  4RYA A;  4P47 A;  5ICQ A;  1LCF A;  1PBP A;  3FXB A;  1FBE A;  5AA4 B;  3HO7 A;  2CMO A;  3EHT A;  4ZE9 A;  1FQB A;  1LBB A;  2XWV A;  1FRP A;  3CSB A;  3DM0 A;  2E1S A;  3M8U A;  1FTK A;  1N04 A;  4G77 A;  4YIC A;  1BK4 A;  5CBS A;  4PFU A;  2D3I A;  4OET A;  4GIZ A;  4BDR A;  3PV0 E;  4IB2 A;  1OVT A;  3ODB A;  1OIB A;  1AIV A;  3T96 B;  4H5F A;  4O3B A;  2BJI A;  1IIW A;  3JZJ A;  2YPN A;  3TAJ A;  3LSX A;  2I3V A;  3W9W A;  2NXO A;  4RK9 A;  1GV8 A;  1FPK A;  1DTG A;  4YKK A;  4HTG A;  1NNF A;  3KC0 A;  3CIJ A;  3MP8 A;  4Q8R A;  2X7P A;  2AYS A;  1B51 A;  3IOW A;  4PAF A;  1OQG A;  3FVN A;  4PFR A;  2ZZV A;  4U22 A;  2B4M A;  2HXW A;  2DWA A;  2PX1 A;  5H8N B;  3CVG A;  4HCW A;  4OQO A;  3C33 A;  2QS3 A;  4KPT A;  3PPQ A;  2E0S A;  1DBZ A;  3FVG A;  4QF9 A;  5CMM A;  1CB6 A;  5AA2 A;  2RF1 A;  4GXS B;  3CR9 A;  1M5B A;  1JW5 A;  1US4 A;  3IL1 B;  3KSJ A;  3MAM A;  4PFY A;  1A8E A;  1JP4 A;  5ET8 A;  4QHQ A;  4X1D A;  5AE4 A;  3FVO A;  1D9V A;  3IAZ A;  4F31 B;  2I58 A;  1B0H A;  4JBZ A;  1SW4 A;  4TLM B;  1XI6 A;  1UTH A;  3N26 A;  4NG7 A;  2HQ0 A;  3LSF B;  3AXF A;  1URS A;  3SZP A;  4BDN A;  4P8B A; 
#chains in the Genus database with same CATH homology
 1HSE A;  1B7Z A;  1Y3Q A;  3PD9 A;  1KA0 A;  2XXY A;  1INP A;  4JSD A;  1PEB A;  4GLI A;  4BLA A;  1XVY A;  1O7T A;  2I3W A;  2Z8F A;  1MY1 A;  4LP2 B;  4TLL B;  2RKM A;  3QUF A;  3S9N C;  4POX A;  4H45 A;  1T0K A;  4IO4 A;  1IMA A;  5B70 A;  1G0H A;  4PFT A;  1RDX A;  4UA8 A;  3Q29 A;  2DVZ A;  3Q28 A;  2UVG A;  1Y4C A;  4FIM A;  2O68 A;  5EQ7 A;  4AB6 A;  1S7Y A;  1ZU0 A;  5ET5 A;  4MLQ A;  4M4G A;  3PPO A;  5I5P A;  3UP9 A;  3QIM A;  3U8Q A;  3MZB A;  1Y3N A;  1ELJ A;  5H8F A;  3FV1 A;  4LVQ A;  5I84 A;  1ZKB A;  3GZG A;  4OVT A;  5DYH A;  4RK2 A;  3U72 A;  5HPQ A;  1PB7 A;  4YMA A;  1TFA A;  2VD3 A;  3H7M A;  1MDQ A;  4IY5 A;  1JVY A;  4OEN A;  3W9V A;  4X1B A;  3PPP A;  4ESW A;  3O97 A;  1H43 A;  3LSW A;  1MH4 A;  2PT1 A;  5DW8 A;  4OMB A;  5A5X A;  2QVV A;  5ET7 A;  3RT8 A;  1IEJ A;  3R6U A;  4ELQ A;  3KJ7 A;  5TU0 A;  1ATG A;  4AQ4 A;  1FPE A;  3PUZ E;  3PGF A;  1BLF A;  2BJJ X;  4OEV A;  1OLA A;  2V3U A;  5KDT B;  1FPL A;  1EZ9 A;  2O84 X;  2F36 A;  2XD2 A;  4GWZ A;  3VFJ A;  3MQ9 A;  3O6I A;  1NV3 A;  3LC8 A;  3MC2 A;  5L9S A;  3SET A;  4JSO A;  4BDM A;  1N7X A;  1IXI A;  3MST A;  3E3K A;  3MP6 A;  1FBF A;  4PE3 A;  3RPW A;  4PCD A;  5ISU A;  4RA1 A;  4YU0 A;  2ONK E;  4PP0 A;  4U23 A;  2Y5L A;  3ILT B;  1SI0 A;  4ZEF A;  3B50 A;  1QKA A;  5DEX A;  4F3B A;  1IMF A;  4R2F A;  4G8H A;  1UTB A;  5I57 B;  3DEL B;  5FTI A;  5H8S A;  3BBR A;  3GBA A;  1O63 A;  4KCD A;  3GLB A;  3MW0 A;  3KOS A;  3ISP A;  2OWT A;  2XXQ A;  2XXT A;  2QMW A;  3TEP A;  4NF5 B;  3RUM A;  3MVZ A;  4EDP A;  1CE2 A;  3FBP A;  4JDF A;  4R73 A;  1FPJ A;  4F19 A;  2GH9 A;  2V93 A;  2IEE A;  3RT6 B;  2WEF A;  1M5C A;  4WXJ A;  1L5T A;  4F2Q A;  3TOD A;  4DLD A;  3R7X A;  3PUW E;  3PUV E;  3KEI A;  4N6K A;  1ANF A;  1YPN A;  3O6G A;  3SER A;  2FA7 A;  4PDH A;  5LTC A;  4NF6 B;  3K6W A;  4PBQ A;  2F78 A;  4NWD A;  4XXU A;  2O1L A;  1XVX A;  4IR8 A;  1FBG A;  3U92 A;  3TUS A;  4G61 A;  2PYY A;  2CZI A;  1NH8 A;  2CEX A;  4N6D A;  1LAX A;  3L6G A;  4AB5 A;  1D9Y A;  1NUY A;  4OA4 A;  4I40 A;  2OWS A;  4YKI A;  3MVY A;  4KI0 E;  2Q8J A;  4XIG Q;  3T0J A;  1B9J A;  4N15 A;  1B3H A;  5IGA A;  3K1P A;  1F9B A;  3G3I A;  1B3E A;  4U1O A;  5I2K B;  4IO6 A;  2F3D A;  1B32 A;  1ZLQ A;  3O66 A;  1P1U A;  2B3F A;  2W7Y A;  5TP9 B;  3R26 A;  4OEU A;  4NX1 A;  1Q9D A;  1B3G A;  4I1D A;  4OYV A;  3H6V A;  5LDZ A;  4ONY A;  4N17 A;  3MZ1 A;  1JEU A;  2ZNS A;  3OEM A;  4H67 A;  4DXB A;  1MPC A;  4QFL A;  1IMB A;  4P0G A;  5I58 A;  2O1M A;  5A5L A;  1IIT A;  1BTJ A;  3FJ7 A;  3UA8 A;  3RPL A;  4YB5 A;  4XKR A;  2YLN A;  2DWJ A;  2VPN A;  1KWH A;  3GXA A;  2Y5K A;  2HXR A;  4HS7 A;  3U1O A;  1YAE A;  4OVS A;  4R6K A;  2ZNU A;  1N76 A;  4G2Z A;  4DI3 D;  4FAJ A;  1WDN A;  1M5E A;  4F1U A;  4DCX A;  4P56 A;  3OO6 A;  1KZ8 A;  2H5Y A;  3EF7 A;  3PU5 A;  5BUU A;  1LFI A;  1MQH A;  4F3P A;  1RKM A;  4UAC A;  4HE0 A;  1B5H A;  4X48 A;  2H4I A;  4JB7 A;  3EN3 A;  3G7W A;  1MPD A;  4PQJ A;  3TTR A;  3DP8 A;  2HZL A;  2DOJ A;  2Y7R A;  2GQ1 A;  1JET A;  3FJM A;  1I69 A;  4MAG A;  3LSL A;  2ZZW A;  3P7I A;  3VXC A;  3TPA A;  1B5J A;  1B3F A;  2DXR A;  2DE3 A;  2VT5 A;  4H8I A;  1URG A;  2D21 A;  2PFY A;  1NV7 A;  4OVJ A;  4GL8 A;  2THI A;  4ZS9 A;  1B7U A;  1VDW A;  4KHZ E;  1NKX A;  4MMP A;  2H98 A;  5AA2 B;  2QMX A;  4GX6 A;  1MQD A;  1R9L A;  1B4Z A;  4MNI A;  3CG1 A;  3VVF A;  4OZ9 A;  2PT2 A;  4L17 A;  1LBV A;  4ZEB A;  1GTK A;  3PUY E;  1KA1 A;  3LV0 A;  1B1H A;  3OXN A;  3V8X B;  1NUZ A;  4RPN A;  4YMB A;  5IZ1 A;  5HBC A;  1IMD A;  2F34 A;  1UTH B;  3HHF A;  4E0X A;  1AWB A;  1NV0 A;  5ICT A;  4WED A;  4YKJ A;  3TEL A;  3QYT A;  2R8T A;  3DLN A;  5AA2 D;  1H44 A;  2P2A A;  2RC8 A;  5HM4 B;  1OVB A;  3SEW A;  3TQW A;  4H5G A;  2MKZ A;  5EQA A;  5H8Q A;  1UQW A;  1SW1 A;  3EQ1 A;  4LON B;  4LZ7 A;  5AA3 A;  3K6U A;  3HHG A;  4IY6 A;  3FD3 A;  3LR1 A;  2NUV A;  4F22 A;  5KZT A;  2RC9 A;  3PPN A;  2LAO A;  4NWC A;  1ZTY A;  2R9J A;  4FBP A;  3HCQ A;  4PBH A;  1FBD A;  1B7H A;  2HPG A;  1FTJ A;  3K00 A;  2B65 A;  4GFR A;  4E0W A;  4AS5 A;  4JVD A;  4NAP A;  2DVC A;  3H06 B;  4QXD A;  1FQD A;  2UYF A;  3RNN A;  5H8F B;  2H99 A;  1SPI A;  1NUW A;  1VR5 A;  3USD A;  1A40 A;  1SYI A;  4F1V A;  3MPK A;  5IM2 A;  5TPA A;  1B58 A;  4EF2 A;  1O64 A;  1FQE A;  5FTH A;  4YB7 A;  1EYK A;  4R9F A;  2D5W A;  5JTY A;  2CZK A;  1MY4 A;  2XXI A;  4R72 A;  2A5S A;  3C9H A;  1A55 A;  2VD2 A;  4ISU A;  3B6T A;  5A5X B;  1SW2 A;  2Q88 A;  5BWJ A;  2I0B A;  4P0I A;  2Q2C A;  4QSE A;  1NNP A;  2GRV A;  4I9D A;  4U1Z A;  4F29 A;  3TTN A;  1USY E;  4IGT A;  2ZYK A;  1AH5 A;  3SEU A;  3FAS A;  3E13 X;  4Q0C A;  3K01 A;  4HXV A;  4MNP A;  3K1M A;  5JEI A;  2HAU A;  4MEV A;  4GWX A;  3FXU A;  4LZ8 A;  1B46 A;  1R1N A;  2Z22 A;  4DXU A;  2XXR A;  3ONM A;  1JVX A;  1MDP 1;  4MX6 A;  2HEU A;  4DE8 A;  2DDK A;  5H8H A;  3HFU A;  1LB9 A;  1PB9 A;  1ZJL A;  3KOT A;  2OK2 A;  5IZ3 A;  1K9Z A;  1II5 A;  5DTB A;  1B52 A;  4GD5 A;  5DEX B;  3IO4 A;  1K9Y A;  3U65 A;  1XC1 A;  1I6B A;  4BDO A;  1UTB B;  3TQL A;  2F6G A;  3ECR A;  3C36 A;  3I3V A;  3CHG A;  1PB8 A;  2B4L A;  3C4M A;  3KC1 A;  1MH3 A;  4NF0 A;  3M3F A;  5K2X A;  1I6A A;  5AA1 A;  2Q74 A;  3RYD A;  3RTW B;  2Q9T A;  1OLC A;  3TZA A;  3OO7 A;  4IO3 A;  4OVR A;  4R9G A;  1RDY A;  1B6H A;  2F7B A;  1OQH A;  3MZ9 A;  3TTM A;  2PBW A;  3OEL A;  4ZDM A;  3TTK A;  3T1B A;  3KBR A;  3U93 A;  1N3X A;  3IK6 B;  4K3F A;  3VXB A;  3G3F A;  3H6W A;  1QGX A;  5IAI A;  4ECF A;  4RXL A;  1VFE A;  4RPO A;  1FPB A;  1SVX B;  3I6V A;  3TFL A;  5EQ8 A;  1DTZ A;  1B3L A;  4N4U A;  1VFD A;  1FTM A;  3BIH A;  1B1X A;  3ZKL A;  4AS4 A;  2R6G E;  1N0T A;  1DMB A;  2ESN A;  3H6T A;  3KJT A;  4XFE A;  2Q8M A;  4RJZ A;  2V3T A;  4P3L A;  2A5T A;  1XHY A;  3FGS A;  3WAF A;  3TKD A;  3ILU B;  3TCF A;  3M3K A;  1USY H;  4EUO A;  3C31 A;  4G4P A;  3G3G A;  2O6A A;  1NNK A;  5FBP A;  3E79 A;  4KQP A;  1EYJ A;  3OSR A;  1VSO A;  4DXC A;  4PGP A;  3FJG A;  3PPR A;  4H0W A;  1QJM A;  2V25 A;  4GVO A;  3T9X B;  3SKP A;  2KR0 A;  5DVJ A;  1H45 A;  4N07 A;  2OWZ A;  4N13 A;  1NV2 A;  2OX3 A;  4H46 A;  4JXI A;  1D9Q A;  4O3C A;  3IO6 A;  2F3B A;  4M1V A;  5I58 B;  1LAG E;  3RPL B;  3LUY A;  3SEX A;  1SYH A;  4ZED A;  4FOR A;  2I4B A;  4GBW A;  5CBR A;  1LAH E;  2F35 A;  1NL5 A;  4GL0 A;  4Z0I A;  1D4N A;  2NWJ A;  2F5X A;  1NMU A;  4DDD A;  1MXX A;  1B05 A;  2WX9 A;  1QUK A;  4DIG A;  4GWY A;  4O3A A;  3VLW A;  3G3K A;  1MY0 A;  2I48 A;  1N3W A;  4F39 A;  3QUJ A;  5KCJ A;  5J16 A;  3TYH A;  2F8D A;  4BDQ A;  3V5A A;  2DXY A;  1AMF A;  2REJ A;  4LQ5 A;  4P1E A;  2NVU B;  1BP5 A;  1MXU A;  4I3E A;  4ELR A;  5I59 A;  4P1L A;  2VGQ A;  1MXZ A;  2VHA A;  4EQ9 A;  1Y9U A;  4GX3 A;  4C1U A;  4OAN A;  3C35 A;  2F7C A;  1MRP A;  3QSL A;  3KN3 A;  1DK4 A;  3LUZ A;  2F97 A;  3B8B A;  4XKN A;  2OJT A;  3DP4 A;  2PFZ A;  1B40 A;  1EZP A;  2Z8E A;  3K1N A;  1LFH A;  2DWH A;  1POY 1;  3OO8 A;  4JVC A;  1LST A;  4X04 A;  3LBS A;  3KG2 A;  3OEN A;  3D1R A;  2Q89 A;  3QXM A;  4MIJ A;  1SQY A;  5B7D A;  1NV6 A;  3IB1 A;  4BDL A;  3TTL A;  4RY1 A;  3THI A;  5IZZ A;  2QSX A;  2CZL A;  4KXP A;  1R9Q A;  2DWI A;  3VV5 A;  1FQF A;  3MUQ A;  3N5L A;  4XTC Q;  1DPP A;  4H6D A;  1SW5 A;  2V84 A;  5I2N A;  1FBH A;  2P3N A;  2H9B A;  2ZYM A;  1H76 A;  2Z8D A;  1FPG A;  4O94 A;  4QBA A;  4ELO A;  4OTE A;  3UN6 A;  1FPI A;  1FTO A;  3IOU A;  3TCH A;  3Q27 A;  4EXK A;  2I0C A;  3D4G A;  3E9X A;  5FHN A;  5K2Y A;  2L5V A;  5EYG A;  2KQZ A;  2GHA A;  3TMG A;  5CMB A;  1GVC A;  2CEY A;  5F7V A;  4HE1 A;  4HE2 A;  1EZO A;  2WBB A;  5H8Q B;  1YTV A;  3IOV A;  3KN8 A;  3OOA A;  4XEQ A;  4GXA A;  2QS1 A;  3C34 A;  1HSL A;  4KYE A;  1FPF A;  5M2V A;  2FVZ A;  1FTA A;  3TDJ A;  4PAK A;  3RLF E;  3BIG A;  4ZZE A;  1IZ1 A;  4XKP A;  5ELV A;  4WEP A;  3Q25 A;  2Y7I A;  3RN8 A;  3SDF A;  3MJN A;  3N6U A;  1XS5 A;  3UOR A;  2B3B A;  3OD7 A;  4TQU Q;  4Q5T A;  2DQV A;  3F11 A;  1Q1K A;  3OSQ A;  3QAX A;  1FJ6 A;  4NHB A;  4H65 A;  3T9H B;  3GYY A;  4X8R A;  4GWW A;  1TT1 A;  3TCG A;  1XT8 A;  4OES A;  3FV2 A;  2VOZ A;  2ABH A;  4EQ7 A;  1EH3 A;  5TPA B;  4WKM A;  4MHF A;  3QMF A;  3O9P A;  4PGN A;  1TXF A;  3G3J A;  4R74 A;  5ESY A;  5JTY B;  5LOM A;  4MNC A;  4F3S A;  4H1X A;  2QVU A;  1M5F A;  1M5D A;  3KSX A;  1DSN A;  2DE4 A;  5DVI A;  5CC2 A;  1P1O A;  3T93 B;  3MVX A;  3O2A A;  3JV9 A;  2FNC A;  4NED A;  4NF4 A;  2XXV A;  1P1N A;  3K6V A;  4Q30 B;  1DPE A;  4I62 A;  4KCC A;  1EU8 A;  2AIX A;  1H3D A;  4ZZA A;  2QPQ A;  4U21 A;  2QS2 A;  3V89 B;  2HFB A;  4FE8 A;  4IGR A;  2XX8 A;  5T3J A;  2OZZ A;  1G0I A;  2P0S A;  4KYS A;  2DP8 A;  3EHU A;  1NV5 A;  1XOC A;  4GBV A;  4YZZ A;  1SD3 A;  3EKI A;  5DT6 A;  3BFU A;  4POW A;  1OMP A;  3KGC A;  2XWK A;  5H8H B;  1J1N A;  4KR5 A;  4GWU A;  5IZ3 B;  1NFT A;  1FJ9 A;  2XXU A;  1IXH A;  4FED A;  4ZEC A;  5CI5 A;  3K4U A;  1QKB A;  2WYK A;  2HCA A;  4F18 A;  2HHM A;  1ZMG A;  2DS9 A;  4OWD A;  4N6P A;  3VE1 B;  2ALU A;  5I56 A;  4ZE8 A;  2XXK A;  2X7Q A;  1LB8 A;  4FEB A;  4F3G A;  3MBP A;  3O28 A;  1S9T A;  1MQJ A;  3IFC A;  1URD A;  4NF8 A;  5L9O A;  1US5 A;  3N6T A;  3KN7 A;  1DCU A;  2XA5 A;  1Z7N E;  3MWB A;  2RC7 A;  3KFM A;  4OER A;  3T66 A;  5JK4 A;  4LQ2 A;  1P99 A;  4DI4 B;  3K0V A;  3HV1 A;  3BFT A;  3Q26 A;  4F2O A;  3SES A;  4G68 A;  4U4S A;  1RYO A;  4G68 C;  4JWX A;  4FJP A;  4MFI A;  3MVW A;  4HW8 A;  3H6U A;  1B0L A;  1IQ7 A;  2JJK A;  1UIV A;  1EYI A;  2PCR A;  4R2B A;  1FW0 A;  1SBP A;  1QUL A;  4G8M A;  2Y7P A;  4OFJ A;  3O29 A;  3FXQ A;  1Y3P A;  1Y20 A;  2A5T B;  4PFW A;  2FYI A;  4KFQ A;  3PMV A;  2XD3 A;  3CG3 A;  4LUB A;  3VDF A;  1LLS A;  4I8C A;  5FHO A;  3E4R A;  3S2V A;  1AOV A;  2XX9 A;  5AA4 A;  2O51 A;  4PET A;  1FBC A;  1QUJ A;  2V3Q A;  1IME A;  1NI9 A;  1LAF E;  4P9K A;  3UIF A;  3T22 A;  4KYD A;  4GX4 A;  3FAT A;  3S4U A;  3CFZ A;  2QFL A;  2VPO A;  1SI1 A;  1FBP A;  3O6H A;  3ZKK A;  3K2D A;  4EQB A;  4N8G A;  1GGG A;  2ONR A;  3VVD A;  3IFA A;  2QJE A;  1S50 A;  2XXW A;  2G29 A;  3GBB A;  4QFO A;  2PMS A;  3OMB A;  1A54 A;  1JQF A;  5ITO A;  2F6P A;  4PC9 A;  1NNT A;  4I3Y A;  4N8Y A;  3U94 A;  2HAV A;  1NV1 A;  3M3L A;  3ZS6 A;  5DVF A;  1JW1 A;  4GWO A;  1NUX A;  1N84 A;  3IOR A;  4OFO A;  5L9M A;  4QSD A;  4LA9 A;  4C0R A;  2DYX A;  4DCY A;  1JEV A;  3SEY A;  5KCJ B;  1AL3 A;  1POT A;  4NTL A;  1YXI A;  2DE2 A;  2REG A;  2Y7K A;  1JW4 A;  4OVQ A;  4O7I A;  1IMC A;  4JWY A;  2H25 A;  3K6X A;  2ZXT A;  4YKP A;  1VE4 A;  3W15 C;  3PMX A;  5EHM A;  3E78 A;  5I59 B;  3EHS A;  1Q35 A;  3RGY A;  1B5I A;  1MS7 A;  1LEV A;  1ZIU A;  4YB6 A;  3PD8 A;  4FAT A;  1QW0 A;  1MY2 A;  1RDZ A;  1BIY A;  1MXW A;  4U4X A;  4NQ8 A;  2P3V A;  5H8N A;  1LFG A;  4LAT A;  1IUD A;  2I4C A;  2UVI A;  4MF3 A;  3B6W A;  2QRY A;  3S9M C;  2FIE A;  1GR2 A;  2VP1 A;  1LBX A;  1Y1Z A;  3ROJ A;  1DOT A;  3FXR A;  3S9E A;  1YCJ A;  4QSC A;  4JVI A;  2I6E A;  4NN3 A;  1MQG A;  4ZEK A;  1A7L A;  4XF5 A;  3UGW A;  4O8M A;  4QFK A;  4DZ1 A;  3FIR A;  4YAH X;  2RCA A;  4PFI A;  1SDX A;  1IXG A;  4MJO A;  5I3S A;  4GWS A;  4OVP A;  4NMY A;  4LN5 A;  4N81 A;  2F7A A;  5CM6 A;  5I2N B;  1TWY A;  2Y84 A;  2R71 A;  2OBG A;  4KD5 A;  3OEK A;  4R6Y A;  2QL3 A;  2QS4 A;  4OXV A;  3WAE A;  2UXA A;  3MP1 A;  1FPD A;  4NE4 A;  3PUX E;  1FCK A;  4QFN A;  2I49 A;  3H4Z A;  1YYZ A;  1P1W A;  2ANJ A;  3MPL A;  2XWI A;  3IJO B;  4HCY A;  3UK4 A;  4PAI A;  4GF8 A;  2OLB A;  2RIN A;  4PTK A;  1WVJ A;  4OFL A;  2O69 A;  3KBZ A;  3PMW A;  2RCB A;  3ZSF A;  3A09 A;  4QFP A;  3T9U A;  4RNS A;  1CNQ A;  4MLV A;  5I7I A;  3IB0 A;  4G8N A;  1YZ0 A;  1Y4T A;  2FHY A;  2ZYO A;  4F1Y A;  3IB2 A;  3S9L C;  1FTL A;  2YJP A;  1LBY A;  1MY3 A;  3H3G A;  4TOZ A;  3T9V A;  5CRY A;  5L8D A;  4EF1 A;  5EYH A;  2WBD A;  3CSG A;  3NOH A;  1FQC A;  4PF6 A;  4MBP A;  2KLF A;  3RY3 A;  1A8F A;  2ZMB A;  4MCO A;  5CMK A;  4PE5 B;  4Z7E A;  1R6Z A;  2XXX A;  2NOO A;  2XXP A;  1MM7 A;  4ND9 A;  3K02 A;  2GFE A;  3A29 A;  5F24 A;  3VVE A;  2FIX A;  1B2H A;  2XX7 A;  4R75 A;  2Z23 A;  5ITP A;  1MG1 A;  5KDT A;  4H8J A;  4NGU A;  2Q2A A;  5CMC A;  3CI8 A;  3HST A;  4PDD A;  1JNF A;  4ESX A;  1MM6 A;  1BKA A;  1LBC A;  3B7D A;  3C32 A;  2AL4 A;  4NF4 B;  3A3U A;  2FBP A;  2HZK A;  3JYR A;  1MQI A;  4XKQ A;  2X26 A;  4N91 A;  3N94 A;  1N7W A;  3HPI A;  4QRZ A;  1MPB A;  1MXV A;  3B6Q A;  3SEV A;  4MH5 A;  5EYF A;  3D4C A;  4JWO A;  3G3H A;  3FUZ A;  2QVR A;  3DP6 A;  2UVJ A;  3FZV A;  1IXC A;  1UIU A;  3KZG A;  2V4C A;  1WOD A;  4GQO A;  5I57 A;  2WYP A;  2O7I A;  4FEC A;  1QUI A;  1NH7 A;  5F1Q A;  4GOT A;  1PC3 A;  2UVH A;  1ZBM A;  2P1S A;  2GHB A;  4PF8 A;  4U2R A;  3IR1 A;  2ZYN A;  3IX1 A;  4NF5 A;  5J1D A;  4EXL A;  3CRB A;  4ELP A;  4LZ5 A;  3L6H A;  1D3K A;  1I6Q A;  3RQT A;  5I56 B;  1LCT A;  1LBZ A;  2UYE A;  3CFL A;  1LGB C;  3A3C A;  4THI A;  3I5O A;  3QK6 A;  3PTY A;  3BKI B;  1B4H A;  5EHS A;  1RYX A;  1FQA A;  4P11 A;  2O7U A;  3HN0 A;  4NF8 B;  4IO7 A;  3VLV A;  4GRK A;  3H03 A;  2G93 A;  3OO9 A;  1NV4 A;  4NF6 A;  2M8C A;  4OHN A;  2WKY A;  5IKB A;  3IOT A;  4ZEI A;  2ZNT A;  4IO5 A;  1P1Q A;  4X9T A;  3V83 A;  5EQ9 A;  4G68 B;  2DSF A;  4C1T A;  1HSJ A;  1Z7M E;  3CFX A;  4O7M A;  1PDA A;  2PVU A;  2AL5 A;  2CZH A;  1PBQ A;  2XHD A;  5ET6 A;  4R6H A;  1LBW A;  2IA4 A;  4UAB A;  3IJX B;  2XWO A;  2ONS A;  3MYU A;  2Y7W A;  1TFD A;  2OCU A;  5I2K A;  1MXY A;  5TP9 A;  4IO2 A;  1A99 A;  5FHM A;  1FSA A;  2XXH A;  3VLU A;  4PFB A;  2ZZX A;  3EPE A;  1Y1M A;  3FVK A;  1QVS A;  3RTF B;  4RYA A;  4P47 A;  5ICQ A;  1LCF A;  1PBP A;  3FXB A;  1FBE A;  5AA4 B;  3HO7 A;  2CMO A;  3EHT A;  4ZE9 A;  1FQB A;  1LBB A;  2XWV A;  1FRP A;  3CSB A;  3DM0 A;  2E1S A;  3M8U A;  1FTK A;  1N04 A;  4G77 A;  4YIC A;  1BK4 A;  5CBS A;  4PFU A;  2D3I A;  4OET A;  4GIZ A;  4BDR A;  3PV0 E;  4IB2 A;  1OVT A;  3ODB A;  1OIB A;  1AIV A;  3T96 B;  4H5F A;  4O3B A;  2BJI A;  1IIW A;  3JZJ A;  2YPN A;  3TAJ A;  3LSX A;  2I3V A;  3W9W A;  2NXO A;  4RK9 A;  1GV8 A;  1FPK A;  1DTG A;  4YKK A;  4HTG A;  1NNF A;  3KC0 A;  3CIJ A;  3MP8 A;  4Q8R A;  2X7P A;  2AYS A;  1B51 A;  3IOW A;  4PAF A;  1OQG A;  3FVN A;  4PFR A;  2ZZV A;  4U22 A;  2B4M A;  2HXW A;  2DWA A;  2PX1 A;  5H8N B;  3CVG A;  4HCW A;  4OQO A;  3C33 A;  2QS3 A;  4KPT A;  3PPQ A;  2E0S A;  1DBZ A;  3FVG A;  4QF9 A;  5CMM A;  1CB6 A;  5AA2 A;  2RF1 A;  4GXS B;  3CR9 A;  1M5B A;  1JW5 A;  1US4 A;  3IL1 B;  3KSJ A;  3MAM A;  4PFY A;  1A8E A;  1JP4 A;  5ET8 A;  4QHQ A;  4X1D A;  5AE4 A;  3FVO A;  1D9V A;  3IAZ A;  4F31 B;  2I58 A;  1B0H A;  4JBZ A;  1SW4 A;  4TLM B;  1XI6 A;  1UTH A;  3N26 A;  4NG7 A;  2HQ0 A;  3LSF B;  3AXF A;  1URS A;  3SZP A;  4BDN A;  4P8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...