2HZKA

Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its open form
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
334
structure length
334
Chain Sequence
VTWRLASSFPKSLDTIFGGAEVLSKMLSEATDGNFQIQVFSAGELVPGLQAADAVTEGTVECCHTVGYYYWGKDPTFALAAAVPFSLSARGINAWHYHGGGIDLYNEFLSQHNIVAFPGGNTGVQMGGWFRREINTVADMQGLKMRVGGFAGKVMERLGVVPQQIAGGDIYPALEKGTIDATEWVGPYDDEKLGFFKVAPYYYYPGWWEGGPTVHFMFNKSAYEGLTPTYQSLLRTACHAADANMLQLYDWKNPTAIKSLVAQGTQLRPFSPEILQACFEAANEVYAEMEASNPAFKKIWDSIKAFRSEHYTWAQIAEYNYDTFMMVQQNAGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP-T family sorbitol/mannitol transporter, periplasmic bin
publication title Crystal structures of an Extracytoplasmic Solute Receptor from a TRAP transporter in its open and closed forms reveal a helix-swapped dimer requiring a cation for alpha-keto acid binding.
pubmed doi rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Ligand binding, transport protein
total genus 116
structure length 334
sequence length 334
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2hzkA02
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2hzkA01
3DP4A 4PBHA 4QFNA 4OMBA 4F2OA 3O6GA 1F9BA 3O29A 1IZ1A 4H5FA 4KD5A 3KZGA 5H8QB 3HO7A 4X9TA 5L9MA 3M3KA 1DPEA 1XVYA 2DWAA 3EHUA 3D4GA 3OOAA 2DXRA 4KYEA 4LONB 3BBRA 1OVTA 3H06B 4OFOA 2Y7WA 3N6UA 4H5GA 5AA1A 4R9GA 2HZLA 2HCAA 1MXXA 2VOZA 4C0RA 4O8MA 2XXRA 1Y20A 4MNCA 2I58A 3IORA 4N6PA 4IY5A 2FA7A 3SEUA 4N8GA 3PU5A 1LFHA 3K1MA 4JWOA 4NWCA 2DVCA 2V93A 1QULA 3VLWA 4OWDA 3KOTA 4F3SA 3MBPA 4MAGA 2HPGA 1ZBMA 1Y9UA 4PFRA 2UYEA 1MPCA 3TTKA 3TUSA 4ELRA 5DVJA 5CBSA 3U65A 2FNCA 4I1DA 4WKMA 3AXFA 4ELOA 1QW0A 1I6AA 2QS2A 3IOWA 1FTOA 5KCJB 3QAXA 4KI0E 4EUOA 5CC2A 1UIVA 1BTJA 3FJGA 4KFQA 4C1TA 4G68A 1A54A 4ISUA 1QUKA 4EXKA 4H8JA 4IO6A 2XWVA 3GBAA 4FECA 3EHTA 3H6VA 1Y3NA 4DXCA 4XTCQ 5I2NA 3TTNA 2XXIA 3I3VA 2XXPA 4GL0A 2XWIA 5AA2A 3GLBA 1MM6A 1FW0A 1M5DA 2ZYNA 2O51A 4OVPA 2REGA 2E0SA 1MY3A 2X7QA 3JV9A 4WEDA 3TQWA 3RT8A 5CMCA 4F19A 3VLVA 4EQ9A 2Y7KA 4ECFA 3PPOA 5TPAB 5TU0A 3FUZA 4F1YA 2D3IA 3LSFB 4ZS9A 3UORA 1AMFA 4ZDMA 3DELB 3E3KA 4PCDA 1TFAA 2ZZVA 2ESNA 1HSLA 5IM2A 4G2ZA 3VE1B 4I8CA 4ZEBA 4XFEA 3SEVA 3TFLA 2XD2A 1SDXA 5F1QA 4PC9A 4X04A 1B0HA 5DYHA 3UN6A 4ELQA 2H5YA 2Q88A 4X48A 1N84A 3TODA 3A3CA 2IEEA 1MY4A 2DE3A 4YMAA 1P1QA 4JSOA 1P1NA 4PAIA 4GF8A 4POWA 2HAUA 4RA1A 1HSJA 1BKAA 4DXBA 1B3LA 3IO4A 3WAFA 1Y4CA 2OWSA 1B7ZA 4NHBA 3K6UA 2YLNA 2PYYA 4GXAA 4EQ7A 2P0SA 3ZS6A 3T9HB 1AH5A 2ZNTA 3QYTA 4DI4B 4LQ5A 5H8HA 1LSTA 3R6UA 4XIGQ 4ZECA 1B4ZA 5I2KB 4OERA 2QS4A 5ITOA 5J1DA 4PAFA 4LQ2A 1LB9A 3K6VA 3MZ9A 2WYKA 3TTRA 2RC8A 2DYXA 4LP2B 4LATA 4YZZA 5DT6A 2DS9A 1DTGA 3TAJA 1KWHA 2QJEA 2OK2A 4MLQA 4GXSB 3E4RA 4U22A 1DSNA 3VFJA 1Y4TA 3TELA 3MJNA 1UTHB 3FVOA 4TQUQ 2UYFA 1J1NA 3S9EA 1MH3A 4MFIA 4NG7A 2WKYA 4QSCA 3PUWE 4FEDA 1EZ9A 3F11A 1A7LA 3LSXA 4PP0A 3TTLA 2O1LA 4JSDA 1B3GA 1WDNA 2BJJX 2CZLA 2OZZA 5I84A 1JEUA 1OVBA 1QUJA 1FQDA 2XXKA 3MP8A 1B3EA 1YPNA 2QPQA 1POY1 1VFDA 1Q35A 4THIA 5CBRA 1XC1A 1WVJA 2ANJA 4OESA 3G7WA 3JYRA 4OYVA 2R71A 1FQAA 4OFLA 4O3BA 4G8NA 3HV1A 3T22A 4IY6A 4LA9A 4PDHA 3KJ7A 2H98A 4HS7A 4FEBA 1TXFA 4RK9A 1YCJA 4NF4B 1O64A 3IOVA 5IGAA 2D21A 4IO3A 3MP6A 1N76A 2ZNUA 1SW4A 2F78A 2F8DA 3KFMA 3O6IA 1NFTA 2I6EA 1B52A 3GYYA 3R26A 2XXQA 1H43A 2F5XA 4RJZA 3HCQA 3MVXA 1ZLQA 3SETA 2XXXA 1MM7A 3Q26A 1OLCA 5ITPA 3BFUA 4EDPA 1NKXA 1LCFA 2R6GE 3KJTA 3S9NC 1FTJA 1JNFA 4QFKA 2O1MA 2F7BA 1R9QA 4G68C 3CFZA 2DWHA 1JEVA 1S50A 3G3FA 2PFYA 2HZKA 3U93A 2QMWA 1DTZA 3RPWA 1N3XA 3K02A 1LBCA 1OLAA 4O3AA 1AL3A 3T9UA 4OENA 1LFIA 5I57A 2Y84A 1D3KA 3EN3A 1HSEA 2UVJA 3MVYA 4LZ8A 4F18A 5I58B 5I5PA 1LAXA 2H25A 4I9DA 3TMGA 3B6TA 2NUVA 1EH3A 3RT6B 1DMBA 2R9JA 3FZVA 3H03A 3ZSFA 4X1BA 1MXYA 4GWOA 4N07A 3OELA 4R73A 3L6HA 5JTYA 4RYAA 5I56A 3PUZE 4PDDA 4ZEIA 1QVSA 1B0LA 4R2FA 5TP9A 5M2VA 3VVEA 3S9LC 1XT8A 1MG1A 4N6DA 4F31B 3T9XB 1R6ZA 4EF1A 2XXWA 3R7XA 3P7IA 4M4GA 1D9YA 1MXVA 5FHMA 3O6HA 1B51A 3IOTA 2VD3A 3U8QA 2XXYA 4YAHX 1QUIA 2ZZXA 5CMKA 2Z22A 3QIMA 1MY2A 4HCWA 3ZKKA 5AA4A 3G3HA 4JWXA 4PGNA 1IIWA 3LUYA 1MQHA 4U1OA 4H6DA 2ABHA 4O7MA 4GL8A 4MF3A 3FXQA 5BWJA 4KCCA 4QF9A 4IO4A 4IGTA 2OLBA 4LZ5A 4OZ9A 3B50A 4R6KA 2ONRA 4YU0A 4OXVA 1IITA 3CRBA 1B7HA 1II5A 2DE4A 1Z7ME 4DE8A 2B3FA 3OENA 5LTCA 5IZZA 4XKNA 2GFEA 4F39A 1B58A 3PUVE 4F29A 4N91A 4GFRA 3ILUB 1O63A 4RNSA 3HPIA 3VXCA 1POTA 1URDA 3E9XA 2HAVA 3H7MA 3PPQA 3SEXA 1ZKBA 2Y7IA 1AIVA 4ELPA 5ISUA 4PFYA 3KN7A 1M5FA 2DOJA 4YB6A 4DZ1A 3K6WA 4HW8A 1JQFA 1LB8A 4QFOA 4BLAA 3UGWA 4XXUA 2O69A 4FORA 4MCOA 4UA8A 1SW1A 5H8FA 1PBQA 4GVOA 4F3BA 4P8BA 4PF8A 1TWYA 2F36A 1SBPA 4HTGA 2PT1A 1JW4A 3KSJA 2F7CA 2YPNA 3H6TA 2GHBA 3C31A 3U94A 1S7YA 1OQHA 4NEDA 3C35A 1LAFE 4P9KA 5FTIA 4Z0IA 3TDJA 4NN3A 4G77A 4OEVA 4NF5A 2THIA 1ATGA 1EZOA 4KQPA 3PMVA 4PFBA 3VXBA 3SESA 1USYE 2ONKE 3DLNA 1OQGA 4P0IA 3PUYE 5H8NA 4OEUA 1CB6A 2DP8A 5F7VA 1Y3PA 3TTMA 3IJOB 4MIJA 1URGA 2P2AA 1JVXA 2G93A 4P1LA 4KYSA 3Q25A 4EF2A 3S9MC 2OJTA 5AA3A 4YKKA 4BDLA 1XOCA 3DP8A 1FCKA 2Q89A 4TOZA 3M8UA 1SI0A 4EXLA 1URSA 1NNKA 1LAGE 4G68B 5K2XA 1MH4A 5HBCA 4NAPA 3PPPA 4M1VA 3HSTA 5H8FB 5B70A 3O9PA 2ALUA 1MQIA 4MEVA 1LAHE 5AA2D 4ZZEA 3CG1A 2Z8EA 1MRPA 5I2NB 2DWIA 2ZYMA 3G3GA 4GD5A 3A09A 1PB8A 2XD3A 3IOUA 4PAKA 5AA2B 4H1XA 1EZPA 4H0WA 3T93B 5K2YA 2ZYKA 4R6HA 4ESXA 3TYHA 1B3HA 2XXUA 4ZEKA 1RYOA 3TCGA 4GRKA 4XKRA 4P0GA 3Q29A 2O68A 2Y7PA 4ND9A 4OETA 4F1UA 4Q0CA 1N7XA 4XF5A 3OO7A 4F22A 4JDFA 3KN8A 1B32A 5CMBA 4N17A 4PF6A 4GOTA 3RNNA 3K00A 4Z7EA 1S9TA 3W15C 4JB7A 4Q8RA 3O97A 2WX9A 3C9HA 4MH5A 3H6WA 3QK6A 2Q9TA 4OVJA 2ONSA 4AB6A 2H99A 1PB9A 3FD3A 1EU8A 3USDA 3G3JA 3TKDA 1LLSA 2AL4A 2XXTA 2I49A 4N13A 3PMWA 3KEIA 1BLFA 3THIA 3QUFA 4DXUA 4XKQA 2RKMA 2W7YA 3EQ1A 4IGRA 2I0CA 4PFTA 4NQ8A 5I59A 4TLLB 1N3WA 3KSXA 4KPTA 3FJ7A 2CEYA 4NF6A 2E1SA 2PFZA 2LAOA 1P1UA 5IAIA 3RY3A 4NX1A 3SKPA 2CMOA 3QSLA 4RY1A 2VD2A 1B5HA 2O6AA 2F34A 2Z23A 1LGBC 3Q28A 2VP1A 1XVXA 1SQYA 5CI5A 1MQGA 4XEQA 1ZMGA 4OTEA 1D4NA 2YJPA 2UXAA 3MPLA 5KDTA 4NTLA 4NGUA 3G3IA 5EHSA 5CRYA 5EYFA 4U4XA 1MY0A 3FVKA 3K0VA 2X7PA 2I4BA 1IXIA 1CE2A 3SDFA 2CEXA 3IK6B 3MPKA 1FQCA 5HPQA 4G4PA 4JXIA 5DEXA 1ZU0A 5H8HB 3Q27A 3W9WA 1PBPA 5HM4B 1GTKA 5I7IA 2Y7RA 1BP5A 4X1DA 2F35A 4YKPA 5B7DA 2I3VA 1WODA 1ZJLA 2M8CA 2WYPA 2Z8FA 2A5TA 4YB5A 1FQBA 1ZIUA 3KOSA 1YTVA 3K01A 3CFLA 1TT1A 4F1VA 4IO5A 2V4CA 4NF6B 3FASA 3FVNA 3KGCA 1VFEA 3K2DA 2XA5A 2G29A 2ZXTA 2H4IA 2I4CA 3OO8A 3DM0A 5DVFA 3T96B 1I6BA 3N5LA 4PFIA 2HXWA 4IB2A 1UQWA 1MY1A 2P1SA 3FXRA 1FQFA 1Y1ZA 1NH7A 4NE4A 5H8SA 4DCXA 4EQBA 1LFGA 3OO9A 4DDDA 4PGPA 1QJMA 2GH9A 4OVTA 3ZKLA 4F3PA 3CR9A 3IR1A 1ZTYA 4BDNA 3FXBA 3PD9A 4OVRA 3OXNA 1PDAA 1BIYA 3DP6A 3BFTA 4BDRA 3MZ1A 4ZEFA 4R9FA 3T9VA 3CI8A 3GZGA 4AB5A 1XHYA 3PD8A 1SW2A 3LC8A 4U2RA 2PBWA 4L17A 3RUMA 5L9OA 3H6UA 4O3CA 3H4ZA 4P56A 1P99A 2QS1A 1SW5A 1MQJA 3IO6A 4E0WA 4GLIA 4NWDA 3PGFA 3ODBA 4ONYA 3C4MA 1MXZA 2DVZA 5A5XA 2NWJA 4MLVA 2V3TA 1Z7NE 3TZAA 3C33A 1TFDA 4QSEA 2V3UA 1MDP1 4GQOA 4JBZA 2REJA 4MMPA 3B7DA 4R2BA 1US4A 3KN3A 3UIFA 3L6GA 1D9VA 3S4UA 1M5CA 3CG3A 4QFLA 4H8IA 3FVGA 1A8FA 4OVSA 1SD3A 1B46A 4OA4A 1FQEA 4ZE9A 5KCJA 1PC3A 2NOOA 1JW1A 4P1EA 1B5IA 2PT2A 4PFUA 3RTFB 3C32A 4Q5TA 4IO7A 4MHFA 3OSRA 1SYIA 4F3GA 2F97A 4PETA 3RLFE 3CIJA 1NL5A 2I3WA 3RTWB 2O7IA 3VDFA 1Y3QA 3M3FA 5BUUA 4WEPA 3FATA 5I57B 1T0KA 3EHSA 1ANFA 4ZZAA 4IO2A 1MQDA 3HHFA 2VGQA 3ONMA 1H45A 3VLUA 5A5XB 2F7AA 1SI1A 3MW0A 2ZMBA 3UP9A 3MZBA 5JTYB 3TPAA 5I56B 1A40A 4OANA 4KYDA 3VV5A 5TP9B 3GBBA 1MXWA 2FYIA 1IEJA 1AOVA 2F6PA 4N4UA 1B05A 2I48A 1NNFA 5IKBA 3TEPA 5FHNA 2Q2AA 3OO6A 4DIGA 3QXMA 3V5AA 5TPAA 2XXHA 4OHNA 1A8EA 4DLDA 3RQTA 2UVGA 2AYSA 3N6TA 2ZNSA 4P3LA 4YB7A 2QMXA 2UVIA 1N0TA 5AA4B 1VE4A 3CSGA 4RXLA 3OMBA 1JETA 4Q30B 2QRYA 3O2AA 1NMUA 2ZYOA 3VVFA 1P1OA 3RN8A 3PPRA 4KCDA 2XX9A 1LBBA 2XXVA 3TCFA 2VHAA 1M5EA 2AL5A 1P1WA 2Q2CA 4P11A 5FHOA 1ELJA 3KBRA 2RINA 2H9BA 4NMYA 3CFXA 2OBGA 4PQJA 3N26A 4K3FA 4H67A 2DSFA 1NH8A 3KG2A 4LZ7A 2XX7A 4RPNA 4R6YA 1US5A 2ZZWA 3FV2A 5ICQA 4OVQA 3MC2A 1FTKA 4U4SA 1MS7A 1USYH 3V89B 4G8MA 4ZE8A 4HCYA 3SERA 3OEMA 3OEKA 3IAZA 5I2KA 3FGSA 5EHMA 4XKPA 4YICA 4E0XA 3LSWA 4KR5A 3IX1A 3N94A 4N8YA 3W9VA 3QUJA 3JZJA 3B6QA 4N6KA 4DCYA 4MX6A 3IB0A 2XHDA 4F2QA 1O7TA 1RYXA 1B2HA 1SVXB 3MQ9A 1NNPA 3HHGA 4YKIA 3BKIB 4BDQA 4ZEDA 3K1NA 1UTHA 3LSLA 1DPPA 4NF5B 3IB1A 3M3LA 4NF0A 1I69A 4UABA 5JEIA 3MVWA 1H76A 1DOTA 5JK4A 3MVZA 3U92A 5H8NB 2O84X 1SYHA 4YMBA 3SEWA 5AE4A 1FTLA 4UACA 1IQ7A 4RPOA 1IXCA 3UK4A 1IXHA 4PE3A 2HQ0A 2RF1A 2VPOA 4G8HA 3B6WA 4FIMA 3WAEA 3CVGA 4FAJA 2OWTA 2OCUA 3K1PA 1MPBA 2RC7A 2DE2A 4R72A 1B4HA 4NF8A 1B40A 3OD7A 3U72A 2UVHA 2PVUA 4QFPA 1MXUA 3HN0A 1L5TA 4QSDA 4AQ4A 1I6QA 4PBQA 5CMMA 2GHAA 2RC9A 2XWOA 4FATA 2HEUA 2Q8JA 3U1OA 1A55A 4R74A 1B1HA 3LBSA 3RGYA 2D5WA 3C36A 3EPEA 3MUQA 4LVQA 2PX1A 1PEBA 3UA8A 3ECRA 3V8XB 4NF4A 2F6GA 2RCBA 5L8DA 2PMSA 3MP1A 2V25A 4BDOA 1QKAA 1UIUA 1Y1MA 5ELVA 2RCAA 1IUDA 4C1UA 1H44A 4OFJA 4N15A 4QRZA 4KHZE 3OSQA 1GR2A 4O94A 3D4CA 3GXAA 2KLFA 3MWBA 1FTMA 4PE5B 3IJXB 3T66A 2X26A 1A99A 1R1NA 4LN5A 5CM6A 2A5SA 4NF8B 3VVDA 4BDMA 2QS3A 4POXA 3FJMA 1R9LA 2VPNA 3IL1B 3K6XA 2AIXA 3PMXA 4OQOA 1IXGA 1VR5A 3G3KA 3ILTB 1B1XA 4FJPA 5I59B 2V84A 5DVIA 3EF7A 4JWYA 3H3GA 1OMPA 3I5OA 2HFBA 3K4UA 2O7UA 1UTBA 3C34A 3TCHA 1N04A 2Z8DA 4DI3D 5I58A 2QSXA 4GIZA 5FTHA 3O66A 5KZTA 4PFWA 3PUXE 4YKJA 1H3DA 3IB2A 4MNIA 2DQVA 1PB7A 4LUBA 3CSBA 5KDTB 3PPNA 3TQLA 2XX8A 2NVUB 1B6HA 5H8QA 2DXYA 3I6VA 5DTBA 3MAMA 5LOMA 4U1ZA 4QHQA 3FV1A 1JVYA 1MPDA 4X8RA 5DEXB 1OIBA 4TLMB 3FIRA 2IA4A 1N7WA 3E13X 5L9SA 4RK2A 4U23A 1RKMA 5ICTA 1MDQA 3LR1A 1GGGA 2A5TB 1B5JA 1XS5A 4WXJA 2DWJA 3S2VA 1Q1KA 3SEYA 4P47A 1GVCA 4I62A 2XWKA 4R75A 1LCTA 3FXUA 1YAEA 4MNPA 1M5BA 4FE8A 3PV0E 1VSOA 1UTBB 4MBPA 4H65A 1QKBA 2B65A 3O28A 1B7UA 2B3BA 2V3QA 2QL3A 4U21A 1JW5A 3V83A 2GRVA 1NNTA 4ESWA 3A3UA 1B9JA 2I0BA 1B3FA 2NXOA 1GV8A
chains in the Genus database with same CATH superfamily
3DP4A 4PBHA 4QFNA 4OMBA 4F2OA 3O6GA 1F9BA 3O29A 3LV0A 1IZ1A 4H5FA 4KD5A 3KZGA 5H8QB 1KA0A 3HO7A 1NUZA 4X9TA 4GX3A 5L9MA 3M3KA 1DPEA 1XVYA 2DWAA 3E79A 3EHUA 3D4GA 3OOAA 2DXRA 4KYEA 1FBDA 4LONB 3BBRA 1OVTA 3H06B 5J16A 4OFOA 2Y7WA 3N6UA 4H5GA 5AA1A 1RDXA 3T1BA 4R9GA 1LEVA 2HZLA 2HCAA 1MXXA 2VOZA 4C0RA 3IFCA 4O8MA 2XXRA 1Y20A 3BIHA 4MNCA 2I58A 3MYUA 3IORA 2OWZA 4N6PA 4IY5A 2FA7A 3SEUA 4N8GA 3PU5A 1LFHA 3K1MA 4JWOA 4NWCA 2DVCA 2V93A 1QULA 3VLWA 5EQAA 4OWDA 3KOTA 4F3SA 3MBPA 4MAGA 2HPGA 1LBYA 1ZBMA 1Y9UA 4PFRA 2UYEA 4QBAA 2B4LA 5FBPA 1MPCA 3TTKA 3TUSA 4ELRA 5DVJA 3U65A 5CBSA 2FNCA 4I1DA 4WKMA 3AXFA 1IMEA 4ELOA 1QW0A 1I6AA 2QS2A 4H46A 2F3DA 1LBVA 3IOWA 1FTOA 5KCJB 3QAXA 4KI0E 4EUOA 5CC2A 1UIVA 1BTJA 3FJGA 4KFQA 4C1TA 2KR0A 4G68A 1A54A 4ISUA 2WBDA 1QUKA 4EXKA 4H8JA 4IO6A 4HE2A 2XWVA 3GBAA 4FECA 2PCRA 3EHTA 1FTAA 3H6VA 1Y3NA 4DXCA 5ESYA 4XTCQ 5I2NA 3TTNA 2XXIA 3I3VA 2XXPA 4GL0A 2XWIA 5AA2A 2QFLA 2OX3A 3GLBA 1MM6A 1FW0A 1M5DA 2ZYNA 2O51A 4OVPA 2WBBA 2REGA 2E0SA 1MY3A 2X7QA 4HE1A 3JV9A 4WEDA 3E78A 1NV2A 3FBPA 3T0JA 5EQ9A 3TQWA 3RT8A 5CMCA 4F19A 3VLVA 4EQ9A 1KZ8A 2Y7KA 4ECFA 3PPOA 5TPAB 5TU0A 3D1RA 3FUZA 4F1YA 2D3IA 3LSFB 4ZS9A 3UORA 1AMFA 4ZDMA 1FPLA 3DELB 3E3KA 2R8TA 4PCDA 1TFAA 2ZZVA 2ESNA 1HSLA 5IM2A 4G2ZA 3VE1B 4I8CA 4ZEBA 4XFEA 3SEVA 3TFLA 2XD2A 1SDXA 4PC9A 5F1QA 4X04A 1B0HA 5DYHA 3UN6A 4ELQA 2H5YA 2Q88A 2CZKA 4X48A 1N84A 3TODA 3A3CA 2IEEA 1MY4A 2DE3A 1EYIA 4YMAA 1P1QA 4JSOA 1P1NA 4PAIA 4GF8A 4POWA 2HAUA 4H45A 4RA1A 4G61A 1FSAA 1HSJA 1BKAA 4DXBA 1B3LA 3IO4A 3WAFA 1Y4CA 2OWSA 1B7ZA 4NHBA 3K6UA 2YLNA 2PYYA 1LBWA 4GXAA 4EQ7A 2P0SA 3ZS6A 3T9HB 1AH5A 2ZNTA 3QYTA 4DI4B 2FIXA 4LQ5A 5H8HA 1LSTA 3R6UA 4XIGQ 4ZECA 1B4ZA 5I2KB 4OERA 2QS4A 5ITOA 1FPGA 5J1DA 1NV0A 4PAFA 4LQ2A 1LB9A 2CZHA 3K6VA 2WEFA 3MZ9A 2WYKA 3TTRA 2RC8A 3QMFA 2DYXA 4LP2B 4LATA 4YZZA 5DT6A 2DS9A 1JP4A 1DTGA 3TAJA 1KWHA 2QJEA 2OK2A 4MLQA 4GXSB 3E4RA 4U22A 1DSNA 3VFJA 1Y4TA 3TELA 3MJNA 4JVIA 1UTHB 3FVOA 4TQUQ 2UYFA 1J1NA 3S9EA 1MH3A 1FPIA 4JVCA 2FVZA 4MFIA 4NG7A 2WKYA 4QSCA 3PUWE 4FEDA 1EZ9A 3F11A 1A7LA 1NUXA 3LSXA 4PP0A 3TTLA 2O1LA 4GWUA 4JSDA 1B3GA 1WDNA 2BJJX 2CZLA 5T3JA 2OZZA 5I84A 1JEUA 1OVBA 4GWZA 1QUJA 1FQDA 2XXKA 3MP8A 1B3EA 1YPNA 2QPQA 1POY1 1LBZA 1VFDA 1FPKA 1Q35A 3KC1A 4THIA 5CBRA 1XC1A 1WVJA 2ANJA 4OESA 3G7WA 3JYRA 4OYVA 2R71A 4MJOA 1FQAA 4OFLA 4O3BA 4G8NA 1YXIA 3HV1A 3T22A 2QVVA 5IZ3B 4IY6A 2L5VA 4LA9A 4PDHA 3KJ7A 2H98A 1CNQA 4HS7A 4FEBA 1TXFA 4RK9A 1YCJA 4NF4B 1O64A 3IOVA 4HXVA 5IGAA 2D21A 1RDZA 4IO3A 3MP6A 4O7IA 1N76A 2ZNUA 1SW4A 2F78A 2F8DA 1DCUA 3KFMA 3O6IA 1NFTA 2I6EA 1B52A 3GYYA 3R26A 2XXQA 3NOHA 1DK4A 1H43A 2F5XA 4RJZA 3HCQA 3MVXA 1ZLQA 3SETA 2XXXA 1MM7A 3Q26A 1OLCA 5ITPA 3BFUA 4EDPA 1NKXA 1LCFA 2R6GE 3KJTA 3S9NC 1FTJA 1JNFA 4QFKA 2O1MA 2F7BA 1R9QA 4G68C 3CFZA 1IMCA 2DWHA 1JEVA 1S50A 2PFYA 3G3FA 2HZKA 3U93A 4AS4A 2QMWA 1DTZA 3RPWA 1N3XA 3K02A 1LBCA 1OLAA 4O3AA 1AL3A 3T9UA 3RPLA 4OENA 1LFIA 5I57A 2Y84A 1D3KA 3EN3A 1HSEA 2UVJA 3MVYA 4LZ8A 4F18A 5I58B 5I5PA 1LAXA 2H25A 4I9DA 3TMGA 4I3YA 5EYGA 3B6TA 2NUVA 1EH3A 3RT6B 1DMBA 2R9JA 3FZVA 3H03A 3ZSFA 4X1BA 1MXYA 3A29A 4GWOA 4N07A 3OELA 4R73A 3L6HA 5JTYA 4RYAA 5I56A 1K9ZA 3PUZE 4PDDA 4ZEIA 1QVSA 1B0LA 4R2FA 5TP9A 5M2VA 3VVEA 3S9LC 1XT8A 1MG1A 4N6DA 4F31B 3T9XB 1R6ZA 4EF1A 2XXWA 3R7XA 3P7IA 4M4GA 1D9YA 1MXVA 5FHMA 3O6HA 1B51A 3IOTA 2VD3A 3U8QA 2XXYA 2ZZXA 1QUIA 2HXRA 4YAHX 5CMKA 2Z22A 3QIMA 1MY2A 1NUWA 4HCWA 3ZKKA 5AA4A 3G3HA 4JWXA 2Q8MA 4PGNA 1IIWA 3LUYA 1MQHA 3KC0A 4U1OA 4H6DA 2ABHA 4O7MA 1DBZA 4GL8A 4MF3A 3FXQA 5BWJA 2HHMA 1YZ0A 4KCCA 4QF9A 4IO4A 4IGTA 3PTYA 2OLBA 4LZ5A 4OZ9A 3B50A 4R6KA 2ONRA 4YU0A 4OXVA 1IITA 3CRBA 5IZ1A 1B7HA 1II5A 2DE4A 1Z7ME 4DE8A 2B3FA 3OENA 5LTCA 5IZZA 4XKNA 2GFEA 4F39A 1B58A 3PUVE 4F29A 4N91A 1Q9DA 4GFRA 3ILUB 1O63A 4RNSA 3HPIA 3VXCA 1POTA 1URDA 3E9XA 2HAVA 3H7MA 3PPQA 3SEXA 1ZKBA 2Y7IA 1AIVA 4ELPA 5ISUA 4PFYA 3KN7A 1M5FA 2DOJA 4YB6A 4DZ1A 3K6WA 4HW8A 1JQFA 1LB8A 4QFOA 4BLAA 3UGWA 4XXUA 4PTKA 2O69A 4FORA 4MCOA 4UA8A 1SW1A 5H8FA 5EQ8A 1FPJA 1PBQA 4GVOA 4P8BA 4PF8A 4F3BA 1EYJA 1TWYA 2F36A 1SBPA 4HTGA 1FBHA 2PT1A 1JW4A 3KSJA 2F7CA 2YPNA 3H6TA 4GX6A 2GHBA 3C31A 3U94A 1S7YA 1XI6A 1OQHA 4NEDA 3C35A 1LAFE 4P9KA 5FTIA 4Z0IA 3TDJA 4NN3A 4G77A 4OEVA 4NF5A 2THIA 1ATGA 1EZOA 4KQPA 3PMVA 4PFBA 3VXBA 3SESA 1USYE 2ONKE 3DLNA 2Q74A 1OQGA 4P0IA 3PUYE 5H8NA 4OEUA 1CB6A 2DP8A 5F7VA 1Y3PA 3TTMA 3IJOB 1NUYA 4MIJA 1URGA 2P2AA 1JVXA 2G93A 4P1LA 4KYSA 4IR8A 2JJKA 3Q25A 4EF2A 3S9MC 2OJTA 5AA3A 1NI9A 4YKKA 3ROJA 4BDLA 1XOCA 3DP8A 1FCKA 2Q89A 4TOZA 3M8UA 1SI0A 4EXLA 1URSA 1NNKA 2FIEA 1LAGE 4G68B 5K2XA 1MH4A 5HBCA 4NAPA 3PPPA 4M1VA 3HSTA 5H8FB 5B70A 3O9PA 2ALUA 1MQIA 4MEVA 1LAHE 5AA2D 4ZZEA 3CG1A 2Z8EA 1MRPA 5I2NB 2DWIA 2ZYMA 3G3GA 2DDKA 4GD5A 3A09A 1PB8A 2XD3A 3IOUA 4PAKA 5AA2B 1BK4A 4H1XA 4H0WA 1EZPA 3T93B 5K2YA 2ZYKA 4R6HA 4ESXA 3TYHA 1B3HA 2XXUA 4ZEKA 1RYOA 3TCGA 4GRKA 4XKRA 4P0GA 3Q29A 2O68A 2Y7PA 4ND9A 4OETA 4F1UA 4Q0CA 1N7XA 1VDWA 4XF5A 3OO7A 4F22A 4JDFA 3KN8A 1B32A 5CMBA 4N17A 4PF6A 4GOTA 3RNNA 3K00A 4Z7EA 1S9TA 3W15C 4JB7A 4Q8RA 3O97A 2WX9A 3C9HA 4MH5A 3H6WA 3QK6A 2Q9TA 4OVJA 2ONSA 4AB6A 2H99A 5LDZA 1PB9A 3FD3A 1EU8A 3USDA 3G3JA 3TKDA 1LLSA 2AL4A 2XXTA 1NV6A 2I49A 5F24A 4GX4A 4N13A 3PMWA 3KEIA 1BLFA 3THIA 3QUFA 4DXUA 4XKQA 2RKMA 2W7YA 1FPFA 3EQ1A 4IGRA 2I0CA 4NQ8A 4PFTA 5I59A 4TLLB 1N3WA 3KSXA 4KPTA 3FJ7A 2CEYA 4NF6A 2E1SA 2PFZA 2LAOA 4GWXA 1P1UA 5IAIA 3RY3A 4NX1A 1EYKA 3SKPA 1NV1A 2CMOA 3QSLA 4RY1A 2VD2A 1NV7A 1B5HA 2O6AA 2F34A 2Z23A 1LGBC 3Q28A 2VP1A 1XVXA 1SQYA 5CI5A 1MQGA 2P3NA 4XEQA 4OTEA 1ZMGA 1D4NA 2YJPA 2UXAA 3MPLA 1FPBA 5KDTA 3HFUA 4NTLA 4NGUA 3G3IA 5EHSA 1G0HA 4GWYA 5CRYA 5EYFA 4U4XA 1MY0A 3FVKA 1FBGA 3K0VA 2X7PA 2I4BA 3KBZA 1IXIA 1CE2A 3SDFA 2CEXA 3IK6B 3MPKA 1QGXA 1FQCA 5HPQA 4G4PA 4JXIA 5DEXA 1ZU0A 5H8HB 3Q27A 3LUZA 1PBPA 3W9WA 1GTKA 1G0IA 2Y7RA 5HM4B 5I7IA 1BP5A 4X1DA 2F35A 4YKPA 5B7DA 2I3VA 1WODA 4I40A 1ZJLA 2M8CA 2WYPA 2Z8FA 2A5TA 1FJ6A 4YB5A 1FQBA 3RYDA 1ZIUA 3KOSA 1YTVA 2GQ1A 3K01A 3CFLA 1TT1A 4F1VA 4IO5A 2V4CA 2Y5KA 4NF6B 3FASA 3FVNA 3KGCA 1VFEA 1IMBA 3K2DA 2XA5A 2G29A 2ZXTA 2H4IA 2I4CA 3OO8A 3DM0A 5DVFA 3T96B 1I6BA 3N5LA 4PFIA 2HXWA 4IB2A 1UQWA 1MY1A 1FBCA 2P1SA 3FXRA 1FQFA 1Y1ZA 1NH7A 4NE4A 5H8SA 4DCXA 3CHGA 4EQBA 1LFGA 3OO9A 4PGPA 4DDDA 1QJMA 2GH9A 1FPDA 4OVTA 3ZKLA 4F3PA 2BJIA 3CR9A 3IR1A 1ZTYA 4BDNA 3FXBA 3PD9A 4OVRA 3OXNA 1PDAA 1BIYA 3DP6A 3BFTA 4BDRA 3MZ1A 4ZEFA 4R9FA 3T9VA 3CI8A 3BIGA 3GZGA 4AB5A 1XHYA 3EKIA 3IFAA 3PD8A 1SW2A 3LC8A 4U2RA 2PBWA 2F3BA 4L17A 3RUMA 5L9OA 3H6UA 4O3CA 3H4ZA 4GBVA 4P56A 1P99A 2QS1A 1SW5A 3MSTA 1MQJA 3IO6A 4E0WA 4KXPA 4GLIA 4NWDA 3PGFA 3ODBA 4ONYA 3C4MA 1MXZA 2DVZA 5A5XA 2FHYA 2NWJA 4MLVA 5ET8A 2V3TA 1Z7NE 3TZAA 3C33A 1TFDA 4QSEA 2V3UA 1MDP1 4GQOA 4JBZA 2REJA 4MMPA 1FPEA 3B7DA 4R2BA 1US4A 4AS5A 3KN3A 3UIFA 3L6GA 1D9VA 3S4UA 1M5CA 3CG3A 4QFLA 4H8IA 3FVGA 1A8FA 1YYZA 2VT5A 4OVSA 1SD3A 1B46A 4OA4A 5A5LA 1FQEA 4ZE9A 5KCJA 1PC3A 2NOOA 1JW1A 1NV4A 4P1EA 1B5IA 2PT2A 4PFUA 3RTFB 3C32A 4Q5TA 4IO7A 4MHFA 3OSRA 1SYIA 4F3GA 2F97A 4PETA 3RLFE 4GWWA 3CIJA 1IMDA 3RPLB 1NL5A 2I3WA 3RTWB 1IMFA 2O7IA 3VDFA 1Y3QA 3M3FA 5BUUA 4WEPA 3FATA 5I57B 1T0KA 3EHSA 1ANFA 4ZZAA 4IO2A 1MQDA 3HHFA 2VGQA 3ONMA 1KA1A 2KQZA 1H45A 1AWBA 3VLUA 5A5XB 2F7AA 1SI1A 3MW0A 2ZMBA 3UP9A 3MZBA 5JTYB 3TPAA 5I56B 5I3SA 1A40A 4FBPA 4OANA 4KYDA 3VV5A 3SZPA 5TP9B 3GBBA 5EQ7A 1MXWA 2FYIA 1IEJA 1AOVA 2F6PA 4N4UA 1B05A 2I48A 1NNFA 5IKBA 3TEPA 4GBWA 5FHNA 2Q2AA 3OO6A 4DIGA 3QXMA 3V5AA 5TPAA 2XXHA 4OHNA 1A8EA 4DLDA 2QVRA 3RQTA 2UVGA 2AYSA 3N6TA 2ZNSA 4P3LA 4YB7A 2QMXA 2UVIA 1N0TA 1K9YA 5DW8A 5AA4B 1VE4A 3CSGA 4RXLA 3OMBA 1JETA 4Q30B 5EYHA 2QRYA 3O2AA 1NMUA 2ZYOA 3VVFA 1P1OA 3RN8A 3PPRA 4KCDA 2XX9A 1LBBA 2XXVA 3TCFA 2VHAA 1M5EA 2AL5A 1P1WA 2Q2CA 4P11A 5FHOA 1ELJA 3KBRA 2RINA 5ET7A 2H9BA 4NMYA 3CFXA 2OBGA 1LBXA 4PQJA 3N26A 4K3FA 4H67A 2DSFA 1NH8A 3KG2A 4LZ7A 2Y5LA 2XX7A 4GWSA 4RPNA 4R6YA 1US5A 2ZZWA 3FV2A 5ICQA 4QXDA 4OVQA 3MC2A 1FTKA 4U4SA 1MS7A 1USYH 3V89B 4G8MA 1FBPA 1FRPA 1SPIA 4ZE8A 4HCYA 1RDYA 3SERA 3OEMA 3OEKA 3IAZA 5I2KA 3FGSA 5EHMA 4XKPA 4YICA 4E0XA 3LSWA 4KR5A 3IX1A 3N94A 4N8YA 3W9VA 3QUJA 3JZJA 3B6QA 4N6KA 4DCYA 4MX6A 3IB0A 2XHDA 4F2QA 1O7TA 1RYXA 1B2HA 1SVXB 3MQ9A 1NNPA 3HHGA 4YKIA 3BKIB 4BDQA 4ZEDA 3K1NA 1UTHA 3LSLA 1DPPA 4NF5B 3IB1A 3M3LA 4NF0A 1NV5A 1I69A 4UABA 5JEIA 3MVWA 1H76A 2CZIA 1DOTA 5JK4A 3MVZA 3U92A 5H8NB 2O84X 1SYHA 4YMBA 3SEWA 5AE4A 1FTLA 4UACA 1IQ7A 4RPOA 1IXCA 3UK4A 1IXHA 4PE3A 2HQ0A 2RF1A 2VPOA 4G8HA 1FBEA 3B6WA 4FIMA 3WAEA 3CVGA 4FAJA 2OWTA 3ISPA 2OCUA 3K1PA 1FBFA 1MPBA 2RC7A 2DE2A 4R72A 1B4HA 1FJ9A 4NF8A 1B40A 3OD7A 3U72A 2UVHA 2PVUA 4QFPA 1MXUA 3HN0A 1L5TA 2B4MA 4QSDA 4PBQA 1I6QA 4AQ4A 5CMMA 2GHAA 2RC9A 2XWOA 4FATA 2HEUA 2Q8JA 3U1OA 1A55A 5IZ3A 4R74A 1B1HA 3B8BA 3LBSA 3RGYA 2D5WA 3C36A 3EPEA 3MUQA 4LVQA 2PX1A 1PEBA 3UA8A 3ECRA 3V8XB 4NF4A 2F6GA 2RCBA 5L8DA 2PMSA 3MP1A 2V25A 4BDOA 1QKAA 5ET5A 1UIUA 1Y1MA 5ELVA 2RCAA 1IUDA 4C1UA 1H44A 4OFJA 4N15A 4QRZA 4KHZE 3OSQA 1GR2A 4O94A 3D4CA 3GXAA 2KLFA 3MWBA 1FTMA 4PE5B 3IJXB 3T66A 2X26A 1A99A 1R1NA 2FBPA 4LN5A 5CM6A 2A5SA 4NF8B 3VVDA 4BDMA 2QS3A 4POXA 3FJMA 1R9LA 2VPNA 3IL1B 2P3VA 3K6XA 2AIXA 3PMXA 4OQOA 1IXGA 1VR5A 3G3KA 3ILTB 1B1XA 4N81A 4FJPA 5I59B 1D9QA 2V84A 5DVIA 3EF7A 4JWYA 3H3GA 1OMPA 3I5OA 2HFBA 3K4UA 2O7UA 1UTBA 3C34A 3TCHA 1N04A 2Z8DA 4DI3D 5I58A 2QSXA 4GIZA 5FTHA 3O66A 5KZTA 4PFWA 3PUXE 4YKJA 1INPA 1H3DA 3IB2A 4MNIA 2DQVA 1PB7A 4LUBA 3CSBA 5KDTB 3PPNA 3TQLA 2XX8A 2NVUB 1B6HA 5H8QA 1NV3A 2DXYA 3I6VA 5DTBA 3MAMA 4I3EA 5LOMA 4U1ZA 4QHQA 3FV1A 1JVYA 1MPDA 4X8RA 5DEXB 1OIBA 4TLMB 3FIRA 2IA4A 1N7WA 3E13X 4JVDA 5L9SA 4RK2A 4U23A 1RKMA 5ICTA 1MDQA 3LR1A 5ET6A 1GGGA 2A5TB 1B5JA 4HE0A 1XS5A 4WXJA 2DWJA 3S2VA 1Q1KA 3SEYA 4P47A 1GVCA 1IMAA 2XWKA 4I62A 2QVUA 4R75A 1LCTA 3FXUA 1YAEA 4MNPA 1M5BA 4FE8A 2MKZA 3PV0E 1VSOA 1UTBB 4MBPA 4H65A 1QKBA 2B65A 3O28A 1B7UA 2B3BA 2V3QA 2QL3A 4U21A 1JW5A 3V83A 2GRVA 1NNTA 4ESWA 3A3UA 1B9JA 2I0BA 1B3FA 2NXOA 1GV8A
chains in the Genus database with same CATH topology
3DP4A 4PBHA 4QFNA 4OMBA 4F2OA 3O6GA 1F9BA 3O29A 3LV0A 1IZ1A 4H5FA 4KD5A 3KZGA 5H8QB 1KA0A 3HO7A 1NUZA 4X9TA 4GX3A 5L9MA 3M3KA 1DPEA 1XVYA 2DWAA 3E79A 3EHUA 3D4GA 3OOAA 2DXRA 4KYEA 1FBDA 4LONB 3BBRA 1OVTA 3H06B 5J16A 4OFOA 2Y7WA 3N6UA 4H5GA 5AA1A 1RDXA 3T1BA 4R9GA 1LEVA 2HZLA 2HCAA 1MXXA 2VOZA 4C0RA 3IFCA 4O8MA 2XXRA 1Y20A 3BIHA 4MNCA 2I58A 3MYUA 3IORA 2OWZA 4N6PA 4IY5A 2FA7A 3SEUA 4N8GA 3PU5A 1LFHA 3K1MA 4JWOA 4NWCA 2DVCA 2V93A 1QULA 3VLWA 5EQAA 4OWDA 3KOTA 4F3SA 3MBPA 4MAGA 2HPGA 1LBYA 1ZBMA 1Y9UA 4PFRA 2UYEA 4QBAA 2B4LA 5FBPA 1MPCA 3TTKA 3TUSA 4ELRA 5DVJA 5CBSA 3U65A 2FNCA 4I1DA 4WKMA 3AXFA 4ELOA 1IMEA 1QW0A 1I6AA 2QS2A 4H46A 2F3DA 1LBVA 3IOWA 1FTOA 5KCJB 3QAXA 4KI0E 4EUOA 5CC2A 1UIVA 1BTJA 3FJGA 4KFQA 4C1TA 2KR0A 4G68A 1A54A 4ISUA 2WBDA 1QUKA 4EXKA 4H8JA 4IO6A 4HE2A 2XWVA 3GBAA 4FECA 2PCRA 3EHTA 1FTAA 3H6VA 1Y3NA 4DXCA 5ESYA 4XTCQ 5I2NA 3TTNA 2XXIA 3I3VA 2XXPA 4GL0A 2XWIA 5AA2A 2QFLA 2OX3A 3GLBA 1MM6A 1FW0A 1M5DA 2ZYNA 2O51A 4OVPA 2WBBA 2REGA 2E0SA 1MY3A 2X7QA 4HE1A 3JV9A 4WEDA 3E78A 1NV2A 3FBPA 3T0JA 5EQ9A 3TQWA 3RT8A 5CMCA 4F19A 3VLVA 4EQ9A 1KZ8A 2Y7KA 4ECFA 3PPOA 5TPAB 5TU0A 3D1RA 3FUZA 4F1YA 2D3IA 3LSFB 4ZS9A 3UORA 1AMFA 4ZDMA 1FPLA 3DELB 3E3KA 2R8TA 4PCDA 1TFAA 2ZZVA 2ESNA 1HSLA 5IM2A 4G2ZA 3VE1B 4I8CA 4ZEBA 4XFEA 3SEVA 3TFLA 2XD2A 1SDXA 5F1QA 4PC9A 4X04A 1B0HA 5DYHA 3UN6A 4ELQA 2H5YA 2Q88A 2CZKA 4X48A 1N84A 3TODA 3A3CA 2IEEA 1MY4A 2DE3A 1EYIA 4YMAA 1P1QA 4JSOA 1P1NA 4PAIA 4GF8A 4POWA 2HAUA 4RA1A 4H45A 4G61A 1FSAA 1HSJA 1BKAA 4DXBA 1B3LA 3IO4A 3WAFA 1Y4CA 2OWSA 1B7ZA 4NHBA 3K6UA 2YLNA 2PYYA 1LBWA 4GXAA 4EQ7A 2P0SA 3ZS6A 3T9HB 1AH5A 2ZNTA 3QYTA 4DI4B 4LQ5A 2FIXA 5H8HA 1LSTA 3R6UA 4XIGQ 4ZECA 1B4ZA 5I2KB 4OERA 2QS4A 5ITOA 1FPGA 5J1DA 1NV0A 4PAFA 4LQ2A 1LB9A 2CZHA 3K6VA 2WEFA 3MZ9A 2WYKA 3TTRA 2RC8A 3QMFA 2DYXA 4LP2B 4LATA 4YZZA 5DT6A 2DS9A 1JP4A 1DTGA 3TAJA 1KWHA 2QJEA 2OK2A 4MLQA 4GXSB 3E4RA 4U22A 1DSNA 3VFJA 1Y4TA 3TELA 3MJNA 4JVIA 1UTHB 3FVOA 4TQUQ 2UYFA 1J1NA 3S9EA 1MH3A 1FPIA 4JVCA 2FVZA 4MFIA 4NG7A 2WKYA 4QSCA 3PUWE 4FEDA 1EZ9A 3F11A 1A7LA 3LSXA 1NUXA 4PP0A 3TTLA 2O1LA 4JSDA 4GWUA 1B3GA 1WDNA 2BJJX 2CZLA 5T3JA 2OZZA 5I84A 1JEUA 1OVBA 4GWZA 1QUJA 1FQDA 2XXKA 3MP8A 1B3EA 1YPNA 2QPQA 1POY1 1LBZA 1VFDA 1FPKA 1Q35A 4THIA 3KC1A 5CBRA 1XC1A 1WVJA 2ANJA 4OESA 3G7WA 3JYRA 4OYVA 2R71A 4MJOA 1FQAA 4OFLA 4O3BA 4G8NA 1YXIA 3HV1A 3T22A 2QVVA 5IZ3B 4IY6A 2L5VA 4LA9A 4PDHA 3KJ7A 2H98A 1CNQA 4HS7A 4FEBA 1TXFA 4RK9A 1YCJA 4NF4B 1O64A 3IOVA 4HXVA 5IGAA 2D21A 1RDZA 4IO3A 3MP6A 4O7IA 1N76A 2ZNUA 1SW4A 2F78A 2F8DA 3KFMA 3O6IA 1DCUA 1NFTA 2I6EA 1B52A 3GYYA 3R26A 2XXQA 3NOHA 1DK4A 1H43A 2F5XA 4RJZA 3HCQA 3MVXA 1ZLQA 3SETA 2XXXA 1MM7A 3Q26A 1OLCA 5ITPA 3BFUA 4EDPA 1NKXA 1LCFA 2R6GE 3KJTA 3S9NC 1FTJA 1JNFA 4QFKA 2O1MA 2F7BA 1R9QA 4G68C 3CFZA 1IMCA 2DWHA 1JEVA 1S50A 3G3FA 2PFYA 2HZKA 3U93A 4AS4A 2QMWA 1DTZA 3RPWA 1N3XA 3K02A 1LBCA 1OLAA 4O3AA 1AL3A 3T9UA 3RPLA 4OENA 1LFIA 5I57A 2Y84A 1D3KA 3EN3A 1HSEA 2UVJA 3MVYA 4LZ8A 4F18A 5I58B 5I5PA 1LAXA 2H25A 4I9DA 3TMGA 4I3YA 5EYGA 3B6TA 2NUVA 1EH3A 3RT6B 1DMBA 2R9JA 3FZVA 3H03A 3ZSFA 4X1BA 1MXYA 3A29A 4GWOA 4N07A 3OELA 4R73A 3L6HA 5JTYA 4RYAA 5I56A 3PUZE 1K9ZA 4PDDA 4ZEIA 1QVSA 1B0LA 4R2FA 5TP9A 5M2VA 3VVEA 3S9LC 1XT8A 1MG1A 4N6DA 4F31B 3T9XB 1R6ZA 4EF1A 2XXWA 3R7XA 3P7IA 4M4GA 1D9YA 1MXVA 5FHMA 3O6HA 1B51A 3IOTA 2VD3A 3U8QA 2XXYA 4YAHX 1QUIA 2HXRA 2ZZXA 5CMKA 2Z22A 3QIMA 1MY2A 4HCWA 3ZKKA 5AA4A 1NUWA 3G3HA 4JWXA 2Q8MA 4PGNA 1IIWA 3LUYA 1MQHA 3KC0A 4U1OA 4H6DA 2ABHA 4O7MA 1DBZA 4GL8A 4MF3A 3FXQA 5BWJA 2HHMA 1YZ0A 4KCCA 4QF9A 4IO4A 4IGTA 3PTYA 2OLBA 4LZ5A 4OZ9A 3B50A 4R6KA 2ONRA 4YU0A 4OXVA 1IITA 3CRBA 5IZ1A 1B7HA 1II5A 2DE4A 1Z7ME 4DE8A 2B3FA 3OENA 5LTCA 5IZZA 4XKNA 2GFEA 4F39A 1B58A 3PUVE 4F29A 4N91A 1Q9DA 4GFRA 3ILUB 1O63A 4RNSA 3HPIA 3VXCA 1POTA 1URDA 3E9XA 2HAVA 3H7MA 3PPQA 3SEXA 1ZKBA 2Y7IA 1AIVA 4ELPA 5ISUA 4PFYA 3KN7A 1M5FA 2DOJA 4YB6A 4DZ1A 3K6WA 4HW8A 1JQFA 1LB8A 4QFOA 4BLAA 3UGWA 4XXUA 4PTKA 2O69A 4FORA 4MCOA 4UA8A 1SW1A 5H8FA 5EQ8A 1FPJA 1PBQA 4GVOA 4F3BA 4P8BA 4PF8A 1TWYA 2F36A 1EYJA 1SBPA 4HTGA 1FBHA 2PT1A 1JW4A 3KSJA 2F7CA 2YPNA 3H6TA 4GX6A 2GHBA 3C31A 3U94A 1S7YA 1XI6A 1OQHA 4NEDA 3C35A 1LAFE 4P9KA 5FTIA 4Z0IA 3TDJA 4NN3A 4G77A 4OEVA 4NF5A 2THIA 1ATGA 1EZOA 4KQPA 3PMVA 4PFBA 3VXBA 3SESA 1USYE 2ONKE 3DLNA 2Q74A 1OQGA 4P0IA 3PUYE 5H8NA 4OEUA 1CB6A 2DP8A 5F7VA 1Y3PA 3TTMA 3IJOB 1NUYA 4MIJA 1URGA 2P2AA 1JVXA 2G93A 4P1LA 4KYSA 4IR8A 2JJKA 3Q25A 4EF2A 3S9MC 2OJTA 5AA3A 1NI9A 4YKKA 4BDLA 3ROJA 1XOCA 3DP8A 1FCKA 2Q89A 4TOZA 3M8UA 1SI0A 4EXLA 1URSA 1NNKA 2FIEA 1LAGE 4G68B 5K2XA 1MH4A 5HBCA 4NAPA 3PPPA 4M1VA 3HSTA 5H8FB 5B70A 3O9PA 2ALUA 1MQIA 4MEVA 1LAHE 5AA2D 4ZZEA 3CG1A 2Z8EA 1MRPA 5I2NB 2DWIA 2ZYMA 3G3GA 2DDKA 4GD5A 3A09A 1PB8A 2XD3A 3IOUA 4PAKA 5AA2B 4H1XA 1EZPA 4H0WA 1BK4A 3T93B 5K2YA 2ZYKA 4R6HA 4ESXA 3TYHA 1B3HA 2XXUA 4ZEKA 1RYOA 3TCGA 4GRKA 4XKRA 4P0GA 3Q29A 2O68A 2Y7PA 4ND9A 4OETA 4F1UA 4Q0CA 1N7XA 1VDWA 4XF5A 3OO7A 4F22A 4JDFA 3KN8A 1B32A 5CMBA 4N17A 4PF6A 4GOTA 3RNNA 3K00A 4Z7EA 1S9TA 3W15C 4JB7A 4Q8RA 3O97A 2WX9A 3C9HA 4MH5A 3H6WA 3QK6A 2Q9TA 4OVJA 2ONSA 4AB6A 2H99A 5LDZA 1PB9A 3FD3A 1EU8A 3USDA 3G3JA 3TKDA 1LLSA 2AL4A 2XXTA 1NV6A 2I49A 5F24A 4N13A 4GX4A 3PMWA 3KEIA 1BLFA 3THIA 3QUFA 4DXUA 4XKQA 2RKMA 2W7YA 3EQ1A 4IGRA 1FPFA 2I0CA 4PFTA 4NQ8A 5I59A 4TLLB 1N3WA 3KSXA 4KPTA 3FJ7A 2CEYA 4NF6A 2E1SA 2PFZA 2LAOA 4GWXA 1P1UA 5IAIA 3RY3A 4NX1A 1EYKA 3SKPA 1NV1A 2CMOA 3QSLA 4RY1A 2VD2A 1NV7A 1B5HA 2O6AA 2F34A 2Z23A 1LGBC 3Q28A 2VP1A 1XVXA 1SQYA 5CI5A 1MQGA 2P3NA 4XEQA 1ZMGA 4OTEA 1D4NA 2YJPA 2UXAA 3MPLA 1FPBA 5KDTA 3HFUA 4NTLA 4NGUA 3G3IA 5EHSA 1G0HA 4GWYA 5CRYA 5EYFA 4U4XA 1MY0A 3FVKA 3K0VA 1FBGA 2X7PA 2I4BA 3KBZA 1IXIA 1CE2A 3SDFA 2CEXA 3IK6B 3MPKA 1QGXA 1FQCA 5HPQA 4G4PA 4JXIA 5DEXA 1ZU0A 5H8HB 3Q27A 3W9WA 1PBPA 5HM4B 1GTKA 1G0IA 2Y7RA 3LUZA 5I7IA 1BP5A 4X1DA 2F35A 4YKPA 5B7DA 2I3VA 1WODA 4I40A 1ZJLA 2M8CA 2WYPA 2Z8FA 2A5TA 1FJ6A 4YB5A 1FQBA 3RYDA 1ZIUA 3KOSA 1YTVA 2GQ1A 3K01A 3CFLA 1TT1A 4F1VA 4IO5A 2V4CA 2Y5KA 4NF6B 3FASA 3FVNA 3KGCA 1VFEA 1IMBA 3K2DA 2XA5A 2G29A 2ZXTA 2H4IA 2I4CA 3OO8A 3DM0A 5DVFA 3T96B 1I6BA 3N5LA 4PFIA 2HXWA 4IB2A 1UQWA 1MY1A 1FBCA 2P1SA 3FXRA 1FQFA 1Y1ZA 1NH7A 4NE4A 5H8SA 4DCXA 3CHGA 4EQBA 1LFGA 3OO9A 4DDDA 4PGPA 1QJMA 2GH9A 1FPDA 4OVTA 3ZKLA 4F3PA 3CR9A 2BJIA 3IR1A 1ZTYA 4BDNA 3FXBA 3PD9A 4OVRA 3OXNA 1PDAA 1BIYA 3DP6A 3BFTA 4BDRA 3MZ1A 4ZEFA 4R9FA 3T9VA 3CI8A 3BIGA 3GZGA 4AB5A 1XHYA 3EKIA 3IFAA 3PD8A 1SW2A 3LC8A 4U2RA 2PBWA 2F3BA 4L17A 3RUMA 5L9OA 3H6UA 4O3CA 3H4ZA 4GBVA 4P56A 1P99A 2QS1A 1SW5A 3MSTA 1MQJA 3IO6A 4E0WA 4KXPA 4GLIA 4NWDA 3PGFA 3ODBA 4ONYA 3C4MA 1MXZA 2DVZA 5A5XA 2FHYA 2NWJA 4MLVA 5ET8A 2V3TA 1Z7NE 3TZAA 3C33A 1TFDA 4QSEA 2V3UA 1MDP1 4GQOA 4JBZA 2REJA 4MMPA 1FPEA 3B7DA 4R2BA 1US4A 4AS5A 3KN3A 3UIFA 3L6GA 1D9VA 3S4UA 1M5CA 3CG3A 4QFLA 4H8IA 3FVGA 1A8FA 1YYZA 2VT5A 4OVSA 1SD3A 1B46A 4OA4A 5A5LA 1FQEA 4ZE9A 5KCJA 1PC3A 2NOOA 1JW1A 1NV4A 4P1EA 1B5IA 2PT2A 4PFUA 3RTFB 3C32A 4Q5TA 4IO7A 4MHFA 3OSRA 1SYIA 4F3GA 2F97A 4PETA 3RLFE 4GWWA 3CIJA 1IMDA 3RPLB 1NL5A 2I3WA 3RTWB 1IMFA 2O7IA 3VDFA 1Y3QA 3M3FA 5BUUA 4WEPA 3FATA 5I57B 1T0KA 3EHSA 1ANFA 4ZZAA 4IO2A 1MQDA 3HHFA 2VGQA 3ONMA 1KA1A 2KQZA 1H45A 1AWBA 3VLUA 5A5XB 2F7AA 1SI1A 3MW0A 2ZMBA 3UP9A 3MZBA 5JTYB 3TPAA 5I56B 5I3SA 1A40A 4FBPA 4OANA 4KYDA 3VV5A 3SZPA 5TP9B 3GBBA 5EQ7A 1MXWA 2FYIA 1IEJA 1AOVA 2F6PA 4N4UA 1B05A 2I48A 1NNFA 5IKBA 3TEPA 4GBWA 5FHNA 2Q2AA 3OO6A 4DIGA 3QXMA 3V5AA 5TPAA 2XXHA 4OHNA 1A8EA 4DLDA 2QVRA 3RQTA 2UVGA 2AYSA 3N6TA 2ZNSA 4P3LA 4YB7A 2QMXA 2UVIA 1N0TA 5AA4B 1K9YA 5DW8A 1VE4A 3CSGA 4RXLA 3OMBA 1JETA 4Q30B 5EYHA 2QRYA 3O2AA 1NMUA 2ZYOA 3VVFA 1P1OA 3RN8A 3PPRA 4KCDA 2XX9A 1LBBA 2XXVA 3TCFA 2VHAA 1M5EA 2AL5A 1P1WA 2Q2CA 4P11A 5FHOA 1ELJA 3KBRA 2RINA 5ET7A 2H9BA 4NMYA 3CFXA 2OBGA 1LBXA 4PQJA 3N26A 4K3FA 4H67A 2DSFA 1NH8A 3KG2A 4LZ7A 2Y5LA 2XX7A 4GWSA 4RPNA 4R6YA 1US5A 2ZZWA 3FV2A 5ICQA 4QXDA 4OVQA 3MC2A 1FTKA 4U4SA 1MS7A 1USYH 3V89B 4G8MA 1FBPA 1FRPA 1SPIA 4ZE8A 4HCYA 1RDYA 3SERA 3OEMA 3OEKA 3IAZA 5I2KA 3FGSA 5EHMA 4XKPA 4YICA 4E0XA 3LSWA 4KR5A 3IX1A 3N94A 4N8YA 3W9VA 3QUJA 3JZJA 3B6QA 4N6KA 4DCYA 4MX6A 3IB0A 2XHDA 4F2QA 1O7TA 1RYXA 1B2HA 1SVXB 3MQ9A 1NNPA 3HHGA 4YKIA 3BKIB 4BDQA 4ZEDA 3K1NA 1UTHA 3LSLA 1DPPA 4NF5B 3IB1A 3M3LA 4NF0A 1NV5A 1I69A 4UABA 5JEIA 3MVWA 1H76A 2CZIA 1DOTA 5JK4A 3MVZA 3U92A 5H8NB 2O84X 1SYHA 4YMBA 3SEWA 5AE4A 1FTLA 4UACA 1IQ7A 4RPOA 1IXCA 3UK4A 1IXHA 4PE3A 2HQ0A 2RF1A 2VPOA 4G8HA 1FBEA 3B6WA 4FIMA 3WAEA 3CVGA 4FAJA 2OWTA 3ISPA 2OCUA 3K1PA 1FBFA 1MPBA 2RC7A 2DE2A 4R72A 1B4HA 1FJ9A 4NF8A 1B40A 3OD7A 3U72A 2UVHA 2PVUA 4QFPA 1MXUA 3HN0A 1L5TA 2B4MA 4QSDA 4AQ4A 1I6QA 4PBQA 5CMMA 2GHAA 2RC9A 2XWOA 4FATA 2HEUA 2Q8JA 3U1OA 1A55A 5IZ3A 4R74A 1B1HA 3LBSA 3B8BA 3RGYA 2D5WA 3C36A 3EPEA 3MUQA 4LVQA 2PX1A 1PEBA 3UA8A 3ECRA 3V8XB 4NF4A 2F6GA 2RCBA 5L8DA 2PMSA 3MP1A 2V25A 4BDOA 1QKAA 5ET5A 1UIUA 1Y1MA 5ELVA 2RCAA 1IUDA 4C1UA 1H44A 4OFJA 4N15A 4QRZA 4KHZE 3OSQA 1GR2A 4O94A 3D4CA 3GXAA 2KLFA 3MWBA 1FTMA 4PE5B 3IJXB 3T66A 2X26A 1A99A 1R1NA 2FBPA 4LN5A 5CM6A 2A5SA 4NF8B 3VVDA 4BDMA 2QS3A 4POXA 3FJMA 1R9LA 2VPNA 3IL1B 2P3VA 3K6XA 2AIXA 3PMXA 4OQOA 1IXGA 1VR5A 3G3KA 3ILTB 1B1XA 4N81A 4FJPA 5I59B 1D9QA 2V84A 5DVIA 3EF7A 4JWYA 3H3GA 1OMPA 3I5OA 2HFBA 3K4UA 2O7UA 1UTBA 3C34A 3TCHA 1N04A 2Z8DA 4DI3D 5I58A 2QSXA 4GIZA 5FTHA 3O66A 5KZTA 4PFWA 3PUXE 4YKJA 1INPA 1H3DA 3IB2A 4MNIA 2DQVA 1PB7A 4LUBA 3CSBA 5KDTB 3PPNA 3TQLA 2XX8A 2NVUB 1B6HA 5H8QA 1NV3A 2DXYA 3I6VA 5DTBA 3MAMA 4I3EA 5LOMA 4U1ZA 4QHQA 3FV1A 1JVYA 1MPDA 4X8RA 5DEXB 1OIBA 4TLMB 3FIRA 2IA4A 1N7WA 3E13X 4JVDA 5L9SA 4RK2A 4U23A 1RKMA 5ICTA 1MDQA 3LR1A 5ET6A 1GGGA 2A5TB 1B5JA 4HE0A 1XS5A 4WXJA 2DWJA 3S2VA 1Q1KA 3SEYA 4P47A 1GVCA 1IMAA 4I62A 2XWKA 2QVUA 4R75A 1LCTA 3FXUA 1YAEA 4MNPA 1M5BA 4FE8A 2MKZA 3PV0E 1VSOA 1UTBB 4MBPA 4H65A 1QKBA 2B65A 3O28A 1B7UA 2B3BA 2V3QA 2QL3A 4U21A 1JW5A 3V83A 2GRVA 1NNTA 4ESWA 3A3UA 1B9JA 2I0BA 1B3FA 2NXOA 1GV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DP4 A;  4PBH A;  4QFN A;  4OMB A;  4F2O A;  3O6G A;  1F9B A;  3O29 A;  1IZ1 A;  4H5F A;  4KD5 A;  3KZG A;  5H8Q B;  3HO7 A;  4X9T A;  5L9M A;  3M3K A;  1DPE A;  1XVY A;  2DWA A;  3EHU A;  3D4G A;  3OOA A;  2DXR A;  4KYE A;  4LON B;  3BBR A;  1OVT A;  3H06 B;  4OFO A;  2Y7W A;  3N6U A;  4H5G A;  5AA1 A;  4R9G A;  2HZL A;  2HCA A;  1MXX A;  2VOZ A;  4C0R A;  4O8M A;  2XXR A;  1Y20 A;  4MNC A;  2I58 A;  3IOR A;  4N6P A;  4IY5 A;  2FA7 A;  3SEU A;  4N8G A;  3PU5 A;  1LFH A;  3K1M A;  4JWO A;  4NWC A;  2DVC A;  2V93 A;  1QUL A;  3VLW A;  4OWD A;  3KOT A;  4F3S A;  3MBP A;  4MAG A;  2HPG A;  1ZBM A;  1Y9U A;  4PFR A;  2UYE A;  1MPC A;  3TTK A;  3TUS A;  4ELR A;  5DVJ A;  5CBS A;  3U65 A;  2FNC A;  4I1D A;  4WKM A;  3AXF A;  4ELO A;  1QW0 A;  1I6A A;  2QS2 A;  3IOW A;  1FTO A;  5KCJ B;  3QAX A;  4KI0 E;  4EUO A;  5CC2 A;  1UIV A;  1BTJ A;  3FJG A;  4KFQ A;  4C1T A;  4G68 A;  1A54 A;  4ISU A;  1QUK A;  4EXK A;  4H8J A;  4IO6 A;  2XWV A;  3GBA A;  4FEC A;  3EHT A;  3H6V A;  1Y3N A;  4DXC A;  4XTC Q;  5I2N A;  3TTN A;  2XXI A;  3I3V A;  2XXP A;  4GL0 A;  2XWI A;  5AA2 A;  3GLB A;  1MM6 A;  1FW0 A;  1M5D A;  2ZYN A;  2O51 A;  4OVP A;  2REG A;  2E0S A;  1MY3 A;  2X7Q A;  3JV9 A;  4WED A;  3TQW A;  3RT8 A;  5CMC A;  4F19 A;  3VLV A;  4EQ9 A;  2Y7K A;  4ECF A;  3PPO A;  5TPA B;  5TU0 A;  3FUZ A;  4F1Y A;  2D3I A;  3LSF B;  4ZS9 A;  3UOR A;  1AMF A;  4ZDM A;  3DEL B;  3E3K A;  4PCD A;  1TFA A;  2ZZV A;  2ESN A;  1HSL A;  5IM2 A;  4G2Z A;  3VE1 B;  4I8C A;  4ZEB A;  4XFE A;  3SEV A;  3TFL A;  2XD2 A;  1SDX A;  5F1Q A;  4PC9 A;  4X04 A;  1B0H A;  5DYH A;  3UN6 A;  4ELQ A;  2H5Y A;  2Q88 A;  4X48 A;  1N84 A;  3TOD A;  3A3C A;  2IEE A;  1MY4 A;  2DE3 A;  4YMA A;  1P1Q A;  4JSO A;  1P1N A;  4PAI A;  4GF8 A;  4POW A;  2HAU A;  4RA1 A;  1HSJ A;  1BKA A;  4DXB A;  1B3L A;  3IO4 A;  3WAF A;  1Y4C A;  2OWS A;  1B7Z A;  4NHB A;  3K6U A;  2YLN A;  2PYY A;  4GXA A;  4EQ7 A;  2P0S A;  3ZS6 A;  3T9H B;  1AH5 A;  2ZNT A;  3QYT A;  4DI4 B;  4LQ5 A;  5H8H A;  1LST A;  3R6U A;  4XIG Q;  4ZEC A;  1B4Z A;  5I2K B;  4OER A;  2QS4 A;  5ITO A;  5J1D A;  4PAF A;  4LQ2 A;  1LB9 A;  3K6V A;  3MZ9 A;  2WYK A;  3TTR A;  2RC8 A;  2DYX A;  4LP2 B;  4LAT A;  4YZZ A;  5DT6 A;  2DS9 A;  1DTG A;  3TAJ A;  1KWH A;  2QJE A;  2OK2 A;  4MLQ A;  4GXS B;  3E4R A;  4U22 A;  1DSN A;  3VFJ A;  1Y4T A;  3TEL A;  3MJN A;  1UTH B;  3FVO A;  4TQU Q;  2UYF A;  1J1N A;  3S9E A;  1MH3 A;  4MFI A;  4NG7 A;  2WKY A;  4QSC A;  3PUW E;  4FED A;  1EZ9 A;  3F11 A;  1A7L A;  3LSX A;  4PP0 A;  3TTL A;  2O1L A;  4JSD A;  1B3G A;  1WDN A;  2BJJ X;  2CZL A;  2OZZ A;  5I84 A;  1JEU A;  1OVB A;  1QUJ A;  1FQD A;  2XXK A;  3MP8 A;  1B3E A;  1YPN A;  2QPQ A;  1POY 1;  1VFD A;  1Q35 A;  4THI A;  5CBR A;  1XC1 A;  1WVJ A;  2ANJ A;  4OES A;  3G7W A;  3JYR A;  4OYV A;  2R71 A;  1FQA A;  4OFL A;  4O3B A;  4G8N A;  3HV1 A;  3T22 A;  4IY6 A;  4LA9 A;  4PDH A;  3KJ7 A;  2H98 A;  4HS7 A;  4FEB A;  1TXF A;  4RK9 A;  1YCJ A;  4NF4 B;  1O64 A;  3IOV A;  5IGA A;  2D21 A;  4IO3 A;  3MP6 A;  1N76 A;  2ZNU A;  1SW4 A;  2F78 A;  2F8D A;  3KFM A;  3O6I A;  1NFT A;  2I6E A;  1B52 A;  3GYY A;  3R26 A;  2XXQ A;  1H43 A;  2F5X A;  4RJZ A;  3HCQ A;  3MVX A;  1ZLQ A;  3SET A;  2XXX A;  1MM7 A;  3Q26 A;  1OLC A;  5ITP A;  3BFU A;  4EDP A;  1NKX A;  1LCF A;  2R6G E;  3KJT A;  3S9N C;  1FTJ A;  1JNF A;  4QFK A;  2O1M A;  2F7B A;  1R9Q A;  4G68 C;  3CFZ A;  2DWH A;  1JEV A;  1S50 A;  3G3F A;  2PFY A;  2HZK A;  3U93 A;  2QMW A;  1DTZ A;  3RPW A;  1N3X A;  3K02 A;  1LBC A;  1OLA A;  4O3A A;  1AL3 A;  3T9U A;  4OEN A;  1LFI A;  5I57 A;  2Y84 A;  1D3K A;  3EN3 A;  1HSE A;  2UVJ A;  3MVY A;  4LZ8 A;  4F18 A;  5I58 B;  5I5P A;  1LAX A;  2H25 A;  4I9D A;  3TMG A;  3B6T A;  2NUV A;  1EH3 A;  3RT6 B;  1DMB A;  2R9J A;  3FZV A;  3H03 A;  3ZSF A;  4X1B A;  1MXY A;  4GWO A;  4N07 A;  3OEL A;  4R73 A;  3L6H A;  5JTY A;  4RYA A;  5I56 A;  3PUZ E;  4PDD A;  4ZEI A;  1QVS A;  1B0L A;  4R2F A;  5TP9 A;  5M2V A;  3VVE A;  3S9L C;  1XT8 A;  1MG1 A;  4N6D A;  4F31 B;  3T9X B;  1R6Z A;  4EF1 A;  2XXW A;  3R7X A;  3P7I A;  4M4G A;  1D9Y A;  1MXV A;  5FHM A;  3O6H A;  1B51 A;  3IOT A;  2VD3 A;  3U8Q A;  2XXY A;  4YAH X;  1QUI A;  2ZZX A;  5CMK A;  2Z22 A;  3QIM A;  1MY2 A;  4HCW A;  3ZKK A;  5AA4 A;  3G3H A;  4JWX A;  4PGN A;  1IIW A;  3LUY A;  1MQH A;  4U1O A;  4H6D A;  2ABH A;  4O7M A;  4GL8 A;  4MF3 A;  3FXQ A;  5BWJ A;  4KCC A;  4QF9 A;  4IO4 A;  4IGT A;  2OLB A;  4LZ5 A;  4OZ9 A;  3B50 A;  4R6K A;  2ONR A;  4YU0 A;  4OXV A;  1IIT A;  3CRB A;  1B7H A;  1II5 A;  2DE4 A;  1Z7M E;  4DE8 A;  2B3F A;  3OEN A;  5LTC A;  5IZZ A;  4XKN A;  2GFE A;  4F39 A;  1B58 A;  3PUV E;  4F29 A;  4N91 A;  4GFR A;  3ILU B;  1O63 A;  4RNS A;  3HPI A;  3VXC A;  1POT A;  1URD A;  3E9X A;  2HAV A;  3H7M A;  3PPQ A;  3SEX A;  1ZKB A;  2Y7I A;  1AIV A;  4ELP A;  5ISU A;  4PFY A;  3KN7 A;  1M5F A;  2DOJ A;  4YB6 A;  4DZ1 A;  3K6W A;  4HW8 A;  1JQF A;  1LB8 A;  4QFO A;  4BLA A;  3UGW A;  4XXU A;  2O69 A;  4FOR A;  4MCO A;  4UA8 A;  1SW1 A;  5H8F A;  1PBQ A;  4GVO A;  4F3B A;  4P8B A;  4PF8 A;  1TWY A;  2F36 A;  1SBP A;  4HTG A;  2PT1 A;  1JW4 A;  3KSJ A;  2F7C A;  2YPN A;  3H6T A;  2GHB A;  3C31 A;  3U94 A;  1S7Y A;  1OQH A;  4NED A;  3C35 A;  1LAF E;  4P9K A;  5FTI A;  4Z0I A;  3TDJ A;  4NN3 A;  4G77 A;  4OEV A;  4NF5 A;  2THI A;  1ATG A;  1EZO A;  4KQP A;  3PMV A;  4PFB A;  3VXB A;  3SES A;  1USY E;  2ONK E;  3DLN A;  1OQG A;  4P0I A;  3PUY E;  5H8N A;  4OEU A;  1CB6 A;  2DP8 A;  5F7V A;  1Y3P A;  3TTM A;  3IJO B;  4MIJ A;  1URG A;  2P2A A;  1JVX A;  2G93 A;  4P1L A;  4KYS A;  3Q25 A;  4EF2 A;  3S9M C;  2OJT A;  5AA3 A;  4YKK A;  4BDL A;  1XOC A;  3DP8 A;  1FCK A;  2Q89 A;  4TOZ A;  3M8U A;  1SI0 A;  4EXL A;  1URS A;  1NNK A;  1LAG E;  4G68 B;  5K2X A;  1MH4 A;  5HBC A;  4NAP A;  3PPP A;  4M1V A;  3HST A;  5H8F B;  5B70 A;  3O9P A;  2ALU A;  1MQI A;  4MEV A;  1LAH E;  5AA2 D;  4ZZE A;  3CG1 A;  2Z8E A;  1MRP A;  5I2N B;  2DWI A;  2ZYM A;  3G3G A;  4GD5 A;  3A09 A;  1PB8 A;  2XD3 A;  3IOU A;  4PAK A;  5AA2 B;  4H1X A;  1EZP A;  4H0W A;  3T93 B;  5K2Y A;  2ZYK A;  4R6H A;  4ESX A;  3TYH A;  1B3H A;  2XXU A;  4ZEK A;  1RYO A;  3TCG A;  4GRK A;  4XKR A;  4P0G A;  3Q29 A;  2O68 A;  2Y7P A;  4ND9 A;  4OET A;  4F1U A;  4Q0C A;  1N7X A;  4XF5 A;  3OO7 A;  4F22 A;  4JDF A;  3KN8 A;  1B32 A;  5CMB A;  4N17 A;  4PF6 A;  4GOT A;  3RNN A;  3K00 A;  4Z7E A;  1S9T A;  3W15 C;  4JB7 A;  4Q8R A;  3O97 A;  2WX9 A;  3C9H A;  4MH5 A;  3H6W A;  3QK6 A;  2Q9T A;  4OVJ A;  2ONS A;  4AB6 A;  2H99 A;  1PB9 A;  3FD3 A;  1EU8 A;  3USD A;  3G3J A;  3TKD A;  1LLS A;  2AL4 A;  2XXT A;  2I49 A;  4N13 A;  3PMW A;  3KEI A;  1BLF A;  3THI A;  3QUF A;  4DXU A;  4XKQ A;  2RKM A;  2W7Y A;  3EQ1 A;  4IGR A;  2I0C A;  4PFT A;  4NQ8 A;  5I59 A;  4TLL B;  1N3W A;  3KSX A;  4KPT A;  3FJ7 A;  2CEY A;  4NF6 A;  2E1S A;  2PFZ A;  2LAO A;  1P1U A;  5IAI A;  3RY3 A;  4NX1 A;  3SKP A;  2CMO A;  3QSL A;  4RY1 A;  2VD2 A;  1B5H A;  2O6A A;  2F34 A;  2Z23 A;  1LGB C;  3Q28 A;  2VP1 A;  1XVX A;  1SQY A;  5CI5 A;  1MQG A;  4XEQ A;  1ZMG A;  4OTE A;  1D4N A;  2YJP A;  2UXA A;  3MPL A;  5KDT A;  4NTL A;  4NGU A;  3G3I A;  5EHS A;  5CRY A;  5EYF A;  4U4X A;  1MY0 A;  3FVK A;  3K0V A;  2X7P A;  2I4B A;  1IXI A;  1CE2 A;  3SDF A;  2CEX A;  3IK6 B;  3MPK A;  1FQC A;  5HPQ A;  4G4P A;  4JXI A;  5DEX A;  1ZU0 A;  5H8H B;  3Q27 A;  3W9W A;  1PBP A;  5HM4 B;  1GTK A;  5I7I A;  2Y7R A;  1BP5 A;  4X1D A;  2F35 A;  4YKP A;  5B7D A;  2I3V A;  1WOD A;  1ZJL A;  2M8C A;  2WYP A;  2Z8F A;  2A5T A;  4YB5 A;  1FQB A;  1ZIU A;  3KOS A;  1YTV A;  3K01 A;  3CFL A;  1TT1 A;  4F1V A;  4IO5 A;  2V4C A;  4NF6 B;  3FAS A;  3FVN A;  3KGC A;  1VFE A;  3K2D A;  2XA5 A;  2G29 A;  2ZXT A;  2H4I A;  2I4C A;  3OO8 A;  3DM0 A;  5DVF A;  3T96 B;  1I6B A;  3N5L A;  4PFI A;  2HXW A;  4IB2 A;  1UQW A;  1MY1 A;  2P1S A;  3FXR A;  1FQF A;  1Y1Z A;  1NH7 A;  4NE4 A;  5H8S A;  4DCX A;  4EQB A;  1LFG A;  3OO9 A;  4DDD A;  4PGP A;  1QJM A;  2GH9 A;  4OVT A;  3ZKL A;  4F3P A;  3CR9 A;  3IR1 A;  1ZTY A;  4BDN A;  3FXB A;  3PD9 A;  4OVR A;  3OXN A;  1PDA A;  1BIY A;  3DP6 A;  3BFT A;  4BDR A;  3MZ1 A;  4ZEF A;  4R9F A;  3T9V A;  3CI8 A;  3GZG A;  4AB5 A;  1XHY A;  3PD8 A;  1SW2 A;  3LC8 A;  4U2R A;  2PBW A;  4L17 A;  3RUM A;  5L9O A;  3H6U A;  4O3C A;  3H4Z A;  4P56 A;  1P99 A;  2QS1 A;  1SW5 A;  1MQJ A;  3IO6 A;  4E0W A;  4GLI A;  4NWD A;  3PGF A;  3ODB A;  4ONY A;  3C4M A;  1MXZ A;  2DVZ A;  5A5X A;  2NWJ A;  4MLV A;  2V3T A;  1Z7N E;  3TZA A;  3C33 A;  1TFD A;  4QSE A;  2V3U A;  1MDP 1;  4GQO A;  4JBZ A;  2REJ A;  4MMP A;  3B7D A;  4R2B A;  1US4 A;  3KN3 A;  3UIF A;  3L6G A;  1D9V A;  3S4U A;  1M5C A;  3CG3 A;  4QFL A;  4H8I A;  3FVG A;  1A8F A;  4OVS A;  1SD3 A;  1B46 A;  4OA4 A;  1FQE A;  4ZE9 A;  5KCJ A;  1PC3 A;  2NOO A;  1JW1 A;  4P1E A;  1B5I A;  2PT2 A;  4PFU A;  3RTF B;  3C32 A;  4Q5T A;  4IO7 A;  4MHF A;  3OSR A;  1SYI A;  4F3G A;  2F97 A;  4PET A;  3RLF E;  3CIJ A;  1NL5 A;  2I3W A;  3RTW B;  2O7I A;  3VDF A;  1Y3Q A;  3M3F A;  5BUU A;  4WEP A;  3FAT A;  5I57 B;  1T0K A;  3EHS A;  1ANF A;  4ZZA A;  4IO2 A;  1MQD A;  3HHF A;  2VGQ A;  3ONM A;  1H45 A;  3VLU A;  5A5X B;  2F7A A;  1SI1 A;  3MW0 A;  2ZMB A;  3UP9 A;  3MZB A;  5JTY B;  3TPA A;  5I56 B;  1A40 A;  4OAN A;  4KYD A;  3VV5 A;  5TP9 B;  3GBB A;  1MXW A;  2FYI A;  1IEJ A;  1AOV A;  2F6P A;  4N4U A;  1B05 A;  2I48 A;  1NNF A;  5IKB A;  3TEP A;  5FHN A;  2Q2A A;  3OO6 A;  4DIG A;  3QXM A;  3V5A A;  5TPA A;  2XXH A;  4OHN A;  1A8E A;  4DLD A;  3RQT A;  2UVG A;  2AYS A;  3N6T A;  2ZNS A;  4P3L A;  4YB7 A;  2QMX A;  2UVI A;  1N0T A;  5AA4 B;  1VE4 A;  3CSG A;  4RXL A;  3OMB A;  1JET A;  4Q30 B;  2QRY A;  3O2A A;  1NMU A;  2ZYO A;  3VVF A;  1P1O A;  3RN8 A;  3PPR A;  4KCD A;  2XX9 A;  1LBB A;  2XXV A;  3TCF A;  2VHA A;  1M5E A;  2AL5 A;  1P1W A;  2Q2C A;  4P11 A;  5FHO A;  1ELJ A;  3KBR A;  2RIN A;  2H9B A;  4NMY A;  3CFX A;  2OBG A;  4PQJ A;  3N26 A;  4K3F A;  4H67 A;  2DSF A;  1NH8 A;  3KG2 A;  4LZ7 A;  2XX7 A;  4RPN A;  4R6Y A;  1US5 A;  2ZZW A;  3FV2 A;  5ICQ A;  4OVQ A;  3MC2 A;  1FTK A;  4U4S A;  1MS7 A;  1USY H;  3V89 B;  4G8M A;  4ZE8 A;  4HCY A;  3SER A;  3OEM A;  3OEK A;  3IAZ A;  5I2K A;  3FGS A;  5EHM A;  4XKP A;  4YIC A;  4E0X A;  3LSW A;  4KR5 A;  3IX1 A;  3N94 A;  4N8Y A;  3W9V A;  3QUJ A;  3JZJ A;  3B6Q A;  4N6K A;  4DCY A;  4MX6 A;  3IB0 A;  2XHD A;  4F2Q A;  1O7T A;  1RYX A;  1B2H A;  1SVX B;  3MQ9 A;  1NNP A;  3HHG A;  4YKI A;  3BKI B;  4BDQ A;  4ZED A;  3K1N A;  1UTH A;  3LSL A;  1DPP A;  4NF5 B;  3IB1 A;  3M3L A;  4NF0 A;  1I69 A;  4UAB A;  5JEI A;  3MVW A;  1H76 A;  1DOT A;  5JK4 A;  3MVZ A;  3U92 A;  5H8N B;  2O84 X;  1SYH A;  4YMB A;  3SEW A;  5AE4 A;  1FTL A;  4UAC A;  1IQ7 A;  4RPO A;  1IXC A;  3UK4 A;  1IXH A;  4PE3 A;  2HQ0 A;  2RF1 A;  2VPO A;  4G8H A;  3B6W A;  4FIM A;  3WAE A;  3CVG A;  4FAJ A;  2OWT A;  2OCU A;  3K1P A;  1MPB A;  2RC7 A;  2DE2 A;  4R72 A;  1B4H A;  4NF8 A;  1B40 A;  3OD7 A;  3U72 A;  2UVH A;  2PVU A;  4QFP A;  1MXU A;  3HN0 A;  1L5T A;  4QSD A;  4AQ4 A;  1I6Q A;  4PBQ A;  5CMM A;  2GHA A;  2RC9 A;  2XWO A;  4FAT A;  2HEU A;  2Q8J A;  3U1O A;  1A55 A;  4R74 A;  1B1H A;  3LBS A;  3RGY A;  2D5W A;  3C36 A;  3EPE A;  3MUQ A;  4LVQ A;  2PX1 A;  1PEB A;  3UA8 A;  3ECR A;  3V8X B;  4NF4 A;  2F6G A;  2RCB A;  5L8D A;  2PMS A;  3MP1 A;  2V25 A;  4BDO A;  1QKA A;  1UIU A;  1Y1M A;  5ELV A;  2RCA A;  1IUD A;  4C1U A;  1H44 A;  4OFJ A;  4N15 A;  4QRZ A;  4KHZ E;  3OSQ A;  1GR2 A;  4O94 A;  3D4C A;  3GXA A;  2KLF A;  3MWB A;  1FTM A;  4PE5 B;  3IJX B;  3T66 A;  2X26 A;  1A99 A;  1R1N A;  4LN5 A;  5CM6 A;  2A5S A;  4NF8 B;  3VVD A;  4BDM A;  2QS3 A;  4POX A;  3FJM A;  1R9L A;  2VPN A;  3IL1 B;  3K6X A;  2AIX A;  3PMX A;  4OQO A;  1IXG A;  1VR5 A;  3G3K A;  3ILT B;  1B1X A;  4FJP A;  5I59 B;  2V84 A;  5DVI A;  3EF7 A;  4JWY A;  3H3G A;  1OMP A;  3I5O A;  2HFB A;  3K4U A;  2O7U A;  1UTB A;  3C34 A;  3TCH A;  1N04 A;  2Z8D A;  4DI3 D;  5I58 A;  2QSX A;  4GIZ A;  5FTH A;  3O66 A;  5KZT A;  4PFW A;  3PUX E;  4YKJ A;  1H3D A;  3IB2 A;  4MNI A;  2DQV A;  1PB7 A;  4LUB A;  3CSB A;  5KDT B;  3PPN A;  3TQL A;  2XX8 A;  2NVU B;  1B6H A;  5H8Q A;  2DXY A;  3I6V A;  5DTB A;  3MAM A;  5LOM A;  4U1Z A;  4QHQ A;  3FV1 A;  1JVY A;  1MPD A;  4X8R A;  5DEX B;  1OIB A;  4TLM B;  3FIR A;  2IA4 A;  1N7W A;  3E13 X;  5L9S A;  4RK2 A;  4U23 A;  1RKM A;  5ICT A;  1MDQ A;  3LR1 A;  1GGG A;  2A5T B;  1B5J A;  1XS5 A;  4WXJ A;  2DWJ A;  3S2V A;  1Q1K A;  3SEY A;  4P47 A;  1GVC A;  4I62 A;  2XWK A;  4R75 A;  1LCT A;  3FXU A;  1YAE A;  4MNP A;  1M5B A;  4FE8 A;  3PV0 E;  1VSO A;  1UTB B;  4MBP A;  4H65 A;  1QKB A;  2B65 A;  3O28 A;  1B7U A;  2B3B A;  2V3Q A;  2QL3 A;  4U21 A;  1JW5 A;  3V83 A;  2GRV A;  1NNT A;  4ESW A;  3A3U A;  1B9J A;  2I0B A;  1B3F A;  2NXO A;  1GV8 A; 
#chains in the Genus database with same CATH topology
 3DP4 A;  4PBH A;  4QFN A;  4OMB A;  4F2O A;  3O6G A;  1F9B A;  3O29 A;  3LV0 A;  1IZ1 A;  4H5F A;  4KD5 A;  3KZG A;  5H8Q B;  1KA0 A;  3HO7 A;  1NUZ A;  4X9T A;  4GX3 A;  5L9M A;  3M3K A;  1DPE A;  1XVY A;  2DWA A;  3E79 A;  3EHU A;  3D4G A;  3OOA A;  2DXR A;  4KYE A;  1FBD A;  4LON B;  3BBR A;  1OVT A;  3H06 B;  5J16 A;  4OFO A;  2Y7W A;  3N6U A;  4H5G A;  5AA1 A;  1RDX A;  3T1B A;  4R9G A;  1LEV A;  2HZL A;  2HCA A;  1MXX A;  2VOZ A;  4C0R A;  3IFC A;  4O8M A;  2XXR A;  1Y20 A;  3BIH A;  4MNC A;  2I58 A;  3MYU A;  3IOR A;  2OWZ A;  4N6P A;  4IY5 A;  2FA7 A;  3SEU A;  4N8G A;  3PU5 A;  1LFH A;  3K1M A;  4JWO A;  4NWC A;  2DVC A;  2V93 A;  1QUL A;  3VLW A;  5EQA A;  4OWD A;  3KOT A;  4F3S A;  3MBP A;  4MAG A;  2HPG A;  1LBY A;  1ZBM A;  1Y9U A;  4PFR A;  2UYE A;  4QBA A;  2B4L A;  5FBP A;  1MPC A;  3TTK A;  3TUS A;  4ELR A;  5DVJ A;  3U65 A;  5CBS A;  2FNC A;  4I1D A;  4WKM A;  3AXF A;  1IME A;  4ELO A;  1QW0 A;  1I6A A;  2QS2 A;  4H46 A;  2F3D A;  1LBV A;  3IOW A;  1FTO A;  5KCJ B;  3QAX A;  4KI0 E;  4EUO A;  5CC2 A;  1UIV A;  1BTJ A;  3FJG A;  4KFQ A;  4C1T A;  2KR0 A;  4G68 A;  1A54 A;  4ISU A;  2WBD A;  1QUK A;  4EXK A;  4H8J A;  4IO6 A;  4HE2 A;  2XWV A;  3GBA A;  4FEC A;  2PCR A;  3EHT A;  1FTA A;  3H6V A;  1Y3N A;  4DXC A;  5ESY A;  4XTC Q;  5I2N A;  3TTN A;  2XXI A;  3I3V A;  2XXP A;  4GL0 A;  2XWI A;  5AA2 A;  2QFL A;  2OX3 A;  3GLB A;  1MM6 A;  1FW0 A;  1M5D A;  2ZYN A;  2O51 A;  4OVP A;  2WBB A;  2REG A;  2E0S A;  1MY3 A;  2X7Q A;  4HE1 A;  3JV9 A;  4WED A;  3E78 A;  1NV2 A;  3FBP A;  3T0J A;  5EQ9 A;  3TQW A;  3RT8 A;  5CMC A;  4F19 A;  3VLV A;  4EQ9 A;  1KZ8 A;  2Y7K A;  4ECF A;  3PPO A;  5TPA B;  5TU0 A;  3D1R A;  3FUZ A;  4F1Y A;  2D3I A;  3LSF B;  4ZS9 A;  3UOR A;  1AMF A;  4ZDM A;  1FPL A;  3DEL B;  3E3K A;  2R8T A;  4PCD A;  1TFA A;  2ZZV A;  2ESN A;  1HSL A;  5IM2 A;  4G2Z A;  3VE1 B;  4I8C A;  4ZEB A;  4XFE A;  3SEV A;  3TFL A;  2XD2 A;  1SDX A;  4PC9 A;  5F1Q A;  4X04 A;  1B0H A;  5DYH A;  3UN6 A;  4ELQ A;  2H5Y A;  2Q88 A;  2CZK A;  4X48 A;  1N84 A;  3TOD A;  3A3C A;  2IEE A;  1MY4 A;  2DE3 A;  1EYI A;  4YMA A;  1P1Q A;  4JSO A;  1P1N A;  4PAI A;  4GF8 A;  4POW A;  2HAU A;  4H45 A;  4RA1 A;  4G61 A;  1FSA A;  1HSJ A;  1BKA A;  4DXB A;  1B3L A;  3IO4 A;  3WAF A;  1Y4C A;  2OWS A;  1B7Z A;  4NHB A;  3K6U A;  2YLN A;  2PYY A;  1LBW A;  4GXA A;  4EQ7 A;  2P0S A;  3ZS6 A;  3T9H B;  1AH5 A;  2ZNT A;  3QYT A;  4DI4 B;  2FIX A;  4LQ5 A;  5H8H A;  1LST A;  3R6U A;  4XIG Q;  4ZEC A;  1B4Z A;  5I2K B;  4OER A;  2QS4 A;  5ITO A;  1FPG A;  5J1D A;  1NV0 A;  4PAF A;  4LQ2 A;  1LB9 A;  2CZH A;  3K6V A;  2WEF A;  3MZ9 A;  2WYK A;  3TTR A;  2RC8 A;  3QMF A;  2DYX A;  4LP2 B;  4LAT A;  4YZZ A;  5DT6 A;  2DS9 A;  1JP4 A;  1DTG A;  3TAJ A;  1KWH A;  2QJE A;  2OK2 A;  4MLQ A;  4GXS B;  3E4R A;  4U22 A;  1DSN A;  3VFJ A;  1Y4T A;  3TEL A;  3MJN A;  4JVI A;  1UTH B;  3FVO A;  4TQU Q;  2UYF A;  1J1N A;  3S9E A;  1MH3 A;  1FPI A;  4JVC A;  2FVZ A;  4MFI A;  4NG7 A;  2WKY A;  4QSC A;  3PUW E;  4FED A;  1EZ9 A;  3F11 A;  1A7L A;  1NUX A;  3LSX A;  4PP0 A;  3TTL A;  2O1L A;  4GWU A;  4JSD A;  1B3G A;  1WDN A;  2BJJ X;  2CZL A;  5T3J A;  2OZZ A;  5I84 A;  1JEU A;  1OVB A;  4GWZ A;  1QUJ A;  1FQD A;  2XXK A;  3MP8 A;  1B3E A;  1YPN A;  2QPQ A;  1POY 1;  1LBZ A;  1VFD A;  1FPK A;  1Q35 A;  3KC1 A;  4THI A;  5CBR A;  1XC1 A;  1WVJ A;  2ANJ A;  4OES A;  3G7W A;  3JYR A;  4OYV A;  2R71 A;  4MJO A;  1FQA A;  4OFL A;  4O3B A;  4G8N A;  1YXI A;  3HV1 A;  3T22 A;  2QVV A;  5IZ3 B;  4IY6 A;  2L5V A;  4LA9 A;  4PDH A;  3KJ7 A;  2H98 A;  1CNQ A;  4HS7 A;  4FEB A;  1TXF A;  4RK9 A;  1YCJ A;  4NF4 B;  1O64 A;  3IOV A;  4HXV A;  5IGA A;  2D21 A;  1RDZ A;  4IO3 A;  3MP6 A;  4O7I A;  1N76 A;  2ZNU A;  1SW4 A;  2F78 A;  2F8D A;  1DCU A;  3KFM A;  3O6I A;  1NFT A;  2I6E A;  1B52 A;  3GYY A;  3R26 A;  2XXQ A;  3NOH A;  1DK4 A;  1H43 A;  2F5X A;  4RJZ A;  3HCQ A;  3MVX A;  1ZLQ A;  3SET A;  2XXX A;  1MM7 A;  3Q26 A;  1OLC A;  5ITP A;  3BFU A;  4EDP A;  1NKX A;  1LCF A;  2R6G E;  3KJT A;  3S9N C;  1FTJ A;  1JNF A;  4QFK A;  2O1M A;  2F7B A;  1R9Q A;  4G68 C;  3CFZ A;  1IMC A;  2DWH A;  1JEV A;  1S50 A;  2PFY A;  3G3F A;  2HZK A;  3U93 A;  4AS4 A;  2QMW A;  1DTZ A;  3RPW A;  1N3X A;  3K02 A;  1LBC A;  1OLA A;  4O3A A;  1AL3 A;  3T9U A;  3RPL A;  4OEN A;  1LFI A;  5I57 A;  2Y84 A;  1D3K A;  3EN3 A;  1HSE A;  2UVJ A;  3MVY A;  4LZ8 A;  4F18 A;  5I58 B;  5I5P A;  1LAX A;  2H25 A;  4I9D A;  3TMG A;  4I3Y A;  5EYG A;  3B6T A;  2NUV A;  1EH3 A;  3RT6 B;  1DMB A;  2R9J A;  3FZV A;  3H03 A;  3ZSF A;  4X1B A;  1MXY A;  3A29 A;  4GWO A;  4N07 A;  3OEL A;  4R73 A;  3L6H A;  5JTY A;  4RYA A;  5I56 A;  1K9Z A;  3PUZ E;  4PDD A;  4ZEI A;  1QVS A;  1B0L A;  4R2F A;  5TP9 A;  5M2V A;  3VVE A;  3S9L C;  1XT8 A;  1MG1 A;  4N6D A;  4F31 B;  3T9X B;  1R6Z A;  4EF1 A;  2XXW A;  3R7X A;  3P7I A;  4M4G A;  1D9Y A;  1MXV A;  5FHM A;  3O6H A;  1B51 A;  3IOT A;  2VD3 A;  3U8Q A;  2XXY A;  2ZZX A;  1QUI A;  2HXR A;  4YAH X;  5CMK A;  2Z22 A;  3QIM A;  1MY2 A;  1NUW A;  4HCW A;  3ZKK A;  5AA4 A;  3G3H A;  4JWX A;  2Q8M A;  4PGN A;  1IIW A;  3LUY A;  1MQH A;  3KC0 A;  4U1O A;  4H6D A;  2ABH A;  4O7M A;  1DBZ A;  4GL8 A;  4MF3 A;  3FXQ A;  5BWJ A;  2HHM A;  1YZ0 A;  4KCC A;  4QF9 A;  4IO4 A;  4IGT A;  3PTY A;  2OLB A;  4LZ5 A;  4OZ9 A;  3B50 A;  4R6K A;  2ONR A;  4YU0 A;  4OXV A;  1IIT A;  3CRB A;  5IZ1 A;  1B7H A;  1II5 A;  2DE4 A;  1Z7M E;  4DE8 A;  2B3F A;  3OEN A;  5LTC A;  5IZZ A;  4XKN A;  2GFE A;  4F39 A;  1B58 A;  3PUV E;  4F29 A;  4N91 A;  1Q9D A;  4GFR A;  3ILU B;  1O63 A;  4RNS A;  3HPI A;  3VXC A;  1POT A;  1URD A;  3E9X A;  2HAV A;  3H7M A;  3PPQ A;  3SEX A;  1ZKB A;  2Y7I A;  1AIV A;  4ELP A;  5ISU A;  4PFY A;  3KN7 A;  1M5F A;  2DOJ A;  4YB6 A;  4DZ1 A;  3K6W A;  4HW8 A;  1JQF A;  1LB8 A;  4QFO A;  4BLA A;  3UGW A;  4XXU A;  4PTK A;  2O69 A;  4FOR A;  4MCO A;  4UA8 A;  1SW1 A;  5H8F A;  5EQ8 A;  1FPJ A;  1PBQ A;  4GVO A;  4P8B A;  4PF8 A;  4F3B A;  1EYJ A;  1TWY A;  2F36 A;  1SBP A;  4HTG A;  1FBH A;  2PT1 A;  1JW4 A;  3KSJ A;  2F7C A;  2YPN A;  3H6T A;  4GX6 A;  2GHB A;  3C31 A;  3U94 A;  1S7Y A;  1XI6 A;  1OQH A;  4NED A;  3C35 A;  1LAF E;  4P9K A;  5FTI A;  4Z0I A;  3TDJ A;  4NN3 A;  4G77 A;  4OEV A;  4NF5 A;  2THI A;  1ATG A;  1EZO A;  4KQP A;  3PMV A;  4PFB A;  3VXB A;  3SES A;  1USY E;  2ONK E;  3DLN A;  2Q74 A;  1OQG A;  4P0I A;  3PUY E;  5H8N A;  4OEU A;  1CB6 A;  2DP8 A;  5F7V A;  1Y3P A;  3TTM A;  3IJO B;  1NUY A;  4MIJ A;  1URG A;  2P2A A;  1JVX A;  2G93 A;  4P1L A;  4KYS A;  4IR8 A;  2JJK A;  3Q25 A;  4EF2 A;  3S9M C;  2OJT A;  5AA3 A;  1NI9 A;  4YKK A;  3ROJ A;  4BDL A;  1XOC A;  3DP8 A;  1FCK A;  2Q89 A;  4TOZ A;  3M8U A;  1SI0 A;  4EXL A;  1URS A;  1NNK A;  2FIE A;  1LAG E;  4G68 B;  5K2X A;  1MH4 A;  5HBC A;  4NAP A;  3PPP A;  4M1V A;  3HST A;  5H8F B;  5B70 A;  3O9P A;  2ALU A;  1MQI A;  4MEV A;  1LAH E;  5AA2 D;  4ZZE A;  3CG1 A;  2Z8E A;  1MRP A;  5I2N B;  2DWI A;  2ZYM A;  3G3G A;  2DDK A;  4GD5 A;  3A09 A;  1PB8 A;  2XD3 A;  3IOU A;  4PAK A;  5AA2 B;  1BK4 A;  4H1X A;  4H0W A;  1EZP A;  3T93 B;  5K2Y A;  2ZYK A;  4R6H A;  4ESX A;  3TYH A;  1B3H A;  2XXU A;  4ZEK A;  1RYO A;  3TCG A;  4GRK A;  4XKR A;  4P0G A;  3Q29 A;  2O68 A;  2Y7P A;  4ND9 A;  4OET A;  4F1U A;  4Q0C A;  1N7X A;  1VDW A;  4XF5 A;  3OO7 A;  4F22 A;  4JDF A;  3KN8 A;  1B32 A;  5CMB A;  4N17 A;  4PF6 A;  4GOT A;  3RNN A;  3K00 A;  4Z7E A;  1S9T A;  3W15 C;  4JB7 A;  4Q8R A;  3O97 A;  2WX9 A;  3C9H A;  4MH5 A;  3H6W A;  3QK6 A;  2Q9T A;  4OVJ A;  2ONS A;  4AB6 A;  2H99 A;  5LDZ A;  1PB9 A;  3FD3 A;  1EU8 A;  3USD A;  3G3J A;  3TKD A;  1LLS A;  2AL4 A;  2XXT A;  1NV6 A;  2I49 A;  5F24 A;  4GX4 A;  4N13 A;  3PMW A;  3KEI A;  1BLF A;  3THI A;  3QUF A;  4DXU A;  4XKQ A;  2RKM A;  2W7Y A;  1FPF A;  3EQ1 A;  4IGR A;  2I0C A;  4NQ8 A;  4PFT A;  5I59 A;  4TLL B;  1N3W A;  3KSX A;  4KPT A;  3FJ7 A;  2CEY A;  4NF6 A;  2E1S A;  2PFZ A;  2LAO A;  4GWX A;  1P1U A;  5IAI A;  3RY3 A;  4NX1 A;  1EYK A;  3SKP A;  1NV1 A;  2CMO A;  3QSL A;  4RY1 A;  2VD2 A;  1NV7 A;  1B5H A;  2O6A A;  2F34 A;  2Z23 A;  1LGB C;  3Q28 A;  2VP1 A;  1XVX A;  1SQY A;  5CI5 A;  1MQG A;  2P3N A;  4XEQ A;  4OTE A;  1ZMG A;  1D4N A;  2YJP A;  2UXA A;  3MPL A;  1FPB A;  5KDT A;  3HFU A;  4NTL A;  4NGU A;  3G3I A;  5EHS A;  1G0H A;  4GWY A;  5CRY A;  5EYF A;  4U4X A;  1MY0 A;  3FVK A;  1FBG A;  3K0V A;  2X7P A;  2I4B A;  3KBZ A;  1IXI A;  1CE2 A;  3SDF A;  2CEX A;  3IK6 B;  3MPK A;  1QGX A;  1FQC A;  5HPQ A;  4G4P A;  4JXI A;  5DEX A;  1ZU0 A;  5H8H B;  3Q27 A;  3LUZ A;  1PBP A;  3W9W A;  1GTK A;  1G0I A;  2Y7R A;  5HM4 B;  5I7I A;  1BP5 A;  4X1D A;  2F35 A;  4YKP A;  5B7D A;  2I3V A;  1WOD A;  4I40 A;  1ZJL A;  2M8C A;  2WYP A;  2Z8F A;  2A5T A;  1FJ6 A;  4YB5 A;  1FQB A;  3RYD A;  1ZIU A;  3KOS A;  1YTV A;  2GQ1 A;  3K01 A;  3CFL A;  1TT1 A;  4F1V A;  4IO5 A;  2V4C A;  2Y5K A;  4NF6 B;  3FAS A;  3FVN A;  3KGC A;  1VFE A;  1IMB A;  3K2D A;  2XA5 A;  2G29 A;  2ZXT A;  2H4I A;  2I4C A;  3OO8 A;  3DM0 A;  5DVF A;  3T96 B;  1I6B A;  3N5L A;  4PFI A;  2HXW A;  4IB2 A;  1UQW A;  1MY1 A;  1FBC A;  2P1S A;  3FXR A;  1FQF A;  1Y1Z A;  1NH7 A;  4NE4 A;  5H8S A;  4DCX A;  3CHG A;  4EQB A;  1LFG A;  3OO9 A;  4PGP A;  4DDD A;  1QJM A;  2GH9 A;  1FPD A;  4OVT A;  3ZKL A;  4F3P A;  2BJI A;  3CR9 A;  3IR1 A;  1ZTY A;  4BDN A;  3FXB A;  3PD9 A;  4OVR A;  3OXN A;  1PDA A;  1BIY A;  3DP6 A;  3BFT A;  4BDR A;  3MZ1 A;  4ZEF A;  4R9F A;  3T9V A;  3CI8 A;  3BIG A;  3GZG A;  4AB5 A;  1XHY A;  3EKI A;  3IFA A;  3PD8 A;  1SW2 A;  3LC8 A;  4U2R A;  2PBW A;  2F3B A;  4L17 A;  3RUM A;  5L9O A;  3H6U A;  4O3C A;  3H4Z A;  4GBV A;  4P56 A;  1P99 A;  2QS1 A;  1SW5 A;  3MST A;  1MQJ A;  3IO6 A;  4E0W A;  4KXP A;  4GLI A;  4NWD A;  3PGF A;  3ODB A;  4ONY A;  3C4M A;  1MXZ A;  2DVZ A;  5A5X A;  2FHY A;  2NWJ A;  4MLV A;  5ET8 A;  2V3T A;  1Z7N E;  3TZA A;  3C33 A;  1TFD A;  4QSE A;  2V3U A;  1MDP 1;  4GQO A;  4JBZ A;  2REJ A;  4MMP A;  1FPE A;  3B7D A;  4R2B A;  1US4 A;  4AS5 A;  3KN3 A;  3UIF A;  3L6G A;  1D9V A;  3S4U A;  1M5C A;  3CG3 A;  4QFL A;  4H8I A;  3FVG A;  1A8F A;  1YYZ A;  2VT5 A;  4OVS A;  1SD3 A;  1B46 A;  4OA4 A;  5A5L A;  1FQE A;  4ZE9 A;  5KCJ A;  1PC3 A;  2NOO A;  1JW1 A;  1NV4 A;  4P1E A;  1B5I A;  2PT2 A;  4PFU A;  3RTF B;  3C32 A;  4Q5T A;  4IO7 A;  4MHF A;  3OSR A;  1SYI A;  4F3G A;  2F97 A;  4PET A;  3RLF E;  4GWW A;  3CIJ A;  1IMD A;  3RPL B;  1NL5 A;  2I3W A;  3RTW B;  1IMF A;  2O7I A;  3VDF A;  1Y3Q A;  3M3F A;  5BUU A;  4WEP A;  3FAT A;  5I57 B;  1T0K A;  3EHS A;  1ANF A;  4ZZA A;  4IO2 A;  1MQD A;  3HHF A;  2VGQ A;  3ONM A;  1KA1 A;  2KQZ A;  1H45 A;  1AWB A;  3VLU A;  5A5X B;  2F7A A;  1SI1 A;  3MW0 A;  2ZMB A;  3UP9 A;  3MZB A;  5JTY B;  3TPA A;  5I56 B;  5I3S A;  1A40 A;  4FBP A;  4OAN A;  4KYD A;  3VV5 A;  3SZP A;  5TP9 B;  3GBB A;  5EQ7 A;  1MXW A;  2FYI A;  1IEJ A;  1AOV A;  2F6P A;  4N4U A;  1B05 A;  2I48 A;  1NNF A;  5IKB A;  3TEP A;  4GBW A;  5FHN A;  2Q2A A;  3OO6 A;  4DIG A;  3QXM A;  3V5A A;  5TPA A;  2XXH A;  4OHN A;  1A8E A;  4DLD A;  2QVR A;  3RQT A;  2UVG A;  2AYS A;  3N6T A;  2ZNS A;  4P3L A;  4YB7 A;  2QMX A;  2UVI A;  1N0T A;  1K9Y A;  5DW8 A;  5AA4 B;  1VE4 A;  3CSG A;  4RXL A;  3OMB A;  1JET A;  4Q30 B;  5EYH A;  2QRY A;  3O2A A;  1NMU A;  2ZYO A;  3VVF A;  1P1O A;  3RN8 A;  3PPR A;  4KCD A;  2XX9 A;  1LBB A;  2XXV A;  3TCF A;  2VHA A;  1M5E A;  2AL5 A;  1P1W A;  2Q2C A;  4P11 A;  5FHO A;  1ELJ A;  3KBR A;  2RIN A;  5ET7 A;  2H9B A;  4NMY A;  3CFX A;  2OBG A;  1LBX A;  4PQJ A;  3N26 A;  4K3F A;  4H67 A;  2DSF A;  1NH8 A;  3KG2 A;  4LZ7 A;  2Y5L A;  2XX7 A;  4GWS A;  4RPN A;  4R6Y A;  1US5 A;  2ZZW A;  3FV2 A;  5ICQ A;  4QXD A;  4OVQ A;  3MC2 A;  1FTK A;  4U4S A;  1MS7 A;  1USY H;  3V89 B;  4G8M A;  1FBP A;  1FRP A;  1SPI A;  4ZE8 A;  4HCY A;  1RDY A;  3SER A;  3OEM A;  3OEK A;  3IAZ A;  5I2K A;  3FGS A;  5EHM A;  4XKP A;  4YIC A;  4E0X A;  3LSW A;  4KR5 A;  3IX1 A;  3N94 A;  4N8Y A;  3W9V A;  3QUJ A;  3JZJ A;  3B6Q A;  4N6K A;  4DCY A;  4MX6 A;  3IB0 A;  2XHD A;  4F2Q A;  1O7T A;  1RYX A;  1B2H A;  1SVX B;  3MQ9 A;  1NNP A;  3HHG A;  4YKI A;  3BKI B;  4BDQ A;  4ZED A;  3K1N A;  1UTH A;  3LSL A;  1DPP A;  4NF5 B;  3IB1 A;  3M3L A;  4NF0 A;  1NV5 A;  1I69 A;  4UAB A;  5JEI A;  3MVW A;  1H76 A;  2CZI A;  1DOT A;  5JK4 A;  3MVZ A;  3U92 A;  5H8N B;  2O84 X;  1SYH A;  4YMB A;  3SEW A;  5AE4 A;  1FTL A;  4UAC A;  1IQ7 A;  4RPO A;  1IXC A;  3UK4 A;  1IXH A;  4PE3 A;  2HQ0 A;  2RF1 A;  2VPO A;  4G8H A;  1FBE A;  3B6W A;  4FIM A;  3WAE A;  3CVG A;  4FAJ A;  2OWT A;  3ISP A;  2OCU A;  3K1P A;  1FBF A;  1MPB A;  2RC7 A;  2DE2 A;  4R72 A;  1B4H A;  1FJ9 A;  4NF8 A;  1B40 A;  3OD7 A;  3U72 A;  2UVH A;  2PVU A;  4QFP A;  1MXU A;  3HN0 A;  1L5T A;  2B4M A;  4QSD A;  4PBQ A;  1I6Q A;  4AQ4 A;  5CMM A;  2GHA A;  2RC9 A;  2XWO A;  4FAT A;  2HEU A;  2Q8J A;  3U1O A;  1A55 A;  5IZ3 A;  4R74 A;  1B1H A;  3B8B A;  3LBS A;  3RGY A;  2D5W A;  3C36 A;  3EPE A;  3MUQ A;  4LVQ A;  2PX1 A;  1PEB A;  3UA8 A;  3ECR A;  3V8X B;  4NF4 A;  2F6G A;  2RCB A;  5L8D A;  2PMS A;  3MP1 A;  2V25 A;  4BDO A;  1QKA A;  5ET5 A;  1UIU A;  1Y1M A;  5ELV A;  2RCA A;  1IUD A;  4C1U A;  1H44 A;  4OFJ A;  4N15 A;  4QRZ A;  4KHZ E;  3OSQ A;  1GR2 A;  4O94 A;  3D4C A;  3GXA A;  2KLF A;  3MWB A;  1FTM A;  4PE5 B;  3IJX B;  3T66 A;  2X26 A;  1A99 A;  1R1N A;  2FBP A;  4LN5 A;  5CM6 A;  2A5S A;  4NF8 B;  3VVD A;  4BDM A;  2QS3 A;  4POX A;  3FJM A;  1R9L A;  2VPN A;  3IL1 B;  2P3V A;  3K6X A;  2AIX A;  3PMX A;  4OQO A;  1IXG A;  1VR5 A;  3G3K A;  3ILT B;  1B1X A;  4N81 A;  4FJP A;  5I59 B;  1D9Q A;  2V84 A;  5DVI A;  3EF7 A;  4JWY A;  3H3G A;  1OMP A;  3I5O A;  2HFB A;  3K4U A;  2O7U A;  1UTB A;  3C34 A;  3TCH A;  1N04 A;  2Z8D A;  4DI3 D;  5I58 A;  2QSX A;  4GIZ A;  5FTH A;  3O66 A;  5KZT A;  4PFW A;  3PUX E;  4YKJ A;  1INP A;  1H3D A;  3IB2 A;  4MNI A;  2DQV A;  1PB7 A;  4LUB A;  3CSB A;  5KDT B;  3PPN A;  3TQL A;  2XX8 A;  2NVU B;  1B6H A;  5H8Q A;  1NV3 A;  2DXY A;  3I6V A;  5DTB A;  3MAM A;  4I3E A;  5LOM A;  4U1Z A;  4QHQ A;  3FV1 A;  1JVY A;  1MPD A;  4X8R A;  5DEX B;  1OIB A;  4TLM B;  3FIR A;  2IA4 A;  1N7W A;  3E13 X;  4JVD A;  5L9S A;  4RK2 A;  4U23 A;  1RKM A;  5ICT A;  1MDQ A;  3LR1 A;  5ET6 A;  1GGG A;  2A5T B;  1B5J A;  4HE0 A;  1XS5 A;  4WXJ A;  2DWJ A;  3S2V A;  1Q1K A;  3SEY A;  4P47 A;  1GVC A;  1IMA A;  2XWK A;  4I62 A;  2QVU A;  4R75 A;  1LCT A;  3FXU A;  1YAE A;  4MNP A;  1M5B A;  4FE8 A;  2MKZ A;  3PV0 E;  1VSO A;  1UTB B;  4MBP A;  4H65 A;  1QKB A;  2B65 A;  3O28 A;  1B7U A;  2B3B A;  2V3Q A;  2QL3 A;  4U21 A;  1JW5 A;  3V83 A;  2GRV A;  1NNT A;  4ESW A;  3A3U A;  1B9J A;  2I0B A;  1B3F A;  2NXO A;  1GV8 A; 
#chains in the Genus database with same CATH homology
 3DP4 A;  4PBH A;  4QFN A;  4OMB A;  4F2O A;  3O6G A;  1F9B A;  3O29 A;  3LV0 A;  1IZ1 A;  4H5F A;  4KD5 A;  3KZG A;  5H8Q B;  1KA0 A;  3HO7 A;  1NUZ A;  4X9T A;  4GX3 A;  5L9M A;  3M3K A;  1DPE A;  1XVY A;  2DWA A;  3E79 A;  3EHU A;  3D4G A;  3OOA A;  2DXR A;  4KYE A;  1FBD A;  4LON B;  3BBR A;  1OVT A;  3H06 B;  5J16 A;  4OFO A;  2Y7W A;  3N6U A;  4H5G A;  5AA1 A;  1RDX A;  3T1B A;  4R9G A;  1LEV A;  2HZL A;  2HCA A;  1MXX A;  2VOZ A;  4C0R A;  3IFC A;  4O8M A;  2XXR A;  1Y20 A;  3BIH A;  4MNC A;  2I58 A;  3MYU A;  3IOR A;  2OWZ A;  4N6P A;  4IY5 A;  2FA7 A;  3SEU A;  4N8G A;  3PU5 A;  1LFH A;  3K1M A;  4JWO A;  4NWC A;  2DVC A;  2V93 A;  1QUL A;  3VLW A;  5EQA A;  4OWD A;  3KOT A;  4F3S A;  3MBP A;  4MAG A;  2HPG A;  1LBY A;  1ZBM A;  1Y9U A;  4PFR A;  2UYE A;  4QBA A;  2B4L A;  5FBP A;  1MPC A;  3TTK A;  3TUS A;  4ELR A;  5DVJ A;  5CBS A;  3U65 A;  2FNC A;  4I1D A;  4WKM A;  3AXF A;  4ELO A;  1IME A;  1QW0 A;  1I6A A;  2QS2 A;  4H46 A;  2F3D A;  1LBV A;  3IOW A;  1FTO A;  5KCJ B;  3QAX A;  4KI0 E;  4EUO A;  5CC2 A;  1UIV A;  1BTJ A;  3FJG A;  4KFQ A;  4C1T A;  2KR0 A;  4G68 A;  1A54 A;  4ISU A;  2WBD A;  1QUK A;  4EXK A;  4H8J A;  4IO6 A;  4HE2 A;  2XWV A;  3GBA A;  4FEC A;  2PCR A;  3EHT A;  1FTA A;  3H6V A;  1Y3N A;  4DXC A;  5ESY A;  4XTC Q;  5I2N A;  3TTN A;  2XXI A;  3I3V A;  2XXP A;  4GL0 A;  2XWI A;  5AA2 A;  2QFL A;  2OX3 A;  3GLB A;  1MM6 A;  1FW0 A;  1M5D A;  2ZYN A;  2O51 A;  4OVP A;  2WBB A;  2REG A;  2E0S A;  1MY3 A;  2X7Q A;  4HE1 A;  3JV9 A;  4WED A;  3E78 A;  1NV2 A;  3FBP A;  3T0J A;  5EQ9 A;  3TQW A;  3RT8 A;  5CMC A;  4F19 A;  3VLV A;  4EQ9 A;  1KZ8 A;  2Y7K A;  4ECF A;  3PPO A;  5TPA B;  5TU0 A;  3D1R A;  3FUZ A;  4F1Y A;  2D3I A;  3LSF B;  4ZS9 A;  3UOR A;  1AMF A;  4ZDM A;  1FPL A;  3DEL B;  3E3K A;  2R8T A;  4PCD A;  1TFA A;  2ZZV A;  2ESN A;  1HSL A;  5IM2 A;  4G2Z A;  3VE1 B;  4I8C A;  4ZEB A;  4XFE A;  3SEV A;  3TFL A;  2XD2 A;  1SDX A;  5F1Q A;  4PC9 A;  4X04 A;  1B0H A;  5DYH A;  3UN6 A;  4ELQ A;  2H5Y A;  2Q88 A;  2CZK A;  4X48 A;  1N84 A;  3TOD A;  3A3C A;  2IEE A;  1MY4 A;  2DE3 A;  1EYI A;  4YMA A;  1P1Q A;  4JSO A;  1P1N A;  4PAI A;  4GF8 A;  4POW A;  2HAU A;  4RA1 A;  4H45 A;  4G61 A;  1FSA A;  1HSJ A;  1BKA A;  4DXB A;  1B3L A;  3IO4 A;  3WAF A;  1Y4C A;  2OWS A;  1B7Z A;  4NHB A;  3K6U A;  2YLN A;  2PYY A;  1LBW A;  4GXA A;  4EQ7 A;  2P0S A;  3ZS6 A;  3T9H B;  1AH5 A;  2ZNT A;  3QYT A;  4DI4 B;  4LQ5 A;  2FIX A;  5H8H A;  1LST A;  3R6U A;  4XIG Q;  4ZEC A;  1B4Z A;  5I2K B;  4OER A;  2QS4 A;  5ITO A;  1FPG A;  5J1D A;  1NV0 A;  4PAF A;  4LQ2 A;  1LB9 A;  2CZH A;  3K6V A;  2WEF A;  3MZ9 A;  2WYK A;  3TTR A;  2RC8 A;  3QMF A;  2DYX A;  4LP2 B;  4LAT A;  4YZZ A;  5DT6 A;  2DS9 A;  1JP4 A;  1DTG A;  3TAJ A;  1KWH A;  2QJE A;  2OK2 A;  4MLQ A;  4GXS B;  3E4R A;  4U22 A;  1DSN A;  3VFJ A;  1Y4T A;  3TEL A;  3MJN A;  4JVI A;  1UTH B;  3FVO A;  4TQU Q;  2UYF A;  1J1N A;  3S9E A;  1MH3 A;  1FPI A;  4JVC A;  2FVZ A;  4MFI A;  4NG7 A;  2WKY A;  4QSC A;  3PUW E;  4FED A;  1EZ9 A;  3F11 A;  1A7L A;  3LSX A;  1NUX A;  4PP0 A;  3TTL A;  2O1L A;  4JSD A;  4GWU A;  1B3G A;  1WDN A;  2BJJ X;  2CZL A;  5T3J A;  2OZZ A;  5I84 A;  1JEU A;  1OVB A;  4GWZ A;  1QUJ A;  1FQD A;  2XXK A;  3MP8 A;  1B3E A;  1YPN A;  2QPQ A;  1POY 1;  1LBZ A;  1VFD A;  1FPK A;  1Q35 A;  4THI A;  3KC1 A;  5CBR A;  1XC1 A;  1WVJ A;  2ANJ A;  4OES A;  3G7W A;  3JYR A;  4OYV A;  2R71 A;  4MJO A;  1FQA A;  4OFL A;  4O3B A;  4G8N A;  1YXI A;  3HV1 A;  3T22 A;  2QVV A;  5IZ3 B;  4IY6 A;  2L5V A;  4LA9 A;  4PDH A;  3KJ7 A;  2H98 A;  1CNQ A;  4HS7 A;  4FEB A;  1TXF A;  4RK9 A;  1YCJ A;  4NF4 B;  1O64 A;  3IOV A;  4HXV A;  5IGA A;  2D21 A;  1RDZ A;  4IO3 A;  3MP6 A;  4O7I A;  1N76 A;  2ZNU A;  1SW4 A;  2F78 A;  2F8D A;  3KFM A;  3O6I A;  1DCU A;  1NFT A;  2I6E A;  1B52 A;  3GYY A;  3R26 A;  2XXQ A;  3NOH A;  1DK4 A;  1H43 A;  2F5X A;  4RJZ A;  3HCQ A;  3MVX A;  1ZLQ A;  3SET A;  2XXX A;  1MM7 A;  3Q26 A;  1OLC A;  5ITP A;  3BFU A;  4EDP A;  1NKX A;  1LCF A;  2R6G E;  3KJT A;  3S9N C;  1FTJ A;  1JNF A;  4QFK A;  2O1M A;  2F7B A;  1R9Q A;  4G68 C;  3CFZ A;  1IMC A;  2DWH A;  1JEV A;  1S50 A;  3G3F A;  2PFY A;  2HZK A;  3U93 A;  4AS4 A;  2QMW A;  1DTZ A;  3RPW A;  1N3X A;  3K02 A;  1LBC A;  1OLA A;  4O3A A;  1AL3 A;  3T9U A;  3RPL A;  4OEN A;  1LFI A;  5I57 A;  2Y84 A;  1D3K A;  3EN3 A;  1HSE A;  2UVJ A;  3MVY A;  4LZ8 A;  4F18 A;  5I58 B;  5I5P A;  1LAX A;  2H25 A;  4I9D A;  3TMG A;  4I3Y A;  5EYG A;  3B6T A;  2NUV A;  1EH3 A;  3RT6 B;  1DMB A;  2R9J A;  3FZV A;  3H03 A;  3ZSF A;  4X1B A;  1MXY A;  3A29 A;  4GWO A;  4N07 A;  3OEL A;  4R73 A;  3L6H A;  5JTY A;  4RYA A;  5I56 A;  3PUZ E;  1K9Z A;  4PDD A;  4ZEI A;  1QVS A;  1B0L A;  4R2F A;  5TP9 A;  5M2V A;  3VVE A;  3S9L C;  1XT8 A;  1MG1 A;  4N6D A;  4F31 B;  3T9X B;  1R6Z A;  4EF1 A;  2XXW A;  3R7X A;  3P7I A;  4M4G A;  1D9Y A;  1MXV A;  5FHM A;  3O6H A;  1B51 A;  3IOT A;  2VD3 A;  3U8Q A;  2XXY A;  4YAH X;  1QUI A;  2HXR A;  2ZZX A;  5CMK A;  2Z22 A;  3QIM A;  1MY2 A;  4HCW A;  3ZKK A;  5AA4 A;  1NUW A;  3G3H A;  4JWX A;  2Q8M A;  4PGN A;  1IIW A;  3LUY A;  1MQH A;  3KC0 A;  4U1O A;  4H6D A;  2ABH A;  4O7M A;  1DBZ A;  4GL8 A;  4MF3 A;  3FXQ A;  5BWJ A;  2HHM A;  1YZ0 A;  4KCC A;  4QF9 A;  4IO4 A;  4IGT A;  3PTY A;  2OLB A;  4LZ5 A;  4OZ9 A;  3B50 A;  4R6K A;  2ONR A;  4YU0 A;  4OXV A;  1IIT A;  3CRB A;  5IZ1 A;  1B7H A;  1II5 A;  2DE4 A;  1Z7M E;  4DE8 A;  2B3F A;  3OEN A;  5LTC A;  5IZZ A;  4XKN A;  2GFE A;  4F39 A;  1B58 A;  3PUV E;  4F29 A;  4N91 A;  1Q9D A;  4GFR A;  3ILU B;  1O63 A;  4RNS A;  3HPI A;  3VXC A;  1POT A;  1URD A;  3E9X A;  2HAV A;  3H7M A;  3PPQ A;  3SEX A;  1ZKB A;  2Y7I A;  1AIV A;  4ELP A;  5ISU A;  4PFY A;  3KN7 A;  1M5F A;  2DOJ A;  4YB6 A;  4DZ1 A;  3K6W A;  4HW8 A;  1JQF A;  1LB8 A;  4QFO A;  4BLA A;  3UGW A;  4XXU A;  4PTK A;  2O69 A;  4FOR A;  4MCO A;  4UA8 A;  1SW1 A;  5H8F A;  5EQ8 A;  1FPJ A;  1PBQ A;  4GVO A;  4F3B A;  4P8B A;  4PF8 A;  1TWY A;  2F36 A;  1EYJ A;  1SBP A;  4HTG A;  1FBH A;  2PT1 A;  1JW4 A;  3KSJ A;  2F7C A;  2YPN A;  3H6T A;  4GX6 A;  2GHB A;  3C31 A;  3U94 A;  1S7Y A;  1XI6 A;  1OQH A;  4NED A;  3C35 A;  1LAF E;  4P9K A;  5FTI A;  4Z0I A;  3TDJ A;  4NN3 A;  4G77 A;  4OEV A;  4NF5 A;  2THI A;  1ATG A;  1EZO A;  4KQP A;  3PMV A;  4PFB A;  3VXB A;  3SES A;  1USY E;  2ONK E;  3DLN A;  2Q74 A;  1OQG A;  4P0I A;  3PUY E;  5H8N A;  4OEU A;  1CB6 A;  2DP8 A;  5F7V A;  1Y3P A;  3TTM A;  3IJO B;  1NUY A;  4MIJ A;  1URG A;  2P2A A;  1JVX A;  2G93 A;  4P1L A;  4KYS A;  4IR8 A;  2JJK A;  3Q25 A;  4EF2 A;  3S9M C;  2OJT A;  5AA3 A;  1NI9 A;  4YKK A;  4BDL A;  3ROJ A;  1XOC A;  3DP8 A;  1FCK A;  2Q89 A;  4TOZ A;  3M8U A;  1SI0 A;  4EXL A;  1URS A;  1NNK A;  2FIE A;  1LAG E;  4G68 B;  5K2X A;  1MH4 A;  5HBC A;  4NAP A;  3PPP A;  4M1V A;  3HST A;  5H8F B;  5B70 A;  3O9P A;  2ALU A;  1MQI A;  4MEV A;  1LAH E;  5AA2 D;  4ZZE A;  3CG1 A;  2Z8E A;  1MRP A;  5I2N B;  2DWI A;  2ZYM A;  3G3G A;  2DDK A;  4GD5 A;  3A09 A;  1PB8 A;  2XD3 A;  3IOU A;  4PAK A;  5AA2 B;  4H1X A;  1EZP A;  4H0W A;  1BK4 A;  3T93 B;  5K2Y A;  2ZYK A;  4R6H A;  4ESX A;  3TYH A;  1B3H A;  2XXU A;  4ZEK A;  1RYO A;  3TCG A;  4GRK A;  4XKR A;  4P0G A;  3Q29 A;  2O68 A;  2Y7P A;  4ND9 A;  4OET A;  4F1U A;  4Q0C A;  1N7X A;  1VDW A;  4XF5 A;  3OO7 A;  4F22 A;  4JDF A;  3KN8 A;  1B32 A;  5CMB A;  4N17 A;  4PF6 A;  4GOT A;  3RNN A;  3K00 A;  4Z7E A;  1S9T A;  3W15 C;  4JB7 A;  4Q8R A;  3O97 A;  2WX9 A;  3C9H A;  4MH5 A;  3H6W A;  3QK6 A;  2Q9T A;  4OVJ A;  2ONS A;  4AB6 A;  2H99 A;  5LDZ A;  1PB9 A;  3FD3 A;  1EU8 A;  3USD A;  3G3J A;  3TKD A;  1LLS A;  2AL4 A;  2XXT A;  1NV6 A;  2I49 A;  5F24 A;  4N13 A;  4GX4 A;  3PMW A;  3KEI A;  1BLF A;  3THI A;  3QUF A;  4DXU A;  4XKQ A;  2RKM A;  2W7Y A;  3EQ1 A;  4IGR A;  1FPF A;  2I0C A;  4PFT A;  4NQ8 A;  5I59 A;  4TLL B;  1N3W A;  3KSX A;  4KPT A;  3FJ7 A;  2CEY A;  4NF6 A;  2E1S A;  2PFZ A;  2LAO A;  4GWX A;  1P1U A;  5IAI A;  3RY3 A;  4NX1 A;  1EYK A;  3SKP A;  1NV1 A;  2CMO A;  3QSL A;  4RY1 A;  2VD2 A;  1NV7 A;  1B5H A;  2O6A A;  2F34 A;  2Z23 A;  1LGB C;  3Q28 A;  2VP1 A;  1XVX A;  1SQY A;  5CI5 A;  1MQG A;  2P3N A;  4XEQ A;  1ZMG A;  4OTE A;  1D4N A;  2YJP A;  2UXA A;  3MPL A;  1FPB A;  5KDT A;  3HFU A;  4NTL A;  4NGU A;  3G3I A;  5EHS A;  1G0H A;  4GWY A;  5CRY A;  5EYF A;  4U4X A;  1MY0 A;  3FVK A;  3K0V A;  1FBG A;  2X7P A;  2I4B A;  3KBZ A;  1IXI A;  1CE2 A;  3SDF A;  2CEX A;  3IK6 B;  3MPK A;  1QGX A;  1FQC A;  5HPQ A;  4G4P A;  4JXI A;  5DEX A;  1ZU0 A;  5H8H B;  3Q27 A;  3W9W A;  1PBP A;  5HM4 B;  1GTK A;  1G0I A;  2Y7R A;  3LUZ A;  5I7I A;  1BP5 A;  4X1D A;  2F35 A;  4YKP A;  5B7D A;  2I3V A;  1WOD A;  4I40 A;  1ZJL A;  2M8C A;  2WYP A;  2Z8F A;  2A5T A;  1FJ6 A;  4YB5 A;  1FQB A;  3RYD A;  1ZIU A;  3KOS A;  1YTV A;  2GQ1 A;  3K01 A;  3CFL A;  1TT1 A;  4F1V A;  4IO5 A;  2V4C A;  2Y5K A;  4NF6 B;  3FAS A;  3FVN A;  3KGC A;  1VFE A;  1IMB A;  3K2D A;  2XA5 A;  2G29 A;  2ZXT A;  2H4I A;  2I4C A;  3OO8 A;  3DM0 A;  5DVF A;  3T96 B;  1I6B A;  3N5L A;  4PFI A;  2HXW A;  4IB2 A;  1UQW A;  1MY1 A;  1FBC A;  2P1S A;  3FXR A;  1FQF A;  1Y1Z A;  1NH7 A;  4NE4 A;  5H8S A;  4DCX A;  3CHG A;  4EQB A;  1LFG A;  3OO9 A;  4DDD A;  4PGP A;  1QJM A;  2GH9 A;  1FPD A;  4OVT A;  3ZKL A;  4F3P A;  3CR9 A;  2BJI A;  3IR1 A;  1ZTY A;  4BDN A;  3FXB A;  3PD9 A;  4OVR A;  3OXN A;  1PDA A;  1BIY A;  3DP6 A;  3BFT A;  4BDR A;  3MZ1 A;  4ZEF A;  4R9F A;  3T9V A;  3CI8 A;  3BIG A;  3GZG A;  4AB5 A;  1XHY A;  3EKI A;  3IFA A;  3PD8 A;  1SW2 A;  3LC8 A;  4U2R A;  2PBW A;  2F3B A;  4L17 A;  3RUM A;  5L9O A;  3H6U A;  4O3C A;  3H4Z A;  4GBV A;  4P56 A;  1P99 A;  2QS1 A;  1SW5 A;  3MST A;  1MQJ A;  3IO6 A;  4E0W A;  4KXP A;  4GLI A;  4NWD A;  3PGF A;  3ODB A;  4ONY A;  3C4M A;  1MXZ A;  2DVZ A;  5A5X A;  2FHY A;  2NWJ A;  4MLV A;  5ET8 A;  2V3T A;  1Z7N E;  3TZA A;  3C33 A;  1TFD A;  4QSE A;  2V3U A;  1MDP 1;  4GQO A;  4JBZ A;  2REJ A;  4MMP A;  1FPE A;  3B7D A;  4R2B A;  1US4 A;  4AS5 A;  3KN3 A;  3UIF A;  3L6G A;  1D9V A;  3S4U A;  1M5C A;  3CG3 A;  4QFL A;  4H8I A;  3FVG A;  1A8F A;  1YYZ A;  2VT5 A;  4OVS A;  1SD3 A;  1B46 A;  4OA4 A;  5A5L A;  1FQE A;  4ZE9 A;  5KCJ A;  1PC3 A;  2NOO A;  1JW1 A;  1NV4 A;  4P1E A;  1B5I A;  2PT2 A;  4PFU A;  3RTF B;  3C32 A;  4Q5T A;  4IO7 A;  4MHF A;  3OSR A;  1SYI A;  4F3G A;  2F97 A;  4PET A;  3RLF E;  4GWW A;  3CIJ A;  1IMD A;  3RPL B;  1NL5 A;  2I3W A;  3RTW B;  1IMF A;  2O7I A;  3VDF A;  1Y3Q A;  3M3F A;  5BUU A;  4WEP A;  3FAT A;  5I57 B;  1T0K A;  3EHS A;  1ANF A;  4ZZA A;  4IO2 A;  1MQD A;  3HHF A;  2VGQ A;  3ONM A;  1KA1 A;  2KQZ A;  1H45 A;  1AWB A;  3VLU A;  5A5X B;  2F7A A;  1SI1 A;  3MW0 A;  2ZMB A;  3UP9 A;  3MZB A;  5JTY B;  3TPA A;  5I56 B;  5I3S A;  1A40 A;  4FBP A;  4OAN A;  4KYD A;  3VV5 A;  3SZP A;  5TP9 B;  3GBB A;  5EQ7 A;  1MXW A;  2FYI A;  1IEJ A;  1AOV A;  2F6P A;  4N4U A;  1B05 A;  2I48 A;  1NNF A;  5IKB A;  3TEP A;  4GBW A;  5FHN A;  2Q2A A;  3OO6 A;  4DIG A;  3QXM A;  3V5A A;  5TPA A;  2XXH A;  4OHN A;  1A8E A;  4DLD A;  2QVR A;  3RQT A;  2UVG A;  2AYS A;  3N6T A;  2ZNS A;  4P3L A;  4YB7 A;  2QMX A;  2UVI A;  1N0T A;  5AA4 B;  1K9Y A;  5DW8 A;  1VE4 A;  3CSG A;  4RXL A;  3OMB A;  1JET A;  4Q30 B;  5EYH A;  2QRY A;  3O2A A;  1NMU A;  2ZYO A;  3VVF A;  1P1O A;  3RN8 A;  3PPR A;  4KCD A;  2XX9 A;  1LBB A;  2XXV A;  3TCF A;  2VHA A;  1M5E A;  2AL5 A;  1P1W A;  2Q2C A;  4P11 A;  5FHO A;  1ELJ A;  3KBR A;  2RIN A;  5ET7 A;  2H9B A;  4NMY A;  3CFX A;  2OBG A;  1LBX A;  4PQJ A;  3N26 A;  4K3F A;  4H67 A;  2DSF A;  1NH8 A;  3KG2 A;  4LZ7 A;  2Y5L A;  2XX7 A;  4GWS A;  4RPN A;  4R6Y A;  1US5 A;  2ZZW A;  3FV2 A;  5ICQ A;  4QXD A;  4OVQ A;  3MC2 A;  1FTK A;  4U4S A;  1MS7 A;  1USY H;  3V89 B;  4G8M A;  1FBP A;  1FRP A;  1SPI A;  4ZE8 A;  4HCY A;  1RDY A;  3SER A;  3OEM A;  3OEK A;  3IAZ A;  5I2K A;  3FGS A;  5EHM A;  4XKP A;  4YIC A;  4E0X A;  3LSW A;  4KR5 A;  3IX1 A;  3N94 A;  4N8Y A;  3W9V A;  3QUJ A;  3JZJ A;  3B6Q A;  4N6K A;  4DCY A;  4MX6 A;  3IB0 A;  2XHD A;  4F2Q A;  1O7T A;  1RYX A;  1B2H A;  1SVX B;  3MQ9 A;  1NNP A;  3HHG A;  4YKI A;  3BKI B;  4BDQ A;  4ZED A;  3K1N A;  1UTH A;  3LSL A;  1DPP A;  4NF5 B;  3IB1 A;  3M3L A;  4NF0 A;  1NV5 A;  1I69 A;  4UAB A;  5JEI A;  3MVW A;  1H76 A;  2CZI A;  1DOT A;  5JK4 A;  3MVZ A;  3U92 A;  5H8N B;  2O84 X;  1SYH A;  4YMB A;  3SEW A;  5AE4 A;  1FTL A;  4UAC A;  1IQ7 A;  4RPO A;  1IXC A;  3UK4 A;  1IXH A;  4PE3 A;  2HQ0 A;  2RF1 A;  2VPO A;  4G8H A;  1FBE A;  3B6W A;  4FIM A;  3WAE A;  3CVG A;  4FAJ A;  2OWT A;  3ISP A;  2OCU A;  3K1P A;  1FBF A;  1MPB A;  2RC7 A;  2DE2 A;  4R72 A;  1B4H A;  1FJ9 A;  4NF8 A;  1B40 A;  3OD7 A;  3U72 A;  2UVH A;  2PVU A;  4QFP A;  1MXU A;  3HN0 A;  1L5T A;  2B4M A;  4QSD A;  4AQ4 A;  1I6Q A;  4PBQ A;  5CMM A;  2GHA A;  2RC9 A;  2XWO A;  4FAT A;  2HEU A;  2Q8J A;  3U1O A;  1A55 A;  5IZ3 A;  4R74 A;  1B1H A;  3LBS A;  3B8B A;  3RGY A;  2D5W A;  3C36 A;  3EPE A;  3MUQ A;  4LVQ A;  2PX1 A;  1PEB A;  3UA8 A;  3ECR A;  3V8X B;  4NF4 A;  2F6G A;  2RCB A;  5L8D A;  2PMS A;  3MP1 A;  2V25 A;  4BDO A;  1QKA A;  5ET5 A;  1UIU A;  1Y1M A;  5ELV A;  2RCA A;  1IUD A;  4C1U A;  1H44 A;  4OFJ A;  4N15 A;  4QRZ A;  4KHZ E;  3OSQ A;  1GR2 A;  4O94 A;  3D4C A;  3GXA A;  2KLF A;  3MWB A;  1FTM A;  4PE5 B;  3IJX B;  3T66 A;  2X26 A;  1A99 A;  1R1N A;  2FBP A;  4LN5 A;  5CM6 A;  2A5S A;  4NF8 B;  3VVD A;  4BDM A;  2QS3 A;  4POX A;  3FJM A;  1R9L A;  2VPN A;  3IL1 B;  2P3V A;  3K6X A;  2AIX A;  3PMX A;  4OQO A;  1IXG A;  1VR5 A;  3G3K A;  3ILT B;  1B1X A;  4N81 A;  4FJP A;  5I59 B;  1D9Q A;  2V84 A;  5DVI A;  3EF7 A;  4JWY A;  3H3G A;  1OMP A;  3I5O A;  2HFB A;  3K4U A;  2O7U A;  1UTB A;  3C34 A;  3TCH A;  1N04 A;  2Z8D A;  4DI3 D;  5I58 A;  2QSX A;  4GIZ A;  5FTH A;  3O66 A;  5KZT A;  4PFW A;  3PUX E;  4YKJ A;  1INP A;  1H3D A;  3IB2 A;  4MNI A;  2DQV A;  1PB7 A;  4LUB A;  3CSB A;  5KDT B;  3PPN A;  3TQL A;  2XX8 A;  2NVU B;  1B6H A;  5H8Q A;  1NV3 A;  2DXY A;  3I6V A;  5DTB A;  3MAM A;  4I3E A;  5LOM A;  4U1Z A;  4QHQ A;  3FV1 A;  1JVY A;  1MPD A;  4X8R A;  5DEX B;  1OIB A;  4TLM B;  3FIR A;  2IA4 A;  1N7W A;  3E13 X;  4JVD A;  5L9S A;  4RK2 A;  4U23 A;  1RKM A;  5ICT A;  1MDQ A;  3LR1 A;  5ET6 A;  1GGG A;  2A5T B;  1B5J A;  4HE0 A;  1XS5 A;  4WXJ A;  2DWJ A;  3S2V A;  1Q1K A;  3SEY A;  4P47 A;  1GVC A;  1IMA A;  4I62 A;  2XWK A;  2QVU A;  4R75 A;  1LCT A;  3FXU A;  1YAE A;  4MNP A;  1M5B A;  4FE8 A;  2MKZ A;  3PV0 E;  1VSO A;  1UTB B;  4MBP A;  4H65 A;  1QKB A;  2B65 A;  3O28 A;  1B7U A;  2B3B A;  2V3Q A;  2QL3 A;  4U21 A;  1JW5 A;  3V83 A;  2GRV A;  1NNT A;  4ESW A;  3A3U A;  1B9J A;  2I0B A;  1B3F A;  2NXO A;  1GV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...