2HZKA

Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its open form
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
334
structure length
334
Chain Sequence
VTWRLASSFPKSLDTIFGGAEVLSKMLSEATDGNFQIQVFSAGELVPGLQAADAVTEGTVECCHTVGYYYWGKDPTFALAAAVPFSLSARGINAWHYHGGGIDLYNEFLSQHNIVAFPGGNTGVQMGGWFRREINTVADMQGLKMRVGGFAGKVMERLGVVPQQIAGGDIYPALEKGTIDATEWVGPYDDEKLGFFKVAPYYYYPGWWEGGPTVHFMFNKSAYEGLTPTYQSLLRTACHAADANMLQLYDWKNPTAIKSLVAQGTQLRPFSPEILQACFEAANEVYAEMEASNPAFKKIWDSIKAFRSEHYTWAQIAEYNYDTFMMVQQNAGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP-T family sorbitol/mannitol transporter, periplasmic bin
publication title Crystal structures of an Extracytoplasmic Solute Receptor from a TRAP transporter in its open and closed forms reveal a helix-swapped dimer requiring a cation for alpha-keto acid binding.
pubmed doi rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Ligand binding, transport protein
total genus 116
structure length 334
sequence length 334
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2hzkA02
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2hzkA01
4EUOA 5AA2D 3FVKA 1MXVA 1BTJA 5I2NA 1QUIA 5LOMA 1NNTA 1AOVA 3S9LC 4F19A 4MF3A 3CFLA 3CI8A 5H8NA 3TTKA 3IJOB 2XWIA 5AA4B 3P7IA 3HHGA 5I57B 1JW4A 3U94A 1QULA 4MHFA 1IXIA 1S50A 2CEXA 4OHNA 1P99A 3CFXA 3KN7A 3SKPA 4FAJA 4P8BA 2REGA 5I2KB 4LQ5A 4L17A 3R7XA 1MXYA 4NWDA 4GF8A 3QK6A 3PUZE 1B58A 3ODBA 2X7QA 2NXOA 4XKNA 1M5FA 4PAFA 4Z0IA 1MXXA 3CG1A 2XX7A 1AH5A 1XOCA 4RK9A 1PDAA 1QW0A 1XT8A 2D21A 4LUBA 2XXPA 2ZYNA 1YTVA 3EN3A 1SYHA 4H67A 4XKQA 2GHAA 3IO4A 1D9VA 3GBBA 3U8QA 4C1TA 2FNCA 3SETA 3BBRA 4OTEA 4QSDA 2D5WA 1I6QA 4FECA 4GIZA 4ELRA 4NGUA 1B9JA 1OMPA 3OELA 4R75A 1PB7A 4QFNA 4OQOA 4P0GA 3MZBA 3PPPA 2GFEA 2Q2CA 3SEUA 4NF4B 1I6AA 4QRZA 3A3CA 1B3EA 3S9EA 4WXJA 1FQDA 5KDTA 3TKDA 4DDDA 3KG2A 1LB8A 1LAHE 3OO6A 5F7VA 5KCJA 5IKBA 4GLIA 1UTBB 5DVJA 4G4PA 1OIBA 4HCYA 4EF2A 3MP8A 1S9TA 4F3BA 1Y4CA 4N6KA 4P47A 4WEDA 3EPEA 2YPNA 2E1SA 3S2VA 1LAFE 3EHUA 4HTGA 4I62A 4THIA 2VD2A 5EYFA 1MH3A 2XD3A 4F1YA 3OMBA 2UVHA 4PE5B 4YAHX 3RNNA 3T9HB 2ZNUA 3TCGA 1Y3NA 4QFOA 1N84A 2PT1A 2UYFA 3MZ1A 3A09A 4BDNA 4NAPA 1B6HA 2NOOA 1LFHA 1IUDA 1J1NA 4NF6A 4NTLA 3PU5A 3UN6A 5AA2B 2Y7PA 4YICA 2ONKE 2GRVA 4OVRA 3B6TA 4ZEIA 1XC1A 3OD7A 3O29A 1ZLQA 3B7DA 1MG1A 3E9XA 3VDFA 3BFUA 5AA3A 4U21A 2E0SA 4ZE9A 3O6IA 3IO6A 3V8XB 4I9DA 4KQPA 1WDNA 4TLMB 4M4GA 2F36A 1SW2A 3KOSA 3SERA 3K6WA 2ZZWA 4G8MA 2ANJA 4YZZA 3OXNA 1Y1ZA 3K0VA 5DVFA 4PBQA 2V4CA 3CG3A 3C4MA 4F2OA 1Z7NE 5AA4A 3FVOA 4X9TA 1B3FA 3DM0A 2P1SA 3VVDA 2REJA 5I57A 1Y20A 3OO8A 1EZ9A 4PDDA 4QHQA 1Q1KA 3UORA 1B4HA 1USYH 3MP6A 1MRPA 4LQ2A 3N94A 4ISUA 3OEMA 2F7AA 1ZU0A 4LA9A 2PBWA 2OK2A 1N04A 4PP0A 2V3UA 2DWAA 1B52A 3M8UA 3EHSA 3G3IA 2Y7RA 2V84A 2RCAA 4X8RA 1ANFA 2DE3A 3U93A 4PBHA 2R71A 5I56B 3ZKLA 3UGWA 2PFYA 1CB6A 4OENA 2H99A 2HXWA 5CRYA 4ZE8A 3RTWB 4TOZA 1XS5A 2P2AA 2DS9A 3TZAA 1NH7A 4O94A 4X1BA 4YB6A 4U23A 3DP8A 2RKMA 3V83A 3K6XA 3TYHA 1SW5A 1TFAA 4GWOA 4GFRA 4LZ7A 1DSNA 1FW0A 5DEXB 1ELJA 3C32A 4Q8RA 1IZ1A 5J1DA 3Q25A 4NF4A 1A7LA 3K4UA 2ZNSA 3PGFA 5I84A 3CSBA 3G3JA 3PUXE 4YMAA 4K3FA 4TLLB 4ELPA 3K6VA 3LSXA 3H4ZA 2H25A 4NWCA 4RA1A 3Q27A 3RPWA 4JXIA 5H8HA 5EHSA 2IA4A 1P1OA 2OLBA 1BKAA 1SW1A 3GZGA 4GL8A 1N7WA 3FASA 2VOZA 4PFWA 1N3WA 2I4CA 2QJEA 4C0RA 1T0KA 1GV8A 4G8NA 3W9WA 3S9MC 1Y4TA 3UK4A 1NFTA 3M3FA 3CRBA 1RKMA 1IQ7A 4U1ZA 3HO7A 5IGAA 4PC9A 5H8SA 4N13A 1II5A 3LUYA 3Q28A 5K2XA 2VPOA 1MDP1 3OEKA 2XWKA 2PFZA 4PGPA 4YKPA 4F3PA 2OZZA 2O1LA 2DE4A 3O6HA 2NVUB 3KGCA 4O3CA 4KCCA 2I0CA 3MZ9A 2GH9A 3UA8A 1MQDA 1NKXA 4DI4B 4KI0E 3I3VA 1N0TA 5AA2A 1URGA 5TPAA 3RN8A 3HCQA 2V25A 2HEUA 4R2FA 5TU0A 4XTCQ 4PFBA 3IL1B 3OO7A 4DXBA 1POY1 2A5TB 3FXQA 1I69A 2F5XA 5JK4A 4HW8A 4EXKA 3JV9A 1UIUA 4G77A 2VPNA 5I58A 1VR5A 3RTFB 5BWJA 2B65A 4GRKA 5B70A 1A54A 2XXTA 2O69A 4F3SA 3T9XB 3K01A 4GXAA 3IORA 1UIVA 1Y1MA 4N07A 3DP4A 3HPIA 4MLQA 5B7DA 2A5SA 4RY1A 5CM6A 4IO4A 4H8JA 2WX9A 3QYTA 2F6PA 3LSLA 4R2BA 2RC9A 4OEVA 2PT2A 3BKIB 3ILTB 1H3DA 4MLVA 1ATGA 4DXUA 1B0HA 4I8CA 4QF9A 4X1DA 2R6GE 1MQHA 1URDA 4ELQA 5FHNA 3AXFA 4RPOA 3VXCA 3TDJA 2DOJA 4DCXA 1JEUA 3DLNA 4RK2A 1B40A 1HSLA 2AL4A 2CEYA 3MUQA 1P1WA 3S9NC 1PEBA 1UTHB 4PFRA 4PF8A 1SD3A 3G3KA 1DPPA 2I3VA 4OVPA 1B51A 1B7ZA 4E0XA 4PE3A 5ICQA 2Z22A 5BUUA 2XXXA 4FIMA 4OERA 4LN5A 4F31B 3H6UA 4KCDA 1Y9UA 4PFIA 4UACA 5CMMA 1URSA 4UABA 3KOTA 2HAVA 1Y3QA 2KLFA 1RYOA 4RNSA 4N6PA 1MM7A 4H65A 5CBRA 3FVNA 1GVCA 2H98A 3PPQA 1DTZA 2OJTA 3OSQA 3UIFA 4KHZE 2QL3A 4OFJA 5ISUA 1ZBMA 4YKKA 3F11A 3D4GA 3PMXA 4ESWA 4LVQA 1MM6A 4OFLA 1Y3PA 2DWIA 1QJMA 3I6VA 4PFUA 2ESNA 1H43A 2R9JA 2G93A 4LONB 4NQ8A 2I4BA 2ZYOA 5DEXA 4RPNA 4NF5B 1OLAA 2DVCA 3PPNA 4F18A 3VFJA 1ZTYA 3RT6B 4Z7EA 2Q89A 5JTYA 1QUKA 3Q29A 4OFOA 1FTLA 5FTIA 2QS1A 3SEWA 3SEXA 2Z23A 3PD8A 4MNIA 2ZXTA 1SI0A 3IB0A 4YKIA 4POXA 3N5LA 2F35A 1YAEA 5I7IA 4XF5A 2UXAA 3TTMA 4R73A 1OLCA 3G3HA 2PX1A 4MMPA 1MXUA 4MH5A 1B5JA 2DVZA 4ZEBA 4NN3A 1MY0A 3KJ7A 4N91A 3FGSA 2H4IA 1MS7A 1O7TA 3VXBA 2I58A 3QXMA 1LCFA 3FJGA 1GTKA 1MXZA 1JW5A 1ZMGA 2Z8DA 4ECFA 5HBCA 2WKYA 1R9QA 3C36A 3TPAA 2Y7KA 1N3XA 2QS2A 2PVUA 1TXFA 3IOWA 2RCBA 1B3LA 4P9KA 4ONYA 2O7UA 4IO6A 1FQBA 1JETA 1M5DA 4R6HA 4F22A 2WYKA 1P1UA 2O51A 3MVWA 4XIGQ 1GGGA 2A5TA 1JVXA 3A3UA 3O2AA 2X26A 4OA4A 1FTOA 1VSOA 3KJTA 5ELVA 5H8QB 2Q9TA 3MVYA 2DXYA 1XVXA 4GD5A 4C1UA 3B50A 5DT6A 1LFGA 1FTKA 5I2NB 2THIA 2VP1A 1AL3A 4JSOA 5AE4A 4JSDA 3LR1A 3KN3A 4P3LA 2DYXA 5JEIA 3R26A 3O28A 5TP9B 1EZOA 4BDRA 3CR9A 1US5A 4DIGA 2YLNA 1ZIUA 4YKJA 3FJMA 2Y7IA 3RY3A 3FD3A 3WAEA 3MW0A 3MAMA 3MVXA 2XX8A 3TTRA 1B5IA 2F6GA 3TFLA 4H5GA 5I2KA 2RC7A 3TMGA 1JQFA 1EZPA 2NUVA 4RJZA 4ZS9A 2DSFA 4P11A 1XHYA 1IITA 4HCWA 2D3IA 3C31A 4ZEDA 4P56A 1PB8A 1A99A 1R1NA 3I5OA 1TWYA 1FTJA 2ZYMA 3K2DA 4KD5A 1MY1A 1SBPA 4OETA 1HSEA 3C35A 2QS4A 4JWYA 1JNFA 2M8CA 4MEVA 1LGBC 4HS7A 4U4XA 1H45A 1SYIA 3SDFA 2HAUA 4BDMA 4QFKA 4F1VA 4F39A 1OVTA 4PFTA 1D4NA 3K6UA 2XXQA 3IOUA 1D3KA 2XXYA 4MX6A 4XKPA 5L9OA 4JWXA 4IGRA 3C9HA 2HFBA 5KZTA 1TFDA 3O6GA 4OESA 2RF1A 4F2QA 4EDPA 3H03A 1Q35A 3JZJA 3MVZA 4JB7A 4NX1A 1HSJA 1MH4A 5IZZA 1M5EA 3MQ9A 3TTNA 4ZEFA 1SW4A 3PMVA 1DTGA 2O1MA 4KR5A 2UYEA 3HSTA 3KSJA 5KCJB 4QSEA 3PUWE 1B05A 3EHTA 1UTBA 4ND9A 1B3HA 3VLWA 3KSXA 1NNKA 2LAOA 4O3AA 3CFZA 2OCUA 2YJPA 4PF6A 3FXRA 5CBSA 4KYDA 4N8YA 2DP8A 4NG7A 4AB5A 3FV2A 5FTHA 1MQIA 3CSGA 5L8DA 4QFLA 3QAXA 3MWBA 2XXHA 1UQWA 2Z8EA 3PUVE 4XEQA 3TUSA 4U1OA 2O7IA 3GYYA 1IXHA 3G7WA 1H44A 3TODA 1VE4A 1BP5A 4IO7A 4I1DA 5K2YA 2RC8A 3FZVA 5HM4B 4R6KA 3IOTA 4H1XA 2GHBA 4FORA 4G8HA 3RGYA 2DE2A 3TTLA 4ZZEA 2V3QA 1RYXA 4F1UA 1IEJA 4P0IA 1Z7ME 3OO9A 4OXVA 4X04A 4O8MA 4JDFA 2F7BA 4ESXA 2ABHA 4DCYA 3QIMA 4FJPA 4NF0A 4UA8A 4YB7A 1QVSA 1L5TA 4MIJA 3VLUA 1H76A 3SEYA 2AL5A 3W15C 3K00A 4EXLA 1B1HA 1B1XA 2I49A 4MBPA 1BLFA 2HZKA 4H0WA 4P1EA 3U1OA 2O84X 3H06B 4F29A 1R9LA 4BDOA 1IXCA 3IB2A 5H8QA 1JW1A 3DELB 1S7YA 3IOVA 3T93B 3QSLA 4R6YA 5IM2A 4KYEA 1MY2A 1POTA 3UP9A 4QSCA 4IY5A 2HQ0A 5TP9A 4E0WA 4RYAA 3HHFA 1LAGE 2F97A 3ZKKA 4OVTA 1LBCA 3RQTA 2UVJA 2XA5A 1YCJA 1SVXB 4R9FA 1B32A 5L9MA 4PDHA 1B7UA 1A8FA 3H3GA 1US4A 5ITPA 2AYSA 4FEDA 3TQWA 3WAFA 4NF8B 2HPGA 4BDLA 3ONMA 4KFQA 3TEPA 3KZGA 2ZZXA 3FUZA 4OZ9A 3LSFB 4G68C 5CMBA 4DI3D 5DYHA 4N4UA 3W9VA 1CE2A 1MPBA 2V3TA 2Y84A 4OVJA 2UVIA 3K1NA 1LCTA 1XVYA 3KBRA 4EF1A 3C33A 5AA1A 1M5BA 4O7MA 1B46A 5I56A 4QFPA 3TQLA 4RXLA 2UVGA 1MPDA 5A5XB 1DOTA 1ZKBA 3SEVA 3IAZA 3V89B 1SI1A 3ILUB 3FIRA 1PBPA 2F7CA 1MDQA 2XXWA 4KPTA 3LSWA 3T9UA 3MP1A 3TELA 2O6AA 1R6ZA 3L6GA 3EQ1A 4G68B 3RT8A 1PC3A 3M3KA 1USYE 3FXUA 1QUJA 4NMYA 2ZZVA 2FYIA 3VVEA 1FQCA 3E3KA 2G29A 2XXUA 3U92A 3N6UA 2DWHA 1LSTA 3G3FA 1DMBA 5H8HB 4MNPA 2HZLA 1NNPA 1NL5A 2I3WA 5I59B 1QKAA 3IX1A 4R9GA 2QSXA 2VGQA 3IR1A 3MJNA 1LAXA 2ALUA 4U2RA 4OVQA 3N26A 4IB2A 1AMFA 1YPNA 5IAIA 4FATA 4F3GA 5ITOA 4WEPA 3MPKA 4PQJA 5DTBA 1VFEA 3T9VA 2AIXA 1TT1A 3EF7A 3RUMA 1N7XA 5H8FB 3O9PA 4AB6A 1FQFA 2XXRA 3PUYE 1MXWA 3L6HA 3E13X 4KYSA 4MCOA 1A40A 1MY3A 5L9SA 4LP2B 1AIVA 1NNFA 2IEEA 2VD3A 3MPLA 1JVYA 3IK6B 2QS3A 5DVIA 4H8IA 2DQVA 4MNCA 2VHAA 3RLFE 5TPAB 5CMKA 4JBZA 2XX9A 1PBQA 4H6DA 1N76A 3U65A 2ZNTA 3LC8A 5I58B 1PB9A 4Q0CA 4OWDA 4ZECA 1I6BA 3H6WA 4NE4A 1P1QA 4N6DA 4P1LA 2H5YA 4IY6A 3FVGA 2PYYA 3PMWA 2FA7A 1FCKA 5H8NB 4NEDA 3FJ7A 2NWJA 1KWHA 3IB1A 3G3GA 4LZ8A 1ZJLA 1F9BA 1DPEA 1M5CA 1B7HA 4POWA 3PD9A 5ICTA 4DE8A 1MQJA 1MPCA 3T66A 3O97A 2I0BA 1IXGA 3FV1A 5I5PA 4GVOA 3V5AA 3QUFA 4OVSA 4TQUQ 3TCHA 2B3BA 3B6QA 2XWVA 2H9BA 2O68A 1VFDA 2QPQA 3S4UA 4ELOA 4GL0A 4DZ1A 3R6UA 2B3FA 1MQGA 3IJXB 2ONRA 3C34A 3LBSA 1LLSA 5CC2A 4BLAA 3JYRA 4NF8A 2OBGA 1UTHA 1OVBA 2CMOA 5FHMA 3H6VA 3KEIA 3TAJA 1FQEA 3D4CA 1WVJA 3THIA 2I48A 3PPRA 5FHOA 3SESA 4LZ5A 2ZYKA 3K02A 1LFIA 4GOTA 2XXKA 4LATA 4IGTA 2QMXA 3HV1A 3O66A 4AQ4A 4ZDMA 4YB5A 3HN0A 2HCAA 4MAGA 1GR2A 4PCDA 2Y7WA 5A5XA 4R74A 4G2ZA 4OEUA 1B3GA 2QMWA 3H7MA 2Q88A 4NHBA 3MBPA 3M3LA 5CMCA 4U4SA 3PV0E 2ZMBA 3N6TA 3ECRA 2XD2A 4FE8A 1EH3A 4FEBA 1LBBA 3OENA 1O64A 4WKMA 3H6TA 3CIJA 4MFIA 3U72A 2OWSA 3GXAA 4Q30B 5HPQA 4BDQA 5KDTB 3GBAA 4YMBA 4PAKA 4PETA 4NF5A 4OANA 3T96B 3QUJA 4G68A 1SQYA 3DP6A 1MY4A 5JTYB 2XWOA 4R72A 1FQAA 4PAIA 1WODA 2XXIA 3B6WA 3USDA 4XFEA 2BJJX 2P0SA 2F34A 4O3BA 2V93A 4N15A 2Q2AA 3K1PA 4H5FA 1B4ZA 2XXVA 5I59A 4PFYA 2Z8FA 4N17A 4DXCA 4N8GA 1B0LA 4EQ9A 1EU8A 2WYPA 3CVGA 4ZEKA 2CZLA 4OYVA 4Q5TA 3FATA 4JWOA 4YU0A 1A8EA 5CI5A 1NH8A 4XXUA 1P1NA 1QKBA 1NMUA 1B2HA 3VV5A 3E4RA 3ZSFA 2PMSA 3OOAA 3Q26A 4EQBA 4XKRA 3KFMA 4U22A 3T22A 3VLVA 4PGNA 2I6EA 5H8FA 5LTCA 1O63A 2QRYA 3BFTA 2DWJA 4NF6B 1JEVA 1SDXA 2Q8JA 4OMBA 2RINA 4X48A 1IIWA 4IO3A 1LB9A 2DXRA 4DLDA 2W7YA 1FTMA 3TCFA 3PPOA 4M1VA 4GQOA 1OQGA 1BIYA 3VVFA 5F1QA 4IO2A 3VE1B 1D9YA 4EQ7A 2F78A 3MC2A 1B5HA 2ONSA 3OSRA 1OQHA 4ZZAA 3ZS6A 1A55A 4IO5A 2XHDA 3KN8A 5M2VA 2OWTA 3K1MA 4GXSB 5EHMA 3GLBA 2F8DA 2X7PA 3FXBA
chains in the Genus database with same CATH superfamily
4EUOA 5AA2D 3FVKA 2QVVA 1MXVA 1BTJA 5I2NA 1QUIA 5LOMA 1NNTA 1AOVA 3S9LC 4F19A 5EQAA 4MF3A 3CFLA 3CI8A 5H8NA 3TTKA 3EKIA 3IJOB 2L5VA 2XWIA 5AA4B 3P7IA 3HHGA 5I57B 1JW4A 3U94A 1QULA 4H46A 4MHFA 1IXIA 5T3JA 1S50A 2CEXA 1FPJA 1QGXA 4OHNA 1P99A 3CFXA 3KN7A 3SKPA 4FAJA 4P8BA 2REGA 4QXDA 5I2KB 5J16A 1BK4A 4L17A 4LQ5A 4H45A 3FBPA 3R7XA 1MXYA 4NWDA 4GF8A 3QK6A 3PUZE 1B58A 3ODBA 2X7QA 2NXOA 4XKNA 1M5FA 4PAFA 4Z0IA 1MXXA 3CG1A 2XX7A 4I3YA 3RYDA 1AH5A 1XOCA 4RK9A 1FBHA 1PDAA 1QW0A 1XT8A 2D21A 4LUBA 2XXPA 2ZYNA 1YTVA 3EN3A 1SYHA 4H67A 4MJOA 4XKQA 2GHAA 3IO4A 1D9VA 3GBBA 3U8QA 1FBFA 4C1TA 2FNCA 3SETA 3BBRA 4OTEA 4QSDA 2D5WA 1I6QA 1IMCA 4FECA 4GIZA 1KA1A 4NGUA 4ELRA 1B9JA 1OMPA 3OELA 4R75A 1PB7A 4QFNA 4OQOA 4P0GA 3MZBA 3PPPA 2GFEA 2Q2CA 3SEUA 4NF4B 1I6AA 4QRZA 3A3CA 1B3EA 3S9EA 4WXJA 1FQDA 5KDTA 3TKDA 4DDDA 3KG2A 1LB8A 1LAHE 3OO6A 5F7VA 5KCJA 5IKBA 4GLIA 1UTBB 5DVJA 4G4PA 1OIBA 1IMAA 4HCYA 4EF2A 3MP8A 1S9TA 4F3BA 1Y4CA 4N6KA 4P47A 2QVUA 4WEDA 3EPEA 2YPNA 2E1SA 3S2VA 3B8BA 1LAFE 3EHUA 1IMFA 4HTGA 4I62A 5ET7A 4THIA 4I3EA 2VD2A 5EYFA 1MH3A 5IZ3B 2XD3A 4F1YA 3OMBA 2BJIA 2UVHA 4PE5B 4YAHX 3RNNA 3T9HB 2ZNUA 1IMEA 1SPIA 3TCGA 1Y3NA 4QFOA 1LBYA 1N84A 2PT1A 2UYFA 3MZ1A 3A09A 4BDNA 4NAPA 1B6HA 2NOOA 1LFHA 1IUDA 1J1NA 4NF6A 4NTLA 3PU5A 3UN6A 5AA2B 2Y7PA 4YICA 2ONKE 2GRVA 4OVRA 3B6TA 3QMFA 4ZEIA 1XC1A 2R8TA 3OD7A 3O29A 4HE2A 1ZLQA 3B7DA 1MG1A 3E9XA 3VDFA 1FJ6A 3BFUA 5AA3A 4U21A 2E0SA 4ZE9A 3O6IA 3IO6A 3V8XB 4I9DA 2B4LA 4KQPA 1WDNA 3KC0A 4TLMB 1NI9A 4M4GA 2F36A 1SW2A 3KOSA 3SERA 3K6WA 2ZZWA 4G8MA 2ANJA 4YZZA 3OXNA 1Y1ZA 3K0VA 5DVFA 4PBQA 2V4CA 3CG3A 3C4MA 4F2OA 1Z7NE 5AA4A 3NOHA 3FVOA 4X9TA 1B3FA 3DM0A 2P1SA 3VVDA 2REJA 5I57A 1Y20A 3OO8A 1EZ9A 4PDDA 4QHQA 1Q1KA 3UORA 2F3DA 1B4HA 1USYH 3MP6A 1MRPA 4LQ2A 3N94A 4ISUA 3OEMA 2F7AA 4GBWA 1ZU0A 4LA9A 2PBWA 2OK2A 1N04A 4PP0A 2Y5KA 2V3UA 2DWAA 1NUZA 1B52A 3M8UA 3EHSA 3G3IA 2Y7RA 2V84A 2RCAA 4X8RA 1ANFA 2DE3A 3U93A 3KC1A 4PBHA 2R71A 5I56B 3ZKLA 4O7IA 3UGWA 2CZKA 2PFYA 1CB6A 2P3VA 4OENA 2H99A 2HXWA 5CRYA 4ZE8A 3RTWB 4TOZA 1XS5A 2P2AA 2DS9A 3TZAA 1NH7A 4O94A 4X1BA 4YB6A 4U23A 1D9QA 3DP8A 3D1RA 2RKMA 3V83A 3K6XA 3TYHA 1SW5A 1TFAA 2HXRA 3BIHA 4GWOA 4GFRA 4LZ7A 1DSNA 1FW0A 5DEXB 1ELJA 3C32A 4Q8RA 1IZ1A 5J1DA 3Q25A 4NF4A 1A7LA 3K4UA 3RPLB 2ZNSA 3PGFA 5I84A 3CSBA 3G3JA 3PUXE 4YMAA 3CHGA 4K3FA 4GX6A 4TLLB 4ELPA 3K6VA 3LSXA 3H4ZA 2H25A 4NWCA 4RA1A 3Q27A 5I3SA 3RPWA 4JXIA 5H8HA 5EHSA 2IA4A 1P1OA 2OLBA 1BKAA 1SW1A 3E79A 5EQ8A 3GZGA 4GL8A 1N7WA 1DCUA 3FASA 2WBBA 2VOZA 4PFWA 1N3WA 2I4CA 4JVIA 2QJEA 1IMDA 4C0RA 1T0KA 1KA0A 1GV8A 4G8NA 3W9WA 5IZ1A 3S9MC 1Y4TA 3UK4A 1NFTA 3M3FA 3CRBA 1RKMA 1IQ7A 4U1ZA 3HO7A 4GWXA 5IGAA 4PC9A 4GWSA 5H8SA 4N13A 1II5A 4GWYA 5IZ3A 3LUYA 3Q28A 5K2XA 3ISPA 2VPOA 1MDP1 3OEKA 2XWKA 2PFZA 4PGPA 4YKPA 4F3PA 2OZZA 2O1LA 2DE4A 3O6HA 2NVUB 3KGCA 4O3CA 4KCCA 2I0CA 3MZ9A 2GH9A 3UA8A 4AS5A 1MQDA 1NKXA 4DI4B 4KI0E 3I3VA 1N0TA 5AA2A 1URGA 5TPAA 3RN8A 3HCQA 2V25A 2HEUA 4PFBA 4R2FA 4XTCQ 5TU0A 3IL1B 3OO7A 4DXBA 1POY1 2A5TB 3FXQA 1I69A 2F5XA 5JK4A 4HW8A 4EXKA 3JV9A 1UIUA 4G77A 2VPNA 5I58A 1VR5A 3RTFB 5BWJA 2B65A 4GRKA 5B70A 1A54A 2XXTA 2O69A 4F3SA 3T9XB 1FPKA 5EYGA 3K01A 5ESYA 4GXAA 3IORA 1UIVA 1Y1MA 4N07A 3DP4A 2MKZA 3HPIA 4MLQA 2KQZA 5B7DA 2A5SA 4RY1A 5CM6A 4IO4A 4H8JA 2WX9A 3QYTA 2F6PA 3LSLA 4R2BA 2RC9A 4OEVA 2PT2A 3BKIB 3ILTB 5ET8A 1H3DA 4MLVA 1ATGA 4DXUA 1B0HA 1IMBA 4I8CA 4QF9A 4X1DA 2R6GE 1MQHA 1URDA 4ELQA 5FHNA 3AXFA 4RPOA 3VXCA 3TDJA 2DOJA 1FPBA 1LBXA 4DCXA 4AS4A 1JEUA 3DLNA 4RK2A 1B40A 1YYZA 1HSLA 2AL4A 2CEYA 3MUQA 1P1WA 3S9NC 1PEBA 1UTHB 4PFRA 4PF8A 1SD3A 1KZ8A 3G3KA 1DPPA 2I3VA 4OVPA 4GWZA 1B51A 1B7ZA 4E0XA 4PE3A 5ICQA 2Z22A 5BUUA 2XXXA 4FIMA 4GBVA 4OERA 4LN5A 4F31B 1YXIA 3H6UA 4KCDA 1Y9UA 4PFIA 4UACA 5CMMA 1URSA 4UABA 3KOTA 2HAVA 1Y3QA 2KLFA 1RYOA 4RNSA 4N6PA 1MM7A 4H65A 5CBRA 3FVNA 2H98A 2FHYA 1GVCA 3PPQA 1DTZA 2OJTA 3OSQA 3UIFA 4KHZE 2QL3A 4OFJA 5ISUA 1ZBMA 4YKKA 3F11A 3D4GA 4GX4A 3PMXA 4ESWA 4LVQA 1MM6A 4OFLA 1Y3PA 2DWIA 1QJMA 3I6VA 4PFUA 2ESNA 1H43A 1FPEA 2R9JA 2G93A 4LONB 4NQ8A 2I4BA 2ZYOA 3IFAA 5DEXA 4RPNA 4NF5B 1OLAA 2DVCA 4N81A 3PPNA 4F18A 3VFJA 1ZTYA 3RT6B 4Z7EA 1XI6A 2Q89A 3RPLA 5JTYA 1QUKA 3Q29A 4OFOA 1FTLA 5FTIA 2QS1A 3SEWA 3SEXA 4GWUA 2Z23A 3PD8A 4MNIA 2ZXTA 1SI0A 3IB0A 3PTYA 4YKIA 4POXA 3N5LA 2F35A 1YAEA 5I7IA 4XF5A 2UXAA 3TTMA 4R73A 1OLCA 3G3HA 2PX1A 4MMPA 1MXUA 4MH5A 1B5JA 2DVZA 4ZEBA 4NN3A 1MY0A 3KJ7A 1NV5A 4N91A 3FGSA 2H4IA 1DBZA 1MS7A 1O7TA 3VXBA 2I58A 3QXMA 1LCFA 3FJGA 5F24A 1GTKA 1MXZA 1JW5A 1ZMGA 2Z8DA 4ECFA 5HBCA 2WKYA 1R9QA 2PCRA 3C36A 3TPAA 1EYKA 2Y7KA 1N3XA 2QS2A 2PVUA 1TXFA 3IOWA 2RCBA 1B3LA 4P9KA 4ONYA 2O7UA 5EQ9A 4IO6A 1FQBA 1JETA 1LBZA 1M5DA 4R6HA 4F22A 2WYKA 1P1UA 2O51A 3MVWA 4XIGQ 1GGGA 2A5TA 1JVXA 3A3UA 3O2AA 2X26A 4OA4A 1FTOA 2QFLA 1VSOA 3KJTA 5ELVA 5H8QB 2Q9TA 3MVYA 2DXYA 1XVXA 4GD5A 2OWZA 4C1UA 3B50A 5DT6A 1LFGA 1FTKA 5I2NB 2THIA 2VP1A 1AL3A 4JSOA 5AE4A 4JSDA 3LR1A 3KN3A 1FJ9A 4P3LA 2DYXA 5JEIA 3R26A 3O28A 5TP9B 1EZOA 4BDRA 3CR9A 1US5A 4DIGA 2YLNA 1ZIUA 4YKJA 3FJMA 2Y7IA 3RY3A 3FD3A 3WAEA 3MW0A 3MAMA 3MVXA 2XX8A 3TTRA 1B5IA 2F6GA 3TFLA 4H5GA 5I2KA 1Q9DA 2RC7A 3TMGA 1JQFA 1EZPA 2NUVA 4RJZA 4ZS9A 2DSFA 4P11A 1XHYA 4I40A 1IITA 4HCWA 2D3IA 3C31A 4ZEDA 1FBEA 1NUWA 4P56A 1PB8A 1A99A 1R1NA 3I5OA 1TWYA 1FTJA 2ZYMA 3K2DA 4KD5A 1NUYA 1MY1A 1SBPA 4OETA 1HSEA 3C35A 2QS4A 4JWYA 1JNFA 2M8CA 4HE0A 4MEVA 1LGBC 4HS7A 3IFCA 4U4XA 1H45A 1SYIA 3SDFA 2HAUA 4BDMA 4QFKA 4F1VA 4F39A 1OVTA 4PFTA 1D4NA 3K6UA 2XXQA 3IOUA 1D3KA 2XXYA 4MX6A 4XKPA 5L9OA 4JWXA 4IGRA 3C9HA 2HFBA 5KZTA 1TFDA 3O6GA 4OESA 2RF1A 4F2QA 4EDPA 3H03A 2FBPA 1Q35A 3JZJA 3MVZA 4JB7A 4NX1A 1HSJA 1MH4A 5IZZA 1M5EA 3MQ9A 3TTNA 2FIXA 2CZHA 1CNQA 5EYHA 4ZEFA 1SW4A 3PMVA 1DTGA 2O1MA 4KR5A 2UYEA 3HSTA 3KSJA 5KCJB 4QSEA 3PUWE 1B05A 3EHTA 1UTBA 4ND9A 1B3HA 3VLWA 3KSXA 1NNKA 2LAOA 4O3AA 3CFZA 2OCUA 2WEFA 2YJPA 4PF6A 3FXRA 5CBSA 2B4MA 4KYDA 4N8YA 2DP8A 4NG7A 4AB5A 1FBCA 3FV2A 5FTHA 1MQIA 3CSGA 5L8DA 4QFLA 3QAXA 3MWBA 2XXHA 1UQWA 2Z8EA 3PUVE 5DW8A 4XEQA 3HFUA 3TUSA 4U1OA 2O7IA 3GYYA 1IXHA 3G7WA 1H44A 3TODA 1VE4A 1BP5A 4IO7A 4I1DA 5K2YA 2RC8A 3FZVA 5HM4B 4R6KA 3IOTA 4H1XA 2GHBA 4FORA 4G8HA 3RGYA 2DE2A 3TTLA 2VT5A 4ZZEA 2V3QA 1RYXA 4F1UA 1IEJA 4P0IA 1Z7ME 2FVZA 3OO9A 4OXVA 4X04A 2FIEA 4O8MA 4JDFA 2F7BA 4ESXA 2ABHA 3A29A 4DCYA 3QIMA 4FJPA 4NF0A 4UA8A 4YB7A 1QVSA 1L5TA 4MIJA 1FBGA 3VLUA 1H76A 3SEYA 2AL5A 4KXPA 3W15C 3K00A 4EXLA 1B1HA 1B1XA 2I49A 1NV4A 4MBPA 1BLFA 2HZKA 1LEVA 4H0WA 1NV0A 4P1EA 3U1OA 2O84X 3H06B 4F29A 1R9LA 4BDOA 1IXCA 3IB2A 5H8QA 1JW1A 3DELB 1S7YA 3IOVA 1FPGA 3T93B 3QSLA 4R6YA 5IM2A 4KYEA 1VDWA 1MY2A 1POTA 5ET5A 3UP9A 4QSCA 2JJKA 4IY5A 1FPLA 2HQ0A 5TP9A 4E0WA 4RYAA 3HHFA 1LAGE 1G0HA 2F97A 3ZKKA 4JVDA 4OVTA 1LBCA 3RQTA 2UVJA 2XA5A 1RDXA 1YCJA 1SVXB 2OX3A 4R9FA 1B32A 2HHMA 5L9MA 4PDHA 1B7UA 1A8FA 3H3GA 1US4A 5ITPA 1INPA 2AYSA 4FEDA 3TQWA 1JP4A 3WAFA 1G0IA 4NF8B 2HPGA 3LV0A 4BDLA 3ONMA 4KFQA 3TEPA 3KZGA 2ZZXA 3FUZA 4OZ9A 3LSFB 4G68C 5CMBA 4HE1A 4DI3D 5DYHA 4N4UA 3MYUA 2P3NA 3W9VA 1CE2A 4FBPA 1MPBA 2V3TA 2Y84A 4OVJA 2UVIA 3K1NA 1LCTA 1XVYA 1RDZA 3KBRA 4EF1A 3C33A 5AA1A 1M5BA 4O7MA 1EYIA 1B46A 2CZIA 5I56A 4QFPA 3TQLA 4RXLA 1NV6A 2UVGA 1MPDA 5A5XB 1DOTA 1ZKBA 3SEVA 3IAZA 3V89B 3KBZA 1SI1A 3ILUB 3FIRA 1PBPA 2F7CA 1MDQA 2XXWA 2F3BA 4KPTA 3LSWA 1K9YA 3T9UA 4G61A 3MP1A 3TELA 2O6AA 1R6ZA 3L6GA 1FPFA 3EQ1A 4G68B 3RT8A 1PC3A 3M3KA 1USYE 3FXUA 1QUJA 4NMYA 2ZZVA 2FYIA 3VVEA 1FQCA 3E3KA 2G29A 2XXUA 3U92A 3N6UA 2DWHA 1LSTA 3G3FA 1DMBA 4MNPA 5H8HB 1YZ0A 2HZLA 1NNPA 1NL5A 2I3WA 5I59B 1QKAA 3IX1A 4R9GA 2QSXA 2VGQA 3IR1A 3MJNA 3T1BA 1LAXA 2ALUA 4U2RA 4OVQA 3N26A 4IB2A 1AMFA 1YPNA 5IAIA 1NV1A 4FATA 4F3GA 5ITOA 4WEPA 3MPKA 4PQJA 5DTBA 1VFEA 3T9VA 2AIXA 1TT1A 3EF7A 3RUMA 1N7XA 5H8FB 3O9PA 4AB6A 1FQFA 2XXRA 3PUYE 4GX3A 1MXWA 3L6HA 3E13X 4KYSA 4MCOA 1FPDA 1A40A 1MY3A 5L9SA 4LP2B 1AIVA 1NNFA 2IEEA 2VD3A 3MPLA 1JVYA 1EYJA 3IK6B 2QS3A 5DVIA 4H8IA 2DQVA 4MNCA 2VHAA 3RLFE 5TPAB 5CMKA 4JBZA 2XX9A 1PBQA 4H6DA 2Q74A 1N76A 3U65A 1LBVA 2ZNTA 3LC8A 5I58B 1NV7A 4HXVA 1PB9A 4Q0CA 4OWDA 4ZECA 1I6BA 3H6WA 3LUZA 4NE4A 1P1QA 4N6DA 5LDZA 4P1LA 2H5YA 4IY6A 2GQ1A 3FVGA 3ROJA 2PYYA 3PMWA 2FA7A 1FCKA 5H8NB 4NEDA 3FJ7A 2NWJA 1KWHA 3IB1A 3G3GA 4LZ8A 1ZJLA 1DPEA 1F9BA 1M5CA 1B7HA 4POWA 3PD9A 5ICTA 2KR0A 4DE8A 3BIGA 1MQJA 1MPCA 3T66A 3O97A 2I0BA 1IXGA 3FV1A 5I5PA 4GVOA 2DDKA 3V5AA 3QUFA 4OVSA 1FPIA 4TQUQ 3TCHA 2B3BA 3B6QA 1RDYA 2XWVA 2H9BA 2O68A 1VFDA 2QPQA 3S4UA 4ELOA 4GL0A 4DZ1A 3R6UA 2B3FA 1MQGA 2QVRA 3IJXB 2ONRA 1FBPA 3C34A 3LBSA 1LLSA 5EQ7A 5CC2A 4BLAA 3JYRA 4NF8A 2OBGA 1UTHA 1OVBA 2CMOA 5FHMA 3H6VA 3KEIA 3TAJA 1FQEA 3D4CA 1WVJA 3THIA 2I48A 4QBAA 3PPRA 5FHOA 3SESA 4LZ5A 2ZYKA 3K02A 1LFIA 4GOTA 2XXKA 4LATA 4IGTA 2QMXA 3HV1A 3O66A 4AQ4A 4ZDMA 1DK4A 4YB5A 1LBWA 3HN0A 2HCAA 4MAGA 1GR2A 4PCDA 5ET6A 2Y7WA 5A5XA 4R74A 4G2ZA 4OEUA 1B3GA 2QMWA 3H7MA 2Q88A 4NHBA 3MBPA 3M3LA 5CMCA 4U4SA 3PV0E 2ZMBA 3N6TA 3ECRA 2XD2A 4FE8A 1EH3A 4FEBA 4PTKA 1LBBA 3OENA 1O64A 4WKMA 1FBDA 4IR8A 3H6TA 3CIJA 5FBPA 4MFIA 3U72A 2OWSA 3GXAA 4Q30B 5HPQA 4BDQA 5KDTB 3GBAA 4YMBA 4PAKA 4PETA 4NF5A 4OANA 3T96B 4GWWA 3QUJA 4G68A 1SQYA 3DP6A 1MY4A 2Q8MA 5JTYB 2XWOA 4R72A 1FQAA 4PAIA 1WODA 2XXIA 3B6WA 4XFEA 3USDA 2BJJX 2P0SA 2F34A 4O3BA 2V93A 4N15A 2Q2AA 3K1PA 4H5FA 1FTAA 1NV3A 1B4ZA 2XXVA 5I59A 4PFYA 2Z8FA 4N17A 4DXCA 4N8GA 1B0LA 4EQ9A 1EU8A 2WYPA 3CVGA 4ZEKA 2CZLA 4OYVA 4Q5TA 3FATA 4JWOA 4YU0A 3E78A 1A8EA 1NUXA 5CI5A 1NH8A 5A5LA 4XXUA 1P1NA 1QKBA 1K9ZA 1NMUA 1B2HA 3VV5A 3E4RA 3ZSFA 2PMSA 3OOAA 3Q26A 4EQBA 4XKRA 3KFMA 4U22A 4PGNA 3T22A 3VLVA 2I6EA 5H8FA 5LTCA 1O63A 2QRYA 3BFTA 2DWJA 4NF6B 1JEVA 1SDXA 2Q8JA 4OMBA 2Y5LA 2RINA 4X48A 3T0JA 1IIWA 4IO3A 1AWBA 1FRPA 1LB9A 2DXRA 4DLDA 2W7YA 1FTMA 3TCFA 3PPOA 4M1VA 4GQOA 1OQGA 1BIYA 3VVFA 5F1QA 4IO2A 3VE1B 1D9YA 4EQ7A 2F78A 3MC2A 1B5HA 2ONSA 4JVCA 3OSRA 1OQHA 1FSAA 2WBDA 4ZZAA 3ZS6A 1A55A 1NV2A 3SZPA 4IO5A 2XHDA 3KN8A 5M2VA 2OWTA 3K1MA 4GXSB 5EHMA 3GLBA 2F8DA 2X7PA 3MSTA 3FXBA
chains in the Genus database with same CATH topology
4EUOA 5AA2D 3FVKA 2QVVA 1MXVA 1BTJA 5I2NA 1QUIA 5LOMA 1NNTA 1AOVA 3S9LC 4F19A 5EQAA 4MF3A 3CFLA 3CI8A 5H8NA 3TTKA 3EKIA 3IJOB 2L5VA 2XWIA 5AA4B 3P7IA 3HHGA 5I57B 1JW4A 3U94A 1QULA 4H46A 4MHFA 1IXIA 5T3JA 1S50A 2CEXA 1FPJA 1QGXA 4OHNA 1P99A 3CFXA 3KN7A 3SKPA 4FAJA 4P8BA 2REGA 4QXDA 5I2KB 5J16A 4LQ5A 4L17A 1BK4A 4H45A 3FBPA 3R7XA 1MXYA 4NWDA 4GF8A 3QK6A 3PUZE 1B58A 3ODBA 2X7QA 2NXOA 4XKNA 1M5FA 4PAFA 4Z0IA 1MXXA 3CG1A 2XX7A 4I3YA 3RYDA 1AH5A 1XOCA 4RK9A 1FBHA 1PDAA 1QW0A 1XT8A 2D21A 4LUBA 2XXPA 2ZYNA 1YTVA 3EN3A 1SYHA 4H67A 4MJOA 4XKQA 2GHAA 3IO4A 1D9VA 3GBBA 3U8QA 1FBFA 4C1TA 2FNCA 3SETA 3BBRA 4OTEA 4QSDA 2D5WA 1I6QA 1IMCA 4FECA 4GIZA 4ELRA 1KA1A 4NGUA 1B9JA 1OMPA 3OELA 4R75A 1PB7A 4QFNA 4OQOA 4P0GA 3MZBA 3PPPA 2GFEA 2Q2CA 3SEUA 4NF4B 1I6AA 4QRZA 3A3CA 1B3EA 3S9EA 4WXJA 1FQDA 5KDTA 3TKDA 4DDDA 3KG2A 1LB8A 1LAHE 3OO6A 5F7VA 5KCJA 5IKBA 4GLIA 1UTBB 5DVJA 4G4PA 1OIBA 1IMAA 4HCYA 4EF2A 3MP8A 1S9TA 4F3BA 1Y4CA 4N6KA 4P47A 2QVUA 4WEDA 3EPEA 2YPNA 2E1SA 3S2VA 3B8BA 1LAFE 3EHUA 1IMFA 4HTGA 4I62A 5ET7A 4THIA 4I3EA 2VD2A 5EYFA 1MH3A 5IZ3B 2XD3A 4F1YA 3OMBA 2BJIA 2UVHA 4PE5B 4YAHX 3RNNA 3T9HB 2ZNUA 1IMEA 1SPIA 3TCGA 1Y3NA 4QFOA 1LBYA 1N84A 2PT1A 2UYFA 3MZ1A 3A09A 4BDNA 4NAPA 1B6HA 2NOOA 1LFHA 1IUDA 1J1NA 4NF6A 4NTLA 3PU5A 3UN6A 5AA2B 2Y7PA 4YICA 2ONKE 2GRVA 4OVRA 3B6TA 3QMFA 4ZEIA 1XC1A 2R8TA 3OD7A 3O29A 4HE2A 1ZLQA 3B7DA 1MG1A 3E9XA 3VDFA 3BFUA 1FJ6A 5AA3A 4U21A 2E0SA 4ZE9A 3O6IA 3IO6A 3V8XB 4I9DA 2B4LA 4KQPA 1WDNA 3KC0A 4TLMB 1NI9A 4M4GA 2F36A 1SW2A 3KOSA 3SERA 3K6WA 2ZZWA 4G8MA 2ANJA 4YZZA 3OXNA 1Y1ZA 3K0VA 5DVFA 4PBQA 2V4CA 3CG3A 3C4MA 4F2OA 1Z7NE 5AA4A 3NOHA 3FVOA 4X9TA 1B3FA 3DM0A 2P1SA 3VVDA 2REJA 5I57A 1Y20A 3OO8A 1EZ9A 4PDDA 4QHQA 1Q1KA 3UORA 2F3DA 1B4HA 1USYH 3MP6A 1MRPA 4LQ2A 3N94A 4ISUA 3OEMA 2F7AA 4GBWA 1ZU0A 4LA9A 2PBWA 2OK2A 1N04A 4PP0A 2Y5KA 2V3UA 2DWAA 1NUZA 1B52A 3M8UA 3EHSA 3G3IA 2Y7RA 2V84A 2RCAA 4X8RA 1ANFA 2DE3A 3U93A 3KC1A 4PBHA 2R71A 5I56B 3ZKLA 4O7IA 3UGWA 2CZKA 2PFYA 1CB6A 2P3VA 4OENA 2H99A 2HXWA 5CRYA 4ZE8A 3RTWB 4TOZA 1XS5A 2P2AA 2DS9A 3TZAA 1NH7A 4O94A 4X1BA 4YB6A 4U23A 1D9QA 3DP8A 3D1RA 2RKMA 3V83A 3K6XA 3TYHA 1SW5A 1TFAA 2HXRA 3BIHA 4GWOA 4GFRA 4LZ7A 1DSNA 1FW0A 5DEXB 1ELJA 3C32A 4Q8RA 1IZ1A 5J1DA 3Q25A 4NF4A 1A7LA 3K4UA 3RPLB 2ZNSA 3PGFA 5I84A 3CSBA 3G3JA 3PUXE 4YMAA 4K3FA 3CHGA 4GX6A 4TLLB 4ELPA 3K6VA 3LSXA 3H4ZA 2H25A 4NWCA 4RA1A 3Q27A 3RPWA 5I3SA 4JXIA 5H8HA 5EHSA 2IA4A 1P1OA 2OLBA 1BKAA 1SW1A 3E79A 5EQ8A 3GZGA 4GL8A 1N7WA 1DCUA 3FASA 2WBBA 2VOZA 4PFWA 1N3WA 2I4CA 4JVIA 2QJEA 1IMDA 4C0RA 1T0KA 1GV8A 1KA0A 4G8NA 3W9WA 5IZ1A 3S9MC 1Y4TA 3UK4A 1NFTA 3M3FA 3CRBA 1RKMA 1IQ7A 4U1ZA 3HO7A 4GWXA 5IGAA 4PC9A 4GWSA 5H8SA 4N13A 1II5A 4GWYA 5IZ3A 3LUYA 3Q28A 5K2XA 3ISPA 2VPOA 1MDP1 3OEKA 2XWKA 2PFZA 4PGPA 4YKPA 4F3PA 2OZZA 2O1LA 2DE4A 3O6HA 2NVUB 3KGCA 4O3CA 4KCCA 2I0CA 3MZ9A 2GH9A 3UA8A 4AS5A 1MQDA 1NKXA 4DI4B 4KI0E 3I3VA 1N0TA 5AA2A 1URGA 5TPAA 3RN8A 3HCQA 2V25A 2HEUA 4R2FA 5TU0A 4XTCQ 4PFBA 3IL1B 3OO7A 4DXBA 1POY1 2A5TB 3FXQA 1I69A 2F5XA 5JK4A 4HW8A 4EXKA 3JV9A 1UIUA 4G77A 2VPNA 5I58A 1VR5A 3RTFB 5BWJA 2B65A 4GRKA 5B70A 1A54A 2XXTA 2O69A 4F3SA 3T9XB 1FPKA 5EYGA 3K01A 5ESYA 4GXAA 3IORA 1UIVA 1Y1MA 4N07A 3DP4A 2MKZA 3HPIA 4MLQA 2KQZA 5B7DA 2A5SA 4RY1A 5CM6A 4IO4A 4H8JA 2WX9A 3QYTA 2F6PA 3LSLA 4R2BA 2RC9A 4OEVA 2PT2A 3BKIB 3ILTB 5ET8A 1H3DA 4MLVA 1ATGA 4DXUA 1B0HA 4I8CA 1IMBA 4QF9A 4X1DA 2R6GE 1MQHA 1URDA 4ELQA 5FHNA 3AXFA 4RPOA 3VXCA 3TDJA 2DOJA 1FPBA 4DCXA 1LBXA 4AS4A 1JEUA 3DLNA 4RK2A 1B40A 1YYZA 1HSLA 2AL4A 2CEYA 3MUQA 1P1WA 3S9NC 1PEBA 1UTHB 4PFRA 4PF8A 1SD3A 3G3KA 1KZ8A 1DPPA 2I3VA 4OVPA 4GWZA 1B51A 1B7ZA 4E0XA 4PE3A 5ICQA 2Z22A 5BUUA 2XXXA 4FIMA 4OERA 4GBVA 4LN5A 4F31B 1YXIA 3H6UA 4KCDA 1Y9UA 4PFIA 4UACA 5CMMA 1URSA 4UABA 3KOTA 2HAVA 1Y3QA 2KLFA 1RYOA 4RNSA 4N6PA 1MM7A 4H65A 5CBRA 3FVNA 1GVCA 2H98A 2FHYA 3PPQA 1DTZA 2OJTA 3OSQA 3UIFA 4KHZE 2QL3A 4OFJA 5ISUA 1ZBMA 4YKKA 3F11A 3D4GA 4GX4A 3PMXA 4ESWA 4LVQA 1MM6A 4OFLA 1Y3PA 2DWIA 1QJMA 3I6VA 4PFUA 2ESNA 1H43A 1FPEA 2R9JA 2G93A 4LONB 4NQ8A 2I4BA 2ZYOA 3IFAA 5DEXA 4RPNA 4NF5B 1OLAA 2DVCA 4N81A 3PPNA 4F18A 3VFJA 1ZTYA 3RT6B 4Z7EA 1XI6A 2Q89A 5JTYA 3RPLA 1QUKA 3Q29A 4OFOA 1FTLA 5FTIA 2QS1A 3SEWA 3SEXA 4GWUA 2Z23A 3PD8A 4MNIA 2ZXTA 1SI0A 3IB0A 4YKIA 3PTYA 4POXA 3N5LA 2F35A 1YAEA 5I7IA 4XF5A 2UXAA 3TTMA 4R73A 1OLCA 3G3HA 2PX1A 4MMPA 1MXUA 4MH5A 1B5JA 2DVZA 4ZEBA 4NN3A 1MY0A 3KJ7A 1NV5A 4N91A 3FGSA 2H4IA 1DBZA 1MS7A 1O7TA 3VXBA 2I58A 3QXMA 1LCFA 3FJGA 5F24A 1GTKA 1MXZA 1JW5A 1ZMGA 2Z8DA 4ECFA 5HBCA 2WKYA 1R9QA 2PCRA 3C36A 3TPAA 1EYKA 2Y7KA 1N3XA 2QS2A 2PVUA 1TXFA 3IOWA 2RCBA 1B3LA 4P9KA 4ONYA 2O7UA 5EQ9A 4IO6A 1FQBA 1JETA 1LBZA 1M5DA 4R6HA 4F22A 2WYKA 1P1UA 2O51A 3MVWA 4XIGQ 1GGGA 2A5TA 1JVXA 3A3UA 3O2AA 2X26A 4OA4A 1FTOA 2QFLA 1VSOA 3KJTA 5ELVA 5H8QB 2Q9TA 3MVYA 2DXYA 1XVXA 4GD5A 4C1UA 2OWZA 3B50A 5DT6A 1LFGA 1FTKA 5I2NB 2THIA 2VP1A 1AL3A 4JSOA 5AE4A 4JSDA 3LR1A 3KN3A 1FJ9A 4P3LA 2DYXA 5JEIA 3R26A 3O28A 5TP9B 1EZOA 4BDRA 3CR9A 1US5A 4DIGA 2YLNA 1ZIUA 4YKJA 3FJMA 2Y7IA 3RY3A 3FD3A 3WAEA 3MW0A 3MAMA 3MVXA 2XX8A 3TTRA 1B5IA 2F6GA 3TFLA 4H5GA 5I2KA 1Q9DA 2RC7A 3TMGA 1JQFA 1EZPA 2NUVA 4RJZA 4ZS9A 2DSFA 4P11A 1XHYA 4I40A 1IITA 4HCWA 2D3IA 3C31A 4ZEDA 1FBEA 1NUWA 4P56A 1PB8A 1A99A 1R1NA 3I5OA 1TWYA 1FTJA 2ZYMA 3K2DA 4KD5A 1NUYA 1MY1A 1SBPA 4OETA 1HSEA 3C35A 2QS4A 4JWYA 1JNFA 2M8CA 4HE0A 4MEVA 1LGBC 4HS7A 3IFCA 4U4XA 1H45A 1SYIA 3SDFA 2HAUA 4BDMA 4QFKA 4F1VA 4F39A 1OVTA 4PFTA 1D4NA 3K6UA 2XXQA 3IOUA 1D3KA 2XXYA 4MX6A 4XKPA 5L9OA 4JWXA 4IGRA 3C9HA 2HFBA 5KZTA 1TFDA 3O6GA 4OESA 2RF1A 4F2QA 4EDPA 3H03A 2FBPA 1Q35A 3JZJA 3MVZA 4JB7A 4NX1A 1HSJA 1MH4A 5IZZA 1M5EA 3MQ9A 3TTNA 2FIXA 2CZHA 1CNQA 5EYHA 4ZEFA 1SW4A 3PMVA 1DTGA 2O1MA 4KR5A 2UYEA 3HSTA 3KSJA 5KCJB 4QSEA 3PUWE 1B05A 3EHTA 1UTBA 4ND9A 1B3HA 3VLWA 3KSXA 1NNKA 2LAOA 4O3AA 3CFZA 2OCUA 2WEFA 2YJPA 4PF6A 3FXRA 5CBSA 2B4MA 4KYDA 4N8YA 2DP8A 4NG7A 4AB5A 1FBCA 3FV2A 5FTHA 1MQIA 3CSGA 5L8DA 4QFLA 3QAXA 3MWBA 2XXHA 1UQWA 2Z8EA 3PUVE 5DW8A 4XEQA 3HFUA 3TUSA 4U1OA 2O7IA 3GYYA 1IXHA 3G7WA 1H44A 3TODA 1VE4A 1BP5A 4IO7A 4I1DA 5K2YA 2RC8A 3FZVA 5HM4B 4R6KA 3IOTA 4H1XA 2GHBA 4FORA 4G8HA 3RGYA 2DE2A 3TTLA 4ZZEA 2VT5A 2V3QA 1RYXA 4F1UA 1IEJA 4P0IA 1Z7ME 2FVZA 3OO9A 4OXVA 4X04A 2FIEA 4O8MA 4JDFA 2F7BA 4ESXA 2ABHA 3A29A 4DCYA 3QIMA 4FJPA 4NF0A 4UA8A 4YB7A 1QVSA 1L5TA 4MIJA 1FBGA 3VLUA 1H76A 3SEYA 2AL5A 4KXPA 3W15C 3K00A 4EXLA 1B1HA 1B1XA 2I49A 1NV4A 4MBPA 1BLFA 2HZKA 1LEVA 4H0WA 1NV0A 4P1EA 3U1OA 2O84X 3H06B 4F29A 1R9LA 4BDOA 1IXCA 3IB2A 5H8QA 1JW1A 3DELB 1S7YA 3IOVA 3T93B 1FPGA 3QSLA 4R6YA 5IM2A 4KYEA 1VDWA 1MY2A 1POTA 3UP9A 5ET5A 4QSCA 2JJKA 4IY5A 2HQ0A 1FPLA 5TP9A 4E0WA 4RYAA 3HHFA 1LAGE 2F97A 3ZKKA 1G0HA 4JVDA 4OVTA 1LBCA 3RQTA 2UVJA 2XA5A 1RDXA 1YCJA 1SVXB 2OX3A 4R9FA 1B32A 2HHMA 5L9MA 4PDHA 1B7UA 1A8FA 3H3GA 1US4A 5ITPA 1INPA 2AYSA 4FEDA 3TQWA 1JP4A 3WAFA 1G0IA 4NF8B 2HPGA 3LV0A 4BDLA 3ONMA 4KFQA 3TEPA 3KZGA 2ZZXA 3FUZA 4OZ9A 3LSFB 4G68C 5CMBA 4HE1A 4DI3D 5DYHA 4N4UA 3MYUA 2P3NA 3W9VA 1CE2A 4FBPA 1MPBA 2V3TA 2Y84A 4OVJA 2UVIA 3K1NA 1LCTA 1XVYA 1RDZA 3KBRA 4EF1A 3C33A 5AA1A 1M5BA 4O7MA 1EYIA 1B46A 2CZIA 5I56A 4QFPA 3TQLA 4RXLA 1NV6A 2UVGA 1MPDA 5A5XB 1DOTA 1ZKBA 3SEVA 3IAZA 3V89B 3KBZA 1SI1A 3ILUB 3FIRA 1PBPA 2F7CA 1MDQA 2XXWA 2F3BA 4KPTA 3LSWA 3T9UA 1K9YA 4G61A 3MP1A 3TELA 2O6AA 1R6ZA 3L6GA 1FPFA 3EQ1A 4G68B 3RT8A 1PC3A 3M3KA 1USYE 3FXUA 1QUJA 4NMYA 2ZZVA 2FYIA 3VVEA 1FQCA 3E3KA 2G29A 2XXUA 3U92A 3N6UA 2DWHA 1LSTA 3G3FA 1DMBA 5H8HB 4MNPA 1YZ0A 2HZLA 1NNPA 1NL5A 2I3WA 5I59B 1QKAA 3IX1A 4R9GA 2QSXA 2VGQA 3IR1A 3MJNA 3T1BA 1LAXA 2ALUA 4U2RA 4OVQA 3N26A 4IB2A 1AMFA 1YPNA 5IAIA 1NV1A 4FATA 4F3GA 5ITOA 4WEPA 3MPKA 4PQJA 5DTBA 1VFEA 3T9VA 2AIXA 1TT1A 3EF7A 3RUMA 1N7XA 5H8FB 3O9PA 4AB6A 1FQFA 2XXRA 3PUYE 4GX3A 1MXWA 3L6HA 3E13X 4KYSA 4MCOA 1FPDA 1A40A 1MY3A 5L9SA 4LP2B 1AIVA 1NNFA 2IEEA 2VD3A 3MPLA 1JVYA 1EYJA 3IK6B 2QS3A 5DVIA 4H8IA 2DQVA 4MNCA 2VHAA 3RLFE 5TPAB 5CMKA 4JBZA 2XX9A 1PBQA 4H6DA 2Q74A 1N76A 3U65A 1LBVA 2ZNTA 3LC8A 5I58B 1NV7A 4HXVA 1PB9A 4Q0CA 4OWDA 4ZECA 1I6BA 3H6WA 3LUZA 4NE4A 1P1QA 4N6DA 5LDZA 4P1LA 2H5YA 4IY6A 3FVGA 2GQ1A 3ROJA 2PYYA 3PMWA 2FA7A 1FCKA 5H8NB 4NEDA 3FJ7A 2NWJA 1KWHA 3IB1A 3G3GA 4LZ8A 1ZJLA 1F9BA 1DPEA 1M5CA 1B7HA 4POWA 3PD9A 5ICTA 2KR0A 4DE8A 3BIGA 1MQJA 1MPCA 3T66A 3O97A 2I0BA 1IXGA 3FV1A 5I5PA 4GVOA 2DDKA 3V5AA 3QUFA 4OVSA 1FPIA 4TQUQ 3TCHA 2B3BA 3B6QA 1RDYA 2XWVA 2H9BA 2O68A 1VFDA 2QPQA 3S4UA 4ELOA 4GL0A 4DZ1A 3R6UA 2B3FA 1MQGA 2QVRA 3IJXB 2ONRA 3C34A 1FBPA 3LBSA 1LLSA 5EQ7A 5CC2A 4BLAA 3JYRA 4NF8A 2OBGA 1UTHA 1OVBA 2CMOA 5FHMA 3H6VA 3KEIA 3TAJA 1FQEA 3D4CA 1WVJA 3THIA 2I48A 4QBAA 3PPRA 5FHOA 3SESA 4LZ5A 2ZYKA 3K02A 1LFIA 4GOTA 2XXKA 4LATA 4IGTA 2QMXA 3HV1A 3O66A 4AQ4A 4ZDMA 1DK4A 4YB5A 1LBWA 3HN0A 2HCAA 4MAGA 1GR2A 4PCDA 5ET6A 2Y7WA 5A5XA 4R74A 4G2ZA 4OEUA 1B3GA 2QMWA 3H7MA 2Q88A 4NHBA 3MBPA 3M3LA 5CMCA 4U4SA 3PV0E 2ZMBA 3N6TA 3ECRA 2XD2A 4FE8A 1EH3A 4FEBA 4PTKA 1LBBA 3OENA 1O64A 4WKMA 1FBDA 4IR8A 3H6TA 3CIJA 5FBPA 4MFIA 3U72A 2OWSA 3GXAA 4Q30B 5HPQA 4BDQA 5KDTB 3GBAA 4YMBA 4PAKA 4PETA 4NF5A 4OANA 3T96B 4GWWA 3QUJA 4G68A 1SQYA 3DP6A 1MY4A 2Q8MA 5JTYB 2XWOA 4R72A 1FQAA 4PAIA 1WODA 2XXIA 3B6WA 3USDA 4XFEA 2BJJX 2P0SA 2F34A 4O3BA 2V93A 4N15A 2Q2AA 3K1PA 4H5FA 1FTAA 1NV3A 1B4ZA 2XXVA 5I59A 4PFYA 2Z8FA 4N17A 4DXCA 4N8GA 1B0LA 4EQ9A 1EU8A 2WYPA 3CVGA 4ZEKA 2CZLA 4OYVA 4Q5TA 3FATA 4JWOA 4YU0A 3E78A 1A8EA 1NUXA 5CI5A 1NH8A 5A5LA 4XXUA 1P1NA 1QKBA 1K9ZA 1NMUA 1B2HA 3VV5A 3E4RA 3ZSFA 2PMSA 3OOAA 3Q26A 4EQBA 4XKRA 3KFMA 4U22A 3T22A 3VLVA 4PGNA 2I6EA 5H8FA 5LTCA 1O63A 2QRYA 3BFTA 2DWJA 4NF6B 1JEVA 1SDXA 2Q8JA 4OMBA 2Y5LA 2RINA 4X48A 3T0JA 1IIWA 4IO3A 1AWBA 1FRPA 1LB9A 2DXRA 4DLDA 2W7YA 1FTMA 3TCFA 3PPOA 4M1VA 4GQOA 1OQGA 1BIYA 3VVFA 5F1QA 4IO2A 3VE1B 1D9YA 4EQ7A 2F78A 3MC2A 1B5HA 2ONSA 4JVCA 3OSRA 1OQHA 1FSAA 2WBDA 4ZZAA 3ZS6A 1A55A 1NV2A 3SZPA 4IO5A 2XHDA 3KN8A 5M2VA 2OWTA 3K1MA 4GXSB 5EHMA 3GLBA 2F8DA 2X7PA 3MSTA 3FXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EUO A;  5AA2 D;  3FVK A;  1MXV A;  1BTJ A;  5I2N A;  1QUI A;  5LOM A;  1NNT A;  1AOV A;  3S9L C;  4F19 A;  4MF3 A;  3CFL A;  3CI8 A;  5H8N A;  3TTK A;  3IJO B;  2XWI A;  5AA4 B;  3P7I A;  3HHG A;  5I57 B;  1JW4 A;  3U94 A;  1QUL A;  4MHF A;  1IXI A;  1S50 A;  2CEX A;  4OHN A;  1P99 A;  3CFX A;  3KN7 A;  3SKP A;  4FAJ A;  4P8B A;  2REG A;  5I2K B;  4LQ5 A;  4L17 A;  3R7X A;  1MXY A;  4NWD A;  4GF8 A;  3QK6 A;  3PUZ E;  1B58 A;  3ODB A;  2X7Q A;  2NXO A;  4XKN A;  1M5F A;  4PAF A;  4Z0I A;  1MXX A;  3CG1 A;  2XX7 A;  1AH5 A;  1XOC A;  4RK9 A;  1PDA A;  1QW0 A;  1XT8 A;  2D21 A;  4LUB A;  2XXP A;  2ZYN A;  1YTV A;  3EN3 A;  1SYH A;  4H67 A;  4XKQ A;  2GHA A;  3IO4 A;  1D9V A;  3GBB A;  3U8Q A;  4C1T A;  2FNC A;  3SET A;  3BBR A;  4OTE A;  4QSD A;  2D5W A;  1I6Q A;  4FEC A;  4GIZ A;  4ELR A;  4NGU A;  1B9J A;  1OMP A;  3OEL A;  4R75 A;  1PB7 A;  4QFN A;  4OQO A;  4P0G A;  3MZB A;  3PPP A;  2GFE A;  2Q2C A;  3SEU A;  4NF4 B;  1I6A A;  4QRZ A;  3A3C A;  1B3E A;  3S9E A;  4WXJ A;  1FQD A;  5KDT A;  3TKD A;  4DDD A;  3KG2 A;  1LB8 A;  1LAH E;  3OO6 A;  5F7V A;  5KCJ A;  5IKB A;  4GLI A;  1UTB B;  5DVJ A;  4G4P A;  1OIB A;  4HCY A;  4EF2 A;  3MP8 A;  1S9T A;  4F3B A;  1Y4C A;  4N6K A;  4P47 A;  4WED A;  3EPE A;  2YPN A;  2E1S A;  3S2V A;  1LAF E;  3EHU A;  4HTG A;  4I62 A;  4THI A;  2VD2 A;  5EYF A;  1MH3 A;  2XD3 A;  4F1Y A;  3OMB A;  2UVH A;  4PE5 B;  4YAH X;  3RNN A;  3T9H B;  2ZNU A;  3TCG A;  1Y3N A;  4QFO A;  1N84 A;  2PT1 A;  2UYF A;  3MZ1 A;  3A09 A;  4BDN A;  4NAP A;  1B6H A;  2NOO A;  1LFH A;  1IUD A;  1J1N A;  4NF6 A;  4NTL A;  3PU5 A;  3UN6 A;  5AA2 B;  2Y7P A;  4YIC A;  2ONK E;  2GRV A;  4OVR A;  3B6T A;  4ZEI A;  1XC1 A;  3OD7 A;  3O29 A;  1ZLQ A;  3B7D A;  1MG1 A;  3E9X A;  3VDF A;  3BFU A;  5AA3 A;  4U21 A;  2E0S A;  4ZE9 A;  3O6I A;  3IO6 A;  3V8X B;  4I9D A;  4KQP A;  1WDN A;  4TLM B;  4M4G A;  2F36 A;  1SW2 A;  3KOS A;  3SER A;  3K6W A;  2ZZW A;  4G8M A;  2ANJ A;  4YZZ A;  3OXN A;  1Y1Z A;  3K0V A;  5DVF A;  4PBQ A;  2V4C A;  3CG3 A;  3C4M A;  4F2O A;  1Z7N E;  5AA4 A;  3FVO A;  4X9T A;  1B3F A;  3DM0 A;  2P1S A;  3VVD A;  2REJ A;  5I57 A;  1Y20 A;  3OO8 A;  1EZ9 A;  4PDD A;  4QHQ A;  1Q1K A;  3UOR A;  1B4H A;  1USY H;  3MP6 A;  1MRP A;  4LQ2 A;  3N94 A;  4ISU A;  3OEM A;  2F7A A;  1ZU0 A;  4LA9 A;  2PBW A;  2OK2 A;  1N04 A;  4PP0 A;  2V3U A;  2DWA A;  1B52 A;  3M8U A;  3EHS A;  3G3I A;  2Y7R A;  2V84 A;  2RCA A;  4X8R A;  1ANF A;  2DE3 A;  3U93 A;  4PBH A;  2R71 A;  5I56 B;  3ZKL A;  3UGW A;  2PFY A;  1CB6 A;  4OEN A;  2H99 A;  2HXW A;  5CRY A;  4ZE8 A;  3RTW B;  4TOZ A;  1XS5 A;  2P2A A;  2DS9 A;  3TZA A;  1NH7 A;  4O94 A;  4X1B A;  4YB6 A;  4U23 A;  3DP8 A;  2RKM A;  3V83 A;  3K6X A;  3TYH A;  1SW5 A;  1TFA A;  4GWO A;  4GFR A;  4LZ7 A;  1DSN A;  1FW0 A;  5DEX B;  1ELJ A;  3C32 A;  4Q8R A;  1IZ1 A;  5J1D A;  3Q25 A;  4NF4 A;  1A7L A;  3K4U A;  2ZNS A;  3PGF A;  5I84 A;  3CSB A;  3G3J A;  3PUX E;  4YMA A;  4K3F A;  4TLL B;  4ELP A;  3K6V A;  3LSX A;  3H4Z A;  2H25 A;  4NWC A;  4RA1 A;  3Q27 A;  3RPW A;  4JXI A;  5H8H A;  5EHS A;  2IA4 A;  1P1O A;  2OLB A;  1BKA A;  1SW1 A;  3GZG A;  4GL8 A;  1N7W A;  3FAS A;  2VOZ A;  4PFW A;  1N3W A;  2I4C A;  2QJE A;  4C0R A;  1T0K A;  1GV8 A;  4G8N A;  3W9W A;  3S9M C;  1Y4T A;  3UK4 A;  1NFT A;  3M3F A;  3CRB A;  1RKM A;  1IQ7 A;  4U1Z A;  3HO7 A;  5IGA A;  4PC9 A;  5H8S A;  4N13 A;  1II5 A;  3LUY A;  3Q28 A;  5K2X A;  2VPO A;  1MDP 1;  3OEK A;  2XWK A;  2PFZ A;  4PGP A;  4YKP A;  4F3P A;  2OZZ A;  2O1L A;  2DE4 A;  3O6H A;  2NVU B;  3KGC A;  4O3C A;  4KCC A;  2I0C A;  3MZ9 A;  2GH9 A;  3UA8 A;  1MQD A;  1NKX A;  4DI4 B;  4KI0 E;  3I3V A;  1N0T A;  5AA2 A;  1URG A;  5TPA A;  3RN8 A;  3HCQ A;  2V25 A;  2HEU A;  4R2F A;  5TU0 A;  4XTC Q;  4PFB A;  3IL1 B;  3OO7 A;  4DXB A;  1POY 1;  2A5T B;  3FXQ A;  1I69 A;  2F5X A;  5JK4 A;  4HW8 A;  4EXK A;  3JV9 A;  1UIU A;  4G77 A;  2VPN A;  5I58 A;  1VR5 A;  3RTF B;  5BWJ A;  2B65 A;  4GRK A;  5B70 A;  1A54 A;  2XXT A;  2O69 A;  4F3S A;  3T9X B;  3K01 A;  4GXA A;  3IOR A;  1UIV A;  1Y1M A;  4N07 A;  3DP4 A;  3HPI A;  4MLQ A;  5B7D A;  2A5S A;  4RY1 A;  5CM6 A;  4IO4 A;  4H8J A;  2WX9 A;  3QYT A;  2F6P A;  3LSL A;  4R2B A;  2RC9 A;  4OEV A;  2PT2 A;  3BKI B;  3ILT B;  1H3D A;  4MLV A;  1ATG A;  4DXU A;  1B0H A;  4I8C A;  4QF9 A;  4X1D A;  2R6G E;  1MQH A;  1URD A;  4ELQ A;  5FHN A;  3AXF A;  4RPO A;  3VXC A;  3TDJ A;  2DOJ A;  4DCX A;  1JEU A;  3DLN A;  4RK2 A;  1B40 A;  1HSL A;  2AL4 A;  2CEY A;  3MUQ A;  1P1W A;  3S9N C;  1PEB A;  1UTH B;  4PFR A;  4PF8 A;  1SD3 A;  3G3K A;  1DPP A;  2I3V A;  4OVP A;  1B51 A;  1B7Z A;  4E0X A;  4PE3 A;  5ICQ A;  2Z22 A;  5BUU A;  2XXX A;  4FIM A;  4OER A;  4LN5 A;  4F31 B;  3H6U A;  4KCD A;  1Y9U A;  4PFI A;  4UAC A;  5CMM A;  1URS A;  4UAB A;  3KOT A;  2HAV A;  1Y3Q A;  2KLF A;  1RYO A;  4RNS A;  4N6P A;  1MM7 A;  4H65 A;  5CBR A;  3FVN A;  1GVC A;  2H98 A;  3PPQ A;  1DTZ A;  2OJT A;  3OSQ A;  3UIF A;  4KHZ E;  2QL3 A;  4OFJ A;  5ISU A;  1ZBM A;  4YKK A;  3F11 A;  3D4G A;  3PMX A;  4ESW A;  4LVQ A;  1MM6 A;  4OFL A;  1Y3P A;  2DWI A;  1QJM A;  3I6V A;  4PFU A;  2ESN A;  1H43 A;  2R9J A;  2G93 A;  4LON B;  4NQ8 A;  2I4B A;  2ZYO A;  5DEX A;  4RPN A;  4NF5 B;  1OLA A;  2DVC A;  3PPN A;  4F18 A;  3VFJ A;  1ZTY A;  3RT6 B;  4Z7E A;  2Q89 A;  5JTY A;  1QUK A;  3Q29 A;  4OFO A;  1FTL A;  5FTI A;  2QS1 A;  3SEW A;  3SEX A;  2Z23 A;  3PD8 A;  4MNI A;  2ZXT A;  1SI0 A;  3IB0 A;  4YKI A;  4POX A;  3N5L A;  2F35 A;  1YAE A;  5I7I A;  4XF5 A;  2UXA A;  3TTM A;  4R73 A;  1OLC A;  3G3H A;  2PX1 A;  4MMP A;  1MXU A;  4MH5 A;  1B5J A;  2DVZ A;  4ZEB A;  4NN3 A;  1MY0 A;  3KJ7 A;  4N91 A;  3FGS A;  2H4I A;  1MS7 A;  1O7T A;  3VXB A;  2I58 A;  3QXM A;  1LCF A;  3FJG A;  1GTK A;  1MXZ A;  1JW5 A;  1ZMG A;  2Z8D A;  4ECF A;  5HBC A;  2WKY A;  1R9Q A;  3C36 A;  3TPA A;  2Y7K A;  1N3X A;  2QS2 A;  2PVU A;  1TXF A;  3IOW A;  2RCB A;  1B3L A;  4P9K A;  4ONY A;  2O7U A;  4IO6 A;  1FQB A;  1JET A;  1M5D A;  4R6H A;  4F22 A;  2WYK A;  1P1U A;  2O51 A;  3MVW A;  4XIG Q;  1GGG A;  2A5T A;  1JVX A;  3A3U A;  3O2A A;  2X26 A;  4OA4 A;  1FTO A;  1VSO A;  3KJT A;  5ELV A;  5H8Q B;  2Q9T A;  3MVY A;  2DXY A;  1XVX A;  4GD5 A;  4C1U A;  3B50 A;  5DT6 A;  1LFG A;  1FTK A;  5I2N B;  2THI A;  2VP1 A;  1AL3 A;  4JSO A;  5AE4 A;  4JSD A;  3LR1 A;  3KN3 A;  4P3L A;  2DYX A;  5JEI A;  3R26 A;  3O28 A;  5TP9 B;  1EZO A;  4BDR A;  3CR9 A;  1US5 A;  4DIG A;  2YLN A;  1ZIU A;  4YKJ A;  3FJM A;  2Y7I A;  3RY3 A;  3FD3 A;  3WAE A;  3MW0 A;  3MAM A;  3MVX A;  2XX8 A;  3TTR A;  1B5I A;  2F6G A;  3TFL A;  4H5G A;  5I2K A;  2RC7 A;  3TMG A;  1JQF A;  1EZP A;  2NUV A;  4RJZ A;  4ZS9 A;  2DSF A;  4P11 A;  1XHY A;  1IIT A;  4HCW A;  2D3I A;  3C31 A;  4ZED A;  4P56 A;  1PB8 A;  1A99 A;  1R1N A;  3I5O A;  1TWY A;  1FTJ A;  2ZYM A;  3K2D A;  4KD5 A;  1MY1 A;  1SBP A;  4OET A;  1HSE A;  3C35 A;  2QS4 A;  4JWY A;  1JNF A;  2M8C A;  4MEV A;  1LGB C;  4HS7 A;  4U4X A;  1H45 A;  1SYI A;  3SDF A;  2HAU A;  4BDM A;  4QFK A;  4F1V A;  4F39 A;  1OVT A;  4PFT A;  1D4N A;  3K6U A;  2XXQ A;  3IOU A;  1D3K A;  2XXY A;  4MX6 A;  4XKP A;  5L9O A;  4JWX A;  4IGR A;  3C9H A;  2HFB A;  5KZT A;  1TFD A;  3O6G A;  4OES A;  2RF1 A;  4F2Q A;  4EDP A;  3H03 A;  1Q35 A;  3JZJ A;  3MVZ A;  4JB7 A;  4NX1 A;  1HSJ A;  1MH4 A;  5IZZ A;  1M5E A;  3MQ9 A;  3TTN A;  4ZEF A;  1SW4 A;  3PMV A;  1DTG A;  2O1M A;  4KR5 A;  2UYE A;  3HST A;  3KSJ A;  5KCJ B;  4QSE A;  3PUW E;  1B05 A;  3EHT A;  1UTB A;  4ND9 A;  1B3H A;  3VLW A;  3KSX A;  1NNK A;  2LAO A;  4O3A A;  3CFZ A;  2OCU A;  2YJP A;  4PF6 A;  3FXR A;  5CBS A;  4KYD A;  4N8Y A;  2DP8 A;  4NG7 A;  4AB5 A;  3FV2 A;  5FTH A;  1MQI A;  3CSG A;  5L8D A;  4QFL A;  3QAX A;  3MWB A;  2XXH A;  1UQW A;  2Z8E A;  3PUV E;  4XEQ A;  3TUS A;  4U1O A;  2O7I A;  3GYY A;  1IXH A;  3G7W A;  1H44 A;  3TOD A;  1VE4 A;  1BP5 A;  4IO7 A;  4I1D A;  5K2Y A;  2RC8 A;  3FZV A;  5HM4 B;  4R6K A;  3IOT A;  4H1X A;  2GHB A;  4FOR A;  4G8H A;  3RGY A;  2DE2 A;  3TTL A;  4ZZE A;  2V3Q A;  1RYX A;  4F1U A;  1IEJ A;  4P0I A;  1Z7M E;  3OO9 A;  4OXV A;  4X04 A;  4O8M A;  4JDF A;  2F7B A;  4ESX A;  2ABH A;  4DCY A;  3QIM A;  4FJP A;  4NF0 A;  4UA8 A;  4YB7 A;  1QVS A;  1L5T A;  4MIJ A;  3VLU A;  1H76 A;  3SEY A;  2AL5 A;  3W15 C;  3K00 A;  4EXL A;  1B1H A;  1B1X A;  2I49 A;  4MBP A;  1BLF A;  2HZK A;  4H0W A;  4P1E A;  3U1O A;  2O84 X;  3H06 B;  4F29 A;  1R9L A;  4BDO A;  1IXC A;  3IB2 A;  5H8Q A;  1JW1 A;  3DEL B;  1S7Y A;  3IOV A;  3T93 B;  3QSL A;  4R6Y A;  5IM2 A;  4KYE A;  1MY2 A;  1POT A;  3UP9 A;  4QSC A;  4IY5 A;  2HQ0 A;  5TP9 A;  4E0W A;  4RYA A;  3HHF A;  1LAG E;  2F97 A;  3ZKK A;  4OVT A;  1LBC A;  3RQT A;  2UVJ A;  2XA5 A;  1YCJ A;  1SVX B;  4R9F A;  1B32 A;  5L9M A;  4PDH A;  1B7U A;  1A8F A;  3H3G A;  1US4 A;  5ITP A;  2AYS A;  4FED A;  3TQW A;  3WAF A;  4NF8 B;  2HPG A;  4BDL A;  3ONM A;  4KFQ A;  3TEP A;  3KZG A;  2ZZX A;  3FUZ A;  4OZ9 A;  3LSF B;  4G68 C;  5CMB A;  4DI3 D;  5DYH A;  4N4U A;  3W9V A;  1CE2 A;  1MPB A;  2V3T A;  2Y84 A;  4OVJ A;  2UVI A;  3K1N A;  1LCT A;  1XVY A;  3KBR A;  4EF1 A;  3C33 A;  5AA1 A;  1M5B A;  4O7M A;  1B46 A;  5I56 A;  4QFP A;  3TQL A;  4RXL A;  2UVG A;  1MPD A;  5A5X B;  1DOT A;  1ZKB A;  3SEV A;  3IAZ A;  3V89 B;  1SI1 A;  3ILU B;  3FIR A;  1PBP A;  2F7C A;  1MDQ A;  2XXW A;  4KPT A;  3LSW A;  3T9U A;  3MP1 A;  3TEL A;  2O6A A;  1R6Z A;  3L6G A;  3EQ1 A;  4G68 B;  3RT8 A;  1PC3 A;  3M3K A;  1USY E;  3FXU A;  1QUJ A;  4NMY A;  2ZZV A;  2FYI A;  3VVE A;  1FQC A;  3E3K A;  2G29 A;  2XXU A;  3U92 A;  3N6U A;  2DWH A;  1LST A;  3G3F A;  1DMB A;  5H8H B;  4MNP A;  2HZL A;  1NNP A;  1NL5 A;  2I3W A;  5I59 B;  1QKA A;  3IX1 A;  4R9G A;  2QSX A;  2VGQ A;  3IR1 A;  3MJN A;  1LAX A;  2ALU A;  4U2R A;  4OVQ A;  3N26 A;  4IB2 A;  1AMF A;  1YPN A;  5IAI A;  4FAT A;  4F3G A;  5ITO A;  4WEP A;  3MPK A;  4PQJ A;  5DTB A;  1VFE A;  3T9V A;  2AIX A;  1TT1 A;  3EF7 A;  3RUM A;  1N7X A;  5H8F B;  3O9P A;  4AB6 A;  1FQF A;  2XXR A;  3PUY E;  1MXW A;  3L6H A;  3E13 X;  4KYS A;  4MCO A;  1A40 A;  1MY3 A;  5L9S A;  4LP2 B;  1AIV A;  1NNF A;  2IEE A;  2VD3 A;  3MPL A;  1JVY A;  3IK6 B;  2QS3 A;  5DVI A;  4H8I A;  2DQV A;  4MNC A;  2VHA A;  3RLF E;  5TPA B;  5CMK A;  4JBZ A;  2XX9 A;  1PBQ A;  4H6D A;  1N76 A;  3U65 A;  2ZNT A;  3LC8 A;  5I58 B;  1PB9 A;  4Q0C A;  4OWD A;  4ZEC A;  1I6B A;  3H6W A;  4NE4 A;  1P1Q A;  4N6D A;  4P1L A;  2H5Y A;  4IY6 A;  3FVG A;  2PYY A;  3PMW A;  2FA7 A;  1FCK A;  5H8N B;  4NED A;  3FJ7 A;  2NWJ A;  1KWH A;  3IB1 A;  3G3G A;  4LZ8 A;  1ZJL A;  1F9B A;  1DPE A;  1M5C A;  1B7H A;  4POW A;  3PD9 A;  5ICT A;  4DE8 A;  1MQJ A;  1MPC A;  3T66 A;  3O97 A;  2I0B A;  1IXG A;  3FV1 A;  5I5P A;  4GVO A;  3V5A A;  3QUF A;  4OVS A;  4TQU Q;  3TCH A;  2B3B A;  3B6Q A;  2XWV A;  2H9B A;  2O68 A;  1VFD A;  2QPQ A;  3S4U A;  4ELO A;  4GL0 A;  4DZ1 A;  3R6U A;  2B3F A;  1MQG A;  3IJX B;  2ONR A;  3C34 A;  3LBS A;  1LLS A;  5CC2 A;  4BLA A;  3JYR A;  4NF8 A;  2OBG A;  1UTH A;  1OVB A;  2CMO A;  5FHM A;  3H6V A;  3KEI A;  3TAJ A;  1FQE A;  3D4C A;  1WVJ A;  3THI A;  2I48 A;  3PPR A;  5FHO A;  3SES A;  4LZ5 A;  2ZYK A;  3K02 A;  1LFI A;  4GOT A;  2XXK A;  4LAT A;  4IGT A;  2QMX A;  3HV1 A;  3O66 A;  4AQ4 A;  4ZDM A;  4YB5 A;  3HN0 A;  2HCA A;  4MAG A;  1GR2 A;  4PCD A;  2Y7W A;  5A5X A;  4R74 A;  4G2Z A;  4OEU A;  1B3G A;  2QMW A;  3H7M A;  2Q88 A;  4NHB A;  3MBP A;  3M3L A;  5CMC A;  4U4S A;  3PV0 E;  2ZMB A;  3N6T A;  3ECR A;  2XD2 A;  4FE8 A;  1EH3 A;  4FEB A;  1LBB A;  3OEN A;  1O64 A;  4WKM A;  3H6T A;  3CIJ A;  4MFI A;  3U72 A;  2OWS A;  3GXA A;  4Q30 B;  5HPQ A;  4BDQ A;  5KDT B;  3GBA A;  4YMB A;  4PAK A;  4PET A;  4NF5 A;  4OAN A;  3T96 B;  3QUJ A;  4G68 A;  1SQY A;  3DP6 A;  1MY4 A;  5JTY B;  2XWO A;  4R72 A;  1FQA A;  4PAI A;  1WOD A;  2XXI A;  3B6W A;  3USD A;  4XFE A;  2BJJ X;  2P0S A;  2F34 A;  4O3B A;  2V93 A;  4N15 A;  2Q2A A;  3K1P A;  4H5F A;  1B4Z A;  2XXV A;  5I59 A;  4PFY A;  2Z8F A;  4N17 A;  4DXC A;  4N8G A;  1B0L A;  4EQ9 A;  1EU8 A;  2WYP A;  3CVG A;  4ZEK A;  2CZL A;  4OYV A;  4Q5T A;  3FAT A;  4JWO A;  4YU0 A;  1A8E A;  5CI5 A;  1NH8 A;  4XXU A;  1P1N A;  1QKB A;  1NMU A;  1B2H A;  3VV5 A;  3E4R A;  3ZSF A;  2PMS A;  3OOA A;  3Q26 A;  4EQB A;  4XKR A;  3KFM A;  4U22 A;  3T22 A;  3VLV A;  4PGN A;  2I6E A;  5H8F A;  5LTC A;  1O63 A;  2QRY A;  3BFT A;  2DWJ A;  4NF6 B;  1JEV A;  1SDX A;  2Q8J A;  4OMB A;  2RIN A;  4X48 A;  1IIW A;  4IO3 A;  1LB9 A;  2DXR A;  4DLD A;  2W7Y A;  1FTM A;  3TCF A;  3PPO A;  4M1V A;  4GQO A;  1OQG A;  1BIY A;  3VVF A;  5F1Q A;  4IO2 A;  3VE1 B;  1D9Y A;  4EQ7 A;  2F78 A;  3MC2 A;  1B5H A;  2ONS A;  3OSR A;  1OQH A;  4ZZA A;  3ZS6 A;  1A55 A;  4IO5 A;  2XHD A;  3KN8 A;  5M2V A;  2OWT A;  3K1M A;  4GXS B;  5EHM A;  3GLB A;  2F8D A;  2X7P A;  3FXB A; 
#chains in the Genus database with same CATH topology
 4EUO A;  5AA2 D;  3FVK A;  2QVV A;  1MXV A;  1BTJ A;  5I2N A;  1QUI A;  5LOM A;  1NNT A;  1AOV A;  3S9L C;  4F19 A;  5EQA A;  4MF3 A;  3CFL A;  3CI8 A;  5H8N A;  3TTK A;  3EKI A;  3IJO B;  2L5V A;  2XWI A;  5AA4 B;  3P7I A;  3HHG A;  5I57 B;  1JW4 A;  3U94 A;  1QUL A;  4H46 A;  4MHF A;  1IXI A;  5T3J A;  1S50 A;  2CEX A;  1FPJ A;  1QGX A;  4OHN A;  1P99 A;  3CFX A;  3KN7 A;  3SKP A;  4FAJ A;  4P8B A;  2REG A;  4QXD A;  5I2K B;  5J16 A;  1BK4 A;  4L17 A;  4LQ5 A;  4H45 A;  3FBP A;  3R7X A;  1MXY A;  4NWD A;  4GF8 A;  3QK6 A;  3PUZ E;  1B58 A;  3ODB A;  2X7Q A;  2NXO A;  4XKN A;  1M5F A;  4PAF A;  4Z0I A;  1MXX A;  3CG1 A;  2XX7 A;  4I3Y A;  3RYD A;  1AH5 A;  1XOC A;  4RK9 A;  1FBH A;  1PDA A;  1QW0 A;  1XT8 A;  2D21 A;  4LUB A;  2XXP A;  2ZYN A;  1YTV A;  3EN3 A;  1SYH A;  4H67 A;  4MJO A;  4XKQ A;  2GHA A;  3IO4 A;  1D9V A;  3GBB A;  3U8Q A;  1FBF A;  4C1T A;  2FNC A;  3SET A;  3BBR A;  4OTE A;  4QSD A;  2D5W A;  1I6Q A;  1IMC A;  4FEC A;  4GIZ A;  1KA1 A;  4NGU A;  4ELR A;  1B9J A;  1OMP A;  3OEL A;  4R75 A;  1PB7 A;  4QFN A;  4OQO A;  4P0G A;  3MZB A;  3PPP A;  2GFE A;  2Q2C A;  3SEU A;  4NF4 B;  1I6A A;  4QRZ A;  3A3C A;  1B3E A;  3S9E A;  4WXJ A;  1FQD A;  5KDT A;  3TKD A;  4DDD A;  3KG2 A;  1LB8 A;  1LAH E;  3OO6 A;  5F7V A;  5KCJ A;  5IKB A;  4GLI A;  1UTB B;  5DVJ A;  4G4P A;  1OIB A;  1IMA A;  4HCY A;  4EF2 A;  3MP8 A;  1S9T A;  4F3B A;  1Y4C A;  4N6K A;  4P47 A;  2QVU A;  4WED A;  3EPE A;  2YPN A;  2E1S A;  3S2V A;  3B8B A;  1LAF E;  3EHU A;  1IMF A;  4HTG A;  4I62 A;  5ET7 A;  4THI A;  4I3E A;  2VD2 A;  5EYF A;  1MH3 A;  5IZ3 B;  2XD3 A;  4F1Y A;  3OMB A;  2BJI A;  2UVH A;  4PE5 B;  4YAH X;  3RNN A;  3T9H B;  2ZNU A;  1IME A;  1SPI A;  3TCG A;  1Y3N A;  4QFO A;  1LBY A;  1N84 A;  2PT1 A;  2UYF A;  3MZ1 A;  3A09 A;  4BDN A;  4NAP A;  1B6H A;  2NOO A;  1LFH A;  1IUD A;  1J1N A;  4NF6 A;  4NTL A;  3PU5 A;  3UN6 A;  5AA2 B;  2Y7P A;  4YIC A;  2ONK E;  2GRV A;  4OVR A;  3B6T A;  3QMF A;  4ZEI A;  1XC1 A;  2R8T A;  3OD7 A;  3O29 A;  4HE2 A;  1ZLQ A;  3B7D A;  1MG1 A;  3E9X A;  3VDF A;  1FJ6 A;  3BFU A;  5AA3 A;  4U21 A;  2E0S A;  4ZE9 A;  3O6I A;  3IO6 A;  3V8X B;  4I9D A;  2B4L A;  4KQP A;  1WDN A;  3KC0 A;  4TLM B;  1NI9 A;  4M4G A;  2F36 A;  1SW2 A;  3KOS A;  3SER A;  3K6W A;  2ZZW A;  4G8M A;  2ANJ A;  4YZZ A;  3OXN A;  1Y1Z A;  3K0V A;  5DVF A;  4PBQ A;  2V4C A;  3CG3 A;  3C4M A;  4F2O A;  1Z7N E;  5AA4 A;  3NOH A;  3FVO A;  4X9T A;  1B3F A;  3DM0 A;  2P1S A;  3VVD A;  2REJ A;  5I57 A;  1Y20 A;  3OO8 A;  1EZ9 A;  4PDD A;  4QHQ A;  1Q1K A;  3UOR A;  2F3D A;  1B4H A;  1USY H;  3MP6 A;  1MRP A;  4LQ2 A;  3N94 A;  4ISU A;  3OEM A;  2F7A A;  4GBW A;  1ZU0 A;  4LA9 A;  2PBW A;  2OK2 A;  1N04 A;  4PP0 A;  2Y5K A;  2V3U A;  2DWA A;  1NUZ A;  1B52 A;  3M8U A;  3EHS A;  3G3I A;  2Y7R A;  2V84 A;  2RCA A;  4X8R A;  1ANF A;  2DE3 A;  3U93 A;  3KC1 A;  4PBH A;  2R71 A;  5I56 B;  3ZKL A;  4O7I A;  3UGW A;  2CZK A;  2PFY A;  1CB6 A;  2P3V A;  4OEN A;  2H99 A;  2HXW A;  5CRY A;  4ZE8 A;  3RTW B;  4TOZ A;  1XS5 A;  2P2A A;  2DS9 A;  3TZA A;  1NH7 A;  4O94 A;  4X1B A;  4YB6 A;  4U23 A;  1D9Q A;  3DP8 A;  3D1R A;  2RKM A;  3V83 A;  3K6X A;  3TYH A;  1SW5 A;  1TFA A;  2HXR A;  3BIH A;  4GWO A;  4GFR A;  4LZ7 A;  1DSN A;  1FW0 A;  5DEX B;  1ELJ A;  3C32 A;  4Q8R A;  1IZ1 A;  5J1D A;  3Q25 A;  4NF4 A;  1A7L A;  3K4U A;  3RPL B;  2ZNS A;  3PGF A;  5I84 A;  3CSB A;  3G3J A;  3PUX E;  4YMA A;  3CHG A;  4K3F A;  4GX6 A;  4TLL B;  4ELP A;  3K6V A;  3LSX A;  3H4Z A;  2H25 A;  4NWC A;  4RA1 A;  3Q27 A;  5I3S A;  3RPW A;  4JXI A;  5H8H A;  5EHS A;  2IA4 A;  1P1O A;  2OLB A;  1BKA A;  1SW1 A;  3E79 A;  5EQ8 A;  3GZG A;  4GL8 A;  1N7W A;  1DCU A;  3FAS A;  2WBB A;  2VOZ A;  4PFW A;  1N3W A;  2I4C A;  4JVI A;  2QJE A;  1IMD A;  4C0R A;  1T0K A;  1KA0 A;  1GV8 A;  4G8N A;  3W9W A;  5IZ1 A;  3S9M C;  1Y4T A;  3UK4 A;  1NFT A;  3M3F A;  3CRB A;  1RKM A;  1IQ7 A;  4U1Z A;  3HO7 A;  4GWX A;  5IGA A;  4PC9 A;  4GWS A;  5H8S A;  4N13 A;  1II5 A;  4GWY A;  5IZ3 A;  3LUY A;  3Q28 A;  5K2X A;  3ISP A;  2VPO A;  1MDP 1;  3OEK A;  2XWK A;  2PFZ A;  4PGP A;  4YKP A;  4F3P A;  2OZZ A;  2O1L A;  2DE4 A;  3O6H A;  2NVU B;  3KGC A;  4O3C A;  4KCC A;  2I0C A;  3MZ9 A;  2GH9 A;  3UA8 A;  4AS5 A;  1MQD A;  1NKX A;  4DI4 B;  4KI0 E;  3I3V A;  1N0T A;  5AA2 A;  1URG A;  5TPA A;  3RN8 A;  3HCQ A;  2V25 A;  2HEU A;  4PFB A;  4R2F A;  4XTC Q;  5TU0 A;  3IL1 B;  3OO7 A;  4DXB A;  1POY 1;  2A5T B;  3FXQ A;  1I69 A;  2F5X A;  5JK4 A;  4HW8 A;  4EXK A;  3JV9 A;  1UIU A;  4G77 A;  2VPN A;  5I58 A;  1VR5 A;  3RTF B;  5BWJ A;  2B65 A;  4GRK A;  5B70 A;  1A54 A;  2XXT A;  2O69 A;  4F3S A;  3T9X B;  1FPK A;  5EYG A;  3K01 A;  5ESY A;  4GXA A;  3IOR A;  1UIV A;  1Y1M A;  4N07 A;  3DP4 A;  2MKZ A;  3HPI A;  4MLQ A;  2KQZ A;  5B7D A;  2A5S A;  4RY1 A;  5CM6 A;  4IO4 A;  4H8J A;  2WX9 A;  3QYT A;  2F6P A;  3LSL A;  4R2B A;  2RC9 A;  4OEV A;  2PT2 A;  3BKI B;  3ILT B;  5ET8 A;  1H3D A;  4MLV A;  1ATG A;  4DXU A;  1B0H A;  1IMB A;  4I8C A;  4QF9 A;  4X1D A;  2R6G E;  1MQH A;  1URD A;  4ELQ A;  5FHN A;  3AXF A;  4RPO A;  3VXC A;  3TDJ A;  2DOJ A;  1FPB A;  1LBX A;  4DCX A;  4AS4 A;  1JEU A;  3DLN A;  4RK2 A;  1B40 A;  1YYZ A;  1HSL A;  2AL4 A;  2CEY A;  3MUQ A;  1P1W A;  3S9N C;  1PEB A;  1UTH B;  4PFR A;  4PF8 A;  1SD3 A;  1KZ8 A;  3G3K A;  1DPP A;  2I3V A;  4OVP A;  4GWZ A;  1B51 A;  1B7Z A;  4E0X A;  4PE3 A;  5ICQ A;  2Z22 A;  5BUU A;  2XXX A;  4FIM A;  4GBV A;  4OER A;  4LN5 A;  4F31 B;  1YXI A;  3H6U A;  4KCD A;  1Y9U A;  4PFI A;  4UAC A;  5CMM A;  1URS A;  4UAB A;  3KOT A;  2HAV A;  1Y3Q A;  2KLF A;  1RYO A;  4RNS A;  4N6P A;  1MM7 A;  4H65 A;  5CBR A;  3FVN A;  2H98 A;  2FHY A;  1GVC A;  3PPQ A;  1DTZ A;  2OJT A;  3OSQ A;  3UIF A;  4KHZ E;  2QL3 A;  4OFJ A;  5ISU A;  1ZBM A;  4YKK A;  3F11 A;  3D4G A;  4GX4 A;  3PMX A;  4ESW A;  4LVQ A;  1MM6 A;  4OFL A;  1Y3P A;  2DWI A;  1QJM A;  3I6V A;  4PFU A;  2ESN A;  1H43 A;  1FPE A;  2R9J A;  2G93 A;  4LON B;  4NQ8 A;  2I4B A;  2ZYO A;  3IFA A;  5DEX A;  4RPN A;  4NF5 B;  1OLA A;  2DVC A;  4N81 A;  3PPN A;  4F18 A;  3VFJ A;  1ZTY A;  3RT6 B;  4Z7E A;  1XI6 A;  2Q89 A;  3RPL A;  5JTY A;  1QUK A;  3Q29 A;  4OFO A;  1FTL A;  5FTI A;  2QS1 A;  3SEW A;  3SEX A;  4GWU A;  2Z23 A;  3PD8 A;  4MNI A;  2ZXT A;  1SI0 A;  3IB0 A;  3PTY A;  4YKI A;  4POX A;  3N5L A;  2F35 A;  1YAE A;  5I7I A;  4XF5 A;  2UXA A;  3TTM A;  4R73 A;  1OLC A;  3G3H A;  2PX1 A;  4MMP A;  1MXU A;  4MH5 A;  1B5J A;  2DVZ A;  4ZEB A;  4NN3 A;  1MY0 A;  3KJ7 A;  1NV5 A;  4N91 A;  3FGS A;  2H4I A;  1DBZ A;  1MS7 A;  1O7T A;  3VXB A;  2I58 A;  3QXM A;  1LCF A;  3FJG A;  5F24 A;  1GTK A;  1MXZ A;  1JW5 A;  1ZMG A;  2Z8D A;  4ECF A;  5HBC A;  2WKY A;  1R9Q A;  2PCR A;  3C36 A;  3TPA A;  1EYK A;  2Y7K A;  1N3X A;  2QS2 A;  2PVU A;  1TXF A;  3IOW A;  2RCB A;  1B3L A;  4P9K A;  4ONY A;  2O7U A;  5EQ9 A;  4IO6 A;  1FQB A;  1JET A;  1LBZ A;  1M5D A;  4R6H A;  4F22 A;  2WYK A;  1P1U A;  2O51 A;  3MVW A;  4XIG Q;  1GGG A;  2A5T A;  1JVX A;  3A3U A;  3O2A A;  2X26 A;  4OA4 A;  1FTO A;  2QFL A;  1VSO A;  3KJT A;  5ELV A;  5H8Q B;  2Q9T A;  3MVY A;  2DXY A;  1XVX A;  4GD5 A;  2OWZ A;  4C1U A;  3B50 A;  5DT6 A;  1LFG A;  1FTK A;  5I2N B;  2THI A;  2VP1 A;  1AL3 A;  4JSO A;  5AE4 A;  4JSD A;  3LR1 A;  3KN3 A;  1FJ9 A;  4P3L A;  2DYX A;  5JEI A;  3R26 A;  3O28 A;  5TP9 B;  1EZO A;  4BDR A;  3CR9 A;  1US5 A;  4DIG A;  2YLN A;  1ZIU A;  4YKJ A;  3FJM A;  2Y7I A;  3RY3 A;  3FD3 A;  3WAE A;  3MW0 A;  3MAM A;  3MVX A;  2XX8 A;  3TTR A;  1B5I A;  2F6G A;  3TFL A;  4H5G A;  5I2K A;  1Q9D A;  2RC7 A;  3TMG A;  1JQF A;  1EZP A;  2NUV A;  4RJZ A;  4ZS9 A;  2DSF A;  4P11 A;  1XHY A;  4I40 A;  1IIT A;  4HCW A;  2D3I A;  3C31 A;  4ZED A;  1FBE A;  1NUW A;  4P56 A;  1PB8 A;  1A99 A;  1R1N A;  3I5O A;  1TWY A;  1FTJ A;  2ZYM A;  3K2D A;  4KD5 A;  1NUY A;  1MY1 A;  1SBP A;  4OET A;  1HSE A;  3C35 A;  2QS4 A;  4JWY A;  1JNF A;  2M8C A;  4HE0 A;  4MEV A;  1LGB C;  4HS7 A;  3IFC A;  4U4X A;  1H45 A;  1SYI A;  3SDF A;  2HAU A;  4BDM A;  4QFK A;  4F1V A;  4F39 A;  1OVT A;  4PFT A;  1D4N A;  3K6U A;  2XXQ A;  3IOU A;  1D3K A;  2XXY A;  4MX6 A;  4XKP A;  5L9O A;  4JWX A;  4IGR A;  3C9H A;  2HFB A;  5KZT A;  1TFD A;  3O6G A;  4OES A;  2RF1 A;  4F2Q A;  4EDP A;  3H03 A;  2FBP A;  1Q35 A;  3JZJ A;  3MVZ A;  4JB7 A;  4NX1 A;  1HSJ A;  1MH4 A;  5IZZ A;  1M5E A;  3MQ9 A;  3TTN A;  2FIX A;  2CZH A;  1CNQ A;  5EYH A;  4ZEF A;  1SW4 A;  3PMV A;  1DTG A;  2O1M A;  4KR5 A;  2UYE A;  3HST A;  3KSJ A;  5KCJ B;  4QSE A;  3PUW E;  1B05 A;  3EHT A;  1UTB A;  4ND9 A;  1B3H A;  3VLW A;  3KSX A;  1NNK A;  2LAO A;  4O3A A;  3CFZ A;  2OCU A;  2WEF A;  2YJP A;  4PF6 A;  3FXR A;  5CBS A;  2B4M A;  4KYD A;  4N8Y A;  2DP8 A;  4NG7 A;  4AB5 A;  1FBC A;  3FV2 A;  5FTH A;  1MQI A;  3CSG A;  5L8D A;  4QFL A;  3QAX A;  3MWB A;  2XXH A;  1UQW A;  2Z8E A;  3PUV E;  5DW8 A;  4XEQ A;  3HFU A;  3TUS A;  4U1O A;  2O7I A;  3GYY A;  1IXH A;  3G7W A;  1H44 A;  3TOD A;  1VE4 A;  1BP5 A;  4IO7 A;  4I1D A;  5K2Y A;  2RC8 A;  3FZV A;  5HM4 B;  4R6K A;  3IOT A;  4H1X A;  2GHB A;  4FOR A;  4G8H A;  3RGY A;  2DE2 A;  3TTL A;  2VT5 A;  4ZZE A;  2V3Q A;  1RYX A;  4F1U A;  1IEJ A;  4P0I A;  1Z7M E;  2FVZ A;  3OO9 A;  4OXV A;  4X04 A;  2FIE A;  4O8M A;  4JDF A;  2F7B A;  4ESX A;  2ABH A;  3A29 A;  4DCY A;  3QIM A;  4FJP A;  4NF0 A;  4UA8 A;  4YB7 A;  1QVS A;  1L5T A;  4MIJ A;  1FBG A;  3VLU A;  1H76 A;  3SEY A;  2AL5 A;  4KXP A;  3W15 C;  3K00 A;  4EXL A;  1B1H A;  1B1X A;  2I49 A;  1NV4 A;  4MBP A;  1BLF A;  2HZK A;  1LEV A;  4H0W A;  1NV0 A;  4P1E A;  3U1O A;  2O84 X;  3H06 B;  4F29 A;  1R9L A;  4BDO A;  1IXC A;  3IB2 A;  5H8Q A;  1JW1 A;  3DEL B;  1S7Y A;  3IOV A;  1FPG A;  3T93 B;  3QSL A;  4R6Y A;  5IM2 A;  4KYE A;  1VDW A;  1MY2 A;  1POT A;  5ET5 A;  3UP9 A;  4QSC A;  2JJK A;  4IY5 A;  1FPL A;  2HQ0 A;  5TP9 A;  4E0W A;  4RYA A;  3HHF A;  1LAG E;  1G0H A;  2F97 A;  3ZKK A;  4JVD A;  4OVT A;  1LBC A;  3RQT A;  2UVJ A;  2XA5 A;  1RDX A;  1YCJ A;  1SVX B;  2OX3 A;  4R9F A;  1B32 A;  2HHM A;  5L9M A;  4PDH A;  1B7U A;  1A8F A;  3H3G A;  1US4 A;  5ITP A;  1INP A;  2AYS A;  4FED A;  3TQW A;  1JP4 A;  3WAF A;  1G0I A;  4NF8 B;  2HPG A;  3LV0 A;  4BDL A;  3ONM A;  4KFQ A;  3TEP A;  3KZG A;  2ZZX A;  3FUZ A;  4OZ9 A;  3LSF B;  4G68 C;  5CMB A;  4HE1 A;  4DI3 D;  5DYH A;  4N4U A;  3MYU A;  2P3N A;  3W9V A;  1CE2 A;  4FBP A;  1MPB A;  2V3T A;  2Y84 A;  4OVJ A;  2UVI A;  3K1N A;  1LCT A;  1XVY A;  1RDZ A;  3KBR A;  4EF1 A;  3C33 A;  5AA1 A;  1M5B A;  4O7M A;  1EYI A;  1B46 A;  2CZI A;  5I56 A;  4QFP A;  3TQL A;  4RXL A;  1NV6 A;  2UVG A;  1MPD A;  5A5X B;  1DOT A;  1ZKB A;  3SEV A;  3IAZ A;  3V89 B;  3KBZ A;  1SI1 A;  3ILU B;  3FIR A;  1PBP A;  2F7C A;  1MDQ A;  2XXW A;  2F3B A;  4KPT A;  3LSW A;  1K9Y A;  3T9U A;  4G61 A;  3MP1 A;  3TEL A;  2O6A A;  1R6Z A;  3L6G A;  1FPF A;  3EQ1 A;  4G68 B;  3RT8 A;  1PC3 A;  3M3K A;  1USY E;  3FXU A;  1QUJ A;  4NMY A;  2ZZV A;  2FYI A;  3VVE A;  1FQC A;  3E3K A;  2G29 A;  2XXU A;  3U92 A;  3N6U A;  2DWH A;  1LST A;  3G3F A;  1DMB A;  4MNP A;  5H8H B;  1YZ0 A;  2HZL A;  1NNP A;  1NL5 A;  2I3W A;  5I59 B;  1QKA A;  3IX1 A;  4R9G A;  2QSX A;  2VGQ A;  3IR1 A;  3MJN A;  3T1B A;  1LAX A;  2ALU A;  4U2R A;  4OVQ A;  3N26 A;  4IB2 A;  1AMF A;  1YPN A;  5IAI A;  1NV1 A;  4FAT A;  4F3G A;  5ITO A;  4WEP A;  3MPK A;  4PQJ A;  5DTB A;  1VFE A;  3T9V A;  2AIX A;  1TT1 A;  3EF7 A;  3RUM A;  1N7X A;  5H8F B;  3O9P A;  4AB6 A;  1FQF A;  2XXR A;  3PUY E;  4GX3 A;  1MXW A;  3L6H A;  3E13 X;  4KYS A;  4MCO A;  1FPD A;  1A40 A;  1MY3 A;  5L9S A;  4LP2 B;  1AIV A;  1NNF A;  2IEE A;  2VD3 A;  3MPL A;  1JVY A;  1EYJ A;  3IK6 B;  2QS3 A;  5DVI A;  4H8I A;  2DQV A;  4MNC A;  2VHA A;  3RLF E;  5TPA B;  5CMK A;  4JBZ A;  2XX9 A;  1PBQ A;  4H6D A;  2Q74 A;  1N76 A;  3U65 A;  1LBV A;  2ZNT A;  3LC8 A;  5I58 B;  1NV7 A;  4HXV A;  1PB9 A;  4Q0C A;  4OWD A;  4ZEC A;  1I6B A;  3H6W A;  3LUZ A;  4NE4 A;  1P1Q A;  4N6D A;  5LDZ A;  4P1L A;  2H5Y A;  4IY6 A;  2GQ1 A;  3FVG A;  3ROJ A;  2PYY A;  3PMW A;  2FA7 A;  1FCK A;  5H8N B;  4NED A;  3FJ7 A;  2NWJ A;  1KWH A;  3IB1 A;  3G3G A;  4LZ8 A;  1ZJL A;  1DPE A;  1F9B A;  1M5C A;  1B7H A;  4POW A;  3PD9 A;  5ICT A;  2KR0 A;  4DE8 A;  3BIG A;  1MQJ A;  1MPC A;  3T66 A;  3O97 A;  2I0B A;  1IXG A;  3FV1 A;  5I5P A;  4GVO A;  2DDK A;  3V5A A;  3QUF A;  4OVS A;  1FPI A;  4TQU Q;  3TCH A;  2B3B A;  3B6Q A;  1RDY A;  2XWV A;  2H9B A;  2O68 A;  1VFD A;  2QPQ A;  3S4U A;  4ELO A;  4GL0 A;  4DZ1 A;  3R6U A;  2B3F A;  1MQG A;  2QVR A;  3IJX B;  2ONR A;  1FBP A;  3C34 A;  3LBS A;  1LLS A;  5EQ7 A;  5CC2 A;  4BLA A;  3JYR A;  4NF8 A;  2OBG A;  1UTH A;  1OVB A;  2CMO A;  5FHM A;  3H6V A;  3KEI A;  3TAJ A;  1FQE A;  3D4C A;  1WVJ A;  3THI A;  2I48 A;  4QBA A;  3PPR A;  5FHO A;  3SES A;  4LZ5 A;  2ZYK A;  3K02 A;  1LFI A;  4GOT A;  2XXK A;  4LAT A;  4IGT A;  2QMX A;  3HV1 A;  3O66 A;  4AQ4 A;  4ZDM A;  1DK4 A;  4YB5 A;  1LBW A;  3HN0 A;  2HCA A;  4MAG A;  1GR2 A;  4PCD A;  5ET6 A;  2Y7W A;  5A5X A;  4R74 A;  4G2Z A;  4OEU A;  1B3G A;  2QMW A;  3H7M A;  2Q88 A;  4NHB A;  3MBP A;  3M3L A;  5CMC A;  4U4S A;  3PV0 E;  2ZMB A;  3N6T A;  3ECR A;  2XD2 A;  4FE8 A;  1EH3 A;  4FEB A;  4PTK A;  1LBB A;  3OEN A;  1O64 A;  4WKM A;  1FBD A;  4IR8 A;  3H6T A;  3CIJ A;  5FBP A;  4MFI A;  3U72 A;  2OWS A;  3GXA A;  4Q30 B;  5HPQ A;  4BDQ A;  5KDT B;  3GBA A;  4YMB A;  4PAK A;  4PET A;  4NF5 A;  4OAN A;  3T96 B;  4GWW A;  3QUJ A;  4G68 A;  1SQY A;  3DP6 A;  1MY4 A;  2Q8M A;  5JTY B;  2XWO A;  4R72 A;  1FQA A;  4PAI A;  1WOD A;  2XXI A;  3B6W A;  4XFE A;  3USD A;  2BJJ X;  2P0S A;  2F34 A;  4O3B A;  2V93 A;  4N15 A;  2Q2A A;  3K1P A;  4H5F A;  1FTA A;  1NV3 A;  1B4Z A;  2XXV A;  5I59 A;  4PFY A;  2Z8F A;  4N17 A;  4DXC A;  4N8G A;  1B0L A;  4EQ9 A;  1EU8 A;  2WYP A;  3CVG A;  4ZEK A;  2CZL A;  4OYV A;  4Q5T A;  3FAT A;  4JWO A;  4YU0 A;  3E78 A;  1A8E A;  1NUX A;  5CI5 A;  1NH8 A;  5A5L A;  4XXU A;  1P1N A;  1QKB A;  1K9Z A;  1NMU A;  1B2H A;  3VV5 A;  3E4R A;  3ZSF A;  2PMS A;  3OOA A;  3Q26 A;  4EQB A;  4XKR A;  3KFM A;  4U22 A;  4PGN A;  3T22 A;  3VLV A;  2I6E A;  5H8F A;  5LTC A;  1O63 A;  2QRY A;  3BFT A;  2DWJ A;  4NF6 B;  1JEV A;  1SDX A;  2Q8J A;  4OMB A;  2Y5L A;  2RIN A;  4X48 A;  3T0J A;  1IIW A;  4IO3 A;  1AWB A;  1FRP A;  1LB9 A;  2DXR A;  4DLD A;  2W7Y A;  1FTM A;  3TCF A;  3PPO A;  4M1V A;  4GQO A;  1OQG A;  1BIY A;  3VVF A;  5F1Q A;  4IO2 A;  3VE1 B;  1D9Y A;  4EQ7 A;  2F78 A;  3MC2 A;  1B5H A;  2ONS A;  4JVC A;  3OSR A;  1OQH A;  1FSA A;  2WBD A;  4ZZA A;  3ZS6 A;  1A55 A;  1NV2 A;  3SZP A;  4IO5 A;  2XHD A;  3KN8 A;  5M2V A;  2OWT A;  3K1M A;  4GXS B;  5EHM A;  3GLB A;  2F8D A;  2X7P A;  3MST A;  3FXB A; 
#chains in the Genus database with same CATH homology
 4EUO A;  5AA2 D;  3FVK A;  2QVV A;  1MXV A;  1BTJ A;  5I2N A;  1QUI A;  5LOM A;  1NNT A;  1AOV A;  3S9L C;  4F19 A;  5EQA A;  4MF3 A;  3CFL A;  3CI8 A;  5H8N A;  3TTK A;  3EKI A;  3IJO B;  2L5V A;  2XWI A;  5AA4 B;  3P7I A;  3HHG A;  5I57 B;  1JW4 A;  3U94 A;  1QUL A;  4H46 A;  4MHF A;  1IXI A;  5T3J A;  1S50 A;  2CEX A;  1FPJ A;  1QGX A;  4OHN A;  1P99 A;  3CFX A;  3KN7 A;  3SKP A;  4FAJ A;  4P8B A;  2REG A;  4QXD A;  5I2K B;  5J16 A;  4LQ5 A;  4L17 A;  1BK4 A;  4H45 A;  3FBP A;  3R7X A;  1MXY A;  4NWD A;  4GF8 A;  3QK6 A;  3PUZ E;  1B58 A;  3ODB A;  2X7Q A;  2NXO A;  4XKN A;  1M5F A;  4PAF A;  4Z0I A;  1MXX A;  3CG1 A;  2XX7 A;  4I3Y A;  3RYD A;  1AH5 A;  1XOC A;  4RK9 A;  1FBH A;  1PDA A;  1QW0 A;  1XT8 A;  2D21 A;  4LUB A;  2XXP A;  2ZYN A;  1YTV A;  3EN3 A;  1SYH A;  4H67 A;  4MJO A;  4XKQ A;  2GHA A;  3IO4 A;  1D9V A;  3GBB A;  3U8Q A;  1FBF A;  4C1T A;  2FNC A;  3SET A;  3BBR A;  4OTE A;  4QSD A;  2D5W A;  1I6Q A;  1IMC A;  4FEC A;  4GIZ A;  4ELR A;  1KA1 A;  4NGU A;  1B9J A;  1OMP A;  3OEL A;  4R75 A;  1PB7 A;  4QFN A;  4OQO A;  4P0G A;  3MZB A;  3PPP A;  2GFE A;  2Q2C A;  3SEU A;  4NF4 B;  1I6A A;  4QRZ A;  3A3C A;  1B3E A;  3S9E A;  4WXJ A;  1FQD A;  5KDT A;  3TKD A;  4DDD A;  3KG2 A;  1LB8 A;  1LAH E;  3OO6 A;  5F7V A;  5KCJ A;  5IKB A;  4GLI A;  1UTB B;  5DVJ A;  4G4P A;  1OIB A;  1IMA A;  4HCY A;  4EF2 A;  3MP8 A;  1S9T A;  4F3B A;  1Y4C A;  4N6K A;  4P47 A;  2QVU A;  4WED A;  3EPE A;  2YPN A;  2E1S A;  3S2V A;  3B8B A;  1LAF E;  3EHU A;  1IMF A;  4HTG A;  4I62 A;  5ET7 A;  4THI A;  4I3E A;  2VD2 A;  5EYF A;  1MH3 A;  5IZ3 B;  2XD3 A;  4F1Y A;  3OMB A;  2BJI A;  2UVH A;  4PE5 B;  4YAH X;  3RNN A;  3T9H B;  2ZNU A;  1IME A;  1SPI A;  3TCG A;  1Y3N A;  4QFO A;  1LBY A;  1N84 A;  2PT1 A;  2UYF A;  3MZ1 A;  3A09 A;  4BDN A;  4NAP A;  1B6H A;  2NOO A;  1LFH A;  1IUD A;  1J1N A;  4NF6 A;  4NTL A;  3PU5 A;  3UN6 A;  5AA2 B;  2Y7P A;  4YIC A;  2ONK E;  2GRV A;  4OVR A;  3B6T A;  3QMF A;  4ZEI A;  1XC1 A;  2R8T A;  3OD7 A;  3O29 A;  4HE2 A;  1ZLQ A;  3B7D A;  1MG1 A;  3E9X A;  3VDF A;  3BFU A;  1FJ6 A;  5AA3 A;  4U21 A;  2E0S A;  4ZE9 A;  3O6I A;  3IO6 A;  3V8X B;  4I9D A;  2B4L A;  4KQP A;  1WDN A;  3KC0 A;  4TLM B;  1NI9 A;  4M4G A;  2F36 A;  1SW2 A;  3KOS A;  3SER A;  3K6W A;  2ZZW A;  4G8M A;  2ANJ A;  4YZZ A;  3OXN A;  1Y1Z A;  3K0V A;  5DVF A;  4PBQ A;  2V4C A;  3CG3 A;  3C4M A;  4F2O A;  1Z7N E;  5AA4 A;  3NOH A;  3FVO A;  4X9T A;  1B3F A;  3DM0 A;  2P1S A;  3VVD A;  2REJ A;  5I57 A;  1Y20 A;  3OO8 A;  1EZ9 A;  4PDD A;  4QHQ A;  1Q1K A;  3UOR A;  2F3D A;  1B4H A;  1USY H;  3MP6 A;  1MRP A;  4LQ2 A;  3N94 A;  4ISU A;  3OEM A;  2F7A A;  4GBW A;  1ZU0 A;  4LA9 A;  2PBW A;  2OK2 A;  1N04 A;  4PP0 A;  2Y5K A;  2V3U A;  2DWA A;  1NUZ A;  1B52 A;  3M8U A;  3EHS A;  3G3I A;  2Y7R A;  2V84 A;  2RCA A;  4X8R A;  1ANF A;  2DE3 A;  3U93 A;  3KC1 A;  4PBH A;  2R71 A;  5I56 B;  3ZKL A;  4O7I A;  3UGW A;  2CZK A;  2PFY A;  1CB6 A;  2P3V A;  4OEN A;  2H99 A;  2HXW A;  5CRY A;  4ZE8 A;  3RTW B;  4TOZ A;  1XS5 A;  2P2A A;  2DS9 A;  3TZA A;  1NH7 A;  4O94 A;  4X1B A;  4YB6 A;  4U23 A;  1D9Q A;  3DP8 A;  3D1R A;  2RKM A;  3V83 A;  3K6X A;  3TYH A;  1SW5 A;  1TFA A;  2HXR A;  3BIH A;  4GWO A;  4GFR A;  4LZ7 A;  1DSN A;  1FW0 A;  5DEX B;  1ELJ A;  3C32 A;  4Q8R A;  1IZ1 A;  5J1D A;  3Q25 A;  4NF4 A;  1A7L A;  3K4U A;  3RPL B;  2ZNS A;  3PGF A;  5I84 A;  3CSB A;  3G3J A;  3PUX E;  4YMA A;  4K3F A;  3CHG A;  4GX6 A;  4TLL B;  4ELP A;  3K6V A;  3LSX A;  3H4Z A;  2H25 A;  4NWC A;  4RA1 A;  3Q27 A;  3RPW A;  5I3S A;  4JXI A;  5H8H A;  5EHS A;  2IA4 A;  1P1O A;  2OLB A;  1BKA A;  1SW1 A;  3E79 A;  5EQ8 A;  3GZG A;  4GL8 A;  1N7W A;  1DCU A;  3FAS A;  2WBB A;  2VOZ A;  4PFW A;  1N3W A;  2I4C A;  4JVI A;  2QJE A;  1IMD A;  4C0R A;  1T0K A;  1GV8 A;  1KA0 A;  4G8N A;  3W9W A;  5IZ1 A;  3S9M C;  1Y4T A;  3UK4 A;  1NFT A;  3M3F A;  3CRB A;  1RKM A;  1IQ7 A;  4U1Z A;  3HO7 A;  4GWX A;  5IGA A;  4PC9 A;  4GWS A;  5H8S A;  4N13 A;  1II5 A;  4GWY A;  5IZ3 A;  3LUY A;  3Q28 A;  5K2X A;  3ISP A;  2VPO A;  1MDP 1;  3OEK A;  2XWK A;  2PFZ A;  4PGP A;  4YKP A;  4F3P A;  2OZZ A;  2O1L A;  2DE4 A;  3O6H A;  2NVU B;  3KGC A;  4O3C A;  4KCC A;  2I0C A;  3MZ9 A;  2GH9 A;  3UA8 A;  4AS5 A;  1MQD A;  1NKX A;  4DI4 B;  4KI0 E;  3I3V A;  1N0T A;  5AA2 A;  1URG A;  5TPA A;  3RN8 A;  3HCQ A;  2V25 A;  2HEU A;  4R2F A;  5TU0 A;  4XTC Q;  4PFB A;  3IL1 B;  3OO7 A;  4DXB A;  1POY 1;  2A5T B;  3FXQ A;  1I69 A;  2F5X A;  5JK4 A;  4HW8 A;  4EXK A;  3JV9 A;  1UIU A;  4G77 A;  2VPN A;  5I58 A;  1VR5 A;  3RTF B;  5BWJ A;  2B65 A;  4GRK A;  5B70 A;  1A54 A;  2XXT A;  2O69 A;  4F3S A;  3T9X B;  1FPK A;  5EYG A;  3K01 A;  5ESY A;  4GXA A;  3IOR A;  1UIV A;  1Y1M A;  4N07 A;  3DP4 A;  2MKZ A;  3HPI A;  4MLQ A;  2KQZ A;  5B7D A;  2A5S A;  4RY1 A;  5CM6 A;  4IO4 A;  4H8J A;  2WX9 A;  3QYT A;  2F6P A;  3LSL A;  4R2B A;  2RC9 A;  4OEV A;  2PT2 A;  3BKI B;  3ILT B;  5ET8 A;  1H3D A;  4MLV A;  1ATG A;  4DXU A;  1B0H A;  4I8C A;  1IMB A;  4QF9 A;  4X1D A;  2R6G E;  1MQH A;  1URD A;  4ELQ A;  5FHN A;  3AXF A;  4RPO A;  3VXC A;  3TDJ A;  2DOJ A;  1FPB A;  4DCX A;  1LBX A;  4AS4 A;  1JEU A;  3DLN A;  4RK2 A;  1B40 A;  1YYZ A;  1HSL A;  2AL4 A;  2CEY A;  3MUQ A;  1P1W A;  3S9N C;  1PEB A;  1UTH B;  4PFR A;  4PF8 A;  1SD3 A;  3G3K A;  1KZ8 A;  1DPP A;  2I3V A;  4OVP A;  4GWZ A;  1B51 A;  1B7Z A;  4E0X A;  4PE3 A;  5ICQ A;  2Z22 A;  5BUU A;  2XXX A;  4FIM A;  4OER A;  4GBV A;  4LN5 A;  4F31 B;  1YXI A;  3H6U A;  4KCD A;  1Y9U A;  4PFI A;  4UAC A;  5CMM A;  1URS A;  4UAB A;  3KOT A;  2HAV A;  1Y3Q A;  2KLF A;  1RYO A;  4RNS A;  4N6P A;  1MM7 A;  4H65 A;  5CBR A;  3FVN A;  1GVC A;  2H98 A;  2FHY A;  3PPQ A;  1DTZ A;  2OJT A;  3OSQ A;  3UIF A;  4KHZ E;  2QL3 A;  4OFJ A;  5ISU A;  1ZBM A;  4YKK A;  3F11 A;  3D4G A;  4GX4 A;  3PMX A;  4ESW A;  4LVQ A;  1MM6 A;  4OFL A;  1Y3P A;  2DWI A;  1QJM A;  3I6V A;  4PFU A;  2ESN A;  1H43 A;  1FPE A;  2R9J A;  2G93 A;  4LON B;  4NQ8 A;  2I4B A;  2ZYO A;  3IFA A;  5DEX A;  4RPN A;  4NF5 B;  1OLA A;  2DVC A;  4N81 A;  3PPN A;  4F18 A;  3VFJ A;  1ZTY A;  3RT6 B;  4Z7E A;  1XI6 A;  2Q89 A;  5JTY A;  3RPL A;  1QUK A;  3Q29 A;  4OFO A;  1FTL A;  5FTI A;  2QS1 A;  3SEW A;  3SEX A;  4GWU A;  2Z23 A;  3PD8 A;  4MNI A;  2ZXT A;  1SI0 A;  3IB0 A;  4YKI A;  3PTY A;  4POX A;  3N5L A;  2F35 A;  1YAE A;  5I7I A;  4XF5 A;  2UXA A;  3TTM A;  4R73 A;  1OLC A;  3G3H A;  2PX1 A;  4MMP A;  1MXU A;  4MH5 A;  1B5J A;  2DVZ A;  4ZEB A;  4NN3 A;  1MY0 A;  3KJ7 A;  1NV5 A;  4N91 A;  3FGS A;  2H4I A;  1DBZ A;  1MS7 A;  1O7T A;  3VXB A;  2I58 A;  3QXM A;  1LCF A;  3FJG A;  5F24 A;  1GTK A;  1MXZ A;  1JW5 A;  1ZMG A;  2Z8D A;  4ECF A;  5HBC A;  2WKY A;  1R9Q A;  2PCR A;  3C36 A;  3TPA A;  1EYK A;  2Y7K A;  1N3X A;  2QS2 A;  2PVU A;  1TXF A;  3IOW A;  2RCB A;  1B3L A;  4P9K A;  4ONY A;  2O7U A;  5EQ9 A;  4IO6 A;  1FQB A;  1JET A;  1LBZ A;  1M5D A;  4R6H A;  4F22 A;  2WYK A;  1P1U A;  2O51 A;  3MVW A;  4XIG Q;  1GGG A;  2A5T A;  1JVX A;  3A3U A;  3O2A A;  2X26 A;  4OA4 A;  1FTO A;  2QFL A;  1VSO A;  3KJT A;  5ELV A;  5H8Q B;  2Q9T A;  3MVY A;  2DXY A;  1XVX A;  4GD5 A;  4C1U A;  2OWZ A;  3B50 A;  5DT6 A;  1LFG A;  1FTK A;  5I2N B;  2THI A;  2VP1 A;  1AL3 A;  4JSO A;  5AE4 A;  4JSD A;  3LR1 A;  3KN3 A;  1FJ9 A;  4P3L A;  2DYX A;  5JEI A;  3R26 A;  3O28 A;  5TP9 B;  1EZO A;  4BDR A;  3CR9 A;  1US5 A;  4DIG A;  2YLN A;  1ZIU A;  4YKJ A;  3FJM A;  2Y7I A;  3RY3 A;  3FD3 A;  3WAE A;  3MW0 A;  3MAM A;  3MVX A;  2XX8 A;  3TTR A;  1B5I A;  2F6G A;  3TFL A;  4H5G A;  5I2K A;  1Q9D A;  2RC7 A;  3TMG A;  1JQF A;  1EZP A;  2NUV A;  4RJZ A;  4ZS9 A;  2DSF A;  4P11 A;  1XHY A;  4I40 A;  1IIT A;  4HCW A;  2D3I A;  3C31 A;  4ZED A;  1FBE A;  1NUW A;  4P56 A;  1PB8 A;  1A99 A;  1R1N A;  3I5O A;  1TWY A;  1FTJ A;  2ZYM A;  3K2D A;  4KD5 A;  1NUY A;  1MY1 A;  1SBP A;  4OET A;  1HSE A;  3C35 A;  2QS4 A;  4JWY A;  1JNF A;  2M8C A;  4HE0 A;  4MEV A;  1LGB C;  4HS7 A;  3IFC A;  4U4X A;  1H45 A;  1SYI A;  3SDF A;  2HAU A;  4BDM A;  4QFK A;  4F1V A;  4F39 A;  1OVT A;  4PFT A;  1D4N A;  3K6U A;  2XXQ A;  3IOU A;  1D3K A;  2XXY A;  4MX6 A;  4XKP A;  5L9O A;  4JWX A;  4IGR A;  3C9H A;  2HFB A;  5KZT A;  1TFD A;  3O6G A;  4OES A;  2RF1 A;  4F2Q A;  4EDP A;  3H03 A;  2FBP A;  1Q35 A;  3JZJ A;  3MVZ A;  4JB7 A;  4NX1 A;  1HSJ A;  1MH4 A;  5IZZ A;  1M5E A;  3MQ9 A;  3TTN A;  2FIX A;  2CZH A;  1CNQ A;  5EYH A;  4ZEF A;  1SW4 A;  3PMV A;  1DTG A;  2O1M A;  4KR5 A;  2UYE A;  3HST A;  3KSJ A;  5KCJ B;  4QSE A;  3PUW E;  1B05 A;  3EHT A;  1UTB A;  4ND9 A;  1B3H A;  3VLW A;  3KSX A;  1NNK A;  2LAO A;  4O3A A;  3CFZ A;  2OCU A;  2WEF A;  2YJP A;  4PF6 A;  3FXR A;  5CBS A;  2B4M A;  4KYD A;  4N8Y A;  2DP8 A;  4NG7 A;  4AB5 A;  1FBC A;  3FV2 A;  5FTH A;  1MQI A;  3CSG A;  5L8D A;  4QFL A;  3QAX A;  3MWB A;  2XXH A;  1UQW A;  2Z8E A;  3PUV E;  5DW8 A;  4XEQ A;  3HFU A;  3TUS A;  4U1O A;  2O7I A;  3GYY A;  1IXH A;  3G7W A;  1H44 A;  3TOD A;  1VE4 A;  1BP5 A;  4IO7 A;  4I1D A;  5K2Y A;  2RC8 A;  3FZV A;  5HM4 B;  4R6K A;  3IOT A;  4H1X A;  2GHB A;  4FOR A;  4G8H A;  3RGY A;  2DE2 A;  3TTL A;  4ZZE A;  2VT5 A;  2V3Q A;  1RYX A;  4F1U A;  1IEJ A;  4P0I A;  1Z7M E;  2FVZ A;  3OO9 A;  4OXV A;  4X04 A;  2FIE A;  4O8M A;  4JDF A;  2F7B A;  4ESX A;  2ABH A;  3A29 A;  4DCY A;  3QIM A;  4FJP A;  4NF0 A;  4UA8 A;  4YB7 A;  1QVS A;  1L5T A;  4MIJ A;  1FBG A;  3VLU A;  1H76 A;  3SEY A;  2AL5 A;  4KXP A;  3W15 C;  3K00 A;  4EXL A;  1B1H A;  1B1X A;  2I49 A;  1NV4 A;  4MBP A;  1BLF A;  2HZK A;  1LEV A;  4H0W A;  1NV0 A;  4P1E A;  3U1O A;  2O84 X;  3H06 B;  4F29 A;  1R9L A;  4BDO A;  1IXC A;  3IB2 A;  5H8Q A;  1JW1 A;  3DEL B;  1S7Y A;  3IOV A;  3T93 B;  1FPG A;  3QSL A;  4R6Y A;  5IM2 A;  4KYE A;  1VDW A;  1MY2 A;  1POT A;  3UP9 A;  5ET5 A;  4QSC A;  2JJK A;  4IY5 A;  2HQ0 A;  1FPL A;  5TP9 A;  4E0W A;  4RYA A;  3HHF A;  1LAG E;  2F97 A;  3ZKK A;  1G0H A;  4JVD A;  4OVT A;  1LBC A;  3RQT A;  2UVJ A;  2XA5 A;  1RDX A;  1YCJ A;  1SVX B;  2OX3 A;  4R9F A;  1B32 A;  2HHM A;  5L9M A;  4PDH A;  1B7U A;  1A8F A;  3H3G A;  1US4 A;  5ITP A;  1INP A;  2AYS A;  4FED A;  3TQW A;  1JP4 A;  3WAF A;  1G0I A;  4NF8 B;  2HPG A;  3LV0 A;  4BDL A;  3ONM A;  4KFQ A;  3TEP A;  3KZG A;  2ZZX A;  3FUZ A;  4OZ9 A;  3LSF B;  4G68 C;  5CMB A;  4HE1 A;  4DI3 D;  5DYH A;  4N4U A;  3MYU A;  2P3N A;  3W9V A;  1CE2 A;  4FBP A;  1MPB A;  2V3T A;  2Y84 A;  4OVJ A;  2UVI A;  3K1N A;  1LCT A;  1XVY A;  1RDZ A;  3KBR A;  4EF1 A;  3C33 A;  5AA1 A;  1M5B A;  4O7M A;  1EYI A;  1B46 A;  2CZI A;  5I56 A;  4QFP A;  3TQL A;  4RXL A;  1NV6 A;  2UVG A;  1MPD A;  5A5X B;  1DOT A;  1ZKB A;  3SEV A;  3IAZ A;  3V89 B;  3KBZ A;  1SI1 A;  3ILU B;  3FIR A;  1PBP A;  2F7C A;  1MDQ A;  2XXW A;  2F3B A;  4KPT A;  3LSW A;  3T9U A;  1K9Y A;  4G61 A;  3MP1 A;  3TEL A;  2O6A A;  1R6Z A;  3L6G A;  1FPF A;  3EQ1 A;  4G68 B;  3RT8 A;  1PC3 A;  3M3K A;  1USY E;  3FXU A;  1QUJ A;  4NMY A;  2ZZV A;  2FYI A;  3VVE A;  1FQC A;  3E3K A;  2G29 A;  2XXU A;  3U92 A;  3N6U A;  2DWH A;  1LST A;  3G3F A;  1DMB A;  5H8H B;  4MNP A;  1YZ0 A;  2HZL A;  1NNP A;  1NL5 A;  2I3W A;  5I59 B;  1QKA A;  3IX1 A;  4R9G A;  2QSX A;  2VGQ A;  3IR1 A;  3MJN A;  3T1B A;  1LAX A;  2ALU A;  4U2R A;  4OVQ A;  3N26 A;  4IB2 A;  1AMF A;  1YPN A;  5IAI A;  1NV1 A;  4FAT A;  4F3G A;  5ITO A;  4WEP A;  3MPK A;  4PQJ A;  5DTB A;  1VFE A;  3T9V A;  2AIX A;  1TT1 A;  3EF7 A;  3RUM A;  1N7X A;  5H8F B;  3O9P A;  4AB6 A;  1FQF A;  2XXR A;  3PUY E;  4GX3 A;  1MXW A;  3L6H A;  3E13 X;  4KYS A;  4MCO A;  1FPD A;  1A40 A;  1MY3 A;  5L9S A;  4LP2 B;  1AIV A;  1NNF A;  2IEE A;  2VD3 A;  3MPL A;  1JVY A;  1EYJ A;  3IK6 B;  2QS3 A;  5DVI A;  4H8I A;  2DQV A;  4MNC A;  2VHA A;  3RLF E;  5TPA B;  5CMK A;  4JBZ A;  2XX9 A;  1PBQ A;  4H6D A;  2Q74 A;  1N76 A;  3U65 A;  1LBV A;  2ZNT A;  3LC8 A;  5I58 B;  1NV7 A;  4HXV A;  1PB9 A;  4Q0C A;  4OWD A;  4ZEC A;  1I6B A;  3H6W A;  3LUZ A;  4NE4 A;  1P1Q A;  4N6D A;  5LDZ A;  4P1L A;  2H5Y A;  4IY6 A;  3FVG A;  2GQ1 A;  3ROJ A;  2PYY A;  3PMW A;  2FA7 A;  1FCK A;  5H8N B;  4NED A;  3FJ7 A;  2NWJ A;  1KWH A;  3IB1 A;  3G3G A;  4LZ8 A;  1ZJL A;  1F9B A;  1DPE A;  1M5C A;  1B7H A;  4POW A;  3PD9 A;  5ICT A;  2KR0 A;  4DE8 A;  3BIG A;  1MQJ A;  1MPC A;  3T66 A;  3O97 A;  2I0B A;  1IXG A;  3FV1 A;  5I5P A;  4GVO A;  2DDK A;  3V5A A;  3QUF A;  4OVS A;  1FPI A;  4TQU Q;  3TCH A;  2B3B A;  3B6Q A;  1RDY A;  2XWV A;  2H9B A;  2O68 A;  1VFD A;  2QPQ A;  3S4U A;  4ELO A;  4GL0 A;  4DZ1 A;  3R6U A;  2B3F A;  1MQG A;  2QVR A;  3IJX B;  2ONR A;  3C34 A;  1FBP A;  3LBS A;  1LLS A;  5EQ7 A;  5CC2 A;  4BLA A;  3JYR A;  4NF8 A;  2OBG A;  1UTH A;  1OVB A;  2CMO A;  5FHM A;  3H6V A;  3KEI A;  3TAJ A;  1FQE A;  3D4C A;  1WVJ A;  3THI A;  2I48 A;  4QBA A;  3PPR A;  5FHO A;  3SES A;  4LZ5 A;  2ZYK A;  3K02 A;  1LFI A;  4GOT A;  2XXK A;  4LAT A;  4IGT A;  2QMX A;  3HV1 A;  3O66 A;  4AQ4 A;  4ZDM A;  1DK4 A;  4YB5 A;  1LBW A;  3HN0 A;  2HCA A;  4MAG A;  1GR2 A;  4PCD A;  5ET6 A;  2Y7W A;  5A5X A;  4R74 A;  4G2Z A;  4OEU A;  1B3G A;  2QMW A;  3H7M A;  2Q88 A;  4NHB A;  3MBP A;  3M3L A;  5CMC A;  4U4S A;  3PV0 E;  2ZMB A;  3N6T A;  3ECR A;  2XD2 A;  4FE8 A;  1EH3 A;  4FEB A;  4PTK A;  1LBB A;  3OEN A;  1O64 A;  4WKM A;  1FBD A;  4IR8 A;  3H6T A;  3CIJ A;  5FBP A;  4MFI A;  3U72 A;  2OWS A;  3GXA A;  4Q30 B;  5HPQ A;  4BDQ A;  5KDT B;  3GBA A;  4YMB A;  4PAK A;  4PET A;  4NF5 A;  4OAN A;  3T96 B;  4GWW A;  3QUJ A;  4G68 A;  1SQY A;  3DP6 A;  1MY4 A;  2Q8M A;  5JTY B;  2XWO A;  4R72 A;  1FQA A;  4PAI A;  1WOD A;  2XXI A;  3B6W A;  3USD A;  4XFE A;  2BJJ X;  2P0S A;  2F34 A;  4O3B A;  2V93 A;  4N15 A;  2Q2A A;  3K1P A;  4H5F A;  1FTA A;  1NV3 A;  1B4Z A;  2XXV A;  5I59 A;  4PFY A;  2Z8F A;  4N17 A;  4DXC A;  4N8G A;  1B0L A;  4EQ9 A;  1EU8 A;  2WYP A;  3CVG A;  4ZEK A;  2CZL A;  4OYV A;  4Q5T A;  3FAT A;  4JWO A;  4YU0 A;  3E78 A;  1A8E A;  1NUX A;  5CI5 A;  1NH8 A;  5A5L A;  4XXU A;  1P1N A;  1QKB A;  1K9Z A;  1NMU A;  1B2H A;  3VV5 A;  3E4R A;  3ZSF A;  2PMS A;  3OOA A;  3Q26 A;  4EQB A;  4XKR A;  3KFM A;  4U22 A;  3T22 A;  3VLV A;  4PGN A;  2I6E A;  5H8F A;  5LTC A;  1O63 A;  2QRY A;  3BFT A;  2DWJ A;  4NF6 B;  1JEV A;  1SDX A;  2Q8J A;  4OMB A;  2Y5L A;  2RIN A;  4X48 A;  3T0J A;  1IIW A;  4IO3 A;  1AWB A;  1FRP A;  1LB9 A;  2DXR A;  4DLD A;  2W7Y A;  1FTM A;  3TCF A;  3PPO A;  4M1V A;  4GQO A;  1OQG A;  1BIY A;  3VVF A;  5F1Q A;  4IO2 A;  3VE1 B;  1D9Y A;  4EQ7 A;  2F78 A;  3MC2 A;  1B5H A;  2ONS A;  4JVC A;  3OSR A;  1OQH A;  1FSA A;  2WBD A;  4ZZA A;  3ZS6 A;  1A55 A;  1NV2 A;  3SZP A;  4IO5 A;  2XHD A;  3KN8 A;  5M2V A;  2OWT A;  3K1M A;  4GXS B;  5EHM A;  3GLB A;  2F8D A;  2X7P A;  3MST A;  3FXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...