1SW2A

Crystal structure of prox from archeoglobus fulgidus in complex with glycine betaine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
270
structure length
270
Chain Sequence
ERVVIGSKPFNEQYILANMIAILLEENGYKAEVKEGLGGTLVNYEALKRNDIQLYVEYTGTAYNVILRKQPPELWDQQYIFDEVKKGLLEADGVVVAAKLGFRDDYALAVRADWAEENGVEKISDLAEFADQLVFGSDPEFASRPDGLPQIKKVYGFEFKEVKQMEPTLMYEAIKNKQVDVIPAYTTDSRVDLFNLKILEDDKGALPPYDAIIIVNGNTAKDEKLISVLKLLEDRIDTDTMRALNYQYDVEKKDAREIAMSFLKEQGLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords osmoprotection protein (proX)
publication title Structural basis for the binding of compatible solutes by ProX from the hyperthermophilic archaeon Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Protein binding
total genus 99
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1sw2A01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 1sw2A02
4H65A 4ZZAA 4ZEIA 1I6BA 3OENA 3VFJA 4OEVA 3B7DA 5CMKA 1FTKA 1OQGA 4BDOA 1SW2A 1LGBC 2R9JA 4ZE8A 2ONSA 2LAOA 2Q89A 3PPOA 4GL0A 3FV2A 1A55A 2H9BA 1URDA 3S9NC 1TFAA 1N3WA 3TYHA 1SDXA 3THIA 3PUZE 1ELJA 5KCJB 4X48A 4AQ4A 3LSFB 4ZE9A 1SI0A 2O1MA 2AL4A 1SYHA 4KYEA 4ZEBA 4IB2A 3TTRA 3OO8A 4OESA 3MQ9A 1NNTA 2H25A 1DTGA 1US5A 3G7WA 1MG1A 4EQ9A 4TLLB 5LOMA 5F1QA 5AE4A 1P1OA 1URGA 4KR5A 5I84A 3W9VA 5TPAA 4DE8A 3EHUA 1UTHA 1BLFA 2O7UA 3IOWA 4DIGA 1MY0A 4AB5A 2UVGA 2AIXA 3EPEA 1NFTA 3FJGA 4C1UA 4EQBA 2NWJA 4RYAA 1UIUA 5KDTA 5L9SA 3FXQA 3QSLA 4IGRA 3A09A 1Q35A 1OVBA 4FORA 2PX1A 4QF9A 4LZ5A 1OLCA 1H3DA 3HV1A 1O63A 3S9EA 5KZTA 2NVUB 4G8MA 2O6AA 1NNKA 5FTHA 2W7YA 3RTWB 2D5WA 5AA2D 2A5TB 4R9FA 4NWDA 4G2ZA 1A40A 3IB2A 4F2OA 2F6PA 1MXYA 3K1MA 1B6HA 5K2XA 3IORA 3RTFB 2E1SA 3TTLA 2O7IA 2DE3A 2UVHA 3M3LA 4OZ9A 4PP0A 4QSCA 2XXHA 2D21A 2Q9TA 4U4XA 5JK4A 1WVJA 3MUQA 1B3LA 2QS4A 1DTZA 2XHDA 4ELRA 4OFOA 4OTEA 4R6YA 1P1NA 1LFGA 4LQ2A 1MXVA 1VE4A 4DCXA 2G29A 1NNPA 3KN3A 4QSEA 3W15C 1P1QA 5DEXA 3VV5A 3EN3A 4OFLA 4N07A 1NNFA 3IX1A 2P0SA 4ECFA 4R9GA 4YICA 1FW0A 3MC2A 4KCCA 4U22A 2I4CA 1PB9A 4PFWA 1Y20A 1B5HA 1Q1KA 2ZNSA 4QRZA 4R2BA 4RNSA 4YKKA 4MLVA 1T0KA 1AOVA 2QJEA 2ZYOA 4F31B 3C32A 1LBCA 1US4A 1B3GA 2QMWA 3C31A 3H3GA 5HBCA 4ZEKA 1HSEA 3E3KA 4GRKA 3GBBA 1MDP1 4QSDA 5CRYA 5TU0A 3GZGA 1MPCA 3VVDA 1QW0A 3JV9A 3IB1A 3ODBA 2F8DA 5KDTB 4YB7A 5I58A 2P1SA 3TQLA 3EF7A 3K02A 3RQTA 5IKBA 3SERA 4H6DA 1DMBA 4Z0IA 3TELA 4Q8RA 3UN6A 2Y7WA 1ZLQA 3V89B 4P0IA 5K2YA 1S50A 1LSTA 2F6GA 3SETA 1BKAA 4XXUA 2ANJA 4UA8A 2Q2AA 1B52A 3E9XA 3TODA 2Z8DA 3H4ZA 2ZXTA 1BTJA 2RKMA 3AXFA 4I8CA 1B51A 2ABHA 1GVCA 3KBRA 4OQOA 3CIJA 1JEVA 2QL3A 4EUOA 2F36A 3LR1A 2REGA 4LONB 3FVNA 2PVUA 4THIA 1SW4A 3I3VA 3B6TA 3OO7A 3DP6A 4DLDA 4IO7A 3HN0A 4BDNA 3H6WA 1NKXA 4O3CA 2I4BA 4EDPA 4H67A 1B05A 3KEIA 4BLAA 3R26A 3FV1A 3PD9A 3EQ1A 3UA8A 1ZTYA 3PUYE 1LFHA 1A99A 3K01A 3FASA 3I5OA 3EHTA 4BDMA 3HCQA 3OOAA 3GLBA 4RY1A 5CMMA 2I3WA 1B7HA 5F7VA 5TP9A 3D4CA 3VLUA 1Y1MA 1A8FA 3N5LA 1AH5A 2V84A 2QS3A 1B1XA 5I58B 2DE2A 2YJPA 3IO4A 3N6TA 2I49A 2HZKA 4FECA 4R73A 1USYH 3K6XA 1IZ1A 1NH7A 1B46A 4PFYA 3TPAA 1FQFA 1OMPA 3MVWA 2YPNA 1PC3A 5J1DA 3SEVA 1JW1A 2V3TA 3USDA 4BDQA 1JW5A 2OWTA 4FEBA 1D9VA 3O2AA 3VXBA 4OVJA 4HTGA 1L5TA 5IAIA 1VSOA 4NF8A 2DSFA 2THIA 5CBRA 3FATA 4G77A 5H8QA 1Y9UA 5CBSA 1JVYA 3OSQA 1VFEA 2ZMBA 2IA4A 1LB9A 3PPNA 4H0WA 2QRYA 2V3UA 1LAXA 4YKJA 3RGYA 3OO9A 3G3KA 2B65A 5L9OA 4G68C 3GXAA 4LUBA 1WDNA 1XHYA 3PMVA 3CFLA 4F39A 3K00A 3N94A 4R72A 1D4NA 4F29A 1GGGA 1CB6A 2UXAA 4KCDA 5DVFA 1FTLA 2NXOA 1R1NA 4DZ1A 1MQIA 3OXNA 3CVGA 5H8HA 3CI8A 5CI5A 2HAUA 2DWIA 1IXCA 1MY3A 3Q26A 5DVIA 2CMOA 1IEJA 4RJZA 2Y7KA 4JXIA 1B4HA 1YTVA 2VD3A 3QXMA 5L9MA 3I6VA 1SBPA 1B3HA 3UGWA 1P99A 3UK4A 2I3VA 4HS7A 1I6QA 1POY1 1MXUA 4XKPA 1N0TA 5I59A 5I56B 3TMGA 2RF1A 2F5XA 3PD8A 3CFZA 1LAHE 4BDRA 4ZZEA 3ZKLA 3MAMA 1YCJA 2RCBA 3RPWA 1QKBA 3H7MA 2RC8A 1IXGA 2X7QA 5AA4B 3VXCA 2GRVA 3C36A 1ATGA 4OWDA 1B1HA 3TKDA 1MY4A 5DVJA 3N6UA 2XD3A 4F3SA 4PETA 2DYXA 5FTIA 4KI0E 3FD3A 4NF8B 4F19A 4OXVA 2QPQA 3C33A 3FIRA 1ZMGA 4NWCA 4F3PA 3T9UA 1S9TA 5H8QB 3DLNA 2P2AA 2QS1A 5FHOA 3B6QA 3O9PA 4XIGQ 3QIMA 4O3AA 3S4UA 4H8JA 1XOCA 4ND9A 2ZYNA 3N26A 1EU8A 3CR9A 2XXWA 1R9LA 4DCYA 2R6GE 4GD5A 4FEDA 1RKMA 5EHSA 1MXZA 2Y7RA 3CFXA 4U23A 1PDAA 3QAXA 3SDFA 2DQVA 4JWOA 4ZECA 2Q88A 3MZ1A 2Z23A 5I2KA 2XXQA 1B3FA 1QUKA 1PB8A 5H8HB 3MZ9A 1JNFA 3H6VA 2XXTA 2I6EA 3O6HA 3KFMA 3ZKKA 4IY6A 4C1TA 2PT2A 4Q30B 5AA3A 4FATA 1B7UA 1D9YA 4NF6A 3GBAA 1BP5A 4WXJA 3TFLA 5I59B 2BJJX 3K0VA 3PMXA 3PPPA 4ZDMA 3JZJA 1MDQA 4DXBA 4I9DA 2V93A 4U2RA 1UTBA 5B7DA 1IXHA 3U1OA 1XT8A 3UIFA 3TCGA 1SW1A 5AA2A 3OO6A 1MY1A 1EH3A 1TT1A 4N13A 2I48A 2I0CA 2AL5A 5TPAB 1UTHB 1SW5A 2E0SA 2Y84A 4HCYA 4LATA 3W9WA 4WEPA 1B0LA 4PFUA 4G4PA 1QUIA 1M5BA 1EZ9A 2V25A 3Q29A 1B40A 3S2VA 3IOTA 1B58A 4F18A 4ZEFA 3T9XB 3OEKA 5FHNA 3HPIA 2GHBA 4PFTA 3H03A 1GR2A 4P11A 3OELA 4G8NA 1MM7A 5I57A 2XXPA 2YLNA 4F3GA 3FXRA 3FVKA 3WAEA 4HCWA 5A5XA 2PYYA 1JW4A 4EF2A 1QULA 4E0XA 1FTJA 4JWYA 3ZSFA 1KWHA 4RPNA 2DE4A 2VHAA 4FE8A 3EHSA 4R2FA 4LQ5A 2QMXA 1B3EA 1LFIA 4QFNA 4YMAA 4NF6B 4F3BA 2F35A 3IJOB 3ILTB 2XXYA 4QHQA 1OLAA 2A5SA 4QFLA 3BFUA 2RC9A 5DEXB 3CRBA 5CMBA 1MQGA 1SQYA 1TXFA 4LVQA 1UTBB 4LP2B 4JBZA 1POTA 2O1LA 2OBGA 4XKRA 3C34A 4QFOA 3G3FA 3RY3A 3FGSA 4YZZA 3LUYA 2O69A 3D4GA 1MXWA 1H43A 1CE2A 1N7WA 4XKQA 1ZKBA 3RT6B 5BUUA 3RN8A 4ISUA 3IOUA 2FYIA 4IO2A 3FVGA 3M3KA 4MBPA 2B3FA 3K6VA 2DXYA 4NF5A 4F1YA 1FQBA 3G3IA 2Z8EA 2WKYA 3VDFA 2DWHA 5BWJA 1NL5A 3OMBA 1A54A 2XD2A 3T93B 2RC7A 1SI1A 4X9TA 3FUZA 3MVXA 4YMBA 2X26A 4LZ7A 4NE4A 3MPLA 1AIVA 1LCTA 1JETA 3CG3A 3L6HA 3DM0A 1URSA 2ZNUA 1QJMA 5I57B 4BDLA 1N7XA 3KJ7A 3RUMA 1SYIA 1RYOA 5DT6A 4KHZE 3BKIB 4ELOA 4PE5B 1EZOA 4QFPA 4F2QA 5A5XB 2VP1A 4I62A 1LAFE 1A8EA 1MH4A 4JDFA 4JWXA 4DXCA 2GFEA 2ONRA 4YB5A 4KQPA 1MS7A 4M1VA 2O68A 3MP8A 3TQWA 5CMCA 3Q28A 2XX9A 2XX7A 2UYEA 3L6GA 3WAFA 2OLBA 2Y7PA 2O84X 2F78A 4MH5A 3P7IA 3MP6A 4Q5TA 1A7LA 3FVOA 4RA1A 3CSBA 4H5FA 5H8NA 4WEDA 4TQUQ 4FAJA 4GFRA 4WKMA 4L17A 2H98A 1P1UA 2F7AA 1GTKA 4F1UA 4KYDA 3SESA 4H8IA 4FIMA 1MQHA 3K1NA 4GF8A 4ELQA 4GOTA 2CZLA 3K6WA 4RK9A 3VE1B 1N3XA 2A5TA 5ICTA 3TCHA 2GH9A 2DVZA 2XXVA 4GLIA 3K1PA 5TP9B 3IK6B 2OCUA 1RYXA 3O29A 4OYVA 1H45A 1SVXB 4KPTA 3RLFE 2DP8A 3KGCA 1EZPA 4MLQA 1IXIA 4YKIA 4OMBA 1YAEA 2HEUA 4EXLA 3MWBA 1B4ZA 3ILUB 1JQFA 1IIWA 2ZNTA 3ONMA 2UVIA 4IGTA 2Z22A 4ESXA 3BBRA 2ONKE 1YPNA 2DOJA 1MPBA 5HM4B 1Y1ZA 5L8DA 3OEMA 4QFKA 1B2HA 3FZVA 3G3JA 1XS5A 1PBQA 1F9BA 1LCFA 4IO5A 3KN8A 1PB7A 3K2DA 1ZU0A 4OERA 3TDJA 4OFJA 1MM6A 3O66A 3TUSA 4GXSB 3SEYA 4KD5A 3MVYA 4OEUA 4K3FA 3DP8A 4LA9A 2ZYKA 3MZBA 4RPOA 3IJXB 1MY2A 2M8CA 3MP1A 4JSOA 5B70A 1N76A 2OWSA 3KN7A 4ZEDA 2QSXA 3T66A 2HZLA 5H8NB 1OVTA 3T9HB 2V3QA 3R6UA 3M8UA 1IUDA 1Z7ME 4F22A 4POWA 1AL3A 1ANFA 1FQAA 1DPEA 1O64A 4JB7A 4POXA 4U1OA 2HXWA 2XXUA 4KFQA 1Y4CA 1LBBA 3HHGA 4M4GA 1BIYA 3TCFA 2I58A 1PEBA 4R6HA 1QUJA 3PPRA 3SEXA 4G68A 1I6AA 1Y4TA 3ZS6A 1DOTA 5ITPA 4NMYA 1JEUA 3H6UA 3U72A 1ZIUA 2DWAA 3SKPA 3G3GA 1AMFA 1B5IA 1S7YA 3CG1A 4IY5A 3C35A 1FQEA 3JYRA 5ITOA 4EF1A 4U21A 1OQHA 5DYHA 5JTYA 3S9LC 3FJ7A 1P1WA 1XVXA 1FQCA 1FQDA 3G3HA 2FNCA 2O51A 3VVFA 4ESWA 2D3IA 4X1BA 4RXLA 4YB6A 2F34A 1MQJA 4E0WA 4X1DA 2RINA 3IR1A 2XXIA 5CM6A 1OIBA 1N04A 4NF4A 4OENA 4OHNA 4PQJA 1B9JA 3ECRA 1GV8A 1ZJLA 3O28A 3MBPA 3MJNA 3BFTA 2UYFA 3KSXA 4YKPA 3Q25A 4GVOA 2KLFA 3T96B 4R75A 4IO6A 1IQ7A 1UQWA 3PUXE 2REJA 3B6WA 3KG2A 1MQDA 2NUVA 1M5FA 4O3BA 3U93A 1R9QA 3OSRA 5ELVA 3A3CA 3HSTA 3PUVE 4NEDA 3KOSA 4DDDA 5EHMA 3LC8A 3V5AA 1TFDA 1B7ZA 4YAHX 3TZAA 1LAGE 3H06B 2DVCA 2FA7A 1MPDA 1I69A 1B32A 5HPQA 3LBSA 5I2KB 3T22A 4JSDA 3TEPA 4GL8A 3LSXA 4IO3A 2HCAA 3E4RA 3PV0E 3U92A 3QUFA 1IITA 1Z7NE 2OZZA 3LSWA 3TAJA 4G68B 2AYSA 3SEUA 2DWJA 4DXUA 3T9VA 1QVSA 3C4MA 3H6TA 4TOZA 2PMSA 2ZYMA 5H8FA 3SEWA 2XX8A 1WODA 1M5EA 1Y3PA 3KOTA 2H99A 1H76A 3KJTA 5M2VA 2OK2A 3FXUA 1FTOA 5CC2A 1JVXA 3U94A 3O6GA 3UORA 2F7BA 1Y3NA 3TTMA 1M5DA 5JTYB 4MF3A 2QS2A 3IAZA 2H5YA 3RT8A 4MFIA 4U4SA 4R6KA 4ZS9A 5ICQA 3IO6A 4U1ZA 1B0HA 2H4IA 1PBPA 3LSLA 1XC1A 3VLVA 1MXXA 5AA2B 2Q2CA 4C0RA 4YU0A 3M3FA 3PUWE 4H1XA 2G93A 3Q27A 4NF4B 1NMUA 2OJTA 4Z7EA 1VFDA 2X7PA 1MH3A 5H8SA 2VD2A 4OETA 4ONYA 1D3KA 2F97A 1HSLA 3O6IA 1H44A 2VOZA 2HAVA 4I1DA 4NTLA 5I2NA 2PT1A 1NH8A 4GXAA 2Y7IA 3S9MC 4LZ8A 1M5CA 1ZBMA 2DXRA 1DSNA 4AB6A 1FTMA 4GIZA 4EXKA 5DTBA 4XKNA 4RK2A 2PBWA 3HHFA 4FJPA 4F1VA 3O97A 1MRPA 3QUJA 5I56A 3HO7A 2HQ0A 3VLWA 3FJMA 4H5GA 4GWOA 2Z8FA 1II5A 5AA1A 2UVJA 3C9HA 3TTNA 2IEEA 3K4UA 3RNNA 3PU5A 5KCJA 2RCAA 5AA4A 5FHMA 2I0BA 1O7TA 5EYFA 2ESNA 1VR5A 3F11A 2HFBA 5JEIA 3TTKA 4N6PA 5H8FB 4TLMB 3KSJA 3VVEA 3CSGA 3K6UA 1HSJA 2ALUA 4Q0CA 3A3UA 1FCKA 2F7CA 3KZGA 2Q8JA 4GQOA 1J1NA 3PGFA 2DS9A 4UACA 3E13X 4KYSA 1Y3QA 4EQ7A 4P0GA 1N84A 2XXRA 4XTCQ 3MPKA 1LB8A 3U8QA 5ISUA 1UIVA 2XXXA 4G8HA 4HW8A 3QYTA 3UP9A 3PPQA 3V8XB 3IL1B 3PMWA 1R6ZA 2R71A 4R74A 3MW0A 1TWYA 3V83A 1B5JA 3DP4A 3DELB 1DPPA 2VGQA 4IO4A 1USYE 1SD3A 2NOOA 3MVZA 4ELPA 3IOVA 1QKAA 3QK6A 4NF5B 2B3BA 1XVYA 3R7XA 1LLSA 5I2NB 2GHAA 3OD7A 3IB0A
chains in the Genus database with same CATH superfamily
4H65A 4ZZAA 4ZEIA 1I6BA 3OENA 2P3NA 3VFJA 4MNCA 3B7DA 4OEVA 5ESYA 5CMKA 1FTKA 1OQGA 2R8TA 4BDOA 4MIJA 1SW2A 1LGBC 2R9JA 4ZE8A 2ONSA 2LAOA 2Q89A 3PPOA 1NUWA 4GL0A 3FV2A 4I3EA 3EKIA 1A55A 2H9BA 1URDA 3S9NC 1TFAA 1N3WA 3TYHA 4N81A 1SDXA 5T3JA 4P1EA 3THIA 3PUZE 1ELJA 2CZIA 5KCJB 4X48A 4AQ4A 3LSFB 4ZE9A 2PCRA 1SI0A 2O1MA 1NUZA 2AL4A 2ZZVA 1NV4A 1SYHA 4KYEA 4ZEBA 4IB2A 3TTRA 3OO8A 4OESA 3MQ9A 1NNTA 2FVZA 2H25A 1DTGA 1US5A 3G7WA 1MG1A 4PAFA 4EQ9A 4TLLB 5LOMA 5F1QA 5AE4A 1P1OA 1URGA 4KR5A 5I84A 3W9VA 5TPAA 4DE8A 3EHUA 1UTHA 1BLFA 2V4CA 4XEQA 4PFBA 2O7UA 3IOWA 1RDYA 4DIGA 1MY0A 4AB5A 2UVGA 1RDZA 2AIXA 2VPNA 3EPEA 1NFTA 3FJGA 2HXRA 4C1UA 4EQBA 2NWJA 4RYAA 1UIUA 3T1BA 5KDTA 2Y5KA 5L9SA 2VT5A 3FXQA 3QSLA 2Y5LA 4IGRA 3A09A 1Q35A 1OVBA 4FORA 2PX1A 4QF9A 1NV2A 3MSTA 2CZKA 4LZ5A 1OLCA 1H3DA 3HV1A 1O63A 3E78A 3S9EA 5KZTA 2NVUB 4G8MA 2O6AA 1NNKA 5FTHA 2W7YA 3RTWB 2D5WA 5AA2D 2A5TB 4R9FA 4NWDA 4G2ZA 1A40A 3IB2A 4F2OA 4GX6A 2F6PA 5IZ3B 1MXYA 3K1MA 4IR8A 1B6HA 1FPGA 5K2XA 3IORA 3RTFB 2E1SA 3TTLA 2O7IA 2DE3A 2UVHA 3M3LA 4HE2A 4OZ9A 4PP0A 3KC0A 1DCUA 1FBGA 4QSCA 2XXHA 2D21A 2Q9TA 4U4XA 5JK4A 1WVJA 4GWXA 3MUQA 1B3LA 2QS4A 1DTZA 2XHDA 4ELRA 4OFOA 2L5VA 4OTEA 4R6YA 1P1NA 1LFGA 3RPLA 4DI3D 4LQ2A 1MXVA 1VE4A 4DCXA 2G29A 1NNPA 1XI6A 3KN3A 4QSEA 3W15C 1P1QA 5DEXA 3VV5A 3EN3A 4OFLA 4N07A 1NNFA 3IX1A 2P0SA 4ECFA 4R9GA 4YICA 1FW0A 3MC2A 4KCCA 4U22A 2I4CA 1PB9A 4PFWA 1Y20A 1B5HA 2OWZA 1Q1KA 2ZNSA 4R2BA 3ISPA 4QRZA 4RNSA 4YKKA 4MLVA 1T0KA 3E79A 2B4MA 1KA1A 1AOVA 2CEYA 2QJEA 2ZYOA 1YZ0A 5EQAA 4F31B 3C32A 1LBCA 5EYGA 1US4A 1B3GA 2QMWA 1FRPA 3C31A 3H3GA 5HBCA 4ZEKA 1HSEA 3E3KA 4GRKA 3GBBA 1MDP1 4I3YA 4QSDA 5CRYA 5TU0A 3GZGA 1MPCA 3VVDA 1QW0A 3JV9A 3IB1A 3ODBA 2F8DA 1FSAA 5KDTB 4X8RA 4YB7A 5I58A 2P1SA 3TQLA 3ROJA 3SZPA 3EF7A 3K02A 3RQTA 5IKBA 3SERA 4H6DA 1DMBA 4Z0IA 3TELA 4Q8RA 3UN6A 2Y7WA 1ZLQA 3V89B 4P0IA 4GBVA 5K2YA 1S50A 1LSTA 2F6GA 3SETA 1BKAA 4XXUA 2ANJA 4UA8A 2FBPA 2Q2AA 1B52A 3E9XA 3TODA 4GWSA 5EQ8A 2GQ1A 4MNIA 2Z8DA 3H4ZA 1FTAA 2ZXTA 1BTJA 4O8MA 4P9KA 2RKMA 3FBPA 3AXFA 4I8CA 1B51A 2ABHA 1GVCA 3KBRA 4OQOA 3CIJA 1RDXA 1JEVA 3LUZA 5ET5A 2QL3A 2XXKA 4EUOA 2WEFA 2F36A 3LR1A 2REGA 4LONB 3FVNA 2PVUA 3LV0A 4THIA 1SW4A 3I3VA 3B6TA 3OO7A 4NG7A 3DP6A 2MKZA 4DLDA 4IO7A 3HN0A 4BDNA 3H6WA 1NKXA 4O3CA 2I4BA 4EDPA 4PC9A 2XWKA 4H67A 1B05A 3KEIA 4BLAA 3R26A 3FV1A 3PD9A 3EQ1A 4GWUA 3UA8A 1ZTYA 3PUYE 1LFHA 1A99A 3K01A 3FASA 3I5OA 3EHTA 4BDMA 3HCQA 3OOAA 3GLBA 4RY1A 5CMMA 5IGAA 2I3WA 1B7HA 5F7VA 5TP9A 3D4CA 3VLUA 1K9YA 1Y1MA 1A8FA 3N5LA 2CZHA 4PE3A 1AH5A 1IMFA 2FIXA 2V84A 2QS3A 3GYYA 1B1XA 5I58B 2DE2A 2YJPA 3IO4A 1FBDA 3N6TA 2I49A 1LBWA 2HZKA 4FECA 4R73A 1USYH 3K6XA 4AS4A 1IZ1A 1NI9A 1NH7A 1B46A 4PFYA 3TPAA 1FQFA 1OMPA 3MVWA 2HPGA 2YPNA 1PC3A 5J1DA 3SEVA 1JW1A 2V3TA 3USDA 4BDQA 1JW5A 2OWTA 4FEBA 1D9VA 3O2AA 5I3SA 4OVJA 3VXBA 4HTGA 1L5TA 4MCOA 5IAIA 1VSOA 4NF8A 2DSFA 2THIA 5CBRA 3FATA 4G77A 3NOHA 5H8QA 1Y9UA 2KQZA 5CBSA 1JVYA 3OSQA 4OVQA 1VFEA 2ZMBA 2IA4A 1LB9A 3PPNA 4H0WA 2QRYA 2V3UA 1LAXA 4YKJA 3RGYA 3OO9A 3G3KA 2B65A 4JVIA 4N91A 5L9OA 4G68C 3GXAA 4LUBA 1WDNA 1DK4A 1XHYA 3PMVA 3CFLA 4F39A 3A29A 3K00A 3N94A 4R72A 1D4NA 4F29A 1GGGA 1CB6A 2UXAA 4KCDA 4NX1A 5DVFA 1FTLA 2NXOA 1R1NA 4DZ1A 1MQIA 3OXNA 3CVGA 5H8HA 1Q9DA 3CI8A 5CI5A 2HAUA 2DWIA 5I7IA 1IXCA 1MY3A 4QXDA 3Q26A 5DVIA 4P56A 2CMOA 1IEJA 4RJZA 2Y7KA 4JXIA 1B4HA 1YTVA 2VD3A 3QXMA 1FPIA 5L9MA 3I6VA 4O94A 1SBPA 1B3HA 3UGWA 1P99A 3UK4A 2I3VA 4HS7A 1I6QA 1POY1 1MXUA 1N0TA 4XKPA 5I59A 5I56B 3TMGA 2RF1A 5EQ7A 2F5XA 3PD8A 3CFZA 1LAHE 4BDRA 4ZZEA 3ZKLA 3MAMA 1YCJA 2RCBA 3RPWA 1QKBA 3H7MA 2RC8A 4PFIA 1IXGA 2X7QA 3RYDA 5AA4B 3MYUA 3VXCA 5ET6A 1YYZA 2GRVA 3C36A 1ATGA 4OWDA 1B1HA 3TKDA 4N15A 1MY4A 5DVJA 3N6UA 2XD3A 4AS5A 4F3SA 5IZZA 4PETA 2DYXA 5FTIA 1IMDA 4KI0E 1NV1A 3FD3A 4NF8B 4F19A 4OXVA 1FPLA 2QPQA 3C33A 3FIRA 1ZMGA 4NWCA 4F3PA 3T9UA 1S9TA 5H8QB 3DLNA 2P2AA 2QS1A 4PGNA 5FHOA 3B6QA 3O9PA 4XIGQ 2Q8MA 3QIMA 2VPOA 4O3AA 3S4UA 5IM2A 4H8JA 1LBVA 4OVTA 1XOCA 4ND9A 2ZYNA 3N26A 1EU8A 3CR9A 2XXWA 1R9LA 4JVCA 4DCYA 2R6GE 4GD5A 4FEDA 1RKMA 5EHSA 1MXZA 2Y7RA 2ZZWA 3CFXA 4U23A 1PDAA 3QAXA 1SPIA 3SDFA 2DQVA 4JWOA 4ZECA 2Q88A 3MZ1A 3IFAA 2Z23A 5I2KA 2XXQA 2JJKA 1NV5A 1B3FA 1QUKA 1PB8A 4N4UA 1EYJA 5H8HB 3MZ9A 1JNFA 3H6VA 2XXTA 2I6EA 3O6HA 3KFMA 3ZKKA 2FHYA 4IY6A 4C1TA 2PT2A 4Q30B 5AA3A 4FATA 1B7UA 1BK4A 1D9YA 4PCDA 4NF6A 4XFEA 1FBCA 3GBAA 1BP5A 4WXJA 3TFLA 5I59B 2BJJX 4H45A 3K0VA 3HFUA 3PMXA 3PPPA 4ZDMA 3JZJA 1MDQA 4DXBA 5I5PA 4I9DA 2V93A 4U2RA 1UTBA 1VDWA 2QVVA 2Q74A 5B7DA 1IXHA 1IMAA 3IFCA 1XT8A 3U1OA 3UIFA 3TCGA 1SW1A 5AA2A 3OO6A 1MY1A 1EH3A 1TT1A 4N13A 2I48A 3D1RA 2I0CA 2AL5A 5TPAB 1UTHB 4LN5A 1SW5A 2E0SA 2Y84A 4HCYA 4LATA 1LBYA 3W9WA 4WEPA 4PAKA 1B0LA 1FPBA 3BIGA 4PFUA 4G4PA 4N6KA 1QUIA 3KBZA 1M5BA 4MMPA 1EZ9A 2V25A 4X04A 4PF8A 3Q29A 1B40A 3S2VA 3IOTA 1B58A 4F18A 4PFRA 4ZEFA 1LBZA 3T9XB 3OEKA 5FHNA 3HPIA 2GHBA 4PFTA 3H03A 1GR2A 4P11A 3OELA 4O7IA 4G8NA 1MM7A 5I57A 4P3LA 2XXPA 4NN3A 2YLNA 4F3GA 2KR0A 3FXRA 3FVKA 3WAEA 4HCWA 5A5XA 2PYYA 1JW4A 4EF2A 1QULA 4E0XA 4N8GA 1FTJA 4JWYA 3ZSFA 1KWHA 4RPNA 2DE4A 2VHAA 4FE8A 3EHSA 4R2FA 4LQ5A 2QMXA 1B3EA 4PBQA 1LBXA 1LFIA 4QFNA 4YMAA 4NF6B 4F3BA 2F35A 3IJOB 3ILTB 2XXYA 4QHQA 3RPLB 1OLAA 2A5SA 4QFLA 3BFUA 2RC9A 5DEXB 3CRBA 5CMBA 1LEVA 1MQGA 1SQYA 1TXFA 4LVQA 4FBPA 1UTBB 3B8BA 2XA5A 4LP2B 4JBZA 2OX3A 1POTA 3KC1A 2O1LA 2OBGA 4XKRA 3C34A 4QFOA 3G3FA 3RY3A 2WX9A 3FGSA 4YZZA 3LUYA 2O69A 3D4GA 1MXWA 1H43A 4NGUA 1CE2A 1N7WA 4XKQA 3CHGA 1ZKBA 3RT6B 5BUUA 3RN8A 4ISUA 3IOUA 4GX4A 2FYIA 4IO2A 4OANA 3FVGA 3M3KA 4MBPA 2B3FA 3K6VA 2DXYA 4NF5A 3PTYA 4F1YA 3U65A 1FQBA 3G3IA 2Z8EA 1NV6A 2WKYA 3VDFA 2DWHA 5BWJA 1NL5A 3OMBA 1A54A 2XD2A 3T93B 2RC7A 1SI1A 4X9TA 1FPJA 3FUZA 3MVXA 4YMBA 2X26A 5ET8A 4LZ7A 4NE4A 3MPLA 1AIVA 1LCTA 4UABA 1JETA 4OVSA 5ET7A 3CG3A 3L6HA 3DM0A 1URSA 2ZNUA 1QJMA 5I57B 4BDLA 1N7XA 3KJ7A 3RUMA 1SYIA 1RYOA 1AWBA 5DT6A 4KHZE 3BKIB 4ELOA 4PE5B 1EZOA 4QFPA 4F2QA 5A5XB 2VP1A 4N6DA 1FJ6A 4I62A 2F3DA 1LAFE 2DDKA 2XWIA 1A8EA 1MH4A 4JDFA 4JWXA 4DXCA 2GFEA 2ONRA 4YB5A 1NV0A 4KQPA 1MS7A 4M1VA 2O68A 3MP8A 3TQWA 5CMCA 3Q28A 4QBAA 2XX9A 2XX7A 2UYEA 3L6GA 2B4LA 3WAFA 2OLBA 1QGXA 2Y7PA 2O84X 1DBZA 2F78A 4MH5A 3P7IA 3MP6A 4Q5TA 1A7LA 3FVOA 4RA1A 3CSBA 4H5FA 5H8NA 4WEDA 4TQUQ 4FAJA 4GFRA 4WKMA 4L17A 2H98A 3T0JA 1P1UA 2F7AA 1GTKA 4F1UA 4KYDA 3SESA 4H8IA 4FIMA 1MQHA 3K1NA 4GF8A 2QFLA 4ELQA 4GOTA 2CZLA 3K6WA 4RK9A 4I40A 3VE1B 1N3XA 2A5TA 5ICTA 3TCHA 4PBHA 2GH9A 2DVZA 2XXVA 4GLIA 3K1PA 5IZ3A 5TP9B 3IK6B 2OCUA 1RYXA 3O29A 4OYVA 1H45A 1SVXB 4KPTA 3RLFE 2DP8A 3KGCA 1EZPA 4MLQA 1IXIA 2PFZA 4YKIA 4OMBA 1YAEA 2HEUA 4EXLA 3MWBA 1NUYA 1B4ZA 3ILUB 1JQFA 1IIWA 2ZNTA 3ONMA 2UVIA 4IGTA 2Z22A 4ESXA 3BBRA 2ONKE 1YPNA 2DOJA 1MPBA 5HM4B 1Y1ZA 5L8DA 3OEMA 4QFKA 1B2HA 1CNQA 3FZVA 3G3JA 1XS5A 1PBQA 1F9BA 1LCFA 4IO5A 3KN8A 1PB7A 3K2DA 1ZU0A 4OERA 3TDJA 4OFJA 1MM6A 3O66A 3TUSA 1FPEA 4GXSB 3SEYA 2PFYA 4KD5A 1EYIA 3MVYA 4OEUA 4K3FA 3DP8A 2HHMA 1EYKA 4LA9A 2ZYKA 3MZBA 4RPOA 3IJXB 1MY2A 2M8CA 3MP1A 4JSOA 5B70A 5LTCA 1N76A 2OWSA 3KN7A 4ZEDA 2QSXA 3T66A 1FPKA 2HZLA 5H8NB 1OVTA 3T9HB 2V3QA 3R6UA 4P8BA 3M8UA 1IUDA 1Z7ME 4F22A 4POWA 1AL3A 1ANFA 2P3VA 1FQAA 1O64A 1DPEA 4JB7A 4POXA 4U1OA 2HXWA 2XXUA 4KFQA 1Y4CA 1LBBA 3HHGA 1FJ9A 4M4GA 1BIYA 3TCFA 2I58A 1PEBA 1D9QA 4R6HA 2QVUA 1QUJA 3PPRA 3SEXA 4G68A 1I6AA 1Y4TA 3ZS6A 1DOTA 5ITPA 1FBPA 4NMYA 1JEUA 1FPFA 3H6UA 3U72A 1ZIUA 2DWAA 3SKPA 3G3GA 1AMFA 1B5IA 1S7YA 3CG1A 4IY5A 3C35A 1FQEA 3JYRA 4O7MA 5ITOA 4EF1A 4OA4A 4U21A 1OQHA 5DYHA 5EQ9A 5JTYA 3S9LC 3FJ7A 1P1WA 1XVXA 1FQCA 1FQDA 4HE1A 3G3HA 2FNCA 2O51A 1JP4A 3VVFA 4ESWA 2D3IA 4X1BA 4RXLA 4YB6A 2F34A 1MQJA 4E0WA 4X1DA 2RINA 3IR1A 2XXIA 5CM6A 1OIBA 1N04A 4NF4A 2WBDA 4OENA 4OHNA 4PQJA 1B9JA 3ECRA 1GV8A 1ZJLA 3O28A 1YXIA 3MBPA 3MJNA 3BFTA 2UYFA 3KSXA 4YKPA 4PDHA 3Q25A 4GVOA 2KLFA 3T96B 4R75A 4IO6A 1IQ7A 1UQWA 3PUXE 2REJA 4GBWA 3B6WA 3KG2A 1MQDA 2NUVA 1M5FA 4O3BA 5IZ1A 3U93A 1R9QA 3OSRA 5ELVA 3A3CA 2XWVA 3HSTA 3PUVE 4NEDA 3KOSA 5DW8A 2F3BA 4DDDA 5EHMA 4MAGA 3LC8A 3V5AA 1TFDA 1B7ZA 4YAHX 3TZAA 1INPA 1LAGE 3H06B 2DVCA 2FIEA 2FA7A 1MPDA 2WYPA 1I69A 1B32A 5J16A 5HPQA 3LBSA 1FBFA 5I2KB 3T22A 4JSDA 3TEPA 4GL8A 3LSXA 4IO3A 2HCAA 3E4RA 3PV0E 3U92A 3QUFA 1IITA 1Z7NE 2OZZA 3LSWA 3TAJA 4G68B 2AYSA 4N17A 4GX3A 3SEUA 2DWJA 4DXUA 2BJIA 3T9VA 1QVSA 3C4MA 3H6TA 4TOZA 2PMSA 1IMBA 5F24A 2ZYMA 5H8FA 3SEWA 2XX8A 1IMCA 1WODA 1M5EA 1Y3PA 3KOTA 4G61A 1KA0A 2H99A 1FBEA 1H76A 3KJTA 5M2VA 2OK2A 2ZZXA 3FXUA 1FTOA 4GWYA 4P47A 4JVDA 5CC2A 1JVXA 3U94A 3O6GA 3UORA 2F7BA 1Y3NA 3TTMA 1M5DA 5JTYB 4MF3A 2QS2A 3IAZA 2H5YA 3RT8A 4MFIA 4NAPA 4U4SA 4R6KA 4ZS9A 3BIHA 5ICQA 3IO6A 4U1ZA 1B0HA 4MEVA 2H4IA 1PBPA 3LSLA 1XC1A 3VLVA 1MXXA 5AA2B 2Q2CA 4C0RA 4YU0A 3M3FA 3PUWE 1G0IA 4H1XA 2G93A 3Q27A 4NF4B 4MJOA 1NMUA 2OJTA 4Z7EA 1VFDA 2X7PA 1MH3A 3B50A 5H8SA 2VD2A 4OETA 4HE0A 4ONYA 1D3KA 2F97A 1HSLA 3O6IA 1H44A 2VOZA 4P1LA 2HAVA 4I1DA 5FBPA 3FXBA 4NTLA 5I2NA 2PT1A 2XWOA 1NH8A 3QMFA 4GXAA 2Y7IA 4DI4B 1G0HA 3S9MC 4LZ8A 1M5CA 4OVRA 1ZBMA 2DXRA 1DSNA 4AB6A 1FTMA 4GIZA 4EXKA 5DTBA 4XKNA 4RK2A 2PBWA 3HHFA 4FJPA 1KZ8A 4F1VA 3O97A 5LDZA 1MRPA 3QUJA 5EYHA 5I56A 3HO7A 4XF5A 2HQ0A 4OVPA 3VLWA 3FJMA 4H5GA 4GWOA 2Z8FA 1II5A 5AA1A 2UVJA 3C9HA 3TTNA 2IEEA 3K4UA 3RNNA 2CEXA 3PU5A 4PTKA 5KCJA 2RCAA 5AA4A 1NUXA 5FHMA 2I0BA 1O7TA 1K9ZA 5EYFA 2ESNA 1VR5A 3F11A 2HFBA 4HXVA 5JEIA 3TTKA 4N6PA 5H8FB 4TLMB 3KSJA 3VVEA 3CSGA 4PDDA 3K6UA 4NQ8A 1HSJA 2ALUA 4N8YA 4H46A 4MNPA 4Q0CA 3A3UA 1FCKA 2F7CA 4NHBA 3KZGA 2Q8JA 4GQOA 1J1NA 4KXPA 4PAIA 3PGFA 5A5LA 2DS9A 4PF6A 4UACA 1NV7A 4GWWA 4MHFA 3E13X 4KYSA 1Y3QA 4EQ7A 4P0GA 1N84A 2XXRA 4XTCQ 3MPKA 1LB8A 3U8QA 5ISUA 1UIVA 2XXXA 4G8HA 4HW8A 2QVRA 3QYTA 1IMEA 3UP9A 3PPQA 3V8XB 3IL1B 3PMWA 1R6ZA 2R71A 4R74A 3MW0A 1TWYA 3V83A 1B5JA 3DP4A 2WBBA 3DELB 1FPDA 1DPPA 1FBHA 2VGQA 4IO4A 1USYE 1SD3A 2NOOA 3MVZA 4ELPA 4MX6A 3IOVA 1QKAA 3QK6A 4NF5B 4GWZA 2B3BA 4NF0A 1XVYA 3R7XA 1NV3A 1LLSA 5I2NB 2GHAA 3OD7A 2WYKA 4PGPA 3IB0A
chains in the Genus database with same CATH topology
4H65A 4ZZAA 4ZEIA 1I6BA 3OENA 3VFJA 4OEVA 3B7DA 5CMKA 1FTKA 1OQGA 4BDOA 1SW2A 1LGBC 2R9JA 4ZE8A 2ONSA 2LAOA 2Q89A 3PPOA 4GL0A 3FV2A 1A55A 2H9BA 1URDA 3S9NC 1TFAA 1N3WA 3TYHA 1SDXA 3THIA 3PUZE 1ELJA 5KCJB 4X48A 4AQ4A 3LSFB 4ZE9A 1SI0A 2O1MA 2AL4A 1SYHA 4KYEA 4ZEBA 4IB2A 3TTRA 3OO8A 4OESA 3MQ9A 1NNTA 2H25A 1DTGA 1US5A 3G7WA 1MG1A 4EQ9A 4TLLB 5LOMA 5F1QA 5AE4A 1P1OA 1URGA 4KR5A 5I84A 3W9VA 5TPAA 4DE8A 3EHUA 1UTHA 1BLFA 2O7UA 3IOWA 4DIGA 1MY0A 4AB5A 2UVGA 2AIXA 3EPEA 1NFTA 3FJGA 4C1UA 4EQBA 2NWJA 4RYAA 1UIUA 5KDTA 5L9SA 3FXQA 3QSLA 4IGRA 3A09A 1Q35A 1OVBA 4FORA 2PX1A 4QF9A 4LZ5A 1OLCA 1H3DA 3HV1A 1O63A 3S9EA 5KZTA 2NVUB 4G8MA 2O6AA 1NNKA 5FTHA 2W7YA 3RTWB 2D5WA 5AA2D 2A5TB 4R9FA 4NWDA 4G2ZA 1A40A 3IB2A 4F2OA 2F6PA 1MXYA 3K1MA 1B6HA 5K2XA 3IORA 3RTFB 2E1SA 3TTLA 2O7IA 2DE3A 2UVHA 3M3LA 4OZ9A 4PP0A 4QSCA 2XXHA 2D21A 2Q9TA 4U4XA 5JK4A 1WVJA 3MUQA 1B3LA 2QS4A 1DTZA 2XHDA 4ELRA 4OFOA 4OTEA 4R6YA 1P1NA 1LFGA 4LQ2A 1MXVA 1VE4A 4DCXA 2G29A 1NNPA 3KN3A 4QSEA 3W15C 1P1QA 5DEXA 3VV5A 3EN3A 4OFLA 4N07A 1NNFA 3IX1A 2P0SA 4ECFA 4R9GA 4YICA 1FW0A 3MC2A 4KCCA 4U22A 2I4CA 1PB9A 4PFWA 1Y20A 1B5HA 1Q1KA 2ZNSA 4QRZA 4R2BA 4RNSA 4YKKA 4MLVA 1T0KA 1AOVA 2QJEA 2ZYOA 4F31B 3C32A 1LBCA 1US4A 1B3GA 2QMWA 3C31A 3H3GA 5HBCA 4ZEKA 1HSEA 3E3KA 4GRKA 3GBBA 1MDP1 4QSDA 5CRYA 5TU0A 3GZGA 1MPCA 3VVDA 1QW0A 3JV9A 3IB1A 3ODBA 2F8DA 5KDTB 4YB7A 5I58A 2P1SA 3TQLA 3EF7A 3K02A 3RQTA 5IKBA 3SERA 4H6DA 1DMBA 4Z0IA 3TELA 4Q8RA 3UN6A 2Y7WA 1ZLQA 3V89B 4P0IA 5K2YA 1S50A 1LSTA 2F6GA 3SETA 1BKAA 4XXUA 2ANJA 4UA8A 2Q2AA 1B52A 3E9XA 3TODA 2Z8DA 3H4ZA 2ZXTA 1BTJA 2RKMA 3AXFA 4I8CA 1B51A 2ABHA 1GVCA 3KBRA 4OQOA 3CIJA 1JEVA 2QL3A 4EUOA 2F36A 3LR1A 2REGA 4LONB 3FVNA 2PVUA 4THIA 1SW4A 3I3VA 3B6TA 3OO7A 3DP6A 4DLDA 4IO7A 3HN0A 4BDNA 3H6WA 1NKXA 4O3CA 2I4BA 4EDPA 4H67A 1B05A 3KEIA 4BLAA 3R26A 3FV1A 3PD9A 3EQ1A 3UA8A 1ZTYA 3PUYE 1LFHA 1A99A 3K01A 3FASA 3I5OA 3EHTA 4BDMA 3HCQA 3OOAA 3GLBA 4RY1A 5CMMA 2I3WA 1B7HA 5F7VA 5TP9A 3D4CA 3VLUA 1Y1MA 1A8FA 3N5LA 1AH5A 2V84A 2QS3A 1B1XA 5I58B 2DE2A 2YJPA 3IO4A 3N6TA 2I49A 2HZKA 4FECA 4R73A 1USYH 3K6XA 1IZ1A 1NH7A 1B46A 4PFYA 3TPAA 1FQFA 1OMPA 3MVWA 2YPNA 1PC3A 5J1DA 3SEVA 1JW1A 2V3TA 3USDA 4BDQA 1JW5A 2OWTA 4FEBA 1D9VA 3O2AA 3VXBA 4OVJA 4HTGA 1L5TA 5IAIA 1VSOA 4NF8A 2DSFA 2THIA 5CBRA 3FATA 4G77A 5H8QA 1Y9UA 5CBSA 1JVYA 3OSQA 1VFEA 2ZMBA 2IA4A 1LB9A 3PPNA 4H0WA 2QRYA 2V3UA 1LAXA 4YKJA 3RGYA 3OO9A 3G3KA 2B65A 5L9OA 4G68C 3GXAA 4LUBA 1WDNA 1XHYA 3PMVA 3CFLA 4F39A 3K00A 3N94A 4R72A 1D4NA 4F29A 1GGGA 1CB6A 2UXAA 4KCDA 5DVFA 1FTLA 2NXOA 1R1NA 4DZ1A 1MQIA 3OXNA 3CVGA 5H8HA 3CI8A 5CI5A 2HAUA 2DWIA 1IXCA 1MY3A 3Q26A 5DVIA 2CMOA 1IEJA 4RJZA 2Y7KA 4JXIA 1B4HA 1YTVA 2VD3A 3QXMA 5L9MA 3I6VA 1SBPA 1B3HA 3UGWA 1P99A 3UK4A 2I3VA 4HS7A 1I6QA 1POY1 1MXUA 4XKPA 1N0TA 5I59A 5I56B 3TMGA 2RF1A 2F5XA 3PD8A 3CFZA 1LAHE 4BDRA 4ZZEA 3ZKLA 3MAMA 1YCJA 2RCBA 3RPWA 1QKBA 3H7MA 2RC8A 1IXGA 2X7QA 5AA4B 3VXCA 2GRVA 3C36A 1ATGA 4OWDA 1B1HA 3TKDA 1MY4A 5DVJA 3N6UA 2XD3A 4F3SA 4PETA 2DYXA 5FTIA 4KI0E 3FD3A 4NF8B 4F19A 4OXVA 2QPQA 3C33A 3FIRA 1ZMGA 4NWCA 4F3PA 3T9UA 1S9TA 5H8QB 3DLNA 2P2AA 2QS1A 5FHOA 3B6QA 3O9PA 4XIGQ 3QIMA 4O3AA 3S4UA 4H8JA 1XOCA 4ND9A 2ZYNA 3N26A 1EU8A 3CR9A 2XXWA 1R9LA 4DCYA 2R6GE 4GD5A 4FEDA 1RKMA 5EHSA 1MXZA 2Y7RA 3CFXA 4U23A 1PDAA 3QAXA 3SDFA 2DQVA 4JWOA 4ZECA 2Q88A 3MZ1A 2Z23A 5I2KA 2XXQA 1B3FA 1QUKA 1PB8A 5H8HB 3MZ9A 1JNFA 3H6VA 2XXTA 2I6EA 3O6HA 3KFMA 3ZKKA 4IY6A 4C1TA 2PT2A 4Q30B 5AA3A 4FATA 1B7UA 1D9YA 4NF6A 3GBAA 1BP5A 4WXJA 3TFLA 5I59B 2BJJX 3K0VA 3PMXA 3PPPA 4ZDMA 3JZJA 1MDQA 4DXBA 4I9DA 2V93A 4U2RA 1UTBA 5B7DA 1IXHA 3U1OA 1XT8A 3UIFA 3TCGA 1SW1A 5AA2A 3OO6A 1MY1A 1EH3A 1TT1A 4N13A 2I48A 2I0CA 2AL5A 5TPAB 1UTHB 1SW5A 2E0SA 2Y84A 4HCYA 4LATA 3W9WA 4WEPA 1B0LA 4PFUA 4G4PA 1QUIA 1M5BA 1EZ9A 2V25A 3Q29A 1B40A 3S2VA 3IOTA 1B58A 4F18A 4ZEFA 3T9XB 3OEKA 5FHNA 3HPIA 2GHBA 4PFTA 3H03A 1GR2A 4P11A 3OELA 4G8NA 1MM7A 5I57A 2XXPA 2YLNA 4F3GA 3FXRA 3FVKA 3WAEA 4HCWA 5A5XA 2PYYA 1JW4A 4EF2A 1QULA 4E0XA 1FTJA 4JWYA 3ZSFA 1KWHA 4RPNA 2DE4A 2VHAA 4FE8A 3EHSA 4R2FA 4LQ5A 2QMXA 1B3EA 1LFIA 4QFNA 4YMAA 4NF6B 4F3BA 2F35A 3IJOB 3ILTB 2XXYA 4QHQA 1OLAA 2A5SA 4QFLA 3BFUA 2RC9A 5DEXB 3CRBA 5CMBA 1MQGA 1SQYA 1TXFA 4LVQA 1UTBB 4LP2B 4JBZA 1POTA 2O1LA 2OBGA 4XKRA 3C34A 4QFOA 3G3FA 3RY3A 3FGSA 4YZZA 3LUYA 2O69A 3D4GA 1MXWA 1H43A 1CE2A 1N7WA 4XKQA 1ZKBA 3RT6B 5BUUA 3RN8A 4ISUA 3IOUA 2FYIA 4IO2A 3FVGA 3M3KA 4MBPA 2B3FA 3K6VA 2DXYA 4NF5A 4F1YA 1FQBA 3G3IA 2Z8EA 2WKYA 3VDFA 2DWHA 5BWJA 1NL5A 3OMBA 1A54A 2XD2A 3T93B 2RC7A 1SI1A 4X9TA 3FUZA 3MVXA 4YMBA 2X26A 4LZ7A 4NE4A 3MPLA 1AIVA 1LCTA 1JETA 3CG3A 3L6HA 3DM0A 1URSA 2ZNUA 1QJMA 5I57B 4BDLA 1N7XA 3KJ7A 3RUMA 1SYIA 1RYOA 5DT6A 4KHZE 3BKIB 4ELOA 4PE5B 1EZOA 4QFPA 4F2QA 5A5XB 2VP1A 4I62A 1LAFE 1A8EA 1MH4A 4JDFA 4JWXA 4DXCA 2GFEA 2ONRA 4YB5A 4KQPA 1MS7A 4M1VA 2O68A 3MP8A 3TQWA 5CMCA 3Q28A 2XX9A 2XX7A 2UYEA 3L6GA 3WAFA 2OLBA 2Y7PA 2O84X 2F78A 4MH5A 3P7IA 3MP6A 4Q5TA 1A7LA 3FVOA 4RA1A 3CSBA 4H5FA 5H8NA 4WEDA 4TQUQ 4FAJA 4GFRA 4WKMA 4L17A 2H98A 1P1UA 2F7AA 1GTKA 4F1UA 4KYDA 3SESA 4H8IA 4FIMA 1MQHA 3K1NA 4GF8A 4ELQA 4GOTA 2CZLA 3K6WA 4RK9A 3VE1B 1N3XA 2A5TA 5ICTA 3TCHA 2GH9A 2DVZA 2XXVA 4GLIA 3K1PA 5TP9B 3IK6B 2OCUA 1RYXA 3O29A 4OYVA 1H45A 1SVXB 4KPTA 3RLFE 2DP8A 3KGCA 1EZPA 4MLQA 1IXIA 4YKIA 4OMBA 1YAEA 2HEUA 4EXLA 3MWBA 1B4ZA 3ILUB 1JQFA 1IIWA 2ZNTA 3ONMA 2UVIA 4IGTA 2Z22A 4ESXA 3BBRA 2ONKE 1YPNA 2DOJA 1MPBA 5HM4B 1Y1ZA 5L8DA 3OEMA 4QFKA 1B2HA 3FZVA 3G3JA 1XS5A 1PBQA 1F9BA 1LCFA 4IO5A 3KN8A 1PB7A 3K2DA 1ZU0A 4OERA 3TDJA 4OFJA 1MM6A 3O66A 3TUSA 4GXSB 3SEYA 4KD5A 3MVYA 4OEUA 4K3FA 3DP8A 4LA9A 2ZYKA 3MZBA 4RPOA 3IJXB 1MY2A 2M8CA 3MP1A 4JSOA 5B70A 1N76A 2OWSA 3KN7A 4ZEDA 2QSXA 3T66A 2HZLA 5H8NB 1OVTA 3T9HB 2V3QA 3R6UA 3M8UA 1IUDA 1Z7ME 4F22A 4POWA 1AL3A 1ANFA 1FQAA 1DPEA 1O64A 4JB7A 4POXA 4U1OA 2HXWA 2XXUA 4KFQA 1Y4CA 1LBBA 3HHGA 4M4GA 1BIYA 3TCFA 2I58A 1PEBA 4R6HA 1QUJA 3PPRA 3SEXA 4G68A 1I6AA 1Y4TA 3ZS6A 1DOTA 5ITPA 4NMYA 1JEUA 3H6UA 3U72A 1ZIUA 2DWAA 3SKPA 3G3GA 1AMFA 1B5IA 1S7YA 3CG1A 4IY5A 3C35A 1FQEA 3JYRA 5ITOA 4EF1A 4U21A 1OQHA 5DYHA 5JTYA 3S9LC 3FJ7A 1P1WA 1XVXA 1FQCA 1FQDA 3G3HA 2FNCA 2O51A 3VVFA 4ESWA 2D3IA 4X1BA 4RXLA 4YB6A 2F34A 1MQJA 4E0WA 4X1DA 2RINA 3IR1A 2XXIA 5CM6A 1OIBA 1N04A 4NF4A 4OENA 4OHNA 4PQJA 1B9JA 3ECRA 1GV8A 1ZJLA 3O28A 3MBPA 3MJNA 3BFTA 2UYFA 3KSXA 4YKPA 3Q25A 4GVOA 2KLFA 3T96B 4R75A 4IO6A 1IQ7A 1UQWA 3PUXE 2REJA 3B6WA 3KG2A 1MQDA 2NUVA 1M5FA 4O3BA 3U93A 1R9QA 3OSRA 5ELVA 3A3CA 3HSTA 3PUVE 4NEDA 3KOSA 4DDDA 5EHMA 3LC8A 3V5AA 1TFDA 1B7ZA 4YAHX 3TZAA 1LAGE 3H06B 2DVCA 2FA7A 1MPDA 1I69A 1B32A 5HPQA 3LBSA 5I2KB 3T22A 4JSDA 3TEPA 4GL8A 3LSXA 4IO3A 2HCAA 3E4RA 3PV0E 3U92A 3QUFA 1IITA 1Z7NE 2OZZA 3LSWA 3TAJA 4G68B 2AYSA 3SEUA 2DWJA 4DXUA 3T9VA 1QVSA 3C4MA 3H6TA 4TOZA 2PMSA 2ZYMA 5H8FA 3SEWA 2XX8A 1WODA 1M5EA 1Y3PA 3KOTA 2H99A 1H76A 3KJTA 5M2VA 2OK2A 3FXUA 1FTOA 5CC2A 1JVXA 3U94A 3O6GA 3UORA 2F7BA 1Y3NA 3TTMA 1M5DA 5JTYB 4MF3A 2QS2A 3IAZA 2H5YA 3RT8A 4MFIA 4U4SA 4R6KA 4ZS9A 5ICQA 3IO6A 4U1ZA 1B0HA 2H4IA 1PBPA 3LSLA 1XC1A 3VLVA 1MXXA 5AA2B 2Q2CA 4C0RA 4YU0A 3M3FA 3PUWE 4H1XA 2G93A 3Q27A 4NF4B 1NMUA 2OJTA 4Z7EA 1VFDA 2X7PA 1MH3A 5H8SA 2VD2A 4OETA 4ONYA 1D3KA 2F97A 1HSLA 3O6IA 1H44A 2VOZA 2HAVA 4I1DA 4NTLA 5I2NA 2PT1A 1NH8A 4GXAA 2Y7IA 3S9MC 4LZ8A 1M5CA 1ZBMA 2DXRA 1DSNA 4AB6A 1FTMA 4GIZA 4EXKA 5DTBA 4XKNA 4RK2A 2PBWA 3HHFA 4FJPA 4F1VA 3O97A 1MRPA 3QUJA 5I56A 3HO7A 2HQ0A 3VLWA 3FJMA 4H5GA 4GWOA 2Z8FA 1II5A 5AA1A 2UVJA 3C9HA 3TTNA 2IEEA 3K4UA 3RNNA 3PU5A 5KCJA 2RCAA 5AA4A 5FHMA 2I0BA 1O7TA 5EYFA 2ESNA 1VR5A 3F11A 2HFBA 5JEIA 3TTKA 4N6PA 5H8FB 4TLMB 3KSJA 3VVEA 3CSGA 3K6UA 1HSJA 2ALUA 4Q0CA 3A3UA 1FCKA 2F7CA 3KZGA 2Q8JA 4GQOA 1J1NA 3PGFA 2DS9A 4UACA 3E13X 4KYSA 1Y3QA 4EQ7A 4P0GA 1N84A 2XXRA 4XTCQ 3MPKA 1LB8A 3U8QA 5ISUA 1UIVA 2XXXA 4G8HA 4HW8A 3QYTA 3UP9A 3PPQA 3V8XB 3IL1B 3PMWA 1R6ZA 2R71A 4R74A 3MW0A 1TWYA 3V83A 1B5JA 3DP4A 3DELB 1DPPA 2VGQA 4IO4A 1USYE 1SD3A 2NOOA 3MVZA 4ELPA 3IOVA 1QKAA 3QK6A 4NF5B 2B3BA 1XVYA 3R7XA 1LLSA 5I2NB 2GHAA 3OD7A 3IB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H65 A;  4ZZA A;  4ZEI A;  1I6B A;  3OEN A;  3VFJ A;  4OEV A;  3B7D A;  5CMK A;  1FTK A;  1OQG A;  4BDO A;  1SW2 A;  1LGB C;  2R9J A;  4ZE8 A;  2ONS A;  2LAO A;  2Q89 A;  3PPO A;  4GL0 A;  3FV2 A;  1A55 A;  2H9B A;  1URD A;  3S9N C;  1TFA A;  1N3W A;  3TYH A;  1SDX A;  3THI A;  3PUZ E;  1ELJ A;  5KCJ B;  4X48 A;  4AQ4 A;  3LSF B;  4ZE9 A;  1SI0 A;  2O1M A;  2AL4 A;  1SYH A;  4KYE A;  4ZEB A;  4IB2 A;  3TTR A;  3OO8 A;  4OES A;  3MQ9 A;  1NNT A;  2H25 A;  1DTG A;  1US5 A;  3G7W A;  1MG1 A;  4EQ9 A;  4TLL B;  5LOM A;  5F1Q A;  5AE4 A;  1P1O A;  1URG A;  4KR5 A;  5I84 A;  3W9V A;  5TPA A;  4DE8 A;  3EHU A;  1UTH A;  1BLF A;  2O7U A;  3IOW A;  4DIG A;  1MY0 A;  4AB5 A;  2UVG A;  2AIX A;  3EPE A;  1NFT A;  3FJG A;  4C1U A;  4EQB A;  2NWJ A;  4RYA A;  1UIU A;  5KDT A;  5L9S A;  3FXQ A;  3QSL A;  4IGR A;  3A09 A;  1Q35 A;  1OVB A;  4FOR A;  2PX1 A;  4QF9 A;  4LZ5 A;  1OLC A;  1H3D A;  3HV1 A;  1O63 A;  3S9E A;  5KZT A;  2NVU B;  4G8M A;  2O6A A;  1NNK A;  5FTH A;  2W7Y A;  3RTW B;  2D5W A;  5AA2 D;  2A5T B;  4R9F A;  4NWD A;  4G2Z A;  1A40 A;  3IB2 A;  4F2O A;  2F6P A;  1MXY A;  3K1M A;  1B6H A;  5K2X A;  3IOR A;  3RTF B;  2E1S A;  3TTL A;  2O7I A;  2DE3 A;  2UVH A;  3M3L A;  4OZ9 A;  4PP0 A;  4QSC A;  2XXH A;  2D21 A;  2Q9T A;  4U4X A;  5JK4 A;  1WVJ A;  3MUQ A;  1B3L A;  2QS4 A;  1DTZ A;  2XHD A;  4ELR A;  4OFO A;  4OTE A;  4R6Y A;  1P1N A;  1LFG A;  4LQ2 A;  1MXV A;  1VE4 A;  4DCX A;  2G29 A;  1NNP A;  3KN3 A;  4QSE A;  3W15 C;  1P1Q A;  5DEX A;  3VV5 A;  3EN3 A;  4OFL A;  4N07 A;  1NNF A;  3IX1 A;  2P0S A;  4ECF A;  4R9G A;  4YIC A;  1FW0 A;  3MC2 A;  4KCC A;  4U22 A;  2I4C A;  1PB9 A;  4PFW A;  1Y20 A;  1B5H A;  1Q1K A;  2ZNS A;  4QRZ A;  4R2B A;  4RNS A;  4YKK A;  4MLV A;  1T0K A;  1AOV A;  2QJE A;  2ZYO A;  4F31 B;  3C32 A;  1LBC A;  1US4 A;  1B3G A;  2QMW A;  3C31 A;  3H3G A;  5HBC A;  4ZEK A;  1HSE A;  3E3K A;  4GRK A;  3GBB A;  1MDP 1;  4QSD A;  5CRY A;  5TU0 A;  3GZG A;  1MPC A;  3VVD A;  1QW0 A;  3JV9 A;  3IB1 A;  3ODB A;  2F8D A;  5KDT B;  4YB7 A;  5I58 A;  2P1S A;  3TQL A;  3EF7 A;  3K02 A;  3RQT A;  5IKB A;  3SER A;  4H6D A;  1DMB A;  4Z0I A;  3TEL A;  4Q8R A;  3UN6 A;  2Y7W A;  1ZLQ A;  3V89 B;  4P0I A;  5K2Y A;  1S50 A;  1LST A;  2F6G A;  3SET A;  1BKA A;  4XXU A;  2ANJ A;  4UA8 A;  2Q2A A;  1B52 A;  3E9X A;  3TOD A;  2Z8D A;  3H4Z A;  2ZXT A;  1BTJ A;  2RKM A;  3AXF A;  4I8C A;  1B51 A;  2ABH A;  1GVC A;  3KBR A;  4OQO A;  3CIJ A;  1JEV A;  2QL3 A;  4EUO A;  2F36 A;  3LR1 A;  2REG A;  4LON B;  3FVN A;  2PVU A;  4THI A;  1SW4 A;  3I3V A;  3B6T A;  3OO7 A;  3DP6 A;  4DLD A;  4IO7 A;  3HN0 A;  4BDN A;  3H6W A;  1NKX A;  4O3C A;  2I4B A;  4EDP A;  4H67 A;  1B05 A;  3KEI A;  4BLA A;  3R26 A;  3FV1 A;  3PD9 A;  3EQ1 A;  3UA8 A;  1ZTY A;  3PUY E;  1LFH A;  1A99 A;  3K01 A;  3FAS A;  3I5O A;  3EHT A;  4BDM A;  3HCQ A;  3OOA A;  3GLB A;  4RY1 A;  5CMM A;  2I3W A;  1B7H A;  5F7V A;  5TP9 A;  3D4C A;  3VLU A;  1Y1M A;  1A8F A;  3N5L A;  1AH5 A;  2V84 A;  2QS3 A;  1B1X A;  5I58 B;  2DE2 A;  2YJP A;  3IO4 A;  3N6T A;  2I49 A;  2HZK A;  4FEC A;  4R73 A;  1USY H;  3K6X A;  1IZ1 A;  1NH7 A;  1B46 A;  4PFY A;  3TPA A;  1FQF A;  1OMP A;  3MVW A;  2YPN A;  1PC3 A;  5J1D A;  3SEV A;  1JW1 A;  2V3T A;  3USD A;  4BDQ A;  1JW5 A;  2OWT A;  4FEB A;  1D9V A;  3O2A A;  3VXB A;  4OVJ A;  4HTG A;  1L5T A;  5IAI A;  1VSO A;  4NF8 A;  2DSF A;  2THI A;  5CBR A;  3FAT A;  4G77 A;  5H8Q A;  1Y9U A;  5CBS A;  1JVY A;  3OSQ A;  1VFE A;  2ZMB A;  2IA4 A;  1LB9 A;  3PPN A;  4H0W A;  2QRY A;  2V3U A;  1LAX A;  4YKJ A;  3RGY A;  3OO9 A;  3G3K A;  2B65 A;  5L9O A;  4G68 C;  3GXA A;  4LUB A;  1WDN A;  1XHY A;  3PMV A;  3CFL A;  4F39 A;  3K00 A;  3N94 A;  4R72 A;  1D4N A;  4F29 A;  1GGG A;  1CB6 A;  2UXA A;  4KCD A;  5DVF A;  1FTL A;  2NXO A;  1R1N A;  4DZ1 A;  1MQI A;  3OXN A;  3CVG A;  5H8H A;  3CI8 A;  5CI5 A;  2HAU A;  2DWI A;  1IXC A;  1MY3 A;  3Q26 A;  5DVI A;  2CMO A;  1IEJ A;  4RJZ A;  2Y7K A;  4JXI A;  1B4H A;  1YTV A;  2VD3 A;  3QXM A;  5L9M A;  3I6V A;  1SBP A;  1B3H A;  3UGW A;  1P99 A;  3UK4 A;  2I3V A;  4HS7 A;  1I6Q A;  1POY 1;  1MXU A;  4XKP A;  1N0T A;  5I59 A;  5I56 B;  3TMG A;  2RF1 A;  2F5X A;  3PD8 A;  3CFZ A;  1LAH E;  4BDR A;  4ZZE A;  3ZKL A;  3MAM A;  1YCJ A;  2RCB A;  3RPW A;  1QKB A;  3H7M A;  2RC8 A;  1IXG A;  2X7Q A;  5AA4 B;  3VXC A;  2GRV A;  3C36 A;  1ATG A;  4OWD A;  1B1H A;  3TKD A;  1MY4 A;  5DVJ A;  3N6U A;  2XD3 A;  4F3S A;  4PET A;  2DYX A;  5FTI A;  4KI0 E;  3FD3 A;  4NF8 B;  4F19 A;  4OXV A;  2QPQ A;  3C33 A;  3FIR A;  1ZMG A;  4NWC A;  4F3P A;  3T9U A;  1S9T A;  5H8Q B;  3DLN A;  2P2A A;  2QS1 A;  5FHO A;  3B6Q A;  3O9P A;  4XIG Q;  3QIM A;  4O3A A;  3S4U A;  4H8J A;  1XOC A;  4ND9 A;  2ZYN A;  3N26 A;  1EU8 A;  3CR9 A;  2XXW A;  1R9L A;  4DCY A;  2R6G E;  4GD5 A;  4FED A;  1RKM A;  5EHS A;  1MXZ A;  2Y7R A;  3CFX A;  4U23 A;  1PDA A;  3QAX A;  3SDF A;  2DQV A;  4JWO A;  4ZEC A;  2Q88 A;  3MZ1 A;  2Z23 A;  5I2K A;  2XXQ A;  1B3F A;  1QUK A;  1PB8 A;  5H8H B;  3MZ9 A;  1JNF A;  3H6V A;  2XXT A;  2I6E A;  3O6H A;  3KFM A;  3ZKK A;  4IY6 A;  4C1T A;  2PT2 A;  4Q30 B;  5AA3 A;  4FAT A;  1B7U A;  1D9Y A;  4NF6 A;  3GBA A;  1BP5 A;  4WXJ A;  3TFL A;  5I59 B;  2BJJ X;  3K0V A;  3PMX A;  3PPP A;  4ZDM A;  3JZJ A;  1MDQ A;  4DXB A;  4I9D A;  2V93 A;  4U2R A;  1UTB A;  5B7D A;  1IXH A;  3U1O A;  1XT8 A;  3UIF A;  3TCG A;  1SW1 A;  5AA2 A;  3OO6 A;  1MY1 A;  1EH3 A;  1TT1 A;  4N13 A;  2I48 A;  2I0C A;  2AL5 A;  5TPA B;  1UTH B;  1SW5 A;  2E0S A;  2Y84 A;  4HCY A;  4LAT A;  3W9W A;  4WEP A;  1B0L A;  4PFU A;  4G4P A;  1QUI A;  1M5B A;  1EZ9 A;  2V25 A;  3Q29 A;  1B40 A;  3S2V A;  3IOT A;  1B58 A;  4F18 A;  4ZEF A;  3T9X B;  3OEK A;  5FHN A;  3HPI A;  2GHB A;  4PFT A;  3H03 A;  1GR2 A;  4P11 A;  3OEL A;  4G8N A;  1MM7 A;  5I57 A;  2XXP A;  2YLN A;  4F3G A;  3FXR A;  3FVK A;  3WAE A;  4HCW A;  5A5X A;  2PYY A;  1JW4 A;  4EF2 A;  1QUL A;  4E0X A;  1FTJ A;  4JWY A;  3ZSF A;  1KWH A;  4RPN A;  2DE4 A;  2VHA A;  4FE8 A;  3EHS A;  4R2F A;  4LQ5 A;  2QMX A;  1B3E A;  1LFI A;  4QFN A;  4YMA A;  4NF6 B;  4F3B A;  2F35 A;  3IJO B;  3ILT B;  2XXY A;  4QHQ A;  1OLA A;  2A5S A;  4QFL A;  3BFU A;  2RC9 A;  5DEX B;  3CRB A;  5CMB A;  1MQG A;  1SQY A;  1TXF A;  4LVQ A;  1UTB B;  4LP2 B;  4JBZ A;  1POT A;  2O1L A;  2OBG A;  4XKR A;  3C34 A;  4QFO A;  3G3F A;  3RY3 A;  3FGS A;  4YZZ A;  3LUY A;  2O69 A;  3D4G A;  1MXW A;  1H43 A;  1CE2 A;  1N7W A;  4XKQ A;  1ZKB A;  3RT6 B;  5BUU A;  3RN8 A;  4ISU A;  3IOU A;  2FYI A;  4IO2 A;  3FVG A;  3M3K A;  4MBP A;  2B3F A;  3K6V A;  2DXY A;  4NF5 A;  4F1Y A;  1FQB A;  3G3I A;  2Z8E A;  2WKY A;  3VDF A;  2DWH A;  5BWJ A;  1NL5 A;  3OMB A;  1A54 A;  2XD2 A;  3T93 B;  2RC7 A;  1SI1 A;  4X9T A;  3FUZ A;  3MVX A;  4YMB A;  2X26 A;  4LZ7 A;  4NE4 A;  3MPL A;  1AIV A;  1LCT A;  1JET A;  3CG3 A;  3L6H A;  3DM0 A;  1URS A;  2ZNU A;  1QJM A;  5I57 B;  4BDL A;  1N7X A;  3KJ7 A;  3RUM A;  1SYI A;  1RYO A;  5DT6 A;  4KHZ E;  3BKI B;  4ELO A;  4PE5 B;  1EZO A;  4QFP A;  4F2Q A;  5A5X B;  2VP1 A;  4I62 A;  1LAF E;  1A8E A;  1MH4 A;  4JDF A;  4JWX A;  4DXC A;  2GFE A;  2ONR A;  4YB5 A;  4KQP A;  1MS7 A;  4M1V A;  2O68 A;  3MP8 A;  3TQW A;  5CMC A;  3Q28 A;  2XX9 A;  2XX7 A;  2UYE A;  3L6G A;  3WAF A;  2OLB A;  2Y7P A;  2O84 X;  2F78 A;  4MH5 A;  3P7I A;  3MP6 A;  4Q5T A;  1A7L A;  3FVO A;  4RA1 A;  3CSB A;  4H5F A;  5H8N A;  4WED A;  4TQU Q;  4FAJ A;  4GFR A;  4WKM A;  4L17 A;  2H98 A;  1P1U A;  2F7A A;  1GTK A;  4F1U A;  4KYD A;  3SES A;  4H8I A;  4FIM A;  1MQH A;  3K1N A;  4GF8 A;  4ELQ A;  4GOT A;  2CZL A;  3K6W A;  4RK9 A;  3VE1 B;  1N3X A;  2A5T A;  5ICT A;  3TCH A;  2GH9 A;  2DVZ A;  2XXV A;  4GLI A;  3K1P A;  5TP9 B;  3IK6 B;  2OCU A;  1RYX A;  3O29 A;  4OYV A;  1H45 A;  1SVX B;  4KPT A;  3RLF E;  2DP8 A;  3KGC A;  1EZP A;  4MLQ A;  1IXI A;  4YKI A;  4OMB A;  1YAE A;  2HEU A;  4EXL A;  3MWB A;  1B4Z A;  3ILU B;  1JQF A;  1IIW A;  2ZNT A;  3ONM A;  2UVI A;  4IGT A;  2Z22 A;  4ESX A;  3BBR A;  2ONK E;  1YPN A;  2DOJ A;  1MPB A;  5HM4 B;  1Y1Z A;  5L8D A;  3OEM A;  4QFK A;  1B2H A;  3FZV A;  3G3J A;  1XS5 A;  1PBQ A;  1F9B A;  1LCF A;  4IO5 A;  3KN8 A;  1PB7 A;  3K2D A;  1ZU0 A;  4OER A;  3TDJ A;  4OFJ A;  1MM6 A;  3O66 A;  3TUS A;  4GXS B;  3SEY A;  4KD5 A;  3MVY A;  4OEU A;  4K3F A;  3DP8 A;  4LA9 A;  2ZYK A;  3MZB A;  4RPO A;  3IJX B;  1MY2 A;  2M8C A;  3MP1 A;  4JSO A;  5B70 A;  1N76 A;  2OWS A;  3KN7 A;  4ZED A;  2QSX A;  3T66 A;  2HZL A;  5H8N B;  1OVT A;  3T9H B;  2V3Q A;  3R6U A;  3M8U A;  1IUD A;  1Z7M E;  4F22 A;  4POW A;  1AL3 A;  1ANF A;  1FQA A;  1DPE A;  1O64 A;  4JB7 A;  4POX A;  4U1O A;  2HXW A;  2XXU A;  4KFQ A;  1Y4C A;  1LBB A;  3HHG A;  4M4G A;  1BIY A;  3TCF A;  2I58 A;  1PEB A;  4R6H A;  1QUJ A;  3PPR A;  3SEX A;  4G68 A;  1I6A A;  1Y4T A;  3ZS6 A;  1DOT A;  5ITP A;  4NMY A;  1JEU A;  3H6U A;  3U72 A;  1ZIU A;  2DWA A;  3SKP A;  3G3G A;  1AMF A;  1B5I A;  1S7Y A;  3CG1 A;  4IY5 A;  3C35 A;  1FQE A;  3JYR A;  5ITO A;  4EF1 A;  4U21 A;  1OQH A;  5DYH A;  5JTY A;  3S9L C;  3FJ7 A;  1P1W A;  1XVX A;  1FQC A;  1FQD A;  3G3H A;  2FNC A;  2O51 A;  3VVF A;  4ESW A;  2D3I A;  4X1B A;  4RXL A;  4YB6 A;  2F34 A;  1MQJ A;  4E0W A;  4X1D A;  2RIN A;  3IR1 A;  2XXI A;  5CM6 A;  1OIB A;  1N04 A;  4NF4 A;  4OEN A;  4OHN A;  4PQJ A;  1B9J A;  3ECR A;  1GV8 A;  1ZJL A;  3O28 A;  3MBP A;  3MJN A;  3BFT A;  2UYF A;  3KSX A;  4YKP A;  3Q25 A;  4GVO A;  2KLF A;  3T96 B;  4R75 A;  4IO6 A;  1IQ7 A;  1UQW A;  3PUX E;  2REJ A;  3B6W A;  3KG2 A;  1MQD A;  2NUV A;  1M5F A;  4O3B A;  3U93 A;  1R9Q A;  3OSR A;  5ELV A;  3A3C A;  3HST A;  3PUV E;  4NED A;  3KOS A;  4DDD A;  5EHM A;  3LC8 A;  3V5A A;  1TFD A;  1B7Z A;  4YAH X;  3TZA A;  1LAG E;  3H06 B;  2DVC A;  2FA7 A;  1MPD A;  1I69 A;  1B32 A;  5HPQ A;  3LBS A;  5I2K B;  3T22 A;  4JSD A;  3TEP A;  4GL8 A;  3LSX A;  4IO3 A;  2HCA A;  3E4R A;  3PV0 E;  3U92 A;  3QUF A;  1IIT A;  1Z7N E;  2OZZ A;  3LSW A;  3TAJ A;  4G68 B;  2AYS A;  3SEU A;  2DWJ A;  4DXU A;  3T9V A;  1QVS A;  3C4M A;  3H6T A;  4TOZ A;  2PMS A;  2ZYM A;  5H8F A;  3SEW A;  2XX8 A;  1WOD A;  1M5E A;  1Y3P A;  3KOT A;  2H99 A;  1H76 A;  3KJT A;  5M2V A;  2OK2 A;  3FXU A;  1FTO A;  5CC2 A;  1JVX A;  3U94 A;  3O6G A;  3UOR A;  2F7B A;  1Y3N A;  3TTM A;  1M5D A;  5JTY B;  4MF3 A;  2QS2 A;  3IAZ A;  2H5Y A;  3RT8 A;  4MFI A;  4U4S A;  4R6K A;  4ZS9 A;  5ICQ A;  3IO6 A;  4U1Z A;  1B0H A;  2H4I A;  1PBP A;  3LSL A;  1XC1 A;  3VLV A;  1MXX A;  5AA2 B;  2Q2C A;  4C0R A;  4YU0 A;  3M3F A;  3PUW E;  4H1X A;  2G93 A;  3Q27 A;  4NF4 B;  1NMU A;  2OJT A;  4Z7E A;  1VFD A;  2X7P A;  1MH3 A;  5H8S A;  2VD2 A;  4OET A;  4ONY A;  1D3K A;  2F97 A;  1HSL A;  3O6I A;  1H44 A;  2VOZ A;  2HAV A;  4I1D A;  4NTL A;  5I2N A;  2PT1 A;  1NH8 A;  4GXA A;  2Y7I A;  3S9M C;  4LZ8 A;  1M5C A;  1ZBM A;  2DXR A;  1DSN A;  4AB6 A;  1FTM A;  4GIZ A;  4EXK A;  5DTB A;  4XKN A;  4RK2 A;  2PBW A;  3HHF A;  4FJP A;  4F1V A;  3O97 A;  1MRP A;  3QUJ A;  5I56 A;  3HO7 A;  2HQ0 A;  3VLW A;  3FJM A;  4H5G A;  4GWO A;  2Z8F A;  1II5 A;  5AA1 A;  2UVJ A;  3C9H A;  3TTN A;  2IEE A;  3K4U A;  3RNN A;  3PU5 A;  5KCJ A;  2RCA A;  5AA4 A;  5FHM A;  2I0B A;  1O7T A;  5EYF A;  2ESN A;  1VR5 A;  3F11 A;  2HFB A;  5JEI A;  3TTK A;  4N6P A;  5H8F B;  4TLM B;  3KSJ A;  3VVE A;  3CSG A;  3K6U A;  1HSJ A;  2ALU A;  4Q0C A;  3A3U A;  1FCK A;  2F7C A;  3KZG A;  2Q8J A;  4GQO A;  1J1N A;  3PGF A;  2DS9 A;  4UAC A;  3E13 X;  4KYS A;  1Y3Q A;  4EQ7 A;  4P0G A;  1N84 A;  2XXR A;  4XTC Q;  3MPK A;  1LB8 A;  3U8Q A;  5ISU A;  1UIV A;  2XXX A;  4G8H A;  4HW8 A;  3QYT A;  3UP9 A;  3PPQ A;  3V8X B;  3IL1 B;  3PMW A;  1R6Z A;  2R71 A;  4R74 A;  3MW0 A;  1TWY A;  3V83 A;  1B5J A;  3DP4 A;  3DEL B;  1DPP A;  2VGQ A;  4IO4 A;  1USY E;  1SD3 A;  2NOO A;  3MVZ A;  4ELP A;  3IOV A;  1QKA A;  3QK6 A;  4NF5 B;  2B3B A;  1XVY A;  3R7X A;  1LLS A;  5I2N B;  2GHA A;  3OD7 A;  3IB0 A; 
#chains in the Genus database with same CATH topology
 4H65 A;  4ZZA A;  4ZEI A;  1I6B A;  3OEN A;  2P3N A;  3VFJ A;  4MNC A;  3B7D A;  4OEV A;  5ESY A;  5CMK A;  1FTK A;  1OQG A;  2R8T A;  4BDO A;  4MIJ A;  1SW2 A;  1LGB C;  2R9J A;  4ZE8 A;  2ONS A;  2LAO A;  2Q89 A;  3PPO A;  1NUW A;  4GL0 A;  3FV2 A;  4I3E A;  3EKI A;  1A55 A;  2H9B A;  1URD A;  3S9N C;  1TFA A;  1N3W A;  3TYH A;  4N81 A;  1SDX A;  5T3J A;  4P1E A;  3THI A;  3PUZ E;  1ELJ A;  2CZI A;  5KCJ B;  4X48 A;  4AQ4 A;  3LSF B;  4ZE9 A;  2PCR A;  1SI0 A;  2O1M A;  1NUZ A;  2AL4 A;  2ZZV A;  1NV4 A;  1SYH A;  4KYE A;  4ZEB A;  4IB2 A;  3TTR A;  3OO8 A;  4OES A;  3MQ9 A;  1NNT A;  2FVZ A;  2H25 A;  1DTG A;  1US5 A;  3G7W A;  1MG1 A;  4PAF A;  4EQ9 A;  4TLL B;  5LOM A;  5F1Q A;  5AE4 A;  1P1O A;  1URG A;  4KR5 A;  5I84 A;  3W9V A;  5TPA A;  4DE8 A;  3EHU A;  1UTH A;  1BLF A;  2V4C A;  4XEQ A;  4PFB A;  2O7U A;  3IOW A;  1RDY A;  4DIG A;  1MY0 A;  4AB5 A;  2UVG A;  1RDZ A;  2AIX A;  2VPN A;  3EPE A;  1NFT A;  3FJG A;  2HXR A;  4C1U A;  4EQB A;  2NWJ A;  4RYA A;  1UIU A;  3T1B A;  5KDT A;  2Y5K A;  5L9S A;  2VT5 A;  3FXQ A;  3QSL A;  2Y5L A;  4IGR A;  3A09 A;  1Q35 A;  1OVB A;  4FOR A;  2PX1 A;  4QF9 A;  1NV2 A;  3MST A;  2CZK A;  4LZ5 A;  1OLC A;  1H3D A;  3HV1 A;  1O63 A;  3E78 A;  3S9E A;  5KZT A;  2NVU B;  4G8M A;  2O6A A;  1NNK A;  5FTH A;  2W7Y A;  3RTW B;  2D5W A;  5AA2 D;  2A5T B;  4R9F A;  4NWD A;  4G2Z A;  1A40 A;  3IB2 A;  4F2O A;  4GX6 A;  2F6P A;  5IZ3 B;  1MXY A;  3K1M A;  4IR8 A;  1B6H A;  1FPG A;  5K2X A;  3IOR A;  3RTF B;  2E1S A;  3TTL A;  2O7I A;  2DE3 A;  2UVH A;  3M3L A;  4HE2 A;  4OZ9 A;  4PP0 A;  3KC0 A;  1DCU A;  1FBG A;  4QSC A;  2XXH A;  2D21 A;  2Q9T A;  4U4X A;  5JK4 A;  1WVJ A;  4GWX A;  3MUQ A;  1B3L A;  2QS4 A;  1DTZ A;  2XHD A;  4ELR A;  4OFO A;  2L5V A;  4OTE A;  4R6Y A;  1P1N A;  1LFG A;  3RPL A;  4DI3 D;  4LQ2 A;  1MXV A;  1VE4 A;  4DCX A;  2G29 A;  1NNP A;  1XI6 A;  3KN3 A;  4QSE A;  3W15 C;  1P1Q A;  5DEX A;  3VV5 A;  3EN3 A;  4OFL A;  4N07 A;  1NNF A;  3IX1 A;  2P0S A;  4ECF A;  4R9G A;  4YIC A;  1FW0 A;  3MC2 A;  4KCC A;  4U22 A;  2I4C A;  1PB9 A;  4PFW A;  1Y20 A;  1B5H A;  2OWZ A;  1Q1K A;  2ZNS A;  4R2B A;  3ISP A;  4QRZ A;  4RNS A;  4YKK A;  4MLV A;  1T0K A;  3E79 A;  2B4M A;  1KA1 A;  1AOV A;  2CEY A;  2QJE A;  2ZYO A;  1YZ0 A;  5EQA A;  4F31 B;  3C32 A;  1LBC A;  5EYG A;  1US4 A;  1B3G A;  2QMW A;  1FRP A;  3C31 A;  3H3G A;  5HBC A;  4ZEK A;  1HSE A;  3E3K A;  4GRK A;  3GBB A;  1MDP 1;  4I3Y A;  4QSD A;  5CRY A;  5TU0 A;  3GZG A;  1MPC A;  3VVD A;  1QW0 A;  3JV9 A;  3IB1 A;  3ODB A;  2F8D A;  1FSA A;  5KDT B;  4X8R A;  4YB7 A;  5I58 A;  2P1S A;  3TQL A;  3ROJ A;  3SZP A;  3EF7 A;  3K02 A;  3RQT A;  5IKB A;  3SER A;  4H6D A;  1DMB A;  4Z0I A;  3TEL A;  4Q8R A;  3UN6 A;  2Y7W A;  1ZLQ A;  3V89 B;  4P0I A;  4GBV A;  5K2Y A;  1S50 A;  1LST A;  2F6G A;  3SET A;  1BKA A;  4XXU A;  2ANJ A;  4UA8 A;  2FBP A;  2Q2A A;  1B52 A;  3E9X A;  3TOD A;  4GWS A;  5EQ8 A;  2GQ1 A;  4MNI A;  2Z8D A;  3H4Z A;  1FTA A;  2ZXT A;  1BTJ A;  4O8M A;  4P9K A;  2RKM A;  3FBP A;  3AXF A;  4I8C A;  1B51 A;  2ABH A;  1GVC A;  3KBR A;  4OQO A;  3CIJ A;  1RDX A;  1JEV A;  3LUZ A;  5ET5 A;  2QL3 A;  2XXK A;  4EUO A;  2WEF A;  2F36 A;  3LR1 A;  2REG A;  4LON B;  3FVN A;  2PVU A;  3LV0 A;  4THI A;  1SW4 A;  3I3V A;  3B6T A;  3OO7 A;  4NG7 A;  3DP6 A;  2MKZ A;  4DLD A;  4IO7 A;  3HN0 A;  4BDN A;  3H6W A;  1NKX A;  4O3C A;  2I4B A;  4EDP A;  4PC9 A;  2XWK A;  4H67 A;  1B05 A;  3KEI A;  4BLA A;  3R26 A;  3FV1 A;  3PD9 A;  3EQ1 A;  4GWU A;  3UA8 A;  1ZTY A;  3PUY E;  1LFH A;  1A99 A;  3K01 A;  3FAS A;  3I5O A;  3EHT A;  4BDM A;  3HCQ A;  3OOA A;  3GLB A;  4RY1 A;  5CMM A;  5IGA A;  2I3W A;  1B7H A;  5F7V A;  5TP9 A;  3D4C A;  3VLU A;  1K9Y A;  1Y1M A;  1A8F A;  3N5L A;  2CZH A;  4PE3 A;  1AH5 A;  1IMF A;  2FIX A;  2V84 A;  2QS3 A;  3GYY A;  1B1X A;  5I58 B;  2DE2 A;  2YJP A;  3IO4 A;  1FBD A;  3N6T A;  2I49 A;  1LBW A;  2HZK A;  4FEC A;  4R73 A;  1USY H;  3K6X A;  4AS4 A;  1IZ1 A;  1NI9 A;  1NH7 A;  1B46 A;  4PFY A;  3TPA A;  1FQF A;  1OMP A;  3MVW A;  2HPG A;  2YPN A;  1PC3 A;  5J1D A;  3SEV A;  1JW1 A;  2V3T A;  3USD A;  4BDQ A;  1JW5 A;  2OWT A;  4FEB A;  1D9V A;  3O2A A;  5I3S A;  4OVJ A;  3VXB A;  4HTG A;  1L5T A;  4MCO A;  5IAI A;  1VSO A;  4NF8 A;  2DSF A;  2THI A;  5CBR A;  3FAT A;  4G77 A;  3NOH A;  5H8Q A;  1Y9U A;  2KQZ A;  5CBS A;  1JVY A;  3OSQ A;  4OVQ A;  1VFE A;  2ZMB A;  2IA4 A;  1LB9 A;  3PPN A;  4H0W A;  2QRY A;  2V3U A;  1LAX A;  4YKJ A;  3RGY A;  3OO9 A;  3G3K A;  2B65 A;  4JVI A;  4N91 A;  5L9O A;  4G68 C;  3GXA A;  4LUB A;  1WDN A;  1DK4 A;  1XHY A;  3PMV A;  3CFL A;  4F39 A;  3A29 A;  3K00 A;  3N94 A;  4R72 A;  1D4N A;  4F29 A;  1GGG A;  1CB6 A;  2UXA A;  4KCD A;  4NX1 A;  5DVF A;  1FTL A;  2NXO A;  1R1N A;  4DZ1 A;  1MQI A;  3OXN A;  3CVG A;  5H8H A;  1Q9D A;  3CI8 A;  5CI5 A;  2HAU A;  2DWI A;  5I7I A;  1IXC A;  1MY3 A;  4QXD A;  3Q26 A;  5DVI A;  4P56 A;  2CMO A;  1IEJ A;  4RJZ A;  2Y7K A;  4JXI A;  1B4H A;  1YTV A;  2VD3 A;  3QXM A;  1FPI A;  5L9M A;  3I6V A;  4O94 A;  1SBP A;  1B3H A;  3UGW A;  1P99 A;  3UK4 A;  2I3V A;  4HS7 A;  1I6Q A;  1POY 1;  1MXU A;  1N0T A;  4XKP A;  5I59 A;  5I56 B;  3TMG A;  2RF1 A;  5EQ7 A;  2F5X A;  3PD8 A;  3CFZ A;  1LAH E;  4BDR A;  4ZZE A;  3ZKL A;  3MAM A;  1YCJ A;  2RCB A;  3RPW A;  1QKB A;  3H7M A;  2RC8 A;  4PFI A;  1IXG A;  2X7Q A;  3RYD A;  5AA4 B;  3MYU A;  3VXC A;  5ET6 A;  1YYZ A;  2GRV A;  3C36 A;  1ATG A;  4OWD A;  1B1H A;  3TKD A;  4N15 A;  1MY4 A;  5DVJ A;  3N6U A;  2XD3 A;  4AS5 A;  4F3S A;  5IZZ A;  4PET A;  2DYX A;  5FTI A;  1IMD A;  4KI0 E;  1NV1 A;  3FD3 A;  4NF8 B;  4F19 A;  4OXV A;  1FPL A;  2QPQ A;  3C33 A;  3FIR A;  1ZMG A;  4NWC A;  4F3P A;  3T9U A;  1S9T A;  5H8Q B;  3DLN A;  2P2A A;  2QS1 A;  4PGN A;  5FHO A;  3B6Q A;  3O9P A;  4XIG Q;  2Q8M A;  3QIM A;  2VPO A;  4O3A A;  3S4U A;  5IM2 A;  4H8J A;  1LBV A;  4OVT A;  1XOC A;  4ND9 A;  2ZYN A;  3N26 A;  1EU8 A;  3CR9 A;  2XXW A;  1R9L A;  4JVC A;  4DCY A;  2R6G E;  4GD5 A;  4FED A;  1RKM A;  5EHS A;  1MXZ A;  2Y7R A;  2ZZW A;  3CFX A;  4U23 A;  1PDA A;  3QAX A;  1SPI A;  3SDF A;  2DQV A;  4JWO A;  4ZEC A;  2Q88 A;  3MZ1 A;  3IFA A;  2Z23 A;  5I2K A;  2XXQ A;  2JJK A;  1NV5 A;  1B3F A;  1QUK A;  1PB8 A;  4N4U A;  1EYJ A;  5H8H B;  3MZ9 A;  1JNF A;  3H6V A;  2XXT A;  2I6E A;  3O6H A;  3KFM A;  3ZKK A;  2FHY A;  4IY6 A;  4C1T A;  2PT2 A;  4Q30 B;  5AA3 A;  4FAT A;  1B7U A;  1BK4 A;  1D9Y A;  4PCD A;  4NF6 A;  4XFE A;  1FBC A;  3GBA A;  1BP5 A;  4WXJ A;  3TFL A;  5I59 B;  2BJJ X;  4H45 A;  3K0V A;  3HFU A;  3PMX A;  3PPP A;  4ZDM A;  3JZJ A;  1MDQ A;  4DXB A;  5I5P A;  4I9D A;  2V93 A;  4U2R A;  1UTB A;  1VDW A;  2QVV A;  2Q74 A;  5B7D A;  1IXH A;  1IMA A;  3IFC A;  1XT8 A;  3U1O A;  3UIF A;  3TCG A;  1SW1 A;  5AA2 A;  3OO6 A;  1MY1 A;  1EH3 A;  1TT1 A;  4N13 A;  2I48 A;  3D1R A;  2I0C A;  2AL5 A;  5TPA B;  1UTH B;  4LN5 A;  1SW5 A;  2E0S A;  2Y84 A;  4HCY A;  4LAT A;  1LBY A;  3W9W A;  4WEP A;  4PAK A;  1B0L A;  1FPB A;  3BIG A;  4PFU A;  4G4P A;  4N6K A;  1QUI A;  3KBZ A;  1M5B A;  4MMP A;  1EZ9 A;  2V25 A;  4X04 A;  4PF8 A;  3Q29 A;  1B40 A;  3S2V A;  3IOT A;  1B58 A;  4F18 A;  4PFR A;  4ZEF A;  1LBZ A;  3T9X B;  3OEK A;  5FHN A;  3HPI A;  2GHB A;  4PFT A;  3H03 A;  1GR2 A;  4P11 A;  3OEL A;  4O7I A;  4G8N A;  1MM7 A;  5I57 A;  4P3L A;  2XXP A;  4NN3 A;  2YLN A;  4F3G A;  2KR0 A;  3FXR A;  3FVK A;  3WAE A;  4HCW A;  5A5X A;  2PYY A;  1JW4 A;  4EF2 A;  1QUL A;  4E0X A;  4N8G A;  1FTJ A;  4JWY A;  3ZSF A;  1KWH A;  4RPN A;  2DE4 A;  2VHA A;  4FE8 A;  3EHS A;  4R2F A;  4LQ5 A;  2QMX A;  1B3E A;  4PBQ A;  1LBX A;  1LFI A;  4QFN A;  4YMA A;  4NF6 B;  4F3B A;  2F35 A;  3IJO B;  3ILT B;  2XXY A;  4QHQ A;  3RPL B;  1OLA A;  2A5S A;  4QFL A;  3BFU A;  2RC9 A;  5DEX B;  3CRB A;  5CMB A;  1LEV A;  1MQG A;  1SQY A;  1TXF A;  4LVQ A;  4FBP A;  1UTB B;  3B8B A;  2XA5 A;  4LP2 B;  4JBZ A;  2OX3 A;  1POT A;  3KC1 A;  2O1L A;  2OBG A;  4XKR A;  3C34 A;  4QFO A;  3G3F A;  3RY3 A;  2WX9 A;  3FGS A;  4YZZ A;  3LUY A;  2O69 A;  3D4G A;  1MXW A;  1H43 A;  4NGU A;  1CE2 A;  1N7W A;  4XKQ A;  3CHG A;  1ZKB A;  3RT6 B;  5BUU A;  3RN8 A;  4ISU A;  3IOU A;  4GX4 A;  2FYI A;  4IO2 A;  4OAN A;  3FVG A;  3M3K A;  4MBP A;  2B3F A;  3K6V A;  2DXY A;  4NF5 A;  3PTY A;  4F1Y A;  3U65 A;  1FQB A;  3G3I A;  2Z8E A;  1NV6 A;  2WKY A;  3VDF A;  2DWH A;  5BWJ A;  1NL5 A;  3OMB A;  1A54 A;  2XD2 A;  3T93 B;  2RC7 A;  1SI1 A;  4X9T A;  1FPJ A;  3FUZ A;  3MVX A;  4YMB A;  2X26 A;  5ET8 A;  4LZ7 A;  4NE4 A;  3MPL A;  1AIV A;  1LCT A;  4UAB A;  1JET A;  4OVS A;  5ET7 A;  3CG3 A;  3L6H A;  3DM0 A;  1URS A;  2ZNU A;  1QJM A;  5I57 B;  4BDL A;  1N7X A;  3KJ7 A;  3RUM A;  1SYI A;  1RYO A;  1AWB A;  5DT6 A;  4KHZ E;  3BKI B;  4ELO A;  4PE5 B;  1EZO A;  4QFP A;  4F2Q A;  5A5X B;  2VP1 A;  4N6D A;  1FJ6 A;  4I62 A;  2F3D A;  1LAF E;  2DDK A;  2XWI A;  1A8E A;  1MH4 A;  4JDF A;  4JWX A;  4DXC A;  2GFE A;  2ONR A;  4YB5 A;  1NV0 A;  4KQP A;  1MS7 A;  4M1V A;  2O68 A;  3MP8 A;  3TQW A;  5CMC A;  3Q28 A;  4QBA A;  2XX9 A;  2XX7 A;  2UYE A;  3L6G A;  2B4L A;  3WAF A;  2OLB A;  1QGX A;  2Y7P A;  2O84 X;  1DBZ A;  2F78 A;  4MH5 A;  3P7I A;  3MP6 A;  4Q5T A;  1A7L A;  3FVO A;  4RA1 A;  3CSB A;  4H5F A;  5H8N A;  4WED A;  4TQU Q;  4FAJ A;  4GFR A;  4WKM A;  4L17 A;  2H98 A;  3T0J A;  1P1U A;  2F7A A;  1GTK A;  4F1U A;  4KYD A;  3SES A;  4H8I A;  4FIM A;  1MQH A;  3K1N A;  4GF8 A;  2QFL A;  4ELQ A;  4GOT A;  2CZL A;  3K6W A;  4RK9 A;  4I40 A;  3VE1 B;  1N3X A;  2A5T A;  5ICT A;  3TCH A;  4PBH A;  2GH9 A;  2DVZ A;  2XXV A;  4GLI A;  3K1P A;  5IZ3 A;  5TP9 B;  3IK6 B;  2OCU A;  1RYX A;  3O29 A;  4OYV A;  1H45 A;  1SVX B;  4KPT A;  3RLF E;  2DP8 A;  3KGC A;  1EZP A;  4MLQ A;  1IXI A;  2PFZ A;  4YKI A;  4OMB A;  1YAE A;  2HEU A;  4EXL A;  3MWB A;  1NUY A;  1B4Z A;  3ILU B;  1JQF A;  1IIW A;  2ZNT A;  3ONM A;  2UVI A;  4IGT A;  2Z22 A;  4ESX A;  3BBR A;  2ONK E;  1YPN A;  2DOJ A;  1MPB A;  5HM4 B;  1Y1Z A;  5L8D A;  3OEM A;  4QFK A;  1B2H A;  1CNQ A;  3FZV A;  3G3J A;  1XS5 A;  1PBQ A;  1F9B A;  1LCF A;  4IO5 A;  3KN8 A;  1PB7 A;  3K2D A;  1ZU0 A;  4OER A;  3TDJ A;  4OFJ A;  1MM6 A;  3O66 A;  3TUS A;  1FPE A;  4GXS B;  3SEY A;  2PFY A;  4KD5 A;  1EYI A;  3MVY A;  4OEU A;  4K3F A;  3DP8 A;  2HHM A;  1EYK A;  4LA9 A;  2ZYK A;  3MZB A;  4RPO A;  3IJX B;  1MY2 A;  2M8C A;  3MP1 A;  4JSO A;  5B70 A;  5LTC A;  1N76 A;  2OWS A;  3KN7 A;  4ZED A;  2QSX A;  3T66 A;  1FPK A;  2HZL A;  5H8N B;  1OVT A;  3T9H B;  2V3Q A;  3R6U A;  4P8B A;  3M8U A;  1IUD A;  1Z7M E;  4F22 A;  4POW A;  1AL3 A;  1ANF A;  2P3V A;  1FQA A;  1O64 A;  1DPE A;  4JB7 A;  4POX A;  4U1O A;  2HXW A;  2XXU A;  4KFQ A;  1Y4C A;  1LBB A;  3HHG A;  1FJ9 A;  4M4G A;  1BIY A;  3TCF A;  2I58 A;  1PEB A;  1D9Q A;  4R6H A;  2QVU A;  1QUJ A;  3PPR A;  3SEX A;  4G68 A;  1I6A A;  1Y4T A;  3ZS6 A;  1DOT A;  5ITP A;  1FBP A;  4NMY A;  1JEU A;  1FPF A;  3H6U A;  3U72 A;  1ZIU A;  2DWA A;  3SKP A;  3G3G A;  1AMF A;  1B5I A;  1S7Y A;  3CG1 A;  4IY5 A;  3C35 A;  1FQE A;  3JYR A;  4O7M A;  5ITO A;  4EF1 A;  4OA4 A;  4U21 A;  1OQH A;  5DYH A;  5EQ9 A;  5JTY A;  3S9L C;  3FJ7 A;  1P1W A;  1XVX A;  1FQC A;  1FQD A;  4HE1 A;  3G3H A;  2FNC A;  2O51 A;  1JP4 A;  3VVF A;  4ESW A;  2D3I A;  4X1B A;  4RXL A;  4YB6 A;  2F34 A;  1MQJ A;  4E0W A;  4X1D A;  2RIN A;  3IR1 A;  2XXI A;  5CM6 A;  1OIB A;  1N04 A;  4NF4 A;  2WBD A;  4OEN A;  4OHN A;  4PQJ A;  1B9J A;  3ECR A;  1GV8 A;  1ZJL A;  3O28 A;  1YXI A;  3MBP A;  3MJN A;  3BFT A;  2UYF A;  3KSX A;  4YKP A;  4PDH A;  3Q25 A;  4GVO A;  2KLF A;  3T96 B;  4R75 A;  4IO6 A;  1IQ7 A;  1UQW A;  3PUX E;  2REJ A;  4GBW A;  3B6W A;  3KG2 A;  1MQD A;  2NUV A;  1M5F A;  4O3B A;  5IZ1 A;  3U93 A;  1R9Q A;  3OSR A;  5ELV A;  3A3C A;  2XWV A;  3HST A;  3PUV E;  4NED A;  3KOS A;  5DW8 A;  2F3B A;  4DDD A;  5EHM A;  4MAG A;  3LC8 A;  3V5A A;  1TFD A;  1B7Z A;  4YAH X;  3TZA A;  1INP A;  1LAG E;  3H06 B;  2DVC A;  2FIE A;  2FA7 A;  1MPD A;  2WYP A;  1I69 A;  1B32 A;  5J16 A;  5HPQ A;  3LBS A;  1FBF A;  5I2K B;  3T22 A;  4JSD A;  3TEP A;  4GL8 A;  3LSX A;  4IO3 A;  2HCA A;  3E4R A;  3PV0 E;  3U92 A;  3QUF A;  1IIT A;  1Z7N E;  2OZZ A;  3LSW A;  3TAJ A;  4G68 B;  2AYS A;  4N17 A;  4GX3 A;  3SEU A;  2DWJ A;  4DXU A;  2BJI A;  3T9V A;  1QVS A;  3C4M A;  3H6T A;  4TOZ A;  2PMS A;  1IMB A;  5F24 A;  2ZYM A;  5H8F A;  3SEW A;  2XX8 A;  1IMC A;  1WOD A;  1M5E A;  1Y3P A;  3KOT A;  4G61 A;  1KA0 A;  2H99 A;  1FBE A;  1H76 A;  3KJT A;  5M2V A;  2OK2 A;  2ZZX A;  3FXU A;  1FTO A;  4GWY A;  4P47 A;  4JVD A;  5CC2 A;  1JVX A;  3U94 A;  3O6G A;  3UOR A;  2F7B A;  1Y3N A;  3TTM A;  1M5D A;  5JTY B;  4MF3 A;  2QS2 A;  3IAZ A;  2H5Y A;  3RT8 A;  4MFI A;  4NAP A;  4U4S A;  4R6K A;  4ZS9 A;  3BIH A;  5ICQ A;  3IO6 A;  4U1Z A;  1B0H A;  4MEV A;  2H4I A;  1PBP A;  3LSL A;  1XC1 A;  3VLV A;  1MXX A;  5AA2 B;  2Q2C A;  4C0R A;  4YU0 A;  3M3F A;  3PUW E;  1G0I A;  4H1X A;  2G93 A;  3Q27 A;  4NF4 B;  4MJO A;  1NMU A;  2OJT A;  4Z7E A;  1VFD A;  2X7P A;  1MH3 A;  3B50 A;  5H8S A;  2VD2 A;  4OET A;  4HE0 A;  4ONY A;  1D3K A;  2F97 A;  1HSL A;  3O6I A;  1H44 A;  2VOZ A;  4P1L A;  2HAV A;  4I1D A;  5FBP A;  3FXB A;  4NTL A;  5I2N A;  2PT1 A;  2XWO A;  1NH8 A;  3QMF A;  4GXA A;  2Y7I A;  4DI4 B;  1G0H A;  3S9M C;  4LZ8 A;  1M5C A;  4OVR A;  1ZBM A;  2DXR A;  1DSN A;  4AB6 A;  1FTM A;  4GIZ A;  4EXK A;  5DTB A;  4XKN A;  4RK2 A;  2PBW A;  3HHF A;  4FJP A;  1KZ8 A;  4F1V A;  3O97 A;  5LDZ A;  1MRP A;  3QUJ A;  5EYH A;  5I56 A;  3HO7 A;  4XF5 A;  2HQ0 A;  4OVP A;  3VLW A;  3FJM A;  4H5G A;  4GWO A;  2Z8F A;  1II5 A;  5AA1 A;  2UVJ A;  3C9H A;  3TTN A;  2IEE A;  3K4U A;  3RNN A;  2CEX A;  3PU5 A;  4PTK A;  5KCJ A;  2RCA A;  5AA4 A;  1NUX A;  5FHM A;  2I0B A;  1O7T A;  1K9Z A;  5EYF A;  2ESN A;  1VR5 A;  3F11 A;  2HFB A;  4HXV A;  5JEI A;  3TTK A;  4N6P A;  5H8F B;  4TLM B;  3KSJ A;  3VVE A;  3CSG A;  4PDD A;  3K6U A;  4NQ8 A;  1HSJ A;  2ALU A;  4N8Y A;  4H46 A;  4MNP A;  4Q0C A;  3A3U A;  1FCK A;  2F7C A;  4NHB A;  3KZG A;  2Q8J A;  4GQO A;  1J1N A;  4KXP A;  4PAI A;  3PGF A;  5A5L A;  2DS9 A;  4PF6 A;  4UAC A;  1NV7 A;  4GWW A;  4MHF A;  3E13 X;  4KYS A;  1Y3Q A;  4EQ7 A;  4P0G A;  1N84 A;  2XXR A;  4XTC Q;  3MPK A;  1LB8 A;  3U8Q A;  5ISU A;  1UIV A;  2XXX A;  4G8H A;  4HW8 A;  2QVR A;  3QYT A;  1IME A;  3UP9 A;  3PPQ A;  3V8X B;  3IL1 B;  3PMW A;  1R6Z A;  2R71 A;  4R74 A;  3MW0 A;  1TWY A;  3V83 A;  1B5J A;  3DP4 A;  2WBB A;  3DEL B;  1FPD A;  1DPP A;  1FBH A;  2VGQ A;  4IO4 A;  1USY E;  1SD3 A;  2NOO A;  3MVZ A;  4ELP A;  4MX6 A;  3IOV A;  1QKA A;  3QK6 A;  4NF5 B;  4GWZ A;  2B3B A;  4NF0 A;  1XVY A;  3R7X A;  1NV3 A;  1LLS A;  5I2N B;  2GHA A;  3OD7 A;  2WYK A;  4PGP A;  3IB0 A; 
#chains in the Genus database with same CATH homology
 4H65 A;  4ZZA A;  4ZEI A;  1I6B A;  3OEN A;  3VFJ A;  4OEV A;  3B7D A;  5CMK A;  1FTK A;  1OQG A;  4BDO A;  1SW2 A;  1LGB C;  2R9J A;  4ZE8 A;  2ONS A;  2LAO A;  2Q89 A;  3PPO A;  4GL0 A;  3FV2 A;  1A55 A;  2H9B A;  1URD A;  3S9N C;  1TFA A;  1N3W A;  3TYH A;  1SDX A;  3THI A;  3PUZ E;  1ELJ A;  5KCJ B;  4X48 A;  4AQ4 A;  3LSF B;  4ZE9 A;  1SI0 A;  2O1M A;  2AL4 A;  1SYH A;  4KYE A;  4ZEB A;  4IB2 A;  3TTR A;  3OO8 A;  4OES A;  3MQ9 A;  1NNT A;  2H25 A;  1DTG A;  1US5 A;  3G7W A;  1MG1 A;  4EQ9 A;  4TLL B;  5LOM A;  5F1Q A;  5AE4 A;  1P1O A;  1URG A;  4KR5 A;  5I84 A;  3W9V A;  5TPA A;  4DE8 A;  3EHU A;  1UTH A;  1BLF A;  2O7U A;  3IOW A;  4DIG A;  1MY0 A;  4AB5 A;  2UVG A;  2AIX A;  3EPE A;  1NFT A;  3FJG A;  4C1U A;  4EQB A;  2NWJ A;  4RYA A;  1UIU A;  5KDT A;  5L9S A;  3FXQ A;  3QSL A;  4IGR A;  3A09 A;  1Q35 A;  1OVB A;  4FOR A;  2PX1 A;  4QF9 A;  4LZ5 A;  1OLC A;  1H3D A;  3HV1 A;  1O63 A;  3S9E A;  5KZT A;  2NVU B;  4G8M A;  2O6A A;  1NNK A;  5FTH A;  2W7Y A;  3RTW B;  2D5W A;  5AA2 D;  2A5T B;  4R9F A;  4NWD A;  4G2Z A;  1A40 A;  3IB2 A;  4F2O A;  2F6P A;  1MXY A;  3K1M A;  1B6H A;  5K2X A;  3IOR A;  3RTF B;  2E1S A;  3TTL A;  2O7I A;  2DE3 A;  2UVH A;  3M3L A;  4OZ9 A;  4PP0 A;  4QSC A;  2XXH A;  2D21 A;  2Q9T A;  4U4X A;  5JK4 A;  1WVJ A;  3MUQ A;  1B3L A;  2QS4 A;  1DTZ A;  2XHD A;  4ELR A;  4OFO A;  4OTE A;  4R6Y A;  1P1N A;  1LFG A;  4LQ2 A;  1MXV A;  1VE4 A;  4DCX A;  2G29 A;  1NNP A;  3KN3 A;  4QSE A;  3W15 C;  1P1Q A;  5DEX A;  3VV5 A;  3EN3 A;  4OFL A;  4N07 A;  1NNF A;  3IX1 A;  2P0S A;  4ECF A;  4R9G A;  4YIC A;  1FW0 A;  3MC2 A;  4KCC A;  4U22 A;  2I4C A;  1PB9 A;  4PFW A;  1Y20 A;  1B5H A;  1Q1K A;  2ZNS A;  4QRZ A;  4R2B A;  4RNS A;  4YKK A;  4MLV A;  1T0K A;  1AOV A;  2QJE A;  2ZYO A;  4F31 B;  3C32 A;  1LBC A;  1US4 A;  1B3G A;  2QMW A;  3C31 A;  3H3G A;  5HBC A;  4ZEK A;  1HSE A;  3E3K A;  4GRK A;  3GBB A;  1MDP 1;  4QSD A;  5CRY A;  5TU0 A;  3GZG A;  1MPC A;  3VVD A;  1QW0 A;  3JV9 A;  3IB1 A;  3ODB A;  2F8D A;  5KDT B;  4YB7 A;  5I58 A;  2P1S A;  3TQL A;  3EF7 A;  3K02 A;  3RQT A;  5IKB A;  3SER A;  4H6D A;  1DMB A;  4Z0I A;  3TEL A;  4Q8R A;  3UN6 A;  2Y7W A;  1ZLQ A;  3V89 B;  4P0I A;  5K2Y A;  1S50 A;  1LST A;  2F6G A;  3SET A;  1BKA A;  4XXU A;  2ANJ A;  4UA8 A;  2Q2A A;  1B52 A;  3E9X A;  3TOD A;  2Z8D A;  3H4Z A;  2ZXT A;  1BTJ A;  2RKM A;  3AXF A;  4I8C A;  1B51 A;  2ABH A;  1GVC A;  3KBR A;  4OQO A;  3CIJ A;  1JEV A;  2QL3 A;  4EUO A;  2F36 A;  3LR1 A;  2REG A;  4LON B;  3FVN A;  2PVU A;  4THI A;  1SW4 A;  3I3V A;  3B6T A;  3OO7 A;  3DP6 A;  4DLD A;  4IO7 A;  3HN0 A;  4BDN A;  3H6W A;  1NKX A;  4O3C A;  2I4B A;  4EDP A;  4H67 A;  1B05 A;  3KEI A;  4BLA A;  3R26 A;  3FV1 A;  3PD9 A;  3EQ1 A;  3UA8 A;  1ZTY A;  3PUY E;  1LFH A;  1A99 A;  3K01 A;  3FAS A;  3I5O A;  3EHT A;  4BDM A;  3HCQ A;  3OOA A;  3GLB A;  4RY1 A;  5CMM A;  2I3W A;  1B7H A;  5F7V A;  5TP9 A;  3D4C A;  3VLU A;  1Y1M A;  1A8F A;  3N5L A;  1AH5 A;  2V84 A;  2QS3 A;  1B1X A;  5I58 B;  2DE2 A;  2YJP A;  3IO4 A;  3N6T A;  2I49 A;  2HZK A;  4FEC A;  4R73 A;  1USY H;  3K6X A;  1IZ1 A;  1NH7 A;  1B46 A;  4PFY A;  3TPA A;  1FQF A;  1OMP A;  3MVW A;  2YPN A;  1PC3 A;  5J1D A;  3SEV A;  1JW1 A;  2V3T A;  3USD A;  4BDQ A;  1JW5 A;  2OWT A;  4FEB A;  1D9V A;  3O2A A;  3VXB A;  4OVJ A;  4HTG A;  1L5T A;  5IAI A;  1VSO A;  4NF8 A;  2DSF A;  2THI A;  5CBR A;  3FAT A;  4G77 A;  5H8Q A;  1Y9U A;  5CBS A;  1JVY A;  3OSQ A;  1VFE A;  2ZMB A;  2IA4 A;  1LB9 A;  3PPN A;  4H0W A;  2QRY A;  2V3U A;  1LAX A;  4YKJ A;  3RGY A;  3OO9 A;  3G3K A;  2B65 A;  5L9O A;  4G68 C;  3GXA A;  4LUB A;  1WDN A;  1XHY A;  3PMV A;  3CFL A;  4F39 A;  3K00 A;  3N94 A;  4R72 A;  1D4N A;  4F29 A;  1GGG A;  1CB6 A;  2UXA A;  4KCD A;  5DVF A;  1FTL A;  2NXO A;  1R1N A;  4DZ1 A;  1MQI A;  3OXN A;  3CVG A;  5H8H A;  3CI8 A;  5CI5 A;  2HAU A;  2DWI A;  1IXC A;  1MY3 A;  3Q26 A;  5DVI A;  2CMO A;  1IEJ A;  4RJZ A;  2Y7K A;  4JXI A;  1B4H A;  1YTV A;  2VD3 A;  3QXM A;  5L9M A;  3I6V A;  1SBP A;  1B3H A;  3UGW A;  1P99 A;  3UK4 A;  2I3V A;  4HS7 A;  1I6Q A;  1POY 1;  1MXU A;  4XKP A;  1N0T A;  5I59 A;  5I56 B;  3TMG A;  2RF1 A;  2F5X A;  3PD8 A;  3CFZ A;  1LAH E;  4BDR A;  4ZZE A;  3ZKL A;  3MAM A;  1YCJ A;  2RCB A;  3RPW A;  1QKB A;  3H7M A;  2RC8 A;  1IXG A;  2X7Q A;  5AA4 B;  3VXC A;  2GRV A;  3C36 A;  1ATG A;  4OWD A;  1B1H A;  3TKD A;  1MY4 A;  5DVJ A;  3N6U A;  2XD3 A;  4F3S A;  4PET A;  2DYX A;  5FTI A;  4KI0 E;  3FD3 A;  4NF8 B;  4F19 A;  4OXV A;  2QPQ A;  3C33 A;  3FIR A;  1ZMG A;  4NWC A;  4F3P A;  3T9U A;  1S9T A;  5H8Q B;  3DLN A;  2P2A A;  2QS1 A;  5FHO A;  3B6Q A;  3O9P A;  4XIG Q;  3QIM A;  4O3A A;  3S4U A;  4H8J A;  1XOC A;  4ND9 A;  2ZYN A;  3N26 A;  1EU8 A;  3CR9 A;  2XXW A;  1R9L A;  4DCY A;  2R6G E;  4GD5 A;  4FED A;  1RKM A;  5EHS A;  1MXZ A;  2Y7R A;  3CFX A;  4U23 A;  1PDA A;  3QAX A;  3SDF A;  2DQV A;  4JWO A;  4ZEC A;  2Q88 A;  3MZ1 A;  2Z23 A;  5I2K A;  2XXQ A;  1B3F A;  1QUK A;  1PB8 A;  5H8H B;  3MZ9 A;  1JNF A;  3H6V A;  2XXT A;  2I6E A;  3O6H A;  3KFM A;  3ZKK A;  4IY6 A;  4C1T A;  2PT2 A;  4Q30 B;  5AA3 A;  4FAT A;  1B7U A;  1D9Y A;  4NF6 A;  3GBA A;  1BP5 A;  4WXJ A;  3TFL A;  5I59 B;  2BJJ X;  3K0V A;  3PMX A;  3PPP A;  4ZDM A;  3JZJ A;  1MDQ A;  4DXB A;  4I9D A;  2V93 A;  4U2R A;  1UTB A;  5B7D A;  1IXH A;  3U1O A;  1XT8 A;  3UIF A;  3TCG A;  1SW1 A;  5AA2 A;  3OO6 A;  1MY1 A;  1EH3 A;  1TT1 A;  4N13 A;  2I48 A;  2I0C A;  2AL5 A;  5TPA B;  1UTH B;  1SW5 A;  2E0S A;  2Y84 A;  4HCY A;  4LAT A;  3W9W A;  4WEP A;  1B0L A;  4PFU A;  4G4P A;  1QUI A;  1M5B A;  1EZ9 A;  2V25 A;  3Q29 A;  1B40 A;  3S2V A;  3IOT A;  1B58 A;  4F18 A;  4ZEF A;  3T9X B;  3OEK A;  5FHN A;  3HPI A;  2GHB A;  4PFT A;  3H03 A;  1GR2 A;  4P11 A;  3OEL A;  4G8N A;  1MM7 A;  5I57 A;  2XXP A;  2YLN A;  4F3G A;  3FXR A;  3FVK A;  3WAE A;  4HCW A;  5A5X A;  2PYY A;  1JW4 A;  4EF2 A;  1QUL A;  4E0X A;  1FTJ A;  4JWY A;  3ZSF A;  1KWH A;  4RPN A;  2DE4 A;  2VHA A;  4FE8 A;  3EHS A;  4R2F A;  4LQ5 A;  2QMX A;  1B3E A;  1LFI A;  4QFN A;  4YMA A;  4NF6 B;  4F3B A;  2F35 A;  3IJO B;  3ILT B;  2XXY A;  4QHQ A;  1OLA A;  2A5S A;  4QFL A;  3BFU A;  2RC9 A;  5DEX B;  3CRB A;  5CMB A;  1MQG A;  1SQY A;  1TXF A;  4LVQ A;  1UTB B;  4LP2 B;  4JBZ A;  1POT A;  2O1L A;  2OBG A;  4XKR A;  3C34 A;  4QFO A;  3G3F A;  3RY3 A;  3FGS A;  4YZZ A;  3LUY A;  2O69 A;  3D4G A;  1MXW A;  1H43 A;  1CE2 A;  1N7W A;  4XKQ A;  1ZKB A;  3RT6 B;  5BUU A;  3RN8 A;  4ISU A;  3IOU A;  2FYI A;  4IO2 A;  3FVG A;  3M3K A;  4MBP A;  2B3F A;  3K6V A;  2DXY A;  4NF5 A;  4F1Y A;  1FQB A;  3G3I A;  2Z8E A;  2WKY A;  3VDF A;  2DWH A;  5BWJ A;  1NL5 A;  3OMB A;  1A54 A;  2XD2 A;  3T93 B;  2RC7 A;  1SI1 A;  4X9T A;  3FUZ A;  3MVX A;  4YMB A;  2X26 A;  4LZ7 A;  4NE4 A;  3MPL A;  1AIV A;  1LCT A;  1JET A;  3CG3 A;  3L6H A;  3DM0 A;  1URS A;  2ZNU A;  1QJM A;  5I57 B;  4BDL A;  1N7X A;  3KJ7 A;  3RUM A;  1SYI A;  1RYO A;  5DT6 A;  4KHZ E;  3BKI B;  4ELO A;  4PE5 B;  1EZO A;  4QFP A;  4F2Q A;  5A5X B;  2VP1 A;  4I62 A;  1LAF E;  1A8E A;  1MH4 A;  4JDF A;  4JWX A;  4DXC A;  2GFE A;  2ONR A;  4YB5 A;  4KQP A;  1MS7 A;  4M1V A;  2O68 A;  3MP8 A;  3TQW A;  5CMC A;  3Q28 A;  2XX9 A;  2XX7 A;  2UYE A;  3L6G A;  3WAF A;  2OLB A;  2Y7P A;  2O84 X;  2F78 A;  4MH5 A;  3P7I A;  3MP6 A;  4Q5T A;  1A7L A;  3FVO A;  4RA1 A;  3CSB A;  4H5F A;  5H8N A;  4WED A;  4TQU Q;  4FAJ A;  4GFR A;  4WKM A;  4L17 A;  2H98 A;  1P1U A;  2F7A A;  1GTK A;  4F1U A;  4KYD A;  3SES A;  4H8I A;  4FIM A;  1MQH A;  3K1N A;  4GF8 A;  4ELQ A;  4GOT A;  2CZL A;  3K6W A;  4RK9 A;  3VE1 B;  1N3X A;  2A5T A;  5ICT A;  3TCH A;  2GH9 A;  2DVZ A;  2XXV A;  4GLI A;  3K1P A;  5TP9 B;  3IK6 B;  2OCU A;  1RYX A;  3O29 A;  4OYV A;  1H45 A;  1SVX B;  4KPT A;  3RLF E;  2DP8 A;  3KGC A;  1EZP A;  4MLQ A;  1IXI A;  4YKI A;  4OMB A;  1YAE A;  2HEU A;  4EXL A;  3MWB A;  1B4Z A;  3ILU B;  1JQF A;  1IIW A;  2ZNT A;  3ONM A;  2UVI A;  4IGT A;  2Z22 A;  4ESX A;  3BBR A;  2ONK E;  1YPN A;  2DOJ A;  1MPB A;  5HM4 B;  1Y1Z A;  5L8D A;  3OEM A;  4QFK A;  1B2H A;  3FZV A;  3G3J A;  1XS5 A;  1PBQ A;  1F9B A;  1LCF A;  4IO5 A;  3KN8 A;  1PB7 A;  3K2D A;  1ZU0 A;  4OER A;  3TDJ A;  4OFJ A;  1MM6 A;  3O66 A;  3TUS A;  4GXS B;  3SEY A;  4KD5 A;  3MVY A;  4OEU A;  4K3F A;  3DP8 A;  4LA9 A;  2ZYK A;  3MZB A;  4RPO A;  3IJX B;  1MY2 A;  2M8C A;  3MP1 A;  4JSO A;  5B70 A;  1N76 A;  2OWS A;  3KN7 A;  4ZED A;  2QSX A;  3T66 A;  2HZL A;  5H8N B;  1OVT A;  3T9H B;  2V3Q A;  3R6U A;  3M8U A;  1IUD A;  1Z7M E;  4F22 A;  4POW A;  1AL3 A;  1ANF A;  1FQA A;  1DPE A;  1O64 A;  4JB7 A;  4POX A;  4U1O A;  2HXW A;  2XXU A;  4KFQ A;  1Y4C A;  1LBB A;  3HHG A;  4M4G A;  1BIY A;  3TCF A;  2I58 A;  1PEB A;  4R6H A;  1QUJ A;  3PPR A;  3SEX A;  4G68 A;  1I6A A;  1Y4T A;  3ZS6 A;  1DOT A;  5ITP A;  4NMY A;  1JEU A;  3H6U A;  3U72 A;  1ZIU A;  2DWA A;  3SKP A;  3G3G A;  1AMF A;  1B5I A;  1S7Y A;  3CG1 A;  4IY5 A;  3C35 A;  1FQE A;  3JYR A;  5ITO A;  4EF1 A;  4U21 A;  1OQH A;  5DYH A;  5JTY A;  3S9L C;  3FJ7 A;  1P1W A;  1XVX A;  1FQC A;  1FQD A;  3G3H A;  2FNC A;  2O51 A;  3VVF A;  4ESW A;  2D3I A;  4X1B A;  4RXL A;  4YB6 A;  2F34 A;  1MQJ A;  4E0W A;  4X1D A;  2RIN A;  3IR1 A;  2XXI A;  5CM6 A;  1OIB A;  1N04 A;  4NF4 A;  4OEN A;  4OHN A;  4PQJ A;  1B9J A;  3ECR A;  1GV8 A;  1ZJL A;  3O28 A;  3MBP A;  3MJN A;  3BFT A;  2UYF A;  3KSX A;  4YKP A;  3Q25 A;  4GVO A;  2KLF A;  3T96 B;  4R75 A;  4IO6 A;  1IQ7 A;  1UQW A;  3PUX E;  2REJ A;  3B6W A;  3KG2 A;  1MQD A;  2NUV A;  1M5F A;  4O3B A;  3U93 A;  1R9Q A;  3OSR A;  5ELV A;  3A3C A;  3HST A;  3PUV E;  4NED A;  3KOS A;  4DDD A;  5EHM A;  3LC8 A;  3V5A A;  1TFD A;  1B7Z A;  4YAH X;  3TZA A;  1LAG E;  3H06 B;  2DVC A;  2FA7 A;  1MPD A;  1I69 A;  1B32 A;  5HPQ A;  3LBS A;  5I2K B;  3T22 A;  4JSD A;  3TEP A;  4GL8 A;  3LSX A;  4IO3 A;  2HCA A;  3E4R A;  3PV0 E;  3U92 A;  3QUF A;  1IIT A;  1Z7N E;  2OZZ A;  3LSW A;  3TAJ A;  4G68 B;  2AYS A;  3SEU A;  2DWJ A;  4DXU A;  3T9V A;  1QVS A;  3C4M A;  3H6T A;  4TOZ A;  2PMS A;  2ZYM A;  5H8F A;  3SEW A;  2XX8 A;  1WOD A;  1M5E A;  1Y3P A;  3KOT A;  2H99 A;  1H76 A;  3KJT A;  5M2V A;  2OK2 A;  3FXU A;  1FTO A;  5CC2 A;  1JVX A;  3U94 A;  3O6G A;  3UOR A;  2F7B A;  1Y3N A;  3TTM A;  1M5D A;  5JTY B;  4MF3 A;  2QS2 A;  3IAZ A;  2H5Y A;  3RT8 A;  4MFI A;  4U4S A;  4R6K A;  4ZS9 A;  5ICQ A;  3IO6 A;  4U1Z A;  1B0H A;  2H4I A;  1PBP A;  3LSL A;  1XC1 A;  3VLV A;  1MXX A;  5AA2 B;  2Q2C A;  4C0R A;  4YU0 A;  3M3F A;  3PUW E;  4H1X A;  2G93 A;  3Q27 A;  4NF4 B;  1NMU A;  2OJT A;  4Z7E A;  1VFD A;  2X7P A;  1MH3 A;  5H8S A;  2VD2 A;  4OET A;  4ONY A;  1D3K A;  2F97 A;  1HSL A;  3O6I A;  1H44 A;  2VOZ A;  2HAV A;  4I1D A;  4NTL A;  5I2N A;  2PT1 A;  1NH8 A;  4GXA A;  2Y7I A;  3S9M C;  4LZ8 A;  1M5C A;  1ZBM A;  2DXR A;  1DSN A;  4AB6 A;  1FTM A;  4GIZ A;  4EXK A;  5DTB A;  4XKN A;  4RK2 A;  2PBW A;  3HHF A;  4FJP A;  4F1V A;  3O97 A;  1MRP A;  3QUJ A;  5I56 A;  3HO7 A;  2HQ0 A;  3VLW A;  3FJM A;  4H5G A;  4GWO A;  2Z8F A;  1II5 A;  5AA1 A;  2UVJ A;  3C9H A;  3TTN A;  2IEE A;  3K4U A;  3RNN A;  3PU5 A;  5KCJ A;  2RCA A;  5AA4 A;  5FHM A;  2I0B A;  1O7T A;  5EYF A;  2ESN A;  1VR5 A;  3F11 A;  2HFB A;  5JEI A;  3TTK A;  4N6P A;  5H8F B;  4TLM B;  3KSJ A;  3VVE A;  3CSG A;  3K6U A;  1HSJ A;  2ALU A;  4Q0C A;  3A3U A;  1FCK A;  2F7C A;  3KZG A;  2Q8J A;  4GQO A;  1J1N A;  3PGF A;  2DS9 A;  4UAC A;  3E13 X;  4KYS A;  1Y3Q A;  4EQ7 A;  4P0G A;  1N84 A;  2XXR A;  4XTC Q;  3MPK A;  1LB8 A;  3U8Q A;  5ISU A;  1UIV A;  2XXX A;  4G8H A;  4HW8 A;  3QYT A;  3UP9 A;  3PPQ A;  3V8X B;  3IL1 B;  3PMW A;  1R6Z A;  2R71 A;  4R74 A;  3MW0 A;  1TWY A;  3V83 A;  1B5J A;  3DP4 A;  3DEL B;  1DPP A;  2VGQ A;  4IO4 A;  1USY E;  1SD3 A;  2NOO A;  3MVZ A;  4ELP A;  3IOV A;  1QKA A;  3QK6 A;  4NF5 B;  2B3B A;  1XVY A;  3R7X A;  1LLS A;  5I2N B;  2GHA A;  3OD7 A;  3IB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...