1SW2A

Crystal structure of prox from archeoglobus fulgidus in complex with glycine betaine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
270
structure length
270
Chain Sequence
ERVVIGSKPFNEQYILANMIAILLEENGYKAEVKEGLGGTLVNYEALKRNDIQLYVEYTGTAYNVILRKQPPELWDQQYIFDEVKKGLLEADGVVVAAKLGFRDDYALAVRADWAEENGVEKISDLAEFADQLVFGSDPEFASRPDGLPQIKKVYGFEFKEVKQMEPTLMYEAIKNKQVDVIPAYTTDSRVDLFNLKILEDDKGALPPYDAIIIVNGNTAKDEKLISVLKLLEDRIDTDTMRALNYQYDVEKKDAREIAMSFLKEQGLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords osmoprotection protein (proX)
publication title Structural basis for the binding of compatible solutes by ProX from the hyperthermophilic archaeon Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 99
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1sw2A01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 1sw2A02
1HSJA 4F22A 1FTOA 5L9SA 3OEKA 3H06B 4OEUA 5I2NB 4JSDA 1OVBA 2RCAA 2AL4A 1NMUA 4L17A 2H25A 2M8CA 1MQDA 3FZVA 1MH4A 1S50A 2H4IA 3HO7A 2ONKE 3GLBA 4G77A 1BP5A 2DVCA 1FTLA 3CR9A 3HV1A 1B0HA 5AA2D 4EDPA 4TLLB 5DEXA 4Q30B 5BWJA 4ZEBA 1AH5A 4I62A 1NH7A 3EN3A 1Y1ZA 2DE3A 1ANFA 3O6GA 1MXVA 1ZTYA 5ICQA 1B4HA 5M2VA 5I59A 4C1UA 2V3TA 4M1VA 2VOZA 3ODBA 4OZ9A 3C33A 3PPPA 5CMKA 4IB2A 3G3IA 5EHMA 4UACA 2G29A 1SI1A 5ICTA 5L9MA 3UIFA 2V84A 3ILTB 5ELVA 1IITA 5H8QA 1B5JA 2V3QA 5TP9A 4ECFA 4GXAA 3EHSA 2HAVA 1RKMA 4AB6A 4R6YA 2DWHA 1USYE 3USDA 5H8SA 5H8FA 3KSJA 3K00A 3TELA 1B5HA 4U22A 4FJPA 1XS5A 4OFOA 4R72A 4P0GA 2XXHA 4I1DA 1KWHA 3H6VA 1XOCA 3S9MC 4HS7A 3E13X 4NF8A 4LONB 3G3HA 4OENA 1JW1A 2XXIA 1EZ9A 3H4ZA 1MM7A 4F1UA 3EF7A 4BDLA 3ZKLA 5A5XB 4H1XA 2XXVA 2DOJA 3M8UA 3T9HB 2VGQA 5DTBA 4NF5A 3IJOB 4JWYA 2Q88A 1L5TA 3OD7A 3GXAA 4DDDA 3TCGA 1ELJA 4IO2A 4U4XA 1VSOA 2XXWA 1IXCA 4H6DA 1FQFA 2OZZA 2O51A 5DEXB 3KG2A 4EXKA 4GXSB 4YKPA 3RTFB 2QSXA 3Q27A 4F29A 4MLQA 1CB6A 1B40A 4QFNA 5I84A 1B52A 5IAIA 4MLVA 4BDRA 4LZ7A 3B6WA 3T9UA 2B65A 4K3FA 3SDFA 4DXCA 3D4GA 5I59B 4X48A 1MQHA 5KZTA 1QKBA 2ZMBA 4ONYA 3Q26A 2DSFA 2I0BA 5L9OA 4YICA 3VLVA 2ZNSA 4BDMA 4EQ7A 5H8QB 1MY3A 3PPOA 5TP9B 1YAEA 2ONRA 4OWDA 3RNNA 4EF1A 3MP8A 1UIVA 5H8FB 4FATA 5KDTA 5AA4A 2CZLA 1IXHA 3CVGA 3MP6A 3SEXA 3KJ7A 2QS3A 1B1XA 2B3BA 2O1LA 4O3BA 5K2YA 3KJTA 2Z22A 4KHZE 4OQOA 2REJA 3B7DA 1FQEA 4NF8B 5FTHA 2WKYA 2DVZA 3Q29A 3MVYA 1URSA 3IOWA 1B51A 2VD2A 1B0LA 3FV2A 1JQFA 3OO7A 1HSEA 3IOVA 3VLUA 4F18A 1B3GA 1USYH 4Z0IA 2ZYOA 3VVEA 4KYEA 1LLSA 3G3JA 3UK4A 1M5FA 3G3KA 4NF5B 4PQJA 3DELB 3H3GA 1P1OA 1VFDA 2B3FA 3K1NA 4IO7A 1MH3A 2H9BA 2UVIA 3PU5A 3H6WA 3N94A 4KPTA 3CI8A 3FD3A 5J1DA 2R9JA 3CG3A 4ZDMA 3Q25A 1D9VA 3K4UA 4OTEA 5FTIA 2O84X 3HHGA 1WVJA 4QHQA 4TLMB 1WODA 3TQWA 1N3WA 4DCYA 1PEBA 3U94A 1ZMGA 2HFBA 3K1PA 3UP9A 3V83A 4OVJA 2YPNA 4R9FA 2V93A 3LR1A 2Y7RA 3PD8A 1ZKBA 3RT6B 2DWJA 3VVFA 1IQ7A 4G4PA 4KFQA 4IO4A 4NMYA 5I2NA 3DM0A 2GFEA 4MH5A 1II5A 2Y7PA 3OSQA 3LBSA 3HN0A 2NXOA 1MXWA 5HBCA 4LUBA 4ELOA 5FHOA 2I3WA 3KEIA 4U1ZA 1NNTA 2I3VA 3MPKA 1Q1KA 4U2RA 3UN6A 4G2ZA 1AIVA 4RJZA 3MP1A 2F8DA 1XC1A 4YU0A 4HW8A 4FEBA 5KDTB 4R2FA 3V89B 5AA4B 2Z8EA 1UTBA 3R7XA 4IGRA 3MPLA 2DXYA 1QKAA 3CFXA 3EHUA 4X1DA 1OQHA 3MJNA 3B6QA 2GRVA 3CIJA 1FW0A 5K2XA 3PPQA 3L6HA 5I2KA 1FCKA 1JW5A 4U4SA 2I49A 1DOTA 3QXMA 4YB5A 3C34A 3R6UA 1FTKA 1B6HA 3K1MA 4KCCA 2F7BA 2I4CA 3HCQA 1DTZA 1MQGA 1ZJLA 2OBGA 4R73A 2NWJA 3OO6A 3KOSA 3RPWA 4RNSA 1JETA 2PVUA 1MXZA 1LSTA 3FVNA 1XT8A 3QYTA 2X7PA 3MZBA 1LB9A 5TPAA 3TUSA 2D21A 3TEPA 1POTA 1H44A 5AA2A 1P1NA 4P11A 1ZU0A 3PMVA 4H5GA 1B3LA 1LFHA 1SDXA 2XD2A 2IEEA 1MPBA 1B4ZA 2XXUA 3O29A 2ZNUA 4WEDA 5JTYB 3TODA 1JVYA 3N6TA 3C35A 3K2DA 2A5TA 3CSBA 3C36A 1M5DA 3TTMA 4F3BA 4RPOA 4ESXA 2XX9A 1B3EA 3S9NC 5IKBA 3T9XB 3TZAA 5A5XA 2XXRA 4R6KA 4IGTA 1ZBMA 1SVXB 3ILUB 4FEDA 4NF4A 5DYHA 1N84A 4JXIA 1MQJA 4E0WA 3TTNA 2F5XA 3K6WA 2Y7KA 2F35A 1UTBB 1US4A 3ZS6A 3FXUA 3HHFA 2W7YA 1GGGA 2ZNTA 3VE1B 3O6HA 3PMXA 4KYDA 2QPQA 1WDNA 3BFUA 3IB1A 4F31B 3TPAA 2LAOA 5I2KB 1LCTA 1NFTA 1DPPA 3OOAA 4BLAA 1TXFA 2X26A 4XIGQ 4RA1A 2Z8FA 2REGA 3TQLA 1MPCA 3FIRA 2O68A 1NNKA 4ND9A 4POXA 3MW0A 3TTLA 4F1YA 2OJTA 2A5SA 3OSRA 4O3AA 4G68A 3A3UA 4F2QA 4KR5A 2DQVA 1NNFA 2OK2A 5TPAB 3OENA 3PMWA 4LATA 1ZLQA 4G8MA 1M5EA 4F3PA 2DWIA 5AA2B 4H5FA 4AQ4A 3PV0E 3QUFA 3WAFA 3ONMA 5CMCA 1IZ1A 4OYVA 2DWAA 3TAJA 4LP2B 4IO3A 1B46A 4C0RA 3JV9A 4U1OA 5JK4A 2A5TB 3DP4A 2ZYKA 2UYFA 1PBPA 3O66A 4GIZA 4DLDA 4H65A 2P2AA 1Y20A 4PP0A 1H76A 2XHDA 4U23A 3TCHA 3I5OA 3TTRA 3SEYA 3MVZA 4NF4B 1URDA 1YTVA 4ZZEA 4LA9A 4RY1A 2Q89A 3OELA 1Y1MA 1SI0A 3K6VA 3C4MA 1MPDA 4I8CA 1HSLA 1LFIA 1SBPA 2RKMA 3RT8A 2XXTA 3Q28A 2FA7A 2QL3A 3QSLA 3JZJA 1JNFA 1SYIA 4QF9A 3AXFA 4JDFA 1P1UA 3RGYA 4DE8A 1US5A 3MZ9A 3RY3A 3FUZA 1B7ZA 4XTCQ 1XVXA 2HXWA 4ZE9A 4ELRA 3TTKA 5I56A 2I6EA 4ZZAA 1Y3QA 4ZEFA 1B7UA 4MFIA 2RF1A 4G68B 3K02A 4I9DA 4YB7A 1B05A 1MS7A 4OHNA 4ELQA 3CFLA 4U21A 3GZGA 1SQYA 1FQBA 2Q2AA 1BLFA 2RCBA 1FQAA 1H43A 1PC3A 3E4RA 2ZXTA 2G93A 4OESA 3FXRA 3DP8A 4GVOA 2F36A 3QUJA 4EUOA 2DYXA 4BDQA 1A54A 1PB8A 4GOTA 2GHAA 1SW5A 5H8HA 2R71A 2XX7A 3T9VA 3TCFA 1LFGA 1PBQA 3BBRA 5ITOA 1A40A 2THIA 1R1NA 2XXPA 1B3FA 5I57A 3K6XA 1FTMA 4F2OA 4YMAA 1ATGA 2IA4A 4NTLA 4KD5A 3U93A 3PUWE 1J1NA 2HZKA 2H98A 1B32A 3TDJA 1A55A 1EU8A 2O69A 4IO6A 2QMXA 3JYRA 3N6UA 2Z23A 5HPQA 2XXYA 3LSWA 4YB6A 1OMPA 4GL8A 5CMMA 2PMSA 2OCUA 4FAJA 5F7VA 3O9PA 3QK6A 4H67A 3G3GA 5JTYA 2I0CA 3LSFB 3VVDA 1MY0A 5CMBA 5H8NA 3SEWA 1GR2A 2GHBA 4GF8A 3RN8A 1VE4A 1RYXA 3G7WA 4NE4A 3ZKKA 4MF3A 2NOOA 1IIWA 3IJXB 1DPEA 4R75A 1AMFA 4LQ2A 5CBSA 5I56B 2FNCA 1SW2A 3EHTA 1Y3PA 1LBBA 3FGSA 3KN8A 4RPNA 2D5WA 4XKQA 4FECA 3UGWA 3CG1A 4R74A 1SYHA 4PETA 1P1QA 4XXUA 4ESWA 4GQOA 3FXQA 2RINA 1RYOA 4ZECA 5H8HB 5JEIA 3C32A 3KN7A 3VXCA 3LC8A 3VFJA 1CE2A 2YJPA 1Q35A 2Q2CA 1UQWA 3FVKA 1N7WA 3TKDA 2UYEA 1PB7A 1N76A 2VP1A 4Q8RA 4G8HA 3MWBA 2CMOA 1BKAA 4H8JA 5I57B 4LZ8A 3N26A 4PFUA 4AB5A 2HAUA 1LAXA 1MXXA 4JBZA 1I6QA 2QS1A 1B1HA 3OO9A 5AE4A 4DIGA 2I4BA 1IXGA 1OLCA 1PDAA 4EXLA 1M5CA 1SD3A 3QAXA 5HM4B 2YLNA 4QRZA 4H0WA 3RQTA 5AA1A 4OERA 1N0TA 3F11A 3T22A 4MBPA 1N04A 3IK6B 4BDOA 3EPEA 4TQUQ 3M3KA 3FJMA 3IO4A 4FE8A 4P0IA 3S9LC 3RUMA 4R6HA 1AOVA 1TWYA 5H8NB 3KFMA 3W9WA 5FHNA 1I6AA 3KSXA 4TOZA 4QFPA 4ZEDA 4YAHX 4X1BA 4X9TA 3MAMA 5EYFA 1DMBA 3KBRA 4XKPA 1S9TA 4WXJA 5ISUA 3VDFA 3B6TA 1UTHB 1QJMA 3THIA 3BFTA 2X7QA 3K01A 2F6PA 3IOTA 2RC9A 4EF2A 3SEUA 4IY5A 1LAFE 1MY2A 4M4GA 5I58A 5CI5A 1NNPA 5DVIA 3FJ7A 5CRYA 4FIMA 3ZSFA 3U92A 4F39A 4OEVA 5L8DA 3SERA 4ZS9A 3G3FA 1OQGA 2GH9A 3BKIB 3IAZA 1FQDA 3VV5A 4ZEIA 1IEJA 2I48A 1QUIA 2XX8A 2QS4A 4GFRA 4PFYA 3PD9A 1MXYA 1PB9A 1MG1A 3T96B 2VHAA 2ZYNA 1JEUA 3PPRA 2UVGA 2OLBA 4NF6A 1QW0A 2ABHA 4F19A 3SKPA 2PYYA 3MVXA 4Q5TA 1OLAA 4PFWA 3RTWB 1VFEA 3KZGA 1R9LA 2XXQA 3SEVA 3OXNA 2DS9A 4JSOA 2NVUB 1H3DA 4N07A 5DVFA 3CFZA 1D3KA 4RK2A 4FORA 3W15C 3CSGA 1O7TA 4ISUA 5B70A 2UXAA 2NUVA 3EQ1A 3TYHA 2HCAA 4N6PA 1XVYA 1MQIA 1OIBA 4DZ1A 3O28A 1GVCA 5KCJA 4E0XA 4F1VA 4OETA 4WKMA 4HCWA 1UIUA 1TT1A 2UVJA 1A7LA 3FVGA 4QFLA 3IB0A 3CRBA 2F7AA 2V25A 4YKIA 4C1TA 3L6GA 1QULA 1P99A 4R2BA 4HCYA 2QS2A 1EZOA 1OVTA 1MY4A 3H6TA 3TFLA 5I58B 1I6BA 3DP6A 2I58A 3V5AA 1GV8A 4NWDA 1A8EA 3E9XA 3KGCA 4YKKA 3S2VA 1B2HA 4KI0E 2H99A 4LZ5A 3S4UA 4JWXA 2F6GA 1Y9UA 5CBRA 4GRKA 3K6UA 4QFOA 5DT6A 2O1MA 1YCJA 4POWA 3O6IA 2F7CA 1Y4CA 2Y7IA 3GBAA 1EZPA 4JWOA 5CM6A 4KQPA 2F34A 1MM6A 3K0VA 3R26A 1TFDA 3FVOA 1QVSA 2QRYA 2ONSA 2V3UA 3KN3A 1QUJA 1D9YA 5FHMA 4NF6B 5F1QA 4PFTA 3U8QA 3O97A 2BJJX 3IR1A 3IO6A 3H7MA 3IORA 4RYAA 3IOUA 5B7DA 1F9BA 2F97A 4NEDA 4THIA 3MUQA 2ALUA 4QFKA 3KOTA 1FQCA 2O7UA 1Y3NA 3PUVE 3UORA 4YZZA 3VLWA 2DP8A 4LQ5A 3PUXE 3C9HA 1DTGA 3RLFE 4ELPA 2PT2A 4BDNA 4KCDA 1LAHE 1O63A 3HPIA 1Z7ME 4QSEA 1D4NA 1LBCA 3H6UA 5AA3A 3ECRA 5KCJB 2HZLA 1FTJA 3M3LA 3PUYE 4Q0CA 2DE4A 3FJGA 3C31A 4JB7A 3SETA 4YMBA 3MBPA 4GL0A 1TFAA 3IX1A 1NH8A 1DSNA 4UA8A 1S7YA 1B3HA 3I3VA 4Z7EA 3FASA 3U72A 3W9VA 4DXBA 2QJEA 4IO5A 1B58A 4R9GA 2PBWA 1GTKA 2VD3A 1N7XA 3O2AA 1VR5A 1NL5A 1T0KA 1B9JA 4G68C 3U1OA 4GWOA 1LAGE 1Y4TA 1P1WA 1MDP1 2O7IA 1N3XA 1EH3A 4F3SA 3I6VA 4F3GA 4PE5B 2ESNA 4ZEKA 1SW1A 2HQ0A 3VXBA 1O64A 1SW4A 5DVJA 1QUKA 2RC7A 1POY1 2P0SA 4OXVA 3E3KA 2HEUA 2PT1A 3SESA 2O6AA 2H5YA 5LOMA 3OMBA 5CC2A 1UTHA 3T93B 3A3CA 1JW4A 2AL5A 1XHYA 3MVWA 3LUYA 1NKXA 1B5IA 4G8NA 2D3IA 4RXLA 1BTJA 2QMWA 3QIMA 4WEPA 5BUUA 2F78A 2FYIA 2Y7WA 1Z7NE 3GBBA 1BIYA 2AIXA 4ZE8A 4XKNA 2DXRA 3WAEA 3HSTA 1JVXA 4NWCA 3MC2A 1R6ZA 1R9QA 3PPNA 5TU0A 2DE2A 1IXIA 4XKRA 2AYSA 3IB2A 4RK9A 2Z8DA 1LGBC 1LB8A 2P1SA 4KYSA 3FV1A 4EQ9A 2XD3A 2ANJA 5ITPA 3OEMA 3V8XB 1URGA 3PUZE 1IUDA 4QSDA 3H03A 3OO8A 4H8IA 5EHSA 2KLFA 3IL1B 1LCFA 1JEVA 1MDQA 3TMGA 1MY1A 4QSCA 4GD5A 2E1SA 4YKJA 4DCXA 2XXXA 1M5BA 2Q8JA 3T66A 3UA8A 2Q9TA 4IY6A 1YPNA 4GLIA 1H45A 2OWSA 2Y84A 3N5LA 1MRPA 1A99A 3MQ9A 2OWTA 1MXUA 4LVQA 3LSLA 3S9EA 4HTGA 3A09A 4OFJA 4OFLA 2E0SA 2ZYMA 3P7IA 4O3CA 1ZIUA 2RC8A 3FATA 3D4CA 3M3FA 2R6GE 2UVHA 1I69A 4OMBA 1A8FA 4DXUA 3LSXA 1AL3A 3DLNA 1B7HA 4EQBA 3MZ1A 4N13A 2PX1A 3PGFA
chains in the Genus database with same CATH superfamily
1HSJA 4F22A 1FTOA 5L9SA 3OEKA 5I5PA 3H06B 4OEUA 5I2NB 4JSDA 1OVBA 2RCAA 2AL4A 1NMUA 2FIEA 4UABA 4L17A 2H25A 2M8CA 1MQDA 3FZVA 1MH4A 1S50A 4NX1A 2H4IA 3HO7A 2ONKE 3GLBA 3CHGA 4G77A 1BP5A 2DVCA 4H45A 1FTLA 3CR9A 3HV1A 1B0HA 5AA2D 4EDPA 4TLLB 5DEXA 4Q30B 1JP4A 4GBWA 3T0JA 5BWJA 4ZEBA 2Y5LA 1IMDA 1AH5A 4I62A 1NH7A 1Q9DA 3EN3A 1Y1ZA 2DE3A 1ANFA 2FBPA 4PFIA 3O6GA 1MXVA 1ZTYA 5ICQA 1B4HA 5M2VA 5I59A 4C1UA 2V3TA 4M1VA 5IZ3B 2VOZA 3ODBA 4OZ9A 3C33A 3PPPA 5CMKA 4IB2A 3G3IA 5EHMA 4UACA 4NF0A 2G29A 1SI1A 5ICTA 5L9MA 3UIFA 2V84A 3ILTB 5ELVA 1IITA 5H8QA 1B5JA 2V3QA 5TP9A 4ECFA 4GXAA 3EHSA 2HAVA 1RKMA 4AB6A 4R6YA 2DWHA 5EQ9A 1USYE 3USDA 3HFUA 5H8SA 5H8FA 3KSJA 3K00A 3TELA 1B5HA 1NV3A 4U22A 5LTCA 4FJPA 1FPDA 1XS5A 4OFOA 4R72A 4P0GA 2XXHA 4I1DA 1KWHA 3H6VA 1XOCA 3S9MC 4HS7A 3E13X 2WBDA 4NF8A 4LONB 4MMPA 3G3HA 1LEVA 4OENA 1JW1A 2XXIA 5FBPA 1EZ9A 3H4ZA 1MM7A 4F1UA 1KA1A 1FPBA 4O8MA 3EF7A 4BDLA 2JJKA 3ZKLA 5A5XB 4H1XA 2XXVA 2DOJA 3M8UA 5IM2A 4P56A 3T9HB 5ET5A 2VGQA 5DTBA 4NF5A 3IJOB 4JWYA 2Q88A 4I40A 1L5TA 3OD7A 3GXAA 4DDDA 3ROJA 1ELJA 2XWOA 4HXVA 3TCGA 4IO2A 4U4XA 2FVZA 1VSOA 2XXWA 1IXCA 4H6DA 1DCUA 3MYUA 1FQFA 2OZZA 2O51A 5DEXB 3KG2A 4EXKA 4GXSB 4YKPA 3RTFB 2QSXA 3Q27A 4F29A 4MLQA 1CB6A 1B40A 4QFNA 5EYGA 5I84A 1B52A 5IAIA 4MLVA 4BDRA 3B50A 4LZ7A 3B6WA 3T9UA 2B65A 4K3FA 3SDFA 4DXCA 3D4GA 5I59B 4X48A 1MQHA 5KZTA 1QGXA 1QKBA 2ZMBA 4ONYA 3Q26A 2DSFA 2I0BA 4AS5A 5L9OA 4YICA 2HXRA 3VLVA 1K9YA 2ZNSA 4BDMA 4EQ7A 1G0IA 5H8QB 1MY3A 3PPOA 5TP9B 1YAEA 2ONRA 4OWDA 3RNNA 4EF1A 3MP8A 1UIVA 5H8FB 4FATA 4MCOA 2WYKA 5KDTA 5AA4A 2CZLA 1IXHA 3CVGA 3MP6A 3SEXA 3KJ7A 2QS3A 1B1XA 2B3BA 2O1LA 4O3BA 5K2YA 3KJTA 2Z22A 4KHZE 4JVDA 1LBWA 3E78A 4OQOA 2REJA 3B7DA 1FQEA 4NF8B 2Q8MA 5FTHA 4O7IA 2WKYA 2DVZA 4PAFA 3Q29A 3MVYA 1URSA 1EYKA 3IOWA 1B51A 2VD2A 1B0LA 3FV2A 1JQFA 3OO7A 1HSEA 3IOVA 3VLUA 4F18A 1B3GA 1USYH 4Z0IA 2ZYOA 4OVPA 3VVEA 5IZZA 4KYEA 1LLSA 3G3JA 3UK4A 1M5FA 3G3KA 4NF5B 4PQJA 3KC1A 3DELB 3H3GA 1P1OA 1VFDA 4PAIA 2B3FA 3K1NA 4IO7A 1MH3A 2H9BA 2UVIA 3PU5A 3H6WA 3N94A 4KPTA 3CI8A 3FD3A 5J1DA 2R9JA 3CG3A 4ZDMA 1FTAA 2FIXA 2P3VA 3Q25A 1D9VA 3K4UA 4OTEA 4GX6A 5FTIA 2O84X 3HHGA 1K9ZA 1WVJA 4QHQA 4N81A 4TLMB 1WODA 3TQWA 1N3WA 5DW8A 1NV1A 4DCYA 1PEBA 3U94A 1ZMGA 2HFBA 3K1PA 3UP9A 3V83A 4OVJA 2YPNA 4R9FA 2V93A 3LR1A 2Y7RA 1EYIA 3PD8A 1ZKBA 3RT6B 2DWJA 4NG7A 3VVFA 1IQ7A 4G4PA 4KFQA 4IO4A 4NMYA 5I2NA 3DM0A 2GFEA 4MH5A 3QMFA 1II5A 2Y7PA 3OSQA 3LBSA 3HN0A 2NXOA 1MXWA 5HBCA 3NOHA 4LUBA 4O7MA 4ELOA 5FHOA 2I3WA 3KEIA 4U1ZA 1NNTA 2I3VA 3MPKA 1Q1KA 4U2RA 3UN6A 4G2ZA 1AIVA 2QVUA 1EYJA 4RJZA 3MP1A 2F8DA 3LV0A 1XC1A 4YU0A 1LBVA 5I7IA 4HW8A 4FEBA 5KDTB 4R2FA 2WYPA 4MHFA 3V89B 5AA4B 2Z8EA 4PFRA 1UTBA 3R7XA 4IGRA 4FBPA 1IMCA 3MPLA 2DXYA 1QKAA 3CFXA 3EHUA 4X1DA 1OQHA 3MJNA 3B6QA 2GRVA 3CIJA 1FW0A 5K2XA 3PPQA 4PCDA 3L6HA 5I2KA 1FCKA 1JW5A 4U4SA 2I49A 1DOTA 3QXMA 4YB5A 3C34A 3R6UA 1FTKA 4QBAA 1B6HA 3KBZA 3K1MA 4KCCA 1FBGA 2F7BA 2I4CA 3HCQA 1DTZA 1MQGA 1ZJLA 3LUZA 1FBPA 2OBGA 4GX4A 4R73A 2NWJA 3OO6A 3KOSA 3RPWA 4RNSA 1JETA 2PVUA 1MXZA 1LSTA 3FVNA 1XT8A 3QYTA 2X7PA 3MZBA 1LB9A 5TPAA 1FPGA 2MKZA 1LBXA 3TUSA 2D21A 4N17A 1FBFA 3EKIA 3TEPA 1NUXA 1POTA 2R8TA 1H44A 5AA2A 3B8BA 1P1NA 4P11A 1ZU0A 3PMVA 4H5GA 1B3LA 1LFHA 1SDXA 2XD2A 4N6KA 2IEEA 1MPBA 1B4ZA 2XXUA 3O29A 2ZNUA 4NN3A 4WEDA 5JTYB 3TODA 1JVYA 3N6TA 3C35A 3K2DA 2A5TA 3CSBA 3C36A 1M5DA 3TTMA 4F3BA 4RPOA 4ESXA 2XX9A 5EQ8A 1B3EA 3S9NC 5IKBA 3T9XB 2WBBA 3TZAA 4GBVA 1DBZA 5A5XA 2XXRA 4R6KA 4IGTA 1ZBMA 1SVXB 2ZZWA 3ILUB 4FEDA 4NF4A 5DYHA 1N84A 4JXIA 1MQJA 4E0WA 3TTNA 1NV7A 1NI9A 1FBCA 1DK4A 2F5XA 3K6WA 2Y7KA 2F35A 1UTBB 1US4A 3ZS6A 3FXUA 3HHFA 5F24A 2W7YA 1GGGA 2ZNTA 1FJ9A 3VE1B 4OVQA 3O6HA 3PMXA 4MAGA 4KYDA 2QPQA 1WDNA 3BFUA 2OWZA 3IB1A 1FPLA 4F31B 3TPAA 2LAOA 5I2KB 2CZIA 1LCTA 1NFTA 2B4LA 1DPPA 3OOAA 4BLAA 1TXFA 2X26A 4XIGQ 4RA1A 2Z8FA 2REGA 3TQLA 2ZZVA 1FPEA 1MPCA 4NGUA 2B4MA 3FIRA 2O68A 1NNKA 4ND9A 4I3EA 2PFZA 4N8GA 4POXA 3MW0A 1FSAA 3TTLA 4F1YA 2OJTA 2A5SA 3OSRA 4O3AA 4G68A 3A3UA 4F2QA 4KR5A 2DQVA 1NNFA 2OK2A 4DI4B 5TPAB 3OENA 3PMWA 4LATA 3IFAA 1ZLQA 4G8MA 4XFEA 1M5EA 4F3PA 2QFLA 2DWIA 5AA2B 4H5FA 4I3YA 4AQ4A 3PV0E 3QUFA 3WAFA 3ONMA 2PFYA 5CMCA 5ET6A 1IZ1A 4OYVA 2DWAA 5ESYA 3TAJA 1KA0A 4LP2B 4IO3A 1B46A 4C0RA 3JV9A 4U1OA 5JK4A 2A5TB 3DP4A 2ZYKA 2UYFA 1NV5A 1PBPA 3O66A 4GIZA 4DLDA 4NHBA 4H65A 2P2AA 1Y20A 4PP0A 1H76A 2XHDA 4U23A 3TCHA 3I5OA 3TTRA 3SEYA 3MVZA 4PF8A 4NF4B 1URDA 1YTVA 4ZZEA 4LA9A 3FBPA 4RY1A 2Q89A 1YXIA 3OELA 1Y1MA 3U65A 4HE2A 1SI0A 3K6VA 3C4MA 2OX3A 1MPDA 4I8CA 1HSLA 5J16A 1LFIA 1SBPA 2RKMA 3RT8A 2XXTA 3Q28A 2FA7A 2QL3A 3QSLA 3JZJA 1JNFA 1SYIA 4N8YA 4QF9A 3AXFA 4JDFA 1P1UA 3RGYA 4DE8A 1US5A 3MZ9A 3GYYA 3RY3A 3FUZA 1B7ZA 4XTCQ 1LBZA 1XVXA 2HXWA 4ZE9A 4ELRA 3TTKA 5I56A 2I6EA 4HE0A 4ZZAA 1Y3QA 4ZEFA 2KR0A 1B7UA 4MFIA 2RF1A 4G68B 3K02A 4I9DA 4YB7A 1B05A 1MS7A 4OHNA 1CNQA 4ELQA 1RDZA 3CFLA 4U21A 3GZGA 1SQYA 1FQBA 2Q2AA 1BLFA 2RCBA 1FQAA 1H43A 4OVSA 1PC3A 3E4RA 2ZXTA 4PTKA 2G93A 4OESA 3FXRA 3DP8A 4GVOA 2F36A 4PF6A 3QUJA 4EUOA 2DYXA 4P1LA 4BDQA 1A54A 1PB8A 4GOTA 2GHAA 1SW5A 5H8HA 2R71A 4GWZA 4IR8A 2XX7A 4N91A 3T9VA 3TCFA 1LFGA 1PBQA 3BBRA 5ITOA 5EYHA 1A40A 2THIA 1R1NA 2XXPA 1B3FA 4OA4A 2XWIA 5I57A 3K6XA 1FTMA 4F2OA 4YMAA 1ATGA 2IA4A 4NTLA 4KD5A 3U93A 5IZ1A 3PUWE 5ET8A 1J1NA 2HZKA 2H98A 1B32A 3TDJA 1A55A 4DI3D 1EU8A 2O69A 4IO6A 2QMXA 3JYRA 3N6UA 3E79A 2Z23A 4MIJA 5HPQA 4NQ8A 2XXYA 3LSWA 3MSTA 4YB6A 1OMPA 4GL8A 5CMMA 2PMSA 2OCUA 4FAJA 1IMAA 5F7VA 3O9PA 3QK6A 4H67A 2V4CA 3G3GA 2I0CA 5JTYA 3LSFB 3VVDA 1MY0A 5CMBA 5H8NA 3SEWA 1GR2A 2GHBA 4GF8A 3RN8A 1VE4A 1RYXA 3G7WA 4NE4A 3ZKKA 4MF3A 2NOOA 1IIWA 4JVCA 3IJXB 1DPEA 4R75A 4KXPA 1AMFA 4LQ2A 5CBSA 4GX3A 5I56B 2FNCA 1SW2A 3EHTA 1Y3PA 1LBBA 3FGSA 3KN8A 4RPNA 2D5WA 4PGNA 4XKQA 4FECA 3UGWA 3RYDA 2XWKA 3CG1A 4R74A 1SYHA 4PETA 1P1QA 4XXUA 4ESWA 4PBHA 4GQOA 3FXQA 2RINA 1RYOA 4ZECA 4PAKA 5H8HB 5JEIA 3C32A 3KN7A 3VXCA 4H46A 3LC8A 3VFJA 1CE2A 2YJPA 1Q35A 2Q2CA 1UQWA 3FVKA 1N7WA 3TKDA 4MEVA 3IFCA 5LDZA 2UYEA 1PB7A 1N76A 2VP1A 4Q8RA 4MNCA 4G8HA 3MWBA 2CMOA 1BKAA 4H8JA 3T1BA 5I57B 4LZ8A 3A29A 3N26A 4PFUA 1FPFA 2XWVA 4AB5A 2HAUA 2WX9A 1LAXA 1MXXA 4JBZA 1I6QA 2QS1A 1B1HA 3OO9A 5AE4A 4DIGA 2I4BA 1IXGA 1OLCA 1PDAA 4EXLA 1M5CA 1RDXA 1SD3A 3QAXA 5HM4B 2YLNA 4QRZA 4H0WA 3BIGA 3RQTA 2XA5A 5AA1A 4OERA 2PCRA 1N0TA 3F11A 3T22A 4MBPA 1N04A 3IK6B 4BDOA 3EPEA 4TQUQ 3M3KA 3FJMA 4P9KA 3IO4A 2F3DA 1FBEA 4FE8A 4P0IA 2P3NA 3S9LC 3RUMA 4R6HA 1AOVA 1TWYA 1NV0A 3SZPA 5H8NB 3KFMA 3W9WA 5FHNA 1I6AA 3KSXA 4TOZA 4QFPA 4ZEDA 2FHYA 2ZZXA 2L5VA 4YAHX 4X1BA 4X9TA 3MAMA 5EYFA 1DMBA 3KBRA 4XKPA 1S9TA 2XXKA 4WXJA 5ISUA 3VDFA 3B6TA 1UTHB 1QJMA 3THIA 3BFTA 2HPGA 2X7QA 3K01A 2F6PA 3IOTA 2RC9A 4EF2A 3SEUA 1SPIA 1AWBA 4IY5A 1LAFE 1MY2A 4M4GA 1YYZA 5I58A 5CI5A 1NNPA 5DVIA 1YZ0A 4GWSA 1FPIA 4OVRA 3FJ7A 3KC0A 5CRYA 4FIMA 3ZSFA 4PFBA 3U92A 4F39A 4OEVA 5L8DA 1D9QA 3SERA 4ZS9A 3G3FA 4P8BA 1OQGA 2GH9A 2CZKA 3BKIB 3IAZA 1FQDA 3VV5A 4ZEIA 2WEFA 1IEJA 2I48A 1QUIA 2XX8A 2QS4A 4GFRA 4PFYA 3PD9A 1MXYA 4X04A 1PB9A 1MG1A 3T96B 2VHAA 2ZYNA 1JEUA 3PPRA 2UVGA 2OLBA 4NF6A 1QW0A 2ABHA 4F19A 3SKPA 2PYYA 3MVXA 4Q5TA 1OLAA 4PFWA 1NV4A 3RTWB 1VFEA 3KZGA 1R9LA 2XXQA 3SEVA 2VT5A 3OXNA 2DS9A 4JSOA 2NVUB 1H3DA 4X8RA 4N07A 5DVFA 3CFZA 1D3KA 4O94A 4RK2A 4FORA 3W15C 3CSGA 1O7TA 4ISUA 5B70A 1NV6A 2UXAA 2NUVA 5A5LA 3EQ1A 3TYHA 2HCAA 4N6PA 1XVYA 3RPLA 4XF5A 1MQIA 1OIBA 4DZ1A 3O28A 4PGPA 1GVCA 5KCJA 4E0XA 4F1VA 4OETA 4WKMA 4HCWA 1UIUA 1TT1A 4XEQA 2UVJA 1A7LA 3FVGA 4QFLA 3IB0A 2HHMA 3CRBA 1G0HA 2F7AA 2V25A 1KZ8A 4YKIA 4C1TA 3L6GA 1QULA 1P99A 4R2BA 4JVIA 4HCYA 2QS2A 1VDWA 1EZOA 1OVTA 1MY4A 3H6TA 3TFLA 5I58B 1IMBA 1I6BA 3DP6A 2I58A 3V5AA 1GV8A 4MNPA 4LN5A 4NWDA 4OVTA 1A8EA 3E9XA 3KGCA 4YKKA 3ISPA 3S2VA 1IMFA 1B2HA 4KI0E 2H99A 4LZ5A 5T3JA 3S4UA 4JWXA 2F6GA 1Y9UA 5CBRA 4GRKA 3K6UA 1RDYA 4QFOA 5DT6A 2O1MA 1YCJA 4POWA 3O6IA 2F7CA 1Y4CA 2Y7IA 3GBAA 1EZPA 4P47A 4P1EA 4JWOA 5CM6A 1INPA 4KQPA 2F34A 1MM6A 2F3BA 1LBYA 3K0VA 1FBHA 3R26A 1TFDA 4P3LA 3FVOA 1QVSA 2QRYA 2ONSA 2V3UA 4G61A 3KN3A 1QUJA 1D9YA 5FHMA 4NF6B 5I3SA 5F1QA 4PFTA 3U8QA 3O97A 2BJJX 1IMEA 3IR1A 3IO6A 3H7MA 3IORA 4RYAA 3IOUA 5B7DA 1F9BA 2F97A 2QVRA 4NEDA 4THIA 3MUQA 2ALUA 4QFKA 4NAPA 3KOTA 1FQCA 2O7UA 1Y3NA 3PUVE 3UORA 4YZZA 3VLWA 2DP8A 4LQ5A 3PUXE 3C9HA 1DTGA 3RLFE 4ELPA 4QXDA 2PT2A 4BDNA 4KCDA 1LAHE 1O63A 3HPIA 1Z7ME 4QSEA 3RPLB 1D4NA 1LBCA 4GWYA 1NV2A 3H6UA 4PDHA 5AA3A 3ECRA 5KCJB 2HZLA 1FTJA 3M3LA 3PUYE 4Q0CA 2DE4A 3FJGA 3C31A 4JB7A 3SETA 4YMBA 1FBDA 3MBPA 4GL0A 1FRPA 1TFAA 3IX1A 1NH8A 2VPNA 1DSNA 4UA8A 1FPKA 1S7YA 1B3HA 3I3VA 4Z7EA 3FASA 3U72A 3W9VA 4DXBA 2VPOA 2QJEA 2BJIA 4IO5A 1B58A 2CEXA 4GWWA 4R9GA 2PBWA 1GTKA 2VD3A 1N7XA 3O2AA 1VR5A 1NL5A 1T0KA 4PBQA 1B9JA 2DDKA 4PC9A 4G68C 3U1OA 4GWOA 4N4UA 1LAGE 1Y4TA 3D1RA 1P1WA 1MDP1 2O7IA 1N3XA 1EH3A 4F3SA 3I6VA 5EQAA 4F3GA 1FPJA 4PE5B 2ESNA 4ZEKA 3PTYA 2CZHA 1SW1A 2HQ0A 3VXBA 1O64A 1SW4A 5DVJA 1QUKA 2RC7A 1POY1 2P0SA 4OXVA 3E3KA 2Q74A 1NUWA 2HEUA 2PT1A 3SESA 2O6AA 2H5YA 5LOMA 3OMBA 5CC2A 1UTHA 3T93B 3A3CA 1JW4A 2AL5A 1XHYA 3MVWA 3LUYA 1NKXA 1B5IA 4G8NA 2D3IA 4RXLA 1BK4A 1BTJA 2QMWA 3QIMA 4WEPA 1FJ6A 5BUUA 2F78A 2FYIA 2Y7WA 1Z7NE 3GBBA 1BIYA 2AIXA 4ZE8A 4PDDA 4XKNA 2DXRA 3WAEA 3HSTA 1JVXA 2QVVA 4NWCA 3MC2A 4N15A 1R6ZA 1NUZA 1R9QA 2CEYA 3PPNA 5TU0A 2DE2A 1IXIA 4XKRA 2AYSA 4HE1A 3IB2A 4RK9A 2Z8DA 1LGBC 1LB8A 2P1SA 2GQ1A 4KYSA 3FV1A 4EQ9A 2XD3A 2ANJA 5ITPA 4N6DA 3BIHA 3OEMA 5IZ3A 3V8XB 1URGA 3PUZE 1IUDA 4QSDA 2Y5KA 3H03A 3OO8A 4H8IA 5EHSA 1XI6A 2KLFA 5EQ7A 3IL1B 4GWXA 1LCFA 1JEVA 4MJOA 1MDQA 4PE3A 3TMGA 1MY1A 4AS4A 4QSCA 4GD5A 2E1SA 4YKJA 1NUYA 4DCXA 5IGAA 2XXXA 1M5BA 2Q8JA 3T66A 4MNIA 3UA8A 2Q9TA 4IY6A 1YPNA 3FXBA 4GLIA 1H45A 2OWSA 2Y84A 3N5LA 1MRPA 1A99A 3MQ9A 2OWTA 1MXUA 4GWUA 3LSLA 4LVQA 3S9EA 4HTGA 3A09A 4OFJA 4OFLA 2E0SA 2ZYMA 3P7IA 5ET7A 4O3CA 1ZIUA 2RC8A 4MX6A 3FATA 3D4CA 3M3FA 2R6GE 2KQZA 2UVHA 1I69A 4OMBA 1A8FA 3LSXA 1AL3A 3DLNA 4OANA 1B7HA 4DXUA 4EQBA 3MZ1A 4N13A 2PX1A 3PGFA
chains in the Genus database with same CATH topology
1HSJA 4F22A 1FTOA 5L9SA 3OEKA 3H06B 4OEUA 5I2NB 4JSDA 1OVBA 2RCAA 2AL4A 1NMUA 4L17A 2H25A 2M8CA 1MQDA 3FZVA 1MH4A 1S50A 2H4IA 3HO7A 2ONKE 3GLBA 4G77A 1BP5A 2DVCA 1FTLA 3CR9A 3HV1A 1B0HA 5AA2D 4EDPA 4TLLB 5DEXA 4Q30B 5BWJA 4ZEBA 1AH5A 4I62A 1NH7A 3EN3A 1Y1ZA 2DE3A 1ANFA 3O6GA 1MXVA 1ZTYA 5ICQA 1B4HA 5M2VA 5I59A 4C1UA 2V3TA 4M1VA 2VOZA 3ODBA 4OZ9A 3C33A 3PPPA 5CMKA 4IB2A 3G3IA 5EHMA 4UACA 2G29A 1SI1A 5ICTA 5L9MA 3UIFA 2V84A 3ILTB 5ELVA 1IITA 5H8QA 1B5JA 2V3QA 5TP9A 4ECFA 4GXAA 3EHSA 2HAVA 1RKMA 4AB6A 4R6YA 2DWHA 1USYE 3USDA 5H8SA 5H8FA 3KSJA 3K00A 3TELA 1B5HA 4U22A 4FJPA 1XS5A 4OFOA 4R72A 4P0GA 2XXHA 4I1DA 1KWHA 3H6VA 1XOCA 3S9MC 4HS7A 3E13X 4NF8A 4LONB 3G3HA 4OENA 1JW1A 2XXIA 1EZ9A 3H4ZA 1MM7A 4F1UA 3EF7A 4BDLA 3ZKLA 5A5XB 4H1XA 2XXVA 2DOJA 3M8UA 3T9HB 2VGQA 5DTBA 4NF5A 3IJOB 4JWYA 2Q88A 1L5TA 3OD7A 3GXAA 4DDDA 3TCGA 1ELJA 4IO2A 4U4XA 1VSOA 2XXWA 1IXCA 4H6DA 1FQFA 2OZZA 2O51A 5DEXB 3KG2A 4EXKA 4GXSB 4YKPA 3RTFB 2QSXA 3Q27A 4F29A 4MLQA 1CB6A 1B40A 4QFNA 5I84A 1B52A 5IAIA 4MLVA 4BDRA 4LZ7A 3B6WA 3T9UA 2B65A 4K3FA 3SDFA 4DXCA 3D4GA 5I59B 4X48A 1MQHA 5KZTA 1QKBA 2ZMBA 4ONYA 3Q26A 2DSFA 2I0BA 5L9OA 4YICA 3VLVA 2ZNSA 4BDMA 4EQ7A 5H8QB 1MY3A 3PPOA 5TP9B 1YAEA 2ONRA 4OWDA 3RNNA 4EF1A 3MP8A 1UIVA 5H8FB 4FATA 5KDTA 5AA4A 2CZLA 1IXHA 3CVGA 3MP6A 3SEXA 3KJ7A 2QS3A 1B1XA 2B3BA 2O1LA 4O3BA 5K2YA 3KJTA 2Z22A 4KHZE 4OQOA 2REJA 3B7DA 1FQEA 4NF8B 5FTHA 2WKYA 2DVZA 3Q29A 3MVYA 1URSA 3IOWA 1B51A 2VD2A 1B0LA 3FV2A 1JQFA 3OO7A 1HSEA 3IOVA 3VLUA 4F18A 1B3GA 1USYH 4Z0IA 2ZYOA 3VVEA 4KYEA 1LLSA 3G3JA 3UK4A 1M5FA 3G3KA 4NF5B 4PQJA 3DELB 3H3GA 1P1OA 1VFDA 2B3FA 3K1NA 4IO7A 1MH3A 2H9BA 2UVIA 3PU5A 3H6WA 3N94A 4KPTA 3CI8A 3FD3A 5J1DA 2R9JA 3CG3A 4ZDMA 3Q25A 1D9VA 3K4UA 4OTEA 5FTIA 2O84X 3HHGA 1WVJA 4QHQA 4TLMB 1WODA 3TQWA 1N3WA 4DCYA 1PEBA 3U94A 1ZMGA 2HFBA 3K1PA 3UP9A 3V83A 4OVJA 2YPNA 4R9FA 2V93A 3LR1A 2Y7RA 3PD8A 1ZKBA 3RT6B 2DWJA 3VVFA 1IQ7A 4G4PA 4KFQA 4IO4A 4NMYA 5I2NA 3DM0A 2GFEA 4MH5A 1II5A 2Y7PA 3OSQA 3LBSA 3HN0A 2NXOA 1MXWA 5HBCA 4LUBA 4ELOA 5FHOA 2I3WA 3KEIA 4U1ZA 1NNTA 2I3VA 3MPKA 1Q1KA 4U2RA 3UN6A 4G2ZA 1AIVA 4RJZA 3MP1A 2F8DA 1XC1A 4YU0A 4HW8A 4FEBA 5KDTB 4R2FA 3V89B 5AA4B 2Z8EA 1UTBA 3R7XA 4IGRA 3MPLA 2DXYA 1QKAA 3CFXA 3EHUA 4X1DA 1OQHA 3MJNA 3B6QA 2GRVA 3CIJA 1FW0A 5K2XA 3PPQA 3L6HA 5I2KA 1FCKA 1JW5A 4U4SA 2I49A 1DOTA 3QXMA 4YB5A 3C34A 3R6UA 1FTKA 1B6HA 3K1MA 4KCCA 2F7BA 2I4CA 3HCQA 1DTZA 1MQGA 1ZJLA 2OBGA 4R73A 2NWJA 3OO6A 3KOSA 3RPWA 4RNSA 1JETA 2PVUA 1MXZA 1LSTA 3FVNA 1XT8A 3QYTA 2X7PA 3MZBA 1LB9A 5TPAA 3TUSA 2D21A 3TEPA 1POTA 1H44A 5AA2A 1P1NA 4P11A 1ZU0A 3PMVA 4H5GA 1B3LA 1LFHA 1SDXA 2XD2A 2IEEA 1MPBA 1B4ZA 2XXUA 3O29A 2ZNUA 4WEDA 5JTYB 3TODA 1JVYA 3N6TA 3C35A 3K2DA 2A5TA 3CSBA 3C36A 1M5DA 3TTMA 4F3BA 4RPOA 4ESXA 2XX9A 1B3EA 3S9NC 5IKBA 3T9XB 3TZAA 5A5XA 2XXRA 4R6KA 4IGTA 1ZBMA 1SVXB 3ILUB 4FEDA 4NF4A 5DYHA 1N84A 4JXIA 1MQJA 4E0WA 3TTNA 2F5XA 3K6WA 2Y7KA 2F35A 1UTBB 1US4A 3ZS6A 3FXUA 3HHFA 2W7YA 1GGGA 2ZNTA 3VE1B 3O6HA 3PMXA 4KYDA 2QPQA 1WDNA 3BFUA 3IB1A 4F31B 3TPAA 2LAOA 5I2KB 1LCTA 1NFTA 1DPPA 3OOAA 4BLAA 1TXFA 2X26A 4XIGQ 4RA1A 2Z8FA 2REGA 3TQLA 1MPCA 3FIRA 2O68A 1NNKA 4ND9A 4POXA 3MW0A 3TTLA 4F1YA 2OJTA 2A5SA 3OSRA 4O3AA 4G68A 3A3UA 4F2QA 4KR5A 2DQVA 1NNFA 2OK2A 5TPAB 3OENA 3PMWA 4LATA 1ZLQA 4G8MA 1M5EA 4F3PA 2DWIA 5AA2B 4H5FA 4AQ4A 3PV0E 3QUFA 3WAFA 3ONMA 5CMCA 1IZ1A 4OYVA 2DWAA 3TAJA 4LP2B 4IO3A 1B46A 4C0RA 3JV9A 4U1OA 5JK4A 2A5TB 3DP4A 2ZYKA 2UYFA 1PBPA 3O66A 4GIZA 4DLDA 4H65A 2P2AA 1Y20A 4PP0A 1H76A 2XHDA 4U23A 3TCHA 3I5OA 3TTRA 3SEYA 3MVZA 4NF4B 1URDA 1YTVA 4ZZEA 4LA9A 4RY1A 2Q89A 3OELA 1Y1MA 1SI0A 3K6VA 3C4MA 1MPDA 4I8CA 1HSLA 1LFIA 1SBPA 2RKMA 3RT8A 2XXTA 3Q28A 2FA7A 2QL3A 3QSLA 3JZJA 1JNFA 1SYIA 4QF9A 3AXFA 4JDFA 1P1UA 3RGYA 4DE8A 1US5A 3MZ9A 3RY3A 3FUZA 1B7ZA 4XTCQ 1XVXA 2HXWA 4ZE9A 4ELRA 3TTKA 5I56A 2I6EA 4ZZAA 1Y3QA 4ZEFA 1B7UA 4MFIA 2RF1A 4G68B 3K02A 4I9DA 4YB7A 1B05A 1MS7A 4OHNA 4ELQA 3CFLA 4U21A 3GZGA 1SQYA 1FQBA 2Q2AA 1BLFA 2RCBA 1FQAA 1H43A 1PC3A 3E4RA 2ZXTA 2G93A 4OESA 3FXRA 3DP8A 4GVOA 2F36A 3QUJA 4EUOA 2DYXA 4BDQA 1A54A 1PB8A 4GOTA 2GHAA 1SW5A 5H8HA 2R71A 2XX7A 3T9VA 3TCFA 1LFGA 1PBQA 3BBRA 5ITOA 1A40A 2THIA 1R1NA 2XXPA 1B3FA 5I57A 3K6XA 1FTMA 4F2OA 4YMAA 1ATGA 2IA4A 4NTLA 4KD5A 3U93A 3PUWE 1J1NA 2HZKA 2H98A 1B32A 3TDJA 1A55A 1EU8A 2O69A 4IO6A 2QMXA 3JYRA 3N6UA 2Z23A 5HPQA 2XXYA 3LSWA 4YB6A 1OMPA 4GL8A 5CMMA 2PMSA 2OCUA 4FAJA 5F7VA 3O9PA 3QK6A 4H67A 3G3GA 5JTYA 2I0CA 3LSFB 3VVDA 1MY0A 5CMBA 5H8NA 3SEWA 1GR2A 2GHBA 4GF8A 3RN8A 1VE4A 1RYXA 3G7WA 4NE4A 3ZKKA 4MF3A 2NOOA 1IIWA 3IJXB 1DPEA 4R75A 1AMFA 4LQ2A 5CBSA 5I56B 2FNCA 1SW2A 3EHTA 1Y3PA 1LBBA 3FGSA 3KN8A 4RPNA 2D5WA 4XKQA 4FECA 3UGWA 3CG1A 4R74A 1SYHA 4PETA 1P1QA 4XXUA 4ESWA 4GQOA 3FXQA 2RINA 1RYOA 4ZECA 5H8HB 5JEIA 3C32A 3KN7A 3VXCA 3LC8A 3VFJA 1CE2A 2YJPA 1Q35A 2Q2CA 1UQWA 3FVKA 1N7WA 3TKDA 2UYEA 1PB7A 1N76A 2VP1A 4Q8RA 4G8HA 3MWBA 2CMOA 1BKAA 4H8JA 5I57B 4LZ8A 3N26A 4PFUA 4AB5A 2HAUA 1LAXA 1MXXA 4JBZA 1I6QA 2QS1A 1B1HA 3OO9A 5AE4A 4DIGA 2I4BA 1IXGA 1OLCA 1PDAA 4EXLA 1M5CA 1SD3A 3QAXA 5HM4B 2YLNA 4QRZA 4H0WA 3RQTA 5AA1A 4OERA 1N0TA 3F11A 3T22A 4MBPA 1N04A 3IK6B 4BDOA 3EPEA 4TQUQ 3M3KA 3FJMA 3IO4A 4FE8A 4P0IA 3S9LC 3RUMA 4R6HA 1AOVA 1TWYA 5H8NB 3KFMA 3W9WA 5FHNA 1I6AA 3KSXA 4TOZA 4QFPA 4ZEDA 4YAHX 4X1BA 4X9TA 3MAMA 5EYFA 1DMBA 3KBRA 4XKPA 1S9TA 4WXJA 5ISUA 3VDFA 3B6TA 1UTHB 1QJMA 3THIA 3BFTA 2X7QA 3K01A 2F6PA 3IOTA 2RC9A 4EF2A 3SEUA 4IY5A 1LAFE 1MY2A 4M4GA 5I58A 5CI5A 1NNPA 5DVIA 3FJ7A 5CRYA 4FIMA 3ZSFA 3U92A 4F39A 4OEVA 5L8DA 3SERA 4ZS9A 3G3FA 1OQGA 2GH9A 3BKIB 3IAZA 1FQDA 3VV5A 4ZEIA 1IEJA 2I48A 1QUIA 2XX8A 2QS4A 4GFRA 4PFYA 3PD9A 1MXYA 1PB9A 1MG1A 3T96B 2VHAA 2ZYNA 1JEUA 3PPRA 2UVGA 2OLBA 4NF6A 1QW0A 2ABHA 4F19A 3SKPA 2PYYA 3MVXA 4Q5TA 1OLAA 4PFWA 3RTWB 1VFEA 3KZGA 1R9LA 2XXQA 3SEVA 3OXNA 2DS9A 4JSOA 2NVUB 1H3DA 4N07A 5DVFA 3CFZA 1D3KA 4RK2A 4FORA 3W15C 3CSGA 1O7TA 4ISUA 5B70A 2UXAA 2NUVA 3EQ1A 3TYHA 2HCAA 4N6PA 1XVYA 1MQIA 1OIBA 4DZ1A 3O28A 1GVCA 5KCJA 4E0XA 4F1VA 4OETA 4WKMA 4HCWA 1UIUA 1TT1A 2UVJA 1A7LA 3FVGA 4QFLA 3IB0A 3CRBA 2F7AA 2V25A 4YKIA 4C1TA 3L6GA 1QULA 1P99A 4R2BA 4HCYA 2QS2A 1EZOA 1OVTA 1MY4A 3H6TA 3TFLA 5I58B 1I6BA 3DP6A 2I58A 3V5AA 1GV8A 4NWDA 1A8EA 3E9XA 3KGCA 4YKKA 3S2VA 1B2HA 4KI0E 2H99A 4LZ5A 3S4UA 4JWXA 2F6GA 1Y9UA 5CBRA 4GRKA 3K6UA 4QFOA 5DT6A 2O1MA 1YCJA 4POWA 3O6IA 2F7CA 1Y4CA 2Y7IA 3GBAA 1EZPA 4JWOA 5CM6A 4KQPA 2F34A 1MM6A 3K0VA 3R26A 1TFDA 3FVOA 1QVSA 2QRYA 2ONSA 2V3UA 3KN3A 1QUJA 1D9YA 5FHMA 4NF6B 5F1QA 4PFTA 3U8QA 3O97A 2BJJX 3IR1A 3IO6A 3H7MA 3IORA 4RYAA 3IOUA 5B7DA 1F9BA 2F97A 4NEDA 4THIA 3MUQA 2ALUA 4QFKA 3KOTA 1FQCA 2O7UA 1Y3NA 3PUVE 3UORA 4YZZA 3VLWA 2DP8A 4LQ5A 3PUXE 3C9HA 1DTGA 3RLFE 4ELPA 2PT2A 4BDNA 4KCDA 1LAHE 1O63A 3HPIA 1Z7ME 4QSEA 1D4NA 1LBCA 3H6UA 5AA3A 3ECRA 5KCJB 2HZLA 1FTJA 3M3LA 3PUYE 4Q0CA 2DE4A 3FJGA 3C31A 4JB7A 3SETA 4YMBA 3MBPA 4GL0A 1TFAA 3IX1A 1NH8A 1DSNA 4UA8A 1S7YA 1B3HA 3I3VA 4Z7EA 3FASA 3U72A 3W9VA 4DXBA 2QJEA 4IO5A 1B58A 4R9GA 2PBWA 1GTKA 2VD3A 1N7XA 3O2AA 1VR5A 1NL5A 1T0KA 1B9JA 4G68C 3U1OA 4GWOA 1LAGE 1Y4TA 1P1WA 1MDP1 2O7IA 1N3XA 1EH3A 4F3SA 3I6VA 4F3GA 4PE5B 2ESNA 4ZEKA 1SW1A 2HQ0A 3VXBA 1O64A 1SW4A 5DVJA 1QUKA 2RC7A 1POY1 2P0SA 4OXVA 3E3KA 2HEUA 2PT1A 3SESA 2O6AA 2H5YA 5LOMA 3OMBA 5CC2A 1UTHA 3T93B 3A3CA 1JW4A 2AL5A 1XHYA 3MVWA 3LUYA 1NKXA 1B5IA 4G8NA 2D3IA 4RXLA 1BTJA 2QMWA 3QIMA 4WEPA 5BUUA 2F78A 2FYIA 2Y7WA 1Z7NE 3GBBA 1BIYA 2AIXA 4ZE8A 4XKNA 2DXRA 3WAEA 3HSTA 1JVXA 4NWCA 3MC2A 1R6ZA 1R9QA 3PPNA 5TU0A 2DE2A 1IXIA 4XKRA 2AYSA 3IB2A 4RK9A 2Z8DA 1LGBC 1LB8A 2P1SA 4KYSA 3FV1A 4EQ9A 2XD3A 2ANJA 5ITPA 3OEMA 3V8XB 1URGA 3PUZE 1IUDA 4QSDA 3H03A 3OO8A 4H8IA 5EHSA 2KLFA 3IL1B 1LCFA 1JEVA 1MDQA 3TMGA 1MY1A 4QSCA 4GD5A 2E1SA 4YKJA 4DCXA 2XXXA 1M5BA 2Q8JA 3T66A 3UA8A 2Q9TA 4IY6A 1YPNA 4GLIA 1H45A 2OWSA 2Y84A 3N5LA 1MRPA 1A99A 3MQ9A 2OWTA 1MXUA 4LVQA 3LSLA 3S9EA 4HTGA 3A09A 4OFJA 4OFLA 2E0SA 2ZYMA 3P7IA 4O3CA 1ZIUA 2RC8A 3FATA 3D4CA 3M3FA 2R6GE 2UVHA 1I69A 4OMBA 1A8FA 4DXUA 3LSXA 1AL3A 3DLNA 1B7HA 4EQBA 3MZ1A 4N13A 2PX1A 3PGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HSJ A;  4F22 A;  1FTO A;  5L9S A;  3OEK A;  3H06 B;  4OEU A;  5I2N B;  4JSD A;  1OVB A;  2RCA A;  2AL4 A;  1NMU A;  4L17 A;  2H25 A;  2M8C A;  1MQD A;  3FZV A;  1MH4 A;  1S50 A;  2H4I A;  3HO7 A;  2ONK E;  3GLB A;  4G77 A;  1BP5 A;  2DVC A;  1FTL A;  3CR9 A;  3HV1 A;  1B0H A;  5AA2 D;  4EDP A;  4TLL B;  5DEX A;  4Q30 B;  5BWJ A;  4ZEB A;  1AH5 A;  4I62 A;  1NH7 A;  3EN3 A;  1Y1Z A;  2DE3 A;  1ANF A;  3O6G A;  1MXV A;  1ZTY A;  5ICQ A;  1B4H A;  5M2V A;  5I59 A;  4C1U A;  2V3T A;  4M1V A;  2VOZ A;  3ODB A;  4OZ9 A;  3C33 A;  3PPP A;  5CMK A;  4IB2 A;  3G3I A;  5EHM A;  4UAC A;  2G29 A;  1SI1 A;  5ICT A;  5L9M A;  3UIF A;  2V84 A;  3ILT B;  5ELV A;  1IIT A;  5H8Q A;  1B5J A;  2V3Q A;  5TP9 A;  4ECF A;  4GXA A;  3EHS A;  2HAV A;  1RKM A;  4AB6 A;  4R6Y A;  2DWH A;  1USY E;  3USD A;  5H8S A;  5H8F A;  3KSJ A;  3K00 A;  3TEL A;  1B5H A;  4U22 A;  4FJP A;  1XS5 A;  4OFO A;  4R72 A;  4P0G A;  2XXH A;  4I1D A;  1KWH A;  3H6V A;  1XOC A;  3S9M C;  4HS7 A;  3E13 X;  4NF8 A;  4LON B;  3G3H A;  4OEN A;  1JW1 A;  2XXI A;  1EZ9 A;  3H4Z A;  1MM7 A;  4F1U A;  3EF7 A;  4BDL A;  3ZKL A;  5A5X B;  4H1X A;  2XXV A;  2DOJ A;  3M8U A;  3T9H B;  2VGQ A;  5DTB A;  4NF5 A;  3IJO B;  4JWY A;  2Q88 A;  1L5T A;  3OD7 A;  3GXA A;  4DDD A;  3TCG A;  1ELJ A;  4IO2 A;  4U4X A;  1VSO A;  2XXW A;  1IXC A;  4H6D A;  1FQF A;  2OZZ A;  2O51 A;  5DEX B;  3KG2 A;  4EXK A;  4GXS B;  4YKP A;  3RTF B;  2QSX A;  3Q27 A;  4F29 A;  4MLQ A;  1CB6 A;  1B40 A;  4QFN A;  5I84 A;  1B52 A;  5IAI A;  4MLV A;  4BDR A;  4LZ7 A;  3B6W A;  3T9U A;  2B65 A;  4K3F A;  3SDF A;  4DXC A;  3D4G A;  5I59 B;  4X48 A;  1MQH A;  5KZT A;  1QKB A;  2ZMB A;  4ONY A;  3Q26 A;  2DSF A;  2I0B A;  5L9O A;  4YIC A;  3VLV A;  2ZNS A;  4BDM A;  4EQ7 A;  5H8Q B;  1MY3 A;  3PPO A;  5TP9 B;  1YAE A;  2ONR A;  4OWD A;  3RNN A;  4EF1 A;  3MP8 A;  1UIV A;  5H8F B;  4FAT A;  5KDT A;  5AA4 A;  2CZL A;  1IXH A;  3CVG A;  3MP6 A;  3SEX A;  3KJ7 A;  2QS3 A;  1B1X A;  2B3B A;  2O1L A;  4O3B A;  5K2Y A;  3KJT A;  2Z22 A;  4KHZ E;  4OQO A;  2REJ A;  3B7D A;  1FQE A;  4NF8 B;  5FTH A;  2WKY A;  2DVZ A;  3Q29 A;  3MVY A;  1URS A;  3IOW A;  1B51 A;  2VD2 A;  1B0L A;  3FV2 A;  1JQF A;  3OO7 A;  1HSE A;  3IOV A;  3VLU A;  4F18 A;  1B3G A;  1USY H;  4Z0I A;  2ZYO A;  3VVE A;  4KYE A;  1LLS A;  3G3J A;  3UK4 A;  1M5F A;  3G3K A;  4NF5 B;  4PQJ A;  3DEL B;  3H3G A;  1P1O A;  1VFD A;  2B3F A;  3K1N A;  4IO7 A;  1MH3 A;  2H9B A;  2UVI A;  3PU5 A;  3H6W A;  3N94 A;  4KPT A;  3CI8 A;  3FD3 A;  5J1D A;  2R9J A;  3CG3 A;  4ZDM A;  3Q25 A;  1D9V A;  3K4U A;  4OTE A;  5FTI A;  2O84 X;  3HHG A;  1WVJ A;  4QHQ A;  4TLM B;  1WOD A;  3TQW A;  1N3W A;  4DCY A;  1PEB A;  3U94 A;  1ZMG A;  2HFB A;  3K1P A;  3UP9 A;  3V83 A;  4OVJ A;  2YPN A;  4R9F A;  2V93 A;  3LR1 A;  2Y7R A;  3PD8 A;  1ZKB A;  3RT6 B;  2DWJ A;  3VVF A;  1IQ7 A;  4G4P A;  4KFQ A;  4IO4 A;  4NMY A;  5I2N A;  3DM0 A;  2GFE A;  4MH5 A;  1II5 A;  2Y7P A;  3OSQ A;  3LBS A;  3HN0 A;  2NXO A;  1MXW A;  5HBC A;  4LUB A;  4ELO A;  5FHO A;  2I3W A;  3KEI A;  4U1Z A;  1NNT A;  2I3V A;  3MPK A;  1Q1K A;  4U2R A;  3UN6 A;  4G2Z A;  1AIV A;  4RJZ A;  3MP1 A;  2F8D A;  1XC1 A;  4YU0 A;  4HW8 A;  4FEB A;  5KDT B;  4R2F A;  3V89 B;  5AA4 B;  2Z8E A;  1UTB A;  3R7X A;  4IGR A;  3MPL A;  2DXY A;  1QKA A;  3CFX A;  3EHU A;  4X1D A;  1OQH A;  3MJN A;  3B6Q A;  2GRV A;  3CIJ A;  1FW0 A;  5K2X A;  3PPQ A;  3L6H A;  5I2K A;  1FCK A;  1JW5 A;  4U4S A;  2I49 A;  1DOT A;  3QXM A;  4YB5 A;  3C34 A;  3R6U A;  1FTK A;  1B6H A;  3K1M A;  4KCC A;  2F7B A;  2I4C A;  3HCQ A;  1DTZ A;  1MQG A;  1ZJL A;  2OBG A;  4R73 A;  2NWJ A;  3OO6 A;  3KOS A;  3RPW A;  4RNS A;  1JET A;  2PVU A;  1MXZ A;  1LST A;  3FVN A;  1XT8 A;  3QYT A;  2X7P A;  3MZB A;  1LB9 A;  5TPA A;  3TUS A;  2D21 A;  3TEP A;  1POT A;  1H44 A;  5AA2 A;  1P1N A;  4P11 A;  1ZU0 A;  3PMV A;  4H5G A;  1B3L A;  1LFH A;  1SDX A;  2XD2 A;  2IEE A;  1MPB A;  1B4Z A;  2XXU A;  3O29 A;  2ZNU A;  4WED A;  5JTY B;  3TOD A;  1JVY A;  3N6T A;  3C35 A;  3K2D A;  2A5T A;  3CSB A;  3C36 A;  1M5D A;  3TTM A;  4F3B A;  4RPO A;  4ESX A;  2XX9 A;  1B3E A;  3S9N C;  5IKB A;  3T9X B;  3TZA A;  5A5X A;  2XXR A;  4R6K A;  4IGT A;  1ZBM A;  1SVX B;  3ILU B;  4FED A;  4NF4 A;  5DYH A;  1N84 A;  4JXI A;  1MQJ A;  4E0W A;  3TTN A;  2F5X A;  3K6W A;  2Y7K A;  2F35 A;  1UTB B;  1US4 A;  3ZS6 A;  3FXU A;  3HHF A;  2W7Y A;  1GGG A;  2ZNT A;  3VE1 B;  3O6H A;  3PMX A;  4KYD A;  2QPQ A;  1WDN A;  3BFU A;  3IB1 A;  4F31 B;  3TPA A;  2LAO A;  5I2K B;  1LCT A;  1NFT A;  1DPP A;  3OOA A;  4BLA A;  1TXF A;  2X26 A;  4XIG Q;  4RA1 A;  2Z8F A;  2REG A;  3TQL A;  1MPC A;  3FIR A;  2O68 A;  1NNK A;  4ND9 A;  4POX A;  3MW0 A;  3TTL A;  4F1Y A;  2OJT A;  2A5S A;  3OSR A;  4O3A A;  4G68 A;  3A3U A;  4F2Q A;  4KR5 A;  2DQV A;  1NNF A;  2OK2 A;  5TPA B;  3OEN A;  3PMW A;  4LAT A;  1ZLQ A;  4G8M A;  1M5E A;  4F3P A;  2DWI A;  5AA2 B;  4H5F A;  4AQ4 A;  3PV0 E;  3QUF A;  3WAF A;  3ONM A;  5CMC A;  1IZ1 A;  4OYV A;  2DWA A;  3TAJ A;  4LP2 B;  4IO3 A;  1B46 A;  4C0R A;  3JV9 A;  4U1O A;  5JK4 A;  2A5T B;  3DP4 A;  2ZYK A;  2UYF A;  1PBP A;  3O66 A;  4GIZ A;  4DLD A;  4H65 A;  2P2A A;  1Y20 A;  4PP0 A;  1H76 A;  2XHD A;  4U23 A;  3TCH A;  3I5O A;  3TTR A;  3SEY A;  3MVZ A;  4NF4 B;  1URD A;  1YTV A;  4ZZE A;  4LA9 A;  4RY1 A;  2Q89 A;  3OEL A;  1Y1M A;  1SI0 A;  3K6V A;  3C4M A;  1MPD A;  4I8C A;  1HSL A;  1LFI A;  1SBP A;  2RKM A;  3RT8 A;  2XXT A;  3Q28 A;  2FA7 A;  2QL3 A;  3QSL A;  3JZJ A;  1JNF A;  1SYI A;  4QF9 A;  3AXF A;  4JDF A;  1P1U A;  3RGY A;  4DE8 A;  1US5 A;  3MZ9 A;  3RY3 A;  3FUZ A;  1B7Z A;  4XTC Q;  1XVX A;  2HXW A;  4ZE9 A;  4ELR A;  3TTK A;  5I56 A;  2I6E A;  4ZZA A;  1Y3Q A;  4ZEF A;  1B7U A;  4MFI A;  2RF1 A;  4G68 B;  3K02 A;  4I9D A;  4YB7 A;  1B05 A;  1MS7 A;  4OHN A;  4ELQ A;  3CFL A;  4U21 A;  3GZG A;  1SQY A;  1FQB A;  2Q2A A;  1BLF A;  2RCB A;  1FQA A;  1H43 A;  1PC3 A;  3E4R A;  2ZXT A;  2G93 A;  4OES A;  3FXR A;  3DP8 A;  4GVO A;  2F36 A;  3QUJ A;  4EUO A;  2DYX A;  4BDQ A;  1A54 A;  1PB8 A;  4GOT A;  2GHA A;  1SW5 A;  5H8H A;  2R71 A;  2XX7 A;  3T9V A;  3TCF A;  1LFG A;  1PBQ A;  3BBR A;  5ITO A;  1A40 A;  2THI A;  1R1N A;  2XXP A;  1B3F A;  5I57 A;  3K6X A;  1FTM A;  4F2O A;  4YMA A;  1ATG A;  2IA4 A;  4NTL A;  4KD5 A;  3U93 A;  3PUW E;  1J1N A;  2HZK A;  2H98 A;  1B32 A;  3TDJ A;  1A55 A;  1EU8 A;  2O69 A;  4IO6 A;  2QMX A;  3JYR A;  3N6U A;  2Z23 A;  5HPQ A;  2XXY A;  3LSW A;  4YB6 A;  1OMP A;  4GL8 A;  5CMM A;  2PMS A;  2OCU A;  4FAJ A;  5F7V A;  3O9P A;  3QK6 A;  4H67 A;  3G3G A;  5JTY A;  2I0C A;  3LSF B;  3VVD A;  1MY0 A;  5CMB A;  5H8N A;  3SEW A;  1GR2 A;  2GHB A;  4GF8 A;  3RN8 A;  1VE4 A;  1RYX A;  3G7W A;  4NE4 A;  3ZKK A;  4MF3 A;  2NOO A;  1IIW A;  3IJX B;  1DPE A;  4R75 A;  1AMF A;  4LQ2 A;  5CBS A;  5I56 B;  2FNC A;  1SW2 A;  3EHT A;  1Y3P A;  1LBB A;  3FGS A;  3KN8 A;  4RPN A;  2D5W A;  4XKQ A;  4FEC A;  3UGW A;  3CG1 A;  4R74 A;  1SYH A;  4PET A;  1P1Q A;  4XXU A;  4ESW A;  4GQO A;  3FXQ A;  2RIN A;  1RYO A;  4ZEC A;  5H8H B;  5JEI A;  3C32 A;  3KN7 A;  3VXC A;  3LC8 A;  3VFJ A;  1CE2 A;  2YJP A;  1Q35 A;  2Q2C A;  1UQW A;  3FVK A;  1N7W A;  3TKD A;  2UYE A;  1PB7 A;  1N76 A;  2VP1 A;  4Q8R A;  4G8H A;  3MWB A;  2CMO A;  1BKA A;  4H8J A;  5I57 B;  4LZ8 A;  3N26 A;  4PFU A;  4AB5 A;  2HAU A;  1LAX A;  1MXX A;  4JBZ A;  1I6Q A;  2QS1 A;  1B1H A;  3OO9 A;  5AE4 A;  4DIG A;  2I4B A;  1IXG A;  1OLC A;  1PDA A;  4EXL A;  1M5C A;  1SD3 A;  3QAX A;  5HM4 B;  2YLN A;  4QRZ A;  4H0W A;  3RQT A;  5AA1 A;  4OER A;  1N0T A;  3F11 A;  3T22 A;  4MBP A;  1N04 A;  3IK6 B;  4BDO A;  3EPE A;  4TQU Q;  3M3K A;  3FJM A;  3IO4 A;  4FE8 A;  4P0I A;  3S9L C;  3RUM A;  4R6H A;  1AOV A;  1TWY A;  5H8N B;  3KFM A;  3W9W A;  5FHN A;  1I6A A;  3KSX A;  4TOZ A;  4QFP A;  4ZED A;  4YAH X;  4X1B A;  4X9T A;  3MAM A;  5EYF A;  1DMB A;  3KBR A;  4XKP A;  1S9T A;  4WXJ A;  5ISU A;  3VDF A;  3B6T A;  1UTH B;  1QJM A;  3THI A;  3BFT A;  2X7Q A;  3K01 A;  2F6P A;  3IOT A;  2RC9 A;  4EF2 A;  3SEU A;  4IY5 A;  1LAF E;  1MY2 A;  4M4G A;  5I58 A;  5CI5 A;  1NNP A;  5DVI A;  3FJ7 A;  5CRY A;  4FIM A;  3ZSF A;  3U92 A;  4F39 A;  4OEV A;  5L8D A;  3SER A;  4ZS9 A;  3G3F A;  1OQG A;  2GH9 A;  3BKI B;  3IAZ A;  1FQD A;  3VV5 A;  4ZEI A;  1IEJ A;  2I48 A;  1QUI A;  2XX8 A;  2QS4 A;  4GFR A;  4PFY A;  3PD9 A;  1MXY A;  1PB9 A;  1MG1 A;  3T96 B;  2VHA A;  2ZYN A;  1JEU A;  3PPR A;  2UVG A;  2OLB A;  4NF6 A;  1QW0 A;  2ABH A;  4F19 A;  3SKP A;  2PYY A;  3MVX A;  4Q5T A;  1OLA A;  4PFW A;  3RTW B;  1VFE A;  3KZG A;  1R9L A;  2XXQ A;  3SEV A;  3OXN A;  2DS9 A;  4JSO A;  2NVU B;  1H3D A;  4N07 A;  5DVF A;  3CFZ A;  1D3K A;  4RK2 A;  4FOR A;  3W15 C;  3CSG A;  1O7T A;  4ISU A;  5B70 A;  2UXA A;  2NUV A;  3EQ1 A;  3TYH A;  2HCA A;  4N6P A;  1XVY A;  1MQI A;  1OIB A;  4DZ1 A;  3O28 A;  1GVC A;  5KCJ A;  4E0X A;  4F1V A;  4OET A;  4WKM A;  4HCW A;  1UIU A;  1TT1 A;  2UVJ A;  1A7L A;  3FVG A;  4QFL A;  3IB0 A;  3CRB A;  2F7A A;  2V25 A;  4YKI A;  4C1T A;  3L6G A;  1QUL A;  1P99 A;  4R2B A;  4HCY A;  2QS2 A;  1EZO A;  1OVT A;  1MY4 A;  3H6T A;  3TFL A;  5I58 B;  1I6B A;  3DP6 A;  2I58 A;  3V5A A;  1GV8 A;  4NWD A;  1A8E A;  3E9X A;  3KGC A;  4YKK A;  3S2V A;  1B2H A;  4KI0 E;  2H99 A;  4LZ5 A;  3S4U A;  4JWX A;  2F6G A;  1Y9U A;  5CBR A;  4GRK A;  3K6U A;  4QFO A;  5DT6 A;  2O1M A;  1YCJ A;  4POW A;  3O6I A;  2F7C A;  1Y4C A;  2Y7I A;  3GBA A;  1EZP A;  4JWO A;  5CM6 A;  4KQP A;  2F34 A;  1MM6 A;  3K0V A;  3R26 A;  1TFD A;  3FVO A;  1QVS A;  2QRY A;  2ONS A;  2V3U A;  3KN3 A;  1QUJ A;  1D9Y A;  5FHM A;  4NF6 B;  5F1Q A;  4PFT A;  3U8Q A;  3O97 A;  2BJJ X;  3IR1 A;  3IO6 A;  3H7M A;  3IOR A;  4RYA A;  3IOU A;  5B7D A;  1F9B A;  2F97 A;  4NED A;  4THI A;  3MUQ A;  2ALU A;  4QFK A;  3KOT A;  1FQC A;  2O7U A;  1Y3N A;  3PUV E;  3UOR A;  4YZZ A;  3VLW A;  2DP8 A;  4LQ5 A;  3PUX E;  3C9H A;  1DTG A;  3RLF E;  4ELP A;  2PT2 A;  4BDN A;  4KCD A;  1LAH E;  1O63 A;  3HPI A;  1Z7M E;  4QSE A;  1D4N A;  1LBC A;  3H6U A;  5AA3 A;  3ECR A;  5KCJ B;  2HZL A;  1FTJ A;  3M3L A;  3PUY E;  4Q0C A;  2DE4 A;  3FJG A;  3C31 A;  4JB7 A;  3SET A;  4YMB A;  3MBP A;  4GL0 A;  1TFA A;  3IX1 A;  1NH8 A;  1DSN A;  4UA8 A;  1S7Y A;  1B3H A;  3I3V A;  4Z7E A;  3FAS A;  3U72 A;  3W9V A;  4DXB A;  2QJE A;  4IO5 A;  1B58 A;  4R9G A;  2PBW A;  1GTK A;  2VD3 A;  1N7X A;  3O2A A;  1VR5 A;  1NL5 A;  1T0K A;  1B9J A;  4G68 C;  3U1O A;  4GWO A;  1LAG E;  1Y4T A;  1P1W A;  1MDP 1;  2O7I A;  1N3X A;  1EH3 A;  4F3S A;  3I6V A;  4F3G A;  4PE5 B;  2ESN A;  4ZEK A;  1SW1 A;  2HQ0 A;  3VXB A;  1O64 A;  1SW4 A;  5DVJ A;  1QUK A;  2RC7 A;  1POY 1;  2P0S A;  4OXV A;  3E3K A;  2HEU A;  2PT1 A;  3SES A;  2O6A A;  2H5Y A;  5LOM A;  3OMB A;  5CC2 A;  1UTH A;  3T93 B;  3A3C A;  1JW4 A;  2AL5 A;  1XHY A;  3MVW A;  3LUY A;  1NKX A;  1B5I A;  4G8N A;  2D3I A;  4RXL A;  1BTJ A;  2QMW A;  3QIM A;  4WEP A;  5BUU A;  2F78 A;  2FYI A;  2Y7W A;  1Z7N E;  3GBB A;  1BIY A;  2AIX A;  4ZE8 A;  4XKN A;  2DXR A;  3WAE A;  3HST A;  1JVX A;  4NWC A;  3MC2 A;  1R6Z A;  1R9Q A;  3PPN A;  5TU0 A;  2DE2 A;  1IXI A;  4XKR A;  2AYS A;  3IB2 A;  4RK9 A;  2Z8D A;  1LGB C;  1LB8 A;  2P1S A;  4KYS A;  3FV1 A;  4EQ9 A;  2XD3 A;  2ANJ A;  5ITP A;  3OEM A;  3V8X B;  1URG A;  3PUZ E;  1IUD A;  4QSD A;  3H03 A;  3OO8 A;  4H8I A;  5EHS A;  2KLF A;  3IL1 B;  1LCF A;  1JEV A;  1MDQ A;  3TMG A;  1MY1 A;  4QSC A;  4GD5 A;  2E1S A;  4YKJ A;  4DCX A;  2XXX A;  1M5B A;  2Q8J A;  3T66 A;  3UA8 A;  2Q9T A;  4IY6 A;  1YPN A;  4GLI A;  1H45 A;  2OWS A;  2Y84 A;  3N5L A;  1MRP A;  1A99 A;  3MQ9 A;  2OWT A;  1MXU A;  4LVQ A;  3LSL A;  3S9E A;  4HTG A;  3A09 A;  4OFJ A;  4OFL A;  2E0S A;  2ZYM A;  3P7I A;  4O3C A;  1ZIU A;  2RC8 A;  3FAT A;  3D4C A;  3M3F A;  2R6G E;  2UVH A;  1I69 A;  4OMB A;  1A8F A;  4DXU A;  3LSX A;  1AL3 A;  3DLN A;  1B7H A;  4EQB A;  3MZ1 A;  4N13 A;  2PX1 A;  3PGF A; 
#chains in the Genus database with same CATH topology
 1HSJ A;  4F22 A;  1FTO A;  5L9S A;  3OEK A;  5I5P A;  3H06 B;  4OEU A;  5I2N B;  4JSD A;  1OVB A;  2RCA A;  2AL4 A;  1NMU A;  2FIE A;  4UAB A;  4L17 A;  2H25 A;  2M8C A;  1MQD A;  3FZV A;  1MH4 A;  1S50 A;  4NX1 A;  2H4I A;  3HO7 A;  2ONK E;  3GLB A;  3CHG A;  4G77 A;  1BP5 A;  2DVC A;  4H45 A;  1FTL A;  3CR9 A;  3HV1 A;  1B0H A;  5AA2 D;  4EDP A;  4TLL B;  5DEX A;  4Q30 B;  1JP4 A;  4GBW A;  3T0J A;  5BWJ A;  4ZEB A;  2Y5L A;  1IMD A;  1AH5 A;  4I62 A;  1NH7 A;  1Q9D A;  3EN3 A;  1Y1Z A;  2DE3 A;  1ANF A;  2FBP A;  4PFI A;  3O6G A;  1MXV A;  1ZTY A;  5ICQ A;  1B4H A;  5M2V A;  5I59 A;  4C1U A;  2V3T A;  4M1V A;  5IZ3 B;  2VOZ A;  3ODB A;  4OZ9 A;  3C33 A;  3PPP A;  5CMK A;  4IB2 A;  3G3I A;  5EHM A;  4UAC A;  4NF0 A;  2G29 A;  1SI1 A;  5ICT A;  5L9M A;  3UIF A;  2V84 A;  3ILT B;  5ELV A;  1IIT A;  5H8Q A;  1B5J A;  2V3Q A;  5TP9 A;  4ECF A;  4GXA A;  3EHS A;  2HAV A;  1RKM A;  4AB6 A;  4R6Y A;  2DWH A;  5EQ9 A;  1USY E;  3USD A;  3HFU A;  5H8S A;  5H8F A;  3KSJ A;  3K00 A;  3TEL A;  1B5H A;  1NV3 A;  4U22 A;  5LTC A;  4FJP A;  1FPD A;  1XS5 A;  4OFO A;  4R72 A;  4P0G A;  2XXH A;  4I1D A;  1KWH A;  3H6V A;  1XOC A;  3S9M C;  4HS7 A;  3E13 X;  2WBD A;  4NF8 A;  4LON B;  4MMP A;  3G3H A;  1LEV A;  4OEN A;  1JW1 A;  2XXI A;  5FBP A;  1EZ9 A;  3H4Z A;  1MM7 A;  4F1U A;  1KA1 A;  1FPB A;  4O8M A;  3EF7 A;  4BDL A;  2JJK A;  3ZKL A;  5A5X B;  4H1X A;  2XXV A;  2DOJ A;  3M8U A;  5IM2 A;  4P56 A;  3T9H B;  5ET5 A;  2VGQ A;  5DTB A;  4NF5 A;  3IJO B;  4JWY A;  2Q88 A;  4I40 A;  1L5T A;  3OD7 A;  3GXA A;  4DDD A;  3ROJ A;  1ELJ A;  2XWO A;  4HXV A;  3TCG A;  4IO2 A;  4U4X A;  2FVZ A;  1VSO A;  2XXW A;  1IXC A;  4H6D A;  1DCU A;  3MYU A;  1FQF A;  2OZZ A;  2O51 A;  5DEX B;  3KG2 A;  4EXK A;  4GXS B;  4YKP A;  3RTF B;  2QSX A;  3Q27 A;  4F29 A;  4MLQ A;  1CB6 A;  1B40 A;  4QFN A;  5EYG A;  5I84 A;  1B52 A;  5IAI A;  4MLV A;  4BDR A;  3B50 A;  4LZ7 A;  3B6W A;  3T9U A;  2B65 A;  4K3F A;  3SDF A;  4DXC A;  3D4G A;  5I59 B;  4X48 A;  1MQH A;  5KZT A;  1QGX A;  1QKB A;  2ZMB A;  4ONY A;  3Q26 A;  2DSF A;  2I0B A;  4AS5 A;  5L9O A;  4YIC A;  2HXR A;  3VLV A;  1K9Y A;  2ZNS A;  4BDM A;  4EQ7 A;  1G0I A;  5H8Q B;  1MY3 A;  3PPO A;  5TP9 B;  1YAE A;  2ONR A;  4OWD A;  3RNN A;  4EF1 A;  3MP8 A;  1UIV A;  5H8F B;  4FAT A;  4MCO A;  2WYK A;  5KDT A;  5AA4 A;  2CZL A;  1IXH A;  3CVG A;  3MP6 A;  3SEX A;  3KJ7 A;  2QS3 A;  1B1X A;  2B3B A;  2O1L A;  4O3B A;  5K2Y A;  3KJT A;  2Z22 A;  4KHZ E;  4JVD A;  1LBW A;  3E78 A;  4OQO A;  2REJ A;  3B7D A;  1FQE A;  4NF8 B;  2Q8M A;  5FTH A;  4O7I A;  2WKY A;  2DVZ A;  4PAF A;  3Q29 A;  3MVY A;  1URS A;  1EYK A;  3IOW A;  1B51 A;  2VD2 A;  1B0L A;  3FV2 A;  1JQF A;  3OO7 A;  1HSE A;  3IOV A;  3VLU A;  4F18 A;  1B3G A;  1USY H;  4Z0I A;  2ZYO A;  4OVP A;  3VVE A;  5IZZ A;  4KYE A;  1LLS A;  3G3J A;  3UK4 A;  1M5F A;  3G3K A;  4NF5 B;  4PQJ A;  3KC1 A;  3DEL B;  3H3G A;  1P1O A;  1VFD A;  4PAI A;  2B3F A;  3K1N A;  4IO7 A;  1MH3 A;  2H9B A;  2UVI A;  3PU5 A;  3H6W A;  3N94 A;  4KPT A;  3CI8 A;  3FD3 A;  5J1D A;  2R9J A;  3CG3 A;  4ZDM A;  1FTA A;  2FIX A;  2P3V A;  3Q25 A;  1D9V A;  3K4U A;  4OTE A;  4GX6 A;  5FTI A;  2O84 X;  3HHG A;  1K9Z A;  1WVJ A;  4QHQ A;  4N81 A;  4TLM B;  1WOD A;  3TQW A;  1N3W A;  5DW8 A;  1NV1 A;  4DCY A;  1PEB A;  3U94 A;  1ZMG A;  2HFB A;  3K1P A;  3UP9 A;  3V83 A;  4OVJ A;  2YPN A;  4R9F A;  2V93 A;  3LR1 A;  2Y7R A;  1EYI A;  3PD8 A;  1ZKB A;  3RT6 B;  2DWJ A;  4NG7 A;  3VVF A;  1IQ7 A;  4G4P A;  4KFQ A;  4IO4 A;  4NMY A;  5I2N A;  3DM0 A;  2GFE A;  4MH5 A;  3QMF A;  1II5 A;  2Y7P A;  3OSQ A;  3LBS A;  3HN0 A;  2NXO A;  1MXW A;  5HBC A;  3NOH A;  4LUB A;  4O7M A;  4ELO A;  5FHO A;  2I3W A;  3KEI A;  4U1Z A;  1NNT A;  2I3V A;  3MPK A;  1Q1K A;  4U2R A;  3UN6 A;  4G2Z A;  1AIV A;  2QVU A;  1EYJ A;  4RJZ A;  3MP1 A;  2F8D A;  3LV0 A;  1XC1 A;  4YU0 A;  1LBV A;  5I7I A;  4HW8 A;  4FEB A;  5KDT B;  4R2F A;  2WYP A;  4MHF A;  3V89 B;  5AA4 B;  2Z8E A;  4PFR A;  1UTB A;  3R7X A;  4IGR A;  4FBP A;  1IMC A;  3MPL A;  2DXY A;  1QKA A;  3CFX A;  3EHU A;  4X1D A;  1OQH A;  3MJN A;  3B6Q A;  2GRV A;  3CIJ A;  1FW0 A;  5K2X A;  3PPQ A;  4PCD A;  3L6H A;  5I2K A;  1FCK A;  1JW5 A;  4U4S A;  2I49 A;  1DOT A;  3QXM A;  4YB5 A;  3C34 A;  3R6U A;  1FTK A;  4QBA A;  1B6H A;  3KBZ A;  3K1M A;  4KCC A;  1FBG A;  2F7B A;  2I4C A;  3HCQ A;  1DTZ A;  1MQG A;  1ZJL A;  3LUZ A;  1FBP A;  2OBG A;  4GX4 A;  4R73 A;  2NWJ A;  3OO6 A;  3KOS A;  3RPW A;  4RNS A;  1JET A;  2PVU A;  1MXZ A;  1LST A;  3FVN A;  1XT8 A;  3QYT A;  2X7P A;  3MZB A;  1LB9 A;  5TPA A;  1FPG A;  2MKZ A;  1LBX A;  3TUS A;  2D21 A;  4N17 A;  1FBF A;  3EKI A;  3TEP A;  1NUX A;  1POT A;  2R8T A;  1H44 A;  5AA2 A;  3B8B A;  1P1N A;  4P11 A;  1ZU0 A;  3PMV A;  4H5G A;  1B3L A;  1LFH A;  1SDX A;  2XD2 A;  4N6K A;  2IEE A;  1MPB A;  1B4Z A;  2XXU A;  3O29 A;  2ZNU A;  4NN3 A;  4WED A;  5JTY B;  3TOD A;  1JVY A;  3N6T A;  3C35 A;  3K2D A;  2A5T A;  3CSB A;  3C36 A;  1M5D A;  3TTM A;  4F3B A;  4RPO A;  4ESX A;  2XX9 A;  5EQ8 A;  1B3E A;  3S9N C;  5IKB A;  3T9X B;  2WBB A;  3TZA A;  4GBV A;  1DBZ A;  5A5X A;  2XXR A;  4R6K A;  4IGT A;  1ZBM A;  1SVX B;  2ZZW A;  3ILU B;  4FED A;  4NF4 A;  5DYH A;  1N84 A;  4JXI A;  1MQJ A;  4E0W A;  3TTN A;  1NV7 A;  1NI9 A;  1FBC A;  1DK4 A;  2F5X A;  3K6W A;  2Y7K A;  2F35 A;  1UTB B;  1US4 A;  3ZS6 A;  3FXU A;  3HHF A;  5F24 A;  2W7Y A;  1GGG A;  2ZNT A;  1FJ9 A;  3VE1 B;  4OVQ A;  3O6H A;  3PMX A;  4MAG A;  4KYD A;  2QPQ A;  1WDN A;  3BFU A;  2OWZ A;  3IB1 A;  1FPL A;  4F31 B;  3TPA A;  2LAO A;  5I2K B;  2CZI A;  1LCT A;  1NFT A;  2B4L A;  1DPP A;  3OOA A;  4BLA A;  1TXF A;  2X26 A;  4XIG Q;  4RA1 A;  2Z8F A;  2REG A;  3TQL A;  2ZZV A;  1FPE A;  1MPC A;  4NGU A;  2B4M A;  3FIR A;  2O68 A;  1NNK A;  4ND9 A;  4I3E A;  2PFZ A;  4N8G A;  4POX A;  3MW0 A;  1FSA A;  3TTL A;  4F1Y A;  2OJT A;  2A5S A;  3OSR A;  4O3A A;  4G68 A;  3A3U A;  4F2Q A;  4KR5 A;  2DQV A;  1NNF A;  2OK2 A;  4DI4 B;  5TPA B;  3OEN A;  3PMW A;  4LAT A;  3IFA A;  1ZLQ A;  4G8M A;  4XFE A;  1M5E A;  4F3P A;  2QFL A;  2DWI A;  5AA2 B;  4H5F A;  4I3Y A;  4AQ4 A;  3PV0 E;  3QUF A;  3WAF A;  3ONM A;  2PFY A;  5CMC A;  5ET6 A;  1IZ1 A;  4OYV A;  2DWA A;  5ESY A;  3TAJ A;  1KA0 A;  4LP2 B;  4IO3 A;  1B46 A;  4C0R A;  3JV9 A;  4U1O A;  5JK4 A;  2A5T B;  3DP4 A;  2ZYK A;  2UYF A;  1NV5 A;  1PBP A;  3O66 A;  4GIZ A;  4DLD A;  4NHB A;  4H65 A;  2P2A A;  1Y20 A;  4PP0 A;  1H76 A;  2XHD A;  4U23 A;  3TCH A;  3I5O A;  3TTR A;  3SEY A;  3MVZ A;  4PF8 A;  4NF4 B;  1URD A;  1YTV A;  4ZZE A;  4LA9 A;  3FBP A;  4RY1 A;  2Q89 A;  1YXI A;  3OEL A;  1Y1M A;  3U65 A;  4HE2 A;  1SI0 A;  3K6V A;  3C4M A;  2OX3 A;  1MPD A;  4I8C A;  1HSL A;  5J16 A;  1LFI A;  1SBP A;  2RKM A;  3RT8 A;  2XXT A;  3Q28 A;  2FA7 A;  2QL3 A;  3QSL A;  3JZJ A;  1JNF A;  1SYI A;  4N8Y A;  4QF9 A;  3AXF A;  4JDF A;  1P1U A;  3RGY A;  4DE8 A;  1US5 A;  3MZ9 A;  3GYY A;  3RY3 A;  3FUZ A;  1B7Z A;  4XTC Q;  1LBZ A;  1XVX A;  2HXW A;  4ZE9 A;  4ELR A;  3TTK A;  5I56 A;  2I6E A;  4HE0 A;  4ZZA A;  1Y3Q A;  4ZEF A;  2KR0 A;  1B7U A;  4MFI A;  2RF1 A;  4G68 B;  3K02 A;  4I9D A;  4YB7 A;  1B05 A;  1MS7 A;  4OHN A;  1CNQ A;  4ELQ A;  1RDZ A;  3CFL A;  4U21 A;  3GZG A;  1SQY A;  1FQB A;  2Q2A A;  1BLF A;  2RCB A;  1FQA A;  1H43 A;  4OVS A;  1PC3 A;  3E4R A;  2ZXT A;  4PTK A;  2G93 A;  4OES A;  3FXR A;  3DP8 A;  4GVO A;  2F36 A;  4PF6 A;  3QUJ A;  4EUO A;  2DYX A;  4P1L A;  4BDQ A;  1A54 A;  1PB8 A;  4GOT A;  2GHA A;  1SW5 A;  5H8H A;  2R71 A;  4GWZ A;  4IR8 A;  2XX7 A;  4N91 A;  3T9V A;  3TCF A;  1LFG A;  1PBQ A;  3BBR A;  5ITO A;  5EYH A;  1A40 A;  2THI A;  1R1N A;  2XXP A;  1B3F A;  4OA4 A;  2XWI A;  5I57 A;  3K6X A;  1FTM A;  4F2O A;  4YMA A;  1ATG A;  2IA4 A;  4NTL A;  4KD5 A;  3U93 A;  5IZ1 A;  3PUW E;  5ET8 A;  1J1N A;  2HZK A;  2H98 A;  1B32 A;  3TDJ A;  1A55 A;  4DI3 D;  1EU8 A;  2O69 A;  4IO6 A;  2QMX A;  3JYR A;  3N6U A;  3E79 A;  2Z23 A;  4MIJ A;  5HPQ A;  4NQ8 A;  2XXY A;  3LSW A;  3MST A;  4YB6 A;  1OMP A;  4GL8 A;  5CMM A;  2PMS A;  2OCU A;  4FAJ A;  1IMA A;  5F7V A;  3O9P A;  3QK6 A;  4H67 A;  2V4C A;  3G3G A;  2I0C A;  5JTY A;  3LSF B;  3VVD A;  1MY0 A;  5CMB A;  5H8N A;  3SEW A;  1GR2 A;  2GHB A;  4GF8 A;  3RN8 A;  1VE4 A;  1RYX A;  3G7W A;  4NE4 A;  3ZKK A;  4MF3 A;  2NOO A;  1IIW A;  4JVC A;  3IJX B;  1DPE A;  4R75 A;  4KXP A;  1AMF A;  4LQ2 A;  5CBS A;  4GX3 A;  5I56 B;  2FNC A;  1SW2 A;  3EHT A;  1Y3P A;  1LBB A;  3FGS A;  3KN8 A;  4RPN A;  2D5W A;  4PGN A;  4XKQ A;  4FEC A;  3UGW A;  3RYD A;  2XWK A;  3CG1 A;  4R74 A;  1SYH A;  4PET A;  1P1Q A;  4XXU A;  4ESW A;  4PBH A;  4GQO A;  3FXQ A;  2RIN A;  1RYO A;  4ZEC A;  4PAK A;  5H8H B;  5JEI A;  3C32 A;  3KN7 A;  3VXC A;  4H46 A;  3LC8 A;  3VFJ A;  1CE2 A;  2YJP A;  1Q35 A;  2Q2C A;  1UQW A;  3FVK A;  1N7W A;  3TKD A;  4MEV A;  3IFC A;  5LDZ A;  2UYE A;  1PB7 A;  1N76 A;  2VP1 A;  4Q8R A;  4MNC A;  4G8H A;  3MWB A;  2CMO A;  1BKA A;  4H8J A;  3T1B A;  5I57 B;  4LZ8 A;  3A29 A;  3N26 A;  4PFU A;  1FPF A;  2XWV A;  4AB5 A;  2HAU A;  2WX9 A;  1LAX A;  1MXX A;  4JBZ A;  1I6Q A;  2QS1 A;  1B1H A;  3OO9 A;  5AE4 A;  4DIG A;  2I4B A;  1IXG A;  1OLC A;  1PDA A;  4EXL A;  1M5C A;  1RDX A;  1SD3 A;  3QAX A;  5HM4 B;  2YLN A;  4QRZ A;  4H0W A;  3BIG A;  3RQT A;  2XA5 A;  5AA1 A;  4OER A;  2PCR A;  1N0T A;  3F11 A;  3T22 A;  4MBP A;  1N04 A;  3IK6 B;  4BDO A;  3EPE A;  4TQU Q;  3M3K A;  3FJM A;  4P9K A;  3IO4 A;  2F3D A;  1FBE A;  4FE8 A;  4P0I A;  2P3N A;  3S9L C;  3RUM A;  4R6H A;  1AOV A;  1TWY A;  1NV0 A;  3SZP A;  5H8N B;  3KFM A;  3W9W A;  5FHN A;  1I6A A;  3KSX A;  4TOZ A;  4QFP A;  4ZED A;  2FHY A;  2ZZX A;  2L5V A;  4YAH X;  4X1B A;  4X9T A;  3MAM A;  5EYF A;  1DMB A;  3KBR A;  4XKP A;  1S9T A;  2XXK A;  4WXJ A;  5ISU A;  3VDF A;  3B6T A;  1UTH B;  1QJM A;  3THI A;  3BFT A;  2HPG A;  2X7Q A;  3K01 A;  2F6P A;  3IOT A;  2RC9 A;  4EF2 A;  3SEU A;  1SPI A;  1AWB A;  4IY5 A;  1LAF E;  1MY2 A;  4M4G A;  1YYZ A;  5I58 A;  5CI5 A;  1NNP A;  5DVI A;  1YZ0 A;  4GWS A;  1FPI A;  4OVR A;  3FJ7 A;  3KC0 A;  5CRY A;  4FIM A;  3ZSF A;  4PFB A;  3U92 A;  4F39 A;  4OEV A;  5L8D A;  1D9Q A;  3SER A;  4ZS9 A;  3G3F A;  4P8B A;  1OQG A;  2GH9 A;  2CZK A;  3BKI B;  3IAZ A;  1FQD A;  3VV5 A;  4ZEI A;  2WEF A;  1IEJ A;  2I48 A;  1QUI A;  2XX8 A;  2QS4 A;  4GFR A;  4PFY A;  3PD9 A;  1MXY A;  4X04 A;  1PB9 A;  1MG1 A;  3T96 B;  2VHA A;  2ZYN A;  1JEU A;  3PPR A;  2UVG A;  2OLB A;  4NF6 A;  1QW0 A;  2ABH A;  4F19 A;  3SKP A;  2PYY A;  3MVX A;  4Q5T A;  1OLA A;  4PFW A;  1NV4 A;  3RTW B;  1VFE A;  3KZG A;  1R9L A;  2XXQ A;  3SEV A;  2VT5 A;  3OXN A;  2DS9 A;  4JSO A;  2NVU B;  1H3D A;  4X8R A;  4N07 A;  5DVF A;  3CFZ A;  1D3K A;  4O94 A;  4RK2 A;  4FOR A;  3W15 C;  3CSG A;  1O7T A;  4ISU A;  5B70 A;  1NV6 A;  2UXA A;  2NUV A;  5A5L A;  3EQ1 A;  3TYH A;  2HCA A;  4N6P A;  1XVY A;  3RPL A;  4XF5 A;  1MQI A;  1OIB A;  4DZ1 A;  3O28 A;  4PGP A;  1GVC A;  5KCJ A;  4E0X A;  4F1V A;  4OET A;  4WKM A;  4HCW A;  1UIU A;  1TT1 A;  4XEQ A;  2UVJ A;  1A7L A;  3FVG A;  4QFL A;  3IB0 A;  2HHM A;  3CRB A;  1G0H A;  2F7A A;  2V25 A;  1KZ8 A;  4YKI A;  4C1T A;  3L6G A;  1QUL A;  1P99 A;  4R2B A;  4JVI A;  4HCY A;  2QS2 A;  1VDW A;  1EZO A;  1OVT A;  1MY4 A;  3H6T A;  3TFL A;  5I58 B;  1IMB A;  1I6B A;  3DP6 A;  2I58 A;  3V5A A;  1GV8 A;  4MNP A;  4LN5 A;  4NWD A;  4OVT A;  1A8E A;  3E9X A;  3KGC A;  4YKK A;  3ISP A;  3S2V A;  1IMF A;  1B2H A;  4KI0 E;  2H99 A;  4LZ5 A;  5T3J A;  3S4U A;  4JWX A;  2F6G A;  1Y9U A;  5CBR A;  4GRK A;  3K6U A;  1RDY A;  4QFO A;  5DT6 A;  2O1M A;  1YCJ A;  4POW A;  3O6I A;  2F7C A;  1Y4C A;  2Y7I A;  3GBA A;  1EZP A;  4P47 A;  4P1E A;  4JWO A;  5CM6 A;  1INP A;  4KQP A;  2F34 A;  1MM6 A;  2F3B A;  1LBY A;  3K0V A;  1FBH A;  3R26 A;  1TFD A;  4P3L A;  3FVO A;  1QVS A;  2QRY A;  2ONS A;  2V3U A;  4G61 A;  3KN3 A;  1QUJ A;  1D9Y A;  5FHM A;  4NF6 B;  5I3S A;  5F1Q A;  4PFT A;  3U8Q A;  3O97 A;  2BJJ X;  1IME A;  3IR1 A;  3IO6 A;  3H7M A;  3IOR A;  4RYA A;  3IOU A;  5B7D A;  1F9B A;  2F97 A;  2QVR A;  4NED A;  4THI A;  3MUQ A;  2ALU A;  4QFK A;  4NAP A;  3KOT A;  1FQC A;  2O7U A;  1Y3N A;  3PUV E;  3UOR A;  4YZZ A;  3VLW A;  2DP8 A;  4LQ5 A;  3PUX E;  3C9H A;  1DTG A;  3RLF E;  4ELP A;  4QXD A;  2PT2 A;  4BDN A;  4KCD A;  1LAH E;  1O63 A;  3HPI A;  1Z7M E;  4QSE A;  3RPL B;  1D4N A;  1LBC A;  4GWY A;  1NV2 A;  3H6U A;  4PDH A;  5AA3 A;  3ECR A;  5KCJ B;  2HZL A;  1FTJ A;  3M3L A;  3PUY E;  4Q0C A;  2DE4 A;  3FJG A;  3C31 A;  4JB7 A;  3SET A;  4YMB A;  1FBD A;  3MBP A;  4GL0 A;  1FRP A;  1TFA A;  3IX1 A;  1NH8 A;  2VPN A;  1DSN A;  4UA8 A;  1FPK A;  1S7Y A;  1B3H A;  3I3V A;  4Z7E A;  3FAS A;  3U72 A;  3W9V A;  4DXB A;  2VPO A;  2QJE A;  2BJI A;  4IO5 A;  1B58 A;  2CEX A;  4GWW A;  4R9G A;  2PBW A;  1GTK A;  2VD3 A;  1N7X A;  3O2A A;  1VR5 A;  1NL5 A;  1T0K A;  4PBQ A;  1B9J A;  2DDK A;  4PC9 A;  4G68 C;  3U1O A;  4GWO A;  4N4U A;  1LAG E;  1Y4T A;  3D1R A;  1P1W A;  1MDP 1;  2O7I A;  1N3X A;  1EH3 A;  4F3S A;  3I6V A;  5EQA A;  4F3G A;  1FPJ A;  4PE5 B;  2ESN A;  4ZEK A;  3PTY A;  2CZH A;  1SW1 A;  2HQ0 A;  3VXB A;  1O64 A;  1SW4 A;  5DVJ A;  1QUK A;  2RC7 A;  1POY 1;  2P0S A;  4OXV A;  3E3K A;  2Q74 A;  1NUW A;  2HEU A;  2PT1 A;  3SES A;  2O6A A;  2H5Y A;  5LOM A;  3OMB A;  5CC2 A;  1UTH A;  3T93 B;  3A3C A;  1JW4 A;  2AL5 A;  1XHY A;  3MVW A;  3LUY A;  1NKX A;  1B5I A;  4G8N A;  2D3I A;  4RXL A;  1BK4 A;  1BTJ A;  2QMW A;  3QIM A;  4WEP A;  1FJ6 A;  5BUU A;  2F78 A;  2FYI A;  2Y7W A;  1Z7N E;  3GBB A;  1BIY A;  2AIX A;  4ZE8 A;  4PDD A;  4XKN A;  2DXR A;  3WAE A;  3HST A;  1JVX A;  2QVV A;  4NWC A;  3MC2 A;  4N15 A;  1R6Z A;  1NUZ A;  1R9Q A;  2CEY A;  3PPN A;  5TU0 A;  2DE2 A;  1IXI A;  4XKR A;  2AYS A;  4HE1 A;  3IB2 A;  4RK9 A;  2Z8D A;  1LGB C;  1LB8 A;  2P1S A;  2GQ1 A;  4KYS A;  3FV1 A;  4EQ9 A;  2XD3 A;  2ANJ A;  5ITP A;  4N6D A;  3BIH A;  3OEM A;  5IZ3 A;  3V8X B;  1URG A;  3PUZ E;  1IUD A;  4QSD A;  2Y5K A;  3H03 A;  3OO8 A;  4H8I A;  5EHS A;  1XI6 A;  2KLF A;  5EQ7 A;  3IL1 B;  4GWX A;  1LCF A;  1JEV A;  4MJO A;  1MDQ A;  4PE3 A;  3TMG A;  1MY1 A;  4AS4 A;  4QSC A;  4GD5 A;  2E1S A;  4YKJ A;  1NUY A;  4DCX A;  5IGA A;  2XXX A;  1M5B A;  2Q8J A;  3T66 A;  4MNI A;  3UA8 A;  2Q9T A;  4IY6 A;  1YPN A;  3FXB A;  4GLI A;  1H45 A;  2OWS A;  2Y84 A;  3N5L A;  1MRP A;  1A99 A;  3MQ9 A;  2OWT A;  1MXU A;  4GWU A;  3LSL A;  4LVQ A;  3S9E A;  4HTG A;  3A09 A;  4OFJ A;  4OFL A;  2E0S A;  2ZYM A;  3P7I A;  5ET7 A;  4O3C A;  1ZIU A;  2RC8 A;  4MX6 A;  3FAT A;  3D4C A;  3M3F A;  2R6G E;  2KQZ A;  2UVH A;  1I69 A;  4OMB A;  1A8F A;  3LSX A;  1AL3 A;  3DLN A;  4OAN A;  1B7H A;  4DXU A;  4EQB A;  3MZ1 A;  4N13 A;  2PX1 A;  3PGF A; 
#chains in the Genus database with same CATH homology
 1HSJ A;  4F22 A;  1FTO A;  5L9S A;  3OEK A;  3H06 B;  4OEU A;  5I2N B;  4JSD A;  1OVB A;  2RCA A;  2AL4 A;  1NMU A;  4L17 A;  2H25 A;  2M8C A;  1MQD A;  3FZV A;  1MH4 A;  1S50 A;  2H4I A;  3HO7 A;  2ONK E;  3GLB A;  4G77 A;  1BP5 A;  2DVC A;  1FTL A;  3CR9 A;  3HV1 A;  1B0H A;  5AA2 D;  4EDP A;  4TLL B;  5DEX A;  4Q30 B;  5BWJ A;  4ZEB A;  1AH5 A;  4I62 A;  1NH7 A;  3EN3 A;  1Y1Z A;  2DE3 A;  1ANF A;  3O6G A;  1MXV A;  1ZTY A;  5ICQ A;  1B4H A;  5M2V A;  5I59 A;  4C1U A;  2V3T A;  4M1V A;  2VOZ A;  3ODB A;  4OZ9 A;  3C33 A;  3PPP A;  5CMK A;  4IB2 A;  3G3I A;  5EHM A;  4UAC A;  2G29 A;  1SI1 A;  5ICT A;  5L9M A;  3UIF A;  2V84 A;  3ILT B;  5ELV A;  1IIT A;  5H8Q A;  1B5J A;  2V3Q A;  5TP9 A;  4ECF A;  4GXA A;  3EHS A;  2HAV A;  1RKM A;  4AB6 A;  4R6Y A;  2DWH A;  1USY E;  3USD A;  5H8S A;  5H8F A;  3KSJ A;  3K00 A;  3TEL A;  1B5H A;  4U22 A;  4FJP A;  1XS5 A;  4OFO A;  4R72 A;  4P0G A;  2XXH A;  4I1D A;  1KWH A;  3H6V A;  1XOC A;  3S9M C;  4HS7 A;  3E13 X;  4NF8 A;  4LON B;  3G3H A;  4OEN A;  1JW1 A;  2XXI A;  1EZ9 A;  3H4Z A;  1MM7 A;  4F1U A;  3EF7 A;  4BDL A;  3ZKL A;  5A5X B;  4H1X A;  2XXV A;  2DOJ A;  3M8U A;  3T9H B;  2VGQ A;  5DTB A;  4NF5 A;  3IJO B;  4JWY A;  2Q88 A;  1L5T A;  3OD7 A;  3GXA A;  4DDD A;  3TCG A;  1ELJ A;  4IO2 A;  4U4X A;  1VSO A;  2XXW A;  1IXC A;  4H6D A;  1FQF A;  2OZZ A;  2O51 A;  5DEX B;  3KG2 A;  4EXK A;  4GXS B;  4YKP A;  3RTF B;  2QSX A;  3Q27 A;  4F29 A;  4MLQ A;  1CB6 A;  1B40 A;  4QFN A;  5I84 A;  1B52 A;  5IAI A;  4MLV A;  4BDR A;  4LZ7 A;  3B6W A;  3T9U A;  2B65 A;  4K3F A;  3SDF A;  4DXC A;  3D4G A;  5I59 B;  4X48 A;  1MQH A;  5KZT A;  1QKB A;  2ZMB A;  4ONY A;  3Q26 A;  2DSF A;  2I0B A;  5L9O A;  4YIC A;  3VLV A;  2ZNS A;  4BDM A;  4EQ7 A;  5H8Q B;  1MY3 A;  3PPO A;  5TP9 B;  1YAE A;  2ONR A;  4OWD A;  3RNN A;  4EF1 A;  3MP8 A;  1UIV A;  5H8F B;  4FAT A;  5KDT A;  5AA4 A;  2CZL A;  1IXH A;  3CVG A;  3MP6 A;  3SEX A;  3KJ7 A;  2QS3 A;  1B1X A;  2B3B A;  2O1L A;  4O3B A;  5K2Y A;  3KJT A;  2Z22 A;  4KHZ E;  4OQO A;  2REJ A;  3B7D A;  1FQE A;  4NF8 B;  5FTH A;  2WKY A;  2DVZ A;  3Q29 A;  3MVY A;  1URS A;  3IOW A;  1B51 A;  2VD2 A;  1B0L A;  3FV2 A;  1JQF A;  3OO7 A;  1HSE A;  3IOV A;  3VLU A;  4F18 A;  1B3G A;  1USY H;  4Z0I A;  2ZYO A;  3VVE A;  4KYE A;  1LLS A;  3G3J A;  3UK4 A;  1M5F A;  3G3K A;  4NF5 B;  4PQJ A;  3DEL B;  3H3G A;  1P1O A;  1VFD A;  2B3F A;  3K1N A;  4IO7 A;  1MH3 A;  2H9B A;  2UVI A;  3PU5 A;  3H6W A;  3N94 A;  4KPT A;  3CI8 A;  3FD3 A;  5J1D A;  2R9J A;  3CG3 A;  4ZDM A;  3Q25 A;  1D9V A;  3K4U A;  4OTE A;  5FTI A;  2O84 X;  3HHG A;  1WVJ A;  4QHQ A;  4TLM B;  1WOD A;  3TQW A;  1N3W A;  4DCY A;  1PEB A;  3U94 A;  1ZMG A;  2HFB A;  3K1P A;  3UP9 A;  3V83 A;  4OVJ A;  2YPN A;  4R9F A;  2V93 A;  3LR1 A;  2Y7R A;  3PD8 A;  1ZKB A;  3RT6 B;  2DWJ A;  3VVF A;  1IQ7 A;  4G4P A;  4KFQ A;  4IO4 A;  4NMY A;  5I2N A;  3DM0 A;  2GFE A;  4MH5 A;  1II5 A;  2Y7P A;  3OSQ A;  3LBS A;  3HN0 A;  2NXO A;  1MXW A;  5HBC A;  4LUB A;  4ELO A;  5FHO A;  2I3W A;  3KEI A;  4U1Z A;  1NNT A;  2I3V A;  3MPK A;  1Q1K A;  4U2R A;  3UN6 A;  4G2Z A;  1AIV A;  4RJZ A;  3MP1 A;  2F8D A;  1XC1 A;  4YU0 A;  4HW8 A;  4FEB A;  5KDT B;  4R2F A;  3V89 B;  5AA4 B;  2Z8E A;  1UTB A;  3R7X A;  4IGR A;  3MPL A;  2DXY A;  1QKA A;  3CFX A;  3EHU A;  4X1D A;  1OQH A;  3MJN A;  3B6Q A;  2GRV A;  3CIJ A;  1FW0 A;  5K2X A;  3PPQ A;  3L6H A;  5I2K A;  1FCK A;  1JW5 A;  4U4S A;  2I49 A;  1DOT A;  3QXM A;  4YB5 A;  3C34 A;  3R6U A;  1FTK A;  1B6H A;  3K1M A;  4KCC A;  2F7B A;  2I4C A;  3HCQ A;  1DTZ A;  1MQG A;  1ZJL A;  2OBG A;  4R73 A;  2NWJ A;  3OO6 A;  3KOS A;  3RPW A;  4RNS A;  1JET A;  2PVU A;  1MXZ A;  1LST A;  3FVN A;  1XT8 A;  3QYT A;  2X7P A;  3MZB A;  1LB9 A;  5TPA A;  3TUS A;  2D21 A;  3TEP A;  1POT A;  1H44 A;  5AA2 A;  1P1N A;  4P11 A;  1ZU0 A;  3PMV A;  4H5G A;  1B3L A;  1LFH A;  1SDX A;  2XD2 A;  2IEE A;  1MPB A;  1B4Z A;  2XXU A;  3O29 A;  2ZNU A;  4WED A;  5JTY B;  3TOD A;  1JVY A;  3N6T A;  3C35 A;  3K2D A;  2A5T A;  3CSB A;  3C36 A;  1M5D A;  3TTM A;  4F3B A;  4RPO A;  4ESX A;  2XX9 A;  1B3E A;  3S9N C;  5IKB A;  3T9X B;  3TZA A;  5A5X A;  2XXR A;  4R6K A;  4IGT A;  1ZBM A;  1SVX B;  3ILU B;  4FED A;  4NF4 A;  5DYH A;  1N84 A;  4JXI A;  1MQJ A;  4E0W A;  3TTN A;  2F5X A;  3K6W A;  2Y7K A;  2F35 A;  1UTB B;  1US4 A;  3ZS6 A;  3FXU A;  3HHF A;  2W7Y A;  1GGG A;  2ZNT A;  3VE1 B;  3O6H A;  3PMX A;  4KYD A;  2QPQ A;  1WDN A;  3BFU A;  3IB1 A;  4F31 B;  3TPA A;  2LAO A;  5I2K B;  1LCT A;  1NFT A;  1DPP A;  3OOA A;  4BLA A;  1TXF A;  2X26 A;  4XIG Q;  4RA1 A;  2Z8F A;  2REG A;  3TQL A;  1MPC A;  3FIR A;  2O68 A;  1NNK A;  4ND9 A;  4POX A;  3MW0 A;  3TTL A;  4F1Y A;  2OJT A;  2A5S A;  3OSR A;  4O3A A;  4G68 A;  3A3U A;  4F2Q A;  4KR5 A;  2DQV A;  1NNF A;  2OK2 A;  5TPA B;  3OEN A;  3PMW A;  4LAT A;  1ZLQ A;  4G8M A;  1M5E A;  4F3P A;  2DWI A;  5AA2 B;  4H5F A;  4AQ4 A;  3PV0 E;  3QUF A;  3WAF A;  3ONM A;  5CMC A;  1IZ1 A;  4OYV A;  2DWA A;  3TAJ A;  4LP2 B;  4IO3 A;  1B46 A;  4C0R A;  3JV9 A;  4U1O A;  5JK4 A;  2A5T B;  3DP4 A;  2ZYK A;  2UYF A;  1PBP A;  3O66 A;  4GIZ A;  4DLD A;  4H65 A;  2P2A A;  1Y20 A;  4PP0 A;  1H76 A;  2XHD A;  4U23 A;  3TCH A;  3I5O A;  3TTR A;  3SEY A;  3MVZ A;  4NF4 B;  1URD A;  1YTV A;  4ZZE A;  4LA9 A;  4RY1 A;  2Q89 A;  3OEL A;  1Y1M A;  1SI0 A;  3K6V A;  3C4M A;  1MPD A;  4I8C A;  1HSL A;  1LFI A;  1SBP A;  2RKM A;  3RT8 A;  2XXT A;  3Q28 A;  2FA7 A;  2QL3 A;  3QSL A;  3JZJ A;  1JNF A;  1SYI A;  4QF9 A;  3AXF A;  4JDF A;  1P1U A;  3RGY A;  4DE8 A;  1US5 A;  3MZ9 A;  3RY3 A;  3FUZ A;  1B7Z A;  4XTC Q;  1XVX A;  2HXW A;  4ZE9 A;  4ELR A;  3TTK A;  5I56 A;  2I6E A;  4ZZA A;  1Y3Q A;  4ZEF A;  1B7U A;  4MFI A;  2RF1 A;  4G68 B;  3K02 A;  4I9D A;  4YB7 A;  1B05 A;  1MS7 A;  4OHN A;  4ELQ A;  3CFL A;  4U21 A;  3GZG A;  1SQY A;  1FQB A;  2Q2A A;  1BLF A;  2RCB A;  1FQA A;  1H43 A;  1PC3 A;  3E4R A;  2ZXT A;  2G93 A;  4OES A;  3FXR A;  3DP8 A;  4GVO A;  2F36 A;  3QUJ A;  4EUO A;  2DYX A;  4BDQ A;  1A54 A;  1PB8 A;  4GOT A;  2GHA A;  1SW5 A;  5H8H A;  2R71 A;  2XX7 A;  3T9V A;  3TCF A;  1LFG A;  1PBQ A;  3BBR A;  5ITO A;  1A40 A;  2THI A;  1R1N A;  2XXP A;  1B3F A;  5I57 A;  3K6X A;  1FTM A;  4F2O A;  4YMA A;  1ATG A;  2IA4 A;  4NTL A;  4KD5 A;  3U93 A;  3PUW E;  1J1N A;  2HZK A;  2H98 A;  1B32 A;  3TDJ A;  1A55 A;  1EU8 A;  2O69 A;  4IO6 A;  2QMX A;  3JYR A;  3N6U A;  2Z23 A;  5HPQ A;  2XXY A;  3LSW A;  4YB6 A;  1OMP A;  4GL8 A;  5CMM A;  2PMS A;  2OCU A;  4FAJ A;  5F7V A;  3O9P A;  3QK6 A;  4H67 A;  3G3G A;  5JTY A;  2I0C A;  3LSF B;  3VVD A;  1MY0 A;  5CMB A;  5H8N A;  3SEW A;  1GR2 A;  2GHB A;  4GF8 A;  3RN8 A;  1VE4 A;  1RYX A;  3G7W A;  4NE4 A;  3ZKK A;  4MF3 A;  2NOO A;  1IIW A;  3IJX B;  1DPE A;  4R75 A;  1AMF A;  4LQ2 A;  5CBS A;  5I56 B;  2FNC A;  1SW2 A;  3EHT A;  1Y3P A;  1LBB A;  3FGS A;  3KN8 A;  4RPN A;  2D5W A;  4XKQ A;  4FEC A;  3UGW A;  3CG1 A;  4R74 A;  1SYH A;  4PET A;  1P1Q A;  4XXU A;  4ESW A;  4GQO A;  3FXQ A;  2RIN A;  1RYO A;  4ZEC A;  5H8H B;  5JEI A;  3C32 A;  3KN7 A;  3VXC A;  3LC8 A;  3VFJ A;  1CE2 A;  2YJP A;  1Q35 A;  2Q2C A;  1UQW A;  3FVK A;  1N7W A;  3TKD A;  2UYE A;  1PB7 A;  1N76 A;  2VP1 A;  4Q8R A;  4G8H A;  3MWB A;  2CMO A;  1BKA A;  4H8J A;  5I57 B;  4LZ8 A;  3N26 A;  4PFU A;  4AB5 A;  2HAU A;  1LAX A;  1MXX A;  4JBZ A;  1I6Q A;  2QS1 A;  1B1H A;  3OO9 A;  5AE4 A;  4DIG A;  2I4B A;  1IXG A;  1OLC A;  1PDA A;  4EXL A;  1M5C A;  1SD3 A;  3QAX A;  5HM4 B;  2YLN A;  4QRZ A;  4H0W A;  3RQT A;  5AA1 A;  4OER A;  1N0T A;  3F11 A;  3T22 A;  4MBP A;  1N04 A;  3IK6 B;  4BDO A;  3EPE A;  4TQU Q;  3M3K A;  3FJM A;  3IO4 A;  4FE8 A;  4P0I A;  3S9L C;  3RUM A;  4R6H A;  1AOV A;  1TWY A;  5H8N B;  3KFM A;  3W9W A;  5FHN A;  1I6A A;  3KSX A;  4TOZ A;  4QFP A;  4ZED A;  4YAH X;  4X1B A;  4X9T A;  3MAM A;  5EYF A;  1DMB A;  3KBR A;  4XKP A;  1S9T A;  4WXJ A;  5ISU A;  3VDF A;  3B6T A;  1UTH B;  1QJM A;  3THI A;  3BFT A;  2X7Q A;  3K01 A;  2F6P A;  3IOT A;  2RC9 A;  4EF2 A;  3SEU A;  4IY5 A;  1LAF E;  1MY2 A;  4M4G A;  5I58 A;  5CI5 A;  1NNP A;  5DVI A;  3FJ7 A;  5CRY A;  4FIM A;  3ZSF A;  3U92 A;  4F39 A;  4OEV A;  5L8D A;  3SER A;  4ZS9 A;  3G3F A;  1OQG A;  2GH9 A;  3BKI B;  3IAZ A;  1FQD A;  3VV5 A;  4ZEI A;  1IEJ A;  2I48 A;  1QUI A;  2XX8 A;  2QS4 A;  4GFR A;  4PFY A;  3PD9 A;  1MXY A;  1PB9 A;  1MG1 A;  3T96 B;  2VHA A;  2ZYN A;  1JEU A;  3PPR A;  2UVG A;  2OLB A;  4NF6 A;  1QW0 A;  2ABH A;  4F19 A;  3SKP A;  2PYY A;  3MVX A;  4Q5T A;  1OLA A;  4PFW A;  3RTW B;  1VFE A;  3KZG A;  1R9L A;  2XXQ A;  3SEV A;  3OXN A;  2DS9 A;  4JSO A;  2NVU B;  1H3D A;  4N07 A;  5DVF A;  3CFZ A;  1D3K A;  4RK2 A;  4FOR A;  3W15 C;  3CSG A;  1O7T A;  4ISU A;  5B70 A;  2UXA A;  2NUV A;  3EQ1 A;  3TYH A;  2HCA A;  4N6P A;  1XVY A;  1MQI A;  1OIB A;  4DZ1 A;  3O28 A;  1GVC A;  5KCJ A;  4E0X A;  4F1V A;  4OET A;  4WKM A;  4HCW A;  1UIU A;  1TT1 A;  2UVJ A;  1A7L A;  3FVG A;  4QFL A;  3IB0 A;  3CRB A;  2F7A A;  2V25 A;  4YKI A;  4C1T A;  3L6G A;  1QUL A;  1P99 A;  4R2B A;  4HCY A;  2QS2 A;  1EZO A;  1OVT A;  1MY4 A;  3H6T A;  3TFL A;  5I58 B;  1I6B A;  3DP6 A;  2I58 A;  3V5A A;  1GV8 A;  4NWD A;  1A8E A;  3E9X A;  3KGC A;  4YKK A;  3S2V A;  1B2H A;  4KI0 E;  2H99 A;  4LZ5 A;  3S4U A;  4JWX A;  2F6G A;  1Y9U A;  5CBR A;  4GRK A;  3K6U A;  4QFO A;  5DT6 A;  2O1M A;  1YCJ A;  4POW A;  3O6I A;  2F7C A;  1Y4C A;  2Y7I A;  3GBA A;  1EZP A;  4JWO A;  5CM6 A;  4KQP A;  2F34 A;  1MM6 A;  3K0V A;  3R26 A;  1TFD A;  3FVO A;  1QVS A;  2QRY A;  2ONS A;  2V3U A;  3KN3 A;  1QUJ A;  1D9Y A;  5FHM A;  4NF6 B;  5F1Q A;  4PFT A;  3U8Q A;  3O97 A;  2BJJ X;  3IR1 A;  3IO6 A;  3H7M A;  3IOR A;  4RYA A;  3IOU A;  5B7D A;  1F9B A;  2F97 A;  4NED A;  4THI A;  3MUQ A;  2ALU A;  4QFK A;  3KOT A;  1FQC A;  2O7U A;  1Y3N A;  3PUV E;  3UOR A;  4YZZ A;  3VLW A;  2DP8 A;  4LQ5 A;  3PUX E;  3C9H A;  1DTG A;  3RLF E;  4ELP A;  2PT2 A;  4BDN A;  4KCD A;  1LAH E;  1O63 A;  3HPI A;  1Z7M E;  4QSE A;  1D4N A;  1LBC A;  3H6U A;  5AA3 A;  3ECR A;  5KCJ B;  2HZL A;  1FTJ A;  3M3L A;  3PUY E;  4Q0C A;  2DE4 A;  3FJG A;  3C31 A;  4JB7 A;  3SET A;  4YMB A;  3MBP A;  4GL0 A;  1TFA A;  3IX1 A;  1NH8 A;  1DSN A;  4UA8 A;  1S7Y A;  1B3H A;  3I3V A;  4Z7E A;  3FAS A;  3U72 A;  3W9V A;  4DXB A;  2QJE A;  4IO5 A;  1B58 A;  4R9G A;  2PBW A;  1GTK A;  2VD3 A;  1N7X A;  3O2A A;  1VR5 A;  1NL5 A;  1T0K A;  1B9J A;  4G68 C;  3U1O A;  4GWO A;  1LAG E;  1Y4T A;  1P1W A;  1MDP 1;  2O7I A;  1N3X A;  1EH3 A;  4F3S A;  3I6V A;  4F3G A;  4PE5 B;  2ESN A;  4ZEK A;  1SW1 A;  2HQ0 A;  3VXB A;  1O64 A;  1SW4 A;  5DVJ A;  1QUK A;  2RC7 A;  1POY 1;  2P0S A;  4OXV A;  3E3K A;  2HEU A;  2PT1 A;  3SES A;  2O6A A;  2H5Y A;  5LOM A;  3OMB A;  5CC2 A;  1UTH A;  3T93 B;  3A3C A;  1JW4 A;  2AL5 A;  1XHY A;  3MVW A;  3LUY A;  1NKX A;  1B5I A;  4G8N A;  2D3I A;  4RXL A;  1BTJ A;  2QMW A;  3QIM A;  4WEP A;  5BUU A;  2F78 A;  2FYI A;  2Y7W A;  1Z7N E;  3GBB A;  1BIY A;  2AIX A;  4ZE8 A;  4XKN A;  2DXR A;  3WAE A;  3HST A;  1JVX A;  4NWC A;  3MC2 A;  1R6Z A;  1R9Q A;  3PPN A;  5TU0 A;  2DE2 A;  1IXI A;  4XKR A;  2AYS A;  3IB2 A;  4RK9 A;  2Z8D A;  1LGB C;  1LB8 A;  2P1S A;  4KYS A;  3FV1 A;  4EQ9 A;  2XD3 A;  2ANJ A;  5ITP A;  3OEM A;  3V8X B;  1URG A;  3PUZ E;  1IUD A;  4QSD A;  3H03 A;  3OO8 A;  4H8I A;  5EHS A;  2KLF A;  3IL1 B;  1LCF A;  1JEV A;  1MDQ A;  3TMG A;  1MY1 A;  4QSC A;  4GD5 A;  2E1S A;  4YKJ A;  4DCX A;  2XXX A;  1M5B A;  2Q8J A;  3T66 A;  3UA8 A;  2Q9T A;  4IY6 A;  1YPN A;  4GLI A;  1H45 A;  2OWS A;  2Y84 A;  3N5L A;  1MRP A;  1A99 A;  3MQ9 A;  2OWT A;  1MXU A;  4LVQ A;  3LSL A;  3S9E A;  4HTG A;  3A09 A;  4OFJ A;  4OFL A;  2E0S A;  2ZYM A;  3P7I A;  4O3C A;  1ZIU A;  2RC8 A;  3FAT A;  3D4C A;  3M3F A;  2R6G E;  2UVH A;  1I69 A;  4OMB A;  1A8F A;  4DXU A;  3LSX A;  1AL3 A;  3DLN A;  1B7H A;  4EQB A;  3MZ1 A;  4N13 A;  2PX1 A;  3PGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...