4UA8A

Eur_01830 (maltotriose-binding protein) complexed with maltotriose
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
383
structure length
383
Chain Sequence
GKETITVMGPAEDLDDAQGAWLKTECEAFAKANPDFNIEFKYVTSSESDAKDVVTKDPKAAADVYMFANDQLEPLIKANAIAKLGGDTAEYVKSSNSEAMAATVTYDGDIYAVPYTSNTWFMYYDKRVFSEDDVKSLDTMLTKGKVSFPFDNGWYLNAFYAANGCTIFGDGTDKAAGYDFSGDKGTAVTNYIVDLFANPNFVMDNNEGSLGLAGLKDGSINAYFNGNWNYDKVKEALGEENVGVAALPTINIGGKDCQLKAFLGSKAIGVNPNCKNQEVAVKLAAFLGSEDAQLAHFKLRGQAPVNKDLATNEEVAADPVAAAMAKVSSDCSVAQPIIDMSGYWDAATPFGDAFQNGAEGQITKDNAAQKTEDFNTQLNDSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Carbohydrate ABC transporter substrate-binding protein, CUT1
publication title Molecular details of a starch utilization pathway in the human gut symbiont Eubacterium rectale.
pubmed doi rcsb
source organism Eubacterium rectale dsm 17629
total genus 136
structure length 383
sequence length 383
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ua8A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ua8A01
1IXCA 3W15C 3PMWA 2Y7PA 1PBPA 5DEXB 5L9MA 3K01A 3LSWA 1B51A 4YKIA 3KN7A 3MP8A 1JETA 3ZKLA 1QUJA 1NNTA 3T9UA 1DOTA 3K1NA 3TCGA 2PBWA 2VHAA 4QSEA 4ELRA 3T66A 1FQBA 3THIA 5CMMA 1SQYA 2VP1A 1NMUA 3V83A 3UK4A 4KFQA 4LP2B 2QPQA 1B3EA 2O84X 5AA4B 1JVXA 4ZEDA 3VLUA 1B1HA 2UVGA 1URGA 2ZNSA 5FHOA 1P1OA 1FQDA 2QS2A 3QSLA 5KZTA 4QHQA 3DLNA 4TLLB 3DP4A 4BDLA 2ESNA 3O6IA 3TQWA 1SI0A 3FJGA 3QIMA 3JV9A 1NNPA 2Z8EA 3O66A 1SW4A 1M5DA 3ILTB 2FA7A 4R9GA 3D4CA 3T22A 4E0WA 2DWIA 1Y3QA 4KCCA 3O29A 4GL8A 3Q26A 3PPPA 3W9WA 4FECA 4KHZE 3KJ7A 3G3JA 3FXUA 2OLBA 4FEDA 2RKMA 3FZVA 4KYSA 2VD2A 4GFRA 5DT6A 3SEVA 3Q25A 1GTKA 1B5IA 1H76A 1OQHA 4RXLA 2AL5A 3HHGA 1LCFA 4P0GA 5LOMA 2RC7A 1CE2A 3QYTA 2Z23A 1US4A 4GIZA 4EUOA 5EHSA 3K6UA 1MDQA 3T93B 2XXWA 2XX7A 4OEUA 5K2YA 4BDOA 1B4ZA 2XXRA 4F1YA 1OLAA 3IB1A 2XXXA 3UP9A 1EZ9A 3I6VA 4R9FA 1B4HA 4GQOA 2E0SA 1M5CA 3TZAA 4ZS9A 4DXBA 4XTCQ 2I58A 1QKBA 1J1NA 1UIUA 4NF4B 4PETA 2VGQA 1MY0A 5TP9A 3Q29A 1D3KA 2UYFA 5I58A 5IKBA 4RK2A 5HM4B 1S7YA 5ITOA 3IOVA 1AOVA 3I3VA 3HHFA 3G7WA 5I2NB 3ILUB 4DXUA 3RT8A 4DDDA 3C31A 1B7UA 2IA4A 4YU0A 3JZJA 3T9HB 5ITPA 5FHNA 4OVJA 3C4MA 1QUKA 3I5OA 4DE8A 1B32A 4ESXA 1I6BA 1TFDA 2VD3A 2XX8A 2P2AA 2Q2AA 1B05A 3FVOA 3RQTA 4R73A 3FASA 1MPBA 1CB6A 2ZYMA 3MPKA 4I8CA 4DXCA 4XKRA 2I49A 3E13X 4IGRA 3F11A 5I57A 4XXUA 1MY3A 1A55A 2ZNTA 4M4GA 4NWDA 1Y1MA 3MJNA 1B5HA 2YPNA 2RC8A 3IOTA 4RK9A 4LVQA 2B65A 1RYOA 1URSA 4FAJA 2H25A 3RGYA 3RT6B 3E3KA 3KSJA 3VVFA 2DVCA 2DQVA 3SKPA 4ZZEA 2OZZA 1Y3PA 4OYVA 4THIA 3N5LA 3VLVA 3PPRA 2DVZA 4PE5B 5DYHA 1IXHA 2GHAA 4OFJA 5M2VA 2PX1A 4EQ9A 4H8IA 4PFYA 4KR5A 1XC1A 3O97A 4R74A 3MZ1A 4L17A 3PPQA 3VFJA 4YZZA 3O2AA 1IXGA 2I4BA 2QS4A 4DCXA 1NNKA 2Q2CA 3TEPA 4GWOA 1ZMGA 4C0RA 2VOZA 1QKAA 3ZS6A 1MPDA 4BDQA 2XXHA 1ZJLA 3HPIA 4QRZA 4FE8A 2UVHA 3GLBA 3FV2A 1VFDA 3B6TA 1M5EA 4YKKA 3RUMA 4ELOA 1POY1 3R6UA 3KZGA 2WKYA 4HCYA 3KOTA 1A54A 3UGWA 1FTMA 5CMKA 5CBSA 2ZYKA 1UIVA 1N7WA 3C9HA 4QSDA 1XT8A 3SESA 4NWCA 4F18A 2Z22A 1FCKA 4OENA 3ODBA 3LBSA 1B5JA 5CI5A 3K2DA 4X1DA 4BDNA 1LCTA 5AA1A 1LBBA 1UTHA 3QUJA 4GL0A 2RC9A 3TAJA 5JTYA 2BJJX 3EN3A 1PBQA 1BLFA 3U93A 2G29A 1WODA 4OERA 4H0WA 3MZBA 3FVNA 3PUVE 2D5WA 2Y7KA 1PB9A 3N6TA 3VE1B 3BFUA 4Q5TA 3SDFA 2DWAA 2F7CA 4R72A 3TCFA 1ZTYA 4IB2A 4H67A 4U1OA 1MH3A 3IB2A 4JXIA 4KPTA 3MVWA 3H06B 4G2ZA 1FQFA 3TPAA 3IO4A 2XXUA 1A40A 2F34A 4IGTA 1MXZA 4MLVA 2I48A 3PUWE 4HTGA 1MM6A 3ZKKA 3ZSFA 1FTOA 5DVJA 1ELJA 4QFKA 4LA9A 2AL4A 4YKJA 4MLQA 4LZ8A 4YB5A 4AB5A 4GOTA 3T9VA 4OQOA 1B3FA 3FD3A 4HCWA 4YICA 4JWYA 5AA2B 4R2FA 4LQ2A 3IO6A 4ELPA 1EZOA 3MUQA 3M3FA 4ZEBA 3GBAA 3FXRA 3S9NC 5KDTA 1TT1A 1B7ZA 3C34A 3PPNA 2H98A 4F31B 4EXKA 1MQHA 4U23A 1ZIUA 4YAHX 4N6PA 2O51A 3ECRA 2XXTA 5DVIA 4H5FA 4JWOA 3CSBA 2DS9A 4OESA 1DTGA 1URDA 4LATA 2FYIA 3SEUA 5TP9B 2I6EA 4K3FA 5FTHA 2AYSA 4I9DA 4GD5A 5I58B 3FXQA 5L9OA 4KYEA 4MH5A 2UYEA 3TCHA 4ZECA 4ZE8A 4O3AA 3GZGA 3KBRA 3QAXA 4ZE9A 3OO6A 4F22A 2DOJA 3A09A 1D9VA 3FGSA 3V5AA 3SEXA 3B7DA 4PFTA 2O68A 4F39A 3IOUA 3MVYA 4F29A 1A8EA 1S9TA 4Q8RA 1NFTA 4HW8A 1SW5A 1JW5A 3IORA 5TU0A 1LFIA 5BUUA 3MWBA 1Y4CA 3S4UA 5I57B 2DWHA 1I69A 3QK6A 1M5BA 4R2BA 1LAHE 3ONMA 3EHUA 2ONSA 3C36A 3FUZA 1SDXA 4Z7EA 4ISUA 3S2VA 3K00A 4PP0A 4RNSA 1DSNA 4LZ7A 1P1NA 3DP6A 1H43A 1Z7ME 2ONRA 4JB7A 5AA2A 2HCAA 3IK6B 4E0XA 3RLFE 2NUVA 4I62A 4EF2A 1RKMA 1Y1ZA 1D9YA 4DIGA 1XS5A 1B7HA 3TELA 4U22A 3IOWA 3TMGA 2DP8A 1SD3A 2B3FA 3AXFA 2OBGA 2PYYA 1A99A 2X7QA 5I2KB 4JSOA 4GXAA 5IAIA 3HN0A 4O3CA 4OTEA 4OXVA 2QMWA 1QVSA 1FTLA 1N7XA 1BTJA 4HS7A 3QUFA 3KOSA 3O6GA 4U4XA 3FVKA 4WXJA 1IITA 1LFHA 2DSFA 1P1QA 3A3UA 5B70A 5H8HA 3HV1A 1VSOA 3CFZA 4ZEFA 4RY1A 1MY4A 4KCDA 1SI1A 2ZYOA 3EF7A 1XHYA 3DELB 2O1MA 2UXAA 5TPAA 5ICQA 2R9JA 1XVYA 2M8CA 4ELQA 2FNCA 5J1DA 1OLCA 3SEYA 4NF5A 2XXQA 3PUYE 2ALUA 1DMBA 1VE4A 2OK2A 4P11A 1PB8A 5AE4A 3A3CA 1HSJA 1BP5A 5ICTA 3N6UA 4ZDMA 3FJMA 3BBRA 3TTRA 3TTNA 3KN8A 2ZXTA 4OETA 1UTHB 3C33A 3H7MA 1OQGA 3UORA 3OD7A 4KI0E 1FTJA 1ZBMA 2XD3A 5JTYB 4XIGQ 3N94A 4UACA 1AMFA 1MRPA 3DM0A 2REJA 2A5TA 1H45A 1MQGA 3PD9A 3K6XA 3OEMA 4F1VA 1MXXA 4FORA 3VXBA 4QSCA 4GVOA 3OEKA 1KWHA 2QL3A 4MF3A 3BFTA 2O1LA 3JYRA 5HPQA 3MVZA 4F19A 3TTMA 3VXCA 2QMXA 2Q89A 4PFUA 1B1XA 4N13A 2GFEA 2D21A 3QXMA 3N26A 5B7DA 4F3GA 5F1QA 3MAMA 4RPNA 1NKXA 4Q0CA 2Z8DA 1Y20A 5I2KA 3K1MA 1JQFA 2O6AA 4R6KA 1A7LA 1R9LA 2P1SA 1BKAA 1LSTA 5HBCA 5JEIA 2I3VA 3EQ1A 2H99A 1O63A 4NEDA 1JEVA 2RINA 1SW1A 4IY5A 3KFMA 2PT2A 4IO7A 4IO2A 1H3DA 4DZ1A 4U2RA 2HZKA 4F2OA 5KDTB 3PUXE 1TWYA 3PD8A 4YMBA 2QS3A 4OEVA 3UA8A 4JSDA 1P99A 2O69A 3M8UA 2ZNUA 1ZLQA 4ZZAA 3V8XB 3OOAA 5A5XA 4YB7A 3G3FA 4FATA 2HXWA 4YB6A 3CFXA 1ZU0A 4AQ4A 4R6HA 2V3TA 1USYH 4NF6B 4O3BA 3LR1A 3LSLA 3PMXA 5I84A 2RCAA 5H8NA 3OXNA 3RTFB 2GHBA 3R7XA 4IY6A 5FHMA 1MY2A 1XVXA 4WEPA 3O6HA 2Y7IA 4IO3A 2ABHA 1MM7A 2P0SA 3CFLA 1AH5A 4QFNA 3TQLA 2A5SA 4H8JA 2NOOA 4ECFA 4F1UA 1ANFA 1GGGA 4G68A 1LGBC 1I6QA 4RJZA 1B40A 3MP6A 4LONB 1LFGA 4EF1A 4C1UA 1T0KA 2XXIA 1JW4A 1Q1KA 3SERA 1N76A 4G77A 4G8HA 3K0VA 1MG1A 1SVXB 1FQAA 1Y4TA 4RYAA 1MQJA 2ANJA 5ISUA 3SEWA 4OZ9A 5CRYA 1FTKA 5F7VA 5L8DA 4H65A 3CSGA 3PU5A 5ELVA 2B3BA 2I0BA 1QJMA 3TTKA 2V25A 3CI8A 4MFIA 3C32A 1LBCA 3EHTA 2X7PA 3MC2A 3MW0A 1OVTA 2PVUA 5CM6A 4BLAA 4IO5A 2X26A 3M3KA 2O7UA 2I4CA 4EQBA 5H8FA 4EXLA 5DTBA 3KGCA 1F9BA 1SYHA 2NXOA 2E1SA 1OIBA 1ZKBA 1MXYA 4YMAA 2HQ0A 2F36A 2XHDA 1YTVA 4IO6A 2Y84A 1N0TA 4H6DA 2R6GE 5H8QA 1XOCA 3IJXB 4NF6A 4XKPA 3PGFA 2DWJA 2O7IA 5KCJA 4JBZA 2QJEA 5H8HB 1UTBA 1OVBA 4C1TA 3T96B 3VDFA 3LSXA 3CG1A 4F3BA 5TPAB 1NH7A 3CVGA 3FV1A 5H8SA 4G68C 3H3GA 4OFOA 2OWSA 4EDPA 3G3IA 4QFPA 1MH4A 1R6ZA 3CG3A 5JK4A 4POXA 2Q9TA 4R6YA 3OO7A 1B3LA 3FVGA 2CZLA 3U92A 4NF5B 5I59A 1MQIA 3VV5A 4LUBA 4TQUQ 2PT1A 3TDJA 3KN3A 1Y3NA 2REGA 3H6UA 1B2HA 1A8FA 3HCQA 1MQDA 3L6HA 1JNFA 3H6VA 2I3WA 3OO8A 4DCYA 4I1DA 3TUSA 3RNNA 1QW0A 1B46A 4M1VA 5AA3A 1RYXA 3VLWA 1DTZA 3O9PA 2Y7RA 1YAEA 2A5TB 2D3IA 5L9SA 3IX1A 1B3GA 3C35A 1IUDA 2PMSA 2GH9A 3H6WA 4YKPA 5I56A 1GR2A 3EHSA 3RY3A 4GRKA 1US5A 2QRYA 2H5YA 1QULA 1B58A 1QUIA 1N3WA 1HSEA 1AL3A 4Z0IA 3B6QA 2NVUB 2F6PA 3VVDA 1IQ7A 3G3KA 4NF8A 1Z7NE 4MBPA 1ATGA 1JW1A 4P0IA 4ND9A 3IR1A 1L5TA 3MQ9A 3CRBA 3U72A 4OHNA 1NNFA 3LUYA 3TODA 1PEBA 3S9LC 4WKMA 4X9TA 3OO9A 2HAVA 1GVCA 3FJ7A 4JDFA 3S9EA 1VR5A 3E4RA 4KD5A 5DEXA 4QFLA 2F35A 2Y7WA 2DE3A 2W7YA 1B0LA 4H5GA 2F6GA 3H4ZA 1N84A 3K02A 1MXWA 2G93A 1JVYA 5AA4A 2F5XA 4GLIA 1USYE 1HSLA 1MDP1 2XD2A 5BWJA 3S9MC 3H03A 1MY1A 1FQCA 1B6HA 1LB9A 5A5XB 2CMOA 3U8QA 1EH3A 2HEUA 2F97A 4IO4A 5DVFA 1LAXA 2THIA 1IIWA 2YJPA 4EQ7A 3MBPA 1EZPA 1N3XA 4FIMA 4ZEIA 5H8NB 2KLFA 2HFBA 4NTLA 3EPEA 1JEUA 3Q27A 3TKDA 1B9JA 4NE4A 1MS7A 2R71A 5CBRA 3OSQA 3UIFA 1LAFE 1O64A 4WEDA 4RA1A 3SETA 4PFWA 4G68B 1VFEA 3PPOA 3WAFA 4AB6A 1OMPA 3PUZE 1NH8A 1P1UA 4G4PA 1YCJA 4ONYA 3H6TA 3OMBA 2V3UA 3GXAA 1H44A 1BIYA 3RTWB 1I6AA 1SW2A 1FQEA 3P7IA 2XXPA 3MPLA 2RF1A 2UVIA 3PV0E 3MVXA 2UVJA 3KSXA 4PQJA 4BDRA 4X1BA 2DYXA 1IEJA 3DP8A 4NF4A 1SBPA 2F7AA 4GF8A 5CMBA 4F3SA 5FTIA 1LB8A 1SYIA 5H8FB 1Y9UA 1DPEA 5I2NA 4DLDA 2Z8FA 1O7TA 4UA8A 2OCUA 2DE2A 2IEEA 3CR9A 3USDA 1FW0A 3TFLA 2OJTA 3UN6A 5CC2A 2XXVA 4TLMB 5H8QB 4U21A 3T9XB 1WVJA 1MXUA 3U1OA 1IZ1A 3VVEA 4RPOA 2Q8JA 4G8MA 4TOZA 1LAGE 2F7BA 3R26A 5EHMA 3K1PA 4R75A 4Q30B 3B6WA 5EYFA 5KCJB 1UTBB 4KQPA 4F2QA 1PC3A 2HZLA 4LZ5A 3TYHA 2QSXA 4OMBA 4BDMA 1NL5A 1R1NA 4OFLA 4POWA 4F3PA 1S50A 2V3QA 4G8NA 2V84A 3G3HA 1P1WA 3K6VA 2Q88A 3K4UA 1N04A 4GXSB 3TTLA 3W9VA 4U1ZA 2F8DA 4QF9A 3RPWA 3U94A 2ONKE 4N07A 5I59B 2OWTA 2H4IA 2XXYA 2LAOA 1YPNA 3OENA 2DXRA 4OWDA 3Q28A 1B0HA 1EU8A 3E9XA 3LC8A 4FEBA 4XKNA 2I0CA 2GRVA 2V93A 1IXIA 3IB0A 3LSFB 3V89B 4QFOA 1LLSA 3M3LA 1POTA 1GV8A 4ESWA 3OELA 1PB7A 3FIRA 3KJTA 3MP1A 2RCBA 3KG2A 2F78A 2ZYNA 1II5A 2AIXA 4ZEKA 1D4NA 1R9QA 4H1XA 2DE4A 4KYDA 5I56B 3RN8A 2DXYA 5K2XA 1Q35A 5AA2D 3GBBA 3D4GA 3PMVA 2ZMBA 1B3HA 1TFAA 1TXFA 1B52A 1MPCA 3MZ9A 2H9BA 1PDAA 3G3GA 3IJOB 4FJPA 4JWXA 2NWJA 3HO7A 1MXVA 5CMCA 3BKIB 4XKQA 2QS1A 3IAZA 3FATA 4LQ5A 4NF8B 4U4SA 1UQWA 4X48A 1M5FA 3HSTA 3CIJA 3L6GA 3K6WA 3O28A 3WAEA 3IL1B 2HAUA 4NMYA 3KEIA 3OSRA 1DPPA 2XX9A 1AIVA 1WDNA 2YLNA
chains in the Genus database with same CATH superfamily
1IXCA 3W15C 1LBWA 3PMWA 2Y7PA 4GX3A 1PBPA 5DEXB 5L9MA 3K01A 3LSWA 1B51A 4PDDA 4YKIA 3KN7A 3MP8A 1JETA 3ZKLA 1QUJA 1NNTA 3T9UA 1DOTA 3K1NA 3TCGA 2PBWA 2VHAA 4QSEA 4ELRA 3T66A 1FQBA 3THIA 5CMMA 1SQYA 2VP1A 1NMUA 3V83A 4P9KA 3UK4A 1RDZA 4KFQA 4LP2B 2QPQA 1NI9A 1B3EA 2O84X 5AA4B 1JVXA 4ZEDA 3VLUA 1B1HA 2UVGA 1URGA 2ZNSA 5FHOA 1P1OA 1FQDA 1G0HA 2QS2A 4I3EA 3QSLA 5DW8A 4PF8A 5KZTA 4QHQA 3DLNA 4TLLB 3DP4A 4BDLA 2ESNA 3O6IA 4X8RA 1FTAA 3TQWA 1SI0A 3FJGA 3QIMA 3JV9A 1NNPA 2Z8EA 1G0IA 4GWZA 3O66A 1SW4A 4IR8A 1VDWA 1M5DA 3ILTB 2FA7A 4R9GA 3D4CA 3T22A 4E0WA 4N4UA 4MNIA 2DWIA 1Y3QA 4KCCA 3O29A 4GL8A 4N17A 1FPIA 3Q26A 3PPPA 3BIHA 4FECA 3W9WA 4KHZE 3KJ7A 3G3JA 3FXUA 2OLBA 4FEDA 2RKMA 3FZVA 4KYSA 2XWVA 2VD2A 4GFRA 5DT6A 3SEVA 2PCRA 3Q25A 1RDXA 2DDKA 1GTKA 1B5IA 1H76A 1OQHA 2ZZVA 2AL5A 4RXLA 3HHGA 1LCFA 4P0GA 5LOMA 2RC7A 1EYKA 1CE2A 3QYTA 2Z23A 1US4A 4GIZA 1NUXA 4EUOA 5EHSA 1IMCA 3K6UA 1MDQA 4GWXA 4NF0A 3T93B 4HXVA 2XXWA 2XX7A 4OEUA 5K2YA 4BDOA 3LUZA 1B4ZA 4N8YA 2XXRA 4F1YA 4MNPA 1OLAA 3IB1A 2XXXA 3UP9A 2JJKA 4N6DA 1EZ9A 3I6VA 4R9FA 1B4HA 4GQOA 2E0SA 1FBEA 3PTYA 1M5CA 3TZAA 4ZS9A 4DXBA 4XTCQ 2I58A 1QKBA 1J1NA 1UIUA 4NF4B 4PETA 2VGQA 1MY0A 5TP9A 3Q29A 1D3KA 2UYFA 5I58A 5IKBA 4RK2A 3HFUA 5HM4B 4OANA 1S7YA 5ITOA 3IOVA 1AOVA 3I3VA 3HHFA 3G7WA 5I2NB 3ILUB 4DXUA 3RT8A 4DDDA 1FBHA 3C31A 1NV4A 1B7UA 2IA4A 4GWWA 4YU0A 3JZJA 3T9HB 5ITPA 5FHNA 4OVJA 3C4MA 1QUKA 3I5OA 4PTKA 4DE8A 1B32A 4ESXA 1I6BA 1TFDA 2VD3A 4X04A 4N8GA 2XX8A 2P2AA 1NV1A 2Q2AA 1B05A 3FVOA 3RQTA 4R73A 3FASA 1MPBA 1CB6A 2ZYMA 3MPKA 4I8CA 4DXCA 4XKRA 2I49A 3E13X 4IGRA 3F11A 5I57A 4XXUA 1MY3A 1A55A 2ZNTA 4M4GA 4NX1A 4NWDA 1Y1MA 3MJNA 1B5HA 2YPNA 2RC8A 3IOTA 4RK9A 4LVQA 4PFIA 2B65A 1RYOA 1URSA 4MJOA 4FAJA 4NGUA 2H25A 4N91A 1LBVA 3RGYA 3RT6B 3E3KA 3KSJA 3VVFA 2DVCA 2ZZWA 2DQVA 3SKPA 4ZZEA 4P8BA 2OZZA 3RPLB 3CHGA 1Y3PA 4OYVA 4THIA 3N5LA 1INPA 3VLVA 3PPRA 4GX6A 2DVZA 4PE5B 5DYHA 1IXHA 2GHAA 4OFJA 5M2VA 2PX1A 4EQ9A 4H8IA 4PFYA 4KR5A 4P3LA 1XC1A 4NHBA 3T0JA 3O97A 4R74A 3MZ1A 4P47A 4L17A 3PPQA 1K9ZA 3VFJA 4YZZA 3O2AA 1IXGA 2I4BA 2QS4A 4DCXA 4I3YA 4P1LA 1NNKA 2Q2CA 3TEPA 4GWOA 1ZMGA 4C0RA 2VOZA 1QKAA 5ET5A 3ZS6A 2L5VA 1MPDA 4BDQA 2XXHA 4G61A 5A5LA 1ZJLA 3HPIA 4QRZA 4FE8A 2UVHA 3GLBA 3FV2A 1VFDA 3B6TA 1M5EA 4YKKA 2FHYA 3RUMA 4ELOA 1POY1 4UABA 4O8MA 5IZ1A 3R6UA 3KZGA 1XI6A 2WKYA 1FPDA 4HCYA 3KOTA 1A54A 4PGNA 3UGWA 1FTMA 5CMKA 5CBSA 2ZYKA 1UIVA 4MHFA 1N7WA 3C9HA 1NV0A 4QSDA 1XT8A 3SESA 3BIGA 4NWCA 4F18A 2Z22A 4XFEA 1FCKA 4NN3A 5EQAA 4OENA 3IFAA 3LBSA 3ODBA 1B5JA 5CI5A 1LBYA 4LN5A 3K2DA 4X1DA 4PCDA 4BDNA 1FBCA 1LCTA 5AA1A 1LBBA 1IMBA 1UTHA 3QUJA 4GL0A 1LBXA 2RC9A 3TAJA 5JTYA 2BJJX 3EN3A 1PBQA 1BLFA 3U93A 2G29A 1WODA 4OERA 4I40A 4H0WA 3MZBA 3FVNA 3PUVE 5J16A 2D5WA 1YYZA 2Y7KA 1PB9A 3N6TA 3RPLA 3VE1B 2HHMA 3BFUA 4Q5TA 3SDFA 2DWAA 2F7CA 4R72A 3TCFA 1ZTYA 4IB2A 4H67A 4PAKA 5EYHA 4U1OA 1MH3A 3IB2A 4JXIA 4KPTA 3MVWA 3H06B 4G2ZA 2OWZA 1FQFA 3TPAA 3IO4A 2XXUA 1A40A 3SZPA 2F34A 5IM2A 4IGTA 1MXZA 4MLVA 2I48A 3PUWE 4HTGA 1MM6A 3ZKKA 3ZSFA 5LDZA 1FTOA 5DVJA 1ELJA 4QFKA 4LA9A 1LEVA 2AL4A 4YKJA 4MLQA 4LZ8A 4YB5A 2CZHA 4AB5A 4GOTA 1EYIA 3T9VA 4OQOA 1B3FA 3FD3A 2MKZA 4HCWA 4YICA 4JVDA 4JWYA 5AA2B 4R2FA 4LQ2A 3IO6A 4ELPA 1EZOA 3MUQA 3M3FA 4ZEBA 3GBAA 3FXRA 3S9NC 5KDTA 1TT1A 1NUWA 1B7ZA 4JVCA 3C34A 3PPNA 2H98A 4F31B 4EXKA 4OA4A 1MQHA 4O94A 4U23A 3D1RA 1ZIUA 4YAHX 4N6PA 2O51A 3ECRA 2XXTA 4JVIA 4H5FA 4JWOA 5DVIA 4PBQA 3CSBA 2DS9A 4OESA 1DTGA 1URDA 1KZ8A 4LATA 2FYIA 3SEUA 5TP9B 2I6EA 4K3FA 5FTHA 2AYSA 4I9DA 4GD5A 5I58B 4GWSA 3FXQA 5L9OA 4KYEA 4MH5A 2UYEA 3TCHA 4ZECA 4XF5A 4ZE8A 4O3AA 3GZGA 3KBRA 3QAXA 4ZE9A 3OO6A 2B4LA 4F22A 2DOJA 2XA5A 3A09A 1D9VA 3FGSA 3V5AA 2OX3A 3SEXA 3B7DA 1FBDA 4PFTA 2O68A 4F39A 3IOUA 3MVYA 4F29A 1A8EA 1S9TA 4Q8RA 1NFTA 4HW8A 1SW5A 1FRPA 4PFRA 1JW5A 3IORA 5TU0A 1LFIA 5BUUA 3MWBA 1Y4CA 3S4UA 5I57B 4MIJA 2VPOA 2DWHA 1I69A 3QK6A 1M5BA 4R2BA 1LAHE 3ONMA 3EHUA 4AS4A 4GWYA 2ONSA 3C36A 2XWKA 3FUZA 1SDXA 4Z7EA 4ISUA 3S2VA 1IMDA 3K00A 4PP0A 4RNSA 1DSNA 4LZ7A 3MYUA 1P1NA 3DP6A 1H43A 1Z7ME 2ONRA 4JB7A 5AA2A 2HCAA 3IK6B 4E0XA 3RLFE 2NUVA 1FPEA 4I62A 4MX6A 4EF2A 1RKMA 1Y1ZA 5EQ7A 5LTCA 1D9YA 4OVQA 4DIGA 1XS5A 1B7HA 3TELA 4U22A 5I7IA 3IOWA 3TMGA 2DP8A 1SD3A 2B3FA 4N6KA 2OBGA 3AXFA 2PYYA 3LV0A 1A99A 2X7QA 4NG7A 5I2KB 4OVRA 4JSOA 4GXAA 2XWOA 5IAIA 1DCUA 1DK4A 3HN0A 4O3CA 4OTEA 4OXVA 2QMWA 1QVSA 4P1EA 1FTLA 1N7XA 1BTJA 3QMFA 4HS7A 3QUFA 3KOSA 3O6GA 4U4XA 3FVKA 4WXJA 1IITA 1FSAA 1LFHA 2DSFA 1P1QA 3A3UA 4GBWA 5B70A 5H8HA 3HV1A 1VSOA 2QVVA 5EQ9A 2P3NA 3CFZA 2WBDA 4RY1A 4ZEFA 1MY4A 1NV3A 4KCDA 1SI1A 2ZYOA 3EF7A 1XHYA 3DELB 2O1MA 2UXAA 4N81A 5TPAA 4DI4B 5ICQA 2R9JA 4P56A 1XVYA 2Y5LA 1FPGA 2M8CA 4ELQA 1FPBA 3KC1A 2FNCA 5J1DA 1OLCA 3SEYA 4NF5A 5EYGA 2XXQA 3PUYE 2ALUA 1DMBA 1VE4A 2OK2A 4P11A 1PB8A 5AE4A 3A3CA 1HSJA 1FPKA 1BP5A 5ICTA 3N6UA 4ZDMA 3FJMA 3BBRA 3TTRA 3TTNA 3KN8A 2ZXTA 4OETA 1UTHB 3C33A 3H7MA 1OQGA 3UORA 3OD7A 4KI0E 1FTJA 1YXIA 1ZBMA 2XD3A 5JTYB 4XIGQ 4PAFA 3N94A 4UACA 1AMFA 1MRPA 3DM0A 2REJA 2A5TA 1H45A 1MQGA 3PD9A 3K6XA 1D9QA 3OEMA 4F1VA 1MXXA 4FORA 3VXBA 4QSCA 2KQZA 4GVOA 3OEKA 1KWHA 2QVUA 2QL3A 4MF3A 5ET7A 3BFTA 2O1LA 3JYRA 5HPQA 3MVZA 4F19A 3TTMA 3VXCA 2QMXA 2Q89A 4PFUA 1B1XA 4N13A 2GFEA 2D21A 3QXMA 3N26A 5B7DA 4F3GA 5F1QA 5I3SA 3MAMA 4RPNA 3ROJA 1NKXA 4Q0CA 2Z8DA 1Y20A 5I2KA 2ZZXA 3K1MA 1JQFA 2O6AA 3FXBA 4R6KA 3MSTA 1A7LA 1R9LA 2P1SA 1BKAA 1LSTA 5HBCA 5JEIA 2I3VA 3EQ1A 2H99A 1O63A 2CEXA 2VT5A 4NEDA 1JEVA 1KA1A 2RINA 1SW1A 4IY5A 3KFMA 2PT2A 4IO7A 4IO2A 1H3DA 5F24A 4HE1A 4DZ1A 4U2RA 2HZKA 4F2OA 5KDTB 3PUXE 1TWYA 3PD8A 4YMBA 2QS3A 4OEVA 4GBVA 1NUZA 1FPFA 3UA8A 4JSDA 1P99A 2O69A 3M8UA 2ZNUA 4QXDA 3U65A 1ZLQA 4ZZAA 3V8XB 3OOAA 5A5XA 1FBPA 4YB7A 3G3FA 4FATA 2HXWA 4YB6A 3CFXA 1K9YA 1ZU0A 4AQ4A 4R6HA 2V3TA 1USYH 4NF6B 4O3BA 3LR1A 3LSLA 3PMXA 5I84A 2RCAA 2CZIA 5H8NA 3OXNA 2F3BA 3RTFB 2GHBA 3R7XA 2F3DA 1KA0A 4IY6A 1AWBA 5FHMA 1MY2A 1XVXA 2WEFA 4WEPA 2PFYA 3O6HA 2Y7IA 4IO3A 2ABHA 1MM7A 2P0SA 3CFLA 1AH5A 4QFNA 3TQLA 1LBZA 2A5SA 4H8JA 1Q9DA 2NOOA 1IMFA 4ECFA 4F1UA 5IGAA 1ANFA 1GGGA 4G68A 1LGBC 1I6QA 4RJZA 1B40A 3MP6A 4LONB 1LFGA 4EF1A 5T3JA 4C1UA 1T0KA 2XXIA 3NOHA 1JW4A 1Q1KA 3SERA 1N76A 4G77A 4G8HA 3K0VA 1MG1A 1FBFA 1SVXB 1FQAA 2XWIA 1Y4TA 4O7MA 3A29A 3E79A 4RYAA 1MQJA 2ANJA 5ISUA 3SEWA 4OZ9A 5CRYA 1FTKA 5F7VA 1JP4A 4PFBA 5L8DA 2BJIA 4H65A 3CSGA 3PU5A 5ELVA 2B3BA 2I0BA 1QJMA 3TTKA 2V25A 3CI8A 4MFIA 4QBAA 3C32A 1LBCA 3EHTA 2X7PA 3MC2A 3MW0A 1OVTA 2PVUA 5CM6A 4BLAA 4IO5A 2X26A 3M3KA 1RDYA 2O7UA 2I4CA 4EQBA 5H8FA 4EXLA 5DTBA 3KGCA 1F9BA 1SYHA 2NXOA 2E1SA 1OIBA 1ZKBA 1MXYA 4YMAA 2HQ0A 2F36A 2XHDA 1YTVA 4IO6A 2Y84A 1N0TA 5ET8A 4H6DA 2R6GE 5H8QA 1XOCA 3IJXB 4NF6A 4XKPA 3PGFA 2DWJA 2Q74A 2O7IA 2PFZA 5KCJA 4JBZA 2QJEA 3E78A 5H8HB 1UTBA 1OVBA 4C1TA 1NUYA 3T96B 3VDFA 3LSXA 3CG1A 4F3BA 5TPAB 1NH7A 3CVGA 3FV1A 5H8SA 4G68C 3H3GA 4FBPA 4OFOA 2OWSA 4EDPA 3G3IA 4QFPA 1MH4A 1R6ZA 3CG3A 5JK4A 4POXA 2Q9TA 4R6YA 3OO7A 1B3LA 3FVGA 2CZLA 3U92A 4NF5B 5I59A 1MQIA 3VV5A 4LUBA 4TQUQ 2PT1A 4MEVA 3TDJA 3KN3A 1Y3NA 2REGA 3H6UA 1B2HA 2QVRA 1A8FA 3HCQA 1MQDA 3L6HA 1JNFA 3H6VA 2I3WA 3OO8A 4DCYA 4I1DA 3TUSA 3RNNA 1QW0A 1B46A 4M1VA 2FVZA 5AA3A 1RYXA 1DBZA 3VLWA 4H45A 4PF6A 1DTZA 4PBHA 3O9PA 2Y7RA 1YAEA 5IZ3A 2A5TB 2V4CA 2D3IA 5L9SA 3IX1A 1B3GA 4PC9A 3C35A 1IUDA 2PMSA 3KBZA 2GH9A 3H6WA 4YKPA 5I56A 1GR2A 3EHSA 3RY3A 4GRKA 1US5A 2QRYA 3IFCA 4OVPA 5ET6A 2H5YA 1QULA 1B58A 1QUIA 1N3WA 1FPJA 2VPNA 1HSEA 1AL3A 4Z0IA 3B6QA 4MMPA 2NVUB 2F6PA 3VVDA 1IQ7A 3G3KA 4NF8A 1Z7NE 4MBPA 1ATGA 1JW1A 4P0IA 4ND9A 3IR1A 1L5TA 4PGPA 3MQ9A 3CRBA 3GYYA 3U72A 4OHNA 1NNFA 3LUYA 3TODA 1PEBA 3S9LC 4WKMA 4X9TA 3OO9A 2HAVA 1GVCA 3FJ7A 4JDFA 3S9EA 1QGXA 1VR5A 3E4RA 4KD5A 5DEXA 2FIXA 4QFLA 2F35A 2Y7WA 3B50A 4HE0A 2DE3A 2W7YA 1B0LA 4H5GA 2F6GA 3H4ZA 1N84A 3K02A 1MXWA 1IMEA 2G93A 1JVYA 2R8TA 5AA4A 2F5XA 4GLIA 1USYE 1HSLA 1MDP1 2XD2A 4PAIA 4NQ8A 5BWJA 4PDHA 3S9MC 3H03A 1MY1A 1FQCA 1B6HA 1LB9A 4H46A 5A5XB 2CMOA 3U8QA 1EH3A 2QFLA 2HEUA 2F97A 4IO4A 1NV5A 3ISPA 5DVFA 1LAXA 4DI3D 2THIA 1IIWA 2YJPA 4EQ7A 2HXRA 3MBPA 2WX9A 1EZPA 1N3XA 4FIMA 4ZEIA 5H8NB 4MAGA 2KLFA 1YZ0A 2HFBA 4NTLA 3EPEA 1JEUA 3Q27A 3TKDA 1B9JA 4NE4A 1IMAA 1MS7A 2R71A 5CBRA 3OSQA 3UIFA 1LAFE 1O64A 4WEDA 4RA1A 3KC0A 3SETA 4PFWA 4G68B 1VFEA 3PPOA 3WAFA 4XEQA 4AB6A 1OMPA 3PUZE 1NH8A 1P1UA 4G4PA 1YCJA 4ONYA 3H6TA 3OMBA 2V3UA 3GXAA 1H44A 2P3VA 1BIYA 4MNCA 1FJ6A 3RTWB 1FJ9A 1I6AA 4O7IA 1SW2A 2CEYA 4KXPA 1FQEA 3P7IA 5FBPA 2XXPA 3MPLA 2RF1A 2UVIA 4NAPA 3PV0E 3MVXA 2UVJA 3KSXA 4PQJA 4BDRA 4X1BA 2DYXA 1IEJA 3DP8A 4NF4A 1SBPA 2FBPA 2F7AA 4GF8A 1NV2A 5CMBA 4F3SA 4PE3A 5FTIA 1LB8A 1SYIA 5H8FB 1Y9UA 1DPEA 3RYDA 4DLDA 5I2NA 2Z8FA 1O7TA 4UA8A 2OCUA 4GX4A 2DE2A 2IEEA 3CR9A 3USDA 1EYJA 1FW0A 1CNQA 3TFLA 2OJTA 3UN6A 3FBPA 5CC2A 2XXVA 4TLMB 5H8QB 2XXKA 4U21A 3T9XB 4AS5A 1WVJA 1MXUA 3U1OA 1IZ1A 5EQ8A 3VVEA 4RPOA 2Q8JA 4G8MA 4TOZA 1LAGE 2F7BA 3R26A 5EHMA 3K1PA 4R75A 4Q30B 4OVSA 3B6WA 5EYFA 5KCJB 1UTBB 4KQPA 4F2QA 1PC3A 5ESYA 2HPGA 2HZLA 4LZ5A 2WYKA 4HE2A 1NV6A 3TYHA 2QSXA 4OMBA 5IZZA 4N15A 4BDMA 1NL5A 1R1NA 4OFLA 1NV7A 4POWA 4F3PA 1S50A 2V3QA 4G8NA 2V84A 3G3HA 1FPLA 2Q8MA 1P1WA 3K6VA 2Q88A 3K4UA 1N04A 4GXSB 3TTLA 3W9VA 4U1ZA 2F8DA 4QF9A 3RPWA 3U94A 2ONKE 4N07A 5I59B 2FIEA 2OWTA 2H4IA 2XXYA 2LAOA 1YPNA 3OENA 2DXRA 4OVTA 4OWDA 3Q28A 1B0HA 1EU8A 3E9XA 3LC8A 4FEBA 4XKNA 2I0CA 2KR0A 2GRVA 2V93A 1SPIA 1IXIA 3IB0A 3LSFB 3V89B 4QFOA 1LLSA 1BK4A 3M3LA 2WBBA 1POTA 1GV8A 4ESWA 3OELA 1PB7A 3FIRA 5IZ3B 3KJTA 3MP1A 2RCBA 2Y5KA 3KG2A 2F78A 4GWUA 2ZYNA 2B4MA 1II5A 2AIXA 4ZEKA 1D4NA 1R9QA 4H1XA 2DE4A 4KYDA 5I56B 3RN8A 2DXYA 5K2XA 1Q35A 5AA2D 1FBGA 3GBBA 3D4GA 3PMVA 2ZMBA 1B3HA 1TFAA 1TXFA 1B52A 1MPCA 3MZ9A 2H9BA 1PDAA 3G3GA 3IJOB 4FJPA 4JWXA 2NWJA 3HO7A 1MXVA 5CMCA 3BKIB 4XKQA 3T1BA 2GQ1A 5I5PA 2QS1A 3IAZA 3FATA 4LQ5A 4NF8B 4U4SA 1UQWA 4X48A 1M5FA 3HSTA 4MCOA 3CIJA 3L6GA 3K6WA 3O28A 2CZKA 3WAEA 3IL1B 2HAUA 4NMYA 3KEIA 3EKIA 3OSRA 1DPPA 2XX9A 1AIVA 2WYPA 3B8BA 1WDNA 2YLNA
chains in the Genus database with same CATH topology
1IXCA 3W15C 3PMWA 2Y7PA 1PBPA 5DEXB 5L9MA 3K01A 3LSWA 1B51A 4YKIA 3KN7A 3MP8A 1JETA 3ZKLA 1QUJA 1NNTA 3T9UA 1DOTA 3K1NA 3TCGA 2PBWA 2VHAA 4QSEA 4ELRA 3T66A 1FQBA 3THIA 5CMMA 1SQYA 2VP1A 1NMUA 3V83A 3UK4A 4KFQA 4LP2B 2QPQA 1B3EA 2O84X 5AA4B 1JVXA 4ZEDA 3VLUA 1B1HA 2UVGA 1URGA 2ZNSA 5FHOA 1P1OA 1FQDA 2QS2A 3QSLA 5KZTA 4QHQA 3DLNA 4TLLB 3DP4A 4BDLA 2ESNA 3O6IA 3TQWA 1SI0A 3FJGA 3QIMA 3JV9A 1NNPA 2Z8EA 3O66A 1SW4A 1M5DA 3ILTB 2FA7A 4R9GA 3D4CA 3T22A 4E0WA 2DWIA 1Y3QA 4KCCA 3O29A 4GL8A 3Q26A 3PPPA 3W9WA 4FECA 4KHZE 3KJ7A 3G3JA 3FXUA 2OLBA 4FEDA 2RKMA 3FZVA 4KYSA 2VD2A 4GFRA 5DT6A 3SEVA 3Q25A 1GTKA 1B5IA 1H76A 1OQHA 4RXLA 2AL5A 3HHGA 1LCFA 4P0GA 5LOMA 2RC7A 1CE2A 3QYTA 2Z23A 1US4A 4GIZA 4EUOA 5EHSA 3K6UA 1MDQA 3T93B 2XXWA 2XX7A 4OEUA 5K2YA 4BDOA 1B4ZA 2XXRA 4F1YA 1OLAA 3IB1A 2XXXA 3UP9A 1EZ9A 3I6VA 4R9FA 1B4HA 4GQOA 2E0SA 1M5CA 3TZAA 4ZS9A 4DXBA 4XTCQ 2I58A 1QKBA 1J1NA 1UIUA 4NF4B 4PETA 2VGQA 1MY0A 5TP9A 3Q29A 1D3KA 2UYFA 5I58A 5IKBA 4RK2A 5HM4B 1S7YA 5ITOA 3IOVA 1AOVA 3I3VA 3HHFA 3G7WA 5I2NB 3ILUB 4DXUA 3RT8A 4DDDA 3C31A 1B7UA 2IA4A 4YU0A 3JZJA 3T9HB 5ITPA 5FHNA 4OVJA 3C4MA 1QUKA 3I5OA 4DE8A 1B32A 4ESXA 1I6BA 1TFDA 2VD3A 2XX8A 2P2AA 2Q2AA 1B05A 3FVOA 3RQTA 4R73A 3FASA 1MPBA 1CB6A 2ZYMA 3MPKA 4I8CA 4DXCA 4XKRA 2I49A 3E13X 4IGRA 3F11A 5I57A 4XXUA 1MY3A 1A55A 2ZNTA 4M4GA 4NWDA 1Y1MA 3MJNA 1B5HA 2YPNA 2RC8A 3IOTA 4RK9A 4LVQA 2B65A 1RYOA 1URSA 4FAJA 2H25A 3RGYA 3RT6B 3E3KA 3KSJA 3VVFA 2DVCA 2DQVA 3SKPA 4ZZEA 2OZZA 1Y3PA 4OYVA 4THIA 3N5LA 3VLVA 3PPRA 2DVZA 4PE5B 5DYHA 1IXHA 2GHAA 4OFJA 5M2VA 2PX1A 4EQ9A 4H8IA 4PFYA 4KR5A 1XC1A 3O97A 4R74A 3MZ1A 4L17A 3PPQA 3VFJA 4YZZA 3O2AA 1IXGA 2I4BA 2QS4A 4DCXA 1NNKA 2Q2CA 3TEPA 4GWOA 1ZMGA 4C0RA 2VOZA 1QKAA 3ZS6A 1MPDA 4BDQA 2XXHA 1ZJLA 3HPIA 4QRZA 4FE8A 2UVHA 3GLBA 3FV2A 1VFDA 3B6TA 1M5EA 4YKKA 3RUMA 4ELOA 1POY1 3R6UA 3KZGA 2WKYA 4HCYA 3KOTA 1A54A 3UGWA 1FTMA 5CMKA 5CBSA 2ZYKA 1UIVA 1N7WA 3C9HA 4QSDA 1XT8A 3SESA 4NWCA 4F18A 2Z22A 1FCKA 4OENA 3ODBA 3LBSA 1B5JA 5CI5A 3K2DA 4X1DA 4BDNA 1LCTA 5AA1A 1LBBA 1UTHA 3QUJA 4GL0A 2RC9A 3TAJA 5JTYA 2BJJX 3EN3A 1PBQA 1BLFA 3U93A 2G29A 1WODA 4OERA 4H0WA 3MZBA 3FVNA 3PUVE 2D5WA 2Y7KA 1PB9A 3N6TA 3VE1B 3BFUA 4Q5TA 3SDFA 2DWAA 2F7CA 4R72A 3TCFA 1ZTYA 4IB2A 4H67A 4U1OA 1MH3A 3IB2A 4JXIA 4KPTA 3MVWA 3H06B 4G2ZA 1FQFA 3TPAA 3IO4A 2XXUA 1A40A 2F34A 4IGTA 1MXZA 4MLVA 2I48A 3PUWE 4HTGA 1MM6A 3ZKKA 3ZSFA 1FTOA 5DVJA 1ELJA 4QFKA 4LA9A 2AL4A 4YKJA 4MLQA 4LZ8A 4YB5A 4AB5A 4GOTA 3T9VA 4OQOA 1B3FA 3FD3A 4HCWA 4YICA 4JWYA 5AA2B 4R2FA 4LQ2A 3IO6A 4ELPA 1EZOA 3MUQA 3M3FA 4ZEBA 3GBAA 3FXRA 3S9NC 5KDTA 1TT1A 1B7ZA 3C34A 3PPNA 2H98A 4F31B 4EXKA 1MQHA 4U23A 1ZIUA 4YAHX 4N6PA 2O51A 3ECRA 2XXTA 5DVIA 4H5FA 4JWOA 3CSBA 2DS9A 4OESA 1DTGA 1URDA 4LATA 2FYIA 3SEUA 5TP9B 2I6EA 4K3FA 5FTHA 2AYSA 4I9DA 4GD5A 5I58B 3FXQA 5L9OA 4KYEA 4MH5A 2UYEA 3TCHA 4ZECA 4ZE8A 4O3AA 3GZGA 3KBRA 3QAXA 4ZE9A 3OO6A 4F22A 2DOJA 3A09A 1D9VA 3FGSA 3V5AA 3SEXA 3B7DA 4PFTA 2O68A 4F39A 3IOUA 3MVYA 4F29A 1A8EA 1S9TA 4Q8RA 1NFTA 4HW8A 1SW5A 1JW5A 3IORA 5TU0A 1LFIA 5BUUA 3MWBA 1Y4CA 3S4UA 5I57B 2DWHA 1I69A 3QK6A 1M5BA 4R2BA 1LAHE 3ONMA 3EHUA 2ONSA 3C36A 3FUZA 1SDXA 4Z7EA 4ISUA 3S2VA 3K00A 4PP0A 4RNSA 1DSNA 4LZ7A 1P1NA 3DP6A 1H43A 1Z7ME 2ONRA 4JB7A 5AA2A 2HCAA 3IK6B 4E0XA 3RLFE 2NUVA 4I62A 4EF2A 1RKMA 1Y1ZA 1D9YA 4DIGA 1XS5A 1B7HA 3TELA 4U22A 3IOWA 3TMGA 2DP8A 1SD3A 2B3FA 3AXFA 2OBGA 2PYYA 1A99A 2X7QA 5I2KB 4JSOA 4GXAA 5IAIA 3HN0A 4O3CA 4OTEA 4OXVA 2QMWA 1QVSA 1FTLA 1N7XA 1BTJA 4HS7A 3QUFA 3KOSA 3O6GA 4U4XA 3FVKA 4WXJA 1IITA 1LFHA 2DSFA 1P1QA 3A3UA 5B70A 5H8HA 3HV1A 1VSOA 3CFZA 4ZEFA 4RY1A 1MY4A 4KCDA 1SI1A 2ZYOA 3EF7A 1XHYA 3DELB 2O1MA 2UXAA 5TPAA 5ICQA 2R9JA 1XVYA 2M8CA 4ELQA 2FNCA 5J1DA 1OLCA 3SEYA 4NF5A 2XXQA 3PUYE 2ALUA 1DMBA 1VE4A 2OK2A 4P11A 1PB8A 5AE4A 3A3CA 1HSJA 1BP5A 5ICTA 3N6UA 4ZDMA 3FJMA 3BBRA 3TTRA 3TTNA 3KN8A 2ZXTA 4OETA 1UTHB 3C33A 3H7MA 1OQGA 3UORA 3OD7A 4KI0E 1FTJA 1ZBMA 2XD3A 5JTYB 4XIGQ 3N94A 4UACA 1AMFA 1MRPA 3DM0A 2REJA 2A5TA 1H45A 1MQGA 3PD9A 3K6XA 3OEMA 4F1VA 1MXXA 4FORA 3VXBA 4QSCA 4GVOA 3OEKA 1KWHA 2QL3A 4MF3A 3BFTA 2O1LA 3JYRA 5HPQA 3MVZA 4F19A 3TTMA 3VXCA 2QMXA 2Q89A 4PFUA 1B1XA 4N13A 2GFEA 2D21A 3QXMA 3N26A 5B7DA 4F3GA 5F1QA 3MAMA 4RPNA 1NKXA 4Q0CA 2Z8DA 1Y20A 5I2KA 3K1MA 1JQFA 2O6AA 4R6KA 1A7LA 1R9LA 2P1SA 1BKAA 1LSTA 5HBCA 5JEIA 2I3VA 3EQ1A 2H99A 1O63A 4NEDA 1JEVA 2RINA 1SW1A 4IY5A 3KFMA 2PT2A 4IO7A 4IO2A 1H3DA 4DZ1A 4U2RA 2HZKA 4F2OA 5KDTB 3PUXE 1TWYA 3PD8A 4YMBA 2QS3A 4OEVA 3UA8A 4JSDA 1P99A 2O69A 3M8UA 2ZNUA 1ZLQA 4ZZAA 3V8XB 3OOAA 5A5XA 4YB7A 3G3FA 4FATA 2HXWA 4YB6A 3CFXA 1ZU0A 4AQ4A 4R6HA 2V3TA 1USYH 4NF6B 4O3BA 3LR1A 3LSLA 3PMXA 5I84A 2RCAA 5H8NA 3OXNA 3RTFB 2GHBA 3R7XA 4IY6A 5FHMA 1MY2A 1XVXA 4WEPA 3O6HA 2Y7IA 4IO3A 2ABHA 1MM7A 2P0SA 3CFLA 1AH5A 4QFNA 3TQLA 2A5SA 4H8JA 2NOOA 4ECFA 4F1UA 1ANFA 1GGGA 4G68A 1LGBC 1I6QA 4RJZA 1B40A 3MP6A 4LONB 1LFGA 4EF1A 4C1UA 1T0KA 2XXIA 1JW4A 1Q1KA 3SERA 1N76A 4G77A 4G8HA 3K0VA 1MG1A 1SVXB 1FQAA 1Y4TA 4RYAA 1MQJA 2ANJA 5ISUA 3SEWA 4OZ9A 5CRYA 1FTKA 5F7VA 5L8DA 4H65A 3CSGA 3PU5A 5ELVA 2B3BA 2I0BA 1QJMA 3TTKA 2V25A 3CI8A 4MFIA 3C32A 1LBCA 3EHTA 2X7PA 3MC2A 3MW0A 1OVTA 2PVUA 5CM6A 4BLAA 4IO5A 2X26A 3M3KA 2O7UA 2I4CA 4EQBA 5H8FA 4EXLA 5DTBA 3KGCA 1F9BA 1SYHA 2NXOA 2E1SA 1OIBA 1ZKBA 1MXYA 4YMAA 2HQ0A 2F36A 2XHDA 1YTVA 4IO6A 2Y84A 1N0TA 4H6DA 2R6GE 5H8QA 1XOCA 3IJXB 4NF6A 4XKPA 3PGFA 2DWJA 2O7IA 5KCJA 4JBZA 2QJEA 5H8HB 1UTBA 1OVBA 4C1TA 3T96B 3VDFA 3LSXA 3CG1A 4F3BA 5TPAB 1NH7A 3CVGA 3FV1A 5H8SA 4G68C 3H3GA 4OFOA 2OWSA 4EDPA 3G3IA 4QFPA 1MH4A 1R6ZA 3CG3A 5JK4A 4POXA 2Q9TA 4R6YA 3OO7A 1B3LA 3FVGA 2CZLA 3U92A 4NF5B 5I59A 1MQIA 3VV5A 4LUBA 4TQUQ 2PT1A 3TDJA 3KN3A 1Y3NA 2REGA 3H6UA 1B2HA 1A8FA 3HCQA 1MQDA 3L6HA 1JNFA 3H6VA 2I3WA 3OO8A 4DCYA 4I1DA 3TUSA 3RNNA 1QW0A 1B46A 4M1VA 5AA3A 1RYXA 3VLWA 1DTZA 3O9PA 2Y7RA 1YAEA 2A5TB 2D3IA 5L9SA 3IX1A 1B3GA 3C35A 1IUDA 2PMSA 2GH9A 3H6WA 4YKPA 5I56A 1GR2A 3EHSA 3RY3A 4GRKA 1US5A 2QRYA 2H5YA 1QULA 1B58A 1QUIA 1N3WA 1HSEA 1AL3A 4Z0IA 3B6QA 2NVUB 2F6PA 3VVDA 1IQ7A 3G3KA 4NF8A 1Z7NE 4MBPA 1ATGA 1JW1A 4P0IA 4ND9A 3IR1A 1L5TA 3MQ9A 3CRBA 3U72A 4OHNA 1NNFA 3LUYA 3TODA 1PEBA 3S9LC 4WKMA 4X9TA 3OO9A 2HAVA 1GVCA 3FJ7A 4JDFA 3S9EA 1VR5A 3E4RA 4KD5A 5DEXA 4QFLA 2F35A 2Y7WA 2DE3A 2W7YA 1B0LA 4H5GA 2F6GA 3H4ZA 1N84A 3K02A 1MXWA 2G93A 1JVYA 5AA4A 2F5XA 4GLIA 1USYE 1HSLA 1MDP1 2XD2A 5BWJA 3S9MC 3H03A 1MY1A 1FQCA 1B6HA 1LB9A 5A5XB 2CMOA 3U8QA 1EH3A 2HEUA 2F97A 4IO4A 5DVFA 1LAXA 2THIA 1IIWA 2YJPA 4EQ7A 3MBPA 1EZPA 1N3XA 4FIMA 4ZEIA 5H8NB 2KLFA 2HFBA 4NTLA 3EPEA 1JEUA 3Q27A 3TKDA 1B9JA 4NE4A 1MS7A 2R71A 5CBRA 3OSQA 3UIFA 1LAFE 1O64A 4WEDA 4RA1A 3SETA 4PFWA 4G68B 1VFEA 3PPOA 3WAFA 4AB6A 1OMPA 3PUZE 1NH8A 1P1UA 4G4PA 1YCJA 4ONYA 3H6TA 3OMBA 2V3UA 3GXAA 1H44A 1BIYA 3RTWB 1I6AA 1SW2A 1FQEA 3P7IA 2XXPA 3MPLA 2RF1A 2UVIA 3PV0E 3MVXA 2UVJA 3KSXA 4PQJA 4BDRA 4X1BA 2DYXA 1IEJA 3DP8A 4NF4A 1SBPA 2F7AA 4GF8A 5CMBA 4F3SA 5FTIA 1LB8A 1SYIA 5H8FB 1Y9UA 1DPEA 5I2NA 4DLDA 2Z8FA 1O7TA 4UA8A 2OCUA 2DE2A 2IEEA 3CR9A 3USDA 1FW0A 3TFLA 2OJTA 3UN6A 5CC2A 2XXVA 4TLMB 5H8QB 4U21A 3T9XB 1WVJA 1MXUA 3U1OA 1IZ1A 3VVEA 4RPOA 2Q8JA 4G8MA 4TOZA 1LAGE 2F7BA 3R26A 5EHMA 3K1PA 4R75A 4Q30B 3B6WA 5EYFA 5KCJB 1UTBB 4KQPA 4F2QA 1PC3A 2HZLA 4LZ5A 3TYHA 2QSXA 4OMBA 4BDMA 1NL5A 1R1NA 4OFLA 4POWA 4F3PA 1S50A 2V3QA 4G8NA 2V84A 3G3HA 1P1WA 3K6VA 2Q88A 3K4UA 1N04A 4GXSB 3TTLA 3W9VA 4U1ZA 2F8DA 4QF9A 3RPWA 3U94A 2ONKE 4N07A 5I59B 2OWTA 2H4IA 2XXYA 2LAOA 1YPNA 3OENA 2DXRA 4OWDA 3Q28A 1B0HA 1EU8A 3E9XA 3LC8A 4FEBA 4XKNA 2I0CA 2GRVA 2V93A 1IXIA 3IB0A 3LSFB 3V89B 4QFOA 1LLSA 3M3LA 1POTA 1GV8A 4ESWA 3OELA 1PB7A 3FIRA 3KJTA 3MP1A 2RCBA 3KG2A 2F78A 2ZYNA 1II5A 2AIXA 4ZEKA 1D4NA 1R9QA 4H1XA 2DE4A 4KYDA 5I56B 3RN8A 2DXYA 5K2XA 1Q35A 5AA2D 3GBBA 3D4GA 3PMVA 2ZMBA 1B3HA 1TFAA 1TXFA 1B52A 1MPCA 3MZ9A 2H9BA 1PDAA 3G3GA 3IJOB 4FJPA 4JWXA 2NWJA 3HO7A 1MXVA 5CMCA 3BKIB 4XKQA 2QS1A 3IAZA 3FATA 4LQ5A 4NF8B 4U4SA 1UQWA 4X48A 1M5FA 3HSTA 3CIJA 3L6GA 3K6WA 3O28A 3WAEA 3IL1B 2HAUA 4NMYA 3KEIA 3OSRA 1DPPA 2XX9A 1AIVA 1WDNA 2YLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IXC A;  3W15 C;  3PMW A;  2Y7P A;  1PBP A;  5DEX B;  5L9M A;  3K01 A;  3LSW A;  1B51 A;  4YKI A;  3KN7 A;  3MP8 A;  1JET A;  3ZKL A;  1QUJ A;  1NNT A;  3T9U A;  1DOT A;  3K1N A;  3TCG A;  2PBW A;  2VHA A;  4QSE A;  4ELR A;  3T66 A;  1FQB A;  3THI A;  5CMM A;  1SQY A;  2VP1 A;  1NMU A;  3V83 A;  3UK4 A;  4KFQ A;  4LP2 B;  2QPQ A;  1B3E A;  2O84 X;  5AA4 B;  1JVX A;  4ZED A;  3VLU A;  1B1H A;  2UVG A;  1URG A;  2ZNS A;  5FHO A;  1P1O A;  1FQD A;  2QS2 A;  3QSL A;  5KZT A;  4QHQ A;  3DLN A;  4TLL B;  3DP4 A;  4BDL A;  2ESN A;  3O6I A;  3TQW A;  1SI0 A;  3FJG A;  3QIM A;  3JV9 A;  1NNP A;  2Z8E A;  3O66 A;  1SW4 A;  1M5D A;  3ILT B;  2FA7 A;  4R9G A;  3D4C A;  3T22 A;  4E0W A;  2DWI A;  1Y3Q A;  4KCC A;  3O29 A;  4GL8 A;  3Q26 A;  3PPP A;  3W9W A;  4FEC A;  4KHZ E;  3KJ7 A;  3G3J A;  3FXU A;  2OLB A;  4FED A;  2RKM A;  3FZV A;  4KYS A;  2VD2 A;  4GFR A;  5DT6 A;  3SEV A;  3Q25 A;  1GTK A;  1B5I A;  1H76 A;  1OQH A;  4RXL A;  2AL5 A;  3HHG A;  1LCF A;  4P0G A;  5LOM A;  2RC7 A;  1CE2 A;  3QYT A;  2Z23 A;  1US4 A;  4GIZ A;  4EUO A;  5EHS A;  3K6U A;  1MDQ A;  3T93 B;  2XXW A;  2XX7 A;  4OEU A;  5K2Y A;  4BDO A;  1B4Z A;  2XXR A;  4F1Y A;  1OLA A;  3IB1 A;  2XXX A;  3UP9 A;  1EZ9 A;  3I6V A;  4R9F A;  1B4H A;  4GQO A;  2E0S A;  1M5C A;  3TZA A;  4ZS9 A;  4DXB A;  4XTC Q;  2I58 A;  1QKB A;  1J1N A;  1UIU A;  4NF4 B;  4PET A;  2VGQ A;  1MY0 A;  5TP9 A;  3Q29 A;  1D3K A;  2UYF A;  5I58 A;  5IKB A;  4RK2 A;  5HM4 B;  1S7Y A;  5ITO A;  3IOV A;  1AOV A;  3I3V A;  3HHF A;  3G7W A;  5I2N B;  3ILU B;  4DXU A;  3RT8 A;  4DDD A;  3C31 A;  1B7U A;  2IA4 A;  4YU0 A;  3JZJ A;  3T9H B;  5ITP A;  5FHN A;  4OVJ A;  3C4M A;  1QUK A;  3I5O A;  4DE8 A;  1B32 A;  4ESX A;  1I6B A;  1TFD A;  2VD3 A;  2XX8 A;  2P2A A;  2Q2A A;  1B05 A;  3FVO A;  3RQT A;  4R73 A;  3FAS A;  1MPB A;  1CB6 A;  2ZYM A;  3MPK A;  4I8C A;  4DXC A;  4XKR A;  2I49 A;  3E13 X;  4IGR A;  3F11 A;  5I57 A;  4XXU A;  1MY3 A;  1A55 A;  2ZNT A;  4M4G A;  4NWD A;  1Y1M A;  3MJN A;  1B5H A;  2YPN A;  2RC8 A;  3IOT A;  4RK9 A;  4LVQ A;  2B65 A;  1RYO A;  1URS A;  4FAJ A;  2H25 A;  3RGY A;  3RT6 B;  3E3K A;  3KSJ A;  3VVF A;  2DVC A;  2DQV A;  3SKP A;  4ZZE A;  2OZZ A;  1Y3P A;  4OYV A;  4THI A;  3N5L A;  3VLV A;  3PPR A;  2DVZ A;  4PE5 B;  5DYH A;  1IXH A;  2GHA A;  4OFJ A;  5M2V A;  2PX1 A;  4EQ9 A;  4H8I A;  4PFY A;  4KR5 A;  1XC1 A;  3O97 A;  4R74 A;  3MZ1 A;  4L17 A;  3PPQ A;  3VFJ A;  4YZZ A;  3O2A A;  1IXG A;  2I4B A;  2QS4 A;  4DCX A;  1NNK A;  2Q2C A;  3TEP A;  4GWO A;  1ZMG A;  4C0R A;  2VOZ A;  1QKA A;  3ZS6 A;  1MPD A;  4BDQ A;  2XXH A;  1ZJL A;  3HPI A;  4QRZ A;  4FE8 A;  2UVH A;  3GLB A;  3FV2 A;  1VFD A;  3B6T A;  1M5E A;  4YKK A;  3RUM A;  4ELO A;  1POY 1;  3R6U A;  3KZG A;  2WKY A;  4HCY A;  3KOT A;  1A54 A;  3UGW A;  1FTM A;  5CMK A;  5CBS A;  2ZYK A;  1UIV A;  1N7W A;  3C9H A;  4QSD A;  1XT8 A;  3SES A;  4NWC A;  4F18 A;  2Z22 A;  1FCK A;  4OEN A;  3ODB A;  3LBS A;  1B5J A;  5CI5 A;  3K2D A;  4X1D A;  4BDN A;  1LCT A;  5AA1 A;  1LBB A;  1UTH A;  3QUJ A;  4GL0 A;  2RC9 A;  3TAJ A;  5JTY A;  2BJJ X;  3EN3 A;  1PBQ A;  1BLF A;  3U93 A;  2G29 A;  1WOD A;  4OER A;  4H0W A;  3MZB A;  3FVN A;  3PUV E;  2D5W A;  2Y7K A;  1PB9 A;  3N6T A;  3VE1 B;  3BFU A;  4Q5T A;  3SDF A;  2DWA A;  2F7C A;  4R72 A;  3TCF A;  1ZTY A;  4IB2 A;  4H67 A;  4U1O A;  1MH3 A;  3IB2 A;  4JXI A;  4KPT A;  3MVW A;  3H06 B;  4G2Z A;  1FQF A;  3TPA A;  3IO4 A;  2XXU A;  1A40 A;  2F34 A;  4IGT A;  1MXZ A;  4MLV A;  2I48 A;  3PUW E;  4HTG A;  1MM6 A;  3ZKK A;  3ZSF A;  1FTO A;  5DVJ A;  1ELJ A;  4QFK A;  4LA9 A;  2AL4 A;  4YKJ A;  4MLQ A;  4LZ8 A;  4YB5 A;  4AB5 A;  4GOT A;  3T9V A;  4OQO A;  1B3F A;  3FD3 A;  4HCW A;  4YIC A;  4JWY A;  5AA2 B;  4R2F A;  4LQ2 A;  3IO6 A;  4ELP A;  1EZO A;  3MUQ A;  3M3F A;  4ZEB A;  3GBA A;  3FXR A;  3S9N C;  5KDT A;  1TT1 A;  1B7Z A;  3C34 A;  3PPN A;  2H98 A;  4F31 B;  4EXK A;  1MQH A;  4U23 A;  1ZIU A;  4YAH X;  4N6P A;  2O51 A;  3ECR A;  2XXT A;  5DVI A;  4H5F A;  4JWO A;  3CSB A;  2DS9 A;  4OES A;  1DTG A;  1URD A;  4LAT A;  2FYI A;  3SEU A;  5TP9 B;  2I6E A;  4K3F A;  5FTH A;  2AYS A;  4I9D A;  4GD5 A;  5I58 B;  3FXQ A;  5L9O A;  4KYE A;  4MH5 A;  2UYE A;  3TCH A;  4ZEC A;  4ZE8 A;  4O3A A;  3GZG A;  3KBR A;  3QAX A;  4ZE9 A;  3OO6 A;  4F22 A;  2DOJ A;  3A09 A;  1D9V A;  3FGS A;  3V5A A;  3SEX A;  3B7D A;  4PFT A;  2O68 A;  4F39 A;  3IOU A;  3MVY A;  4F29 A;  1A8E A;  1S9T A;  4Q8R A;  1NFT A;  4HW8 A;  1SW5 A;  1JW5 A;  3IOR A;  5TU0 A;  1LFI A;  5BUU A;  3MWB A;  1Y4C A;  3S4U A;  5I57 B;  2DWH A;  1I69 A;  3QK6 A;  1M5B A;  4R2B A;  1LAH E;  3ONM A;  3EHU A;  2ONS A;  3C36 A;  3FUZ A;  1SDX A;  4Z7E A;  4ISU A;  3S2V A;  3K00 A;  4PP0 A;  4RNS A;  1DSN A;  4LZ7 A;  1P1N A;  3DP6 A;  1H43 A;  1Z7M E;  2ONR A;  4JB7 A;  5AA2 A;  2HCA A;  3IK6 B;  4E0X A;  3RLF E;  2NUV A;  4I62 A;  4EF2 A;  1RKM A;  1Y1Z A;  1D9Y A;  4DIG A;  1XS5 A;  1B7H A;  3TEL A;  4U22 A;  3IOW A;  3TMG A;  2DP8 A;  1SD3 A;  2B3F A;  3AXF A;  2OBG A;  2PYY A;  1A99 A;  2X7Q A;  5I2K B;  4JSO A;  4GXA A;  5IAI A;  3HN0 A;  4O3C A;  4OTE A;  4OXV A;  2QMW A;  1QVS A;  1FTL A;  1N7X A;  1BTJ A;  4HS7 A;  3QUF A;  3KOS A;  3O6G A;  4U4X A;  3FVK A;  4WXJ A;  1IIT A;  1LFH A;  2DSF A;  1P1Q A;  3A3U A;  5B70 A;  5H8H A;  3HV1 A;  1VSO A;  3CFZ A;  4ZEF A;  4RY1 A;  1MY4 A;  4KCD A;  1SI1 A;  2ZYO A;  3EF7 A;  1XHY A;  3DEL B;  2O1M A;  2UXA A;  5TPA A;  5ICQ A;  2R9J A;  1XVY A;  2M8C A;  4ELQ A;  2FNC A;  5J1D A;  1OLC A;  3SEY A;  4NF5 A;  2XXQ A;  3PUY E;  2ALU A;  1DMB A;  1VE4 A;  2OK2 A;  4P11 A;  1PB8 A;  5AE4 A;  3A3C A;  1HSJ A;  1BP5 A;  5ICT A;  3N6U A;  4ZDM A;  3FJM A;  3BBR A;  3TTR A;  3TTN A;  3KN8 A;  2ZXT A;  4OET A;  1UTH B;  3C33 A;  3H7M A;  1OQG A;  3UOR A;  3OD7 A;  4KI0 E;  1FTJ A;  1ZBM A;  2XD3 A;  5JTY B;  4XIG Q;  3N94 A;  4UAC A;  1AMF A;  1MRP A;  3DM0 A;  2REJ A;  2A5T A;  1H45 A;  1MQG A;  3PD9 A;  3K6X A;  3OEM A;  4F1V A;  1MXX A;  4FOR A;  3VXB A;  4QSC A;  4GVO A;  3OEK A;  1KWH A;  2QL3 A;  4MF3 A;  3BFT A;  2O1L A;  3JYR A;  5HPQ A;  3MVZ A;  4F19 A;  3TTM A;  3VXC A;  2QMX A;  2Q89 A;  4PFU A;  1B1X A;  4N13 A;  2GFE A;  2D21 A;  3QXM A;  3N26 A;  5B7D A;  4F3G A;  5F1Q A;  3MAM A;  4RPN A;  1NKX A;  4Q0C A;  2Z8D A;  1Y20 A;  5I2K A;  3K1M A;  1JQF A;  2O6A A;  4R6K A;  1A7L A;  1R9L A;  2P1S A;  1BKA A;  1LST A;  5HBC A;  5JEI A;  2I3V A;  3EQ1 A;  2H99 A;  1O63 A;  4NED A;  1JEV A;  2RIN A;  1SW1 A;  4IY5 A;  3KFM A;  2PT2 A;  4IO7 A;  4IO2 A;  1H3D A;  4DZ1 A;  4U2R A;  2HZK A;  4F2O A;  5KDT B;  3PUX E;  1TWY A;  3PD8 A;  4YMB A;  2QS3 A;  4OEV A;  3UA8 A;  4JSD A;  1P99 A;  2O69 A;  3M8U A;  2ZNU A;  1ZLQ A;  4ZZA A;  3V8X B;  3OOA A;  5A5X A;  4YB7 A;  3G3F A;  4FAT A;  2HXW A;  4YB6 A;  3CFX A;  1ZU0 A;  4AQ4 A;  4R6H A;  2V3T A;  1USY H;  4NF6 B;  4O3B A;  3LR1 A;  3LSL A;  3PMX A;  5I84 A;  2RCA A;  5H8N A;  3OXN A;  3RTF B;  2GHB A;  3R7X A;  4IY6 A;  5FHM A;  1MY2 A;  1XVX A;  4WEP A;  3O6H A;  2Y7I A;  4IO3 A;  2ABH A;  1MM7 A;  2P0S A;  3CFL A;  1AH5 A;  4QFN A;  3TQL A;  2A5S A;  4H8J A;  2NOO A;  4ECF A;  4F1U A;  1ANF A;  1GGG A;  4G68 A;  1LGB C;  1I6Q A;  4RJZ A;  1B40 A;  3MP6 A;  4LON B;  1LFG A;  4EF1 A;  4C1U A;  1T0K A;  2XXI A;  1JW4 A;  1Q1K A;  3SER A;  1N76 A;  4G77 A;  4G8H A;  3K0V A;  1MG1 A;  1SVX B;  1FQA A;  1Y4T A;  4RYA A;  1MQJ A;  2ANJ A;  5ISU A;  3SEW A;  4OZ9 A;  5CRY A;  1FTK A;  5F7V A;  5L8D A;  4H65 A;  3CSG A;  3PU5 A;  5ELV A;  2B3B A;  2I0B A;  1QJM A;  3TTK A;  2V25 A;  3CI8 A;  4MFI A;  3C32 A;  1LBC A;  3EHT A;  2X7P A;  3MC2 A;  3MW0 A;  1OVT A;  2PVU A;  5CM6 A;  4BLA A;  4IO5 A;  2X26 A;  3M3K A;  2O7U A;  2I4C A;  4EQB A;  5H8F A;  4EXL A;  5DTB A;  3KGC A;  1F9B A;  1SYH A;  2NXO A;  2E1S A;  1OIB A;  1ZKB A;  1MXY A;  4YMA A;  2HQ0 A;  2F36 A;  2XHD A;  1YTV A;  4IO6 A;  2Y84 A;  1N0T A;  4H6D A;  2R6G E;  5H8Q A;  1XOC A;  3IJX B;  4NF6 A;  4XKP A;  3PGF A;  2DWJ A;  2O7I A;  5KCJ A;  4JBZ A;  2QJE A;  5H8H B;  1UTB A;  1OVB A;  4C1T A;  3T96 B;  3VDF A;  3LSX A;  3CG1 A;  4F3B A;  5TPA B;  1NH7 A;  3CVG A;  3FV1 A;  5H8S A;  4G68 C;  3H3G A;  4OFO A;  2OWS A;  4EDP A;  3G3I A;  4QFP A;  1MH4 A;  1R6Z A;  3CG3 A;  5JK4 A;  4POX A;  2Q9T A;  4R6Y A;  3OO7 A;  1B3L A;  3FVG A;  2CZL A;  3U92 A;  4NF5 B;  5I59 A;  1MQI A;  3VV5 A;  4LUB A;  4TQU Q;  2PT1 A;  3TDJ A;  3KN3 A;  1Y3N A;  2REG A;  3H6U A;  1B2H A;  1A8F A;  3HCQ A;  1MQD A;  3L6H A;  1JNF A;  3H6V A;  2I3W A;  3OO8 A;  4DCY A;  4I1D A;  3TUS A;  3RNN A;  1QW0 A;  1B46 A;  4M1V A;  5AA3 A;  1RYX A;  3VLW A;  1DTZ A;  3O9P A;  2Y7R A;  1YAE A;  2A5T B;  2D3I A;  5L9S A;  3IX1 A;  1B3G A;  3C35 A;  1IUD A;  2PMS A;  2GH9 A;  3H6W A;  4YKP A;  5I56 A;  1GR2 A;  3EHS A;  3RY3 A;  4GRK A;  1US5 A;  2QRY A;  2H5Y A;  1QUL A;  1B58 A;  1QUI A;  1N3W A;  1HSE A;  1AL3 A;  4Z0I A;  3B6Q A;  2NVU B;  2F6P A;  3VVD A;  1IQ7 A;  3G3K A;  4NF8 A;  1Z7N E;  4MBP A;  1ATG A;  1JW1 A;  4P0I A;  4ND9 A;  3IR1 A;  1L5T A;  3MQ9 A;  3CRB A;  3U72 A;  4OHN A;  1NNF A;  3LUY A;  3TOD A;  1PEB A;  3S9L C;  4WKM A;  4X9T A;  3OO9 A;  2HAV A;  1GVC A;  3FJ7 A;  4JDF A;  3S9E A;  1VR5 A;  3E4R A;  4KD5 A;  5DEX A;  4QFL A;  2F35 A;  2Y7W A;  2DE3 A;  2W7Y A;  1B0L A;  4H5G A;  2F6G A;  3H4Z A;  1N84 A;  3K02 A;  1MXW A;  2G93 A;  1JVY A;  5AA4 A;  2F5X A;  4GLI A;  1USY E;  1HSL A;  1MDP 1;  2XD2 A;  5BWJ A;  3S9M C;  3H03 A;  1MY1 A;  1FQC A;  1B6H A;  1LB9 A;  5A5X B;  2CMO A;  3U8Q A;  1EH3 A;  2HEU A;  2F97 A;  4IO4 A;  5DVF A;  1LAX A;  2THI A;  1IIW A;  2YJP A;  4EQ7 A;  3MBP A;  1EZP A;  1N3X A;  4FIM A;  4ZEI A;  5H8N B;  2KLF A;  2HFB A;  4NTL A;  3EPE A;  1JEU A;  3Q27 A;  3TKD A;  1B9J A;  4NE4 A;  1MS7 A;  2R71 A;  5CBR A;  3OSQ A;  3UIF A;  1LAF E;  1O64 A;  4WED A;  4RA1 A;  3SET A;  4PFW A;  4G68 B;  1VFE A;  3PPO A;  3WAF A;  4AB6 A;  1OMP A;  3PUZ E;  1NH8 A;  1P1U A;  4G4P A;  1YCJ A;  4ONY A;  3H6T A;  3OMB A;  2V3U A;  3GXA A;  1H44 A;  1BIY A;  3RTW B;  1I6A A;  1SW2 A;  1FQE A;  3P7I A;  2XXP A;  3MPL A;  2RF1 A;  2UVI A;  3PV0 E;  3MVX A;  2UVJ A;  3KSX A;  4PQJ A;  4BDR A;  4X1B A;  2DYX A;  1IEJ A;  3DP8 A;  4NF4 A;  1SBP A;  2F7A A;  4GF8 A;  5CMB A;  4F3S A;  5FTI A;  1LB8 A;  1SYI A;  5H8F B;  1Y9U A;  1DPE A;  5I2N A;  4DLD A;  2Z8F A;  1O7T A;  4UA8 A;  2OCU A;  2DE2 A;  2IEE A;  3CR9 A;  3USD A;  1FW0 A;  3TFL A;  2OJT A;  3UN6 A;  5CC2 A;  2XXV A;  4TLM B;  5H8Q B;  4U21 A;  3T9X B;  1WVJ A;  1MXU A;  3U1O A;  1IZ1 A;  3VVE A;  4RPO A;  2Q8J A;  4G8M A;  4TOZ A;  1LAG E;  2F7B A;  3R26 A;  5EHM A;  3K1P A;  4R75 A;  4Q30 B;  3B6W A;  5EYF A;  5KCJ B;  1UTB B;  4KQP A;  4F2Q A;  1PC3 A;  2HZL A;  4LZ5 A;  3TYH A;  2QSX A;  4OMB A;  4BDM A;  1NL5 A;  1R1N A;  4OFL A;  4POW A;  4F3P A;  1S50 A;  2V3Q A;  4G8N A;  2V84 A;  3G3H A;  1P1W A;  3K6V A;  2Q88 A;  3K4U A;  1N04 A;  4GXS B;  3TTL A;  3W9V A;  4U1Z A;  2F8D A;  4QF9 A;  3RPW A;  3U94 A;  2ONK E;  4N07 A;  5I59 B;  2OWT A;  2H4I A;  2XXY A;  2LAO A;  1YPN A;  3OEN A;  2DXR A;  4OWD A;  3Q28 A;  1B0H A;  1EU8 A;  3E9X A;  3LC8 A;  4FEB A;  4XKN A;  2I0C A;  2GRV A;  2V93 A;  1IXI A;  3IB0 A;  3LSF B;  3V89 B;  4QFO A;  1LLS A;  3M3L A;  1POT A;  1GV8 A;  4ESW A;  3OEL A;  1PB7 A;  3FIR A;  3KJT A;  3MP1 A;  2RCB A;  3KG2 A;  2F78 A;  2ZYN A;  1II5 A;  2AIX A;  4ZEK A;  1D4N A;  1R9Q A;  4H1X A;  2DE4 A;  4KYD A;  5I56 B;  3RN8 A;  2DXY A;  5K2X A;  1Q35 A;  5AA2 D;  3GBB A;  3D4G A;  3PMV A;  2ZMB A;  1B3H A;  1TFA A;  1TXF A;  1B52 A;  1MPC A;  3MZ9 A;  2H9B A;  1PDA A;  3G3G A;  3IJO B;  4FJP A;  4JWX A;  2NWJ A;  3HO7 A;  1MXV A;  5CMC A;  3BKI B;  4XKQ A;  2QS1 A;  3IAZ A;  3FAT A;  4LQ5 A;  4NF8 B;  4U4S A;  1UQW A;  4X48 A;  1M5F A;  3HST A;  3CIJ A;  3L6G A;  3K6W A;  3O28 A;  3WAE A;  3IL1 B;  2HAU A;  4NMY A;  3KEI A;  3OSR A;  1DPP A;  2XX9 A;  1AIV A;  1WDN A;  2YLN A; 
#chains in the Genus database with same CATH topology
 1IXC A;  3W15 C;  1LBW A;  3PMW A;  2Y7P A;  4GX3 A;  1PBP A;  5DEX B;  5L9M A;  3K01 A;  3LSW A;  1B51 A;  4PDD A;  4YKI A;  3KN7 A;  3MP8 A;  1JET A;  3ZKL A;  1QUJ A;  1NNT A;  3T9U A;  1DOT A;  3K1N A;  3TCG A;  2PBW A;  2VHA A;  4QSE A;  4ELR A;  3T66 A;  1FQB A;  3THI A;  5CMM A;  1SQY A;  2VP1 A;  1NMU A;  3V83 A;  4P9K A;  3UK4 A;  1RDZ A;  4KFQ A;  4LP2 B;  2QPQ A;  1NI9 A;  1B3E A;  2O84 X;  5AA4 B;  1JVX A;  4ZED A;  3VLU A;  1B1H A;  2UVG A;  1URG A;  2ZNS A;  5FHO A;  1P1O A;  1FQD A;  1G0H A;  2QS2 A;  4I3E A;  3QSL A;  5DW8 A;  4PF8 A;  5KZT A;  4QHQ A;  3DLN A;  4TLL B;  3DP4 A;  4BDL A;  2ESN A;  3O6I A;  4X8R A;  1FTA A;  3TQW A;  1SI0 A;  3FJG A;  3QIM A;  3JV9 A;  1NNP A;  2Z8E A;  1G0I A;  4GWZ A;  3O66 A;  1SW4 A;  4IR8 A;  1VDW A;  1M5D A;  3ILT B;  2FA7 A;  4R9G A;  3D4C A;  3T22 A;  4E0W A;  4N4U A;  4MNI A;  2DWI A;  1Y3Q A;  4KCC A;  3O29 A;  4GL8 A;  4N17 A;  1FPI A;  3Q26 A;  3PPP A;  3BIH A;  4FEC A;  3W9W A;  4KHZ E;  3KJ7 A;  3G3J A;  3FXU A;  2OLB A;  4FED A;  2RKM A;  3FZV A;  4KYS A;  2XWV A;  2VD2 A;  4GFR A;  5DT6 A;  3SEV A;  2PCR A;  3Q25 A;  1RDX A;  2DDK A;  1GTK A;  1B5I A;  1H76 A;  1OQH A;  2ZZV A;  2AL5 A;  4RXL A;  3HHG A;  1LCF A;  4P0G A;  5LOM A;  2RC7 A;  1EYK A;  1CE2 A;  3QYT A;  2Z23 A;  1US4 A;  4GIZ A;  1NUX A;  4EUO A;  5EHS A;  1IMC A;  3K6U A;  1MDQ A;  4GWX A;  4NF0 A;  3T93 B;  4HXV A;  2XXW A;  2XX7 A;  4OEU A;  5K2Y A;  4BDO A;  3LUZ A;  1B4Z A;  4N8Y A;  2XXR A;  4F1Y A;  4MNP A;  1OLA A;  3IB1 A;  2XXX A;  3UP9 A;  2JJK A;  4N6D A;  1EZ9 A;  3I6V A;  4R9F A;  1B4H A;  4GQO A;  2E0S A;  1FBE A;  3PTY A;  1M5C A;  3TZA A;  4ZS9 A;  4DXB A;  4XTC Q;  2I58 A;  1QKB A;  1J1N A;  1UIU A;  4NF4 B;  4PET A;  2VGQ A;  1MY0 A;  5TP9 A;  3Q29 A;  1D3K A;  2UYF A;  5I58 A;  5IKB A;  4RK2 A;  3HFU A;  5HM4 B;  4OAN A;  1S7Y A;  5ITO A;  3IOV A;  1AOV A;  3I3V A;  3HHF A;  3G7W A;  5I2N B;  3ILU B;  4DXU A;  3RT8 A;  4DDD A;  1FBH A;  3C31 A;  1NV4 A;  1B7U A;  2IA4 A;  4GWW A;  4YU0 A;  3JZJ A;  3T9H B;  5ITP A;  5FHN A;  4OVJ A;  3C4M A;  1QUK A;  3I5O A;  4PTK A;  4DE8 A;  1B32 A;  4ESX A;  1I6B A;  1TFD A;  2VD3 A;  4X04 A;  4N8G A;  2XX8 A;  2P2A A;  1NV1 A;  2Q2A A;  1B05 A;  3FVO A;  3RQT A;  4R73 A;  3FAS A;  1MPB A;  1CB6 A;  2ZYM A;  3MPK A;  4I8C A;  4DXC A;  4XKR A;  2I49 A;  3E13 X;  4IGR A;  3F11 A;  5I57 A;  4XXU A;  1MY3 A;  1A55 A;  2ZNT A;  4M4G A;  4NX1 A;  4NWD A;  1Y1M A;  3MJN A;  1B5H A;  2YPN A;  2RC8 A;  3IOT A;  4RK9 A;  4LVQ A;  4PFI A;  2B65 A;  1RYO A;  1URS A;  4MJO A;  4FAJ A;  4NGU A;  2H25 A;  4N91 A;  1LBV A;  3RGY A;  3RT6 B;  3E3K A;  3KSJ A;  3VVF A;  2DVC A;  2ZZW A;  2DQV A;  3SKP A;  4ZZE A;  4P8B A;  2OZZ A;  3RPL B;  3CHG A;  1Y3P A;  4OYV A;  4THI A;  3N5L A;  1INP A;  3VLV A;  3PPR A;  4GX6 A;  2DVZ A;  4PE5 B;  5DYH A;  1IXH A;  2GHA A;  4OFJ A;  5M2V A;  2PX1 A;  4EQ9 A;  4H8I A;  4PFY A;  4KR5 A;  4P3L A;  1XC1 A;  4NHB A;  3T0J A;  3O97 A;  4R74 A;  3MZ1 A;  4P47 A;  4L17 A;  3PPQ A;  1K9Z A;  3VFJ A;  4YZZ A;  3O2A A;  1IXG A;  2I4B A;  2QS4 A;  4DCX A;  4I3Y A;  4P1L A;  1NNK A;  2Q2C A;  3TEP A;  4GWO A;  1ZMG A;  4C0R A;  2VOZ A;  1QKA A;  5ET5 A;  3ZS6 A;  2L5V A;  1MPD A;  4BDQ A;  2XXH A;  4G61 A;  5A5L A;  1ZJL A;  3HPI A;  4QRZ A;  4FE8 A;  2UVH A;  3GLB A;  3FV2 A;  1VFD A;  3B6T A;  1M5E A;  4YKK A;  2FHY A;  3RUM A;  4ELO A;  1POY 1;  4UAB A;  4O8M A;  5IZ1 A;  3R6U A;  3KZG A;  1XI6 A;  2WKY A;  1FPD A;  4HCY A;  3KOT A;  1A54 A;  4PGN A;  3UGW A;  1FTM A;  5CMK A;  5CBS A;  2ZYK A;  1UIV A;  4MHF A;  1N7W A;  3C9H A;  1NV0 A;  4QSD A;  1XT8 A;  3SES A;  3BIG A;  4NWC A;  4F18 A;  2Z22 A;  4XFE A;  1FCK A;  4NN3 A;  5EQA A;  4OEN A;  3IFA A;  3LBS A;  3ODB A;  1B5J A;  5CI5 A;  1LBY A;  4LN5 A;  3K2D A;  4X1D A;  4PCD A;  4BDN A;  1FBC A;  1LCT A;  5AA1 A;  1LBB A;  1IMB A;  1UTH A;  3QUJ A;  4GL0 A;  1LBX A;  2RC9 A;  3TAJ A;  5JTY A;  2BJJ X;  3EN3 A;  1PBQ A;  1BLF A;  3U93 A;  2G29 A;  1WOD A;  4OER A;  4I40 A;  4H0W A;  3MZB A;  3FVN A;  3PUV E;  5J16 A;  2D5W A;  1YYZ A;  2Y7K A;  1PB9 A;  3N6T A;  3RPL A;  3VE1 B;  2HHM A;  3BFU A;  4Q5T A;  3SDF A;  2DWA A;  2F7C A;  4R72 A;  3TCF A;  1ZTY A;  4IB2 A;  4H67 A;  4PAK A;  5EYH A;  4U1O A;  1MH3 A;  3IB2 A;  4JXI A;  4KPT A;  3MVW A;  3H06 B;  4G2Z A;  2OWZ A;  1FQF A;  3TPA A;  3IO4 A;  2XXU A;  1A40 A;  3SZP A;  2F34 A;  5IM2 A;  4IGT A;  1MXZ A;  4MLV A;  2I48 A;  3PUW E;  4HTG A;  1MM6 A;  3ZKK A;  3ZSF A;  5LDZ A;  1FTO A;  5DVJ A;  1ELJ A;  4QFK A;  4LA9 A;  1LEV A;  2AL4 A;  4YKJ A;  4MLQ A;  4LZ8 A;  4YB5 A;  2CZH A;  4AB5 A;  4GOT A;  1EYI A;  3T9V A;  4OQO A;  1B3F A;  3FD3 A;  2MKZ A;  4HCW A;  4YIC A;  4JVD A;  4JWY A;  5AA2 B;  4R2F A;  4LQ2 A;  3IO6 A;  4ELP A;  1EZO A;  3MUQ A;  3M3F A;  4ZEB A;  3GBA A;  3FXR A;  3S9N C;  5KDT A;  1TT1 A;  1NUW A;  1B7Z A;  4JVC A;  3C34 A;  3PPN A;  2H98 A;  4F31 B;  4EXK A;  4OA4 A;  1MQH A;  4O94 A;  4U23 A;  3D1R A;  1ZIU A;  4YAH X;  4N6P A;  2O51 A;  3ECR A;  2XXT A;  4JVI A;  4H5F A;  4JWO A;  5DVI A;  4PBQ A;  3CSB A;  2DS9 A;  4OES A;  1DTG A;  1URD A;  1KZ8 A;  4LAT A;  2FYI A;  3SEU A;  5TP9 B;  2I6E A;  4K3F A;  5FTH A;  2AYS A;  4I9D A;  4GD5 A;  5I58 B;  4GWS A;  3FXQ A;  5L9O A;  4KYE A;  4MH5 A;  2UYE A;  3TCH A;  4ZEC A;  4XF5 A;  4ZE8 A;  4O3A A;  3GZG A;  3KBR A;  3QAX A;  4ZE9 A;  3OO6 A;  2B4L A;  4F22 A;  2DOJ A;  2XA5 A;  3A09 A;  1D9V A;  3FGS A;  3V5A A;  2OX3 A;  3SEX A;  3B7D A;  1FBD A;  4PFT A;  2O68 A;  4F39 A;  3IOU A;  3MVY A;  4F29 A;  1A8E A;  1S9T A;  4Q8R A;  1NFT A;  4HW8 A;  1SW5 A;  1FRP A;  4PFR A;  1JW5 A;  3IOR A;  5TU0 A;  1LFI A;  5BUU A;  3MWB A;  1Y4C A;  3S4U A;  5I57 B;  4MIJ A;  2VPO A;  2DWH A;  1I69 A;  3QK6 A;  1M5B A;  4R2B A;  1LAH E;  3ONM A;  3EHU A;  4AS4 A;  4GWY A;  2ONS A;  3C36 A;  2XWK A;  3FUZ A;  1SDX A;  4Z7E A;  4ISU A;  3S2V A;  1IMD A;  3K00 A;  4PP0 A;  4RNS A;  1DSN A;  4LZ7 A;  3MYU A;  1P1N A;  3DP6 A;  1H43 A;  1Z7M E;  2ONR A;  4JB7 A;  5AA2 A;  2HCA A;  3IK6 B;  4E0X A;  3RLF E;  2NUV A;  1FPE A;  4I62 A;  4MX6 A;  4EF2 A;  1RKM A;  1Y1Z A;  5EQ7 A;  5LTC A;  1D9Y A;  4OVQ A;  4DIG A;  1XS5 A;  1B7H A;  3TEL A;  4U22 A;  5I7I A;  3IOW A;  3TMG A;  2DP8 A;  1SD3 A;  2B3F A;  4N6K A;  2OBG A;  3AXF A;  2PYY A;  3LV0 A;  1A99 A;  2X7Q A;  4NG7 A;  5I2K B;  4OVR A;  4JSO A;  4GXA A;  2XWO A;  5IAI A;  1DCU A;  1DK4 A;  3HN0 A;  4O3C A;  4OTE A;  4OXV A;  2QMW A;  1QVS A;  4P1E A;  1FTL A;  1N7X A;  1BTJ A;  3QMF A;  4HS7 A;  3QUF A;  3KOS A;  3O6G A;  4U4X A;  3FVK A;  4WXJ A;  1IIT A;  1FSA A;  1LFH A;  2DSF A;  1P1Q A;  3A3U A;  4GBW A;  5B70 A;  5H8H A;  3HV1 A;  1VSO A;  2QVV A;  5EQ9 A;  2P3N A;  3CFZ A;  2WBD A;  4RY1 A;  4ZEF A;  1MY4 A;  1NV3 A;  4KCD A;  1SI1 A;  2ZYO A;  3EF7 A;  1XHY A;  3DEL B;  2O1M A;  2UXA A;  4N81 A;  5TPA A;  4DI4 B;  5ICQ A;  2R9J A;  4P56 A;  1XVY A;  2Y5L A;  1FPG A;  2M8C A;  4ELQ A;  1FPB A;  3KC1 A;  2FNC A;  5J1D A;  1OLC A;  3SEY A;  4NF5 A;  5EYG A;  2XXQ A;  3PUY E;  2ALU A;  1DMB A;  1VE4 A;  2OK2 A;  4P11 A;  1PB8 A;  5AE4 A;  3A3C A;  1HSJ A;  1FPK A;  1BP5 A;  5ICT A;  3N6U A;  4ZDM A;  3FJM A;  3BBR A;  3TTR A;  3TTN A;  3KN8 A;  2ZXT A;  4OET A;  1UTH B;  3C33 A;  3H7M A;  1OQG A;  3UOR A;  3OD7 A;  4KI0 E;  1FTJ A;  1YXI A;  1ZBM A;  2XD3 A;  5JTY B;  4XIG Q;  4PAF A;  3N94 A;  4UAC A;  1AMF A;  1MRP A;  3DM0 A;  2REJ A;  2A5T A;  1H45 A;  1MQG A;  3PD9 A;  3K6X A;  1D9Q A;  3OEM A;  4F1V A;  1MXX A;  4FOR A;  3VXB A;  4QSC A;  2KQZ A;  4GVO A;  3OEK A;  1KWH A;  2QVU A;  2QL3 A;  4MF3 A;  5ET7 A;  3BFT A;  2O1L A;  3JYR A;  5HPQ A;  3MVZ A;  4F19 A;  3TTM A;  3VXC A;  2QMX A;  2Q89 A;  4PFU A;  1B1X A;  4N13 A;  2GFE A;  2D21 A;  3QXM A;  3N26 A;  5B7D A;  4F3G A;  5F1Q A;  5I3S A;  3MAM A;  4RPN A;  3ROJ A;  1NKX A;  4Q0C A;  2Z8D A;  1Y20 A;  5I2K A;  2ZZX A;  3K1M A;  1JQF A;  2O6A A;  3FXB A;  4R6K A;  3MST A;  1A7L A;  1R9L A;  2P1S A;  1BKA A;  1LST A;  5HBC A;  5JEI A;  2I3V A;  3EQ1 A;  2H99 A;  1O63 A;  2CEX A;  2VT5 A;  4NED A;  1JEV A;  1KA1 A;  2RIN A;  1SW1 A;  4IY5 A;  3KFM A;  2PT2 A;  4IO7 A;  4IO2 A;  1H3D A;  5F24 A;  4HE1 A;  4DZ1 A;  4U2R A;  2HZK A;  4F2O A;  5KDT B;  3PUX E;  1TWY A;  3PD8 A;  4YMB A;  2QS3 A;  4OEV A;  4GBV A;  1NUZ A;  1FPF A;  3UA8 A;  4JSD A;  1P99 A;  2O69 A;  3M8U A;  2ZNU A;  4QXD A;  3U65 A;  1ZLQ A;  4ZZA A;  3V8X B;  3OOA A;  5A5X A;  1FBP A;  4YB7 A;  3G3F A;  4FAT A;  2HXW A;  4YB6 A;  3CFX A;  1K9Y A;  1ZU0 A;  4AQ4 A;  4R6H A;  2V3T A;  1USY H;  4NF6 B;  4O3B A;  3LR1 A;  3LSL A;  3PMX A;  5I84 A;  2RCA A;  2CZI A;  5H8N A;  3OXN A;  2F3B A;  3RTF B;  2GHB A;  3R7X A;  2F3D A;  1KA0 A;  4IY6 A;  1AWB A;  5FHM A;  1MY2 A;  1XVX A;  2WEF A;  4WEP A;  2PFY A;  3O6H A;  2Y7I A;  4IO3 A;  2ABH A;  1MM7 A;  2P0S A;  3CFL A;  1AH5 A;  4QFN A;  3TQL A;  1LBZ A;  2A5S A;  4H8J A;  1Q9D A;  2NOO A;  1IMF A;  4ECF A;  4F1U A;  5IGA A;  1ANF A;  1GGG A;  4G68 A;  1LGB C;  1I6Q A;  4RJZ A;  1B40 A;  3MP6 A;  4LON B;  1LFG A;  4EF1 A;  5T3J A;  4C1U A;  1T0K A;  2XXI A;  3NOH A;  1JW4 A;  1Q1K A;  3SER A;  1N76 A;  4G77 A;  4G8H A;  3K0V A;  1MG1 A;  1FBF A;  1SVX B;  1FQA A;  2XWI A;  1Y4T A;  4O7M A;  3A29 A;  3E79 A;  4RYA A;  1MQJ A;  2ANJ A;  5ISU A;  3SEW A;  4OZ9 A;  5CRY A;  1FTK A;  5F7V A;  1JP4 A;  4PFB A;  5L8D A;  2BJI A;  4H65 A;  3CSG A;  3PU5 A;  5ELV A;  2B3B A;  2I0B A;  1QJM A;  3TTK A;  2V25 A;  3CI8 A;  4MFI A;  4QBA A;  3C32 A;  1LBC A;  3EHT A;  2X7P A;  3MC2 A;  3MW0 A;  1OVT A;  2PVU A;  5CM6 A;  4BLA A;  4IO5 A;  2X26 A;  3M3K A;  1RDY A;  2O7U A;  2I4C A;  4EQB A;  5H8F A;  4EXL A;  5DTB A;  3KGC A;  1F9B A;  1SYH A;  2NXO A;  2E1S A;  1OIB A;  1ZKB A;  1MXY A;  4YMA A;  2HQ0 A;  2F36 A;  2XHD A;  1YTV A;  4IO6 A;  2Y84 A;  1N0T A;  5ET8 A;  4H6D A;  2R6G E;  5H8Q A;  1XOC A;  3IJX B;  4NF6 A;  4XKP A;  3PGF A;  2DWJ A;  2Q74 A;  2O7I A;  2PFZ A;  5KCJ A;  4JBZ A;  2QJE A;  3E78 A;  5H8H B;  1UTB A;  1OVB A;  4C1T A;  1NUY A;  3T96 B;  3VDF A;  3LSX A;  3CG1 A;  4F3B A;  5TPA B;  1NH7 A;  3CVG A;  3FV1 A;  5H8S A;  4G68 C;  3H3G A;  4FBP A;  4OFO A;  2OWS A;  4EDP A;  3G3I A;  4QFP A;  1MH4 A;  1R6Z A;  3CG3 A;  5JK4 A;  4POX A;  2Q9T A;  4R6Y A;  3OO7 A;  1B3L A;  3FVG A;  2CZL A;  3U92 A;  4NF5 B;  5I59 A;  1MQI A;  3VV5 A;  4LUB A;  4TQU Q;  2PT1 A;  4MEV A;  3TDJ A;  3KN3 A;  1Y3N A;  2REG A;  3H6U A;  1B2H A;  2QVR A;  1A8F A;  3HCQ A;  1MQD A;  3L6H A;  1JNF A;  3H6V A;  2I3W A;  3OO8 A;  4DCY A;  4I1D A;  3TUS A;  3RNN A;  1QW0 A;  1B46 A;  4M1V A;  2FVZ A;  5AA3 A;  1RYX A;  1DBZ A;  3VLW A;  4H45 A;  4PF6 A;  1DTZ A;  4PBH A;  3O9P A;  2Y7R A;  1YAE A;  5IZ3 A;  2A5T B;  2V4C A;  2D3I A;  5L9S A;  3IX1 A;  1B3G A;  4PC9 A;  3C35 A;  1IUD A;  2PMS A;  3KBZ A;  2GH9 A;  3H6W A;  4YKP A;  5I56 A;  1GR2 A;  3EHS A;  3RY3 A;  4GRK A;  1US5 A;  2QRY A;  3IFC A;  4OVP A;  5ET6 A;  2H5Y A;  1QUL A;  1B58 A;  1QUI A;  1N3W A;  1FPJ A;  2VPN A;  1HSE A;  1AL3 A;  4Z0I A;  3B6Q A;  4MMP A;  2NVU B;  2F6P A;  3VVD A;  1IQ7 A;  3G3K A;  4NF8 A;  1Z7N E;  4MBP A;  1ATG A;  1JW1 A;  4P0I A;  4ND9 A;  3IR1 A;  1L5T A;  4PGP A;  3MQ9 A;  3CRB A;  3GYY A;  3U72 A;  4OHN A;  1NNF A;  3LUY A;  3TOD A;  1PEB A;  3S9L C;  4WKM A;  4X9T A;  3OO9 A;  2HAV A;  1GVC A;  3FJ7 A;  4JDF A;  3S9E A;  1QGX A;  1VR5 A;  3E4R A;  4KD5 A;  5DEX A;  2FIX A;  4QFL A;  2F35 A;  2Y7W A;  3B50 A;  4HE0 A;  2DE3 A;  2W7Y A;  1B0L A;  4H5G A;  2F6G A;  3H4Z A;  1N84 A;  3K02 A;  1MXW A;  1IME A;  2G93 A;  1JVY A;  2R8T A;  5AA4 A;  2F5X A;  4GLI A;  1USY E;  1HSL A;  1MDP 1;  2XD2 A;  4PAI A;  4NQ8 A;  5BWJ A;  4PDH A;  3S9M C;  3H03 A;  1MY1 A;  1FQC A;  1B6H A;  1LB9 A;  4H46 A;  5A5X B;  2CMO A;  3U8Q A;  1EH3 A;  2QFL A;  2HEU A;  2F97 A;  4IO4 A;  1NV5 A;  3ISP A;  5DVF A;  1LAX A;  4DI3 D;  2THI A;  1IIW A;  2YJP A;  4EQ7 A;  2HXR A;  3MBP A;  2WX9 A;  1EZP A;  1N3X A;  4FIM A;  4ZEI A;  5H8N B;  4MAG A;  2KLF A;  1YZ0 A;  2HFB A;  4NTL A;  3EPE A;  1JEU A;  3Q27 A;  3TKD A;  1B9J A;  4NE4 A;  1IMA A;  1MS7 A;  2R71 A;  5CBR A;  3OSQ A;  3UIF A;  1LAF E;  1O64 A;  4WED A;  4RA1 A;  3KC0 A;  3SET A;  4PFW A;  4G68 B;  1VFE A;  3PPO A;  3WAF A;  4XEQ A;  4AB6 A;  1OMP A;  3PUZ E;  1NH8 A;  1P1U A;  4G4P A;  1YCJ A;  4ONY A;  3H6T A;  3OMB A;  2V3U A;  3GXA A;  1H44 A;  2P3V A;  1BIY A;  4MNC A;  1FJ6 A;  3RTW B;  1FJ9 A;  1I6A A;  4O7I A;  1SW2 A;  2CEY A;  4KXP A;  1FQE A;  3P7I A;  5FBP A;  2XXP A;  3MPL A;  2RF1 A;  2UVI A;  4NAP A;  3PV0 E;  3MVX A;  2UVJ A;  3KSX A;  4PQJ A;  4BDR A;  4X1B A;  2DYX A;  1IEJ A;  3DP8 A;  4NF4 A;  1SBP A;  2FBP A;  2F7A A;  4GF8 A;  1NV2 A;  5CMB A;  4F3S A;  4PE3 A;  5FTI A;  1LB8 A;  1SYI A;  5H8F B;  1Y9U A;  1DPE A;  3RYD A;  4DLD A;  5I2N A;  2Z8F A;  1O7T A;  4UA8 A;  2OCU A;  4GX4 A;  2DE2 A;  2IEE A;  3CR9 A;  3USD A;  1EYJ A;  1FW0 A;  1CNQ A;  3TFL A;  2OJT A;  3UN6 A;  3FBP A;  5CC2 A;  2XXV A;  4TLM B;  5H8Q B;  2XXK A;  4U21 A;  3T9X B;  4AS5 A;  1WVJ A;  1MXU A;  3U1O A;  1IZ1 A;  5EQ8 A;  3VVE A;  4RPO A;  2Q8J A;  4G8M A;  4TOZ A;  1LAG E;  2F7B A;  3R26 A;  5EHM A;  3K1P A;  4R75 A;  4Q30 B;  4OVS A;  3B6W A;  5EYF A;  5KCJ B;  1UTB B;  4KQP A;  4F2Q A;  1PC3 A;  5ESY A;  2HPG A;  2HZL A;  4LZ5 A;  2WYK A;  4HE2 A;  1NV6 A;  3TYH A;  2QSX A;  4OMB A;  5IZZ A;  4N15 A;  4BDM A;  1NL5 A;  1R1N A;  4OFL A;  1NV7 A;  4POW A;  4F3P A;  1S50 A;  2V3Q A;  4G8N A;  2V84 A;  3G3H A;  1FPL A;  2Q8M A;  1P1W A;  3K6V A;  2Q88 A;  3K4U A;  1N04 A;  4GXS B;  3TTL A;  3W9V A;  4U1Z A;  2F8D A;  4QF9 A;  3RPW A;  3U94 A;  2ONK E;  4N07 A;  5I59 B;  2FIE A;  2OWT A;  2H4I A;  2XXY A;  2LAO A;  1YPN A;  3OEN A;  2DXR A;  4OVT A;  4OWD A;  3Q28 A;  1B0H A;  1EU8 A;  3E9X A;  3LC8 A;  4FEB A;  4XKN A;  2I0C A;  2KR0 A;  2GRV A;  2V93 A;  1SPI A;  1IXI A;  3IB0 A;  3LSF B;  3V89 B;  4QFO A;  1LLS A;  1BK4 A;  3M3L A;  2WBB A;  1POT A;  1GV8 A;  4ESW A;  3OEL A;  1PB7 A;  3FIR A;  5IZ3 B;  3KJT A;  3MP1 A;  2RCB A;  2Y5K A;  3KG2 A;  2F78 A;  4GWU A;  2ZYN A;  2B4M A;  1II5 A;  2AIX A;  4ZEK A;  1D4N A;  1R9Q A;  4H1X A;  2DE4 A;  4KYD A;  5I56 B;  3RN8 A;  2DXY A;  5K2X A;  1Q35 A;  5AA2 D;  1FBG A;  3GBB A;  3D4G A;  3PMV A;  2ZMB A;  1B3H A;  1TFA A;  1TXF A;  1B52 A;  1MPC A;  3MZ9 A;  2H9B A;  1PDA A;  3G3G A;  3IJO B;  4FJP A;  4JWX A;  2NWJ A;  3HO7 A;  1MXV A;  5CMC A;  3BKI B;  4XKQ A;  3T1B A;  2GQ1 A;  5I5P A;  2QS1 A;  3IAZ A;  3FAT A;  4LQ5 A;  4NF8 B;  4U4S A;  1UQW A;  4X48 A;  1M5F A;  3HST A;  4MCO A;  3CIJ A;  3L6G A;  3K6W A;  3O28 A;  2CZK A;  3WAE A;  3IL1 B;  2HAU A;  4NMY A;  3KEI A;  3EKI A;  3OSR A;  1DPP A;  2XX9 A;  1AIV A;  2WYP A;  3B8B A;  1WDN A;  2YLN A; 
#chains in the Genus database with same CATH homology
 1IXC A;  3W15 C;  3PMW A;  2Y7P A;  1PBP A;  5DEX B;  5L9M A;  3K01 A;  3LSW A;  1B51 A;  4YKI A;  3KN7 A;  3MP8 A;  1JET A;  3ZKL A;  1QUJ A;  1NNT A;  3T9U A;  1DOT A;  3K1N A;  3TCG A;  2PBW A;  2VHA A;  4QSE A;  4ELR A;  3T66 A;  1FQB A;  3THI A;  5CMM A;  1SQY A;  2VP1 A;  1NMU A;  3V83 A;  3UK4 A;  4KFQ A;  4LP2 B;  2QPQ A;  1B3E A;  2O84 X;  5AA4 B;  1JVX A;  4ZED A;  3VLU A;  1B1H A;  2UVG A;  1URG A;  2ZNS A;  5FHO A;  1P1O A;  1FQD A;  2QS2 A;  3QSL A;  5KZT A;  4QHQ A;  3DLN A;  4TLL B;  3DP4 A;  4BDL A;  2ESN A;  3O6I A;  3TQW A;  1SI0 A;  3FJG A;  3QIM A;  3JV9 A;  1NNP A;  2Z8E A;  3O66 A;  1SW4 A;  1M5D A;  3ILT B;  2FA7 A;  4R9G A;  3D4C A;  3T22 A;  4E0W A;  2DWI A;  1Y3Q A;  4KCC A;  3O29 A;  4GL8 A;  3Q26 A;  3PPP A;  3W9W A;  4FEC A;  4KHZ E;  3KJ7 A;  3G3J A;  3FXU A;  2OLB A;  4FED A;  2RKM A;  3FZV A;  4KYS A;  2VD2 A;  4GFR A;  5DT6 A;  3SEV A;  3Q25 A;  1GTK A;  1B5I A;  1H76 A;  1OQH A;  4RXL A;  2AL5 A;  3HHG A;  1LCF A;  4P0G A;  5LOM A;  2RC7 A;  1CE2 A;  3QYT A;  2Z23 A;  1US4 A;  4GIZ A;  4EUO A;  5EHS A;  3K6U A;  1MDQ A;  3T93 B;  2XXW A;  2XX7 A;  4OEU A;  5K2Y A;  4BDO A;  1B4Z A;  2XXR A;  4F1Y A;  1OLA A;  3IB1 A;  2XXX A;  3UP9 A;  1EZ9 A;  3I6V A;  4R9F A;  1B4H A;  4GQO A;  2E0S A;  1M5C A;  3TZA A;  4ZS9 A;  4DXB A;  4XTC Q;  2I58 A;  1QKB A;  1J1N A;  1UIU A;  4NF4 B;  4PET A;  2VGQ A;  1MY0 A;  5TP9 A;  3Q29 A;  1D3K A;  2UYF A;  5I58 A;  5IKB A;  4RK2 A;  5HM4 B;  1S7Y A;  5ITO A;  3IOV A;  1AOV A;  3I3V A;  3HHF A;  3G7W A;  5I2N B;  3ILU B;  4DXU A;  3RT8 A;  4DDD A;  3C31 A;  1B7U A;  2IA4 A;  4YU0 A;  3JZJ A;  3T9H B;  5ITP A;  5FHN A;  4OVJ A;  3C4M A;  1QUK A;  3I5O A;  4DE8 A;  1B32 A;  4ESX A;  1I6B A;  1TFD A;  2VD3 A;  2XX8 A;  2P2A A;  2Q2A A;  1B05 A;  3FVO A;  3RQT A;  4R73 A;  3FAS A;  1MPB A;  1CB6 A;  2ZYM A;  3MPK A;  4I8C A;  4DXC A;  4XKR A;  2I49 A;  3E13 X;  4IGR A;  3F11 A;  5I57 A;  4XXU A;  1MY3 A;  1A55 A;  2ZNT A;  4M4G A;  4NWD A;  1Y1M A;  3MJN A;  1B5H A;  2YPN A;  2RC8 A;  3IOT A;  4RK9 A;  4LVQ A;  2B65 A;  1RYO A;  1URS A;  4FAJ A;  2H25 A;  3RGY A;  3RT6 B;  3E3K A;  3KSJ A;  3VVF A;  2DVC A;  2DQV A;  3SKP A;  4ZZE A;  2OZZ A;  1Y3P A;  4OYV A;  4THI A;  3N5L A;  3VLV A;  3PPR A;  2DVZ A;  4PE5 B;  5DYH A;  1IXH A;  2GHA A;  4OFJ A;  5M2V A;  2PX1 A;  4EQ9 A;  4H8I A;  4PFY A;  4KR5 A;  1XC1 A;  3O97 A;  4R74 A;  3MZ1 A;  4L17 A;  3PPQ A;  3VFJ A;  4YZZ A;  3O2A A;  1IXG A;  2I4B A;  2QS4 A;  4DCX A;  1NNK A;  2Q2C A;  3TEP A;  4GWO A;  1ZMG A;  4C0R A;  2VOZ A;  1QKA A;  3ZS6 A;  1MPD A;  4BDQ A;  2XXH A;  1ZJL A;  3HPI A;  4QRZ A;  4FE8 A;  2UVH A;  3GLB A;  3FV2 A;  1VFD A;  3B6T A;  1M5E A;  4YKK A;  3RUM A;  4ELO A;  1POY 1;  3R6U A;  3KZG A;  2WKY A;  4HCY A;  3KOT A;  1A54 A;  3UGW A;  1FTM A;  5CMK A;  5CBS A;  2ZYK A;  1UIV A;  1N7W A;  3C9H A;  4QSD A;  1XT8 A;  3SES A;  4NWC A;  4F18 A;  2Z22 A;  1FCK A;  4OEN A;  3ODB A;  3LBS A;  1B5J A;  5CI5 A;  3K2D A;  4X1D A;  4BDN A;  1LCT A;  5AA1 A;  1LBB A;  1UTH A;  3QUJ A;  4GL0 A;  2RC9 A;  3TAJ A;  5JTY A;  2BJJ X;  3EN3 A;  1PBQ A;  1BLF A;  3U93 A;  2G29 A;  1WOD A;  4OER A;  4H0W A;  3MZB A;  3FVN A;  3PUV E;  2D5W A;  2Y7K A;  1PB9 A;  3N6T A;  3VE1 B;  3BFU A;  4Q5T A;  3SDF A;  2DWA A;  2F7C A;  4R72 A;  3TCF A;  1ZTY A;  4IB2 A;  4H67 A;  4U1O A;  1MH3 A;  3IB2 A;  4JXI A;  4KPT A;  3MVW A;  3H06 B;  4G2Z A;  1FQF A;  3TPA A;  3IO4 A;  2XXU A;  1A40 A;  2F34 A;  4IGT A;  1MXZ A;  4MLV A;  2I48 A;  3PUW E;  4HTG A;  1MM6 A;  3ZKK A;  3ZSF A;  1FTO A;  5DVJ A;  1ELJ A;  4QFK A;  4LA9 A;  2AL4 A;  4YKJ A;  4MLQ A;  4LZ8 A;  4YB5 A;  4AB5 A;  4GOT A;  3T9V A;  4OQO A;  1B3F A;  3FD3 A;  4HCW A;  4YIC A;  4JWY A;  5AA2 B;  4R2F A;  4LQ2 A;  3IO6 A;  4ELP A;  1EZO A;  3MUQ A;  3M3F A;  4ZEB A;  3GBA A;  3FXR A;  3S9N C;  5KDT A;  1TT1 A;  1B7Z A;  3C34 A;  3PPN A;  2H98 A;  4F31 B;  4EXK A;  1MQH A;  4U23 A;  1ZIU A;  4YAH X;  4N6P A;  2O51 A;  3ECR A;  2XXT A;  5DVI A;  4H5F A;  4JWO A;  3CSB A;  2DS9 A;  4OES A;  1DTG A;  1URD A;  4LAT A;  2FYI A;  3SEU A;  5TP9 B;  2I6E A;  4K3F A;  5FTH A;  2AYS A;  4I9D A;  4GD5 A;  5I58 B;  3FXQ A;  5L9O A;  4KYE A;  4MH5 A;  2UYE A;  3TCH A;  4ZEC A;  4ZE8 A;  4O3A A;  3GZG A;  3KBR A;  3QAX A;  4ZE9 A;  3OO6 A;  4F22 A;  2DOJ A;  3A09 A;  1D9V A;  3FGS A;  3V5A A;  3SEX A;  3B7D A;  4PFT A;  2O68 A;  4F39 A;  3IOU A;  3MVY A;  4F29 A;  1A8E A;  1S9T A;  4Q8R A;  1NFT A;  4HW8 A;  1SW5 A;  1JW5 A;  3IOR A;  5TU0 A;  1LFI A;  5BUU A;  3MWB A;  1Y4C A;  3S4U A;  5I57 B;  2DWH A;  1I69 A;  3QK6 A;  1M5B A;  4R2B A;  1LAH E;  3ONM A;  3EHU A;  2ONS A;  3C36 A;  3FUZ A;  1SDX A;  4Z7E A;  4ISU A;  3S2V A;  3K00 A;  4PP0 A;  4RNS A;  1DSN A;  4LZ7 A;  1P1N A;  3DP6 A;  1H43 A;  1Z7M E;  2ONR A;  4JB7 A;  5AA2 A;  2HCA A;  3IK6 B;  4E0X A;  3RLF E;  2NUV A;  4I62 A;  4EF2 A;  1RKM A;  1Y1Z A;  1D9Y A;  4DIG A;  1XS5 A;  1B7H A;  3TEL A;  4U22 A;  3IOW A;  3TMG A;  2DP8 A;  1SD3 A;  2B3F A;  3AXF A;  2OBG A;  2PYY A;  1A99 A;  2X7Q A;  5I2K B;  4JSO A;  4GXA A;  5IAI A;  3HN0 A;  4O3C A;  4OTE A;  4OXV A;  2QMW A;  1QVS A;  1FTL A;  1N7X A;  1BTJ A;  4HS7 A;  3QUF A;  3KOS A;  3O6G A;  4U4X A;  3FVK A;  4WXJ A;  1IIT A;  1LFH A;  2DSF A;  1P1Q A;  3A3U A;  5B70 A;  5H8H A;  3HV1 A;  1VSO A;  3CFZ A;  4ZEF A;  4RY1 A;  1MY4 A;  4KCD A;  1SI1 A;  2ZYO A;  3EF7 A;  1XHY A;  3DEL B;  2O1M A;  2UXA A;  5TPA A;  5ICQ A;  2R9J A;  1XVY A;  2M8C A;  4ELQ A;  2FNC A;  5J1D A;  1OLC A;  3SEY A;  4NF5 A;  2XXQ A;  3PUY E;  2ALU A;  1DMB A;  1VE4 A;  2OK2 A;  4P11 A;  1PB8 A;  5AE4 A;  3A3C A;  1HSJ A;  1BP5 A;  5ICT A;  3N6U A;  4ZDM A;  3FJM A;  3BBR A;  3TTR A;  3TTN A;  3KN8 A;  2ZXT A;  4OET A;  1UTH B;  3C33 A;  3H7M A;  1OQG A;  3UOR A;  3OD7 A;  4KI0 E;  1FTJ A;  1ZBM A;  2XD3 A;  5JTY B;  4XIG Q;  3N94 A;  4UAC A;  1AMF A;  1MRP A;  3DM0 A;  2REJ A;  2A5T A;  1H45 A;  1MQG A;  3PD9 A;  3K6X A;  3OEM A;  4F1V A;  1MXX A;  4FOR A;  3VXB A;  4QSC A;  4GVO A;  3OEK A;  1KWH A;  2QL3 A;  4MF3 A;  3BFT A;  2O1L A;  3JYR A;  5HPQ A;  3MVZ A;  4F19 A;  3TTM A;  3VXC A;  2QMX A;  2Q89 A;  4PFU A;  1B1X A;  4N13 A;  2GFE A;  2D21 A;  3QXM A;  3N26 A;  5B7D A;  4F3G A;  5F1Q A;  3MAM A;  4RPN A;  1NKX A;  4Q0C A;  2Z8D A;  1Y20 A;  5I2K A;  3K1M A;  1JQF A;  2O6A A;  4R6K A;  1A7L A;  1R9L A;  2P1S A;  1BKA A;  1LST A;  5HBC A;  5JEI A;  2I3V A;  3EQ1 A;  2H99 A;  1O63 A;  4NED A;  1JEV A;  2RIN A;  1SW1 A;  4IY5 A;  3KFM A;  2PT2 A;  4IO7 A;  4IO2 A;  1H3D A;  4DZ1 A;  4U2R A;  2HZK A;  4F2O A;  5KDT B;  3PUX E;  1TWY A;  3PD8 A;  4YMB A;  2QS3 A;  4OEV A;  3UA8 A;  4JSD A;  1P99 A;  2O69 A;  3M8U A;  2ZNU A;  1ZLQ A;  4ZZA A;  3V8X B;  3OOA A;  5A5X A;  4YB7 A;  3G3F A;  4FAT A;  2HXW A;  4YB6 A;  3CFX A;  1ZU0 A;  4AQ4 A;  4R6H A;  2V3T A;  1USY H;  4NF6 B;  4O3B A;  3LR1 A;  3LSL A;  3PMX A;  5I84 A;  2RCA A;  5H8N A;  3OXN A;  3RTF B;  2GHB A;  3R7X A;  4IY6 A;  5FHM A;  1MY2 A;  1XVX A;  4WEP A;  3O6H A;  2Y7I A;  4IO3 A;  2ABH A;  1MM7 A;  2P0S A;  3CFL A;  1AH5 A;  4QFN A;  3TQL A;  2A5S A;  4H8J A;  2NOO A;  4ECF A;  4F1U A;  1ANF A;  1GGG A;  4G68 A;  1LGB C;  1I6Q A;  4RJZ A;  1B40 A;  3MP6 A;  4LON B;  1LFG A;  4EF1 A;  4C1U A;  1T0K A;  2XXI A;  1JW4 A;  1Q1K A;  3SER A;  1N76 A;  4G77 A;  4G8H A;  3K0V A;  1MG1 A;  1SVX B;  1FQA A;  1Y4T A;  4RYA A;  1MQJ A;  2ANJ A;  5ISU A;  3SEW A;  4OZ9 A;  5CRY A;  1FTK A;  5F7V A;  5L8D A;  4H65 A;  3CSG A;  3PU5 A;  5ELV A;  2B3B A;  2I0B A;  1QJM A;  3TTK A;  2V25 A;  3CI8 A;  4MFI A;  3C32 A;  1LBC A;  3EHT A;  2X7P A;  3MC2 A;  3MW0 A;  1OVT A;  2PVU A;  5CM6 A;  4BLA A;  4IO5 A;  2X26 A;  3M3K A;  2O7U A;  2I4C A;  4EQB A;  5H8F A;  4EXL A;  5DTB A;  3KGC A;  1F9B A;  1SYH A;  2NXO A;  2E1S A;  1OIB A;  1ZKB A;  1MXY A;  4YMA A;  2HQ0 A;  2F36 A;  2XHD A;  1YTV A;  4IO6 A;  2Y84 A;  1N0T A;  4H6D A;  2R6G E;  5H8Q A;  1XOC A;  3IJX B;  4NF6 A;  4XKP A;  3PGF A;  2DWJ A;  2O7I A;  5KCJ A;  4JBZ A;  2QJE A;  5H8H B;  1UTB A;  1OVB A;  4C1T A;  3T96 B;  3VDF A;  3LSX A;  3CG1 A;  4F3B A;  5TPA B;  1NH7 A;  3CVG A;  3FV1 A;  5H8S A;  4G68 C;  3H3G A;  4OFO A;  2OWS A;  4EDP A;  3G3I A;  4QFP A;  1MH4 A;  1R6Z A;  3CG3 A;  5JK4 A;  4POX A;  2Q9T A;  4R6Y A;  3OO7 A;  1B3L A;  3FVG A;  2CZL A;  3U92 A;  4NF5 B;  5I59 A;  1MQI A;  3VV5 A;  4LUB A;  4TQU Q;  2PT1 A;  3TDJ A;  3KN3 A;  1Y3N A;  2REG A;  3H6U A;  1B2H A;  1A8F A;  3HCQ A;  1MQD A;  3L6H A;  1JNF A;  3H6V A;  2I3W A;  3OO8 A;  4DCY A;  4I1D A;  3TUS A;  3RNN A;  1QW0 A;  1B46 A;  4M1V A;  5AA3 A;  1RYX A;  3VLW A;  1DTZ A;  3O9P A;  2Y7R A;  1YAE A;  2A5T B;  2D3I A;  5L9S A;  3IX1 A;  1B3G A;  3C35 A;  1IUD A;  2PMS A;  2GH9 A;  3H6W A;  4YKP A;  5I56 A;  1GR2 A;  3EHS A;  3RY3 A;  4GRK A;  1US5 A;  2QRY A;  2H5Y A;  1QUL A;  1B58 A;  1QUI A;  1N3W A;  1HSE A;  1AL3 A;  4Z0I A;  3B6Q A;  2NVU B;  2F6P A;  3VVD A;  1IQ7 A;  3G3K A;  4NF8 A;  1Z7N E;  4MBP A;  1ATG A;  1JW1 A;  4P0I A;  4ND9 A;  3IR1 A;  1L5T A;  3MQ9 A;  3CRB A;  3U72 A;  4OHN A;  1NNF A;  3LUY A;  3TOD A;  1PEB A;  3S9L C;  4WKM A;  4X9T A;  3OO9 A;  2HAV A;  1GVC A;  3FJ7 A;  4JDF A;  3S9E A;  1VR5 A;  3E4R A;  4KD5 A;  5DEX A;  4QFL A;  2F35 A;  2Y7W A;  2DE3 A;  2W7Y A;  1B0L A;  4H5G A;  2F6G A;  3H4Z A;  1N84 A;  3K02 A;  1MXW A;  2G93 A;  1JVY A;  5AA4 A;  2F5X A;  4GLI A;  1USY E;  1HSL A;  1MDP 1;  2XD2 A;  5BWJ A;  3S9M C;  3H03 A;  1MY1 A;  1FQC A;  1B6H A;  1LB9 A;  5A5X B;  2CMO A;  3U8Q A;  1EH3 A;  2HEU A;  2F97 A;  4IO4 A;  5DVF A;  1LAX A;  2THI A;  1IIW A;  2YJP A;  4EQ7 A;  3MBP A;  1EZP A;  1N3X A;  4FIM A;  4ZEI A;  5H8N B;  2KLF A;  2HFB A;  4NTL A;  3EPE A;  1JEU A;  3Q27 A;  3TKD A;  1B9J A;  4NE4 A;  1MS7 A;  2R71 A;  5CBR A;  3OSQ A;  3UIF A;  1LAF E;  1O64 A;  4WED A;  4RA1 A;  3SET A;  4PFW A;  4G68 B;  1VFE A;  3PPO A;  3WAF A;  4AB6 A;  1OMP A;  3PUZ E;  1NH8 A;  1P1U A;  4G4P A;  1YCJ A;  4ONY A;  3H6T A;  3OMB A;  2V3U A;  3GXA A;  1H44 A;  1BIY A;  3RTW B;  1I6A A;  1SW2 A;  1FQE A;  3P7I A;  2XXP A;  3MPL A;  2RF1 A;  2UVI A;  3PV0 E;  3MVX A;  2UVJ A;  3KSX A;  4PQJ A;  4BDR A;  4X1B A;  2DYX A;  1IEJ A;  3DP8 A;  4NF4 A;  1SBP A;  2F7A A;  4GF8 A;  5CMB A;  4F3S A;  5FTI A;  1LB8 A;  1SYI A;  5H8F B;  1Y9U A;  1DPE A;  5I2N A;  4DLD A;  2Z8F A;  1O7T A;  4UA8 A;  2OCU A;  2DE2 A;  2IEE A;  3CR9 A;  3USD A;  1FW0 A;  3TFL A;  2OJT A;  3UN6 A;  5CC2 A;  2XXV A;  4TLM B;  5H8Q B;  4U21 A;  3T9X B;  1WVJ A;  1MXU A;  3U1O A;  1IZ1 A;  3VVE A;  4RPO A;  2Q8J A;  4G8M A;  4TOZ A;  1LAG E;  2F7B A;  3R26 A;  5EHM A;  3K1P A;  4R75 A;  4Q30 B;  3B6W A;  5EYF A;  5KCJ B;  1UTB B;  4KQP A;  4F2Q A;  1PC3 A;  2HZL A;  4LZ5 A;  3TYH A;  2QSX A;  4OMB A;  4BDM A;  1NL5 A;  1R1N A;  4OFL A;  4POW A;  4F3P A;  1S50 A;  2V3Q A;  4G8N A;  2V84 A;  3G3H A;  1P1W A;  3K6V A;  2Q88 A;  3K4U A;  1N04 A;  4GXS B;  3TTL A;  3W9V A;  4U1Z A;  2F8D A;  4QF9 A;  3RPW A;  3U94 A;  2ONK E;  4N07 A;  5I59 B;  2OWT A;  2H4I A;  2XXY A;  2LAO A;  1YPN A;  3OEN A;  2DXR A;  4OWD A;  3Q28 A;  1B0H A;  1EU8 A;  3E9X A;  3LC8 A;  4FEB A;  4XKN A;  2I0C A;  2GRV A;  2V93 A;  1IXI A;  3IB0 A;  3LSF B;  3V89 B;  4QFO A;  1LLS A;  3M3L A;  1POT A;  1GV8 A;  4ESW A;  3OEL A;  1PB7 A;  3FIR A;  3KJT A;  3MP1 A;  2RCB A;  3KG2 A;  2F78 A;  2ZYN A;  1II5 A;  2AIX A;  4ZEK A;  1D4N A;  1R9Q A;  4H1X A;  2DE4 A;  4KYD A;  5I56 B;  3RN8 A;  2DXY A;  5K2X A;  1Q35 A;  5AA2 D;  3GBB A;  3D4G A;  3PMV A;  2ZMB A;  1B3H A;  1TFA A;  1TXF A;  1B52 A;  1MPC A;  3MZ9 A;  2H9B A;  1PDA A;  3G3G A;  3IJO B;  4FJP A;  4JWX A;  2NWJ A;  3HO7 A;  1MXV A;  5CMC A;  3BKI B;  4XKQ A;  2QS1 A;  3IAZ A;  3FAT A;  4LQ5 A;  4NF8 B;  4U4S A;  1UQW A;  4X48 A;  1M5F A;  3HST A;  3CIJ A;  3L6G A;  3K6W A;  3O28 A;  3WAE A;  3IL1 B;  2HAU A;  4NMY A;  3KEI A;  3OSR A;  1DPP A;  2XX9 A;  1AIV A;  1WDN A;  2YLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...