1TFDA

High-resolution x-ray studies on rabbit serum transferrin: preliminary structure analysis of the n-terminal half-molecule at 2.3 angstroms resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
299
structure length
294
Chain Sequence
b'VRWCAVNDHEASKCANFRDSMKKVLPEDGPRIICVKKASYLDCIKAIAAHEADAVTLDAGLVHEAGLTPNNLKPVVAEFYGSKENPKTFYYAVALVKKGSNFQLNELQGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVASFFSGSCVPCADQLCQLCPGCGCSSSQPYFGYSGAFKCLKDGLGDVAFVKQETIFENLPSKDERDQYELLCLDNTRKPVDEYEQCHLARVPSHAVVARSVDGKEDLIWELLNQAQEHFGKDKSGDFQLFSSPHGKNLLFKDSAYGFFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFERRIN
publication title High-Resolution X-Ray Studies on Rabbit Serum Transferrin: Preliminary Structure Analysis of the N-Terminal Half-Molecule at 2.3 Angstroms Resolution
pubmed rcsb
source organism Oryctolagus cuniculus
molecule tags Iron transport protein
total genus 67
structure length 294
sequence length 299
ec nomenclature
pdb deposition date 1990-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1tfdA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1tfdA02
4MF3A 2XD3A 4LATA 4I62A 1B58A 3OENA 4NMYA 3IOUA 2DWAA 2XXWA 1PB7A 1A7LA 3PPOA 4RNSA 5F7VA 2RC7A 2GH9A 4F1VA 4F18A 3D4GA 5HBCA 2PMSA 2I6EA 1B3HA 1R9QA 4FATA 4OXVA 4N07A 1Y3QA 4Q5TA 1YAEA 4F3BA 2Y7KA 2YPNA 3K4UA 1IQ7A 4ZEKA 3TODA 3HN0A 4RPOA 2OWSA 3UN6A 3IOWA 1SYHA 3OEMA 1URGA 1B51A 3CSGA 2ZNTA 3KFMA 4YKPA 3OO7A 4O3CA 3VLVA 1PBQA 3MAMA 1ZTYA 2QJEA 3KJ7A 2DE2A 4YAHX 4UA8A 3FGSA 1ZLQA 3GZGA 5I58B 2V84A 4RPNA 4IGTA 4NWDA 2NWJA 4GOTA 4F31B 4BDLA 5DEXA 1URDA 3Q28A 4ZS9A 4OENA 3PMVA 4KD5A 4ZEDA 1H76A 3MPKA 3RT6B 2O7UA 2A5TB 3U93A 3O6HA 3FJGA 1LAFE 3KN8A 2QRYA 3PD9A 1WODA 2ONRA 5A5XA 3VFJA 2UYEA 3H6TA 3HV1A 5BWJA 2Y84A 3C34A 2M8CA 2D3IA 3UIFA 1JEUA 3S9NC 1N84A 4YKKA 1MQJA 3V8XB 1XOCA 1PB9A 4TOZA 3TKDA 1M5DA 2PT2A 1H43A 1Y4CA 3TTNA 2I0BA 5ICQA 2XD2A 1B46A 5K2YA 5H8FA 1B3LA 4M1VA 2HCAA 3GXAA 3N6TA 2F7BA 2X7QA 1MPBA 1B3GA 4U21A 5DVIA 4K3FA 3O66A 5KCJB 5I59B 3IJOB 3ZKKA 3WAEA 4F3PA 1XVXA 3VLUA 4TQUQ 3PUZE 4L17A 2B3FA 4IGRA 4LVQA 5CBRA 3EF7A 3N6UA 3M3FA 4FEBA 2OK2A 4I8CA 5JTYB 3VDFA 2PT1A 3G3IA 2ZYNA 4GFRA 3FVGA 5TU0A 3KBRA 3KSXA 2DWIA 3OMBA 3R6UA 1PB8A 4C1TA 3TQWA 4EF2A 3EQ1A 2DXYA 4QFLA 5H8QB 4OFLA 5I2NA 2DP8A 3K6UA 2HFBA 4FE8A 4JDFA 4KYEA 3JYRA 1FQFA 3TDJA 1AIVA 5I56A 1Z7ME 1B6HA 4KI0E 1H45A 1MY0A 1JQFA 4LZ5A 3ODBA 1I69A 3O6IA 3RY3A 1B7UA 2VGQA 1OQGA 4OETA 3DLNA 1HSLA 3RQTA 2B65A 1I6AA 3MP8A 3K6VA 2HZLA 4Q8RA 1IITA 4DLDA 3IORA 2ALUA 4DCXA 1MG1A 1USYH 3AXFA 3FJMA 4IO6A 3C9HA 3PD8A 2I49A 4YICA 3C33A 5DEXB 3HO7A 1MXXA 2QMXA 4P11A 2F8DA 3UK4A 2H98A 3TTLA 1MDP1 4HTGA 3DP4A 3PPQA 3OO6A 4HS7A 3MZBA 4C1UA 2NUVA 4NF6A 1ATGA 5A5XB 1B1HA 3THIA 1PEBA 3SETA 2F6PA 2Z8EA 1LAGE 4QSEA 1MM7A 3U94A 1N7XA 1S7YA 1SQYA 3MVYA 4EF1A 4BLAA 2DOJA 4U1OA 1FTLA 3MUQA 4IY6A 3K0VA 4NF4A 3O29A 5FHNA 3L6GA 3FVNA 3V5AA 3FD3A 1I6QA 3CVGA 3H7MA 5CC2A 1MH3A 2REJA 4FECA 2RC9A 3MPLA 2THIA 4H67A 3VVEA 3S2VA 4RY1A 1NH7A 1POY1 4ZE9A 1BLFA 1LFGA 3LSXA 4F3SA 2VD2A 2X7PA 5TP9B 3B6WA 3G3FA 3OD7A 1GR2A 4GVOA 3PMWA 3E13X 1AMFA 3CG1A 3EN3A 3BFUA 5I58A 4H65A 4H6DA 4MLQA 4GXSB 5CMMA 2R71A 2XX8A 1B40A 2Y7IA 2PX1A 2A5TA 5KDTA 5EYFA 2H5YA 5DTBA 4F1UA 4BDOA 5I2NB 4NTLA 3CR9A 3I3VA 3TELA 3TUSA 3BKIB 4H8JA 4BDNA 3OELA 3KSJA 1QKAA 3SESA 5L9OA 2UVGA 2OZZA 5I56B 1CE2A 4LQ2A 5ICTA 4QSCA 4DIGA 3RUMA 3QXMA 4N6PA 1QUJA 3M3KA 5AA1A 2UVHA 3QSLA 3MZ1A 3HHGA 1O63A 1TT1A 4KYDA 2A5SA 1D9YA 3K1PA 3H6WA 2B3BA 1RKMA 1OLCA 2HEUA 3CIJA 5JK4A 4IO7A 2QMWA 2XX7A 1N04A 2VHAA 3IAZA 3UORA 3IJXB 5KCJA 2ZYOA 4G8MA 1NNFA 4GF8A 4BDRA 4XTCQ 4GLIA 1MY4A 4LP2B 1GVCA 1VFDA 1MY1A 4ESXA 4R75A 3OOAA 3CI8A 3GBBA 3TTRA 4NF6B 1LBCA 1MM6A 5JTYA 1LGBC 3LR1A 4O3BA 1P1QA 4XKNA 2OJTA 3QUFA 3A09A 1P1UA 4OERA 4ELPA 2VP1A 1NKXA 2HAVA 1FQAA 3OSQA 2REGA 1Q35A 1JW5A 4OEUA 3T22A 3TYHA 4NF4B 1WVJA 4O3AA 3TCGA 1ZBMA 2Q88A 3IO6A 2KLFA 3K1MA 4NF8A 1LLSA 5H8QA 4NEDA 3T66A 1J1NA 3RT8A 5CMCA 2XXIA 4AB5A 4OZ9A 2Z23A 3WAFA 1LBBA 2ZXTA 3DP6A 3QAXA 1VSOA 1DOTA 3GLBA 2E1SA 3E9XA 3A3UA 1MQDA 3MWBA 4JSOA 1IXIA 2RF1A 2VD3A 2YJPA 4X1BA 1JVXA 4LQ5A 4IO4A 2QS3A 3RGYA 1BKAA 2XXYA 2V93A 1AH5A 3R7XA 2ZYMA 4ZEBA 1UQWA 3O28A 4YMAA 1FQDA 4PFTA 3K01A 3FUZA 5DT6A 5KDTB 4U2RA 2R6GE 5EHSA 3TCHA 1P1OA 1B4ZA 1LB8A 1MY2A 1MQIA 4WXJA 4IO5A 1B05A 1OQHA 5H8NA 4F2OA 2GRVA 4ND9A 3CFXA 4TLMB 2UVJA 3EHUA 3B7DA 3ZKLA 3GBAA 4P0GA 4RYAA 1IUDA 3C32A 4F3GA 5BUUA 4G68C 1GV8A 1N3XA 3CSBA 5CI5A 1FTKA 2XXUA 3KG2A 4F39A 4WKMA 1FQEA 5HM4B 3S9EA 5JEIA 1DMBA 5CMKA 2ESNA 2NXOA 4XIGQ 1SW1A 3P7IA 4XKPA 2V25A 2V3QA 1ZIUA 2I3WA 4QFOA 2CZLA 3S4UA 1MXZA 4GD5A 1Y20A 1LFHA 4EUOA 1IXCA 1US4A 1B2HA 2DVCA 5B70A 2AIXA 2Z8FA 1CB6A 3T96B 3DP8A 5LOMA 4OWDA 3PUWE 2RINA 4ZE8A 2Z8DA 3MVZA 3PUXE 3SDFA 5TP9A 1EU8A 3HHFA 2FNCA 5HPQA 2QS4A 4ZZAA 3FXUA 4RK2A 3PUYE 4R6YA 1SW4A 2ZYKA 3O2AA 1Y9UA 1USYE 1FCKA 4OHNA 1FQCA 2Q9TA 1QW0A 3H03A 2XXXA 3DM0A 1IIWA 4KFQA 4YB6A 4NF8B 1XHYA 3LSFB 1Y3PA 3SERA 3FXQA 3H3GA 4R73A 3K2DA 1QVSA 4OYVA 4HCWA 2DS9A 1OVBA 3TZAA 3MW0A 1OMPA 1IZ1A 1MDQA 4YMBA 1ANFA 3FASA 1AL3A 1MQGA 3L6HA 4LUBA 1Y3NA 1NNTA 3W15C 4ZECA 3LSWA 1MPDA 2IEEA 3JV9A 4OFOA 4EDPA 4RA1A 5FHOA 3BFTA 2Q2CA 3T9HB 1NNKA 2F6GA 1M5CA 2D21A 2XXRA 3HCQA 2ONSA 1LAXA 1RYXA 3V89B 3JZJA 1MQHA 5ISUA 3EHSA 3QIMA 1UTHA 3O9PA 4OTEA 4JSDA 1LFIA 1BIYA 3KGCA 1DSNA 3H4ZA 1IXGA 2P1SA 1B4HA 2NVUB 2G29A 5H8NB 4X48A 3TTMA 4ELRA 4OQOA 4KCDA 4FIMA 3H06B 2PYYA 2ZMBA 1SDXA 3OO8A 1JVYA 3PMXA 2BJJX 1NFTA 4F19A 2H9BA 4LZ7A 5EHMA 3A3CA 1UTBB 3C36A 3CG3A 2F5XA 4H0WA 4E0WA 1DPEA 4QFPA 5AA2A 3B6TA 5AA4B 1SBPA 1OIBA 4G77A 2HXWA 5I2KA 1XC1A 4PE5B 1SVXB 2O51A 2QSXA 4XKQA 4BDMA 3UA8A 4C0RA 3K6WA 3T93B 3TAJA 2OCUA 1P1WA 3N26A 1S9TA 4YKIA 3N5LA 4MBPA 2QS1A 4WEDA 2RKMA 2ABHA 3RNNA 3MQ9A 3MP6A 3MVXA 2DE4A 1LB9A 3O6GA 5H8HA 1MPCA 2F7AA 4R9FA 3K00A 2F97A 4DXUA 3G3GA 1VFEA 4PFWA 2DYXA 3MP1A 4R74A 4G68B 5ITPA 4PFUA 4QFKA 1TFAA 3FV2A 3BBRA 2PBWA 3UGWA 3VV5A 1PDAA 3TQLA 2AYSA 4GIZA 2UVIA 3VXBA 3OO9A 2ZNSA 4IB2A 3VXCA 1LCFA 4R6KA 5CM6A 2ZNUA 2GHBA 5I57A 1EZ9A 1QUIA 2H99A 1N7WA 4I1DA 3K1NA 4U23A 1H3DA 1JW4A 3O97A 1UIVA 3KJTA 5K2XA 4R9GA 4ELQA 3FVOA 5TPAA 3G3KA 4GXAA 4I9DA 4EQ7A 1JW1A 2I4CA 2O1LA 2O69A 3SEUA 1XS5A 2V3TA 2ANJA 5CMBA 1SW5A 1TFDA 3MBPA 3G7WA 2RCAA 3KOTA 4H5GA 1EZPA 4UACA 3I6VA 2Y7WA 1TWYA 3S9LC 4OEVA 4R6HA 1UTHB 3F11A 2XXTA 5IKBA 2G93A 1SI0A 3KOSA 1QULA 4H5FA 4EXKA 2HZKA 1POTA 1WDNA 3IOTA 4Q30B 3MC2A 4IO2A 4ZZEA 1SI1A 2CMOA 3C35A 1Y4TA 3KN3A 4JBZA 1KWHA 1IXHA 1OVTA 4NE4A 2Y7RA 2OLBA 2IA4A 3IB1A 4JB7A 2I4BA 2XXVA 4ZDMA 3M3LA 1R6ZA 1B52A 3VE1B 1SD3A 4FJPA 4MFIA 5AA2B 4DE8A 1XT8A 2QL3A 1A99A 4Z0IA 3MZ9A 4M4GA 5I2KB 4DDDA 3G3HA 2FA7A 1GTKA 3RTWB 3LC8A 5FHMA 4KPTA 4F29A 3LSLA 2PVUA 4HCYA 5J1DA 1SYIA 2R9JA 2RC8A 2GHAA 1BTJA 2F7CA 1MS7A 1FTMA 1QUKA 5H8HB 1B0HA 1MXUA 1LSTA 3ONMA 1YPNA 3IB2A 3EPEA 1JETA 1B7ZA 3M8UA 1DTGA 1QKBA 1A8EA 4MLVA 3T9UA 1VR5A 1D3KA 2HAUA 3S9MC 4RJZA 1FTOA 3SEWA 1H44A 2F78A 5F1QA 4ESWA 4YB5A 3C31A 4EQ9A 3PV0E 3ILTB 1A54A 3ZS6A 1YTVA 4LZ8A 5I57B 1MRPA 1F9BA 2Q89A 3VVDA 1B5JA 2QS2A 1AOVA 4JWOA 4F1YA 3FZVA 2I58A 3VVFA 4OFJA 4GQOA 2O6AA 1OLAA 3LUYA 5TPAB 4GL0A 3FIRA 3SEVA 2XXPA 5CRYA 1ZJLA 1EZOA 3IO4A 3FXRA 4G2ZA 1A55A 3FV1A 1Y1MA 1US5A 4DZ1A 4U4SA 4OMBA 4ZEFA 1UTBA 1PC3A 2F36A 4NF5A 3MJNA 2DQVA 4R72A 3KN7A 2AL5A 5I84A 1II5A 1S50A 4FORA 2I3VA 5AA4A 1O7TA 3HPIA 5M2VA 3CRBA 4YU0A 3IR1A 4JWXA 4QHQA 3E4RA 4ZEIA 4AB6A 4FAJA 1P1NA 4DCYA 4KHZE 4EXLA 2DVZA 1HSEA 2I0CA 1D4NA 3T9XB 3PPPA 4YZZA 4YB7A 2Y7PA 3UP9A 3ECRA 4QSDA 4Z7EA 4KQPA 5IAIA 4F22A 3TPAA 1B5IA 1FQBA 1FW0A 4LONB 4P0IA 4G68A 5AA2D 3W9VA 2WKYA 1MXYA 1XVYA 3ILUB 1YCJA 3PGFA 1Y1ZA 4R2FA 4XKRA 4MH5A 2AL4A 1M5EA 3USDA 3DELB 3Q26A 5L9MA 2O68A 1BP5A 1L5TA 1MH4A 1B3EA 4PETA 1O64A 4ONYA 4PQJA 5AE4A 2W7YA 4OESA 2F34A 2NOOA 2OBGA 3R26A 1MY3A 4IO3A 2XHDA 3U92A 1ELJA 4F2QA 4KR5A 4DXBA 1LCTA 3Q25A 2Q8JA 3RN8A 2P2AA 1PBPA 1GGGA 3LBSA 4GRKA 4QFNA 1JNFA 1M5FA 3PPNA 2E0SA 1HSJA 4NWCA 4X1DA 1R9LA 2UYFA 3C4MA 2X26A 3IB0A 4JXIA 2O84X 2FYIA 3U8QA 4G8NA 3H6VA 4U4XA 2RCBA 4G4PA 3RLFE 2LAOA 1Q1KA 3CFZA 5ELVA 4GL8A 3TMGA 4AQ4A 2HQ0A 1B0LA 1RYOA 1VE4A 1B3FA 5FTIA 4LA9A 1SW2A 1NNPA 3E3KA 2I48A 5FTHA 2YLNA 1R1NA 4GWOA 1UIUA 1NMUA 3MVWA 1N76A 4ELOA 3ZSFA 1D9VA 3IX1A 4RK9A 3K6XA 2O7IA 4POWA 4KCCA 3H6UA 4NF5B 4U1ZA 1MXWA 2P0SA 3IOVA 1ZMGA 1B1XA 4ISUA 3V83A 2DWHA 3I5OA 4XXUA 5H8FB 5DYHA 1JEVA 2DXRA 2XXHA 3OSRA 2GFEA 3Q29A 3EHTA 1M5BA 2VOZA 4EQBA 4POXA 3U1OA 1LAHE 4U22A 1A40A 3QK6A 1FTJA 3CFLA 1NH8A 5DVFA 3SEYA 1A8FA 1MXVA 1N3WA 3KZGA 2ONKE 4ECFA 3KEIA 1NL5A 4TLLB 3B6QA 1B32A 3TTKA 3RTFB 1Z7NE 5ITOA 3D4CA 1B5HA 4DXCA 1DTZA 1DPPA 4Q0CA 4QF9A 5L9SA 1I6BA 2H25A 3Q27A 3HSTA 2DWJA 3TEPA 2DSFA 2XX9A 3FVKA 3N94A 1URSA 1N0TA 5KZTA 4PP0A 1B7HA 2F35A 4FEDA 5B7DA 3FJ7A 5AA3A 4JWYA 1B9JA 2OWTA 3RPWA 2O1MA 3T9VA 3OXNA 4KYSA 4HW8A 4IY5A 4PFYA 4YKJA 2Q2AA 2Z22A 4N13A 3PUVE 3G3JA 2XXQA 5L8DA 1EH3A 2DE3A 3PU5A 3IK6B 4QRZA 3W9WA 3QUJA 3IL1B 4E0XA 5DVJA 3OEKA 4H1XA 3TCFA 2D5WA 3FATA 3SEXA 4WEPA 3PPRA 2QPQA 1IEJA 2H4IA 1TXFA 2UXAA 4THIA 1QJMA 5CBSA 3TFLA 5I59A 4H8IA 4RXLA 4X9TA 4BDQA 4R2BA 3QYTA 2V3UA 1ZU0A 4OVJA 4G8HA 1P99A 1ZKBA 3SKPA 3K02A 3U72A 1T0KA 3VLWA 5H8SA
chains in the Genus database with same CATH superfamily
2VPNA 4MF3A 3GYYA 2XD3A 2MKZA 4MJOA 4LATA 4I62A 1B58A 3OENA 4NMYA 3IOUA 2DWAA 4MIJA 5EQAA 2XXWA 1PB7A 1A7LA 4GWUA 3PPOA 4RNSA 5F7VA 2RC7A 2R8TA 2GH9A 4F1VA 4P1EA 4F18A 3D4GA 3T0JA 5HBCA 2PMSA 2F3DA 2I6EA 4GWSA 1B3HA 1R9QA 1EYJA 4FATA 4OXVA 4N07A 1Y3QA 4Q5TA 1YAEA 4F3BA 5IGAA 2Y7KA 2YPNA 3K4UA 1IQ7A 4ZEKA 3TODA 3HN0A 4RPOA 2OWSA 3UN6A 3IOWA 1SYHA 3OEMA 1URGA 1B51A 3CSGA 3PTYA 2ZNTA 3KFMA 4YKPA 3OO7A 4O3CA 3VLVA 5IM2A 1PBQA 3MAMA 1ZTYA 2QJEA 3KJ7A 2DE2A 4YAHX 2Q8MA 4UA8A 3FGSA 1ZLQA 3GZGA 5I58B 2V84A 4NX1A 4O94A 4RPNA 4IGTA 4NWDA 2NWJA 4GOTA 4F31B 4BDLA 5DEXA 1URDA 3Q28A 4ZS9A 4OENA 3PMVA 4KD5A 4ZEDA 1H76A 3MPKA 3RT6B 2O7UA 2A5TB 3U93A 3O6HA 3FJGA 1LAFE 3KN8A 2QRYA 4GX3A 3PD9A 4MEVA 1WODA 2ONRA 5A5XA 3VFJA 2UYEA 4HE1A 3H6TA 4P3LA 3HV1A 5BWJA 2Y84A 3C34A 2M8CA 2D3IA 3UIFA 1JEUA 3S9NC 1N84A 4YKKA 1MQJA 3ROJA 3V8XB 1XOCA 1PB9A 4TOZA 3TKDA 2FHYA 1M5DA 2PT2A 1YZ0A 1H43A 1Y4CA 2V4CA 2I0BA 3TTNA 5ICQA 2XD2A 1B46A 5K2YA 5H8FA 4PTKA 1B3LA 4M1VA 4NQ8A 2HCAA 3GXAA 2DDKA 3N6TA 5T3JA 1CNQA 2F7BA 1MPBA 2X7QA 1B3GA 4U21A 5DVIA 4K3FA 4N91A 3O66A 5KCJB 5I59B 4PDDA 3IJOB 3ZKKA 3B8BA 3WAEA 4F3PA 1LBWA 1XVXA 3VLUA 3IFAA 4TQUQ 3PUZE 4L17A 2B3FA 4IGRA 4LVQA 5CBRA 3EF7A 3N6UA 3M3FA 4FEBA 2OK2A 4I8CA 5JTYB 3VDFA 2PT1A 3G3IA 2ZYNA 4JVDA 5I7IA 4GFRA 3FVGA 5TU0A 3KBRA 3KSXA 2DWIA 3OMBA 3R6UA 1PB8A 4C1TA 3TQWA 4EF2A 3EQ1A 2DXYA 4QFLA 5H8QB 4OFLA 2QVUA 5I2NA 2DP8A 4N81A 3K6UA 1FPFA 5EQ8A 2HFBA 4FE8A 4JDFA 4KYEA 3JYRA 1FQFA 3TDJA 1AIVA 5I56A 1Z7ME 1B6HA 1IMBA 4KI0E 1H45A 1MY0A 1JQFA 4LZ5A 2BJIA 3ODBA 1I69A 2Y5LA 3O6IA 3RY3A 1B7UA 2VGQA 1OQGA 4OETA 3DLNA 1HSLA 3RQTA 3MP8A 2B65A 1I6AA 3LV0A 3K6VA 2HZLA 4Q8RA 1IITA 4DLDA 2CEXA 3IORA 2ALUA 4DCXA 1MG1A 1USYH 3AXFA 3FJMA 4IO6A 3C9HA 3PD8A 2I49A 4YICA 3C33A 5DEXB 3IFCA 3HO7A 2OX3A 1MXXA 2QMXA 4P11A 3MYUA 2F8DA 3UK4A 2H98A 4GBVA 3TTLA 1MDP1 4HTGA 3DP4A 3PPQA 3OO6A 4HS7A 3MZBA 4C1UA 2NUVA 4NF6A 1ATGA 2HXRA 1FBEA 5A5XB 1B1HA 3THIA 1PEBA 3SETA 4P8BA 2F6PA 4NF0A 2Z8EA 1LAGE 4QSEA 1MM7A 2ZZWA 3U94A 1N7XA 1S7YA 1SQYA 4KXPA 3MVYA 4EF1A 2ZZVA 4BLAA 2DOJA 1KA0A 4U1OA 1FTLA 3MUQA 4IY6A 3K0VA 4NF4A 4OVTA 3O29A 5FHNA 3L6GA 3FVNA 1RDZA 3E79A 3V5AA 3FD3A 1I6QA 3CVGA 3H7MA 1FPJA 2P3VA 5CC2A 1MH3A 2REJA 4FECA 2RC9A 3MPLA 2THIA 4H67A 3VVEA 3S2VA 4RY1A 2P3NA 1NH7A 4I3YA 1POY1 4ZE9A 1BLFA 1LFGA 3LSXA 4F3SA 2VD2A 2X7PA 5TP9B 3B6WA 3G3FA 3OD7A 1GR2A 4GVOA 3PMWA 3E13X 1AMFA 4HE0A 3CG1A 3EN3A 3BFUA 5I58A 4H65A 4H6DA 4MLQA 4GXSB 5CMMA 2R71A 2CEYA 2XX8A 1B40A 4H46A 2Y7IA 2PX1A 2A5TA 5KDTA 5EYFA 5I5PA 2H5YA 5DTBA 2XWIA 4BDOA 4F1UA 5I2NB 4NTLA 1FPIA 3CR9A 3I3VA 3TELA 3TUSA 3BKIB 4H8JA 4BDNA 3OELA 3KSJA 1QKAA 3SESA 4PFIA 5L9OA 4IR8A 2UVGA 5IZ1A 2OZZA 4GX6A 1FPDA 5I56B 1CE2A 4LQ2A 1NI9A 5ICTA 4QSCA 4DIGA 5FBPA 3RUMA 3QXMA 4N6PA 1QUJA 3M3KA 5AA1A 2UVHA 3QSLA 3MZ1A 3HHGA 1O63A 1TT1A 4KYDA 2A5SA 1FBDA 1D9YA 3K1PA 3H6WA 2B3BA 1RKMA 1OLCA 2HEUA 3CIJA 5JK4A 4IO7A 4AS5A 2WBBA 3D1RA 2QMWA 2XX7A 1N04A 2VHAA 3IAZA 4PAFA 1NV5A 3UORA 3IJXB 5KCJA 2ZYOA 4G8MA 1NNFA 4GF8A 4BDRA 4XTCQ 4GLIA 1MY4A 4LP2B 1GVCA 1VFDA 1MY1A 2QFLA 4ESXA 4R75A 3OOAA 5I3SA 2JJKA 3CI8A 1IMFA 3GBBA 3TTRA 4NF6B 1LBCA 1MM6A 5JTYA 1LGBC 3LR1A 4O3BA 1P1QA 4O8MA 4XKNA 2OJTA 3QUFA 3A09A 1P1UA 4OERA 4ELPA 2VP1A 1NKXA 2HAVA 1FQAA 3OSQA 2REGA 4NG7A 2B4MA 1Q35A 1JW5A 4OEUA 3T22A 4I40A 3TYHA 4NF4B 1WVJA 3HFUA 4O3AA 3TCGA 1ZBMA 2Q88A 3IO6A 2KLFA 3K1MA 4NF8A 1LLSA 5H8QA 4NEDA 3T66A 1J1NA 4OVSA 2HHMA 3RT8A 5CMCA 2OWZA 2XXIA 4AB5A 4OZ9A 2Z23A 3WAFA 1LBBA 2ZXTA 3DP6A 4OVQA 3QAXA 1AWBA 4P9KA 1VSOA 2QVVA 1DOTA 3GLBA 2E1SA 4MNIA 3E9XA 3A3UA 1MQDA 3MWBA 4JSOA 1IXIA 2RF1A 1YXIA 3T1BA 2VD3A 2YJPA 4X1BA 5EYHA 1JVXA 4LQ5A 4IO4A 2QS3A 3RGYA 1BKAA 4NAPA 2XXYA 2V93A 1AH5A 3R7XA 2ZYMA 4ZEBA 1UQWA 3O28A 4YMAA 1FQDA 4PFTA 1NUZA 3K01A 3FUZA 5DT6A 5KDTB 4U2RA 2R6GE 5EHSA 3TCHA 1P1OA 1B4ZA 1LB8A 1MY2A 1MQIA 4X8RA 4WXJA 3NOHA 4IO5A 2L5VA 1B05A 1OQHA 5H8NA 4F2OA 3E78A 2GRVA 4ND9A 3CFXA 4TLMB 2UVJA 3EHUA 3B7DA 3ZKLA 3GBAA 4P0GA 4RYAA 1IUDA 3C32A 1EYIA 4F3GA 1FRPA 5BUUA 5A5LA 4G68C 1GV8A 1N3XA 3CSBA 5CI5A 1FTKA 2XXUA 3KG2A 4F39A 4WKMA 1FQEA 1G0HA 5HM4B 3S9EA 5JEIA 1DMBA 5CMKA 2ESNA 2NXOA 4XIGQ 1SW1A 3P7IA 4XKPA 2V25A 2V3QA 1ZIUA 2I3WA 4QFOA 2CZLA 3S4UA 1MXZA 4GD5A 1Y20A 1LFHA 4EUOA 1IXCA 2FBPA 1US4A 2WEFA 1B2HA 2DVCA 5B70A 4MNPA 2AIXA 1FBFA 2Z8FA 1CB6A 3T96B 3DP8A 5LOMA 4OWDA 3PUWE 2RINA 4ZE8A 2Z8DA 3MVZA 3PUXE 3SDFA 5TP9A 1EU8A 3HHFA 5DW8A 2FNCA 2CZHA 1KZ8A 4N17A 5HPQA 2QS4A 4MHFA 4ZZAA 3FXUA 4PC9A 4RK2A 3PUYE 4R6YA 1SW4A 2ZYKA 3O2AA 1Y9UA 1USYE 1FCKA 4GWZA 4OHNA 1FQCA 2Q9TA 1QW0A 3H03A 2XXXA 3DM0A 2CZIA 1IIWA 4KFQA 4YB6A 2FVZA 2CZKA 4NF8B 1XHYA 3LSFB 4MX6A 1Y3PA 3SERA 3FXQA 3H3GA 4R73A 3K2DA 1QVSA 2HPGA 4OYVA 4HCWA 2DS9A 1OVBA 3TZAA 3MW0A 4PCDA 1OMPA 1IZ1A 1MDQA 4YMBA 1ANFA 1FPKA 3FASA 1AL3A 1MQGA 3L6HA 4LUBA 5EQ9A 1Y3NA 1NNTA 3W15C 3LSWA 4OFOA 1MPDA 2IEEA 3JV9A 4ZECA 4EDPA 4RA1A 3CHGA 4OVRA 5FHOA 3BFTA 2Q2CA 3T9HB 1LBVA 1NNKA 4PGPA 1DCUA 3U65A 2F6GA 1M5CA 3BIHA 2D21A 2XXRA 3HCQA 2KQZA 2ONSA 1LAXA 1RYXA 3V89B 1INPA 3JZJA 1MQHA 5ISUA 3EHSA 3QIMA 1UTHA 3O9PA 1RDXA 4OTEA 4JSDA 1LFIA 1BIYA 3KGCA 1DSNA 2PCRA 3H4ZA 1IXGA 2P1SA 1B4HA 2NVUB 2G29A 5H8NB 1DBZA 5LDZA 4X48A 3TTMA 4ELRA 4OQOA 1JP4A 4KCDA 4FIMA 3H06B 2PYYA 1LBZA 4H45A 2ZMBA 1SDXA 3OO8A 1JVYA 3PMXA 2BJJX 1NFTA 4F19A 2H9BA 4LZ7A 5EHMA 1FSAA 3A3CA 1UTBB 3C36A 3CG3A 4X04A 2F5XA 4H0WA 4E0WA 1DPEA 4DI3D 4QFPA 5AA2A 2PFYA 3B6TA 1KA1A 4N15A 5AA4B 1SBPA 1NUYA 1OIBA 2B4LA 5ET8A 4G77A 2HXWA 5I2KA 1XC1A 4PE5B 1SVXB 2O51A 2QSXA 4XKQA 4BDMA 3UA8A 4C0RA 3K6WA 3T93B 3TAJA 2OCUA 1P1WA 3N26A 1S9TA 4YKIA 3N5LA 4MBPA 2QS1A 4WEDA 1LEVA 2RKMA 4P1LA 2ABHA 3RNNA 3MQ9A 3MP6A 4PFRA 3MVXA 2DE4A 1LB9A 3O6GA 5H8HA 1MPCA 3KBZA 1YYZA 2F7AA 3BIGA 2F97A 3K00A 4R9FA 4DXUA 3G3GA 4QXDA 1VFEA 4PFWA 1FPLA 2DYXA 3MP1A 4R74A 4G68B 5ITPA 4PFUA 4QFKA 1TFAA 3FV2A 3BBRA 4NHBA 2PBWA 3UGWA 3VV5A 1PDAA 3TQLA 2AYSA 2WX9A 4GIZA 2UVIA 3VXBA 3OO9A 2ZNSA 4IB2A 3VXCA 4N6KA 1LCFA 4R6KA 3QMFA 5CM6A 2ZNUA 2GHBA 5I57A 1EZ9A 1QUIA 2H99A 1N7WA 4I1DA 3K1NA 4U23A 1H3DA 1JW4A 3O97A 1VDWA 1UIVA 3KJTA 5K2XA 4R9GA 4ELQA 3FVOA 5TPAA 3G3KA 1FBCA 4GXAA 4I9DA 4EQ7A 1FPBA 1JW1A 2I4CA 2O1LA 4LN5A 3RPLA 2O69A 3SEUA 1XS5A 4PFBA 1SPIA 2V3TA 3ISPA 4GWWA 2ANJA 5CMBA 1SW5A 1TFDA 3MBPA 3G7WA 2RCAA 3KOTA 2XWVA 1D9QA 1NV0A 4H5GA 1BK4A 1EZPA 4UACA 3I6VA 2Y7WA 1TWYA 3KC1A 3S9LC 4PBHA 4OEVA 4R6HA 1UTHB 3F11A 2XXTA 5IKBA 2G93A 1SI0A 3KOSA 1QULA 4PGNA 4H5FA 2XXKA 4EXKA 2HZKA 1POTA 1WDNA 3IOTA 5IZ3A 1XI6A 4Q30B 3MC2A 4IO2A 4ZZEA 4PDHA 1SI1A 2CMOA 3A29A 3C35A 1Y4TA 3KN3A 4JBZA 1FPGA 1KWHA 1IXHA 4XFEA 1OVTA 4NE4A 2Y7RA 3LUZA 2OLBA 2IA4A 3IB1A 4JB7A 2I4BA 5EYGA 2XXVA 4ZDMA 1K9YA 3M3LA 1R6ZA 1B52A 3VE1B 1SD3A 4FJPA 4MFIA 5AA2B 4DE8A 1XT8A 2QL3A 1A99A 4Z0IA 3B50A 4GWXA 3MZ9A 2QVRA 4M4GA 5I2KB 4DDDA 3G3HA 2FA7A 5ET5A 1GTKA 4OVPA 3RTWB 3LC8A 5FHMA 1FTAA 4KPTA 4F29A 3LSLA 2PVUA 4HCYA 5J1DA 4P47A 4PBQA 1SYIA 2R9JA 2RC8A 2GHAA 1BTJA 2F7CA 4GX4A 5F24A 1MS7A 1FTMA 2F3BA 1QUKA 5H8HB 1B0HA 1MXUA 1LSTA 3ONMA 1YPNA 3IB2A 5J16A 3EPEA 1JETA 1B7ZA 3M8UA 1DTGA 1LBXA 1QKBA 1A8EA 4MLVA 4NGUA 3T9UA 3EKIA 1VR5A 1D3KA 2HAUA 3S9MC 5IZZA 4RJZA 1FTOA 3SEWA 1NUWA 1H44A 2F78A 5F1QA 4ESWA 4YB5A 3C31A 4EQ9A 1IMEA 3PV0E 3ILTB 1A54A 3ZS6A 1YTVA 5ET6A 4LZ8A 5I57B 2WBDA 1MRPA 1F9BA 2Q89A 3VVDA 1K9ZA 5LTCA 1B5JA 2XWOA 2QS2A 1AOVA 1Q9DA 4JWOA 4F1YA 3FZVA 2I58A 3VVFA 4OFJA 4GQOA 2O6AA 1OLAA 4N4UA 1DK4A 3LUYA 5TPAB 4GL0A 3FIRA 3SEVA 4I3EA 2XXPA 5CRYA 1ZJLA 1EZOA 3IO4A 3FXRA 3RPLB 4G2ZA 1A55A 3FV1A 4PE3A 1Y1MA 1US5A 4DZ1A 4U4SA 4OMBA 4ZEFA 1UTBA 1PC3A 2F36A 4NF5A 3MJNA 2DQVA 4R72A 3KN7A 2AL5A 1IMCA 5I84A 1II5A 1S50A 4O7MA 4FORA 2I3VA 5AA4A 1O7TA 3HPIA 5M2VA 1FBHA 3CRBA 4YU0A 3IR1A 4JWXA 4QHQA 3E4RA 4ZEIA 2WYPA 4AB6A 4FAJA 1P1NA 4DCYA 4KHZE 4EXLA 4HE2A 2DVZA 1HSEA 5IZ3B 2I0CA 1D4NA 3T9XB 3PPPA 4YZZA 4YB7A 2Y7PA 3UP9A 3ECRA 4QSDA 4Z7EA 1FBGA 4KQPA 5IAIA 4F22A 1FPEA 4PF6A 3TPAA 1B5IA 4G61A 1FQBA 1FW0A 4LONB 1NV3A 4P0IA 4G68A 5AA2D 3W9VA 2WKYA 4XEQA 1FBPA 1MXYA 1XVYA 3ILUB 1YCJA 3PGFA 1Y1ZA 4JVIA 4OANA 4R2FA 4XKRA 4MH5A 2AL4A 1M5EA 3USDA 3DELB 3Q26A 5L9MA 2O68A 1BP5A 1L5TA 5ESYA 1MH4A 4QBAA 1B3EA 4PETA 1O64A 4ONYA 4PQJA 5AE4A 2W7YA 2ZZXA 2F34A 2NOOA 4HXVA 3SZPA 2OBGA 3R26A 1MY3A 3RYDA 4IO3A 2XHDA 1RDYA 3U92A 1ELJA 4F2QA 4KR5A 4DXBA 1LCTA 3Q25A 2Q8JA 3RN8A 2XA5A 2P2AA 1PBPA 1GGGA 3LBSA 4GRKA 2PFZA 4QFNA 3FBPA 4UABA 1JNFA 1M5FA 3PPNA 2E0SA 1HSJA 1IMAA 4NWCA 4X1DA 1R9LA 2UYFA 3C4MA 2X26A 3IB0A 4JXIA 2O84X 2FYIA 3U8QA 4G8NA 3H6VA 4U4XA 2RCBA 5ET7A 4G4PA 4PAKA 3RLFE 2LAOA 1Q1KA 3CFZA 5ELVA 4GL8A 3TMGA 4AQ4A 2HQ0A 1B0LA 1RYOA 1VE4A 1B3FA 5FTIA 2VPOA 4LA9A 1SW2A 1NNPA 2Y5KA 3E3KA 2I48A 5FTHA 2KR0A 2YLNA 1R1NA 4N6DA 2Q74A 4GWOA 1G0IA 1UIUA 1NMUA 3MVWA 1N76A 4ELOA 3ZSFA 1D9VA 1NV1A 3IX1A 4RK9A 3K6XA 2O7IA 4POWA 4KCCA 3H6UA 4NF5B 4U1ZA 1MXWA 2P0SA 3IOVA 1ZMGA 1FJ6A 1B1XA 4ISUA 3V83A 2DWHA 3I5OA 4XXUA 5H8FB 5DYHA 1JEVA 3KC0A 4N8YA 2DXRA 2XXHA 3OSRA 4MNCA 1FJ9A 2GFEA 3Q29A 3EHTA 5EQ7A 1M5BA 2VOZA 4EQBA 4POXA 3U1OA 1LAHE 4U22A 1A40A 3QK6A 5H8SA 1FTJA 3CFLA 1NH8A 5DVFA 3SEYA 1A8FA 1MXVA 1N3WA 3KZGA 2ONKE 4ECFA 3KEIA 1NL5A 4TLLB 3B6QA 1B32A 1NV2A 3TTKA 3RTFB 1Z7NE 5ITOA 3D4CA 2VT5A 1B5HA 3MSTA 4DXCA 1DTZA 1DPPA 4Q0CA 4QF9A 3FXBA 5L9SA 1I6BA 2H25A 4AS4A 4NN3A 3Q27A 3HSTA 2DWJA 3TEPA 2DSFA 2XX9A 3FVKA 3N94A 1URSA 1N0TA 5KZTA 4PP0A 1B7HA 2F35A 4FEDA 4MCOA 5B7DA 3FJ7A 2GQ1A 5AA3A 4JWYA 1B9JA 2OWTA 3RPWA 2O1MA 4XF5A 4PAIA 4O7IA 4OA4A 3T9VA 1QGXA 3OXNA 4KYSA 4HW8A 4FBPA 2FIXA 1NV7A 1NUXA 4IY5A 4PFYA 4YKJA 2Q2AA 2Z22A 4N13A 4MMPA 4P56A 3PUVE 3G3JA 4GWYA 4JVCA 2XXQA 5L8DA 1LBYA 1EH3A 1IMDA 2DE3A 3PU5A 3IK6B 4QRZA 3W9WA 3QUJA 3IL1B 4E0XA 5DVJA 3OEKA 4H1XA 3TCFA 2D5WA 3FATA 3SEXA 4WEPA 3PPRA 1NV6A 2QPQA 1IEJA 2H4IA 1TXFA 2UXAA 4DI4B 4THIA 1QJMA 4PF8A 5CBSA 2FIEA 3TFLA 5I59A 4N8GA 4H8IA 4RXLA 4X9TA 4MAGA 2XWKA 4BDQA 4R2BA 2WYKA 3QYTA 2V3UA 4OVJA 1ZU0A 1EYKA 4GBWA 4G8HA 1P99A 1NV4A 1ZKBA 3SKPA 3K02A 3U72A 1T0KA 3VLWA 4OESA
chains in the Genus database with same CATH topology
4MF3A 2XD3A 4LATA 4I62A 1B58A 3OENA 4NMYA 3IOUA 2DWAA 2XXWA 1PB7A 1A7LA 3PPOA 4RNSA 5F7VA 2RC7A 2GH9A 4F1VA 4F18A 3D4GA 5HBCA 2PMSA 2I6EA 1B3HA 1R9QA 4FATA 4OXVA 4N07A 1Y3QA 4Q5TA 1YAEA 4F3BA 2Y7KA 2YPNA 3K4UA 1IQ7A 4ZEKA 3TODA 3HN0A 4RPOA 2OWSA 3UN6A 3IOWA 1SYHA 3OEMA 1URGA 1B51A 3CSGA 2ZNTA 3KFMA 4YKPA 3OO7A 4O3CA 3VLVA 1PBQA 3MAMA 1ZTYA 2QJEA 3KJ7A 2DE2A 4YAHX 4UA8A 3FGSA 1ZLQA 3GZGA 5I58B 2V84A 4RPNA 4IGTA 4NWDA 2NWJA 4GOTA 4F31B 4BDLA 5DEXA 1URDA 3Q28A 4ZS9A 4OENA 3PMVA 4KD5A 4ZEDA 1H76A 3MPKA 3RT6B 2O7UA 2A5TB 3U93A 3O6HA 3FJGA 1LAFE 3KN8A 2QRYA 3PD9A 1WODA 2ONRA 5A5XA 3VFJA 2UYEA 3H6TA 3HV1A 5BWJA 2Y84A 3C34A 2M8CA 2D3IA 3UIFA 1JEUA 3S9NC 1N84A 4YKKA 1MQJA 3V8XB 1XOCA 1PB9A 4TOZA 3TKDA 1M5DA 2PT2A 1H43A 1Y4CA 3TTNA 2I0BA 5ICQA 2XD2A 1B46A 5K2YA 5H8FA 1B3LA 4M1VA 2HCAA 3GXAA 3N6TA 2F7BA 2X7QA 1MPBA 1B3GA 4U21A 5DVIA 4K3FA 3O66A 5KCJB 5I59B 3IJOB 3ZKKA 3WAEA 4F3PA 1XVXA 3VLUA 4TQUQ 3PUZE 4L17A 2B3FA 4IGRA 4LVQA 5CBRA 3EF7A 3N6UA 3M3FA 4FEBA 2OK2A 4I8CA 5JTYB 3VDFA 2PT1A 3G3IA 2ZYNA 4GFRA 3FVGA 5TU0A 3KBRA 3KSXA 2DWIA 3OMBA 3R6UA 1PB8A 4C1TA 3TQWA 4EF2A 3EQ1A 2DXYA 4QFLA 5H8QB 4OFLA 5I2NA 2DP8A 3K6UA 2HFBA 4FE8A 4JDFA 4KYEA 3JYRA 1FQFA 3TDJA 1AIVA 5I56A 1Z7ME 1B6HA 4KI0E 1H45A 1MY0A 1JQFA 4LZ5A 3ODBA 1I69A 3O6IA 3RY3A 1B7UA 2VGQA 1OQGA 4OETA 3DLNA 1HSLA 3RQTA 2B65A 1I6AA 3MP8A 3K6VA 2HZLA 4Q8RA 1IITA 4DLDA 3IORA 2ALUA 4DCXA 1MG1A 1USYH 3AXFA 3FJMA 4IO6A 3C9HA 3PD8A 2I49A 4YICA 3C33A 5DEXB 3HO7A 1MXXA 2QMXA 4P11A 2F8DA 3UK4A 2H98A 3TTLA 1MDP1 4HTGA 3DP4A 3PPQA 3OO6A 4HS7A 3MZBA 4C1UA 2NUVA 4NF6A 1ATGA 5A5XB 1B1HA 3THIA 1PEBA 3SETA 2F6PA 2Z8EA 1LAGE 4QSEA 1MM7A 3U94A 1N7XA 1S7YA 1SQYA 3MVYA 4EF1A 4BLAA 2DOJA 4U1OA 1FTLA 3MUQA 4IY6A 3K0VA 4NF4A 3O29A 5FHNA 3L6GA 3FVNA 3V5AA 3FD3A 1I6QA 3CVGA 3H7MA 5CC2A 1MH3A 2REJA 4FECA 2RC9A 3MPLA 2THIA 4H67A 3VVEA 3S2VA 4RY1A 1NH7A 1POY1 4ZE9A 1BLFA 1LFGA 3LSXA 4F3SA 2VD2A 2X7PA 5TP9B 3B6WA 3G3FA 3OD7A 1GR2A 4GVOA 3PMWA 3E13X 1AMFA 3CG1A 3EN3A 3BFUA 5I58A 4H65A 4H6DA 4MLQA 4GXSB 5CMMA 2R71A 2XX8A 1B40A 2Y7IA 2PX1A 2A5TA 5KDTA 5EYFA 2H5YA 5DTBA 4F1UA 4BDOA 5I2NB 4NTLA 3CR9A 3I3VA 3TELA 3TUSA 3BKIB 4H8JA 4BDNA 3OELA 3KSJA 1QKAA 3SESA 5L9OA 2UVGA 2OZZA 5I56B 1CE2A 4LQ2A 5ICTA 4QSCA 4DIGA 3RUMA 3QXMA 4N6PA 1QUJA 3M3KA 5AA1A 2UVHA 3QSLA 3MZ1A 3HHGA 1O63A 1TT1A 4KYDA 2A5SA 1D9YA 3K1PA 3H6WA 2B3BA 1RKMA 1OLCA 2HEUA 3CIJA 5JK4A 4IO7A 2QMWA 2XX7A 1N04A 2VHAA 3IAZA 3UORA 3IJXB 5KCJA 2ZYOA 4G8MA 1NNFA 4GF8A 4BDRA 4XTCQ 4GLIA 1MY4A 4LP2B 1GVCA 1VFDA 1MY1A 4ESXA 4R75A 3OOAA 3CI8A 3GBBA 3TTRA 4NF6B 1LBCA 1MM6A 5JTYA 1LGBC 3LR1A 4O3BA 1P1QA 4XKNA 2OJTA 3QUFA 3A09A 1P1UA 4OERA 4ELPA 2VP1A 1NKXA 2HAVA 1FQAA 3OSQA 2REGA 1Q35A 1JW5A 4OEUA 3T22A 3TYHA 4NF4B 1WVJA 4O3AA 3TCGA 1ZBMA 2Q88A 3IO6A 2KLFA 3K1MA 4NF8A 1LLSA 5H8QA 4NEDA 3T66A 1J1NA 3RT8A 5CMCA 2XXIA 4AB5A 4OZ9A 2Z23A 3WAFA 1LBBA 2ZXTA 3DP6A 3QAXA 1VSOA 1DOTA 3GLBA 2E1SA 3E9XA 3A3UA 1MQDA 3MWBA 4JSOA 1IXIA 2RF1A 2VD3A 2YJPA 4X1BA 1JVXA 4LQ5A 4IO4A 2QS3A 3RGYA 1BKAA 2XXYA 2V93A 1AH5A 3R7XA 2ZYMA 4ZEBA 1UQWA 3O28A 4YMAA 1FQDA 4PFTA 3K01A 3FUZA 5DT6A 5KDTB 4U2RA 2R6GE 5EHSA 3TCHA 1P1OA 1B4ZA 1LB8A 1MY2A 1MQIA 4WXJA 4IO5A 1B05A 1OQHA 5H8NA 4F2OA 2GRVA 4ND9A 3CFXA 4TLMB 2UVJA 3EHUA 3B7DA 3ZKLA 3GBAA 4P0GA 4RYAA 1IUDA 3C32A 4F3GA 5BUUA 4G68C 1GV8A 1N3XA 3CSBA 5CI5A 1FTKA 2XXUA 3KG2A 4F39A 4WKMA 1FQEA 5HM4B 3S9EA 5JEIA 1DMBA 5CMKA 2ESNA 2NXOA 4XIGQ 1SW1A 3P7IA 4XKPA 2V25A 2V3QA 1ZIUA 2I3WA 4QFOA 2CZLA 3S4UA 1MXZA 4GD5A 1Y20A 1LFHA 4EUOA 1IXCA 1US4A 1B2HA 2DVCA 5B70A 2AIXA 2Z8FA 1CB6A 3T96B 3DP8A 5LOMA 4OWDA 3PUWE 2RINA 4ZE8A 2Z8DA 3MVZA 3PUXE 3SDFA 5TP9A 1EU8A 3HHFA 2FNCA 5HPQA 2QS4A 4ZZAA 3FXUA 4RK2A 3PUYE 4R6YA 1SW4A 2ZYKA 3O2AA 1Y9UA 1USYE 1FCKA 4OHNA 1FQCA 2Q9TA 1QW0A 3H03A 2XXXA 3DM0A 1IIWA 4KFQA 4YB6A 4NF8B 1XHYA 3LSFB 1Y3PA 3SERA 3FXQA 3H3GA 4R73A 3K2DA 1QVSA 4OYVA 4HCWA 2DS9A 1OVBA 3TZAA 3MW0A 1OMPA 1IZ1A 1MDQA 4YMBA 1ANFA 3FASA 1AL3A 1MQGA 3L6HA 4LUBA 1Y3NA 1NNTA 3W15C 4ZECA 3LSWA 1MPDA 2IEEA 3JV9A 4OFOA 4EDPA 4RA1A 5FHOA 3BFTA 2Q2CA 3T9HB 1NNKA 2F6GA 1M5CA 2D21A 2XXRA 3HCQA 2ONSA 1LAXA 1RYXA 3V89B 3JZJA 1MQHA 5ISUA 3EHSA 3QIMA 1UTHA 3O9PA 4OTEA 4JSDA 1LFIA 1BIYA 3KGCA 1DSNA 3H4ZA 1IXGA 2P1SA 1B4HA 2NVUB 2G29A 5H8NB 4X48A 3TTMA 4ELRA 4OQOA 4KCDA 4FIMA 3H06B 2PYYA 2ZMBA 1SDXA 3OO8A 1JVYA 3PMXA 2BJJX 1NFTA 4F19A 2H9BA 4LZ7A 5EHMA 3A3CA 1UTBB 3C36A 3CG3A 2F5XA 4H0WA 4E0WA 1DPEA 4QFPA 5AA2A 3B6TA 5AA4B 1SBPA 1OIBA 4G77A 2HXWA 5I2KA 1XC1A 4PE5B 1SVXB 2O51A 2QSXA 4XKQA 4BDMA 3UA8A 4C0RA 3K6WA 3T93B 3TAJA 2OCUA 1P1WA 3N26A 1S9TA 4YKIA 3N5LA 4MBPA 2QS1A 4WEDA 2RKMA 2ABHA 3RNNA 3MQ9A 3MP6A 3MVXA 2DE4A 1LB9A 3O6GA 5H8HA 1MPCA 2F7AA 4R9FA 3K00A 2F97A 4DXUA 3G3GA 1VFEA 4PFWA 2DYXA 3MP1A 4R74A 4G68B 5ITPA 4PFUA 4QFKA 1TFAA 3FV2A 3BBRA 2PBWA 3UGWA 3VV5A 1PDAA 3TQLA 2AYSA 4GIZA 2UVIA 3VXBA 3OO9A 2ZNSA 4IB2A 3VXCA 1LCFA 4R6KA 5CM6A 2ZNUA 2GHBA 5I57A 1EZ9A 1QUIA 2H99A 1N7WA 4I1DA 3K1NA 4U23A 1H3DA 1JW4A 3O97A 1UIVA 3KJTA 5K2XA 4R9GA 4ELQA 3FVOA 5TPAA 3G3KA 4GXAA 4I9DA 4EQ7A 1JW1A 2I4CA 2O1LA 2O69A 3SEUA 1XS5A 2V3TA 2ANJA 5CMBA 1SW5A 1TFDA 3MBPA 3G7WA 2RCAA 3KOTA 4H5GA 1EZPA 4UACA 3I6VA 2Y7WA 1TWYA 3S9LC 4OEVA 4R6HA 1UTHB 3F11A 2XXTA 5IKBA 2G93A 1SI0A 3KOSA 1QULA 4H5FA 4EXKA 2HZKA 1POTA 1WDNA 3IOTA 4Q30B 3MC2A 4IO2A 4ZZEA 1SI1A 2CMOA 3C35A 1Y4TA 3KN3A 4JBZA 1KWHA 1IXHA 1OVTA 4NE4A 2Y7RA 2OLBA 2IA4A 3IB1A 4JB7A 2I4BA 2XXVA 4ZDMA 3M3LA 1R6ZA 1B52A 3VE1B 1SD3A 4FJPA 4MFIA 5AA2B 4DE8A 1XT8A 2QL3A 1A99A 4Z0IA 3MZ9A 4M4GA 5I2KB 4DDDA 3G3HA 2FA7A 1GTKA 3RTWB 3LC8A 5FHMA 4KPTA 4F29A 3LSLA 2PVUA 4HCYA 5J1DA 1SYIA 2R9JA 2RC8A 2GHAA 1BTJA 2F7CA 1MS7A 1FTMA 1QUKA 5H8HB 1B0HA 1MXUA 1LSTA 3ONMA 1YPNA 3IB2A 3EPEA 1JETA 1B7ZA 3M8UA 1DTGA 1QKBA 1A8EA 4MLVA 3T9UA 1VR5A 1D3KA 2HAUA 3S9MC 4RJZA 1FTOA 3SEWA 1H44A 2F78A 5F1QA 4ESWA 4YB5A 3C31A 4EQ9A 3PV0E 3ILTB 1A54A 3ZS6A 1YTVA 4LZ8A 5I57B 1MRPA 1F9BA 2Q89A 3VVDA 1B5JA 2QS2A 1AOVA 4JWOA 4F1YA 3FZVA 2I58A 3VVFA 4OFJA 4GQOA 2O6AA 1OLAA 3LUYA 5TPAB 4GL0A 3FIRA 3SEVA 2XXPA 5CRYA 1ZJLA 1EZOA 3IO4A 3FXRA 4G2ZA 1A55A 3FV1A 1Y1MA 1US5A 4DZ1A 4U4SA 4OMBA 4ZEFA 1UTBA 1PC3A 2F36A 4NF5A 3MJNA 2DQVA 4R72A 3KN7A 2AL5A 5I84A 1II5A 1S50A 4FORA 2I3VA 5AA4A 1O7TA 3HPIA 5M2VA 3CRBA 4YU0A 3IR1A 4JWXA 4QHQA 3E4RA 4ZEIA 4AB6A 4FAJA 1P1NA 4DCYA 4KHZE 4EXLA 2DVZA 1HSEA 2I0CA 1D4NA 3T9XB 3PPPA 4YZZA 4YB7A 2Y7PA 3UP9A 3ECRA 4QSDA 4Z7EA 4KQPA 5IAIA 4F22A 3TPAA 1B5IA 1FQBA 1FW0A 4LONB 4P0IA 4G68A 5AA2D 3W9VA 2WKYA 1MXYA 1XVYA 3ILUB 1YCJA 3PGFA 1Y1ZA 4R2FA 4XKRA 4MH5A 2AL4A 1M5EA 3USDA 3DELB 3Q26A 5L9MA 2O68A 1BP5A 1L5TA 1MH4A 1B3EA 4PETA 1O64A 4ONYA 4PQJA 5AE4A 2W7YA 4OESA 2F34A 2NOOA 2OBGA 3R26A 1MY3A 4IO3A 2XHDA 3U92A 1ELJA 4F2QA 4KR5A 4DXBA 1LCTA 3Q25A 2Q8JA 3RN8A 2P2AA 1PBPA 1GGGA 3LBSA 4GRKA 4QFNA 1JNFA 1M5FA 3PPNA 2E0SA 1HSJA 4NWCA 4X1DA 1R9LA 2UYFA 3C4MA 2X26A 3IB0A 4JXIA 2O84X 2FYIA 3U8QA 4G8NA 3H6VA 4U4XA 2RCBA 4G4PA 3RLFE 2LAOA 1Q1KA 3CFZA 5ELVA 4GL8A 3TMGA 4AQ4A 2HQ0A 1B0LA 1RYOA 1VE4A 1B3FA 5FTIA 4LA9A 1SW2A 1NNPA 3E3KA 2I48A 5FTHA 2YLNA 1R1NA 4GWOA 1UIUA 1NMUA 3MVWA 1N76A 4ELOA 3ZSFA 1D9VA 3IX1A 4RK9A 3K6XA 2O7IA 4POWA 4KCCA 3H6UA 4NF5B 4U1ZA 1MXWA 2P0SA 3IOVA 1ZMGA 1B1XA 4ISUA 3V83A 2DWHA 3I5OA 4XXUA 5H8FB 5DYHA 1JEVA 2DXRA 2XXHA 3OSRA 2GFEA 3Q29A 3EHTA 1M5BA 2VOZA 4EQBA 4POXA 3U1OA 1LAHE 4U22A 1A40A 3QK6A 1FTJA 3CFLA 1NH8A 5DVFA 3SEYA 1A8FA 1MXVA 1N3WA 3KZGA 2ONKE 4ECFA 3KEIA 1NL5A 4TLLB 3B6QA 1B32A 3TTKA 3RTFB 1Z7NE 5ITOA 3D4CA 1B5HA 4DXCA 1DTZA 1DPPA 4Q0CA 4QF9A 5L9SA 1I6BA 2H25A 3Q27A 3HSTA 2DWJA 3TEPA 2DSFA 2XX9A 3FVKA 3N94A 1URSA 1N0TA 5KZTA 4PP0A 1B7HA 2F35A 4FEDA 5B7DA 3FJ7A 5AA3A 4JWYA 1B9JA 2OWTA 3RPWA 2O1MA 3T9VA 3OXNA 4KYSA 4HW8A 4IY5A 4PFYA 4YKJA 2Q2AA 2Z22A 4N13A 3PUVE 3G3JA 2XXQA 5L8DA 1EH3A 2DE3A 3PU5A 3IK6B 4QRZA 3W9WA 3QUJA 3IL1B 4E0XA 5DVJA 3OEKA 4H1XA 3TCFA 2D5WA 3FATA 3SEXA 4WEPA 3PPRA 2QPQA 1IEJA 2H4IA 1TXFA 2UXAA 4THIA 1QJMA 5CBSA 3TFLA 5I59A 4H8IA 4RXLA 4X9TA 4BDQA 4R2BA 3QYTA 2V3UA 1ZU0A 4OVJA 4G8HA 1P99A 1ZKBA 3SKPA 3K02A 3U72A 1T0KA 3VLWA 5H8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MF3 A;  2XD3 A;  4LAT A;  4I62 A;  1B58 A;  3OEN A;  4NMY A;  3IOU A;  2DWA A;  2XXW A;  1PB7 A;  1A7L A;  3PPO A;  4RNS A;  5F7V A;  2RC7 A;  2GH9 A;  4F1V A;  4F18 A;  3D4G A;  5HBC A;  2PMS A;  2I6E A;  1B3H A;  1R9Q A;  4FAT A;  4OXV A;  4N07 A;  1Y3Q A;  4Q5T A;  1YAE A;  4F3B A;  2Y7K A;  2YPN A;  3K4U A;  1IQ7 A;  4ZEK A;  3TOD A;  3HN0 A;  4RPO A;  2OWS A;  3UN6 A;  3IOW A;  1SYH A;  3OEM A;  1URG A;  1B51 A;  3CSG A;  2ZNT A;  3KFM A;  4YKP A;  3OO7 A;  4O3C A;  3VLV A;  1PBQ A;  3MAM A;  1ZTY A;  2QJE A;  3KJ7 A;  2DE2 A;  4YAH X;  4UA8 A;  3FGS A;  1ZLQ A;  3GZG A;  5I58 B;  2V84 A;  4RPN A;  4IGT A;  4NWD A;  2NWJ A;  4GOT A;  4F31 B;  4BDL A;  5DEX A;  1URD A;  3Q28 A;  4ZS9 A;  4OEN A;  3PMV A;  4KD5 A;  4ZED A;  1H76 A;  3MPK A;  3RT6 B;  2O7U A;  2A5T B;  3U93 A;  3O6H A;  3FJG A;  1LAF E;  3KN8 A;  2QRY A;  3PD9 A;  1WOD A;  2ONR A;  5A5X A;  3VFJ A;  2UYE A;  3H6T A;  3HV1 A;  5BWJ A;  2Y84 A;  3C34 A;  2M8C A;  2D3I A;  3UIF A;  1JEU A;  3S9N C;  1N84 A;  4YKK A;  1MQJ A;  3V8X B;  1XOC A;  1PB9 A;  4TOZ A;  3TKD A;  1M5D A;  2PT2 A;  1H43 A;  1Y4C A;  3TTN A;  2I0B A;  5ICQ A;  2XD2 A;  1B46 A;  5K2Y A;  5H8F A;  1B3L A;  4M1V A;  2HCA A;  3GXA A;  3N6T A;  2F7B A;  2X7Q A;  1MPB A;  1B3G A;  4U21 A;  5DVI A;  4K3F A;  3O66 A;  5KCJ B;  5I59 B;  3IJO B;  3ZKK A;  3WAE A;  4F3P A;  1XVX A;  3VLU A;  4TQU Q;  3PUZ E;  4L17 A;  2B3F A;  4IGR A;  4LVQ A;  5CBR A;  3EF7 A;  3N6U A;  3M3F A;  4FEB A;  2OK2 A;  4I8C A;  5JTY B;  3VDF A;  2PT1 A;  3G3I A;  2ZYN A;  4GFR A;  3FVG A;  5TU0 A;  3KBR A;  3KSX A;  2DWI A;  3OMB A;  3R6U A;  1PB8 A;  4C1T A;  3TQW A;  4EF2 A;  3EQ1 A;  2DXY A;  4QFL A;  5H8Q B;  4OFL A;  5I2N A;  2DP8 A;  3K6U A;  2HFB A;  4FE8 A;  4JDF A;  4KYE A;  3JYR A;  1FQF A;  3TDJ A;  1AIV A;  5I56 A;  1Z7M E;  1B6H A;  4KI0 E;  1H45 A;  1MY0 A;  1JQF A;  4LZ5 A;  3ODB A;  1I69 A;  3O6I A;  3RY3 A;  1B7U A;  2VGQ A;  1OQG A;  4OET A;  3DLN A;  1HSL A;  3RQT A;  2B65 A;  1I6A A;  3MP8 A;  3K6V A;  2HZL A;  4Q8R A;  1IIT A;  4DLD A;  3IOR A;  2ALU A;  4DCX A;  1MG1 A;  1USY H;  3AXF A;  3FJM A;  4IO6 A;  3C9H A;  3PD8 A;  2I49 A;  4YIC A;  3C33 A;  5DEX B;  3HO7 A;  1MXX A;  2QMX A;  4P11 A;  2F8D A;  3UK4 A;  2H98 A;  3TTL A;  1MDP 1;  4HTG A;  3DP4 A;  3PPQ A;  3OO6 A;  4HS7 A;  3MZB A;  4C1U A;  2NUV A;  4NF6 A;  1ATG A;  5A5X B;  1B1H A;  3THI A;  1PEB A;  3SET A;  2F6P A;  2Z8E A;  1LAG E;  4QSE A;  1MM7 A;  3U94 A;  1N7X A;  1S7Y A;  1SQY A;  3MVY A;  4EF1 A;  4BLA A;  2DOJ A;  4U1O A;  1FTL A;  3MUQ A;  4IY6 A;  3K0V A;  4NF4 A;  3O29 A;  5FHN A;  3L6G A;  3FVN A;  3V5A A;  3FD3 A;  1I6Q A;  3CVG A;  3H7M A;  5CC2 A;  1MH3 A;  2REJ A;  4FEC A;  2RC9 A;  3MPL A;  2THI A;  4H67 A;  3VVE A;  3S2V A;  4RY1 A;  1NH7 A;  1POY 1;  4ZE9 A;  1BLF A;  1LFG A;  3LSX A;  4F3S A;  2VD2 A;  2X7P A;  5TP9 B;  3B6W A;  3G3F A;  3OD7 A;  1GR2 A;  4GVO A;  3PMW A;  3E13 X;  1AMF A;  3CG1 A;  3EN3 A;  3BFU A;  5I58 A;  4H65 A;  4H6D A;  4MLQ A;  4GXS B;  5CMM A;  2R71 A;  2XX8 A;  1B40 A;  2Y7I A;  2PX1 A;  2A5T A;  5KDT A;  5EYF A;  2H5Y A;  5DTB A;  4F1U A;  4BDO A;  5I2N B;  4NTL A;  3CR9 A;  3I3V A;  3TEL A;  3TUS A;  3BKI B;  4H8J A;  4BDN A;  3OEL A;  3KSJ A;  1QKA A;  3SES A;  5L9O A;  2UVG A;  2OZZ A;  5I56 B;  1CE2 A;  4LQ2 A;  5ICT A;  4QSC A;  4DIG A;  3RUM A;  3QXM A;  4N6P A;  1QUJ A;  3M3K A;  5AA1 A;  2UVH A;  3QSL A;  3MZ1 A;  3HHG A;  1O63 A;  1TT1 A;  4KYD A;  2A5S A;  1D9Y A;  3K1P A;  3H6W A;  2B3B A;  1RKM A;  1OLC A;  2HEU A;  3CIJ A;  5JK4 A;  4IO7 A;  2QMW A;  2XX7 A;  1N04 A;  2VHA A;  3IAZ A;  3UOR A;  3IJX B;  5KCJ A;  2ZYO A;  4G8M A;  1NNF A;  4GF8 A;  4BDR A;  4XTC Q;  4GLI A;  1MY4 A;  4LP2 B;  1GVC A;  1VFD A;  1MY1 A;  4ESX A;  4R75 A;  3OOA A;  3CI8 A;  3GBB A;  3TTR A;  4NF6 B;  1LBC A;  1MM6 A;  5JTY A;  1LGB C;  3LR1 A;  4O3B A;  1P1Q A;  4XKN A;  2OJT A;  3QUF A;  3A09 A;  1P1U A;  4OER A;  4ELP A;  2VP1 A;  1NKX A;  2HAV A;  1FQA A;  3OSQ A;  2REG A;  1Q35 A;  1JW5 A;  4OEU A;  3T22 A;  3TYH A;  4NF4 B;  1WVJ A;  4O3A A;  3TCG A;  1ZBM A;  2Q88 A;  3IO6 A;  2KLF A;  3K1M A;  4NF8 A;  1LLS A;  5H8Q A;  4NED A;  3T66 A;  1J1N A;  3RT8 A;  5CMC A;  2XXI A;  4AB5 A;  4OZ9 A;  2Z23 A;  3WAF A;  1LBB A;  2ZXT A;  3DP6 A;  3QAX A;  1VSO A;  1DOT A;  3GLB A;  2E1S A;  3E9X A;  3A3U A;  1MQD A;  3MWB A;  4JSO A;  1IXI A;  2RF1 A;  2VD3 A;  2YJP A;  4X1B A;  1JVX A;  4LQ5 A;  4IO4 A;  2QS3 A;  3RGY A;  1BKA A;  2XXY A;  2V93 A;  1AH5 A;  3R7X A;  2ZYM A;  4ZEB A;  1UQW A;  3O28 A;  4YMA A;  1FQD A;  4PFT A;  3K01 A;  3FUZ A;  5DT6 A;  5KDT B;  4U2R A;  2R6G E;  5EHS A;  3TCH A;  1P1O A;  1B4Z A;  1LB8 A;  1MY2 A;  1MQI A;  4WXJ A;  4IO5 A;  1B05 A;  1OQH A;  5H8N A;  4F2O A;  2GRV A;  4ND9 A;  3CFX A;  4TLM B;  2UVJ A;  3EHU A;  3B7D A;  3ZKL A;  3GBA A;  4P0G A;  4RYA A;  1IUD A;  3C32 A;  4F3G A;  5BUU A;  4G68 C;  1GV8 A;  1N3X A;  3CSB A;  5CI5 A;  1FTK A;  2XXU A;  3KG2 A;  4F39 A;  4WKM A;  1FQE A;  5HM4 B;  3S9E A;  5JEI A;  1DMB A;  5CMK A;  2ESN A;  2NXO A;  4XIG Q;  1SW1 A;  3P7I A;  4XKP A;  2V25 A;  2V3Q A;  1ZIU A;  2I3W A;  4QFO A;  2CZL A;  3S4U A;  1MXZ A;  4GD5 A;  1Y20 A;  1LFH A;  4EUO A;  1IXC A;  1US4 A;  1B2H A;  2DVC A;  5B70 A;  2AIX A;  2Z8F A;  1CB6 A;  3T96 B;  3DP8 A;  5LOM A;  4OWD A;  3PUW E;  2RIN A;  4ZE8 A;  2Z8D A;  3MVZ A;  3PUX E;  3SDF A;  5TP9 A;  1EU8 A;  3HHF A;  2FNC A;  5HPQ A;  2QS4 A;  4ZZA A;  3FXU A;  4RK2 A;  3PUY E;  4R6Y A;  1SW4 A;  2ZYK A;  3O2A A;  1Y9U A;  1USY E;  1FCK A;  4OHN A;  1FQC A;  2Q9T A;  1QW0 A;  3H03 A;  2XXX A;  3DM0 A;  1IIW A;  4KFQ A;  4YB6 A;  4NF8 B;  1XHY A;  3LSF B;  1Y3P A;  3SER A;  3FXQ A;  3H3G A;  4R73 A;  3K2D A;  1QVS A;  4OYV A;  4HCW A;  2DS9 A;  1OVB A;  3TZA A;  3MW0 A;  1OMP A;  1IZ1 A;  1MDQ A;  4YMB A;  1ANF A;  3FAS A;  1AL3 A;  1MQG A;  3L6H A;  4LUB A;  1Y3N A;  1NNT A;  3W15 C;  4ZEC A;  3LSW A;  1MPD A;  2IEE A;  3JV9 A;  4OFO A;  4EDP A;  4RA1 A;  5FHO A;  3BFT A;  2Q2C A;  3T9H B;  1NNK A;  2F6G A;  1M5C A;  2D21 A;  2XXR A;  3HCQ A;  2ONS A;  1LAX A;  1RYX A;  3V89 B;  3JZJ A;  1MQH A;  5ISU A;  3EHS A;  3QIM A;  1UTH A;  3O9P A;  4OTE A;  4JSD A;  1LFI A;  1BIY A;  3KGC A;  1DSN A;  3H4Z A;  1IXG A;  2P1S A;  1B4H A;  2NVU B;  2G29 A;  5H8N B;  4X48 A;  3TTM A;  4ELR A;  4OQO A;  4KCD A;  4FIM A;  3H06 B;  2PYY A;  2ZMB A;  1SDX A;  3OO8 A;  1JVY A;  3PMX A;  2BJJ X;  1NFT A;  4F19 A;  2H9B A;  4LZ7 A;  5EHM A;  3A3C A;  1UTB B;  3C36 A;  3CG3 A;  2F5X A;  4H0W A;  4E0W A;  1DPE A;  4QFP A;  5AA2 A;  3B6T A;  5AA4 B;  1SBP A;  1OIB A;  4G77 A;  2HXW A;  5I2K A;  1XC1 A;  4PE5 B;  1SVX B;  2O51 A;  2QSX A;  4XKQ A;  4BDM A;  3UA8 A;  4C0R A;  3K6W A;  3T93 B;  3TAJ A;  2OCU A;  1P1W A;  3N26 A;  1S9T A;  4YKI A;  3N5L A;  4MBP A;  2QS1 A;  4WED A;  2RKM A;  2ABH A;  3RNN A;  3MQ9 A;  3MP6 A;  3MVX A;  2DE4 A;  1LB9 A;  3O6G A;  5H8H A;  1MPC A;  2F7A A;  4R9F A;  3K00 A;  2F97 A;  4DXU A;  3G3G A;  1VFE A;  4PFW A;  2DYX A;  3MP1 A;  4R74 A;  4G68 B;  5ITP A;  4PFU A;  4QFK A;  1TFA A;  3FV2 A;  3BBR A;  2PBW A;  3UGW A;  3VV5 A;  1PDA A;  3TQL A;  2AYS A;  4GIZ A;  2UVI A;  3VXB A;  3OO9 A;  2ZNS A;  4IB2 A;  3VXC A;  1LCF A;  4R6K A;  5CM6 A;  2ZNU A;  2GHB A;  5I57 A;  1EZ9 A;  1QUI A;  2H99 A;  1N7W A;  4I1D A;  3K1N A;  4U23 A;  1H3D A;  1JW4 A;  3O97 A;  1UIV A;  3KJT A;  5K2X A;  4R9G A;  4ELQ A;  3FVO A;  5TPA A;  3G3K A;  4GXA A;  4I9D A;  4EQ7 A;  1JW1 A;  2I4C A;  2O1L A;  2O69 A;  3SEU A;  1XS5 A;  2V3T A;  2ANJ A;  5CMB A;  1SW5 A;  1TFD A;  3MBP A;  3G7W A;  2RCA A;  3KOT A;  4H5G A;  1EZP A;  4UAC A;  3I6V A;  2Y7W A;  1TWY A;  3S9L C;  4OEV A;  4R6H A;  1UTH B;  3F11 A;  2XXT A;  5IKB A;  2G93 A;  1SI0 A;  3KOS A;  1QUL A;  4H5F A;  4EXK A;  2HZK A;  1POT A;  1WDN A;  3IOT A;  4Q30 B;  3MC2 A;  4IO2 A;  4ZZE A;  1SI1 A;  2CMO A;  3C35 A;  1Y4T A;  3KN3 A;  4JBZ A;  1KWH A;  1IXH A;  1OVT A;  4NE4 A;  2Y7R A;  2OLB A;  2IA4 A;  3IB1 A;  4JB7 A;  2I4B A;  2XXV A;  4ZDM A;  3M3L A;  1R6Z A;  1B52 A;  3VE1 B;  1SD3 A;  4FJP A;  4MFI A;  5AA2 B;  4DE8 A;  1XT8 A;  2QL3 A;  1A99 A;  4Z0I A;  3MZ9 A;  4M4G A;  5I2K B;  4DDD A;  3G3H A;  2FA7 A;  1GTK A;  3RTW B;  3LC8 A;  5FHM A;  4KPT A;  4F29 A;  3LSL A;  2PVU A;  4HCY A;  5J1D A;  1SYI A;  2R9J A;  2RC8 A;  2GHA A;  1BTJ A;  2F7C A;  1MS7 A;  1FTM A;  1QUK A;  5H8H B;  1B0H A;  1MXU A;  1LST A;  3ONM A;  1YPN A;  3IB2 A;  3EPE A;  1JET A;  1B7Z A;  3M8U A;  1DTG A;  1QKB A;  1A8E A;  4MLV A;  3T9U A;  1VR5 A;  1D3K A;  2HAU A;  3S9M C;  4RJZ A;  1FTO A;  3SEW A;  1H44 A;  2F78 A;  5F1Q A;  4ESW A;  4YB5 A;  3C31 A;  4EQ9 A;  3PV0 E;  3ILT B;  1A54 A;  3ZS6 A;  1YTV A;  4LZ8 A;  5I57 B;  1MRP A;  1F9B A;  2Q89 A;  3VVD A;  1B5J A;  2QS2 A;  1AOV A;  4JWO A;  4F1Y A;  3FZV A;  2I58 A;  3VVF A;  4OFJ A;  4GQO A;  2O6A A;  1OLA A;  3LUY A;  5TPA B;  4GL0 A;  3FIR A;  3SEV A;  2XXP A;  5CRY A;  1ZJL A;  1EZO A;  3IO4 A;  3FXR A;  4G2Z A;  1A55 A;  3FV1 A;  1Y1M A;  1US5 A;  4DZ1 A;  4U4S A;  4OMB A;  4ZEF A;  1UTB A;  1PC3 A;  2F36 A;  4NF5 A;  3MJN A;  2DQV A;  4R72 A;  3KN7 A;  2AL5 A;  5I84 A;  1II5 A;  1S50 A;  4FOR A;  2I3V A;  5AA4 A;  1O7T A;  3HPI A;  5M2V A;  3CRB A;  4YU0 A;  3IR1 A;  4JWX A;  4QHQ A;  3E4R A;  4ZEI A;  4AB6 A;  4FAJ A;  1P1N A;  4DCY A;  4KHZ E;  4EXL A;  2DVZ A;  1HSE A;  2I0C A;  1D4N A;  3T9X B;  3PPP A;  4YZZ A;  4YB7 A;  2Y7P A;  3UP9 A;  3ECR A;  4QSD A;  4Z7E A;  4KQP A;  5IAI A;  4F22 A;  3TPA A;  1B5I A;  1FQB A;  1FW0 A;  4LON B;  4P0I A;  4G68 A;  5AA2 D;  3W9V A;  2WKY A;  1MXY A;  1XVY A;  3ILU B;  1YCJ A;  3PGF A;  1Y1Z A;  4R2F A;  4XKR A;  4MH5 A;  2AL4 A;  1M5E A;  3USD A;  3DEL B;  3Q26 A;  5L9M A;  2O68 A;  1BP5 A;  1L5T A;  1MH4 A;  1B3E A;  4PET A;  1O64 A;  4ONY A;  4PQJ A;  5AE4 A;  2W7Y A;  4OES A;  2F34 A;  2NOO A;  2OBG A;  3R26 A;  1MY3 A;  4IO3 A;  2XHD A;  3U92 A;  1ELJ A;  4F2Q A;  4KR5 A;  4DXB A;  1LCT A;  3Q25 A;  2Q8J A;  3RN8 A;  2P2A A;  1PBP A;  1GGG A;  3LBS A;  4GRK A;  4QFN A;  1JNF A;  1M5F A;  3PPN A;  2E0S A;  1HSJ A;  4NWC A;  4X1D A;  1R9L A;  2UYF A;  3C4M A;  2X26 A;  3IB0 A;  4JXI A;  2O84 X;  2FYI A;  3U8Q A;  4G8N A;  3H6V A;  4U4X A;  2RCB A;  4G4P A;  3RLF E;  2LAO A;  1Q1K A;  3CFZ A;  5ELV A;  4GL8 A;  3TMG A;  4AQ4 A;  2HQ0 A;  1B0L A;  1RYO A;  1VE4 A;  1B3F A;  5FTI A;  4LA9 A;  1SW2 A;  1NNP A;  3E3K A;  2I48 A;  5FTH A;  2YLN A;  1R1N A;  4GWO A;  1UIU A;  1NMU A;  3MVW A;  1N76 A;  4ELO A;  3ZSF A;  1D9V A;  3IX1 A;  4RK9 A;  3K6X A;  2O7I A;  4POW A;  4KCC A;  3H6U A;  4NF5 B;  4U1Z A;  1MXW A;  2P0S A;  3IOV A;  1ZMG A;  1B1X A;  4ISU A;  3V83 A;  2DWH A;  3I5O A;  4XXU A;  5H8F B;  5DYH A;  1JEV A;  2DXR A;  2XXH A;  3OSR A;  2GFE A;  3Q29 A;  3EHT A;  1M5B A;  2VOZ A;  4EQB A;  4POX A;  3U1O A;  1LAH E;  4U22 A;  1A40 A;  3QK6 A;  1FTJ A;  3CFL A;  1NH8 A;  5DVF A;  3SEY A;  1A8F A;  1MXV A;  1N3W A;  3KZG A;  2ONK E;  4ECF A;  3KEI A;  1NL5 A;  4TLL B;  3B6Q A;  1B32 A;  3TTK A;  3RTF B;  1Z7N E;  5ITO A;  3D4C A;  1B5H A;  4DXC A;  1DTZ A;  1DPP A;  4Q0C A;  4QF9 A;  5L9S A;  1I6B A;  2H25 A;  3Q27 A;  3HST A;  2DWJ A;  3TEP A;  2DSF A;  2XX9 A;  3FVK A;  3N94 A;  1URS A;  1N0T A;  5KZT A;  4PP0 A;  1B7H A;  2F35 A;  4FED A;  5B7D A;  3FJ7 A;  5AA3 A;  4JWY A;  1B9J A;  2OWT A;  3RPW A;  2O1M A;  3T9V A;  3OXN A;  4KYS A;  4HW8 A;  4IY5 A;  4PFY A;  4YKJ A;  2Q2A A;  2Z22 A;  4N13 A;  3PUV E;  3G3J A;  2XXQ A;  5L8D A;  1EH3 A;  2DE3 A;  3PU5 A;  3IK6 B;  4QRZ A;  3W9W A;  3QUJ A;  3IL1 B;  4E0X A;  5DVJ A;  3OEK A;  4H1X A;  3TCF A;  2D5W A;  3FAT A;  3SEX A;  4WEP A;  3PPR A;  2QPQ A;  1IEJ A;  2H4I A;  1TXF A;  2UXA A;  4THI A;  1QJM A;  5CBS A;  3TFL A;  5I59 A;  4H8I A;  4RXL A;  4X9T A;  4BDQ A;  4R2B A;  3QYT A;  2V3U A;  1ZU0 A;  4OVJ A;  4G8H A;  1P99 A;  1ZKB A;  3SKP A;  3K02 A;  3U72 A;  1T0K A;  3VLW A;  5H8S A; 
#chains in the Genus database with same CATH topology
 2VPN A;  4MF3 A;  3GYY A;  2XD3 A;  2MKZ A;  4MJO A;  4LAT A;  4I62 A;  1B58 A;  3OEN A;  4NMY A;  3IOU A;  2DWA A;  4MIJ A;  5EQA A;  2XXW A;  1PB7 A;  1A7L A;  4GWU A;  3PPO A;  4RNS A;  5F7V A;  2RC7 A;  2R8T A;  2GH9 A;  4F1V A;  4P1E A;  4F18 A;  3D4G A;  3T0J A;  5HBC A;  2PMS A;  2F3D A;  2I6E A;  4GWS A;  1B3H A;  1R9Q A;  1EYJ A;  4FAT A;  4OXV A;  4N07 A;  1Y3Q A;  4Q5T A;  1YAE A;  4F3B A;  5IGA A;  2Y7K A;  2YPN A;  3K4U A;  1IQ7 A;  4ZEK A;  3TOD A;  3HN0 A;  4RPO A;  2OWS A;  3UN6 A;  3IOW A;  1SYH A;  3OEM A;  1URG A;  1B51 A;  3CSG A;  3PTY A;  2ZNT A;  3KFM A;  4YKP A;  3OO7 A;  4O3C A;  3VLV A;  5IM2 A;  1PBQ A;  3MAM A;  1ZTY A;  2QJE A;  3KJ7 A;  2DE2 A;  4YAH X;  2Q8M A;  4UA8 A;  3FGS A;  1ZLQ A;  3GZG A;  5I58 B;  2V84 A;  4NX1 A;  4O94 A;  4RPN A;  4IGT A;  4NWD A;  2NWJ A;  4GOT A;  4F31 B;  4BDL A;  5DEX A;  1URD A;  3Q28 A;  4ZS9 A;  4OEN A;  3PMV A;  4KD5 A;  4ZED A;  1H76 A;  3MPK A;  3RT6 B;  2O7U A;  2A5T B;  3U93 A;  3O6H A;  3FJG A;  1LAF E;  3KN8 A;  2QRY A;  4GX3 A;  3PD9 A;  4MEV A;  1WOD A;  2ONR A;  5A5X A;  3VFJ A;  2UYE A;  4HE1 A;  3H6T A;  4P3L A;  3HV1 A;  5BWJ A;  2Y84 A;  3C34 A;  2M8C A;  2D3I A;  3UIF A;  1JEU A;  3S9N C;  1N84 A;  4YKK A;  1MQJ A;  3ROJ A;  3V8X B;  1XOC A;  1PB9 A;  4TOZ A;  3TKD A;  2FHY A;  1M5D A;  2PT2 A;  1YZ0 A;  1H43 A;  1Y4C A;  2V4C A;  2I0B A;  3TTN A;  5ICQ A;  2XD2 A;  1B46 A;  5K2Y A;  5H8F A;  4PTK A;  1B3L A;  4M1V A;  4NQ8 A;  2HCA A;  3GXA A;  2DDK A;  3N6T A;  5T3J A;  1CNQ A;  2F7B A;  1MPB A;  2X7Q A;  1B3G A;  4U21 A;  5DVI A;  4K3F A;  4N91 A;  3O66 A;  5KCJ B;  5I59 B;  4PDD A;  3IJO B;  3ZKK A;  3B8B A;  3WAE A;  4F3P A;  1LBW A;  1XVX A;  3VLU A;  3IFA A;  4TQU Q;  3PUZ E;  4L17 A;  2B3F A;  4IGR A;  4LVQ A;  5CBR A;  3EF7 A;  3N6U A;  3M3F A;  4FEB A;  2OK2 A;  4I8C A;  5JTY B;  3VDF A;  2PT1 A;  3G3I A;  2ZYN A;  4JVD A;  5I7I A;  4GFR A;  3FVG A;  5TU0 A;  3KBR A;  3KSX A;  2DWI A;  3OMB A;  3R6U A;  1PB8 A;  4C1T A;  3TQW A;  4EF2 A;  3EQ1 A;  2DXY A;  4QFL A;  5H8Q B;  4OFL A;  2QVU A;  5I2N A;  2DP8 A;  4N81 A;  3K6U A;  1FPF A;  5EQ8 A;  2HFB A;  4FE8 A;  4JDF A;  4KYE A;  3JYR A;  1FQF A;  3TDJ A;  1AIV A;  5I56 A;  1Z7M E;  1B6H A;  1IMB A;  4KI0 E;  1H45 A;  1MY0 A;  1JQF A;  4LZ5 A;  2BJI A;  3ODB A;  1I69 A;  2Y5L A;  3O6I A;  3RY3 A;  1B7U A;  2VGQ A;  1OQG A;  4OET A;  3DLN A;  1HSL A;  3RQT A;  3MP8 A;  2B65 A;  1I6A A;  3LV0 A;  3K6V A;  2HZL A;  4Q8R A;  1IIT A;  4DLD A;  2CEX A;  3IOR A;  2ALU A;  4DCX A;  1MG1 A;  1USY H;  3AXF A;  3FJM A;  4IO6 A;  3C9H A;  3PD8 A;  2I49 A;  4YIC A;  3C33 A;  5DEX B;  3IFC A;  3HO7 A;  2OX3 A;  1MXX A;  2QMX A;  4P11 A;  3MYU A;  2F8D A;  3UK4 A;  2H98 A;  4GBV A;  3TTL A;  1MDP 1;  4HTG A;  3DP4 A;  3PPQ A;  3OO6 A;  4HS7 A;  3MZB A;  4C1U A;  2NUV A;  4NF6 A;  1ATG A;  2HXR A;  1FBE A;  5A5X B;  1B1H A;  3THI A;  1PEB A;  3SET A;  4P8B A;  2F6P A;  4NF0 A;  2Z8E A;  1LAG E;  4QSE A;  1MM7 A;  2ZZW A;  3U94 A;  1N7X A;  1S7Y A;  1SQY A;  4KXP A;  3MVY A;  4EF1 A;  2ZZV A;  4BLA A;  2DOJ A;  1KA0 A;  4U1O A;  1FTL A;  3MUQ A;  4IY6 A;  3K0V A;  4NF4 A;  4OVT A;  3O29 A;  5FHN A;  3L6G A;  3FVN A;  1RDZ A;  3E79 A;  3V5A A;  3FD3 A;  1I6Q A;  3CVG A;  3H7M A;  1FPJ A;  2P3V A;  5CC2 A;  1MH3 A;  2REJ A;  4FEC A;  2RC9 A;  3MPL A;  2THI A;  4H67 A;  3VVE A;  3S2V A;  4RY1 A;  2P3N A;  1NH7 A;  4I3Y A;  1POY 1;  4ZE9 A;  1BLF A;  1LFG A;  3LSX A;  4F3S A;  2VD2 A;  2X7P A;  5TP9 B;  3B6W A;  3G3F A;  3OD7 A;  1GR2 A;  4GVO A;  3PMW A;  3E13 X;  1AMF A;  4HE0 A;  3CG1 A;  3EN3 A;  3BFU A;  5I58 A;  4H65 A;  4H6D A;  4MLQ A;  4GXS B;  5CMM A;  2R71 A;  2CEY A;  2XX8 A;  1B40 A;  4H46 A;  2Y7I A;  2PX1 A;  2A5T A;  5KDT A;  5EYF A;  5I5P A;  2H5Y A;  5DTB A;  2XWI A;  4BDO A;  4F1U A;  5I2N B;  4NTL A;  1FPI A;  3CR9 A;  3I3V A;  3TEL A;  3TUS A;  3BKI B;  4H8J A;  4BDN A;  3OEL A;  3KSJ A;  1QKA A;  3SES A;  4PFI A;  5L9O A;  4IR8 A;  2UVG A;  5IZ1 A;  2OZZ A;  4GX6 A;  1FPD A;  5I56 B;  1CE2 A;  4LQ2 A;  1NI9 A;  5ICT A;  4QSC A;  4DIG A;  5FBP A;  3RUM A;  3QXM A;  4N6P A;  1QUJ A;  3M3K A;  5AA1 A;  2UVH A;  3QSL A;  3MZ1 A;  3HHG A;  1O63 A;  1TT1 A;  4KYD A;  2A5S A;  1FBD A;  1D9Y A;  3K1P A;  3H6W A;  2B3B A;  1RKM A;  1OLC A;  2HEU A;  3CIJ A;  5JK4 A;  4IO7 A;  4AS5 A;  2WBB A;  3D1R A;  2QMW A;  2XX7 A;  1N04 A;  2VHA A;  3IAZ A;  4PAF A;  1NV5 A;  3UOR A;  3IJX B;  5KCJ A;  2ZYO A;  4G8M A;  1NNF A;  4GF8 A;  4BDR A;  4XTC Q;  4GLI A;  1MY4 A;  4LP2 B;  1GVC A;  1VFD A;  1MY1 A;  2QFL A;  4ESX A;  4R75 A;  3OOA A;  5I3S A;  2JJK A;  3CI8 A;  1IMF A;  3GBB A;  3TTR A;  4NF6 B;  1LBC A;  1MM6 A;  5JTY A;  1LGB C;  3LR1 A;  4O3B A;  1P1Q A;  4O8M A;  4XKN A;  2OJT A;  3QUF A;  3A09 A;  1P1U A;  4OER A;  4ELP A;  2VP1 A;  1NKX A;  2HAV A;  1FQA A;  3OSQ A;  2REG A;  4NG7 A;  2B4M A;  1Q35 A;  1JW5 A;  4OEU A;  3T22 A;  4I40 A;  3TYH A;  4NF4 B;  1WVJ A;  3HFU A;  4O3A A;  3TCG A;  1ZBM A;  2Q88 A;  3IO6 A;  2KLF A;  3K1M A;  4NF8 A;  1LLS A;  5H8Q A;  4NED A;  3T66 A;  1J1N A;  4OVS A;  2HHM A;  3RT8 A;  5CMC A;  2OWZ A;  2XXI A;  4AB5 A;  4OZ9 A;  2Z23 A;  3WAF A;  1LBB A;  2ZXT A;  3DP6 A;  4OVQ A;  3QAX A;  1AWB A;  4P9K A;  1VSO A;  2QVV A;  1DOT A;  3GLB A;  2E1S A;  4MNI A;  3E9X A;  3A3U A;  1MQD A;  3MWB A;  4JSO A;  1IXI A;  2RF1 A;  1YXI A;  3T1B A;  2VD3 A;  2YJP A;  4X1B A;  5EYH A;  1JVX A;  4LQ5 A;  4IO4 A;  2QS3 A;  3RGY A;  1BKA A;  4NAP A;  2XXY A;  2V93 A;  1AH5 A;  3R7X A;  2ZYM A;  4ZEB A;  1UQW A;  3O28 A;  4YMA A;  1FQD A;  4PFT A;  1NUZ A;  3K01 A;  3FUZ A;  5DT6 A;  5KDT B;  4U2R A;  2R6G E;  5EHS A;  3TCH A;  1P1O A;  1B4Z A;  1LB8 A;  1MY2 A;  1MQI A;  4X8R A;  4WXJ A;  3NOH A;  4IO5 A;  2L5V A;  1B05 A;  1OQH A;  5H8N A;  4F2O A;  3E78 A;  2GRV A;  4ND9 A;  3CFX A;  4TLM B;  2UVJ A;  3EHU A;  3B7D A;  3ZKL A;  3GBA A;  4P0G A;  4RYA A;  1IUD A;  3C32 A;  1EYI A;  4F3G A;  1FRP A;  5BUU A;  5A5L A;  4G68 C;  1GV8 A;  1N3X A;  3CSB A;  5CI5 A;  1FTK A;  2XXU A;  3KG2 A;  4F39 A;  4WKM A;  1FQE A;  1G0H A;  5HM4 B;  3S9E A;  5JEI A;  1DMB A;  5CMK A;  2ESN A;  2NXO A;  4XIG Q;  1SW1 A;  3P7I A;  4XKP A;  2V25 A;  2V3Q A;  1ZIU A;  2I3W A;  4QFO A;  2CZL A;  3S4U A;  1MXZ A;  4GD5 A;  1Y20 A;  1LFH A;  4EUO A;  1IXC A;  2FBP A;  1US4 A;  2WEF A;  1B2H A;  2DVC A;  5B70 A;  4MNP A;  2AIX A;  1FBF A;  2Z8F A;  1CB6 A;  3T96 B;  3DP8 A;  5LOM A;  4OWD A;  3PUW E;  2RIN A;  4ZE8 A;  2Z8D A;  3MVZ A;  3PUX E;  3SDF A;  5TP9 A;  1EU8 A;  3HHF A;  5DW8 A;  2FNC A;  2CZH A;  1KZ8 A;  4N17 A;  5HPQ A;  2QS4 A;  4MHF A;  4ZZA A;  3FXU A;  4PC9 A;  4RK2 A;  3PUY E;  4R6Y A;  1SW4 A;  2ZYK A;  3O2A A;  1Y9U A;  1USY E;  1FCK A;  4GWZ A;  4OHN A;  1FQC A;  2Q9T A;  1QW0 A;  3H03 A;  2XXX A;  3DM0 A;  2CZI A;  1IIW A;  4KFQ A;  4YB6 A;  2FVZ A;  2CZK A;  4NF8 B;  1XHY A;  3LSF B;  4MX6 A;  1Y3P A;  3SER A;  3FXQ A;  3H3G A;  4R73 A;  3K2D A;  1QVS A;  2HPG A;  4OYV A;  4HCW A;  2DS9 A;  1OVB A;  3TZA A;  3MW0 A;  4PCD A;  1OMP A;  1IZ1 A;  1MDQ A;  4YMB A;  1ANF A;  1FPK A;  3FAS A;  1AL3 A;  1MQG A;  3L6H A;  4LUB A;  5EQ9 A;  1Y3N A;  1NNT A;  3W15 C;  3LSW A;  4OFO A;  1MPD A;  2IEE A;  3JV9 A;  4ZEC A;  4EDP A;  4RA1 A;  3CHG A;  4OVR A;  5FHO A;  3BFT A;  2Q2C A;  3T9H B;  1LBV A;  1NNK A;  4PGP A;  1DCU A;  3U65 A;  2F6G A;  1M5C A;  3BIH A;  2D21 A;  2XXR A;  3HCQ A;  2KQZ A;  2ONS A;  1LAX A;  1RYX A;  3V89 B;  1INP A;  3JZJ A;  1MQH A;  5ISU A;  3EHS A;  3QIM A;  1UTH A;  3O9P A;  1RDX A;  4OTE A;  4JSD A;  1LFI A;  1BIY A;  3KGC A;  1DSN A;  2PCR A;  3H4Z A;  1IXG A;  2P1S A;  1B4H A;  2NVU B;  2G29 A;  5H8N B;  1DBZ A;  5LDZ A;  4X48 A;  3TTM A;  4ELR A;  4OQO A;  1JP4 A;  4KCD A;  4FIM A;  3H06 B;  2PYY A;  1LBZ A;  4H45 A;  2ZMB A;  1SDX A;  3OO8 A;  1JVY A;  3PMX A;  2BJJ X;  1NFT A;  4F19 A;  2H9B A;  4LZ7 A;  5EHM A;  1FSA A;  3A3C A;  1UTB B;  3C36 A;  3CG3 A;  4X04 A;  2F5X A;  4H0W A;  4E0W A;  1DPE A;  4DI3 D;  4QFP A;  5AA2 A;  2PFY A;  3B6T A;  1KA1 A;  4N15 A;  5AA4 B;  1SBP A;  1NUY A;  1OIB A;  2B4L A;  5ET8 A;  4G77 A;  2HXW A;  5I2K A;  1XC1 A;  4PE5 B;  1SVX B;  2O51 A;  2QSX A;  4XKQ A;  4BDM A;  3UA8 A;  4C0R A;  3K6W A;  3T93 B;  3TAJ A;  2OCU A;  1P1W A;  3N26 A;  1S9T A;  4YKI A;  3N5L A;  4MBP A;  2QS1 A;  4WED A;  1LEV A;  2RKM A;  4P1L A;  2ABH A;  3RNN A;  3MQ9 A;  3MP6 A;  4PFR A;  3MVX A;  2DE4 A;  1LB9 A;  3O6G A;  5H8H A;  1MPC A;  3KBZ A;  1YYZ A;  2F7A A;  3BIG A;  2F97 A;  3K00 A;  4R9F A;  4DXU A;  3G3G A;  4QXD A;  1VFE A;  4PFW A;  1FPL A;  2DYX A;  3MP1 A;  4R74 A;  4G68 B;  5ITP A;  4PFU A;  4QFK A;  1TFA A;  3FV2 A;  3BBR A;  4NHB A;  2PBW A;  3UGW A;  3VV5 A;  1PDA A;  3TQL A;  2AYS A;  2WX9 A;  4GIZ A;  2UVI A;  3VXB A;  3OO9 A;  2ZNS A;  4IB2 A;  3VXC A;  4N6K A;  1LCF A;  4R6K A;  3QMF A;  5CM6 A;  2ZNU A;  2GHB A;  5I57 A;  1EZ9 A;  1QUI A;  2H99 A;  1N7W A;  4I1D A;  3K1N A;  4U23 A;  1H3D A;  1JW4 A;  3O97 A;  1VDW A;  1UIV A;  3KJT A;  5K2X A;  4R9G A;  4ELQ A;  3FVO A;  5TPA A;  3G3K A;  1FBC A;  4GXA A;  4I9D A;  4EQ7 A;  1FPB A;  1JW1 A;  2I4C A;  2O1L A;  4LN5 A;  3RPL A;  2O69 A;  3SEU A;  1XS5 A;  4PFB A;  1SPI A;  2V3T A;  3ISP A;  4GWW A;  2ANJ A;  5CMB A;  1SW5 A;  1TFD A;  3MBP A;  3G7W A;  2RCA A;  3KOT A;  2XWV A;  1D9Q A;  1NV0 A;  4H5G A;  1BK4 A;  1EZP A;  4UAC A;  3I6V A;  2Y7W A;  1TWY A;  3KC1 A;  3S9L C;  4PBH A;  4OEV A;  4R6H A;  1UTH B;  3F11 A;  2XXT A;  5IKB A;  2G93 A;  1SI0 A;  3KOS A;  1QUL A;  4PGN A;  4H5F A;  2XXK A;  4EXK A;  2HZK A;  1POT A;  1WDN A;  3IOT A;  5IZ3 A;  1XI6 A;  4Q30 B;  3MC2 A;  4IO2 A;  4ZZE A;  4PDH A;  1SI1 A;  2CMO A;  3A29 A;  3C35 A;  1Y4T A;  3KN3 A;  4JBZ A;  1FPG A;  1KWH A;  1IXH A;  4XFE A;  1OVT A;  4NE4 A;  2Y7R A;  3LUZ A;  2OLB A;  2IA4 A;  3IB1 A;  4JB7 A;  2I4B A;  5EYG A;  2XXV A;  4ZDM A;  1K9Y A;  3M3L A;  1R6Z A;  1B52 A;  3VE1 B;  1SD3 A;  4FJP A;  4MFI A;  5AA2 B;  4DE8 A;  1XT8 A;  2QL3 A;  1A99 A;  4Z0I A;  3B50 A;  4GWX A;  3MZ9 A;  2QVR A;  4M4G A;  5I2K B;  4DDD A;  3G3H A;  2FA7 A;  5ET5 A;  1GTK A;  4OVP A;  3RTW B;  3LC8 A;  5FHM A;  1FTA A;  4KPT A;  4F29 A;  3LSL A;  2PVU A;  4HCY A;  5J1D A;  4P47 A;  4PBQ A;  1SYI A;  2R9J A;  2RC8 A;  2GHA A;  1BTJ A;  2F7C A;  4GX4 A;  5F24 A;  1MS7 A;  1FTM A;  2F3B A;  1QUK A;  5H8H B;  1B0H A;  1MXU A;  1LST A;  3ONM A;  1YPN A;  3IB2 A;  5J16 A;  3EPE A;  1JET A;  1B7Z A;  3M8U A;  1DTG A;  1LBX A;  1QKB A;  1A8E A;  4MLV A;  4NGU A;  3T9U A;  3EKI A;  1VR5 A;  1D3K A;  2HAU A;  3S9M C;  5IZZ A;  4RJZ A;  1FTO A;  3SEW A;  1NUW A;  1H44 A;  2F78 A;  5F1Q A;  4ESW A;  4YB5 A;  3C31 A;  4EQ9 A;  1IME A;  3PV0 E;  3ILT B;  1A54 A;  3ZS6 A;  1YTV A;  5ET6 A;  4LZ8 A;  5I57 B;  2WBD A;  1MRP A;  1F9B A;  2Q89 A;  3VVD A;  1K9Z A;  5LTC A;  1B5J A;  2XWO A;  2QS2 A;  1AOV A;  1Q9D A;  4JWO A;  4F1Y A;  3FZV A;  2I58 A;  3VVF A;  4OFJ A;  4GQO A;  2O6A A;  1OLA A;  4N4U A;  1DK4 A;  3LUY A;  5TPA B;  4GL0 A;  3FIR A;  3SEV A;  4I3E A;  2XXP A;  5CRY A;  1ZJL A;  1EZO A;  3IO4 A;  3FXR A;  3RPL B;  4G2Z A;  1A55 A;  3FV1 A;  4PE3 A;  1Y1M A;  1US5 A;  4DZ1 A;  4U4S A;  4OMB A;  4ZEF A;  1UTB A;  1PC3 A;  2F36 A;  4NF5 A;  3MJN A;  2DQV A;  4R72 A;  3KN7 A;  2AL5 A;  1IMC A;  5I84 A;  1II5 A;  1S50 A;  4O7M A;  4FOR A;  2I3V A;  5AA4 A;  1O7T A;  3HPI A;  5M2V A;  1FBH A;  3CRB A;  4YU0 A;  3IR1 A;  4JWX A;  4QHQ A;  3E4R A;  4ZEI A;  2WYP A;  4AB6 A;  4FAJ A;  1P1N A;  4DCY A;  4KHZ E;  4EXL A;  4HE2 A;  2DVZ A;  1HSE A;  5IZ3 B;  2I0C A;  1D4N A;  3T9X B;  3PPP A;  4YZZ A;  4YB7 A;  2Y7P A;  3UP9 A;  3ECR A;  4QSD A;  4Z7E A;  1FBG A;  4KQP A;  5IAI A;  4F22 A;  1FPE A;  4PF6 A;  3TPA A;  1B5I A;  4G61 A;  1FQB A;  1FW0 A;  4LON B;  1NV3 A;  4P0I A;  4G68 A;  5AA2 D;  3W9V A;  2WKY A;  4XEQ A;  1FBP A;  1MXY A;  1XVY A;  3ILU B;  1YCJ A;  3PGF A;  1Y1Z A;  4JVI A;  4OAN A;  4R2F A;  4XKR A;  4MH5 A;  2AL4 A;  1M5E A;  3USD A;  3DEL B;  3Q26 A;  5L9M A;  2O68 A;  1BP5 A;  1L5T A;  5ESY A;  1MH4 A;  4QBA A;  1B3E A;  4PET A;  1O64 A;  4ONY A;  4PQJ A;  5AE4 A;  2W7Y A;  2ZZX A;  2F34 A;  2NOO A;  4HXV A;  3SZP A;  2OBG A;  3R26 A;  1MY3 A;  3RYD A;  4IO3 A;  2XHD A;  1RDY A;  3U92 A;  1ELJ A;  4F2Q A;  4KR5 A;  4DXB A;  1LCT A;  3Q25 A;  2Q8J A;  3RN8 A;  2XA5 A;  2P2A A;  1PBP A;  1GGG A;  3LBS A;  4GRK A;  2PFZ A;  4QFN A;  3FBP A;  4UAB A;  1JNF A;  1M5F A;  3PPN A;  2E0S A;  1HSJ A;  1IMA A;  4NWC A;  4X1D A;  1R9L A;  2UYF A;  3C4M A;  2X26 A;  3IB0 A;  4JXI A;  2O84 X;  2FYI A;  3U8Q A;  4G8N A;  3H6V A;  4U4X A;  2RCB A;  5ET7 A;  4G4P A;  4PAK A;  3RLF E;  2LAO A;  1Q1K A;  3CFZ A;  5ELV A;  4GL8 A;  3TMG A;  4AQ4 A;  2HQ0 A;  1B0L A;  1RYO A;  1VE4 A;  1B3F A;  5FTI A;  2VPO A;  4LA9 A;  1SW2 A;  1NNP A;  2Y5K A;  3E3K A;  2I48 A;  5FTH A;  2KR0 A;  2YLN A;  1R1N A;  4N6D A;  2Q74 A;  4GWO A;  1G0I A;  1UIU A;  1NMU A;  3MVW A;  1N76 A;  4ELO A;  3ZSF A;  1D9V A;  1NV1 A;  3IX1 A;  4RK9 A;  3K6X A;  2O7I A;  4POW A;  4KCC A;  3H6U A;  4NF5 B;  4U1Z A;  1MXW A;  2P0S A;  3IOV A;  1ZMG A;  1FJ6 A;  1B1X A;  4ISU A;  3V83 A;  2DWH A;  3I5O A;  4XXU A;  5H8F B;  5DYH A;  1JEV A;  3KC0 A;  4N8Y A;  2DXR A;  2XXH A;  3OSR A;  4MNC A;  1FJ9 A;  2GFE A;  3Q29 A;  3EHT A;  5EQ7 A;  1M5B A;  2VOZ A;  4EQB A;  4POX A;  3U1O A;  1LAH E;  4U22 A;  1A40 A;  3QK6 A;  5H8S A;  1FTJ A;  3CFL A;  1NH8 A;  5DVF A;  3SEY A;  1A8F A;  1MXV A;  1N3W A;  3KZG A;  2ONK E;  4ECF A;  3KEI A;  1NL5 A;  4TLL B;  3B6Q A;  1B32 A;  1NV2 A;  3TTK A;  3RTF B;  1Z7N E;  5ITO A;  3D4C A;  2VT5 A;  1B5H A;  3MST A;  4DXC A;  1DTZ A;  1DPP A;  4Q0C A;  4QF9 A;  3FXB A;  5L9S A;  1I6B A;  2H25 A;  4AS4 A;  4NN3 A;  3Q27 A;  3HST A;  2DWJ A;  3TEP A;  2DSF A;  2XX9 A;  3FVK A;  3N94 A;  1URS A;  1N0T A;  5KZT A;  4PP0 A;  1B7H A;  2F35 A;  4FED A;  4MCO A;  5B7D A;  3FJ7 A;  2GQ1 A;  5AA3 A;  4JWY A;  1B9J A;  2OWT A;  3RPW A;  2O1M A;  4XF5 A;  4PAI A;  4O7I A;  4OA4 A;  3T9V A;  1QGX A;  3OXN A;  4KYS A;  4HW8 A;  4FBP A;  2FIX A;  1NV7 A;  1NUX A;  4IY5 A;  4PFY A;  4YKJ A;  2Q2A A;  2Z22 A;  4N13 A;  4MMP A;  4P56 A;  3PUV E;  3G3J A;  4GWY A;  4JVC A;  2XXQ A;  5L8D A;  1LBY A;  1EH3 A;  1IMD A;  2DE3 A;  3PU5 A;  3IK6 B;  4QRZ A;  3W9W A;  3QUJ A;  3IL1 B;  4E0X A;  5DVJ A;  3OEK A;  4H1X A;  3TCF A;  2D5W A;  3FAT A;  3SEX A;  4WEP A;  3PPR A;  1NV6 A;  2QPQ A;  1IEJ A;  2H4I A;  1TXF A;  2UXA A;  4DI4 B;  4THI A;  1QJM A;  4PF8 A;  5CBS A;  2FIE A;  3TFL A;  5I59 A;  4N8G A;  4H8I A;  4RXL A;  4X9T A;  4MAG A;  2XWK A;  4BDQ A;  4R2B A;  2WYK A;  3QYT A;  2V3U A;  4OVJ A;  1ZU0 A;  1EYK A;  4GBW A;  4G8H A;  1P99 A;  1NV4 A;  1ZKB A;  3SKP A;  3K02 A;  3U72 A;  1T0K A;  3VLW A;  4OES A; 
#chains in the Genus database with same CATH homology
 4MF3 A;  2XD3 A;  4LAT A;  4I62 A;  1B58 A;  3OEN A;  4NMY A;  3IOU A;  2DWA A;  2XXW A;  1PB7 A;  1A7L A;  3PPO A;  4RNS A;  5F7V A;  2RC7 A;  2GH9 A;  4F1V A;  4F18 A;  3D4G A;  5HBC A;  2PMS A;  2I6E A;  1B3H A;  1R9Q A;  4FAT A;  4OXV A;  4N07 A;  1Y3Q A;  4Q5T A;  1YAE A;  4F3B A;  2Y7K A;  2YPN A;  3K4U A;  1IQ7 A;  4ZEK A;  3TOD A;  3HN0 A;  4RPO A;  2OWS A;  3UN6 A;  3IOW A;  1SYH A;  3OEM A;  1URG A;  1B51 A;  3CSG A;  2ZNT A;  3KFM A;  4YKP A;  3OO7 A;  4O3C A;  3VLV A;  1PBQ A;  3MAM A;  1ZTY A;  2QJE A;  3KJ7 A;  2DE2 A;  4YAH X;  4UA8 A;  3FGS A;  1ZLQ A;  3GZG A;  5I58 B;  2V84 A;  4RPN A;  4IGT A;  4NWD A;  2NWJ A;  4GOT A;  4F31 B;  4BDL A;  5DEX A;  1URD A;  3Q28 A;  4ZS9 A;  4OEN A;  3PMV A;  4KD5 A;  4ZED A;  1H76 A;  3MPK A;  3RT6 B;  2O7U A;  2A5T B;  3U93 A;  3O6H A;  3FJG A;  1LAF E;  3KN8 A;  2QRY A;  3PD9 A;  1WOD A;  2ONR A;  5A5X A;  3VFJ A;  2UYE A;  3H6T A;  3HV1 A;  5BWJ A;  2Y84 A;  3C34 A;  2M8C A;  2D3I A;  3UIF A;  1JEU A;  3S9N C;  1N84 A;  4YKK A;  1MQJ A;  3V8X B;  1XOC A;  1PB9 A;  4TOZ A;  3TKD A;  1M5D A;  2PT2 A;  1H43 A;  1Y4C A;  3TTN A;  2I0B A;  5ICQ A;  2XD2 A;  1B46 A;  5K2Y A;  5H8F A;  1B3L A;  4M1V A;  2HCA A;  3GXA A;  3N6T A;  2F7B A;  2X7Q A;  1MPB A;  1B3G A;  4U21 A;  5DVI A;  4K3F A;  3O66 A;  5KCJ B;  5I59 B;  3IJO B;  3ZKK A;  3WAE A;  4F3P A;  1XVX A;  3VLU A;  4TQU Q;  3PUZ E;  4L17 A;  2B3F A;  4IGR A;  4LVQ A;  5CBR A;  3EF7 A;  3N6U A;  3M3F A;  4FEB A;  2OK2 A;  4I8C A;  5JTY B;  3VDF A;  2PT1 A;  3G3I A;  2ZYN A;  4GFR A;  3FVG A;  5TU0 A;  3KBR A;  3KSX A;  2DWI A;  3OMB A;  3R6U A;  1PB8 A;  4C1T A;  3TQW A;  4EF2 A;  3EQ1 A;  2DXY A;  4QFL A;  5H8Q B;  4OFL A;  5I2N A;  2DP8 A;  3K6U A;  2HFB A;  4FE8 A;  4JDF A;  4KYE A;  3JYR A;  1FQF A;  3TDJ A;  1AIV A;  5I56 A;  1Z7M E;  1B6H A;  4KI0 E;  1H45 A;  1MY0 A;  1JQF A;  4LZ5 A;  3ODB A;  1I69 A;  3O6I A;  3RY3 A;  1B7U A;  2VGQ A;  1OQG A;  4OET A;  3DLN A;  1HSL A;  3RQT A;  2B65 A;  1I6A A;  3MP8 A;  3K6V A;  2HZL A;  4Q8R A;  1IIT A;  4DLD A;  3IOR A;  2ALU A;  4DCX A;  1MG1 A;  1USY H;  3AXF A;  3FJM A;  4IO6 A;  3C9H A;  3PD8 A;  2I49 A;  4YIC A;  3C33 A;  5DEX B;  3HO7 A;  1MXX A;  2QMX A;  4P11 A;  2F8D A;  3UK4 A;  2H98 A;  3TTL A;  1MDP 1;  4HTG A;  3DP4 A;  3PPQ A;  3OO6 A;  4HS7 A;  3MZB A;  4C1U A;  2NUV A;  4NF6 A;  1ATG A;  5A5X B;  1B1H A;  3THI A;  1PEB A;  3SET A;  2F6P A;  2Z8E A;  1LAG E;  4QSE A;  1MM7 A;  3U94 A;  1N7X A;  1S7Y A;  1SQY A;  3MVY A;  4EF1 A;  4BLA A;  2DOJ A;  4U1O A;  1FTL A;  3MUQ A;  4IY6 A;  3K0V A;  4NF4 A;  3O29 A;  5FHN A;  3L6G A;  3FVN A;  3V5A A;  3FD3 A;  1I6Q A;  3CVG A;  3H7M A;  5CC2 A;  1MH3 A;  2REJ A;  4FEC A;  2RC9 A;  3MPL A;  2THI A;  4H67 A;  3VVE A;  3S2V A;  4RY1 A;  1NH7 A;  1POY 1;  4ZE9 A;  1BLF A;  1LFG A;  3LSX A;  4F3S A;  2VD2 A;  2X7P A;  5TP9 B;  3B6W A;  3G3F A;  3OD7 A;  1GR2 A;  4GVO A;  3PMW A;  3E13 X;  1AMF A;  3CG1 A;  3EN3 A;  3BFU A;  5I58 A;  4H65 A;  4H6D A;  4MLQ A;  4GXS B;  5CMM A;  2R71 A;  2XX8 A;  1B40 A;  2Y7I A;  2PX1 A;  2A5T A;  5KDT A;  5EYF A;  2H5Y A;  5DTB A;  4F1U A;  4BDO A;  5I2N B;  4NTL A;  3CR9 A;  3I3V A;  3TEL A;  3TUS A;  3BKI B;  4H8J A;  4BDN A;  3OEL A;  3KSJ A;  1QKA A;  3SES A;  5L9O A;  2UVG A;  2OZZ A;  5I56 B;  1CE2 A;  4LQ2 A;  5ICT A;  4QSC A;  4DIG A;  3RUM A;  3QXM A;  4N6P A;  1QUJ A;  3M3K A;  5AA1 A;  2UVH A;  3QSL A;  3MZ1 A;  3HHG A;  1O63 A;  1TT1 A;  4KYD A;  2A5S A;  1D9Y A;  3K1P A;  3H6W A;  2B3B A;  1RKM A;  1OLC A;  2HEU A;  3CIJ A;  5JK4 A;  4IO7 A;  2QMW A;  2XX7 A;  1N04 A;  2VHA A;  3IAZ A;  3UOR A;  3IJX B;  5KCJ A;  2ZYO A;  4G8M A;  1NNF A;  4GF8 A;  4BDR A;  4XTC Q;  4GLI A;  1MY4 A;  4LP2 B;  1GVC A;  1VFD A;  1MY1 A;  4ESX A;  4R75 A;  3OOA A;  3CI8 A;  3GBB A;  3TTR A;  4NF6 B;  1LBC A;  1MM6 A;  5JTY A;  1LGB C;  3LR1 A;  4O3B A;  1P1Q A;  4XKN A;  2OJT A;  3QUF A;  3A09 A;  1P1U A;  4OER A;  4ELP A;  2VP1 A;  1NKX A;  2HAV A;  1FQA A;  3OSQ A;  2REG A;  1Q35 A;  1JW5 A;  4OEU A;  3T22 A;  3TYH A;  4NF4 B;  1WVJ A;  4O3A A;  3TCG A;  1ZBM A;  2Q88 A;  3IO6 A;  2KLF A;  3K1M A;  4NF8 A;  1LLS A;  5H8Q A;  4NED A;  3T66 A;  1J1N A;  3RT8 A;  5CMC A;  2XXI A;  4AB5 A;  4OZ9 A;  2Z23 A;  3WAF A;  1LBB A;  2ZXT A;  3DP6 A;  3QAX A;  1VSO A;  1DOT A;  3GLB A;  2E1S A;  3E9X A;  3A3U A;  1MQD A;  3MWB A;  4JSO A;  1IXI A;  2RF1 A;  2VD3 A;  2YJP A;  4X1B A;  1JVX A;  4LQ5 A;  4IO4 A;  2QS3 A;  3RGY A;  1BKA A;  2XXY A;  2V93 A;  1AH5 A;  3R7X A;  2ZYM A;  4ZEB A;  1UQW A;  3O28 A;  4YMA A;  1FQD A;  4PFT A;  3K01 A;  3FUZ A;  5DT6 A;  5KDT B;  4U2R A;  2R6G E;  5EHS A;  3TCH A;  1P1O A;  1B4Z A;  1LB8 A;  1MY2 A;  1MQI A;  4WXJ A;  4IO5 A;  1B05 A;  1OQH A;  5H8N A;  4F2O A;  2GRV A;  4ND9 A;  3CFX A;  4TLM B;  2UVJ A;  3EHU A;  3B7D A;  3ZKL A;  3GBA A;  4P0G A;  4RYA A;  1IUD A;  3C32 A;  4F3G A;  5BUU A;  4G68 C;  1GV8 A;  1N3X A;  3CSB A;  5CI5 A;  1FTK A;  2XXU A;  3KG2 A;  4F39 A;  4WKM A;  1FQE A;  5HM4 B;  3S9E A;  5JEI A;  1DMB A;  5CMK A;  2ESN A;  2NXO A;  4XIG Q;  1SW1 A;  3P7I A;  4XKP A;  2V25 A;  2V3Q A;  1ZIU A;  2I3W A;  4QFO A;  2CZL A;  3S4U A;  1MXZ A;  4GD5 A;  1Y20 A;  1LFH A;  4EUO A;  1IXC A;  1US4 A;  1B2H A;  2DVC A;  5B70 A;  2AIX A;  2Z8F A;  1CB6 A;  3T96 B;  3DP8 A;  5LOM A;  4OWD A;  3PUW E;  2RIN A;  4ZE8 A;  2Z8D A;  3MVZ A;  3PUX E;  3SDF A;  5TP9 A;  1EU8 A;  3HHF A;  2FNC A;  5HPQ A;  2QS4 A;  4ZZA A;  3FXU A;  4RK2 A;  3PUY E;  4R6Y A;  1SW4 A;  2ZYK A;  3O2A A;  1Y9U A;  1USY E;  1FCK A;  4OHN A;  1FQC A;  2Q9T A;  1QW0 A;  3H03 A;  2XXX A;  3DM0 A;  1IIW A;  4KFQ A;  4YB6 A;  4NF8 B;  1XHY A;  3LSF B;  1Y3P A;  3SER A;  3FXQ A;  3H3G A;  4R73 A;  3K2D A;  1QVS A;  4OYV A;  4HCW A;  2DS9 A;  1OVB A;  3TZA A;  3MW0 A;  1OMP A;  1IZ1 A;  1MDQ A;  4YMB A;  1ANF A;  3FAS A;  1AL3 A;  1MQG A;  3L6H A;  4LUB A;  1Y3N A;  1NNT A;  3W15 C;  4ZEC A;  3LSW A;  1MPD A;  2IEE A;  3JV9 A;  4OFO A;  4EDP A;  4RA1 A;  5FHO A;  3BFT A;  2Q2C A;  3T9H B;  1NNK A;  2F6G A;  1M5C A;  2D21 A;  2XXR A;  3HCQ A;  2ONS A;  1LAX A;  1RYX A;  3V89 B;  3JZJ A;  1MQH A;  5ISU A;  3EHS A;  3QIM A;  1UTH A;  3O9P A;  4OTE A;  4JSD A;  1LFI A;  1BIY A;  3KGC A;  1DSN A;  3H4Z A;  1IXG A;  2P1S A;  1B4H A;  2NVU B;  2G29 A;  5H8N B;  4X48 A;  3TTM A;  4ELR A;  4OQO A;  4KCD A;  4FIM A;  3H06 B;  2PYY A;  2ZMB A;  1SDX A;  3OO8 A;  1JVY A;  3PMX A;  2BJJ X;  1NFT A;  4F19 A;  2H9B A;  4LZ7 A;  5EHM A;  3A3C A;  1UTB B;  3C36 A;  3CG3 A;  2F5X A;  4H0W A;  4E0W A;  1DPE A;  4QFP A;  5AA2 A;  3B6T A;  5AA4 B;  1SBP A;  1OIB A;  4G77 A;  2HXW A;  5I2K A;  1XC1 A;  4PE5 B;  1SVX B;  2O51 A;  2QSX A;  4XKQ A;  4BDM A;  3UA8 A;  4C0R A;  3K6W A;  3T93 B;  3TAJ A;  2OCU A;  1P1W A;  3N26 A;  1S9T A;  4YKI A;  3N5L A;  4MBP A;  2QS1 A;  4WED A;  2RKM A;  2ABH A;  3RNN A;  3MQ9 A;  3MP6 A;  3MVX A;  2DE4 A;  1LB9 A;  3O6G A;  5H8H A;  1MPC A;  2F7A A;  4R9F A;  3K00 A;  2F97 A;  4DXU A;  3G3G A;  1VFE A;  4PFW A;  2DYX A;  3MP1 A;  4R74 A;  4G68 B;  5ITP A;  4PFU A;  4QFK A;  1TFA A;  3FV2 A;  3BBR A;  2PBW A;  3UGW A;  3VV5 A;  1PDA A;  3TQL A;  2AYS A;  4GIZ A;  2UVI A;  3VXB A;  3OO9 A;  2ZNS A;  4IB2 A;  3VXC A;  1LCF A;  4R6K A;  5CM6 A;  2ZNU A;  2GHB A;  5I57 A;  1EZ9 A;  1QUI A;  2H99 A;  1N7W A;  4I1D A;  3K1N A;  4U23 A;  1H3D A;  1JW4 A;  3O97 A;  1UIV A;  3KJT A;  5K2X A;  4R9G A;  4ELQ A;  3FVO A;  5TPA A;  3G3K A;  4GXA A;  4I9D A;  4EQ7 A;  1JW1 A;  2I4C A;  2O1L A;  2O69 A;  3SEU A;  1XS5 A;  2V3T A;  2ANJ A;  5CMB A;  1SW5 A;  1TFD A;  3MBP A;  3G7W A;  2RCA A;  3KOT A;  4H5G A;  1EZP A;  4UAC A;  3I6V A;  2Y7W A;  1TWY A;  3S9L C;  4OEV A;  4R6H A;  1UTH B;  3F11 A;  2XXT A;  5IKB A;  2G93 A;  1SI0 A;  3KOS A;  1QUL A;  4H5F A;  4EXK A;  2HZK A;  1POT A;  1WDN A;  3IOT A;  4Q30 B;  3MC2 A;  4IO2 A;  4ZZE A;  1SI1 A;  2CMO A;  3C35 A;  1Y4T A;  3KN3 A;  4JBZ A;  1KWH A;  1IXH A;  1OVT A;  4NE4 A;  2Y7R A;  2OLB A;  2IA4 A;  3IB1 A;  4JB7 A;  2I4B A;  2XXV A;  4ZDM A;  3M3L A;  1R6Z A;  1B52 A;  3VE1 B;  1SD3 A;  4FJP A;  4MFI A;  5AA2 B;  4DE8 A;  1XT8 A;  2QL3 A;  1A99 A;  4Z0I A;  3MZ9 A;  4M4G A;  5I2K B;  4DDD A;  3G3H A;  2FA7 A;  1GTK A;  3RTW B;  3LC8 A;  5FHM A;  4KPT A;  4F29 A;  3LSL A;  2PVU A;  4HCY A;  5J1D A;  1SYI A;  2R9J A;  2RC8 A;  2GHA A;  1BTJ A;  2F7C A;  1MS7 A;  1FTM A;  1QUK A;  5H8H B;  1B0H A;  1MXU A;  1LST A;  3ONM A;  1YPN A;  3IB2 A;  3EPE A;  1JET A;  1B7Z A;  3M8U A;  1DTG A;  1QKB A;  1A8E A;  4MLV A;  3T9U A;  1VR5 A;  1D3K A;  2HAU A;  3S9M C;  4RJZ A;  1FTO A;  3SEW A;  1H44 A;  2F78 A;  5F1Q A;  4ESW A;  4YB5 A;  3C31 A;  4EQ9 A;  3PV0 E;  3ILT B;  1A54 A;  3ZS6 A;  1YTV A;  4LZ8 A;  5I57 B;  1MRP A;  1F9B A;  2Q89 A;  3VVD A;  1B5J A;  2QS2 A;  1AOV A;  4JWO A;  4F1Y A;  3FZV A;  2I58 A;  3VVF A;  4OFJ A;  4GQO A;  2O6A A;  1OLA A;  3LUY A;  5TPA B;  4GL0 A;  3FIR A;  3SEV A;  2XXP A;  5CRY A;  1ZJL A;  1EZO A;  3IO4 A;  3FXR A;  4G2Z A;  1A55 A;  3FV1 A;  1Y1M A;  1US5 A;  4DZ1 A;  4U4S A;  4OMB A;  4ZEF A;  1UTB A;  1PC3 A;  2F36 A;  4NF5 A;  3MJN A;  2DQV A;  4R72 A;  3KN7 A;  2AL5 A;  5I84 A;  1II5 A;  1S50 A;  4FOR A;  2I3V A;  5AA4 A;  1O7T A;  3HPI A;  5M2V A;  3CRB A;  4YU0 A;  3IR1 A;  4JWX A;  4QHQ A;  3E4R A;  4ZEI A;  4AB6 A;  4FAJ A;  1P1N A;  4DCY A;  4KHZ E;  4EXL A;  2DVZ A;  1HSE A;  2I0C A;  1D4N A;  3T9X B;  3PPP A;  4YZZ A;  4YB7 A;  2Y7P A;  3UP9 A;  3ECR A;  4QSD A;  4Z7E A;  4KQP A;  5IAI A;  4F22 A;  3TPA A;  1B5I A;  1FQB A;  1FW0 A;  4LON B;  4P0I A;  4G68 A;  5AA2 D;  3W9V A;  2WKY A;  1MXY A;  1XVY A;  3ILU B;  1YCJ A;  3PGF A;  1Y1Z A;  4R2F A;  4XKR A;  4MH5 A;  2AL4 A;  1M5E A;  3USD A;  3DEL B;  3Q26 A;  5L9M A;  2O68 A;  1BP5 A;  1L5T A;  1MH4 A;  1B3E A;  4PET A;  1O64 A;  4ONY A;  4PQJ A;  5AE4 A;  2W7Y A;  4OES A;  2F34 A;  2NOO A;  2OBG A;  3R26 A;  1MY3 A;  4IO3 A;  2XHD A;  3U92 A;  1ELJ A;  4F2Q A;  4KR5 A;  4DXB A;  1LCT A;  3Q25 A;  2Q8J A;  3RN8 A;  2P2A A;  1PBP A;  1GGG A;  3LBS A;  4GRK A;  4QFN A;  1JNF A;  1M5F A;  3PPN A;  2E0S A;  1HSJ A;  4NWC A;  4X1D A;  1R9L A;  2UYF A;  3C4M A;  2X26 A;  3IB0 A;  4JXI A;  2O84 X;  2FYI A;  3U8Q A;  4G8N A;  3H6V A;  4U4X A;  2RCB A;  4G4P A;  3RLF E;  2LAO A;  1Q1K A;  3CFZ A;  5ELV A;  4GL8 A;  3TMG A;  4AQ4 A;  2HQ0 A;  1B0L A;  1RYO A;  1VE4 A;  1B3F A;  5FTI A;  4LA9 A;  1SW2 A;  1NNP A;  3E3K A;  2I48 A;  5FTH A;  2YLN A;  1R1N A;  4GWO A;  1UIU A;  1NMU A;  3MVW A;  1N76 A;  4ELO A;  3ZSF A;  1D9V A;  3IX1 A;  4RK9 A;  3K6X A;  2O7I A;  4POW A;  4KCC A;  3H6U A;  4NF5 B;  4U1Z A;  1MXW A;  2P0S A;  3IOV A;  1ZMG A;  1B1X A;  4ISU A;  3V83 A;  2DWH A;  3I5O A;  4XXU A;  5H8F B;  5DYH A;  1JEV A;  2DXR A;  2XXH A;  3OSR A;  2GFE A;  3Q29 A;  3EHT A;  1M5B A;  2VOZ A;  4EQB A;  4POX A;  3U1O A;  1LAH E;  4U22 A;  1A40 A;  3QK6 A;  1FTJ A;  3CFL A;  1NH8 A;  5DVF A;  3SEY A;  1A8F A;  1MXV A;  1N3W A;  3KZG A;  2ONK E;  4ECF A;  3KEI A;  1NL5 A;  4TLL B;  3B6Q A;  1B32 A;  3TTK A;  3RTF B;  1Z7N E;  5ITO A;  3D4C A;  1B5H A;  4DXC A;  1DTZ A;  1DPP A;  4Q0C A;  4QF9 A;  5L9S A;  1I6B A;  2H25 A;  3Q27 A;  3HST A;  2DWJ A;  3TEP A;  2DSF A;  2XX9 A;  3FVK A;  3N94 A;  1URS A;  1N0T A;  5KZT A;  4PP0 A;  1B7H A;  2F35 A;  4FED A;  5B7D A;  3FJ7 A;  5AA3 A;  4JWY A;  1B9J A;  2OWT A;  3RPW A;  2O1M A;  3T9V A;  3OXN A;  4KYS A;  4HW8 A;  4IY5 A;  4PFY A;  4YKJ A;  2Q2A A;  2Z22 A;  4N13 A;  3PUV E;  3G3J A;  2XXQ A;  5L8D A;  1EH3 A;  2DE3 A;  3PU5 A;  3IK6 B;  4QRZ A;  3W9W A;  3QUJ A;  3IL1 B;  4E0X A;  5DVJ A;  3OEK A;  4H1X A;  3TCF A;  2D5W A;  3FAT A;  3SEX A;  4WEP A;  3PPR A;  2QPQ A;  1IEJ A;  2H4I A;  1TXF A;  2UXA A;  4THI A;  1QJM A;  5CBS A;  3TFL A;  5I59 A;  4H8I A;  4RXL A;  4X9T A;  4BDQ A;  4R2B A;  3QYT A;  2V3U A;  1ZU0 A;  4OVJ A;  4G8H A;  1P99 A;  1ZKB A;  3SKP A;  3K02 A;  3U72 A;  1T0K A;  3VLW A;  5H8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...