1TFDA

High-resolution x-ray studies on rabbit serum transferrin: preliminary structure analysis of the n-terminal half-molecule at 2.3 angstroms resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
299
structure length
294
Chain Sequence
VRWCAVNDHEASKCANFRDSMKKVLPEDGPRIICVKKASYLDCIKAIAAHEADAVTLDAGLVHEAGLTPNNLKPVVAEFYGSKENPKTFYYAVALVKKGSNFQLNELQGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVASFFSGSCVPCADQLCQLCPGCGCSSSQPYFGYSGAFKCLKDGLGDVAFVKQETIFENLPSKDERDQYELLCLDNTRKPVDEYEQCHLARVPSHAVVARSVDGKEDLIWELLNQAQEHFGKDKSGDFQLFSSPHGKNLLFKDSAYGFFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFERRIN
publication title High-Resolution X-Ray Studies on Rabbit Serum Transferrin: Preliminary Structure Analysis of the N-Terminal Half-Molecule at 2.3 Angstroms Resolution
pubmed rcsb
source organism Oryctolagus cuniculus
molecule tags Iron transport protein
total genus 67
structure length 294
sequence length 299
ec nomenclature
pdb deposition date 1990-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1tfdA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1tfdA02
1NMUA 3PMVA 4FIMA 4QHQA 5F7VA 3OO9A 3TTRA 2Y7PA 3CFXA 1FTJA 1SYIA 3MVWA 3CSGA 2PMSA 3TTNA 2QMXA 2F6GA 5CI5A 3W15C 4OXVA 3Q27A 4NF5B 1FW0A 3CG3A 3K1NA 3MP8A 3CFZA 4LVQA 4RK9A 1JETA 1UIUA 1YPNA 4IB2A 2P1SA 5I2KB 3K01A 4GXAA 4ND9A 3LR1A 3OO6A 3CI8A 5M2VA 2ZNUA 1M5EA 2RC8A 1MXZA 3VLUA 1H3DA 1URGA 4C0RA 1D9YA 3G3IA 4OESA 3HHGA 3C31A 4GL0A 3V89B 1URDA 3GXAA 1B40A 3RPWA 4MH5A 4NEDA 2G29A 2ANJA 5HBCA 4ELPA 2QPQA 4H8IA 1QVSA 3RN8A 3VDFA 1QW0A 4GF8A 3P7IA 4F1VA 1AIVA 4ISUA 4TLMB 1P1UA 1MQDA 1MXUA 4WXJA 1IZ1A 5JK4A 5DTBA 4KYSA 3RY3A 4I8CA 2I58A 1SW1A 3BFUA 2D3IA 3HN0A 3DELB 3FATA 4Q8RA 4LQ5A 3OSQA 4NF5A 1Z7NE 1B3LA 5H8HB 5JTYB 3U72A 2KLFA 2DE3A 5FTIA 2F7BA 5I2KA 4FEDA 2F5XA 4IY6A 4JWOA 1IXHA 2BJJX 1FQFA 4PFWA 3VVDA 4HCWA 3ZSFA 3V83A 3E13X 1LAGE 1XS5A 4YICA 1LB9A 4EQBA 4YU0A 4F2QA 3EHTA 3S4UA 1OLCA 1S50A 4WEDA 4GFRA 5LOMA 4JSOA 2CZLA 1MQJA 3H6TA 1S9TA 4OMBA 3KN7A 1OMPA 2VD2A 2XXIA 3PUWE 3TFLA 3SERA 3TUSA 3G3FA 1JW1A 3C35A 1LCFA 2DWJA 4K3FA 3KJTA 1P99A 2O69A 3TDJA 2HFBA 4GQOA 1TWYA 4DZ1A 3O6GA 4U2RA 1Y20A 2R71A 1B3EA 4M4GA 3FXUA 3SEVA 5FHOA 1GGGA 3OSRA 4NF4B 2OCUA 3R7XA 5H8HA 5JTYA 4ZEDA 1B52A 5DVJA 4WKMA 3RTFB 1B7UA 1FTOA 4ESXA 5KDTB 4R6HA 4OHNA 2AL5A 3N5LA 1HSJA 1ZJLA 1MDQA 2IEEA 1MPDA 4ELOA 4BDRA 4FORA 2PVUA 1US5A 3VLVA 4QSEA 1B0HA 3M3FA 3H3GA 3PGFA 1B7ZA 1P1OA 5F1QA 4H5GA 1SD3A 3W9WA 4LA9A 1JVXA 3K6XA 2VD3A 5AA2D 4LQ2A 1ZIUA 4MBPA 2QSXA 1LLSA 2I3VA 1US4A 2DVZA 3W9VA 4R75A 3IB0A 4E0WA 1N04A 1PBQA 4X1BA 1IIWA 2UVJA 4OZ9A 5L9SA 2UYEA 1SDXA 1MQIA 3TCGA 3GBAA 4RJZA 4XXUA 4P0GA 3VXBA 3U1OA 2GRVA 3CR9A 3MZ1A 4LONB 4R74A 1EZPA 2GH9A 4KPTA 4F22A 1QKBA 3H6UA 2I49A 1Y9UA 1N7WA 5AA1A 1A99A 2RF1A 3A09A 2ONSA 4NF4A 3WAFA 1DTGA 5CBRA 2H5YA 3V5AA 5CMBA 1MG1A 1N76A 1M5CA 2HQ0A 3V8XB 1SBPA 3IAZA 1SW4A 5KDTA 1JW5A 1VFEA 2F7AA 2B65A 1POY1 4MLQA 3QAXA 2H99A 3MW0A 1B6HA 2PBWA 3GZGA 5L8DA 4POXA 3TTMA 3MC2A 4F3GA 2PYYA 3QSLA 4OETA 3ODBA 1DOTA 2O1LA 3FVOA 2R9JA 3U8QA 2B3FA 2YJPA 5I58B 4F1YA 1GTKA 3TTLA 3T9HB 3EQ1A 3A3UA 4ZDMA 2QS3A 2VOZA 3N6UA 5H8QB 3OO7A 5AA4B 3EPEA 5TU0A 1F9BA 4RNSA 4HCYA 4IO6A 2QL3A 3HV1A 4KYDA 3Q28A 3VVFA 4C1TA 3TCFA 1SI1A 3K4UA 4PP0A 3QK6A 4G77A 4DIGA 4YB6A 1TFAA 1S7YA 3Q25A 4F3BA 3QXMA 1GVCA 1IQ7A 1N3XA 4R9FA 1FTKA 2UXAA 2OWTA 2QRYA 2E1SA 4ONYA 1LGBC 2CMOA 4GXSB 2I48A 3SEUA 5I59B 4EDPA 3SEWA 5ELVA 1B5JA 1I6AA 3JZJA 3OO8A 3G3JA 3MJNA 2XXRA 4F29A 3LSLA 1R9LA 4YB5A 5I58A 1BIYA 4OEUA 1O63A 3S9NC 1OIBA 4P11A 1SYHA 3O2AA 1A54A 5DYHA 1R6ZA 3K6UA 2HAUA 5H8QA 1OQHA 4JWYA 2FNCA 5AA4A 3HSTA 4H1XA 4P0IA 2XXYA 2NUVA 2ZYNA 5ITOA 1II5A 3S9MC 3KGCA 4H8JA 4PETA 1BKAA 1SW5A 4XKNA 4PE5B 2W7YA 3PPQA 4BDMA 2F78A 1Z7ME 4PQJA 4OEVA 1CE2A 1M5FA 4OFJA 4Z0IA 1RKMA 2YLNA 1LBBA 1QUJA 1B4HA 3USDA 4RXLA 5I59A 3SESA 3SDFA 2Y7WA 2DWIA 1LSTA 4HTGA 1JEVA 1H45A 1OVBA 4R6YA 1PC3A 1NNFA 2YPNA 5CMKA 3OEMA 1B51A 1O7TA 4DCYA 1Y3PA 3QIMA 3PV0E 3MVXA 4XKQA 5K2YA 1BTJA 5AA2B 3E9XA 1URSA 2E0SA 2O6AA 3C33A 4F19A 1JQFA 1MQHA 2OLBA 3JV9A 3ECRA 1FQDA 2F35A 2HXWA 4GD5A 3PUXE 2Y7RA 1H44A 1LFHA 5TP9B 3UGWA 4HW8A 3K6WA 4R2BA 2ZYKA 2OK2A 1VE4A 4MF3A 1FTLA 1MPCA 2XHDA 3FVGA 3O6IA 1BP5A 2OBGA 3MAMA 2DP8A 1UIVA 3Q26A 4EUOA 1ELJA 2I0CA 3RT8A 3MVZA 1UTBB 2ALUA 3C36A 3FUZA 5DVIA 3F11A 1LAFE 1MDP1 2RC9A 5KZTA 3THIA 3MP6A 1Y3NA 3T66A 2G93A 2AL4A 2HCAA 4JSDA 1IXCA 3FJ7A 1H76A 2NWJA 2F97A 2HAVA 2H98A 3D4CA 3H6WA 1MH4A 4X48A 2XXXA 3UA8A 5AA2A 2XXHA 2LAOA 1TFDA 3N94A 1J1NA 4G2ZA 2X7QA 3T9UA 5EYFA 5I2NA 4JB7A 2OWSA 1NNPA 3DM0A 1NNKA 1USYH 2DE2A 4BDNA 5TP9A 4EF1A 2M8CA 1GV8A 3L6GA 4KR5A 1YCJA 1CB6A 5B7DA 3H7MA 3L6HA 4YB7A 1QUIA 2XD2A 1USYE 4AB6A 1ZLQA 3FXQA 2UVIA 2DQVA 1XVYA 4L17A 1Q1KA 3CSBA 1LFIA 1Y1ZA 1LAXA 1UTBA 3CG1A 3TCHA 2O51A 4THIA 2X7PA 2ZYMA 1LB8A 4TOZA 3RNNA 1UTHB 3CFLA 3KEIA 3BKIB 1B9JA 4GLIA 3BFTA 3LBSA 1P1QA 1VSOA 1M5DA 4QFNA 4LZ8A 4FE8A 5FHMA 4OFOA 5ISUA 5HPQA 3LUYA 2ZMBA 1EZOA 3FVNA 3GLBA 3TELA 3PD9A 3VFJA 1YAEA 3UORA 3KOSA 3O97A 3DP6A 5ICQA 2ZNTA 3T93B 4OWDA 1FTMA 4U1OA 4H6DA 1NNTA 3O6HA 3TQLA 1QJMA 5K2XA 1A40A 2O68A 2ZXTA 3C32A 1PBPA 2A5SA 3KBRA 5DEXB 3G3HA 1B3HA 1P1NA 4AQ4A 4HS7A 2DWHA 4QFPA 3S9LC 3RGYA 3JYRA 1MPBA 2XXUA 1SI0A 4JWXA 3IOUA 3MP1A 4ZE9A 2IA4A 1A55A 1IXGA 3K1PA 3U94A 3TMGA 4OTEA 3M3LA 1UTHA 3TQWA 3B6WA 1ATGA 4KFQA 2WKYA 2PT1A 3OENA 2DOJA 2ESNA 3I3VA 3KJ7A 3OD7A 3O29A 2F34A 4G68B 2UVHA 3TAJA 4F31B 1TT1A 3E4RA 4U1ZA 3IOTA 2Z8FA 4DDDA 1LBCA 2GFEA 3MZBA 2GHBA 3GBBA 3MBPA 1MY4A 1Y4CA 1IITA 3CRBA 4FEBA 1WODA 2XXWA 4R9GA 5KCJB 4OYVA 5CRYA 2Q89A 1SW2A 5BWJA 2HZLA 2XXTA 3A3CA 3MWBA 3KSJA 1ZKBA 1BLFA 1MY1A 4Z7EA 5DEXA 4BDQA 2A5TB 3ZKLA 1LAHE 3IJOB 3H6VA 3TEPA 2DE4A 3S2VA 1MS7A 2B3BA 3I6VA 1HSEA 2V25A 3TKDA 5B70A 3KG2A 2QMWA 1D3KA 4NF8B 2HEUA 3ILUB 2QS1A 5ICTA 3G3KA 4GVOA 1PB7A 1VFDA 4EXKA 4QFLA 4BLAA 1Y1MA 3UP9A 4C1UA 1JVYA 2NXOA 4ZEBA 4XKPA 4G68A 2PX1A 1P1WA 3QUJA 3SEXA 3PMWA 3EN3A 4JBZA 3LSXA 4Q30B 1ZMGA 4KYEA 3IX1A 1YTVA 3BBRA 3PPRA 2H4IA 4KCDA 1FQBA 4QRZA 3PD8A 4QFKA 4IY5A 3LSFB 4EQ7A 1FQCA 4N07A 1D9VA 5KCJA 1AH5A 4YMBA 4ZEKA 4LZ5A 2O84X 4EQ9A 2RCBA 4GIZA 3CVGA 3IO6A 1PB9A 2NVUB 3KN8A 4ZS9A 3HCQA 2Y7KA 2A5TA 3SEYA 3HHFA 1MH3A 4YKPA 4GWOA 1H43A 3E3KA 1FQEA 2THIA 5H8NB 3RUMA 5CMCA 2UVGA 4YKKA 2ONKE 4NF8A 4G8MA 2XX7A 4IO2A 3IR1A 4H5FA 4QF9A 4MFIA 2P0SA 2I4CA 3C34A 3QUFA 3PMXA 3FD3A 3DP8A 3DLNA 2V3QA 4RYAA 1XHYA 1GR2A 2XD3A 4YKJA 1IUDA 4I62A 4BDLA 4NWCA 4G8NA 3TTKA 5CC2A 1HSLA 3IORA 3K6VA 1B5IA 2H25A 4NWDA 3SKPA 3RQTA 2F7CA 2RC7A 3TZAA 2V84A 5EHMA 1L5TA 2V93A 2REJA 2Z8EA 2Q2CA 1DPPA 2DYXA 5AA3A 1M5BA 1R9QA 1A8FA 2V3UA 4E0XA 2AYSA 5TPAB 3H4ZA 4WEPA 3FJMA 5FHNA 5L9OA 1I69A 3UN6A 5CBSA 4POWA 1EU8A 1MM7A 3PUZE 2O7IA 4ZEIA 2VHAA 5H8NA 3C9HA 4R6KA 3EHUA 4GOTA 1QULA 1MXXA 4FAJA 4EXLA 5A5XB 3K0VA 2HZKA 3FV1A 5I2NB 4Q0CA 5DT6A 4YZZA 1PB8A 1WDNA 3IB2A 1D4NA 3IK6B 5FTHA 4FECA 4OFLA 4GRKA 1PDAA 2NOOA 4JDFA 5AE4A 1ZU0A 3N26A 1DMBA 3VE1B 4X9TA 4ZE8A 3U93A 4I9DA 3IJXB 1NH8A 3FGSA 1PEBA 1SVXB 2Q8JA 4XKRA 3MPKA 4G68C 3OEKA 3IB1A 3FXRA 3HPIA 1MY0A 1R1NA 4DLDA 4EF2A 5TPAA 3Q29A 4G8HA 3MZ9A 2XXPA 2XXQA 3G3GA 2I6EA 2F6PA 2RCAA 1FCKA 4ESWA 4G4PA 1XT8A 3RT6B 4MLVA 5I56B 1B5HA 1Y4TA 1A7LA 4YMAA 4F3PA 4FJPA 1DTZA 2FA7A 3O9PA 5A5XA 1MXWA 1FQAA 4U22A 3VXCA 3MPLA 3QYTA 5IKBA 4KHZE 4PFYA 2D5WA 2ABHA 3M8UA 1SQYA 1B4ZA 4IGTA 4DE8A 2I3WA 2Y7IA 3IOWA 4KCCA 1XC1A 1N84A 4QSDA 2V3TA 1LCTA 3H06B 3R26A 4IGRA 2DWAA 1T0KA 2P2AA 3UIFA 3LSWA 4OQOA 2DS9A 4ZECA 3S9EA 3T96B 2D21A 3OOAA 1O64A 3CIJA 3FIRA 1TXFA 3K02A 1B58A 4U23A 2Q2AA 3TODA 4NMYA 3PU5A 4LATA 4OVJA 2O7UA 4Q5TA 2DXYA 3MVYA 1WVJA 1Y3QA 5H8FB 1IEJA 4N6PA 2F8DA 3DP4A 4XTCQ 4UACA 2Q88A 2R6GE 1MY2A 3KFMA 4KI0E 1N7XA 5I56A 3H03A 4PFTA 2ZNSA 1VR5A 1ZBMA 4BDOA 2XX8A 5J1DA 5HM4B 1XOCA 2XXVA 1B3GA 1B1HA 3T9XB 4LUBA 3VV5A 3C4MA 1DPEA 5IAIA 2XX9A 1OVTA 2UYFA 3T9VA 1N0TA 1B7HA 3D4GA 4YKIA 5CM6A 4AB5A 3R6UA 4UA8A 4LZ7A 1B3FA 2Z8DA 1RYXA 2GHAA 3UK4A 4M1VA 1JW4A 2RINA 3I5OA 1MRPA 1IXIA 5I84A 1OLAA 2DSFA 1POTA 5H8FA 3PUVE 3MQ9A 4ELQA 3FASA 4F18A 1QUKA 3O66A 3PPOA 4H0WA 1AMFA 2O1MA 3T22A 2QS4A 1NFTA 3FJGA 1B0LA 2REGA 3TYHA 4U21A 3MUQA 1ZTYA 2X26A 1MXYA 4NE4A 2RKMA 4ELRA 4U4SA 1KWHA 1ANFA 1NL5A 2PT2A 1I6BA 3KZGA 3B7DA 3IL1B 2H9BA 1LFGA 3O28A 3K00A 4R72A 4RPNA 4ZEFA 2I0BA 4NF6B 2F36A 3HO7A 1JEUA 3U92A 1MXVA 4RPOA 3IOVA 3PPNA 1EZ9A 3K1MA 3FVKA 2DVCA 1I6QA 2ONRA 1MY3A 1B05A 1NH7A 4DXUA 2FYIA 3KOTA 1RYOA 2OJTA 3KSXA 1MM6A 5DVFA 4QFOA 3ILTB 3AXFA 1AOVA 4ZZEA 4OENA 5JEIA 3ZS6A 1OQGA 3G7WA 5BUUA 3PUYE 3FZVA 1XVXA 3IO4A 3M3KA 2QS2A 4I1DA 4TLLB 2I4BA 1A8EA 1B32A 3OMBA 4ZZAA 3B6QA 4XIGQ 2ZYOA 3RLFE 4F1UA 5CMMA 4R2FA 1Q35A 4O3CA 3PPPA 4F2OA 4TQUQ 1B46A 1UQWA 5I57B 5L9MA 1B1XA 4IO7A 3ONMA 4JXIA 3FV2A 4YAHX 3ZKKA 4NF6A 1DSNA 3VVEA 4IO5A 4KD5A 2DXRA 3LC8A 4DXCA 4IO3A 3TPAA 3SETA 4KQPA 4O3AA 4X1DA 5ITPA 4U4XA 4PFUA 4RY1A 1AL3A 3KN3A 4F3SA 4H65A 3VLWA 2QJEA 4R73A 1NKXA 4QSCA 3EF7A 3B6TA 2Y84A 2OZZA 4ECFA 2Z23A 5H8SA 2VGQA 4H67A 2AIXA 4F39A 1QKAA 3EHSA 4DXBA 3N6TA 4RA1A 4RK2A 1B2HA 4LP2B 4O3BA 4OERA 2Q9TA 1JNFA 3RTWB 4NTLA 4FATA 3OXNA 2Z22A 5EHSA 5I57A 3K2DA 4DCXA 1N3WA 3WAEA 4N13A 2VP1A 1EH3A 4GL8A 3OELA 4IO4A 1MQGA
chains in the Genus database with same CATH superfamily
1NMUA 3PMVA 4FIMA 4QHQA 5F7VA 3OO9A 3TTRA 2Y7PA 3LV0A 3CFXA 1AWBA 1FTJA 1SYIA 3MVWA 3CSGA 2PMSA 2Y5LA 1KZ8A 3TTNA 2QMXA 2F6GA 5CI5A 3W15C 4OXVA 3Q27A 4NF5B 5ET8A 1FW0A 3CG3A 4N6DA 3K1NA 3MP8A 3CFZA 4LVQA 4RK9A 1JETA 1UIUA 1YPNA 4IB2A 4MNPA 2P1SA 5I2KB 4N4UA 3K01A 4GXAA 4ND9A 3LR1A 3OO6A 5EQAA 3CI8A 5M2VA 2ZNUA 1M5EA 2RC8A 1MXZA 1IMEA 3VLUA 2Q74A 1H3DA 1URGA 4C0RA 1D9YA 1FPLA 3G3IA 4OESA 3HHGA 3C31A 4GL0A 3V89B 4PAIA 1URDA 3GXAA 1B40A 4GX3A 3RPWA 2WBDA 4MH5A 4NEDA 2G29A 2ANJA 5HBCA 4P56A 1FBCA 4ELPA 2QPQA 4H8IA 1QVSA 4N8GA 1FPKA 3RN8A 3VDFA 1QW0A 4GF8A 3P7IA 4F1VA 1AIVA 4ISUA 4TLMB 4PE3A 1P1UA 1MQDA 1MXUA 4WXJA 1IZ1A 5JK4A 2HPGA 4KYSA 5DTBA 3RY3A 4I8CA 1DBZA 2I58A 1SW1A 3BFUA 2D3IA 3HN0A 3DELB 3FATA 5IGAA 4Q8RA 4LQ5A 5I3SA 3OSQA 4NF5A 4OANA 1Z7NE 1B3LA 5H8HB 5JTYB 3U72A 2KLFA 2DDKA 2DE3A 5FTIA 3T1BA 2F7BA 4PAFA 5I2KA 4FEDA 2F5XA 4IY6A 4JWOA 1IXHA 2BJJX 4I3YA 1FQFA 4PFWA 3VVDA 2KQZA 4HCWA 4P47A 3ZSFA 3V83A 3E13X 1LAGE 1XS5A 4YICA 1LB9A 4EQBA 2XA5A 4YU0A 3RPLB 4F2QA 3EHTA 3S4UA 1OLCA 2FIXA 1S50A 4WEDA 4GFRA 5LOMA 4JSOA 2CZLA 1MQJA 3H6TA 1S9TA 4OMBA 5EQ7A 4GWXA 4MNCA 3KN7A 1OMPA 2VD2A 2XXIA 3PUWE 3TFLA 3SERA 3TUSA 3G3FA 3BIHA 1JW1A 3C35A 1LCFA 1EYIA 2DWJA 4K3FA 3KJTA 1P99A 1NI9A 2O69A 3TDJA 3GYYA 2HFBA 4GQOA 4JVDA 1TWYA 4MCOA 4DZ1A 3O6GA 4U2RA 1Y20A 2R71A 1B3EA 4M4GA 5I7IA 3FXUA 3SEVA 1DCUA 1GGGA 5FHOA 4NF4B 3OSRA 4HXVA 2OCUA 3R7XA 5H8HA 5JTYA 4ZEDA 1B52A 5DVJA 4WKMA 3RTFB 1B7UA 1FTOA 4ESXA 5KDTB 4R6HA 4OHNA 2AL5A 3N5LA 1HSJA 1ZJLA 1MDQA 2IEEA 1MPDA 4ELOA 2B4MA 2PFZA 4BDRA 4FORA 2PVUA 1XI6A 1US5A 3VLVA 4QSEA 5DW8A 1B0HA 3M3FA 4KXPA 3H3GA 3PGFA 1B7ZA 1FSAA 3RPLA 1P1OA 5F1QA 4H5GA 1SD3A 3W9WA 4LA9A 1JVXA 3K6XA 2VD3A 5AA2D 4LQ2A 1ZIUA 4MBPA 2QSXA 1LLSA 2I3VA 1US4A 5ET5A 2DVZA 3W9VA 4R75A 3IB0A 4E0WA 1N04A 4PFIA 1PBQA 4X1BA 1IIWA 4OA4A 3HFUA 2F3BA 2UVJA 4OZ9A 5L9SA 2UYEA 1SDXA 1MQIA 3TCGA 3GBAA 4RJZA 4XXUA 4P0GA 3VXBA 3U1OA 2GRVA 4MJOA 2WBBA 3CR9A 3MZ1A 4LONB 4R74A 1EZPA 4NGUA 2GH9A 4OVPA 3NOHA 4KPTA 4F22A 1QKBA 3H6UA 1DK4A 2I49A 1Y9UA 1N7WA 4PFBA 4GWZA 5AA1A 1A99A 2RF1A 3A09A 1FPIA 2ONSA 4NF4A 3WAFA 1DTGA 5CBRA 2H5YA 3V5AA 5CMBA 1MG1A 1IMCA 1N76A 1M5CA 2HQ0A 3V8XB 1SBPA 3IAZA 1SW4A 5KDTA 1NV1A 1JW5A 1VFEA 2F7AA 2B65A 1K9YA 1POY1 4N6KA 4MLQA 3QAXA 2F3DA 2H99A 2WYKA 3MW0A 1B6HA 2PBWA 3GZGA 5L8DA 4POXA 4MNIA 3TTMA 3MC2A 3CHGA 4F3GA 1IMFA 2PYYA 3QSLA 4OETA 1RDZA 3ODBA 1DOTA 2O1LA 3FVOA 2R9JA 3U8QA 2B3FA 2YJPA 5I58B 4F1YA 1GTKA 3TTLA 2HXRA 3T9HB 3EQ1A 3A3UA 4ZDMA 2QS3A 2VOZA 4PF6A 3N6UA 5ET6A 5H8QB 3OO7A 4H46A 5AA4B 2BJIA 3EPEA 5TU0A 1F9BA 4RNSA 4HCYA 4IO6A 2QL3A 3HV1A 4KYDA 3Q28A 3VVFA 5I5PA 4C1TA 3TCFA 3D1RA 2GQ1A 1SI1A 3K4UA 2P3NA 4PP0A 3QK6A 4G77A 4JVCA 4DIGA 4YB6A 1TFAA 1S7YA 3Q25A 4F3BA 3QXMA 1GVCA 1IQ7A 1N3XA 4HE1A 4R9FA 1FTKA 2UXAA 1FBHA 2OWTA 2FIEA 2QRYA 2E1SA 4ONYA 1LGBC 2CMOA 4GXSB 2I48A 3SEUA 5I59B 4EDPA 3SEWA 5ELVA 1B5JA 1I6AA 3JZJA 3OO8A 1FBDA 4XEQA 4PFRA 3G3JA 3MJNA 2XXRA 4F29A 3LSLA 1R9LA 2ZZVA 4YB5A 5I58A 1BIYA 4OEUA 1O63A 3S9NC 4GBWA 1OIBA 5T3JA 4P11A 1SYHA 3O2AA 1YZ0A 1A54A 4XFEA 5DYHA 1R6ZA 3K6UA 2HAUA 2QFLA 5H8QA 1OQHA 4JWYA 2FNCA 5AA4A 3HSTA 4H1XA 1FPEA 4P0IA 4GWWA 2XXYA 2NUVA 2ZYNA 5ITOA 1II5A 2R8TA 3S9MC 3KGCA 4H8JA 4N17A 4PETA 1BKAA 1SW5A 4XKNA 4PE5B 2W7YA 3PPQA 4BDMA 2F78A 1BK4A 1FJ9A 3IFAA 4PDHA 1Z7ME 4PQJA 4OEVA 1CE2A 1M5FA 4OFJA 4Z0IA 1RKMA 2YLNA 1LBBA 1QUJA 5EYGA 1B4HA 3USDA 4RXLA 5I59A 3SESA 3SDFA 2Y7WA 2DWIA 1LSTA 4HTGA 1JEVA 1H45A 4PBQA 1OVBA 4R6YA 1PC3A 1NNFA 2YPNA 4P8BA 2L5VA 5CMKA 3OEMA 1B51A 2FVZA 1O7TA 4DCYA 1Y3PA 3QIMA 2Y5KA 3PV0E 3MVXA 4XKQA 5K2YA 1BTJA 3E9XA 5AA2B 1URSA 2E0SA 2O6AA 3C33A 4F19A 1JQFA 1MQHA 2OLBA 3JV9A 3ECRA 4HE0A 4AS4A 1FQDA 2F35A 2HXWA 4GD5A 1G0HA 3PUXE 4PF8A 2Y7RA 1H44A 1LFHA 5TP9B 3UGWA 4HW8A 3K6WA 4R2BA 2ZYKA 2OK2A 1VE4A 4MF3A 1FTLA 1MPCA 2B4LA 2XHDA 3FVGA 3O6IA 1BP5A 1LBXA 2OBGA 3MAMA 2DP8A 1UIVA 4GX4A 4NQ8A 3Q26A 4OVTA 4EUOA 1ELJA 2I0CA 3RT8A 3MVZA 1UTBB 2ALUA 3C36A 3FUZA 5DVIA 3F11A 1LAFE 1MDP1 2RC9A 5KZTA 3THIA 3MP6A 1Y3NA 3T66A 2G93A 2AL4A 2HCAA 4JSDA 1IXCA 3FJ7A 1H76A 2NWJA 2F97A 2HAVA 2H98A 3D4CA 3H6WA 1MH4A 4X48A 2XXXA 3UA8A 5AA2A 2XXHA 2LAOA 1TFDA 3N94A 1J1NA 4G2ZA 1RDXA 2X7QA 3T9UA 5EYFA 1QGXA 5I2NA 4JB7A 4MIJA 1FBGA 2OWSA 1NNPA 3DM0A 1NNKA 2XWIA 1USYH 4X8RA 2DE2A 4BDNA 4H45A 5TP9A 3FBPA 4EF1A 1NUZA 2M8CA 1GV8A 3L6GA 4KR5A 1YCJA 1NUWA 1CB6A 5B7DA 3H7MA 3L6HA 4YB7A 3IFCA 1IMDA 1QUIA 1LBWA 2XD2A 1USYE 4AB6A 1ZLQA 3FXQA 2ZZWA 2UVIA 2DQVA 1XVYA 4L17A 4PGPA 1Q1KA 3CSBA 1LFIA 1Y1ZA 1LAXA 1UTBA 3CG1A 3TCHA 2O51A 4THIA 2X7PA 3KC0A 2ZYMA 1LB8A 4TOZA 3RNNA 1UTHB 3CFLA 3KEIA 2XWOA 2VT5A 3BKIB 1B9JA 4GLIA 4N15A 3BFTA 3LBSA 1P1QA 1VSOA 1M5DA 4QFNA 2VPNA 4LZ8A 4PTKA 4FE8A 3B8BA 4PCDA 5FHMA 4OFOA 5ISUA 5HPQA 1NV2A 3LUYA 2ZMBA 1EZOA 3FVNA 3GLBA 3TELA 3PD9A 3VFJA 1YAEA 4GBVA 3UORA 3KOSA 3O97A 3DP6A 4AS5A 5ICQA 2ZNTA 3T93B 4OWDA 3PTYA 1FTMA 4U1OA 4H6DA 1NNTA 3O6HA 3TQLA 4MAGA 1QJMA 5K2XA 1A40A 2O68A 2ZXTA 3C32A 1PBPA 2A5SA 3KBRA 5DEXB 3G3HA 1B3HA 1P1NA 4AQ4A 1NV4A 4HS7A 2DWHA 4DI4B 3EKIA 4QFPA 3S9LC 1D9QA 3RGYA 3JYRA 1MPBA 2XXUA 1SI0A 4JWXA 3IOUA 3MP1A 4ZE9A 2IA4A 2WX9A 1A55A 1IXGA 5A5LA 3K1PA 3U94A 3TMGA 1IMBA 4OTEA 3M3LA 1UTHA 3TQWA 5EQ8A 3B6WA 1ATGA 4KFQA 2WKYA 4O8MA 2PT1A 3OENA 2DOJA 2ESNA 3I3VA 3KJ7A 3OD7A 3O29A 2F34A 4G68B 2UVHA 3TAJA 4F31B 1TT1A 3E4RA 4U1ZA 3IOTA 5FBPA 4O7IA 1LBVA 1KA1A 1FPDA 2Z8FA 4DDDA 1LBCA 2GFEA 3MZBA 2GHBA 2P3VA 3GBBA 3MBPA 1MY4A 1Y4CA 1IITA 3CRBA 4FEBA 1WODA 2PCRA 5J16A 2XXWA 4R9GA 5KCJB 4OYVA 5CRYA 2Q89A 1SW2A 5BWJA 2HZLA 2XXTA 3A3CA 3MWBA 3KSJA 1ZKBA 1BLFA 1MY1A 4Z7EA 5DEXA 4BDQA 2A5TB 3ZKLA 2WEFA 1LAHE 2XWVA 3IJOB 3H6VA 3TEPA 2DE4A 3S2VA 1MS7A 2B3BA 3I6VA 4QBAA 1LEVA 1HSEA 2V25A 3TKDA 3E79A 1KA0A 5B70A 3KG2A 2QMWA 4GWYA 1D3KA 4NF8B 2HEUA 3ILUB 2QS1A 5ICTA 3G3KA 4GVOA 1PB7A 1VFDA 4EXKA 4QFLA 4BLAA 1Y1MA 3UP9A 4C1UA 4N81A 4P9KA 1JVYA 3SZPA 2NXOA 4ZEBA 4XKPA 1Q9DA 4G68A 2PX1A 4QXDA 1P1WA 3QUJA 3SEXA 3PMWA 3EN3A 4JBZA 3LSXA 4Q30B 1ZMGA 2QVRA 4KYEA 3IX1A 4PGNA 1YTVA 3BBRA 3PPRA 2H4IA 4O94A 4KCDA 1FQBA 4QRZA 3PD8A 4QFKA 4IY5A 3LSFB 4EQ7A 2XWKA 1FQCA 4N07A 1D9VA 5KCJA 1AH5A 4YMBA 4ZEKA 4LZ5A 4MMPA 2O84X 4EQ9A 2RCBA 4GIZA 3CVGA 3IO6A 1PB9A 2NVUB 3KN8A 4ZS9A 4O7MA 2MKZA 3HCQA 2Y7KA 2A5TA 3SEYA 3HHFA 1MH3A 4YKPA 4P3LA 4GWOA 4MX6A 1H43A 3E3KA 3T0JA 2QVUA 1FQEA 2THIA 1JP4A 5H8NB 3RUMA 3MSTA 4GWUA 5IZ3B 5CMCA 2UVGA 4YKKA 2ONKE 4NF8A 4G8MA 2XX7A 4IO2A 3IR1A 4H5FA 4QF9A 4MFIA 2QVVA 2P0SA 2I4CA 3C34A 3QUFA 3PMXA 3FD3A 1VDWA 3DP8A 3DLNA 2V3QA 4RYAA 1XHYA 1GR2A 2PFYA 2XD3A 4YKJA 1IUDA 2CZIA 4I62A 4BDLA 4NWCA 4G8NA 3TTKA 5CC2A 1HSLA 3IORA 1FPGA 3K6VA 1B5IA 2H25A 4NWDA 3SKPA 3KBZA 3RQTA 4XF5A 2F7CA 5F24A 1NV6A 2RC7A 3TZAA 2V84A 5EHMA 1L5TA 2V93A 2KR0A 2REJA 2Z8EA 2Q2CA 1DPPA 2DYXA 5AA3A 4PDDA 1M5BA 1SPIA 3E78A 1R9QA 4MHFA 1A8FA 2V3UA 4OVRA 4E0XA 3LUZA 2AYSA 2V4CA 5TPAB 3H4ZA 4WEPA 2CZHA 3FJMA 5FHNA 5L9OA 1I69A 3UN6A 5CBSA 4POWA 1EU8A 1MM7A 2XXKA 3PUZE 2O7IA 4ZEIA 2VHAA 5H8NA 1NV0A 3C9HA 5IZ3A 4R6KA 3EHUA 3MYUA 4GOTA 1QULA 1MXXA 4FAJA 4EXLA 5A5XB 3K0VA 2HZKA 3FV1A 5I2NB 4Q0CA 5DT6A 4YZZA 1PB8A 1WDNA 1K9ZA 3IB2A 1D4NA 3IK6B 5FTHA 4FECA 4OFLA 4GRKA 1PDAA 4LN5A 1FBPA 2NOOA 4JDFA 5AE4A 1RDYA 1ZU0A 3B50A 3N26A 1DMBA 4G61A 1G0IA 3VE1B 4X9TA 4ZE8A 1FBFA 3U93A 4I9DA 3IJXB 1NH8A 3FGSA 1PEBA 1SVXB 2Q8JA 2CZKA 4XKRA 3MPKA 4G68C 3OEKA 3IB1A 3FXRA 3HPIA 1MY0A 1R1NA 4DLDA 4EF2A 5TPAA 3KC1A 3Q29A 4G8HA 3MZ9A 2XXPA 2XXQA 3G3GA 2I6EA 2F6PA 1NUXA 1YYZA 2RCAA 1FCKA 4ESWA 4G4PA 1NV5A 1XT8A 3RT6B 3U65A 4MLVA 5I56B 1B5HA 1Y4TA 1A7LA 4YMAA 4F3PA 2OWZA 4FJPA 1DTZA 1FPFA 1CNQA 2FA7A 3O9PA 5A5XA 1FPBA 1MXWA 1FQAA 4U22A 3VXCA 3MPLA 3QYTA 1LBZA 5IKBA 4KHZE 4PFYA 2D5WA 2ABHA 3M8UA 2CEXA 1SQYA 1B4ZA 4IGTA 4DE8A 2WYPA 2I3WA 2Y7IA 3IOWA 4KCCA 1XC1A 1N84A 4QSDA 4P1LA 2V3TA 1LCTA 3H06B 3R26A 4IGRA 2DWAA 1T0KA 2P2AA 3UIFA 3LSWA 4OQOA 2DS9A 4ZECA 3S9EA 1FBEA 3T96B 1YXIA 2D21A 3OOAA 4NG7A 1O64A 3CIJA 3FIRA 1TXFA 3K02A 1B58A 4U23A 2Q2AA 3TODA 4NMYA 3PU5A 4LATA 4OVJA 2O7UA 4Q5TA 2DXYA 3MVYA 1WVJA 1Y3QA 5H8FB 1IEJA 4N6PA 2F8DA 3DP4A 4NN3A 4XTCQ 4UACA 2Q88A 5LTCA 2R6GE 1MY2A 3KFMA 4KI0E 1N7XA 5I56A 3H03A 4GWSA 4NX1A 4PFTA 2ZNSA 1VR5A 4N91A 4I40A 1ZBMA 5IM2A 4BDOA 2XX8A 5J1DA 5HM4B 1XOCA 2XXVA 1B3GA 3ISPA 1B1HA 3T9XB 4LUBA 3VV5A 3C4MA 1DPEA 5IAIA 2XX9A 1OVTA 2UYFA 3T9VA 1N0TA 1B7HA 3D4GA 5ET7A 4YKIA 5CM6A 4AB5A 3R6UA 4UA8A 4LZ7A 1B3FA 1INPA 2Z8DA 1RYXA 2CEYA 2GHAA 3UK4A 4M1VA 1JW4A 2RINA 3I5OA 3RYDA 4DI3D 2FHYA 1MRPA 4JVIA 1IXIA 5I84A 1OLAA 2DSFA 1POTA 5IZ1A 5H8FA 3PUVE 3MQ9A 4ELQA 3FASA 4F18A 1QUKA 3O66A 3PPOA 2Q8MA 4H0WA 1AMFA 2O1MA 3T22A 2QS4A 1NFTA 3FJGA 1B0LA 2REGA 3TYHA 1FJ6A 4N8YA 4U21A 3MUQA 1ZTYA 2X26A 4MEVA 5LDZA 1MXYA 4NF0A 4NE4A 2RKMA 4ELRA 2VPOA 5ESYA 4U4SA 3BIGA 1KWHA 1ANFA 5IZZA 1NL5A 4X04A 2PT2A 1I6BA 3KZGA 3B7DA 3IL1B 2H9BA 4HE2A 1LFGA 3O28A 3K00A 4R72A 1LBYA 4RPNA 4ZEFA 2I0BA 4NF6B 2F36A 3HO7A 1JEUA 4PC9A 3U92A 1MXVA 4P1EA 4RPOA 3IOVA 3PPNA 1EZ9A 3K1MA 3FVKA 2DVCA 1I6QA 4UABA 2ONRA 3A29A 1MY3A 1B05A 1NH7A 4FBPA 4DXUA 2FYIA 3KOTA 1RYOA 2OJTA 3KSXA 1MM6A 5DVFA 4QFOA 3ILTB 3AXFA 1AOVA 4ZZEA 4OENA 1EYJA 5JEIA 3ZS6A 1OQGA 3G7WA 5BUUA 3PUYE 3FZVA 5EYHA 2ZZXA 1XVXA 1NV3A 3IO4A 3M3KA 2QS2A 4I1DA 2OX3A 4TLLB 2I4BA 1A8EA 1NUYA 3FXBA 1B32A 3OMBA 4ZZAA 3B6QA 4XIGQ 2ZYOA 3RLFE 4F1UA 5CMMA 4R2FA 4OVQA 1Q35A 4O3CA 3PPPA 4F2OA 4TQUQ 4GX6A 1B46A 1UQWA 5I57B 5L9MA 2JJKA 1B1XA 4IO7A 4PBHA 3ONMA 4JXIA 3FV2A 4YAHX 3ZKKA 4NF6A 1DSNA 3VVEA 4IO5A 4KD5A 2DXRA 3LC8A 4DXCA 4IO3A 3TPAA 3SETA 4KQPA 4O3AA 4X1DA 5ITPA 4U4XA 4PFUA 4RY1A 1NV7A 1AL3A 4OVSA 3KN3A 4F3SA 4H65A 3VLWA 2QJEA 4R73A 1NKXA 4QSCA 3EF7A 1EYKA 3B6TA 2Y84A 4PAKA 2OZZA 4ECFA 2Z23A 5H8SA 2VGQA 4H67A 4NHBA 2AIXA 4F39A 1IMAA 1QKAA 3EHSA 4DXBA 3N6TA 4IR8A 4RA1A 2FBPA 4RK2A 1B2HA 3ROJA 4LP2B 4O3BA 3QMFA 4OERA 2Q9TA 1JNFA 3RTWB 4I3EA 4NTLA 2HHMA 1FPJA 4FATA 3OXNA 2Z22A 5EHSA 5I57A 3K2DA 5EQ9A 4DCXA 1N3WA 3WAEA 4N13A 1FRPA 2VP1A 1EH3A 1FTAA 4GL8A 3OELA 4IO4A 4NAPA 1MQGA
chains in the Genus database with same CATH topology
1NMUA 3PMVA 4FIMA 4QHQA 5F7VA 3OO9A 3TTRA 2Y7PA 3CFXA 1FTJA 1SYIA 3MVWA 3CSGA 2PMSA 3TTNA 2QMXA 2F6GA 5CI5A 3W15C 4OXVA 3Q27A 4NF5B 1FW0A 3CG3A 3K1NA 3MP8A 3CFZA 4LVQA 4RK9A 1JETA 1UIUA 1YPNA 4IB2A 2P1SA 5I2KB 3K01A 4GXAA 4ND9A 3LR1A 3OO6A 3CI8A 5M2VA 2ZNUA 1M5EA 2RC8A 1MXZA 3VLUA 1H3DA 1URGA 4C0RA 1D9YA 3G3IA 4OESA 3HHGA 3C31A 4GL0A 3V89B 1URDA 3GXAA 1B40A 3RPWA 4MH5A 4NEDA 2G29A 2ANJA 5HBCA 4ELPA 2QPQA 4H8IA 1QVSA 3RN8A 3VDFA 1QW0A 4GF8A 3P7IA 4F1VA 1AIVA 4ISUA 4TLMB 1P1UA 1MQDA 1MXUA 4WXJA 1IZ1A 5JK4A 5DTBA 4KYSA 3RY3A 4I8CA 2I58A 1SW1A 3BFUA 2D3IA 3HN0A 3DELB 3FATA 4Q8RA 4LQ5A 3OSQA 4NF5A 1Z7NE 1B3LA 5H8HB 5JTYB 3U72A 2KLFA 2DE3A 5FTIA 2F7BA 5I2KA 4FEDA 2F5XA 4IY6A 4JWOA 1IXHA 2BJJX 1FQFA 4PFWA 3VVDA 4HCWA 3ZSFA 3V83A 3E13X 1LAGE 1XS5A 4YICA 1LB9A 4EQBA 4YU0A 4F2QA 3EHTA 3S4UA 1OLCA 1S50A 4WEDA 4GFRA 5LOMA 4JSOA 2CZLA 1MQJA 3H6TA 1S9TA 4OMBA 3KN7A 1OMPA 2VD2A 2XXIA 3PUWE 3TFLA 3SERA 3TUSA 3G3FA 1JW1A 3C35A 1LCFA 2DWJA 4K3FA 3KJTA 1P99A 2O69A 3TDJA 2HFBA 4GQOA 1TWYA 4DZ1A 3O6GA 4U2RA 1Y20A 2R71A 1B3EA 4M4GA 3FXUA 3SEVA 5FHOA 1GGGA 3OSRA 4NF4B 2OCUA 3R7XA 5H8HA 5JTYA 4ZEDA 1B52A 5DVJA 4WKMA 3RTFB 1B7UA 1FTOA 4ESXA 5KDTB 4R6HA 4OHNA 2AL5A 3N5LA 1HSJA 1ZJLA 1MDQA 2IEEA 1MPDA 4ELOA 4BDRA 4FORA 2PVUA 1US5A 3VLVA 4QSEA 1B0HA 3M3FA 3H3GA 3PGFA 1B7ZA 1P1OA 5F1QA 4H5GA 1SD3A 3W9WA 4LA9A 1JVXA 3K6XA 2VD3A 5AA2D 4LQ2A 1ZIUA 4MBPA 2QSXA 1LLSA 2I3VA 1US4A 2DVZA 3W9VA 4R75A 3IB0A 4E0WA 1N04A 1PBQA 4X1BA 1IIWA 2UVJA 4OZ9A 5L9SA 2UYEA 1SDXA 1MQIA 3TCGA 3GBAA 4RJZA 4XXUA 4P0GA 3VXBA 3U1OA 2GRVA 3CR9A 3MZ1A 4LONB 4R74A 1EZPA 2GH9A 4KPTA 4F22A 1QKBA 3H6UA 2I49A 1Y9UA 1N7WA 5AA1A 1A99A 2RF1A 3A09A 2ONSA 4NF4A 3WAFA 1DTGA 5CBRA 2H5YA 3V5AA 5CMBA 1MG1A 1N76A 1M5CA 2HQ0A 3V8XB 1SBPA 3IAZA 1SW4A 5KDTA 1JW5A 1VFEA 2F7AA 2B65A 1POY1 4MLQA 3QAXA 2H99A 3MW0A 1B6HA 2PBWA 3GZGA 5L8DA 4POXA 3TTMA 3MC2A 4F3GA 2PYYA 3QSLA 4OETA 3ODBA 1DOTA 2O1LA 3FVOA 2R9JA 3U8QA 2B3FA 2YJPA 5I58B 4F1YA 1GTKA 3TTLA 3T9HB 3EQ1A 3A3UA 4ZDMA 2QS3A 2VOZA 3N6UA 5H8QB 3OO7A 5AA4B 3EPEA 5TU0A 1F9BA 4RNSA 4HCYA 4IO6A 2QL3A 3HV1A 4KYDA 3Q28A 3VVFA 4C1TA 3TCFA 1SI1A 3K4UA 4PP0A 3QK6A 4G77A 4DIGA 4YB6A 1TFAA 1S7YA 3Q25A 4F3BA 3QXMA 1GVCA 1IQ7A 1N3XA 4R9FA 1FTKA 2UXAA 2OWTA 2QRYA 2E1SA 4ONYA 1LGBC 2CMOA 4GXSB 2I48A 3SEUA 5I59B 4EDPA 3SEWA 5ELVA 1B5JA 1I6AA 3JZJA 3OO8A 3G3JA 3MJNA 2XXRA 4F29A 3LSLA 1R9LA 4YB5A 5I58A 1BIYA 4OEUA 1O63A 3S9NC 1OIBA 4P11A 1SYHA 3O2AA 1A54A 5DYHA 1R6ZA 3K6UA 2HAUA 5H8QA 1OQHA 4JWYA 2FNCA 5AA4A 3HSTA 4H1XA 4P0IA 2XXYA 2NUVA 2ZYNA 5ITOA 1II5A 3S9MC 3KGCA 4H8JA 4PETA 1BKAA 1SW5A 4XKNA 4PE5B 2W7YA 3PPQA 4BDMA 2F78A 1Z7ME 4PQJA 4OEVA 1CE2A 1M5FA 4OFJA 4Z0IA 1RKMA 2YLNA 1LBBA 1QUJA 1B4HA 3USDA 4RXLA 5I59A 3SESA 3SDFA 2Y7WA 2DWIA 1LSTA 4HTGA 1JEVA 1H45A 1OVBA 4R6YA 1PC3A 1NNFA 2YPNA 5CMKA 3OEMA 1B51A 1O7TA 4DCYA 1Y3PA 3QIMA 3PV0E 3MVXA 4XKQA 5K2YA 1BTJA 5AA2B 3E9XA 1URSA 2E0SA 2O6AA 3C33A 4F19A 1JQFA 1MQHA 2OLBA 3JV9A 3ECRA 1FQDA 2F35A 2HXWA 4GD5A 3PUXE 2Y7RA 1H44A 1LFHA 5TP9B 3UGWA 4HW8A 3K6WA 4R2BA 2ZYKA 2OK2A 1VE4A 4MF3A 1FTLA 1MPCA 2XHDA 3FVGA 3O6IA 1BP5A 2OBGA 3MAMA 2DP8A 1UIVA 3Q26A 4EUOA 1ELJA 2I0CA 3RT8A 3MVZA 1UTBB 2ALUA 3C36A 3FUZA 5DVIA 3F11A 1LAFE 1MDP1 2RC9A 5KZTA 3THIA 3MP6A 1Y3NA 3T66A 2G93A 2AL4A 2HCAA 4JSDA 1IXCA 3FJ7A 1H76A 2NWJA 2F97A 2HAVA 2H98A 3D4CA 3H6WA 1MH4A 4X48A 2XXXA 3UA8A 5AA2A 2XXHA 2LAOA 1TFDA 3N94A 1J1NA 4G2ZA 2X7QA 3T9UA 5EYFA 5I2NA 4JB7A 2OWSA 1NNPA 3DM0A 1NNKA 1USYH 2DE2A 4BDNA 5TP9A 4EF1A 2M8CA 1GV8A 3L6GA 4KR5A 1YCJA 1CB6A 5B7DA 3H7MA 3L6HA 4YB7A 1QUIA 2XD2A 1USYE 4AB6A 1ZLQA 3FXQA 2UVIA 2DQVA 1XVYA 4L17A 1Q1KA 3CSBA 1LFIA 1Y1ZA 1LAXA 1UTBA 3CG1A 3TCHA 2O51A 4THIA 2X7PA 2ZYMA 1LB8A 4TOZA 3RNNA 1UTHB 3CFLA 3KEIA 3BKIB 1B9JA 4GLIA 3BFTA 3LBSA 1P1QA 1VSOA 1M5DA 4QFNA 4LZ8A 4FE8A 5FHMA 4OFOA 5ISUA 5HPQA 3LUYA 2ZMBA 1EZOA 3FVNA 3GLBA 3TELA 3PD9A 3VFJA 1YAEA 3UORA 3KOSA 3O97A 3DP6A 5ICQA 2ZNTA 3T93B 4OWDA 1FTMA 4U1OA 4H6DA 1NNTA 3O6HA 3TQLA 1QJMA 5K2XA 1A40A 2O68A 2ZXTA 3C32A 1PBPA 2A5SA 3KBRA 5DEXB 3G3HA 1B3HA 1P1NA 4AQ4A 4HS7A 2DWHA 4QFPA 3S9LC 3RGYA 3JYRA 1MPBA 2XXUA 1SI0A 4JWXA 3IOUA 3MP1A 4ZE9A 2IA4A 1A55A 1IXGA 3K1PA 3U94A 3TMGA 4OTEA 3M3LA 1UTHA 3TQWA 3B6WA 1ATGA 4KFQA 2WKYA 2PT1A 3OENA 2DOJA 2ESNA 3I3VA 3KJ7A 3OD7A 3O29A 2F34A 4G68B 2UVHA 3TAJA 4F31B 1TT1A 3E4RA 4U1ZA 3IOTA 2Z8FA 4DDDA 1LBCA 2GFEA 3MZBA 2GHBA 3GBBA 3MBPA 1MY4A 1Y4CA 1IITA 3CRBA 4FEBA 1WODA 2XXWA 4R9GA 5KCJB 4OYVA 5CRYA 2Q89A 1SW2A 5BWJA 2HZLA 2XXTA 3A3CA 3MWBA 3KSJA 1ZKBA 1BLFA 1MY1A 4Z7EA 5DEXA 4BDQA 2A5TB 3ZKLA 1LAHE 3IJOB 3H6VA 3TEPA 2DE4A 3S2VA 1MS7A 2B3BA 3I6VA 1HSEA 2V25A 3TKDA 5B70A 3KG2A 2QMWA 1D3KA 4NF8B 2HEUA 3ILUB 2QS1A 5ICTA 3G3KA 4GVOA 1PB7A 1VFDA 4EXKA 4QFLA 4BLAA 1Y1MA 3UP9A 4C1UA 1JVYA 2NXOA 4ZEBA 4XKPA 4G68A 2PX1A 1P1WA 3QUJA 3SEXA 3PMWA 3EN3A 4JBZA 3LSXA 4Q30B 1ZMGA 4KYEA 3IX1A 1YTVA 3BBRA 3PPRA 2H4IA 4KCDA 1FQBA 4QRZA 3PD8A 4QFKA 4IY5A 3LSFB 4EQ7A 1FQCA 4N07A 1D9VA 5KCJA 1AH5A 4YMBA 4ZEKA 4LZ5A 2O84X 4EQ9A 2RCBA 4GIZA 3CVGA 3IO6A 1PB9A 2NVUB 3KN8A 4ZS9A 3HCQA 2Y7KA 2A5TA 3SEYA 3HHFA 1MH3A 4YKPA 4GWOA 1H43A 3E3KA 1FQEA 2THIA 5H8NB 3RUMA 5CMCA 2UVGA 4YKKA 2ONKE 4NF8A 4G8MA 2XX7A 4IO2A 3IR1A 4H5FA 4QF9A 4MFIA 2P0SA 2I4CA 3C34A 3QUFA 3PMXA 3FD3A 3DP8A 3DLNA 2V3QA 4RYAA 1XHYA 1GR2A 2XD3A 4YKJA 1IUDA 4I62A 4BDLA 4NWCA 4G8NA 3TTKA 5CC2A 1HSLA 3IORA 3K6VA 1B5IA 2H25A 4NWDA 3SKPA 3RQTA 2F7CA 2RC7A 3TZAA 2V84A 5EHMA 1L5TA 2V93A 2REJA 2Z8EA 2Q2CA 1DPPA 2DYXA 5AA3A 1M5BA 1R9QA 1A8FA 2V3UA 4E0XA 2AYSA 5TPAB 3H4ZA 4WEPA 3FJMA 5FHNA 5L9OA 1I69A 3UN6A 5CBSA 4POWA 1EU8A 1MM7A 3PUZE 2O7IA 4ZEIA 2VHAA 5H8NA 3C9HA 4R6KA 3EHUA 4GOTA 1QULA 1MXXA 4FAJA 4EXLA 5A5XB 3K0VA 2HZKA 3FV1A 5I2NB 4Q0CA 5DT6A 4YZZA 1PB8A 1WDNA 3IB2A 1D4NA 3IK6B 5FTHA 4FECA 4OFLA 4GRKA 1PDAA 2NOOA 4JDFA 5AE4A 1ZU0A 3N26A 1DMBA 3VE1B 4X9TA 4ZE8A 3U93A 4I9DA 3IJXB 1NH8A 3FGSA 1PEBA 1SVXB 2Q8JA 4XKRA 3MPKA 4G68C 3OEKA 3IB1A 3FXRA 3HPIA 1MY0A 1R1NA 4DLDA 4EF2A 5TPAA 3Q29A 4G8HA 3MZ9A 2XXPA 2XXQA 3G3GA 2I6EA 2F6PA 2RCAA 1FCKA 4ESWA 4G4PA 1XT8A 3RT6B 4MLVA 5I56B 1B5HA 1Y4TA 1A7LA 4YMAA 4F3PA 4FJPA 1DTZA 2FA7A 3O9PA 5A5XA 1MXWA 1FQAA 4U22A 3VXCA 3MPLA 3QYTA 5IKBA 4KHZE 4PFYA 2D5WA 2ABHA 3M8UA 1SQYA 1B4ZA 4IGTA 4DE8A 2I3WA 2Y7IA 3IOWA 4KCCA 1XC1A 1N84A 4QSDA 2V3TA 1LCTA 3H06B 3R26A 4IGRA 2DWAA 1T0KA 2P2AA 3UIFA 3LSWA 4OQOA 2DS9A 4ZECA 3S9EA 3T96B 2D21A 3OOAA 1O64A 3CIJA 3FIRA 1TXFA 3K02A 1B58A 4U23A 2Q2AA 3TODA 4NMYA 3PU5A 4LATA 4OVJA 2O7UA 4Q5TA 2DXYA 3MVYA 1WVJA 1Y3QA 5H8FB 1IEJA 4N6PA 2F8DA 3DP4A 4XTCQ 4UACA 2Q88A 2R6GE 1MY2A 3KFMA 4KI0E 1N7XA 5I56A 3H03A 4PFTA 2ZNSA 1VR5A 1ZBMA 4BDOA 2XX8A 5J1DA 5HM4B 1XOCA 2XXVA 1B3GA 1B1HA 3T9XB 4LUBA 3VV5A 3C4MA 1DPEA 5IAIA 2XX9A 1OVTA 2UYFA 3T9VA 1N0TA 1B7HA 3D4GA 4YKIA 5CM6A 4AB5A 3R6UA 4UA8A 4LZ7A 1B3FA 2Z8DA 1RYXA 2GHAA 3UK4A 4M1VA 1JW4A 2RINA 3I5OA 1MRPA 1IXIA 5I84A 1OLAA 2DSFA 1POTA 5H8FA 3PUVE 3MQ9A 4ELQA 3FASA 4F18A 1QUKA 3O66A 3PPOA 4H0WA 1AMFA 2O1MA 3T22A 2QS4A 1NFTA 3FJGA 1B0LA 2REGA 3TYHA 4U21A 3MUQA 1ZTYA 2X26A 1MXYA 4NE4A 2RKMA 4ELRA 4U4SA 1KWHA 1ANFA 1NL5A 2PT2A 1I6BA 3KZGA 3B7DA 3IL1B 2H9BA 1LFGA 3O28A 3K00A 4R72A 4RPNA 4ZEFA 2I0BA 4NF6B 2F36A 3HO7A 1JEUA 3U92A 1MXVA 4RPOA 3IOVA 3PPNA 1EZ9A 3K1MA 3FVKA 2DVCA 1I6QA 2ONRA 1MY3A 1B05A 1NH7A 4DXUA 2FYIA 3KOTA 1RYOA 2OJTA 3KSXA 1MM6A 5DVFA 4QFOA 3ILTB 3AXFA 1AOVA 4ZZEA 4OENA 5JEIA 3ZS6A 1OQGA 3G7WA 5BUUA 3PUYE 3FZVA 1XVXA 3IO4A 3M3KA 2QS2A 4I1DA 4TLLB 2I4BA 1A8EA 1B32A 3OMBA 4ZZAA 3B6QA 4XIGQ 2ZYOA 3RLFE 4F1UA 5CMMA 4R2FA 1Q35A 4O3CA 3PPPA 4F2OA 4TQUQ 1B46A 1UQWA 5I57B 5L9MA 1B1XA 4IO7A 3ONMA 4JXIA 3FV2A 4YAHX 3ZKKA 4NF6A 1DSNA 3VVEA 4IO5A 4KD5A 2DXRA 3LC8A 4DXCA 4IO3A 3TPAA 3SETA 4KQPA 4O3AA 4X1DA 5ITPA 4U4XA 4PFUA 4RY1A 1AL3A 3KN3A 4F3SA 4H65A 3VLWA 2QJEA 4R73A 1NKXA 4QSCA 3EF7A 3B6TA 2Y84A 2OZZA 4ECFA 2Z23A 5H8SA 2VGQA 4H67A 2AIXA 4F39A 1QKAA 3EHSA 4DXBA 3N6TA 4RA1A 4RK2A 1B2HA 4LP2B 4O3BA 4OERA 2Q9TA 1JNFA 3RTWB 4NTLA 4FATA 3OXNA 2Z22A 5EHSA 5I57A 3K2DA 4DCXA 1N3WA 3WAEA 4N13A 2VP1A 1EH3A 4GL8A 3OELA 4IO4A 1MQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMU A;  3PMV A;  4FIM A;  4QHQ A;  5F7V A;  3OO9 A;  3TTR A;  2Y7P A;  3CFX A;  1FTJ A;  1SYI A;  3MVW A;  3CSG A;  2PMS A;  3TTN A;  2QMX A;  2F6G A;  5CI5 A;  3W15 C;  4OXV A;  3Q27 A;  4NF5 B;  1FW0 A;  3CG3 A;  3K1N A;  3MP8 A;  3CFZ A;  4LVQ A;  4RK9 A;  1JET A;  1UIU A;  1YPN A;  4IB2 A;  2P1S A;  5I2K B;  3K01 A;  4GXA A;  4ND9 A;  3LR1 A;  3OO6 A;  3CI8 A;  5M2V A;  2ZNU A;  1M5E A;  2RC8 A;  1MXZ A;  3VLU A;  1H3D A;  1URG A;  4C0R A;  1D9Y A;  3G3I A;  4OES A;  3HHG A;  3C31 A;  4GL0 A;  3V89 B;  1URD A;  3GXA A;  1B40 A;  3RPW A;  4MH5 A;  4NED A;  2G29 A;  2ANJ A;  5HBC A;  4ELP A;  2QPQ A;  4H8I A;  1QVS A;  3RN8 A;  3VDF A;  1QW0 A;  4GF8 A;  3P7I A;  4F1V A;  1AIV A;  4ISU A;  4TLM B;  1P1U A;  1MQD A;  1MXU A;  4WXJ A;  1IZ1 A;  5JK4 A;  5DTB A;  4KYS A;  3RY3 A;  4I8C A;  2I58 A;  1SW1 A;  3BFU A;  2D3I A;  3HN0 A;  3DEL B;  3FAT A;  4Q8R A;  4LQ5 A;  3OSQ A;  4NF5 A;  1Z7N E;  1B3L A;  5H8H B;  5JTY B;  3U72 A;  2KLF A;  2DE3 A;  5FTI A;  2F7B A;  5I2K A;  4FED A;  2F5X A;  4IY6 A;  4JWO A;  1IXH A;  2BJJ X;  1FQF A;  4PFW A;  3VVD A;  4HCW A;  3ZSF A;  3V83 A;  3E13 X;  1LAG E;  1XS5 A;  4YIC A;  1LB9 A;  4EQB A;  4YU0 A;  4F2Q A;  3EHT A;  3S4U A;  1OLC A;  1S50 A;  4WED A;  4GFR A;  5LOM A;  4JSO A;  2CZL A;  1MQJ A;  3H6T A;  1S9T A;  4OMB A;  3KN7 A;  1OMP A;  2VD2 A;  2XXI A;  3PUW E;  3TFL A;  3SER A;  3TUS A;  3G3F A;  1JW1 A;  3C35 A;  1LCF A;  2DWJ A;  4K3F A;  3KJT A;  1P99 A;  2O69 A;  3TDJ A;  2HFB A;  4GQO A;  1TWY A;  4DZ1 A;  3O6G A;  4U2R A;  1Y20 A;  2R71 A;  1B3E A;  4M4G A;  3FXU A;  3SEV A;  5FHO A;  1GGG A;  3OSR A;  4NF4 B;  2OCU A;  3R7X A;  5H8H A;  5JTY A;  4ZED A;  1B52 A;  5DVJ A;  4WKM A;  3RTF B;  1B7U A;  1FTO A;  4ESX A;  5KDT B;  4R6H A;  4OHN A;  2AL5 A;  3N5L A;  1HSJ A;  1ZJL A;  1MDQ A;  2IEE A;  1MPD A;  4ELO A;  4BDR A;  4FOR A;  2PVU A;  1US5 A;  3VLV A;  4QSE A;  1B0H A;  3M3F A;  3H3G A;  3PGF A;  1B7Z A;  1P1O A;  5F1Q A;  4H5G A;  1SD3 A;  3W9W A;  4LA9 A;  1JVX A;  3K6X A;  2VD3 A;  5AA2 D;  4LQ2 A;  1ZIU A;  4MBP A;  2QSX A;  1LLS A;  2I3V A;  1US4 A;  2DVZ A;  3W9V A;  4R75 A;  3IB0 A;  4E0W A;  1N04 A;  1PBQ A;  4X1B A;  1IIW A;  2UVJ A;  4OZ9 A;  5L9S A;  2UYE A;  1SDX A;  1MQI A;  3TCG A;  3GBA A;  4RJZ A;  4XXU A;  4P0G A;  3VXB A;  3U1O A;  2GRV A;  3CR9 A;  3MZ1 A;  4LON B;  4R74 A;  1EZP A;  2GH9 A;  4KPT A;  4F22 A;  1QKB A;  3H6U A;  2I49 A;  1Y9U A;  1N7W A;  5AA1 A;  1A99 A;  2RF1 A;  3A09 A;  2ONS A;  4NF4 A;  3WAF A;  1DTG A;  5CBR A;  2H5Y A;  3V5A A;  5CMB A;  1MG1 A;  1N76 A;  1M5C A;  2HQ0 A;  3V8X B;  1SBP A;  3IAZ A;  1SW4 A;  5KDT A;  1JW5 A;  1VFE A;  2F7A A;  2B65 A;  1POY 1;  4MLQ A;  3QAX A;  2H99 A;  3MW0 A;  1B6H A;  2PBW A;  3GZG A;  5L8D A;  4POX A;  3TTM A;  3MC2 A;  4F3G A;  2PYY A;  3QSL A;  4OET A;  3ODB A;  1DOT A;  2O1L A;  3FVO A;  2R9J A;  3U8Q A;  2B3F A;  2YJP A;  5I58 B;  4F1Y A;  1GTK A;  3TTL A;  3T9H B;  3EQ1 A;  3A3U A;  4ZDM A;  2QS3 A;  2VOZ A;  3N6U A;  5H8Q B;  3OO7 A;  5AA4 B;  3EPE A;  5TU0 A;  1F9B A;  4RNS A;  4HCY A;  4IO6 A;  2QL3 A;  3HV1 A;  4KYD A;  3Q28 A;  3VVF A;  4C1T A;  3TCF A;  1SI1 A;  3K4U A;  4PP0 A;  3QK6 A;  4G77 A;  4DIG A;  4YB6 A;  1TFA A;  1S7Y A;  3Q25 A;  4F3B A;  3QXM A;  1GVC A;  1IQ7 A;  1N3X A;  4R9F A;  1FTK A;  2UXA A;  2OWT A;  2QRY A;  2E1S A;  4ONY A;  1LGB C;  2CMO A;  4GXS B;  2I48 A;  3SEU A;  5I59 B;  4EDP A;  3SEW A;  5ELV A;  1B5J A;  1I6A A;  3JZJ A;  3OO8 A;  3G3J A;  3MJN A;  2XXR A;  4F29 A;  3LSL A;  1R9L A;  4YB5 A;  5I58 A;  1BIY A;  4OEU A;  1O63 A;  3S9N C;  1OIB A;  4P11 A;  1SYH A;  3O2A A;  1A54 A;  5DYH A;  1R6Z A;  3K6U A;  2HAU A;  5H8Q A;  1OQH A;  4JWY A;  2FNC A;  5AA4 A;  3HST A;  4H1X A;  4P0I A;  2XXY A;  2NUV A;  2ZYN A;  5ITO A;  1II5 A;  3S9M C;  3KGC A;  4H8J A;  4PET A;  1BKA A;  1SW5 A;  4XKN A;  4PE5 B;  2W7Y A;  3PPQ A;  4BDM A;  2F78 A;  1Z7M E;  4PQJ A;  4OEV A;  1CE2 A;  1M5F A;  4OFJ A;  4Z0I A;  1RKM A;  2YLN A;  1LBB A;  1QUJ A;  1B4H A;  3USD A;  4RXL A;  5I59 A;  3SES A;  3SDF A;  2Y7W A;  2DWI A;  1LST A;  4HTG A;  1JEV A;  1H45 A;  1OVB A;  4R6Y A;  1PC3 A;  1NNF A;  2YPN A;  5CMK A;  3OEM A;  1B51 A;  1O7T A;  4DCY A;  1Y3P A;  3QIM A;  3PV0 E;  3MVX A;  4XKQ A;  5K2Y A;  1BTJ A;  5AA2 B;  3E9X A;  1URS A;  2E0S A;  2O6A A;  3C33 A;  4F19 A;  1JQF A;  1MQH A;  2OLB A;  3JV9 A;  3ECR A;  1FQD A;  2F35 A;  2HXW A;  4GD5 A;  3PUX E;  2Y7R A;  1H44 A;  1LFH A;  5TP9 B;  3UGW A;  4HW8 A;  3K6W A;  4R2B A;  2ZYK A;  2OK2 A;  1VE4 A;  4MF3 A;  1FTL A;  1MPC A;  2XHD A;  3FVG A;  3O6I A;  1BP5 A;  2OBG A;  3MAM A;  2DP8 A;  1UIV A;  3Q26 A;  4EUO A;  1ELJ A;  2I0C A;  3RT8 A;  3MVZ A;  1UTB B;  2ALU A;  3C36 A;  3FUZ A;  5DVI A;  3F11 A;  1LAF E;  1MDP 1;  2RC9 A;  5KZT A;  3THI A;  3MP6 A;  1Y3N A;  3T66 A;  2G93 A;  2AL4 A;  2HCA A;  4JSD A;  1IXC A;  3FJ7 A;  1H76 A;  2NWJ A;  2F97 A;  2HAV A;  2H98 A;  3D4C A;  3H6W A;  1MH4 A;  4X48 A;  2XXX A;  3UA8 A;  5AA2 A;  2XXH A;  2LAO A;  1TFD A;  3N94 A;  1J1N A;  4G2Z A;  2X7Q A;  3T9U A;  5EYF A;  5I2N A;  4JB7 A;  2OWS A;  1NNP A;  3DM0 A;  1NNK A;  1USY H;  2DE2 A;  4BDN A;  5TP9 A;  4EF1 A;  2M8C A;  1GV8 A;  3L6G A;  4KR5 A;  1YCJ A;  1CB6 A;  5B7D A;  3H7M A;  3L6H A;  4YB7 A;  1QUI A;  2XD2 A;  1USY E;  4AB6 A;  1ZLQ A;  3FXQ A;  2UVI A;  2DQV A;  1XVY A;  4L17 A;  1Q1K A;  3CSB A;  1LFI A;  1Y1Z A;  1LAX A;  1UTB A;  3CG1 A;  3TCH A;  2O51 A;  4THI A;  2X7P A;  2ZYM A;  1LB8 A;  4TOZ A;  3RNN A;  1UTH B;  3CFL A;  3KEI A;  3BKI B;  1B9J A;  4GLI A;  3BFT A;  3LBS A;  1P1Q A;  1VSO A;  1M5D A;  4QFN A;  4LZ8 A;  4FE8 A;  5FHM A;  4OFO A;  5ISU A;  5HPQ A;  3LUY A;  2ZMB A;  1EZO A;  3FVN A;  3GLB A;  3TEL A;  3PD9 A;  3VFJ A;  1YAE A;  3UOR A;  3KOS A;  3O97 A;  3DP6 A;  5ICQ A;  2ZNT A;  3T93 B;  4OWD A;  1FTM A;  4U1O A;  4H6D A;  1NNT A;  3O6H A;  3TQL A;  1QJM A;  5K2X A;  1A40 A;  2O68 A;  2ZXT A;  3C32 A;  1PBP A;  2A5S A;  3KBR A;  5DEX B;  3G3H A;  1B3H A;  1P1N A;  4AQ4 A;  4HS7 A;  2DWH A;  4QFP A;  3S9L C;  3RGY A;  3JYR A;  1MPB A;  2XXU A;  1SI0 A;  4JWX A;  3IOU A;  3MP1 A;  4ZE9 A;  2IA4 A;  1A55 A;  1IXG A;  3K1P A;  3U94 A;  3TMG A;  4OTE A;  3M3L A;  1UTH A;  3TQW A;  3B6W A;  1ATG A;  4KFQ A;  2WKY A;  2PT1 A;  3OEN A;  2DOJ A;  2ESN A;  3I3V A;  3KJ7 A;  3OD7 A;  3O29 A;  2F34 A;  4G68 B;  2UVH A;  3TAJ A;  4F31 B;  1TT1 A;  3E4R A;  4U1Z A;  3IOT A;  2Z8F A;  4DDD A;  1LBC A;  2GFE A;  3MZB A;  2GHB A;  3GBB A;  3MBP A;  1MY4 A;  1Y4C A;  1IIT A;  3CRB A;  4FEB A;  1WOD A;  2XXW A;  4R9G A;  5KCJ B;  4OYV A;  5CRY A;  2Q89 A;  1SW2 A;  5BWJ A;  2HZL A;  2XXT A;  3A3C A;  3MWB A;  3KSJ A;  1ZKB A;  1BLF A;  1MY1 A;  4Z7E A;  5DEX A;  4BDQ A;  2A5T B;  3ZKL A;  1LAH E;  3IJO B;  3H6V A;  3TEP A;  2DE4 A;  3S2V A;  1MS7 A;  2B3B A;  3I6V A;  1HSE A;  2V25 A;  3TKD A;  5B70 A;  3KG2 A;  2QMW A;  1D3K A;  4NF8 B;  2HEU A;  3ILU B;  2QS1 A;  5ICT A;  3G3K A;  4GVO A;  1PB7 A;  1VFD A;  4EXK A;  4QFL A;  4BLA A;  1Y1M A;  3UP9 A;  4C1U A;  1JVY A;  2NXO A;  4ZEB A;  4XKP A;  4G68 A;  2PX1 A;  1P1W A;  3QUJ A;  3SEX A;  3PMW A;  3EN3 A;  4JBZ A;  3LSX A;  4Q30 B;  1ZMG A;  4KYE A;  3IX1 A;  1YTV A;  3BBR A;  3PPR A;  2H4I A;  4KCD A;  1FQB A;  4QRZ A;  3PD8 A;  4QFK A;  4IY5 A;  3LSF B;  4EQ7 A;  1FQC A;  4N07 A;  1D9V A;  5KCJ A;  1AH5 A;  4YMB A;  4ZEK A;  4LZ5 A;  2O84 X;  4EQ9 A;  2RCB A;  4GIZ A;  3CVG A;  3IO6 A;  1PB9 A;  2NVU B;  3KN8 A;  4ZS9 A;  3HCQ A;  2Y7K A;  2A5T A;  3SEY A;  3HHF A;  1MH3 A;  4YKP A;  4GWO A;  1H43 A;  3E3K A;  1FQE A;  2THI A;  5H8N B;  3RUM A;  5CMC A;  2UVG A;  4YKK A;  2ONK E;  4NF8 A;  4G8M A;  2XX7 A;  4IO2 A;  3IR1 A;  4H5F A;  4QF9 A;  4MFI A;  2P0S A;  2I4C A;  3C34 A;  3QUF A;  3PMX A;  3FD3 A;  3DP8 A;  3DLN A;  2V3Q A;  4RYA A;  1XHY A;  1GR2 A;  2XD3 A;  4YKJ A;  1IUD A;  4I62 A;  4BDL A;  4NWC A;  4G8N A;  3TTK A;  5CC2 A;  1HSL A;  3IOR A;  3K6V A;  1B5I A;  2H25 A;  4NWD A;  3SKP A;  3RQT A;  2F7C A;  2RC7 A;  3TZA A;  2V84 A;  5EHM A;  1L5T A;  2V93 A;  2REJ A;  2Z8E A;  2Q2C A;  1DPP A;  2DYX A;  5AA3 A;  1M5B A;  1R9Q A;  1A8F A;  2V3U A;  4E0X A;  2AYS A;  5TPA B;  3H4Z A;  4WEP A;  3FJM A;  5FHN A;  5L9O A;  1I69 A;  3UN6 A;  5CBS A;  4POW A;  1EU8 A;  1MM7 A;  3PUZ E;  2O7I A;  4ZEI A;  2VHA A;  5H8N A;  3C9H A;  4R6K A;  3EHU A;  4GOT A;  1QUL A;  1MXX A;  4FAJ A;  4EXL A;  5A5X B;  3K0V A;  2HZK A;  3FV1 A;  5I2N B;  4Q0C A;  5DT6 A;  4YZZ A;  1PB8 A;  1WDN A;  3IB2 A;  1D4N A;  3IK6 B;  5FTH A;  4FEC A;  4OFL A;  4GRK A;  1PDA A;  2NOO A;  4JDF A;  5AE4 A;  1ZU0 A;  3N26 A;  1DMB A;  3VE1 B;  4X9T A;  4ZE8 A;  3U93 A;  4I9D A;  3IJX B;  1NH8 A;  3FGS A;  1PEB A;  1SVX B;  2Q8J A;  4XKR A;  3MPK A;  4G68 C;  3OEK A;  3IB1 A;  3FXR A;  3HPI A;  1MY0 A;  1R1N A;  4DLD A;  4EF2 A;  5TPA A;  3Q29 A;  4G8H A;  3MZ9 A;  2XXP A;  2XXQ A;  3G3G A;  2I6E A;  2F6P A;  2RCA A;  1FCK A;  4ESW A;  4G4P A;  1XT8 A;  3RT6 B;  4MLV A;  5I56 B;  1B5H A;  1Y4T A;  1A7L A;  4YMA A;  4F3P A;  4FJP A;  1DTZ A;  2FA7 A;  3O9P A;  5A5X A;  1MXW A;  1FQA A;  4U22 A;  3VXC A;  3MPL A;  3QYT A;  5IKB A;  4KHZ E;  4PFY A;  2D5W A;  2ABH A;  3M8U A;  1SQY A;  1B4Z A;  4IGT A;  4DE8 A;  2I3W A;  2Y7I A;  3IOW A;  4KCC A;  1XC1 A;  1N84 A;  4QSD A;  2V3T A;  1LCT A;  3H06 B;  3R26 A;  4IGR A;  2DWA A;  1T0K A;  2P2A A;  3UIF A;  3LSW A;  4OQO A;  2DS9 A;  4ZEC A;  3S9E A;  3T96 B;  2D21 A;  3OOA A;  1O64 A;  3CIJ A;  3FIR A;  1TXF A;  3K02 A;  1B58 A;  4U23 A;  2Q2A A;  3TOD A;  4NMY A;  3PU5 A;  4LAT A;  4OVJ A;  2O7U A;  4Q5T A;  2DXY A;  3MVY A;  1WVJ A;  1Y3Q A;  5H8F B;  1IEJ A;  4N6P A;  2F8D A;  3DP4 A;  4XTC Q;  4UAC A;  2Q88 A;  2R6G E;  1MY2 A;  3KFM A;  4KI0 E;  1N7X A;  5I56 A;  3H03 A;  4PFT A;  2ZNS A;  1VR5 A;  1ZBM A;  4BDO A;  2XX8 A;  5J1D A;  5HM4 B;  1XOC A;  2XXV A;  1B3G A;  1B1H A;  3T9X B;  4LUB A;  3VV5 A;  3C4M A;  1DPE A;  5IAI A;  2XX9 A;  1OVT A;  2UYF A;  3T9V A;  1N0T A;  1B7H A;  3D4G A;  4YKI A;  5CM6 A;  4AB5 A;  3R6U A;  4UA8 A;  4LZ7 A;  1B3F A;  2Z8D A;  1RYX A;  2GHA A;  3UK4 A;  4M1V A;  1JW4 A;  2RIN A;  3I5O A;  1MRP A;  1IXI A;  5I84 A;  1OLA A;  2DSF A;  1POT A;  5H8F A;  3PUV E;  3MQ9 A;  4ELQ A;  3FAS A;  4F18 A;  1QUK A;  3O66 A;  3PPO A;  4H0W A;  1AMF A;  2O1M A;  3T22 A;  2QS4 A;  1NFT A;  3FJG A;  1B0L A;  2REG A;  3TYH A;  4U21 A;  3MUQ A;  1ZTY A;  2X26 A;  1MXY A;  4NE4 A;  2RKM A;  4ELR A;  4U4S A;  1KWH A;  1ANF A;  1NL5 A;  2PT2 A;  1I6B A;  3KZG A;  3B7D A;  3IL1 B;  2H9B A;  1LFG A;  3O28 A;  3K00 A;  4R72 A;  4RPN A;  4ZEF A;  2I0B A;  4NF6 B;  2F36 A;  3HO7 A;  1JEU A;  3U92 A;  1MXV A;  4RPO A;  3IOV A;  3PPN A;  1EZ9 A;  3K1M A;  3FVK A;  2DVC A;  1I6Q A;  2ONR A;  1MY3 A;  1B05 A;  1NH7 A;  4DXU A;  2FYI A;  3KOT A;  1RYO A;  2OJT A;  3KSX A;  1MM6 A;  5DVF A;  4QFO A;  3ILT B;  3AXF A;  1AOV A;  4ZZE A;  4OEN A;  5JEI A;  3ZS6 A;  1OQG A;  3G7W A;  5BUU A;  3PUY E;  3FZV A;  1XVX A;  3IO4 A;  3M3K A;  2QS2 A;  4I1D A;  4TLL B;  2I4B A;  1A8E A;  1B32 A;  3OMB A;  4ZZA A;  3B6Q A;  4XIG Q;  2ZYO A;  3RLF E;  4F1U A;  5CMM A;  4R2F A;  1Q35 A;  4O3C A;  3PPP A;  4F2O A;  4TQU Q;  1B46 A;  1UQW A;  5I57 B;  5L9M A;  1B1X A;  4IO7 A;  3ONM A;  4JXI A;  3FV2 A;  4YAH X;  3ZKK A;  4NF6 A;  1DSN A;  3VVE A;  4IO5 A;  4KD5 A;  2DXR A;  3LC8 A;  4DXC A;  4IO3 A;  3TPA A;  3SET A;  4KQP A;  4O3A A;  4X1D A;  5ITP A;  4U4X A;  4PFU A;  4RY1 A;  1AL3 A;  3KN3 A;  4F3S A;  4H65 A;  3VLW A;  2QJE A;  4R73 A;  1NKX A;  4QSC A;  3EF7 A;  3B6T A;  2Y84 A;  2OZZ A;  4ECF A;  2Z23 A;  5H8S A;  2VGQ A;  4H67 A;  2AIX A;  4F39 A;  1QKA A;  3EHS A;  4DXB A;  3N6T A;  4RA1 A;  4RK2 A;  1B2H A;  4LP2 B;  4O3B A;  4OER A;  2Q9T A;  1JNF A;  3RTW B;  4NTL A;  4FAT A;  3OXN A;  2Z22 A;  5EHS A;  5I57 A;  3K2D A;  4DCX A;  1N3W A;  3WAE A;  4N13 A;  2VP1 A;  1EH3 A;  4GL8 A;  3OEL A;  4IO4 A;  1MQG A; 
#chains in the Genus database with same CATH topology
 1NMU A;  3PMV A;  4FIM A;  4QHQ A;  5F7V A;  3OO9 A;  3TTR A;  2Y7P A;  3LV0 A;  3CFX A;  1AWB A;  1FTJ A;  1SYI A;  3MVW A;  3CSG A;  2PMS A;  2Y5L A;  1KZ8 A;  3TTN A;  2QMX A;  2F6G A;  5CI5 A;  3W15 C;  4OXV A;  3Q27 A;  4NF5 B;  5ET8 A;  1FW0 A;  3CG3 A;  4N6D A;  3K1N A;  3MP8 A;  3CFZ A;  4LVQ A;  4RK9 A;  1JET A;  1UIU A;  1YPN A;  4IB2 A;  4MNP A;  2P1S A;  5I2K B;  4N4U A;  3K01 A;  4GXA A;  4ND9 A;  3LR1 A;  3OO6 A;  5EQA A;  3CI8 A;  5M2V A;  2ZNU A;  1M5E A;  2RC8 A;  1MXZ A;  1IME A;  3VLU A;  2Q74 A;  1H3D A;  1URG A;  4C0R A;  1D9Y A;  1FPL A;  3G3I A;  4OES A;  3HHG A;  3C31 A;  4GL0 A;  3V89 B;  4PAI A;  1URD A;  3GXA A;  1B40 A;  4GX3 A;  3RPW A;  2WBD A;  4MH5 A;  4NED A;  2G29 A;  2ANJ A;  5HBC A;  4P56 A;  1FBC A;  4ELP A;  2QPQ A;  4H8I A;  1QVS A;  4N8G A;  1FPK A;  3RN8 A;  3VDF A;  1QW0 A;  4GF8 A;  3P7I A;  4F1V A;  1AIV A;  4ISU A;  4TLM B;  4PE3 A;  1P1U A;  1MQD A;  1MXU A;  4WXJ A;  1IZ1 A;  5JK4 A;  2HPG A;  4KYS A;  5DTB A;  3RY3 A;  4I8C A;  1DBZ A;  2I58 A;  1SW1 A;  3BFU A;  2D3I A;  3HN0 A;  3DEL B;  3FAT A;  5IGA A;  4Q8R A;  4LQ5 A;  5I3S A;  3OSQ A;  4NF5 A;  4OAN A;  1Z7N E;  1B3L A;  5H8H B;  5JTY B;  3U72 A;  2KLF A;  2DDK A;  2DE3 A;  5FTI A;  3T1B A;  2F7B A;  4PAF A;  5I2K A;  4FED A;  2F5X A;  4IY6 A;  4JWO A;  1IXH A;  2BJJ X;  4I3Y A;  1FQF A;  4PFW A;  3VVD A;  2KQZ A;  4HCW A;  4P47 A;  3ZSF A;  3V83 A;  3E13 X;  1LAG E;  1XS5 A;  4YIC A;  1LB9 A;  4EQB A;  2XA5 A;  4YU0 A;  3RPL B;  4F2Q A;  3EHT A;  3S4U A;  1OLC A;  2FIX A;  1S50 A;  4WED A;  4GFR A;  5LOM A;  4JSO A;  2CZL A;  1MQJ A;  3H6T A;  1S9T A;  4OMB A;  5EQ7 A;  4GWX A;  4MNC A;  3KN7 A;  1OMP A;  2VD2 A;  2XXI A;  3PUW E;  3TFL A;  3SER A;  3TUS A;  3G3F A;  3BIH A;  1JW1 A;  3C35 A;  1LCF A;  1EYI A;  2DWJ A;  4K3F A;  3KJT A;  1P99 A;  1NI9 A;  2O69 A;  3TDJ A;  3GYY A;  2HFB A;  4GQO A;  4JVD A;  1TWY A;  4MCO A;  4DZ1 A;  3O6G A;  4U2R A;  1Y20 A;  2R71 A;  1B3E A;  4M4G A;  5I7I A;  3FXU A;  3SEV A;  1DCU A;  1GGG A;  5FHO A;  4NF4 B;  3OSR A;  4HXV A;  2OCU A;  3R7X A;  5H8H A;  5JTY A;  4ZED A;  1B52 A;  5DVJ A;  4WKM A;  3RTF B;  1B7U A;  1FTO A;  4ESX A;  5KDT B;  4R6H A;  4OHN A;  2AL5 A;  3N5L A;  1HSJ A;  1ZJL A;  1MDQ A;  2IEE A;  1MPD A;  4ELO A;  2B4M A;  2PFZ A;  4BDR A;  4FOR A;  2PVU A;  1XI6 A;  1US5 A;  3VLV A;  4QSE A;  5DW8 A;  1B0H A;  3M3F A;  4KXP A;  3H3G A;  3PGF A;  1B7Z A;  1FSA A;  3RPL A;  1P1O A;  5F1Q A;  4H5G A;  1SD3 A;  3W9W A;  4LA9 A;  1JVX A;  3K6X A;  2VD3 A;  5AA2 D;  4LQ2 A;  1ZIU A;  4MBP A;  2QSX A;  1LLS A;  2I3V A;  1US4 A;  5ET5 A;  2DVZ A;  3W9V A;  4R75 A;  3IB0 A;  4E0W A;  1N04 A;  4PFI A;  1PBQ A;  4X1B A;  1IIW A;  4OA4 A;  3HFU A;  2F3B A;  2UVJ A;  4OZ9 A;  5L9S A;  2UYE A;  1SDX A;  1MQI A;  3TCG A;  3GBA A;  4RJZ A;  4XXU A;  4P0G A;  3VXB A;  3U1O A;  2GRV A;  4MJO A;  2WBB A;  3CR9 A;  3MZ1 A;  4LON B;  4R74 A;  1EZP A;  4NGU A;  2GH9 A;  4OVP A;  3NOH A;  4KPT A;  4F22 A;  1QKB A;  3H6U A;  1DK4 A;  2I49 A;  1Y9U A;  1N7W A;  4PFB A;  4GWZ A;  5AA1 A;  1A99 A;  2RF1 A;  3A09 A;  1FPI A;  2ONS A;  4NF4 A;  3WAF A;  1DTG A;  5CBR A;  2H5Y A;  3V5A A;  5CMB A;  1MG1 A;  1IMC A;  1N76 A;  1M5C A;  2HQ0 A;  3V8X B;  1SBP A;  3IAZ A;  1SW4 A;  5KDT A;  1NV1 A;  1JW5 A;  1VFE A;  2F7A A;  2B65 A;  1K9Y A;  1POY 1;  4N6K A;  4MLQ A;  3QAX A;  2F3D A;  2H99 A;  2WYK A;  3MW0 A;  1B6H A;  2PBW A;  3GZG A;  5L8D A;  4POX A;  4MNI A;  3TTM A;  3MC2 A;  3CHG A;  4F3G A;  1IMF A;  2PYY A;  3QSL A;  4OET A;  1RDZ A;  3ODB A;  1DOT A;  2O1L A;  3FVO A;  2R9J A;  3U8Q A;  2B3F A;  2YJP A;  5I58 B;  4F1Y A;  1GTK A;  3TTL A;  2HXR A;  3T9H B;  3EQ1 A;  3A3U A;  4ZDM A;  2QS3 A;  2VOZ A;  4PF6 A;  3N6U A;  5ET6 A;  5H8Q B;  3OO7 A;  4H46 A;  5AA4 B;  2BJI A;  3EPE A;  5TU0 A;  1F9B A;  4RNS A;  4HCY A;  4IO6 A;  2QL3 A;  3HV1 A;  4KYD A;  3Q28 A;  3VVF A;  5I5P A;  4C1T A;  3TCF A;  3D1R A;  2GQ1 A;  1SI1 A;  3K4U A;  2P3N A;  4PP0 A;  3QK6 A;  4G77 A;  4JVC A;  4DIG A;  4YB6 A;  1TFA A;  1S7Y A;  3Q25 A;  4F3B A;  3QXM A;  1GVC A;  1IQ7 A;  1N3X A;  4HE1 A;  4R9F A;  1FTK A;  2UXA A;  1FBH A;  2OWT A;  2FIE A;  2QRY A;  2E1S A;  4ONY A;  1LGB C;  2CMO A;  4GXS B;  2I48 A;  3SEU A;  5I59 B;  4EDP A;  3SEW A;  5ELV A;  1B5J A;  1I6A A;  3JZJ A;  3OO8 A;  1FBD A;  4XEQ A;  4PFR A;  3G3J A;  3MJN A;  2XXR A;  4F29 A;  3LSL A;  1R9L A;  2ZZV A;  4YB5 A;  5I58 A;  1BIY A;  4OEU A;  1O63 A;  3S9N C;  4GBW A;  1OIB A;  5T3J A;  4P11 A;  1SYH A;  3O2A A;  1YZ0 A;  1A54 A;  4XFE A;  5DYH A;  1R6Z A;  3K6U A;  2HAU A;  2QFL A;  5H8Q A;  1OQH A;  4JWY A;  2FNC A;  5AA4 A;  3HST A;  4H1X A;  1FPE A;  4P0I A;  4GWW A;  2XXY A;  2NUV A;  2ZYN A;  5ITO A;  1II5 A;  2R8T A;  3S9M C;  3KGC A;  4H8J A;  4N17 A;  4PET A;  1BKA A;  1SW5 A;  4XKN A;  4PE5 B;  2W7Y A;  3PPQ A;  4BDM A;  2F78 A;  1BK4 A;  1FJ9 A;  3IFA A;  4PDH A;  1Z7M E;  4PQJ A;  4OEV A;  1CE2 A;  1M5F A;  4OFJ A;  4Z0I A;  1RKM A;  2YLN A;  1LBB A;  1QUJ A;  5EYG A;  1B4H A;  3USD A;  4RXL A;  5I59 A;  3SES A;  3SDF A;  2Y7W A;  2DWI A;  1LST A;  4HTG A;  1JEV A;  1H45 A;  4PBQ A;  1OVB A;  4R6Y A;  1PC3 A;  1NNF A;  2YPN A;  4P8B A;  2L5V A;  5CMK A;  3OEM A;  1B51 A;  2FVZ A;  1O7T A;  4DCY A;  1Y3P A;  3QIM A;  2Y5K A;  3PV0 E;  3MVX A;  4XKQ A;  5K2Y A;  1BTJ A;  3E9X A;  5AA2 B;  1URS A;  2E0S A;  2O6A A;  3C33 A;  4F19 A;  1JQF A;  1MQH A;  2OLB A;  3JV9 A;  3ECR A;  4HE0 A;  4AS4 A;  1FQD A;  2F35 A;  2HXW A;  4GD5 A;  1G0H A;  3PUX E;  4PF8 A;  2Y7R A;  1H44 A;  1LFH A;  5TP9 B;  3UGW A;  4HW8 A;  3K6W A;  4R2B A;  2ZYK A;  2OK2 A;  1VE4 A;  4MF3 A;  1FTL A;  1MPC A;  2B4L A;  2XHD A;  3FVG A;  3O6I A;  1BP5 A;  1LBX A;  2OBG A;  3MAM A;  2DP8 A;  1UIV A;  4GX4 A;  4NQ8 A;  3Q26 A;  4OVT A;  4EUO A;  1ELJ A;  2I0C A;  3RT8 A;  3MVZ A;  1UTB B;  2ALU A;  3C36 A;  3FUZ A;  5DVI A;  3F11 A;  1LAF E;  1MDP 1;  2RC9 A;  5KZT A;  3THI A;  3MP6 A;  1Y3N A;  3T66 A;  2G93 A;  2AL4 A;  2HCA A;  4JSD A;  1IXC A;  3FJ7 A;  1H76 A;  2NWJ A;  2F97 A;  2HAV A;  2H98 A;  3D4C A;  3H6W A;  1MH4 A;  4X48 A;  2XXX A;  3UA8 A;  5AA2 A;  2XXH A;  2LAO A;  1TFD A;  3N94 A;  1J1N A;  4G2Z A;  1RDX A;  2X7Q A;  3T9U A;  5EYF A;  1QGX A;  5I2N A;  4JB7 A;  4MIJ A;  1FBG A;  2OWS A;  1NNP A;  3DM0 A;  1NNK A;  2XWI A;  1USY H;  4X8R A;  2DE2 A;  4BDN A;  4H45 A;  5TP9 A;  3FBP A;  4EF1 A;  1NUZ A;  2M8C A;  1GV8 A;  3L6G A;  4KR5 A;  1YCJ A;  1NUW A;  1CB6 A;  5B7D A;  3H7M A;  3L6H A;  4YB7 A;  3IFC A;  1IMD A;  1QUI A;  1LBW A;  2XD2 A;  1USY E;  4AB6 A;  1ZLQ A;  3FXQ A;  2ZZW A;  2UVI A;  2DQV A;  1XVY A;  4L17 A;  4PGP A;  1Q1K A;  3CSB A;  1LFI A;  1Y1Z A;  1LAX A;  1UTB A;  3CG1 A;  3TCH A;  2O51 A;  4THI A;  2X7P A;  3KC0 A;  2ZYM A;  1LB8 A;  4TOZ A;  3RNN A;  1UTH B;  3CFL A;  3KEI A;  2XWO A;  2VT5 A;  3BKI B;  1B9J A;  4GLI A;  4N15 A;  3BFT A;  3LBS A;  1P1Q A;  1VSO A;  1M5D A;  4QFN A;  2VPN A;  4LZ8 A;  4PTK A;  4FE8 A;  3B8B A;  4PCD A;  5FHM A;  4OFO A;  5ISU A;  5HPQ A;  1NV2 A;  3LUY A;  2ZMB A;  1EZO A;  3FVN A;  3GLB A;  3TEL A;  3PD9 A;  3VFJ A;  1YAE A;  4GBV A;  3UOR A;  3KOS A;  3O97 A;  3DP6 A;  4AS5 A;  5ICQ A;  2ZNT A;  3T93 B;  4OWD A;  3PTY A;  1FTM A;  4U1O A;  4H6D A;  1NNT A;  3O6H A;  3TQL A;  4MAG A;  1QJM A;  5K2X A;  1A40 A;  2O68 A;  2ZXT A;  3C32 A;  1PBP A;  2A5S A;  3KBR A;  5DEX B;  3G3H A;  1B3H A;  1P1N A;  4AQ4 A;  1NV4 A;  4HS7 A;  2DWH A;  4DI4 B;  3EKI A;  4QFP A;  3S9L C;  1D9Q A;  3RGY A;  3JYR A;  1MPB A;  2XXU A;  1SI0 A;  4JWX A;  3IOU A;  3MP1 A;  4ZE9 A;  2IA4 A;  2WX9 A;  1A55 A;  1IXG A;  5A5L A;  3K1P A;  3U94 A;  3TMG A;  1IMB A;  4OTE A;  3M3L A;  1UTH A;  3TQW A;  5EQ8 A;  3B6W A;  1ATG A;  4KFQ A;  2WKY A;  4O8M A;  2PT1 A;  3OEN A;  2DOJ A;  2ESN A;  3I3V A;  3KJ7 A;  3OD7 A;  3O29 A;  2F34 A;  4G68 B;  2UVH A;  3TAJ A;  4F31 B;  1TT1 A;  3E4R A;  4U1Z A;  3IOT A;  5FBP A;  4O7I A;  1LBV A;  1KA1 A;  1FPD A;  2Z8F A;  4DDD A;  1LBC A;  2GFE A;  3MZB A;  2GHB A;  2P3V A;  3GBB A;  3MBP A;  1MY4 A;  1Y4C A;  1IIT A;  3CRB A;  4FEB A;  1WOD A;  2PCR A;  5J16 A;  2XXW A;  4R9G A;  5KCJ B;  4OYV A;  5CRY A;  2Q89 A;  1SW2 A;  5BWJ A;  2HZL A;  2XXT A;  3A3C A;  3MWB A;  3KSJ A;  1ZKB A;  1BLF A;  1MY1 A;  4Z7E A;  5DEX A;  4BDQ A;  2A5T B;  3ZKL A;  2WEF A;  1LAH E;  2XWV A;  3IJO B;  3H6V A;  3TEP A;  2DE4 A;  3S2V A;  1MS7 A;  2B3B A;  3I6V A;  4QBA A;  1LEV A;  1HSE A;  2V25 A;  3TKD A;  3E79 A;  1KA0 A;  5B70 A;  3KG2 A;  2QMW A;  4GWY A;  1D3K A;  4NF8 B;  2HEU A;  3ILU B;  2QS1 A;  5ICT A;  3G3K A;  4GVO A;  1PB7 A;  1VFD A;  4EXK A;  4QFL A;  4BLA A;  1Y1M A;  3UP9 A;  4C1U A;  4N81 A;  4P9K A;  1JVY A;  3SZP A;  2NXO A;  4ZEB A;  4XKP A;  1Q9D A;  4G68 A;  2PX1 A;  4QXD A;  1P1W A;  3QUJ A;  3SEX A;  3PMW A;  3EN3 A;  4JBZ A;  3LSX A;  4Q30 B;  1ZMG A;  2QVR A;  4KYE A;  3IX1 A;  4PGN A;  1YTV A;  3BBR A;  3PPR A;  2H4I A;  4O94 A;  4KCD A;  1FQB A;  4QRZ A;  3PD8 A;  4QFK A;  4IY5 A;  3LSF B;  4EQ7 A;  2XWK A;  1FQC A;  4N07 A;  1D9V A;  5KCJ A;  1AH5 A;  4YMB A;  4ZEK A;  4LZ5 A;  4MMP A;  2O84 X;  4EQ9 A;  2RCB A;  4GIZ A;  3CVG A;  3IO6 A;  1PB9 A;  2NVU B;  3KN8 A;  4ZS9 A;  4O7M A;  2MKZ A;  3HCQ A;  2Y7K A;  2A5T A;  3SEY A;  3HHF A;  1MH3 A;  4YKP A;  4P3L A;  4GWO A;  4MX6 A;  1H43 A;  3E3K A;  3T0J A;  2QVU A;  1FQE A;  2THI A;  1JP4 A;  5H8N B;  3RUM A;  3MST A;  4GWU A;  5IZ3 B;  5CMC A;  2UVG A;  4YKK A;  2ONK E;  4NF8 A;  4G8M A;  2XX7 A;  4IO2 A;  3IR1 A;  4H5F A;  4QF9 A;  4MFI A;  2QVV A;  2P0S A;  2I4C A;  3C34 A;  3QUF A;  3PMX A;  3FD3 A;  1VDW A;  3DP8 A;  3DLN A;  2V3Q A;  4RYA A;  1XHY A;  1GR2 A;  2PFY A;  2XD3 A;  4YKJ A;  1IUD A;  2CZI A;  4I62 A;  4BDL A;  4NWC A;  4G8N A;  3TTK A;  5CC2 A;  1HSL A;  3IOR A;  1FPG A;  3K6V A;  1B5I A;  2H25 A;  4NWD A;  3SKP A;  3KBZ A;  3RQT A;  4XF5 A;  2F7C A;  5F24 A;  1NV6 A;  2RC7 A;  3TZA A;  2V84 A;  5EHM A;  1L5T A;  2V93 A;  2KR0 A;  2REJ A;  2Z8E A;  2Q2C A;  1DPP A;  2DYX A;  5AA3 A;  4PDD A;  1M5B A;  1SPI A;  3E78 A;  1R9Q A;  4MHF A;  1A8F A;  2V3U A;  4OVR A;  4E0X A;  3LUZ A;  2AYS A;  2V4C A;  5TPA B;  3H4Z A;  4WEP A;  2CZH A;  3FJM A;  5FHN A;  5L9O A;  1I69 A;  3UN6 A;  5CBS A;  4POW A;  1EU8 A;  1MM7 A;  2XXK A;  3PUZ E;  2O7I A;  4ZEI A;  2VHA A;  5H8N A;  1NV0 A;  3C9H A;  5IZ3 A;  4R6K A;  3EHU A;  3MYU A;  4GOT A;  1QUL A;  1MXX A;  4FAJ A;  4EXL A;  5A5X B;  3K0V A;  2HZK A;  3FV1 A;  5I2N B;  4Q0C A;  5DT6 A;  4YZZ A;  1PB8 A;  1WDN A;  1K9Z A;  3IB2 A;  1D4N A;  3IK6 B;  5FTH A;  4FEC A;  4OFL A;  4GRK A;  1PDA A;  4LN5 A;  1FBP A;  2NOO A;  4JDF A;  5AE4 A;  1RDY A;  1ZU0 A;  3B50 A;  3N26 A;  1DMB A;  4G61 A;  1G0I A;  3VE1 B;  4X9T A;  4ZE8 A;  1FBF A;  3U93 A;  4I9D A;  3IJX B;  1NH8 A;  3FGS A;  1PEB A;  1SVX B;  2Q8J A;  2CZK A;  4XKR A;  3MPK A;  4G68 C;  3OEK A;  3IB1 A;  3FXR A;  3HPI A;  1MY0 A;  1R1N A;  4DLD A;  4EF2 A;  5TPA A;  3KC1 A;  3Q29 A;  4G8H A;  3MZ9 A;  2XXP A;  2XXQ A;  3G3G A;  2I6E A;  2F6P A;  1NUX A;  1YYZ A;  2RCA A;  1FCK A;  4ESW A;  4G4P A;  1NV5 A;  1XT8 A;  3RT6 B;  3U65 A;  4MLV A;  5I56 B;  1B5H A;  1Y4T A;  1A7L A;  4YMA A;  4F3P A;  2OWZ A;  4FJP A;  1DTZ A;  1FPF A;  1CNQ A;  2FA7 A;  3O9P A;  5A5X A;  1FPB A;  1MXW A;  1FQA A;  4U22 A;  3VXC A;  3MPL A;  3QYT A;  1LBZ A;  5IKB A;  4KHZ E;  4PFY A;  2D5W A;  2ABH A;  3M8U A;  2CEX A;  1SQY A;  1B4Z A;  4IGT A;  4DE8 A;  2WYP A;  2I3W A;  2Y7I A;  3IOW A;  4KCC A;  1XC1 A;  1N84 A;  4QSD A;  4P1L A;  2V3T A;  1LCT A;  3H06 B;  3R26 A;  4IGR A;  2DWA A;  1T0K A;  2P2A A;  3UIF A;  3LSW A;  4OQO A;  2DS9 A;  4ZEC A;  3S9E A;  1FBE A;  3T96 B;  1YXI A;  2D21 A;  3OOA A;  4NG7 A;  1O64 A;  3CIJ A;  3FIR A;  1TXF A;  3K02 A;  1B58 A;  4U23 A;  2Q2A A;  3TOD A;  4NMY A;  3PU5 A;  4LAT A;  4OVJ A;  2O7U A;  4Q5T A;  2DXY A;  3MVY A;  1WVJ A;  1Y3Q A;  5H8F B;  1IEJ A;  4N6P A;  2F8D A;  3DP4 A;  4NN3 A;  4XTC Q;  4UAC A;  2Q88 A;  5LTC A;  2R6G E;  1MY2 A;  3KFM A;  4KI0 E;  1N7X A;  5I56 A;  3H03 A;  4GWS A;  4NX1 A;  4PFT A;  2ZNS A;  1VR5 A;  4N91 A;  4I40 A;  1ZBM A;  5IM2 A;  4BDO A;  2XX8 A;  5J1D A;  5HM4 B;  1XOC A;  2XXV A;  1B3G A;  3ISP A;  1B1H A;  3T9X B;  4LUB A;  3VV5 A;  3C4M A;  1DPE A;  5IAI A;  2XX9 A;  1OVT A;  2UYF A;  3T9V A;  1N0T A;  1B7H A;  3D4G A;  5ET7 A;  4YKI A;  5CM6 A;  4AB5 A;  3R6U A;  4UA8 A;  4LZ7 A;  1B3F A;  1INP A;  2Z8D A;  1RYX A;  2CEY A;  2GHA A;  3UK4 A;  4M1V A;  1JW4 A;  2RIN A;  3I5O A;  3RYD A;  4DI3 D;  2FHY A;  1MRP A;  4JVI A;  1IXI A;  5I84 A;  1OLA A;  2DSF A;  1POT A;  5IZ1 A;  5H8F A;  3PUV E;  3MQ9 A;  4ELQ A;  3FAS A;  4F18 A;  1QUK A;  3O66 A;  3PPO A;  2Q8M A;  4H0W A;  1AMF A;  2O1M A;  3T22 A;  2QS4 A;  1NFT A;  3FJG A;  1B0L A;  2REG A;  3TYH A;  1FJ6 A;  4N8Y A;  4U21 A;  3MUQ A;  1ZTY A;  2X26 A;  4MEV A;  5LDZ A;  1MXY A;  4NF0 A;  4NE4 A;  2RKM A;  4ELR A;  2VPO A;  5ESY A;  4U4S A;  3BIG A;  1KWH A;  1ANF A;  5IZZ A;  1NL5 A;  4X04 A;  2PT2 A;  1I6B A;  3KZG A;  3B7D A;  3IL1 B;  2H9B A;  4HE2 A;  1LFG A;  3O28 A;  3K00 A;  4R72 A;  1LBY A;  4RPN A;  4ZEF A;  2I0B A;  4NF6 B;  2F36 A;  3HO7 A;  1JEU A;  4PC9 A;  3U92 A;  1MXV A;  4P1E A;  4RPO A;  3IOV A;  3PPN A;  1EZ9 A;  3K1M A;  3FVK A;  2DVC A;  1I6Q A;  4UAB A;  2ONR A;  3A29 A;  1MY3 A;  1B05 A;  1NH7 A;  4FBP A;  4DXU A;  2FYI A;  3KOT A;  1RYO A;  2OJT A;  3KSX A;  1MM6 A;  5DVF A;  4QFO A;  3ILT B;  3AXF A;  1AOV A;  4ZZE A;  4OEN A;  1EYJ A;  5JEI A;  3ZS6 A;  1OQG A;  3G7W A;  5BUU A;  3PUY E;  3FZV A;  5EYH A;  2ZZX A;  1XVX A;  1NV3 A;  3IO4 A;  3M3K A;  2QS2 A;  4I1D A;  2OX3 A;  4TLL B;  2I4B A;  1A8E A;  1NUY A;  3FXB A;  1B32 A;  3OMB A;  4ZZA A;  3B6Q A;  4XIG Q;  2ZYO A;  3RLF E;  4F1U A;  5CMM A;  4R2F A;  4OVQ A;  1Q35 A;  4O3C A;  3PPP A;  4F2O A;  4TQU Q;  4GX6 A;  1B46 A;  1UQW A;  5I57 B;  5L9M A;  2JJK A;  1B1X A;  4IO7 A;  4PBH A;  3ONM A;  4JXI A;  3FV2 A;  4YAH X;  3ZKK A;  4NF6 A;  1DSN A;  3VVE A;  4IO5 A;  4KD5 A;  2DXR A;  3LC8 A;  4DXC A;  4IO3 A;  3TPA A;  3SET A;  4KQP A;  4O3A A;  4X1D A;  5ITP A;  4U4X A;  4PFU A;  4RY1 A;  1NV7 A;  1AL3 A;  4OVS A;  3KN3 A;  4F3S A;  4H65 A;  3VLW A;  2QJE A;  4R73 A;  1NKX A;  4QSC A;  3EF7 A;  1EYK A;  3B6T A;  2Y84 A;  4PAK A;  2OZZ A;  4ECF A;  2Z23 A;  5H8S A;  2VGQ A;  4H67 A;  4NHB A;  2AIX A;  4F39 A;  1IMA A;  1QKA A;  3EHS A;  4DXB A;  3N6T A;  4IR8 A;  4RA1 A;  2FBP A;  4RK2 A;  1B2H A;  3ROJ A;  4LP2 B;  4O3B A;  3QMF A;  4OER A;  2Q9T A;  1JNF A;  3RTW B;  4I3E A;  4NTL A;  2HHM A;  1FPJ A;  4FAT A;  3OXN A;  2Z22 A;  5EHS A;  5I57 A;  3K2D A;  5EQ9 A;  4DCX A;  1N3W A;  3WAE A;  4N13 A;  1FRP A;  2VP1 A;  1EH3 A;  1FTA A;  4GL8 A;  3OEL A;  4IO4 A;  4NAP A;  1MQG A; 
#chains in the Genus database with same CATH homology
 1NMU A;  3PMV A;  4FIM A;  4QHQ A;  5F7V A;  3OO9 A;  3TTR A;  2Y7P A;  3CFX A;  1FTJ A;  1SYI A;  3MVW A;  3CSG A;  2PMS A;  3TTN A;  2QMX A;  2F6G A;  5CI5 A;  3W15 C;  4OXV A;  3Q27 A;  4NF5 B;  1FW0 A;  3CG3 A;  3K1N A;  3MP8 A;  3CFZ A;  4LVQ A;  4RK9 A;  1JET A;  1UIU A;  1YPN A;  4IB2 A;  2P1S A;  5I2K B;  3K01 A;  4GXA A;  4ND9 A;  3LR1 A;  3OO6 A;  3CI8 A;  5M2V A;  2ZNU A;  1M5E A;  2RC8 A;  1MXZ A;  3VLU A;  1H3D A;  1URG A;  4C0R A;  1D9Y A;  3G3I A;  4OES A;  3HHG A;  3C31 A;  4GL0 A;  3V89 B;  1URD A;  3GXA A;  1B40 A;  3RPW A;  4MH5 A;  4NED A;  2G29 A;  2ANJ A;  5HBC A;  4ELP A;  2QPQ A;  4H8I A;  1QVS A;  3RN8 A;  3VDF A;  1QW0 A;  4GF8 A;  3P7I A;  4F1V A;  1AIV A;  4ISU A;  4TLM B;  1P1U A;  1MQD A;  1MXU A;  4WXJ A;  1IZ1 A;  5JK4 A;  5DTB A;  4KYS A;  3RY3 A;  4I8C A;  2I58 A;  1SW1 A;  3BFU A;  2D3I A;  3HN0 A;  3DEL B;  3FAT A;  4Q8R A;  4LQ5 A;  3OSQ A;  4NF5 A;  1Z7N E;  1B3L A;  5H8H B;  5JTY B;  3U72 A;  2KLF A;  2DE3 A;  5FTI A;  2F7B A;  5I2K A;  4FED A;  2F5X A;  4IY6 A;  4JWO A;  1IXH A;  2BJJ X;  1FQF A;  4PFW A;  3VVD A;  4HCW A;  3ZSF A;  3V83 A;  3E13 X;  1LAG E;  1XS5 A;  4YIC A;  1LB9 A;  4EQB A;  4YU0 A;  4F2Q A;  3EHT A;  3S4U A;  1OLC A;  1S50 A;  4WED A;  4GFR A;  5LOM A;  4JSO A;  2CZL A;  1MQJ A;  3H6T A;  1S9T A;  4OMB A;  3KN7 A;  1OMP A;  2VD2 A;  2XXI A;  3PUW E;  3TFL A;  3SER A;  3TUS A;  3G3F A;  1JW1 A;  3C35 A;  1LCF A;  2DWJ A;  4K3F A;  3KJT A;  1P99 A;  2O69 A;  3TDJ A;  2HFB A;  4GQO A;  1TWY A;  4DZ1 A;  3O6G A;  4U2R A;  1Y20 A;  2R71 A;  1B3E A;  4M4G A;  3FXU A;  3SEV A;  5FHO A;  1GGG A;  3OSR A;  4NF4 B;  2OCU A;  3R7X A;  5H8H A;  5JTY A;  4ZED A;  1B52 A;  5DVJ A;  4WKM A;  3RTF B;  1B7U A;  1FTO A;  4ESX A;  5KDT B;  4R6H A;  4OHN A;  2AL5 A;  3N5L A;  1HSJ A;  1ZJL A;  1MDQ A;  2IEE A;  1MPD A;  4ELO A;  4BDR A;  4FOR A;  2PVU A;  1US5 A;  3VLV A;  4QSE A;  1B0H A;  3M3F A;  3H3G A;  3PGF A;  1B7Z A;  1P1O A;  5F1Q A;  4H5G A;  1SD3 A;  3W9W A;  4LA9 A;  1JVX A;  3K6X A;  2VD3 A;  5AA2 D;  4LQ2 A;  1ZIU A;  4MBP A;  2QSX A;  1LLS A;  2I3V A;  1US4 A;  2DVZ A;  3W9V A;  4R75 A;  3IB0 A;  4E0W A;  1N04 A;  1PBQ A;  4X1B A;  1IIW A;  2UVJ A;  4OZ9 A;  5L9S A;  2UYE A;  1SDX A;  1MQI A;  3TCG A;  3GBA A;  4RJZ A;  4XXU A;  4P0G A;  3VXB A;  3U1O A;  2GRV A;  3CR9 A;  3MZ1 A;  4LON B;  4R74 A;  1EZP A;  2GH9 A;  4KPT A;  4F22 A;  1QKB A;  3H6U A;  2I49 A;  1Y9U A;  1N7W A;  5AA1 A;  1A99 A;  2RF1 A;  3A09 A;  2ONS A;  4NF4 A;  3WAF A;  1DTG A;  5CBR A;  2H5Y A;  3V5A A;  5CMB A;  1MG1 A;  1N76 A;  1M5C A;  2HQ0 A;  3V8X B;  1SBP A;  3IAZ A;  1SW4 A;  5KDT A;  1JW5 A;  1VFE A;  2F7A A;  2B65 A;  1POY 1;  4MLQ A;  3QAX A;  2H99 A;  3MW0 A;  1B6H A;  2PBW A;  3GZG A;  5L8D A;  4POX A;  3TTM A;  3MC2 A;  4F3G A;  2PYY A;  3QSL A;  4OET A;  3ODB A;  1DOT A;  2O1L A;  3FVO A;  2R9J A;  3U8Q A;  2B3F A;  2YJP A;  5I58 B;  4F1Y A;  1GTK A;  3TTL A;  3T9H B;  3EQ1 A;  3A3U A;  4ZDM A;  2QS3 A;  2VOZ A;  3N6U A;  5H8Q B;  3OO7 A;  5AA4 B;  3EPE A;  5TU0 A;  1F9B A;  4RNS A;  4HCY A;  4IO6 A;  2QL3 A;  3HV1 A;  4KYD A;  3Q28 A;  3VVF A;  4C1T A;  3TCF A;  1SI1 A;  3K4U A;  4PP0 A;  3QK6 A;  4G77 A;  4DIG A;  4YB6 A;  1TFA A;  1S7Y A;  3Q25 A;  4F3B A;  3QXM A;  1GVC A;  1IQ7 A;  1N3X A;  4R9F A;  1FTK A;  2UXA A;  2OWT A;  2QRY A;  2E1S A;  4ONY A;  1LGB C;  2CMO A;  4GXS B;  2I48 A;  3SEU A;  5I59 B;  4EDP A;  3SEW A;  5ELV A;  1B5J A;  1I6A A;  3JZJ A;  3OO8 A;  3G3J A;  3MJN A;  2XXR A;  4F29 A;  3LSL A;  1R9L A;  4YB5 A;  5I58 A;  1BIY A;  4OEU A;  1O63 A;  3S9N C;  1OIB A;  4P11 A;  1SYH A;  3O2A A;  1A54 A;  5DYH A;  1R6Z A;  3K6U A;  2HAU A;  5H8Q A;  1OQH A;  4JWY A;  2FNC A;  5AA4 A;  3HST A;  4H1X A;  4P0I A;  2XXY A;  2NUV A;  2ZYN A;  5ITO A;  1II5 A;  3S9M C;  3KGC A;  4H8J A;  4PET A;  1BKA A;  1SW5 A;  4XKN A;  4PE5 B;  2W7Y A;  3PPQ A;  4BDM A;  2F78 A;  1Z7M E;  4PQJ A;  4OEV A;  1CE2 A;  1M5F A;  4OFJ A;  4Z0I A;  1RKM A;  2YLN A;  1LBB A;  1QUJ A;  1B4H A;  3USD A;  4RXL A;  5I59 A;  3SES A;  3SDF A;  2Y7W A;  2DWI A;  1LST A;  4HTG A;  1JEV A;  1H45 A;  1OVB A;  4R6Y A;  1PC3 A;  1NNF A;  2YPN A;  5CMK A;  3OEM A;  1B51 A;  1O7T A;  4DCY A;  1Y3P A;  3QIM A;  3PV0 E;  3MVX A;  4XKQ A;  5K2Y A;  1BTJ A;  5AA2 B;  3E9X A;  1URS A;  2E0S A;  2O6A A;  3C33 A;  4F19 A;  1JQF A;  1MQH A;  2OLB A;  3JV9 A;  3ECR A;  1FQD A;  2F35 A;  2HXW A;  4GD5 A;  3PUX E;  2Y7R A;  1H44 A;  1LFH A;  5TP9 B;  3UGW A;  4HW8 A;  3K6W A;  4R2B A;  2ZYK A;  2OK2 A;  1VE4 A;  4MF3 A;  1FTL A;  1MPC A;  2XHD A;  3FVG A;  3O6I A;  1BP5 A;  2OBG A;  3MAM A;  2DP8 A;  1UIV A;  3Q26 A;  4EUO A;  1ELJ A;  2I0C A;  3RT8 A;  3MVZ A;  1UTB B;  2ALU A;  3C36 A;  3FUZ A;  5DVI A;  3F11 A;  1LAF E;  1MDP 1;  2RC9 A;  5KZT A;  3THI A;  3MP6 A;  1Y3N A;  3T66 A;  2G93 A;  2AL4 A;  2HCA A;  4JSD A;  1IXC A;  3FJ7 A;  1H76 A;  2NWJ A;  2F97 A;  2HAV A;  2H98 A;  3D4C A;  3H6W A;  1MH4 A;  4X48 A;  2XXX A;  3UA8 A;  5AA2 A;  2XXH A;  2LAO A;  1TFD A;  3N94 A;  1J1N A;  4G2Z A;  2X7Q A;  3T9U A;  5EYF A;  5I2N A;  4JB7 A;  2OWS A;  1NNP A;  3DM0 A;  1NNK A;  1USY H;  2DE2 A;  4BDN A;  5TP9 A;  4EF1 A;  2M8C A;  1GV8 A;  3L6G A;  4KR5 A;  1YCJ A;  1CB6 A;  5B7D A;  3H7M A;  3L6H A;  4YB7 A;  1QUI A;  2XD2 A;  1USY E;  4AB6 A;  1ZLQ A;  3FXQ A;  2UVI A;  2DQV A;  1XVY A;  4L17 A;  1Q1K A;  3CSB A;  1LFI A;  1Y1Z A;  1LAX A;  1UTB A;  3CG1 A;  3TCH A;  2O51 A;  4THI A;  2X7P A;  2ZYM A;  1LB8 A;  4TOZ A;  3RNN A;  1UTH B;  3CFL A;  3KEI A;  3BKI B;  1B9J A;  4GLI A;  3BFT A;  3LBS A;  1P1Q A;  1VSO A;  1M5D A;  4QFN A;  4LZ8 A;  4FE8 A;  5FHM A;  4OFO A;  5ISU A;  5HPQ A;  3LUY A;  2ZMB A;  1EZO A;  3FVN A;  3GLB A;  3TEL A;  3PD9 A;  3VFJ A;  1YAE A;  3UOR A;  3KOS A;  3O97 A;  3DP6 A;  5ICQ A;  2ZNT A;  3T93 B;  4OWD A;  1FTM A;  4U1O A;  4H6D A;  1NNT A;  3O6H A;  3TQL A;  1QJM A;  5K2X A;  1A40 A;  2O68 A;  2ZXT A;  3C32 A;  1PBP A;  2A5S A;  3KBR A;  5DEX B;  3G3H A;  1B3H A;  1P1N A;  4AQ4 A;  4HS7 A;  2DWH A;  4QFP A;  3S9L C;  3RGY A;  3JYR A;  1MPB A;  2XXU A;  1SI0 A;  4JWX A;  3IOU A;  3MP1 A;  4ZE9 A;  2IA4 A;  1A55 A;  1IXG A;  3K1P A;  3U94 A;  3TMG A;  4OTE A;  3M3L A;  1UTH A;  3TQW A;  3B6W A;  1ATG A;  4KFQ A;  2WKY A;  2PT1 A;  3OEN A;  2DOJ A;  2ESN A;  3I3V A;  3KJ7 A;  3OD7 A;  3O29 A;  2F34 A;  4G68 B;  2UVH A;  3TAJ A;  4F31 B;  1TT1 A;  3E4R A;  4U1Z A;  3IOT A;  2Z8F A;  4DDD A;  1LBC A;  2GFE A;  3MZB A;  2GHB A;  3GBB A;  3MBP A;  1MY4 A;  1Y4C A;  1IIT A;  3CRB A;  4FEB A;  1WOD A;  2XXW A;  4R9G A;  5KCJ B;  4OYV A;  5CRY A;  2Q89 A;  1SW2 A;  5BWJ A;  2HZL A;  2XXT A;  3A3C A;  3MWB A;  3KSJ A;  1ZKB A;  1BLF A;  1MY1 A;  4Z7E A;  5DEX A;  4BDQ A;  2A5T B;  3ZKL A;  1LAH E;  3IJO B;  3H6V A;  3TEP A;  2DE4 A;  3S2V A;  1MS7 A;  2B3B A;  3I6V A;  1HSE A;  2V25 A;  3TKD A;  5B70 A;  3KG2 A;  2QMW A;  1D3K A;  4NF8 B;  2HEU A;  3ILU B;  2QS1 A;  5ICT A;  3G3K A;  4GVO A;  1PB7 A;  1VFD A;  4EXK A;  4QFL A;  4BLA A;  1Y1M A;  3UP9 A;  4C1U A;  1JVY A;  2NXO A;  4ZEB A;  4XKP A;  4G68 A;  2PX1 A;  1P1W A;  3QUJ A;  3SEX A;  3PMW A;  3EN3 A;  4JBZ A;  3LSX A;  4Q30 B;  1ZMG A;  4KYE A;  3IX1 A;  1YTV A;  3BBR A;  3PPR A;  2H4I A;  4KCD A;  1FQB A;  4QRZ A;  3PD8 A;  4QFK A;  4IY5 A;  3LSF B;  4EQ7 A;  1FQC A;  4N07 A;  1D9V A;  5KCJ A;  1AH5 A;  4YMB A;  4ZEK A;  4LZ5 A;  2O84 X;  4EQ9 A;  2RCB A;  4GIZ A;  3CVG A;  3IO6 A;  1PB9 A;  2NVU B;  3KN8 A;  4ZS9 A;  3HCQ A;  2Y7K A;  2A5T A;  3SEY A;  3HHF A;  1MH3 A;  4YKP A;  4GWO A;  1H43 A;  3E3K A;  1FQE A;  2THI A;  5H8N B;  3RUM A;  5CMC A;  2UVG A;  4YKK A;  2ONK E;  4NF8 A;  4G8M A;  2XX7 A;  4IO2 A;  3IR1 A;  4H5F A;  4QF9 A;  4MFI A;  2P0S A;  2I4C A;  3C34 A;  3QUF A;  3PMX A;  3FD3 A;  3DP8 A;  3DLN A;  2V3Q A;  4RYA A;  1XHY A;  1GR2 A;  2XD3 A;  4YKJ A;  1IUD A;  4I62 A;  4BDL A;  4NWC A;  4G8N A;  3TTK A;  5CC2 A;  1HSL A;  3IOR A;  3K6V A;  1B5I A;  2H25 A;  4NWD A;  3SKP A;  3RQT A;  2F7C A;  2RC7 A;  3TZA A;  2V84 A;  5EHM A;  1L5T A;  2V93 A;  2REJ A;  2Z8E A;  2Q2C A;  1DPP A;  2DYX A;  5AA3 A;  1M5B A;  1R9Q A;  1A8F A;  2V3U A;  4E0X A;  2AYS A;  5TPA B;  3H4Z A;  4WEP A;  3FJM A;  5FHN A;  5L9O A;  1I69 A;  3UN6 A;  5CBS A;  4POW A;  1EU8 A;  1MM7 A;  3PUZ E;  2O7I A;  4ZEI A;  2VHA A;  5H8N A;  3C9H A;  4R6K A;  3EHU A;  4GOT A;  1QUL A;  1MXX A;  4FAJ A;  4EXL A;  5A5X B;  3K0V A;  2HZK A;  3FV1 A;  5I2N B;  4Q0C A;  5DT6 A;  4YZZ A;  1PB8 A;  1WDN A;  3IB2 A;  1D4N A;  3IK6 B;  5FTH A;  4FEC A;  4OFL A;  4GRK A;  1PDA A;  2NOO A;  4JDF A;  5AE4 A;  1ZU0 A;  3N26 A;  1DMB A;  3VE1 B;  4X9T A;  4ZE8 A;  3U93 A;  4I9D A;  3IJX B;  1NH8 A;  3FGS A;  1PEB A;  1SVX B;  2Q8J A;  4XKR A;  3MPK A;  4G68 C;  3OEK A;  3IB1 A;  3FXR A;  3HPI A;  1MY0 A;  1R1N A;  4DLD A;  4EF2 A;  5TPA A;  3Q29 A;  4G8H A;  3MZ9 A;  2XXP A;  2XXQ A;  3G3G A;  2I6E A;  2F6P A;  2RCA A;  1FCK A;  4ESW A;  4G4P A;  1XT8 A;  3RT6 B;  4MLV A;  5I56 B;  1B5H A;  1Y4T A;  1A7L A;  4YMA A;  4F3P A;  4FJP A;  1DTZ A;  2FA7 A;  3O9P A;  5A5X A;  1MXW A;  1FQA A;  4U22 A;  3VXC A;  3MPL A;  3QYT A;  5IKB A;  4KHZ E;  4PFY A;  2D5W A;  2ABH A;  3M8U A;  1SQY A;  1B4Z A;  4IGT A;  4DE8 A;  2I3W A;  2Y7I A;  3IOW A;  4KCC A;  1XC1 A;  1N84 A;  4QSD A;  2V3T A;  1LCT A;  3H06 B;  3R26 A;  4IGR A;  2DWA A;  1T0K A;  2P2A A;  3UIF A;  3LSW A;  4OQO A;  2DS9 A;  4ZEC A;  3S9E A;  3T96 B;  2D21 A;  3OOA A;  1O64 A;  3CIJ A;  3FIR A;  1TXF A;  3K02 A;  1B58 A;  4U23 A;  2Q2A A;  3TOD A;  4NMY A;  3PU5 A;  4LAT A;  4OVJ A;  2O7U A;  4Q5T A;  2DXY A;  3MVY A;  1WVJ A;  1Y3Q A;  5H8F B;  1IEJ A;  4N6P A;  2F8D A;  3DP4 A;  4XTC Q;  4UAC A;  2Q88 A;  2R6G E;  1MY2 A;  3KFM A;  4KI0 E;  1N7X A;  5I56 A;  3H03 A;  4PFT A;  2ZNS A;  1VR5 A;  1ZBM A;  4BDO A;  2XX8 A;  5J1D A;  5HM4 B;  1XOC A;  2XXV A;  1B3G A;  1B1H A;  3T9X B;  4LUB A;  3VV5 A;  3C4M A;  1DPE A;  5IAI A;  2XX9 A;  1OVT A;  2UYF A;  3T9V A;  1N0T A;  1B7H A;  3D4G A;  4YKI A;  5CM6 A;  4AB5 A;  3R6U A;  4UA8 A;  4LZ7 A;  1B3F A;  2Z8D A;  1RYX A;  2GHA A;  3UK4 A;  4M1V A;  1JW4 A;  2RIN A;  3I5O A;  1MRP A;  1IXI A;  5I84 A;  1OLA A;  2DSF A;  1POT A;  5H8F A;  3PUV E;  3MQ9 A;  4ELQ A;  3FAS A;  4F18 A;  1QUK A;  3O66 A;  3PPO A;  4H0W A;  1AMF A;  2O1M A;  3T22 A;  2QS4 A;  1NFT A;  3FJG A;  1B0L A;  2REG A;  3TYH A;  4U21 A;  3MUQ A;  1ZTY A;  2X26 A;  1MXY A;  4NE4 A;  2RKM A;  4ELR A;  4U4S A;  1KWH A;  1ANF A;  1NL5 A;  2PT2 A;  1I6B A;  3KZG A;  3B7D A;  3IL1 B;  2H9B A;  1LFG A;  3O28 A;  3K00 A;  4R72 A;  4RPN A;  4ZEF A;  2I0B A;  4NF6 B;  2F36 A;  3HO7 A;  1JEU A;  3U92 A;  1MXV A;  4RPO A;  3IOV A;  3PPN A;  1EZ9 A;  3K1M A;  3FVK A;  2DVC A;  1I6Q A;  2ONR A;  1MY3 A;  1B05 A;  1NH7 A;  4DXU A;  2FYI A;  3KOT A;  1RYO A;  2OJT A;  3KSX A;  1MM6 A;  5DVF A;  4QFO A;  3ILT B;  3AXF A;  1AOV A;  4ZZE A;  4OEN A;  5JEI A;  3ZS6 A;  1OQG A;  3G7W A;  5BUU A;  3PUY E;  3FZV A;  1XVX A;  3IO4 A;  3M3K A;  2QS2 A;  4I1D A;  4TLL B;  2I4B A;  1A8E A;  1B32 A;  3OMB A;  4ZZA A;  3B6Q A;  4XIG Q;  2ZYO A;  3RLF E;  4F1U A;  5CMM A;  4R2F A;  1Q35 A;  4O3C A;  3PPP A;  4F2O A;  4TQU Q;  1B46 A;  1UQW A;  5I57 B;  5L9M A;  1B1X A;  4IO7 A;  3ONM A;  4JXI A;  3FV2 A;  4YAH X;  3ZKK A;  4NF6 A;  1DSN A;  3VVE A;  4IO5 A;  4KD5 A;  2DXR A;  3LC8 A;  4DXC A;  4IO3 A;  3TPA A;  3SET A;  4KQP A;  4O3A A;  4X1D A;  5ITP A;  4U4X A;  4PFU A;  4RY1 A;  1AL3 A;  3KN3 A;  4F3S A;  4H65 A;  3VLW A;  2QJE A;  4R73 A;  1NKX A;  4QSC A;  3EF7 A;  3B6T A;  2Y84 A;  2OZZ A;  4ECF A;  2Z23 A;  5H8S A;  2VGQ A;  4H67 A;  2AIX A;  4F39 A;  1QKA A;  3EHS A;  4DXB A;  3N6T A;  4RA1 A;  4RK2 A;  1B2H A;  4LP2 B;  4O3B A;  4OER A;  2Q9T A;  1JNF A;  3RTW B;  4NTL A;  4FAT A;  3OXN A;  2Z22 A;  5EHS A;  5I57 A;  3K2D A;  4DCX A;  1N3W A;  3WAE A;  4N13 A;  2VP1 A;  1EH3 A;  4GL8 A;  3OEL A;  4IO4 A;  1MQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...