1XT8A

Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
248
structure length
248
Chain Sequence
LNSLDKIKQNGVVRIGVFGDKPPFGYVDEKGNNQGYDIALAKRIAKELFGDENKVQFVLVEAANRVEFLKSNKVDIILANFTQTPQRAEQVDFCSPYMKVALGVAVPKDSNITSVEDLKDKTLLLNKGTTADAYFTQNYPNIKTLKYDQNTETFAALMDKRGDALSHDNTLLFAWVKDHPDFKMGIKELGNKDVIAPAVKKGDKELKEFIDNLIIKLGQEQFFHKAYDETLKAHFGDDVKADDVVIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords putative amino-acid transporter periplasmic solute-binding p
publication title An ATP-binding cassette-type cysteine transporter in Campylobacter jejuni inferred from the structure of an extracytoplasmic solute receptor protein.
pubmed doi rcsb
source organism Campylobacter jejuni
total genus 74
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1xt8A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1xt8A02
2XX9A 1EH3A 3E13X 1D9VA 2QS3A 4QSEA 2O51A 4XKRA 3IJOB 2F6GA 4U21A 1NNTA 4F22A 3T9VA 4OHNA 3FXRA 2QSXA 3SEYA 4RA1A 4Q0CA 2RCBA 2X7PA 4WXJA 3O97A 1M5FA 5I57B 1MXUA 1ZIUA 1FCKA 2Q89A 3DP6A 1JW1A 2ONSA 4OEVA 5HPQA 3CRBA 3RQTA 3H4ZA 3TZAA 2RCAA 4ZEDA 1FTJA 1EU8A 4RYAA 4GL0A 3C35A 4LZ5A 5HM4B 4QFOA 3KN7A 2QS4A 4LATA 1JNFA 3CR9A 1N04A 3LBSA 3OMBA 4ZEBA 1RYOA 2H5YA 3OENA 3QYTA 3THIA 2DOJA 2F7BA 1TT1A 3MBPA 1A8EA 3IO6A 4OESA 3RPWA 1IQ7A 1H45A 4R6YA 2Z22A 2PMSA 2UVIA 1NNKA 1Q1KA 3G3HA 4QFKA 3IX1A 4H8IA 2VOZA 3ECRA 1FQEA 2QMXA 4QF9A 3RY3A 1B32A 1GR2A 5JK4A 3FJ7A 4HS7A 4JBZA 3MPLA 1MM7A 4KFQA 3MP6A 1LBCA 4LUBA 2ZMBA 2I0BA 4NWCA 5FHMA 5H8NA 3Q27A 3O66A 5ELVA 1I6AA 3KG2A 3T96B 3TODA 3Q25A 3MP8A 3W9VA 3VLVA 1IIWA 4Q8RA 4NF5B 3HCQA 1M5BA 3VVEA 4DCXA 3PD8A 4UACA 1N7WA 3C33A 2R6GE 1TWYA 4F2OA 3OD7A 5M2VA 2OWSA 5B7DA 3ONMA 3QIMA 3M3LA 3AXFA 3PUVE 5F1QA 4TQUQ 1WVJA 4GL8A 3RLFE 3K1NA 4GLIA 1L5TA 3K1PA 1IXIA 1Z7NE 1N0TA 2KLFA 2THIA 3HV1A 3TCFA 1Z7ME 2P0SA 3OO8A 4NF6A 1MPDA 3EHSA 1LFGA 3JZJA 5DVIA 3T22A 1AH5A 4KYDA 4R6HA 4EXKA 5J1DA 4IGTA 3ZS6A 3O9PA 3DLNA 4H65A 4KCCA 3TPAA 2H9BA 4FAJA 3R7XA 2O7UA 1Y9UA 1ZTYA 3K2DA 5L9SA 4OENA 4OFOA 2XXRA 3Q26A 3RGYA 2F7AA 4DXUA 1ZU0A 3H3GA 3H7MA 4IY5A 5TPAB 2HZKA 3QK6A 4WEDA 2DQVA 1D4NA 1A55A 3PUXE 1B5IA 3F11A 4Q5TA 1OVBA 1UQWA 2RC8A 2W7YA 1JEUA 1HSLA 2OCUA 2ZNUA 5KZTA 2H98A 2GFEA 4F3PA 5EYFA 1B52A 3FZVA 5EHSA 2PBWA 1Y1ZA 3DP4A 2FYIA 1PBQA 3P7IA 1MXVA 2D3IA 1P1WA 3W15C 1WODA 2HCAA 4ZEFA 1MXZA 3PUZE 1FQBA 3G3IA 2VD2A 3PUWE 4YKKA 3UK4A 3KN3A 4GOTA 2GH9A 5H8HA 3IOWA 4BDOA 3MAMA 1HSJA 3U8QA 5ITPA 3OELA 1Y3PA 2OJTA 2QPQA 1IXCA 2REGA 5AE4A 4NTLA 5AA4B 4JWOA 3HN0A 1B3HA 4TLLB 5H8QB 1SW4A 3O6IA 4EF1A 1OLCA 3PUYE 2OBGA 3C9HA 1MY4A 1LAFE 1PB8A 1M5DA 2HFBA 4EF2A 5DEXB 2DWHA 4HW8A 4QFLA 5JEIA 3ZKKA 4NF8B 5B70A 1Y20A 4LZ8A 3E9XA 4F39A 1Q35A 4U1ZA 1MY3A 1D9YA 3O6GA 4G68B 4PFUA 5AA1A 2RC9A 2Y7RA 5I58A 4RXLA 3N5LA 3TCHA 2F34A 4DXBA 4JB7A 3ILTB 2AL4A 1T0KA 1VFEA 2DVCA 1DTGA 3L6HA 2DE2A 4DZ1A 5I2NB 4R72A 2ZYOA 4KI0E 3S9EA 2P1SA 1HSEA 1H44A 4G8HA 4JSDA 5IKBA 4RPNA 4K3FA 4F2QA 3LSWA 1NH7A 1FTLA 3PMWA 4O3BA 4ISUA 1SBPA 1F9BA 1TFDA 4JWYA 5AA3A 2P2AA 4EXLA 3PD9A 4FORA 1B46A 1BKAA 1ZJLA 2F97A 4GF8A 3KOTA 5I56B 4GD5A 3GLBA 3PPRA 1QW0A 3M3FA 2O1MA 3T9HB 1A40A 2ONRA 5H8FB 4F3SA 5I2KB 4XKNA 1YAEA 2G93A 2OK2A 1URGA 3MZBA 2RKMA 3N94A 4P11A 5I59A 1N7XA 4YZZA 2V3UA 4F1UA 3IORA 4I62A 4BDQA 4NEDA 2AIXA 3U94A 2YJPA 4OXVA 3C32A 4UA8A 2XX7A 4THIA 1DPPA 5A5XB 1BLFA 5KCJB 1LGBC 4NF4B 4XTCQ 2RINA 1A54A 4MBPA 3UP9A 3RT8A 3FIRA 5AA2A 1SW1A 4IO3A 1LCFA 2Q8JA 5TP9A 3VXCA 4FE8A 3PPOA 4DDDA 2VP1A 4BDRA 2QS1A 4H5FA 4RJZA 4IY6A 4ZZAA 3IB1A 3JV9A 2UXAA 1SI1A 2FNCA 1ZMGA 3TKDA 1H76A 2WKYA 4PFWA 2F6PA 2UYFA 2FA7A 3FVOA 1M5EA 4U23A 4IO4A 2VD3A 2QJEA 1R6ZA 1R9LA 4LP2B 4H1XA 1S9TA 3PV0E 4OERA 1B0LA 1IITA 2A5TA 2HEUA 4YU0A 3ODBA 4G8NA 3E3KA 2XXQA 3S4UA 1JQFA 5I84A 4FATA 4I8CA 3HSTA 2E0SA 2UVJA 1FTOA 3MW0A 2ZYMA 3SEXA 1LSTA 1LFHA 2DWAA 3V89B 5CBRA 1P1QA 2DE4A 1UTBA 2O6AA 3HPIA 3CFXA 2V3TA 2YPNA 1IEJA 3G3JA 4EQBA 2OLBA 3I6VA 3K0VA 3I5OA 5CMMA 5CC2A 3QXMA 1S7YA 3KJTA 3KZGA 4MF3A 5KDTA 1MXWA 4H6DA 4XIGQ 4HCYA 3IL1B 2GHBA 4NWDA 4GFRA 1B7UA 1MXXA 3SERA 3UA8A 4GVOA 3N6TA 4XXUA 2XXTA 3N26A 3TTNA 1MQIA 3MVYA 3BFTA 3FGSA 4FIMA 1JVXA 1SQYA 4Z7EA 3TTLA 5K2YA 3OOAA 3HHFA 2LAOA 3RN8A 1FQFA 1O64A 3VXBA 1LB8A 1YTVA 1B5HA 4LONB 2DE3A 1B9JA 3FXQA 3A09A 1PB9A 2DXRA 5H8NB 3EHTA 3EN3A 1LLSA 1OQHA 4YKIA 4L17A 5CMKA 3Q29A 4IGRA 1MY1A 1JW4A 1SYIA 3WAEA 1B0HA 4KCDA 1ATGA 3V5AA 4MH5A 1MG1A 3HO7A 3TMGA 4JSOA 2Z8EA 5L9MA 1JETA 1UIUA 3IB2A 4M1VA 5H8SA 1B6HA 1VR5A 4G2ZA 2B3FA 3K6UA 3UIFA 2X26A 3K6WA 1ELJA 3G3GA 2UVHA 3SEUA 2A5SA 2PYYA 2XXPA 1URDA 1B3FA 1JW5A 3H6VA 1B4HA 4AQ4A 1I69A 4NF6B 1Y4TA 3G3FA 1POTA 5L8DA 4I9DA 3V8XB 2B65A 4G4PA 1IZ1A 2Q9TA 4QRZA 1B51A 4FEDA 2Y7KA 4POWA 1SYHA 3B6QA 3FUZA 3FJGA 1KWHA 5CI5A 4F18A 3FD3A 4LA9A 1JVYA 1I6QA 2H4IA 4ELQA 5F7VA 1MQDA 2I58A 3DM0A 1Y3QA 3FVKA 3GZGA 3B7DA 1RYXA 1QUJA 1XHYA 2PT2A 3K00A 4OWDA 1B1XA 4QSCA 2DWIA 4GRKA 3OSQA 1JEVA 1MRPA 4GIZA 1MPBA 2HQ0A 1UTHA 2PT1A 1ZBMA 3DELB 2Y7PA 2XXYA 3FVGA 1XVXA 4EQ9A 2Y84A 2HXWA 4Z0IA 4PQJA 1IUDA 3N6UA 3FXUA 3S9NC 4E0WA 4U2RA 1P1UA 1I6BA 5H8HB 5CM6A 3CSBA 4ESXA 1LAXA 1MDQA 3GBAA 5BUUA 2UYEA 4DIGA 2NXOA 2XD3A 3CIJA 4KYEA 3S2VA 4RNSA 1R9QA 5JTYA 2VGQA 4PETA 1TXFA 4DE8A 4X48A 1FTKA 1QULA 2RC7A 3QUFA 1AMFA 1P99A 3R26A 1FTMA 4IO5A 4ZS9A 2I48A 1SI0A 3CFZA 2F5XA 4C1TA 4MLVA 1B4ZA 3K02A 4IO7A 1P1NA 3WAFA 1DTZA 3D4GA 3TUSA 1NL5A 1Y1MA 1A99A 1B05A 4JDFA 1QKBA 4ECFA 1NH8A 4GQOA 4YICA 4U4XA 5I56A 3CI8A 3ILUB 2D21A 3RTFB 1AOVA 3OXNA 2ALUA 1XVYA 4X1BA 3ZSFA 2GRVA 3VLUA 5I58B 3QUJA 4YB7A 3K1MA 4FECA 3K4UA 1SDXA 4E0XA 2D5WA 4F19A 3EF7A 1XS5A 4EDPA 3C36A 4P0GA 1IXGA 4R2FA 2IA4A 2X7QA 3T93B 4ONYA 1A8FA 3K6XA 4U1OA 2HAVA 1OVTA 2Q88A 4OVJA 5TU0A 2ZXTA 1XC1A 1QKAA 2F8DA 1EZPA 4N13A 3MQ9A 1OLAA 1MH3A 2ZYKA 4WKMA 2I4CA 4LZ7A 2O84X 3IOTA 1NNPA 3MC2A 1MQJA 3G7WA 3TEPA 3SKPA 4YKJA 4OQOA 2I4BA 4I1DA 2BJJX 5I57A 3TQWA 3T9XB 1N76A 1LCTA 1MS7A 3KSJA 1QJMA 2O69A 1MPCA 4H0WA 2XXXA 3IJXB 3LR1A 3U92A 2DP8A 5ITOA 4H5GA 1MY2A 4O3CA 1B2HA 3RT6B 1H3DA 1AIVA 3USDA 3UN6A 4ZECA 1PEBA 4QFPA 2G29A 4PFYA 1P1OA 1LAGE 1USYH 3FVNA 4JXIA 1CE2A 3D4CA 4ELRA 4X1DA 2O1LA 5I59B 2XXHA 4DXCA 3TELA 2QS2A 3MP1A 3O2AA 5FHOA 1QUIA 1BIYA 3TDJA 2HAUA 4R75A 2DSFA 3VDFA 4KHZE 2NOOA 5FTIA 5DTBA 3UORA 1N3WA 3OO7A 2V25A 1EZOA 2M8CA 4YKPA 5AA2B 2H25A 3OO9A 2V84A 3QSLA 3FV2A 5TP9B 4OYVA 3EHUA 1PB7A 2UVGA 2OWTA 3A3CA 3LUYA 3PPPA 3PMXA 4LVQA 1B7ZA 3CG1A 2I6EA 1B40A 2F35A 1B7HA 4R6KA 1MDP1 3BBRA 1MQGA 2DVZA 3H6UA 3EPEA 4PE5B 1EZ9A 3PU5A 4RPOA 4ZE9A 4R9GA 2Z8FA 3M3KA 4BDNA 3U1OA 3U93A 4O3AA 3RTWB 5ICTA 3MVWA 2XX8A 3VLWA 1OMPA 3TFLA 3KGCA 3C4MA 4OFLA 2XHDA 5CMBA 3U72A 2XXUA 1Y3NA 3IAZA 4G8MA 2F36A 2XXWA 1D3KA 4IB2A 3KEIA 3ZKLA 4F1YA 2RF1A 4NF5A 1US4A 3DP8A 3E4RA 2A5TB 3VV5A 2NVUB 1LBBA 4BDLA 4M4GA 4MLQA 1SVXB 3OEKA 3T66A 3LSXA 4EUOA 3CVGA 3Q28A 1GVCA 1NMUA 4FJPA 4TLMB 3SETA 4F3GA 1NNFA 1POY1 3PGFA 1YCJA 4G68C 4ELPA 1OIBA 3BKIB 3PPNA 4R73A 1ZKBA 3IO4A 2XD2A 1UTBB 4YMBA 3GXAA 4IO6A 3TTRA 4KPTA 2I3WA 5HBCA 3FV1A 4P0IA 4GWOA 1MH4A 3KBRA 3W9WA 2R71A 2QL3A 1GV8A 3S9MC 3TQLA 4NE4A 4OMBA 3O6HA 1NFTA 2CMOA 3KN8A 5FHNA 3LSFB 5KDTB 1H43A 1PC3A 3MPKA 1MQHA 4BLAA 1IXHA 1DPEA 1II5A 3MVXA 3MUQA 4ND9A 4KR5A 1B3EA 5TPAA 2Y7IA 3TAJA 2XXIA 2NUVA 1FQDA 1BP5A 2PVUA 1DMBA 1SD3A 5K2XA 1MM6A 1B3GA 1Y4CA 1ANFA 1PBPA 2CZLA 4ZEIA 3K6VA 2DWJA 1VFDA 1J1NA 1USYE 3V83A 5CBSA 1DSNA 3SDFA 1YPNA 4ZZEA 2V93A 1LB9A 3FATA 3GBBA 3SESA 3C31A 4POXA 3IOVA 5ISUA 1B1HA 2VHAA 4R9FA 5CRYA 1O63A 1XT8A 4KD5A 3CSGA 3JYRA 2Y7WA 3PMVA 4U4SA 4OEUA 2F7CA 2REJA 3HHGA 3SEWA 2GHAA 4ZE8A 3OEMA 4OFJA 4H67A 5AA2D 4DCYA 3KSXA 3QAXA 2Z23A 2V3QA 5FTHA 4YAHX 5AA4A 2ESNA 4XKPA 3KFMA 2ZYNA 5H8QA 2ANJA 1SW2A 4IO2A 1LAHE 2I49A 1B3LA 3IB0A 4QSDA 1B5JA 3T9UA 5DEXA 4HCWA 3KOSA 4NF8A 3CG3A 3G3KA 2QRYA 2ONKE 2QMWA 3FASA 3PPQA 3S9LC 1ZLQA 3H6WA 2YLNA 2R9JA 3A3UA 4OETA 4KQPA 4N6PA 4AB6A 4RK2A 3LSLA 3UGWA 4R74A 4HTGA 4G68A 3OO6A 4QHQA 4C1UA 4DLDA 2ZNSA 3MZ9A 2ZNTA 4GXSB 4NMYA 1OQGA 5EHMA 3IK6B 2OZZA 3BFUA 2DXYA 3MVZA 3LC8A 4F29A 2PX1A 5DVFA 2B3BA 5IAIA 1TFAA 1S50A 1VSOA 5ICQA 5I2NA 1FQCA 3TCGA 1UTHB 2Z8DA 3I3VA 1A7LA 3MZ1A 2AL5A 1MXYA 4OZ9A 4EQ7A 4LQ5A 4FEBA 3B6WA 1PDAA 4F1VA 2H99A 3KJ7A 3MJNA 4F31B 4OTEA 2HZLA 4XKQA 1M5CA 1R1NA 2O7IA 4R2BA 4ZEKA 4YMAA 3TYHA 3OSRA 4JWXA 1WDNA 3RUMA 4N07A 3H6TA 4Q30B 5L9OA 5CMCA 5LOMA 4WEPA 4ESWA 1LFIA 1XOCA 3R6UA 2I3VA 3C34A 3SEVA 1NKXA 4F3BA 3VFJA 5JTYB 1B58A 3B6TA 2AYSA 4MFIA 4H8JA 4ELOA 2Q2CA 4C0RA 5BWJA 3IOUA 4RY1A 2IEEA 1N3XA 1CB6A 1US5A 1O7TA 1QUKA 3IR1A 5H8FA 3H03A 4X9TA 4QFNA 5I2KA 1FW0A 1AL3A 3H06B 1GGGA 3EQ1A 1URSA 2I0CA 4G77A 1MY0A 3VE1B 1FQAA 4BDMA 2ABHA 5A5XA 1GTKA 5KCJA 5DT6A 4NF4A 4YB6A 4ZDMA 2NWJA 3TTKA 3L6GA 2XXVA 2O68A 2F78A 4RK9A 3O28A 5DVJA 2Q2AA 3MWBA 1VE4A 1DOTA 3K01A 1SW5A 4PP0A 3RNNA 3VVDA 5DYHA 4U22A 2DYXA 4YB5A 4TOZA 4GXAA 1N84A 1RKMA 2DS9A 4KYSA 3FJMA 3M8UA 4PFTA 3O29A 1UIVA 4LQ2A 3CFLA 3VVFA 4AB5A 1BTJA 2E1SA 3TTMA 1QVSA
chains in the Genus database with same CATH superfamily
2XX9A 4G61A 1EH3A 4GWUA 3E13X 1D9VA 2QS3A 4QSEA 2O51A 4XKRA 3IJOB 2F6GA 3U65A 4U21A 1NNTA 4F22A 3T9VA 4GBVA 4OHNA 3FXRA 2QSXA 3SEYA 4RA1A 4Q0CA 1YXIA 4XF5A 4MCOA 2RCBA 2X7PA 4WXJA 3O97A 1M5FA 2QFLA 5I57B 2QVVA 1MXUA 1NV3A 1ZIUA 1XI6A 4N91A 1NV5A 1FCKA 2Q89A 3DP6A 4HXVA 1JW1A 2ONSA 5ESYA 4OEVA 3LV0A 5HPQA 3CRBA 3RQTA 1FBDA 3H4ZA 3TZAA 2RCAA 5I7IA 4ZEDA 1FTJA 1EU8A 4RYAA 4MJOA 4GL0A 3C35A 4LZ5A 5HM4B 4QFOA 3KN7A 2QS4A 4LATA 1JNFA 3CR9A 4OA4A 1N04A 2HHMA 3LBSA 3OMBA 4ZEBA 1RYOA 2H5YA 3OENA 3QYTA 3THIA 2DOJA 2F7BA 1TT1A 4NG7A 3MBPA 1A8EA 3IO6A 4OESA 3RPWA 1IQ7A 1H45A 4R6YA 2Z22A 4QXDA 2PMSA 2UVIA 1NNKA 1Q1KA 3G3HA 4QFKA 1FPDA 1YZ0A 3IX1A 4H8IA 2VOZA 3ECRA 5I5PA 1FQEA 2QMXA 4QF9A 3RY3A 1B32A 1GR2A 5JK4A 3FJ7A 4HS7A 4JBZA 3MPLA 1MM7A 4KFQA 1FPGA 1LBYA 3MP6A 1LBCA 4LUBA 2ZMBA 2I0BA 4NWCA 5FHMA 5H8NA 3Q27A 3O66A 5ELVA 1I6AA 3KG2A 3T96B 3TODA 4HE2A 3Q25A 4MAGA 3MP8A 4MX6A 3W9VA 3VLVA 1IIWA 4Q8RA 4NF5B 3HCQA 2KQZA 1M5BA 3VVEA 4DCXA 1CNQA 3PD8A 4UACA 1N7WA 3C33A 2R6GE 1TWYA 1NV4A 4F2OA 3OD7A 5M2VA 2OWSA 3MSTA 5B7DA 2L5VA 1D9QA 3ONMA 3QIMA 3M3LA 3AXFA 3PUVE 5F1QA 5F24A 4TQUQ 3RPLA 1WVJA 4GL8A 3RLFE 3K1NA 4GLIA 1L5TA 3K1PA 1IXIA 1Z7NE 1N0TA 2KLFA 2THIA 3HV1A 3TCFA 2PCRA 1FJ9A 1Z7ME 3KBZA 4PDHA 2P0SA 3OO8A 5EQ8A 4NF6A 1MPDA 3EHSA 1LFGA 3JZJA 5DVIA 3T22A 1AH5A 4KYDA 1NUXA 4R6HA 4EXKA 5J1DA 4IGTA 2ZZVA 3ZS6A 3O9PA 4MMPA 1FPFA 3DLNA 4H65A 4KCCA 3TPAA 4DI4B 4GX4A 2H9BA 4FAJA 3R7XA 3ISPA 3CHGA 2O7UA 1Y9UA 1ZTYA 3K2DA 5L9SA 4OENA 2HXRA 4OFOA 5EYGA 2XXRA 3Q26A 3RGYA 2F7AA 4DXUA 1G0IA 3A29A 1ZU0A 3H3GA 3H7MA 4PFRA 4IY5A 5TPAB 2HZKA 3QK6A 4P1EA 4WEDA 2DQVA 1D4NA 1A55A 3PUXE 1B5IA 4GX6A 3F11A 4Q5TA 1LBVA 1OVBA 1UQWA 2RC8A 2W7YA 1JEUA 1HSLA 2OCUA 2ZNUA 5FBPA 4PFIA 5KZTA 2H98A 2GFEA 4F3PA 2HPGA 5EYFA 1B52A 3FZVA 5EHSA 2PBWA 1Y1ZA 3DP4A 4NHBA 2FYIA 2WYKA 1PBQA 3P7IA 3RYDA 1MXVA 2D3IA 1P1WA 3W15C 1RDYA 1WODA 2HCAA 4ZEFA 2R8TA 1MXZA 3PUZE 2DDKA 1FQBA 3G3IA 5IM2A 2VD2A 3PUWE 4YKKA 3UK4A 3KN3A 4GOTA 2GH9A 5H8HA 3IOWA 4BDOA 3MAMA 1HSJA 2KR0A 3U8QA 5ITPA 3OELA 1Y3PA 4HE1A 2OJTA 2QPQA 1IXCA 2REGA 5AE4A 2XWOA 4NTLA 5AA4B 4JWOA 3HN0A 1B3HA 4TLLB 5H8QB 1SW4A 4GX3A 3O6IA 4PFBA 1KA0A 4EF1A 1OLCA 4PCDA 2FBPA 3PUYE 2OBGA 2VT5A 3C9HA 4GWZA 4IR8A 1MY4A 1LAFE 1PB8A 1M5DA 2HFBA 5IZ3A 1NUYA 4JVDA 4EF2A 1FPBA 4PC9A 5DEXB 2DWHA 4HW8A 4QFLA 5JEIA 3ZKKA 4NF8B 5B70A 1Y20A 4LZ8A 3E9XA 4MIJA 4F39A 2CZHA 1Q35A 4U1ZA 4I3EA 1MY3A 1D9YA 1FBPA 3O6GA 4G68B 4PFUA 5AA1A 2RC9A 2Y7RA 5I58A 4RXLA 3N5LA 3TCHA 2F34A 2FHYA 4DXBA 4JB7A 3ILTB 2AL4A 1T0KA 1VFEA 2DVCA 1DTGA 3L6HA 1FPIA 2DE2A 4DZ1A 5I2NB 4PAFA 4R72A 2ZYOA 4KI0E 3S9EA 2P1SA 1HSEA 1H44A 1IMFA 4G8HA 4JSDA 5IKBA 4RPNA 2VPOA 4K3FA 2WEFA 4F2QA 1RDXA 3LSWA 4X8RA 1NH7A 1FTLA 3PMWA 4O3BA 4ISUA 1JP4A 1SBPA 1F9BA 1TFDA 4JWYA 5AA3A 2P2AA 4EXLA 4UABA 3PD9A 4FORA 1NUZA 1B46A 1BKAA 1ZJLA 2F97A 3T0JA 4GF8A 3KOTA 5I56B 4GD5A 3GLBA 3PPRA 1QW0A 1NV7A 3M3FA 2O1MA 3T9HB 1A40A 1NV1A 2ONRA 5H8FB 4F3SA 5I2KB 4XKNA 1YAEA 2G93A 2OK2A 1IMEA 1URGA 3MZBA 2RKMA 3N94A 4P11A 5I59A 1N7XA 4YZZA 2V3UA 4F1UA 3IORA 4I62A 4BDQA 4NEDA 2AIXA 3U94A 2YJPA 4OXVA 3C32A 4UA8A 2XX7A 4THIA 1DPPA 5A5XB 1BLFA 2XWKA 5KCJB 1LGBC 4NF4B 4XTCQ 2RINA 1A54A 4MBPA 3UP9A 3RT8A 3FIRA 5ET7A 5AA2A 5EQ7A 1SW1A 4IO3A 1LCFA 1G0HA 2Q8JA 5TP9A 3VXCA 4FE8A 3PPOA 4DI3D 1FPKA 4DDDA 2VP1A 4BDRA 2QS1A 4QBAA 4H5FA 4RJZA 4IY6A 5T3JA 4ZZAA 3IB1A 3JV9A 2UXAA 1SI1A 4OVRA 1FBGA 2FNCA 1ZMGA 3TKDA 1H76A 2WKYA 4PFWA 2F6PA 2UYFA 2FA7A 3FVOA 2PFZA 1VDWA 2Q8MA 1M5EA 4U23A 1INPA 4IO4A 2VD3A 2QJEA 1R6ZA 1R9LA 4LP2B 4H1XA 4JVIA 1S9TA 1LEVA 3PV0E 4OERA 4NN3A 1B0LA 1IITA 2A5TA 2HEUA 4YU0A 3ODBA 4G8NA 3E3KA 2XXQA 3S4UA 1JQFA 5I84A 4O94A 4AS4A 4FATA 4I8CA 3HSTA 2E0SA 2UVJA 1FTOA 1LBZA 3MW0A 2ZYMA 3SEXA 2FVZA 1LSTA 1LFHA 2DWAA 4GWXA 3V89B 5CBRA 1P1QA 2DE4A 1UTBA 2O6AA 3HPIA 3CFXA 4P8BA 3IFCA 4PBHA 2V3TA 2YPNA 4LN5A 1IEJA 3G3JA 4N17A 4PGNA 4EQBA 2OLBA 1FTAA 3I6VA 3K0VA 3I5OA 5CMMA 5CC2A 3QXMA 4P56A 1S7YA 4PBQA 3KJTA 1IMAA 2FIEA 3KZGA 4MF3A 5KDTA 1MXWA 4H6DA 4XIGQ 1FPEA 4HCYA 3IL1B 1FSAA 2GHBA 2ZZWA 4NWDA 4GFRA 1B7UA 1MXXA 3SERA 3UA8A 2WYPA 4GVOA 3N6TA 2JJKA 4XXUA 2XXTA 3N26A 3TTNA 1MQIA 3MVYA 3BFTA 3FGSA 4FIMA 3EKIA 1JVXA 1SQYA 4Z7EA 3TTLA 5K2YA 3OOAA 4FBPA 3HHFA 2LAOA 3RN8A 1FQFA 1O64A 3VXBA 1LB8A 1YTVA 1B5HA 4LONB 2DE3A 1B9JA 3FXQA 4MNCA 3A09A 1PB9A 2DXRA 5H8NB 3EHTA 3EN3A 1LLSA 1OQHA 2CEXA 3BIHA 4YKIA 4L17A 5CMKA 4N8GA 3Q29A 4IGRA 1MY1A 1JW4A 1SYIA 1NV2A 3WAEA 1B0HA 4KCDA 1ATGA 3V5AA 3HFUA 1MG1A 3HO7A 4MH5A 3TMGA 1YYZA 4JSOA 2Z8EA 5L9MA 1JETA 1UIUA 3IB2A 5IGAA 4M1VA 3B50A 5H8SA 1B6HA 4N15A 1VR5A 4G2ZA 2B3FA 3K6UA 3UIFA 2X26A 3K6WA 3RPLB 1AWBA 1FPJA 1ELJA 3G3GA 5ET6A 4OVQA 2UVHA 3SEUA 2A5SA 4HE0A 1DCUA 2PYYA 2XXPA 4OVSA 4P1LA 1URDA 1B3FA 1JW5A 3H6VA 1B4HA 4AQ4A 1I69A 1LBWA 4NF6B 1Y4TA 3G3FA 1POTA 1EYKA 5L8DA 4I9DA 3V8XB 4XEQA 2B65A 4G4PA 1IZ1A 1LBXA 2OWZA 2Q9TA 4QRZA 1B51A 4FEDA 4PAKA 2Y7KA 4POWA 1SYHA 3B6QA 3FUZA 3FJGA 1KWHA 5CI5A 4OVPA 4F18A 3FD3A 4PTKA 4LA9A 1JVYA 1I6QA 1IMBA 2H4IA 4ELQA 5F7VA 1MQDA 2I58A 3DM0A 4PF8A 1Y3QA 3FVKA 3GZGA 3E79A 3B7DA 3FXBA 1RYXA 1KA1A 1QUJA 1XHYA 2PT2A 3E78A 3K00A 4OWDA 1B1XA 4GBWA 3D1RA 4QSCA 5ET5A 2DWIA 4GRKA 3NOHA 3OSQA 1JEVA 1MRPA 4GIZA 1MPBA 2HQ0A 1UTHA 4MEVA 2PT1A 1ZBMA 3DELB 2Y7PA 2XXYA 2XXKA 2V4CA 4PAIA 3FVGA 1XVXA 1FJ6A 2XWVA 3LUZA 4EQ9A 2Y84A 2HXWA 4Z0IA 4PQJA 1IUDA 2XA5A 4AS5A 2Q74A 3N6UA 3FXUA 3S9NC 4E0WA 4U2RA 1P1UA 1I6BA 5H8HB 5CM6A 3CSBA 4PGPA 2P3NA 4ESXA 1LAXA 1MDQA 2PFYA 3GBAA 5BUUA 5ET8A 1DK4A 2GQ1A 2UYEA 4DIGA 2NXOA 2XD3A 3CIJA 4KYEA 3S2VA 4RNSA 1R9QA 5JTYA 2VGQA 4PETA 1TXFA 4H45A 4DE8A 4X48A 1FTKA 1QULA 2RC7A 3QUFA 1AMFA 1P99A 3R26A 1FTMA 4IO5A 4ZS9A 5IZ3B 2B4MA 1SI0A 2I48A 3CFZA 2F5XA 4MNIA 4C1TA 4MLVA 1B4ZA 3K02A 4IO7A 1P1NA 1FBEA 3WAFA 1DTZA 3D4GA 3TUSA 4NF0A 1NL5A 1Y1MA 2B4LA 1A99A 1B05A 4JDFA 1QKBA 4ECFA 1NH8A 4GQOA 4YICA 4U4XA 5I56A 3CI8A 3ILUB 2D21A 3RTFB 1AOVA 3OXNA 2ALUA 1XVYA 2ZZXA 4X1BA 3ZSFA 2GRVA 3VLUA 5I58B 3QUJA 4YB7A 3K1MA 4FECA 3K4UA 1SDXA 2Y5KA 4E0XA 2D5WA 4P47A 4F19A 3EF7A 1XS5A 4EDPA 3C36A 4P0GA 1IXGA 2F3BA 4R2FA 2IA4A 2X7QA 3T93B 4ONYA 2VPNA 1A8FA 3K6XA 4U1OA 2HAVA 3GYYA 1OVTA 4H46A 2Q88A 4OVJA 5TU0A 2ZXTA 1XC1A 5IZZA 2WX9A 1QKAA 2F8DA 1EZPA 4N13A 3MQ9A 1OLAA 1MH3A 2ZYKA 4WKMA 2I4CA 4LZ7A 2O84X 4MNPA 3IOTA 3SZPA 1NNPA 3MC2A 1MQJA 4O7IA 1NV0A 3G7WA 3TEPA 3SKPA 4YKJA 4OQOA 2I4BA 4I1DA 2BJJX 5I57A 3TQWA 3T9XB 1N76A 1LCTA 1MS7A 3KSJA 1QJMA 2O69A 1MPCA 4H0WA 2XXXA 3IJXB 3LR1A 3U92A 2DP8A 5ITOA 4MHFA 4H5GA 4O7MA 1MY2A 2WBBA 4O3CA 1B2HA 3RT6B 1H3DA 3MYUA 1AIVA 3USDA 3UN6A 4ZECA 1PEBA 4QFPA 2G29A 4PFYA 1P1OA 1LAGE 1USYH 3FVNA 4JXIA 1CE2A 3D4CA 4ELRA 4X1DA 1EYJA 2O1LA 5I59B 2XXHA 4DXCA 3TELA 2QS2A 3MP1A 3O2AA 5FHOA 1QUIA 1BIYA 3TDJA 2HAUA 2QVRA 4R75A 2DSFA 3ROJA 3VDFA 4KHZE 2NOOA 5FTIA 5DTBA 3UORA 1N3WA 3OO7A 2V25A 1EZOA 2M8CA 2MKZA 4YKPA 5AA2B 2H25A 3OO9A 2V84A 3QSLA 3FV2A 5TP9B 4OYVA 3EHUA 1BK4A 1PB7A 2UVGA 2OWTA 3BIGA 3A3CA 3LUYA 3PPPA 1QGXA 3PMXA 5LDZA 4LVQA 1B7ZA 3CG1A 2I6EA 1B40A 2F35A 1B7HA 4R6KA 1MDP1 3BBRA 1MQGA 2DVZA 3H6UA 4N4UA 3EPEA 4PE5B 1EZ9A 3PU5A 4P9KA 4RPOA 4ZE9A 4R9GA 2Z8FA 3M3KA 4BDNA 3U1OA 3U93A 4O3AA 3RTWB 5ICTA 3MVWA 2XX8A 3VLWA 1OMPA 3TFLA 3KGCA 3C4MA 4OFLA 2XHDA 1IMDA 5CMBA 3U72A 2XXUA 1Y3NA 3IAZA 4G8MA 2F36A 2XXWA 1D3KA 4IB2A 3KEIA 3ZKLA 4F1YA 2RF1A 4NF5A 1US4A 3DP8A 3E4RA 2A5TB 4NQ8A 3VV5A 2NVUB 1LBBA 4BDLA 4M4GA 4MLQA 4NX1A 1SVXB 3OEKA 3T66A 3LSXA 5A5LA 4EUOA 3CVGA 3Q28A 1GVCA 1NMUA 4FJPA 4TLMB 1FBCA 3SETA 5EYHA 4F3GA 4OVTA 1NNFA 1POY1 3PGFA 1YCJA 4G68C 4ELPA 1OIBA 3BKIB 1FBHA 3PPNA 4R73A 1ZKBA 3IO4A 4N6DA 4KXPA 2XD2A 1UTBB 4YMBA 3GXAA 4IO6A 3TTRA 4KPTA 2I3WA 5HBCA 4GWSA 3KC0A 3B8BA 3FV1A 4P0IA 2QVUA 4GWOA 4NGUA 1MH4A 3KBRA 3W9WA 2R71A 1K9YA 4N6KA 2QL3A 1GV8A 4I40A 3S9MC 3TQLA 1Q9DA 4NE4A 4OMBA 3O6HA 1NFTA 2CMOA 3KN8A 5FHNA 3LSFB 5KDTB 1H43A 4PF6A 1PC3A 3MPKA 1MQHA 4BLAA 1IXHA 1DPEA 1II5A 3MVXA 3MUQA 4ND9A 2P3VA 4KR5A 1B3EA 5TPAA 2Y7IA 3TAJA 2XXIA 1RDZA 2NUVA 1FQDA 1BP5A 2PVUA 1DMBA 1SD3A 5J16A 5K2XA 1MM6A 1B3GA 1Y4CA 1ANFA 1PBPA 4O8MA 2CZLA 4ZEIA 3K6VA 2DWJA 1VFDA 1FRPA 1J1NA 1USYE 3V83A 2CZIA 5CBSA 1DSNA 3SDFA 1YPNA 4X04A 4ZZEA 2V93A 1LB9A 3FATA 3GBBA 3SESA 3C31A 4POXA 3IOVA 5ISUA 1B1HA 2VHAA 4R9FA 5CRYA 1O63A 1XT8A 4JVCA 4KD5A 2Y5LA 3CSGA 2CEYA 3JYRA 2Y7WA 4XFEA 3PMVA 4U4SA 4OEUA 2F7CA 2REJA 3HHGA 5I3SA 3SEWA 2GHAA 4ZE8A 3OEMA 4OFJA 4H67A 5AA2D 4DCYA 3KSXA 3QAXA 2Z23A 2V3QA 5FTHA 4YAHX 5AA4A 2ESNA 1KZ8A 4XKPA 3KFMA 2ZYNA 5H8QA 4OANA 1NI9A 5LTCA 2ANJA 1SW2A 1K9ZA 3IFAA 4IO2A 1LAHE 2I49A 1B3LA 3IB0A 4QSDA 1B5JA 3T9UA 5DEXA 4HCWA 3KOSA 4NF8A 3CG3A 3G3KA 2QRYA 1EYIA 2ONKE 2QMWA 3FASA 4N8YA 3PPQA 3PTYA 3S9LC 1ZLQA 1SPIA 3H6WA 2YLNA 2R9JA 3A3UA 4OETA 4P3LA 4KQPA 4N6PA 4AB6A 4RK2A 3LSLA 3T1BA 2FIXA 3UGWA 4R74A 4HTGA 4G68A 3OO6A 4QHQA 4C1UA 4PDDA 4DLDA 2ZNSA 3MZ9A 2ZNTA 4GXSB 4NMYA 1OQGA 5EHMA 3IK6B 2OZZA 3BFUA 2DXYA 3MVZA 3LC8A 1DBZA 4F29A 1IMCA 2PX1A 5IZ1A 1NV6A 5DVFA 2B3BA 5IAIA 1TFAA 2F3DA 1S50A 2OX3A 1VSOA 5ICQA 5I2NA 1FQCA 3TCGA 1UTHB 2Z8DA 3I3VA 1A7LA 4N81A 3FBPA 3MZ1A 2AL5A 1MXYA 4OZ9A 4EQ7A 4LQ5A 4FEBA 3B6WA 1PDAA 2WBDA 4F1VA 2BJIA 2H99A 3KJ7A 3MJNA 4F31B 4OTEA 2HZLA 4XKQA 1M5CA 1R1NA 4PE3A 2O7IA 4R2BA 5EQ9A 4ZEKA 4YMAA 3TYHA 5EQAA 3OSRA 4JWXA 1WDNA 3RUMA 4N07A 3H6TA 1FBFA 4Q30B 5L9OA 5CMCA 1NUWA 5LOMA 4WEPA 4ESWA 4GWYA 1LFIA 1XOCA 3R6UA 2I3VA 3C34A 3SEVA 1NKXA 4F3BA 2XWIA 3VFJA 5JTYB 1B58A 3B6TA 2AYSA 4MFIA 4H8JA 5DW8A 4ELOA 2Q2CA 4C0RA 5BWJA 3IOUA 4RY1A 2IEEA 1N3XA 1CB6A 1US5A 1FPLA 1O7TA 1QUKA 3IR1A 5H8FA 3H03A 3KC1A 4QFNA 4X9TA 4I3YA 5I2KA 1FW0A 1AL3A 3H06B 1GGGA 3EQ1A 1URSA 2I0CA 4G77A 1MY0A 3VE1B 1FQAA 4BDMA 2ABHA 5A5XA 1GTKA 5KCJA 5DT6A 4NF4A 4YB6A 4GWWA 4ZDMA 2NWJA 3TTKA 3L6GA 2XXVA 2O68A 2F78A 4RK9A 3O28A 5DVJA 2Q2AA 3MWBA 1VE4A 1DOTA 3K01A 3QMFA 1SW5A 4PP0A 3RNNA 3VVDA 5DYHA 4U22A 2DYXA 4YB5A 4TOZA 4GXAA 1N84A 1RKMA 2DS9A 4KYSA 3FJMA 3M8UA 4PFTA 3O29A 1UIVA 4LQ2A 3CFLA 4NAPA 3VVFA 4AB5A 1BTJA 2E1SA 2CZKA 3TTMA 1QVSA
chains in the Genus database with same CATH topology
2XX9A 1EH3A 3E13X 1D9VA 2QS3A 4QSEA 2O51A 4XKRA 3IJOB 2F6GA 4U21A 1NNTA 4F22A 3T9VA 4OHNA 3FXRA 2QSXA 3SEYA 4RA1A 4Q0CA 2RCBA 2X7PA 4WXJA 3O97A 1M5FA 5I57B 1MXUA 1ZIUA 1FCKA 2Q89A 3DP6A 1JW1A 2ONSA 4OEVA 5HPQA 3CRBA 3RQTA 3H4ZA 3TZAA 2RCAA 4ZEDA 1FTJA 1EU8A 4RYAA 4GL0A 3C35A 4LZ5A 5HM4B 4QFOA 3KN7A 2QS4A 4LATA 1JNFA 3CR9A 1N04A 3LBSA 3OMBA 4ZEBA 1RYOA 2H5YA 3OENA 3QYTA 3THIA 2DOJA 2F7BA 1TT1A 3MBPA 1A8EA 3IO6A 4OESA 3RPWA 1IQ7A 1H45A 4R6YA 2Z22A 2PMSA 2UVIA 1NNKA 1Q1KA 3G3HA 4QFKA 3IX1A 4H8IA 2VOZA 3ECRA 1FQEA 2QMXA 4QF9A 3RY3A 1B32A 1GR2A 5JK4A 3FJ7A 4HS7A 4JBZA 3MPLA 1MM7A 4KFQA 3MP6A 1LBCA 4LUBA 2ZMBA 2I0BA 4NWCA 5FHMA 5H8NA 3Q27A 3O66A 5ELVA 1I6AA 3KG2A 3T96B 3TODA 3Q25A 3MP8A 3W9VA 3VLVA 1IIWA 4Q8RA 4NF5B 3HCQA 1M5BA 3VVEA 4DCXA 3PD8A 4UACA 1N7WA 3C33A 2R6GE 1TWYA 4F2OA 3OD7A 5M2VA 2OWSA 5B7DA 3ONMA 3QIMA 3M3LA 3AXFA 3PUVE 5F1QA 4TQUQ 1WVJA 4GL8A 3RLFE 3K1NA 4GLIA 1L5TA 3K1PA 1IXIA 1Z7NE 1N0TA 2KLFA 2THIA 3HV1A 3TCFA 1Z7ME 2P0SA 3OO8A 4NF6A 1MPDA 3EHSA 1LFGA 3JZJA 5DVIA 3T22A 1AH5A 4KYDA 4R6HA 4EXKA 5J1DA 4IGTA 3ZS6A 3O9PA 3DLNA 4H65A 4KCCA 3TPAA 2H9BA 4FAJA 3R7XA 2O7UA 1Y9UA 1ZTYA 3K2DA 5L9SA 4OENA 4OFOA 2XXRA 3Q26A 3RGYA 2F7AA 4DXUA 1ZU0A 3H3GA 3H7MA 4IY5A 5TPAB 2HZKA 3QK6A 4WEDA 2DQVA 1D4NA 1A55A 3PUXE 1B5IA 3F11A 4Q5TA 1OVBA 1UQWA 2RC8A 2W7YA 1JEUA 1HSLA 2OCUA 2ZNUA 5KZTA 2H98A 2GFEA 4F3PA 5EYFA 1B52A 3FZVA 5EHSA 2PBWA 1Y1ZA 3DP4A 2FYIA 1PBQA 3P7IA 1MXVA 2D3IA 1P1WA 3W15C 1WODA 2HCAA 4ZEFA 1MXZA 3PUZE 1FQBA 3G3IA 2VD2A 3PUWE 4YKKA 3UK4A 3KN3A 4GOTA 2GH9A 5H8HA 3IOWA 4BDOA 3MAMA 1HSJA 3U8QA 5ITPA 3OELA 1Y3PA 2OJTA 2QPQA 1IXCA 2REGA 5AE4A 4NTLA 5AA4B 4JWOA 3HN0A 1B3HA 4TLLB 5H8QB 1SW4A 3O6IA 4EF1A 1OLCA 3PUYE 2OBGA 3C9HA 1MY4A 1LAFE 1PB8A 1M5DA 2HFBA 4EF2A 5DEXB 2DWHA 4HW8A 4QFLA 5JEIA 3ZKKA 4NF8B 5B70A 1Y20A 4LZ8A 3E9XA 4F39A 1Q35A 4U1ZA 1MY3A 1D9YA 3O6GA 4G68B 4PFUA 5AA1A 2RC9A 2Y7RA 5I58A 4RXLA 3N5LA 3TCHA 2F34A 4DXBA 4JB7A 3ILTB 2AL4A 1T0KA 1VFEA 2DVCA 1DTGA 3L6HA 2DE2A 4DZ1A 5I2NB 4R72A 2ZYOA 4KI0E 3S9EA 2P1SA 1HSEA 1H44A 4G8HA 4JSDA 5IKBA 4RPNA 4K3FA 4F2QA 3LSWA 1NH7A 1FTLA 3PMWA 4O3BA 4ISUA 1SBPA 1F9BA 1TFDA 4JWYA 5AA3A 2P2AA 4EXLA 3PD9A 4FORA 1B46A 1BKAA 1ZJLA 2F97A 4GF8A 3KOTA 5I56B 4GD5A 3GLBA 3PPRA 1QW0A 3M3FA 2O1MA 3T9HB 1A40A 2ONRA 5H8FB 4F3SA 5I2KB 4XKNA 1YAEA 2G93A 2OK2A 1URGA 3MZBA 2RKMA 3N94A 4P11A 5I59A 1N7XA 4YZZA 2V3UA 4F1UA 3IORA 4I62A 4BDQA 4NEDA 2AIXA 3U94A 2YJPA 4OXVA 3C32A 4UA8A 2XX7A 4THIA 1DPPA 5A5XB 1BLFA 5KCJB 1LGBC 4NF4B 4XTCQ 2RINA 1A54A 4MBPA 3UP9A 3RT8A 3FIRA 5AA2A 1SW1A 4IO3A 1LCFA 2Q8JA 5TP9A 3VXCA 4FE8A 3PPOA 4DDDA 2VP1A 4BDRA 2QS1A 4H5FA 4RJZA 4IY6A 4ZZAA 3IB1A 3JV9A 2UXAA 1SI1A 2FNCA 1ZMGA 3TKDA 1H76A 2WKYA 4PFWA 2F6PA 2UYFA 2FA7A 3FVOA 1M5EA 4U23A 4IO4A 2VD3A 2QJEA 1R6ZA 1R9LA 4LP2B 4H1XA 1S9TA 3PV0E 4OERA 1B0LA 1IITA 2A5TA 2HEUA 4YU0A 3ODBA 4G8NA 3E3KA 2XXQA 3S4UA 1JQFA 5I84A 4FATA 4I8CA 3HSTA 2E0SA 2UVJA 1FTOA 3MW0A 2ZYMA 3SEXA 1LSTA 1LFHA 2DWAA 3V89B 5CBRA 1P1QA 2DE4A 1UTBA 2O6AA 3HPIA 3CFXA 2V3TA 2YPNA 1IEJA 3G3JA 4EQBA 2OLBA 3I6VA 3K0VA 3I5OA 5CMMA 5CC2A 3QXMA 1S7YA 3KJTA 3KZGA 4MF3A 5KDTA 1MXWA 4H6DA 4XIGQ 4HCYA 3IL1B 2GHBA 4NWDA 4GFRA 1B7UA 1MXXA 3SERA 3UA8A 4GVOA 3N6TA 4XXUA 2XXTA 3N26A 3TTNA 1MQIA 3MVYA 3BFTA 3FGSA 4FIMA 1JVXA 1SQYA 4Z7EA 3TTLA 5K2YA 3OOAA 3HHFA 2LAOA 3RN8A 1FQFA 1O64A 3VXBA 1LB8A 1YTVA 1B5HA 4LONB 2DE3A 1B9JA 3FXQA 3A09A 1PB9A 2DXRA 5H8NB 3EHTA 3EN3A 1LLSA 1OQHA 4YKIA 4L17A 5CMKA 3Q29A 4IGRA 1MY1A 1JW4A 1SYIA 3WAEA 1B0HA 4KCDA 1ATGA 3V5AA 4MH5A 1MG1A 3HO7A 3TMGA 4JSOA 2Z8EA 5L9MA 1JETA 1UIUA 3IB2A 4M1VA 5H8SA 1B6HA 1VR5A 4G2ZA 2B3FA 3K6UA 3UIFA 2X26A 3K6WA 1ELJA 3G3GA 2UVHA 3SEUA 2A5SA 2PYYA 2XXPA 1URDA 1B3FA 1JW5A 3H6VA 1B4HA 4AQ4A 1I69A 4NF6B 1Y4TA 3G3FA 1POTA 5L8DA 4I9DA 3V8XB 2B65A 4G4PA 1IZ1A 2Q9TA 4QRZA 1B51A 4FEDA 2Y7KA 4POWA 1SYHA 3B6QA 3FUZA 3FJGA 1KWHA 5CI5A 4F18A 3FD3A 4LA9A 1JVYA 1I6QA 2H4IA 4ELQA 5F7VA 1MQDA 2I58A 3DM0A 1Y3QA 3FVKA 3GZGA 3B7DA 1RYXA 1QUJA 1XHYA 2PT2A 3K00A 4OWDA 1B1XA 4QSCA 2DWIA 4GRKA 3OSQA 1JEVA 1MRPA 4GIZA 1MPBA 2HQ0A 1UTHA 2PT1A 1ZBMA 3DELB 2Y7PA 2XXYA 3FVGA 1XVXA 4EQ9A 2Y84A 2HXWA 4Z0IA 4PQJA 1IUDA 3N6UA 3FXUA 3S9NC 4E0WA 4U2RA 1P1UA 1I6BA 5H8HB 5CM6A 3CSBA 4ESXA 1LAXA 1MDQA 3GBAA 5BUUA 2UYEA 4DIGA 2NXOA 2XD3A 3CIJA 4KYEA 3S2VA 4RNSA 1R9QA 5JTYA 2VGQA 4PETA 1TXFA 4DE8A 4X48A 1FTKA 1QULA 2RC7A 3QUFA 1AMFA 1P99A 3R26A 1FTMA 4IO5A 4ZS9A 2I48A 1SI0A 3CFZA 2F5XA 4C1TA 4MLVA 1B4ZA 3K02A 4IO7A 1P1NA 3WAFA 1DTZA 3D4GA 3TUSA 1NL5A 1Y1MA 1A99A 1B05A 4JDFA 1QKBA 4ECFA 1NH8A 4GQOA 4YICA 4U4XA 5I56A 3CI8A 3ILUB 2D21A 3RTFB 1AOVA 3OXNA 2ALUA 1XVYA 4X1BA 3ZSFA 2GRVA 3VLUA 5I58B 3QUJA 4YB7A 3K1MA 4FECA 3K4UA 1SDXA 4E0XA 2D5WA 4F19A 3EF7A 1XS5A 4EDPA 3C36A 4P0GA 1IXGA 4R2FA 2IA4A 2X7QA 3T93B 4ONYA 1A8FA 3K6XA 4U1OA 2HAVA 1OVTA 2Q88A 4OVJA 5TU0A 2ZXTA 1XC1A 1QKAA 2F8DA 1EZPA 4N13A 3MQ9A 1OLAA 1MH3A 2ZYKA 4WKMA 2I4CA 4LZ7A 2O84X 3IOTA 1NNPA 3MC2A 1MQJA 3G7WA 3TEPA 3SKPA 4YKJA 4OQOA 2I4BA 4I1DA 2BJJX 5I57A 3TQWA 3T9XB 1N76A 1LCTA 1MS7A 3KSJA 1QJMA 2O69A 1MPCA 4H0WA 2XXXA 3IJXB 3LR1A 3U92A 2DP8A 5ITOA 4H5GA 1MY2A 4O3CA 1B2HA 3RT6B 1H3DA 1AIVA 3USDA 3UN6A 4ZECA 1PEBA 4QFPA 2G29A 4PFYA 1P1OA 1LAGE 1USYH 3FVNA 4JXIA 1CE2A 3D4CA 4ELRA 4X1DA 2O1LA 5I59B 2XXHA 4DXCA 3TELA 2QS2A 3MP1A 3O2AA 5FHOA 1QUIA 1BIYA 3TDJA 2HAUA 4R75A 2DSFA 3VDFA 4KHZE 2NOOA 5FTIA 5DTBA 3UORA 1N3WA 3OO7A 2V25A 1EZOA 2M8CA 4YKPA 5AA2B 2H25A 3OO9A 2V84A 3QSLA 3FV2A 5TP9B 4OYVA 3EHUA 1PB7A 2UVGA 2OWTA 3A3CA 3LUYA 3PPPA 3PMXA 4LVQA 1B7ZA 3CG1A 2I6EA 1B40A 2F35A 1B7HA 4R6KA 1MDP1 3BBRA 1MQGA 2DVZA 3H6UA 3EPEA 4PE5B 1EZ9A 3PU5A 4RPOA 4ZE9A 4R9GA 2Z8FA 3M3KA 4BDNA 3U1OA 3U93A 4O3AA 3RTWB 5ICTA 3MVWA 2XX8A 3VLWA 1OMPA 3TFLA 3KGCA 3C4MA 4OFLA 2XHDA 5CMBA 3U72A 2XXUA 1Y3NA 3IAZA 4G8MA 2F36A 2XXWA 1D3KA 4IB2A 3KEIA 3ZKLA 4F1YA 2RF1A 4NF5A 1US4A 3DP8A 3E4RA 2A5TB 3VV5A 2NVUB 1LBBA 4BDLA 4M4GA 4MLQA 1SVXB 3OEKA 3T66A 3LSXA 4EUOA 3CVGA 3Q28A 1GVCA 1NMUA 4FJPA 4TLMB 3SETA 4F3GA 1NNFA 1POY1 3PGFA 1YCJA 4G68C 4ELPA 1OIBA 3BKIB 3PPNA 4R73A 1ZKBA 3IO4A 2XD2A 1UTBB 4YMBA 3GXAA 4IO6A 3TTRA 4KPTA 2I3WA 5HBCA 3FV1A 4P0IA 4GWOA 1MH4A 3KBRA 3W9WA 2R71A 2QL3A 1GV8A 3S9MC 3TQLA 4NE4A 4OMBA 3O6HA 1NFTA 2CMOA 3KN8A 5FHNA 3LSFB 5KDTB 1H43A 1PC3A 3MPKA 1MQHA 4BLAA 1IXHA 1DPEA 1II5A 3MVXA 3MUQA 4ND9A 4KR5A 1B3EA 5TPAA 2Y7IA 3TAJA 2XXIA 2NUVA 1FQDA 1BP5A 2PVUA 1DMBA 1SD3A 5K2XA 1MM6A 1B3GA 1Y4CA 1ANFA 1PBPA 2CZLA 4ZEIA 3K6VA 2DWJA 1VFDA 1J1NA 1USYE 3V83A 5CBSA 1DSNA 3SDFA 1YPNA 4ZZEA 2V93A 1LB9A 3FATA 3GBBA 3SESA 3C31A 4POXA 3IOVA 5ISUA 1B1HA 2VHAA 4R9FA 5CRYA 1O63A 1XT8A 4KD5A 3CSGA 3JYRA 2Y7WA 3PMVA 4U4SA 4OEUA 2F7CA 2REJA 3HHGA 3SEWA 2GHAA 4ZE8A 3OEMA 4OFJA 4H67A 5AA2D 4DCYA 3KSXA 3QAXA 2Z23A 2V3QA 5FTHA 4YAHX 5AA4A 2ESNA 4XKPA 3KFMA 2ZYNA 5H8QA 2ANJA 1SW2A 4IO2A 1LAHE 2I49A 1B3LA 3IB0A 4QSDA 1B5JA 3T9UA 5DEXA 4HCWA 3KOSA 4NF8A 3CG3A 3G3KA 2QRYA 2ONKE 2QMWA 3FASA 3PPQA 3S9LC 1ZLQA 3H6WA 2YLNA 2R9JA 3A3UA 4OETA 4KQPA 4N6PA 4AB6A 4RK2A 3LSLA 3UGWA 4R74A 4HTGA 4G68A 3OO6A 4QHQA 4C1UA 4DLDA 2ZNSA 3MZ9A 2ZNTA 4GXSB 4NMYA 1OQGA 5EHMA 3IK6B 2OZZA 3BFUA 2DXYA 3MVZA 3LC8A 4F29A 2PX1A 5DVFA 2B3BA 5IAIA 1TFAA 1S50A 1VSOA 5ICQA 5I2NA 1FQCA 3TCGA 1UTHB 2Z8DA 3I3VA 1A7LA 3MZ1A 2AL5A 1MXYA 4OZ9A 4EQ7A 4LQ5A 4FEBA 3B6WA 1PDAA 4F1VA 2H99A 3KJ7A 3MJNA 4F31B 4OTEA 2HZLA 4XKQA 1M5CA 1R1NA 2O7IA 4R2BA 4ZEKA 4YMAA 3TYHA 3OSRA 4JWXA 1WDNA 3RUMA 4N07A 3H6TA 4Q30B 5L9OA 5CMCA 5LOMA 4WEPA 4ESWA 1LFIA 1XOCA 3R6UA 2I3VA 3C34A 3SEVA 1NKXA 4F3BA 3VFJA 5JTYB 1B58A 3B6TA 2AYSA 4MFIA 4H8JA 4ELOA 2Q2CA 4C0RA 5BWJA 3IOUA 4RY1A 2IEEA 1N3XA 1CB6A 1US5A 1O7TA 1QUKA 3IR1A 5H8FA 3H03A 4X9TA 4QFNA 5I2KA 1FW0A 1AL3A 3H06B 1GGGA 3EQ1A 1URSA 2I0CA 4G77A 1MY0A 3VE1B 1FQAA 4BDMA 2ABHA 5A5XA 1GTKA 5KCJA 5DT6A 4NF4A 4YB6A 4ZDMA 2NWJA 3TTKA 3L6GA 2XXVA 2O68A 2F78A 4RK9A 3O28A 5DVJA 2Q2AA 3MWBA 1VE4A 1DOTA 3K01A 1SW5A 4PP0A 3RNNA 3VVDA 5DYHA 4U22A 2DYXA 4YB5A 4TOZA 4GXAA 1N84A 1RKMA 2DS9A 4KYSA 3FJMA 3M8UA 4PFTA 3O29A 1UIVA 4LQ2A 3CFLA 3VVFA 4AB5A 1BTJA 2E1SA 3TTMA 1QVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XX9 A;  1EH3 A;  3E13 X;  1D9V A;  2QS3 A;  4QSE A;  2O51 A;  4XKR A;  3IJO B;  2F6G A;  4U21 A;  1NNT A;  4F22 A;  3T9V A;  4OHN A;  3FXR A;  2QSX A;  3SEY A;  4RA1 A;  4Q0C A;  2RCB A;  2X7P A;  4WXJ A;  3O97 A;  1M5F A;  5I57 B;  1MXU A;  1ZIU A;  1FCK A;  2Q89 A;  3DP6 A;  1JW1 A;  2ONS A;  4OEV A;  5HPQ A;  3CRB A;  3RQT A;  3H4Z A;  3TZA A;  2RCA A;  4ZED A;  1FTJ A;  1EU8 A;  4RYA A;  4GL0 A;  3C35 A;  4LZ5 A;  5HM4 B;  4QFO A;  3KN7 A;  2QS4 A;  4LAT A;  1JNF A;  3CR9 A;  1N04 A;  3LBS A;  3OMB A;  4ZEB A;  1RYO A;  2H5Y A;  3OEN A;  3QYT A;  3THI A;  2DOJ A;  2F7B A;  1TT1 A;  3MBP A;  1A8E A;  3IO6 A;  4OES A;  3RPW A;  1IQ7 A;  1H45 A;  4R6Y A;  2Z22 A;  2PMS A;  2UVI A;  1NNK A;  1Q1K A;  3G3H A;  4QFK A;  3IX1 A;  4H8I A;  2VOZ A;  3ECR A;  1FQE A;  2QMX A;  4QF9 A;  3RY3 A;  1B32 A;  1GR2 A;  5JK4 A;  3FJ7 A;  4HS7 A;  4JBZ A;  3MPL A;  1MM7 A;  4KFQ A;  3MP6 A;  1LBC A;  4LUB A;  2ZMB A;  2I0B A;  4NWC A;  5FHM A;  5H8N A;  3Q27 A;  3O66 A;  5ELV A;  1I6A A;  3KG2 A;  3T96 B;  3TOD A;  3Q25 A;  3MP8 A;  3W9V A;  3VLV A;  1IIW A;  4Q8R A;  4NF5 B;  3HCQ A;  1M5B A;  3VVE A;  4DCX A;  3PD8 A;  4UAC A;  1N7W A;  3C33 A;  2R6G E;  1TWY A;  4F2O A;  3OD7 A;  5M2V A;  2OWS A;  5B7D A;  3ONM A;  3QIM A;  3M3L A;  3AXF A;  3PUV E;  5F1Q A;  4TQU Q;  1WVJ A;  4GL8 A;  3RLF E;  3K1N A;  4GLI A;  1L5T A;  3K1P A;  1IXI A;  1Z7N E;  1N0T A;  2KLF A;  2THI A;  3HV1 A;  3TCF A;  1Z7M E;  2P0S A;  3OO8 A;  4NF6 A;  1MPD A;  3EHS A;  1LFG A;  3JZJ A;  5DVI A;  3T22 A;  1AH5 A;  4KYD A;  4R6H A;  4EXK A;  5J1D A;  4IGT A;  3ZS6 A;  3O9P A;  3DLN A;  4H65 A;  4KCC A;  3TPA A;  2H9B A;  4FAJ A;  3R7X A;  2O7U A;  1Y9U A;  1ZTY A;  3K2D A;  5L9S A;  4OEN A;  4OFO A;  2XXR A;  3Q26 A;  3RGY A;  2F7A A;  4DXU A;  1ZU0 A;  3H3G A;  3H7M A;  4IY5 A;  5TPA B;  2HZK A;  3QK6 A;  4WED A;  2DQV A;  1D4N A;  1A55 A;  3PUX E;  1B5I A;  3F11 A;  4Q5T A;  1OVB A;  1UQW A;  2RC8 A;  2W7Y A;  1JEU A;  1HSL A;  2OCU A;  2ZNU A;  5KZT A;  2H98 A;  2GFE A;  4F3P A;  5EYF A;  1B52 A;  3FZV A;  5EHS A;  2PBW A;  1Y1Z A;  3DP4 A;  2FYI A;  1PBQ A;  3P7I A;  1MXV A;  2D3I A;  1P1W A;  3W15 C;  1WOD A;  2HCA A;  4ZEF A;  1MXZ A;  3PUZ E;  1FQB A;  3G3I A;  2VD2 A;  3PUW E;  4YKK A;  3UK4 A;  3KN3 A;  4GOT A;  2GH9 A;  5H8H A;  3IOW A;  4BDO A;  3MAM A;  1HSJ A;  3U8Q A;  5ITP A;  3OEL A;  1Y3P A;  2OJT A;  2QPQ A;  1IXC A;  2REG A;  5AE4 A;  4NTL A;  5AA4 B;  4JWO A;  3HN0 A;  1B3H A;  4TLL B;  5H8Q B;  1SW4 A;  3O6I A;  4EF1 A;  1OLC A;  3PUY E;  2OBG A;  3C9H A;  1MY4 A;  1LAF E;  1PB8 A;  1M5D A;  2HFB A;  4EF2 A;  5DEX B;  2DWH A;  4HW8 A;  4QFL A;  5JEI A;  3ZKK A;  4NF8 B;  5B70 A;  1Y20 A;  4LZ8 A;  3E9X A;  4F39 A;  1Q35 A;  4U1Z A;  1MY3 A;  1D9Y A;  3O6G A;  4G68 B;  4PFU A;  5AA1 A;  2RC9 A;  2Y7R A;  5I58 A;  4RXL A;  3N5L A;  3TCH A;  2F34 A;  4DXB A;  4JB7 A;  3ILT B;  2AL4 A;  1T0K A;  1VFE A;  2DVC A;  1DTG A;  3L6H A;  2DE2 A;  4DZ1 A;  5I2N B;  4R72 A;  2ZYO A;  4KI0 E;  3S9E A;  2P1S A;  1HSE A;  1H44 A;  4G8H A;  4JSD A;  5IKB A;  4RPN A;  4K3F A;  4F2Q A;  3LSW A;  1NH7 A;  1FTL A;  3PMW A;  4O3B A;  4ISU A;  1SBP A;  1F9B A;  1TFD A;  4JWY A;  5AA3 A;  2P2A A;  4EXL A;  3PD9 A;  4FOR A;  1B46 A;  1BKA A;  1ZJL A;  2F97 A;  4GF8 A;  3KOT A;  5I56 B;  4GD5 A;  3GLB A;  3PPR A;  1QW0 A;  3M3F A;  2O1M A;  3T9H B;  1A40 A;  2ONR A;  5H8F B;  4F3S A;  5I2K B;  4XKN A;  1YAE A;  2G93 A;  2OK2 A;  1URG A;  3MZB A;  2RKM A;  3N94 A;  4P11 A;  5I59 A;  1N7X A;  4YZZ A;  2V3U A;  4F1U A;  3IOR A;  4I62 A;  4BDQ A;  4NED A;  2AIX A;  3U94 A;  2YJP A;  4OXV A;  3C32 A;  4UA8 A;  2XX7 A;  4THI A;  1DPP A;  5A5X B;  1BLF A;  5KCJ B;  1LGB C;  4NF4 B;  4XTC Q;  2RIN A;  1A54 A;  4MBP A;  3UP9 A;  3RT8 A;  3FIR A;  5AA2 A;  1SW1 A;  4IO3 A;  1LCF A;  2Q8J A;  5TP9 A;  3VXC A;  4FE8 A;  3PPO A;  4DDD A;  2VP1 A;  4BDR A;  2QS1 A;  4H5F A;  4RJZ A;  4IY6 A;  4ZZA A;  3IB1 A;  3JV9 A;  2UXA A;  1SI1 A;  2FNC A;  1ZMG A;  3TKD A;  1H76 A;  2WKY A;  4PFW A;  2F6P A;  2UYF A;  2FA7 A;  3FVO A;  1M5E A;  4U23 A;  4IO4 A;  2VD3 A;  2QJE A;  1R6Z A;  1R9L A;  4LP2 B;  4H1X A;  1S9T A;  3PV0 E;  4OER A;  1B0L A;  1IIT A;  2A5T A;  2HEU A;  4YU0 A;  3ODB A;  4G8N A;  3E3K A;  2XXQ A;  3S4U A;  1JQF A;  5I84 A;  4FAT A;  4I8C A;  3HST A;  2E0S A;  2UVJ A;  1FTO A;  3MW0 A;  2ZYM A;  3SEX A;  1LST A;  1LFH A;  2DWA A;  3V89 B;  5CBR A;  1P1Q A;  2DE4 A;  1UTB A;  2O6A A;  3HPI A;  3CFX A;  2V3T A;  2YPN A;  1IEJ A;  3G3J A;  4EQB A;  2OLB A;  3I6V A;  3K0V A;  3I5O A;  5CMM A;  5CC2 A;  3QXM A;  1S7Y A;  3KJT A;  3KZG A;  4MF3 A;  5KDT A;  1MXW A;  4H6D A;  4XIG Q;  4HCY A;  3IL1 B;  2GHB A;  4NWD A;  4GFR A;  1B7U A;  1MXX A;  3SER A;  3UA8 A;  4GVO A;  3N6T A;  4XXU A;  2XXT A;  3N26 A;  3TTN A;  1MQI A;  3MVY A;  3BFT A;  3FGS A;  4FIM A;  1JVX A;  1SQY A;  4Z7E A;  3TTL A;  5K2Y A;  3OOA A;  3HHF A;  2LAO A;  3RN8 A;  1FQF A;  1O64 A;  3VXB A;  1LB8 A;  1YTV A;  1B5H A;  4LON B;  2DE3 A;  1B9J A;  3FXQ A;  3A09 A;  1PB9 A;  2DXR A;  5H8N B;  3EHT A;  3EN3 A;  1LLS A;  1OQH A;  4YKI A;  4L17 A;  5CMK A;  3Q29 A;  4IGR A;  1MY1 A;  1JW4 A;  1SYI A;  3WAE A;  1B0H A;  4KCD A;  1ATG A;  3V5A A;  4MH5 A;  1MG1 A;  3HO7 A;  3TMG A;  4JSO A;  2Z8E A;  5L9M A;  1JET A;  1UIU A;  3IB2 A;  4M1V A;  5H8S A;  1B6H A;  1VR5 A;  4G2Z A;  2B3F A;  3K6U A;  3UIF A;  2X26 A;  3K6W A;  1ELJ A;  3G3G A;  2UVH A;  3SEU A;  2A5S A;  2PYY A;  2XXP A;  1URD A;  1B3F A;  1JW5 A;  3H6V A;  1B4H A;  4AQ4 A;  1I69 A;  4NF6 B;  1Y4T A;  3G3F A;  1POT A;  5L8D A;  4I9D A;  3V8X B;  2B65 A;  4G4P A;  1IZ1 A;  2Q9T A;  4QRZ A;  1B51 A;  4FED A;  2Y7K A;  4POW A;  1SYH A;  3B6Q A;  3FUZ A;  3FJG A;  1KWH A;  5CI5 A;  4F18 A;  3FD3 A;  4LA9 A;  1JVY A;  1I6Q A;  2H4I A;  4ELQ A;  5F7V A;  1MQD A;  2I58 A;  3DM0 A;  1Y3Q A;  3FVK A;  3GZG A;  3B7D A;  1RYX A;  1QUJ A;  1XHY A;  2PT2 A;  3K00 A;  4OWD A;  1B1X A;  4QSC A;  2DWI A;  4GRK A;  3OSQ A;  1JEV A;  1MRP A;  4GIZ A;  1MPB A;  2HQ0 A;  1UTH A;  2PT1 A;  1ZBM A;  3DEL B;  2Y7P A;  2XXY A;  3FVG A;  1XVX A;  4EQ9 A;  2Y84 A;  2HXW A;  4Z0I A;  4PQJ A;  1IUD A;  3N6U A;  3FXU A;  3S9N C;  4E0W A;  4U2R A;  1P1U A;  1I6B A;  5H8H B;  5CM6 A;  3CSB A;  4ESX A;  1LAX A;  1MDQ A;  3GBA A;  5BUU A;  2UYE A;  4DIG A;  2NXO A;  2XD3 A;  3CIJ A;  4KYE A;  3S2V A;  4RNS A;  1R9Q A;  5JTY A;  2VGQ A;  4PET A;  1TXF A;  4DE8 A;  4X48 A;  1FTK A;  1QUL A;  2RC7 A;  3QUF A;  1AMF A;  1P99 A;  3R26 A;  1FTM A;  4IO5 A;  4ZS9 A;  2I48 A;  1SI0 A;  3CFZ A;  2F5X A;  4C1T A;  4MLV A;  1B4Z A;  3K02 A;  4IO7 A;  1P1N A;  3WAF A;  1DTZ A;  3D4G A;  3TUS A;  1NL5 A;  1Y1M A;  1A99 A;  1B05 A;  4JDF A;  1QKB A;  4ECF A;  1NH8 A;  4GQO A;  4YIC A;  4U4X A;  5I56 A;  3CI8 A;  3ILU B;  2D21 A;  3RTF B;  1AOV A;  3OXN A;  2ALU A;  1XVY A;  4X1B A;  3ZSF A;  2GRV A;  3VLU A;  5I58 B;  3QUJ A;  4YB7 A;  3K1M A;  4FEC A;  3K4U A;  1SDX A;  4E0X A;  2D5W A;  4F19 A;  3EF7 A;  1XS5 A;  4EDP A;  3C36 A;  4P0G A;  1IXG A;  4R2F A;  2IA4 A;  2X7Q A;  3T93 B;  4ONY A;  1A8F A;  3K6X A;  4U1O A;  2HAV A;  1OVT A;  2Q88 A;  4OVJ A;  5TU0 A;  2ZXT A;  1XC1 A;  1QKA A;  2F8D A;  1EZP A;  4N13 A;  3MQ9 A;  1OLA A;  1MH3 A;  2ZYK A;  4WKM A;  2I4C A;  4LZ7 A;  2O84 X;  3IOT A;  1NNP A;  3MC2 A;  1MQJ A;  3G7W A;  3TEP A;  3SKP A;  4YKJ A;  4OQO A;  2I4B A;  4I1D A;  2BJJ X;  5I57 A;  3TQW A;  3T9X B;  1N76 A;  1LCT A;  1MS7 A;  3KSJ A;  1QJM A;  2O69 A;  1MPC A;  4H0W A;  2XXX A;  3IJX B;  3LR1 A;  3U92 A;  2DP8 A;  5ITO A;  4H5G A;  1MY2 A;  4O3C A;  1B2H A;  3RT6 B;  1H3D A;  1AIV A;  3USD A;  3UN6 A;  4ZEC A;  1PEB A;  4QFP A;  2G29 A;  4PFY A;  1P1O A;  1LAG E;  1USY H;  3FVN A;  4JXI A;  1CE2 A;  3D4C A;  4ELR A;  4X1D A;  2O1L A;  5I59 B;  2XXH A;  4DXC A;  3TEL A;  2QS2 A;  3MP1 A;  3O2A A;  5FHO A;  1QUI A;  1BIY A;  3TDJ A;  2HAU A;  4R75 A;  2DSF A;  3VDF A;  4KHZ E;  2NOO A;  5FTI A;  5DTB A;  3UOR A;  1N3W A;  3OO7 A;  2V25 A;  1EZO A;  2M8C A;  4YKP A;  5AA2 B;  2H25 A;  3OO9 A;  2V84 A;  3QSL A;  3FV2 A;  5TP9 B;  4OYV A;  3EHU A;  1PB7 A;  2UVG A;  2OWT A;  3A3C A;  3LUY A;  3PPP A;  3PMX A;  4LVQ A;  1B7Z A;  3CG1 A;  2I6E A;  1B40 A;  2F35 A;  1B7H A;  4R6K A;  1MDP 1;  3BBR A;  1MQG A;  2DVZ A;  3H6U A;  3EPE A;  4PE5 B;  1EZ9 A;  3PU5 A;  4RPO A;  4ZE9 A;  4R9G A;  2Z8F A;  3M3K A;  4BDN A;  3U1O A;  3U93 A;  4O3A A;  3RTW B;  5ICT A;  3MVW A;  2XX8 A;  3VLW A;  1OMP A;  3TFL A;  3KGC A;  3C4M A;  4OFL A;  2XHD A;  5CMB A;  3U72 A;  2XXU A;  1Y3N A;  3IAZ A;  4G8M A;  2F36 A;  2XXW A;  1D3K A;  4IB2 A;  3KEI A;  3ZKL A;  4F1Y A;  2RF1 A;  4NF5 A;  1US4 A;  3DP8 A;  3E4R A;  2A5T B;  3VV5 A;  2NVU B;  1LBB A;  4BDL A;  4M4G A;  4MLQ A;  1SVX B;  3OEK A;  3T66 A;  3LSX A;  4EUO A;  3CVG A;  3Q28 A;  1GVC A;  1NMU A;  4FJP A;  4TLM B;  3SET A;  4F3G A;  1NNF A;  1POY 1;  3PGF A;  1YCJ A;  4G68 C;  4ELP A;  1OIB A;  3BKI B;  3PPN A;  4R73 A;  1ZKB A;  3IO4 A;  2XD2 A;  1UTB B;  4YMB A;  3GXA A;  4IO6 A;  3TTR A;  4KPT A;  2I3W A;  5HBC A;  3FV1 A;  4P0I A;  4GWO A;  1MH4 A;  3KBR A;  3W9W A;  2R71 A;  2QL3 A;  1GV8 A;  3S9M C;  3TQL A;  4NE4 A;  4OMB A;  3O6H A;  1NFT A;  2CMO A;  3KN8 A;  5FHN A;  3LSF B;  5KDT B;  1H43 A;  1PC3 A;  3MPK A;  1MQH A;  4BLA A;  1IXH A;  1DPE A;  1II5 A;  3MVX A;  3MUQ A;  4ND9 A;  4KR5 A;  1B3E A;  5TPA A;  2Y7I A;  3TAJ A;  2XXI A;  2NUV A;  1FQD A;  1BP5 A;  2PVU A;  1DMB A;  1SD3 A;  5K2X A;  1MM6 A;  1B3G A;  1Y4C A;  1ANF A;  1PBP A;  2CZL A;  4ZEI A;  3K6V A;  2DWJ A;  1VFD A;  1J1N A;  1USY E;  3V83 A;  5CBS A;  1DSN A;  3SDF A;  1YPN A;  4ZZE A;  2V93 A;  1LB9 A;  3FAT A;  3GBB A;  3SES A;  3C31 A;  4POX A;  3IOV A;  5ISU A;  1B1H A;  2VHA A;  4R9F A;  5CRY A;  1O63 A;  1XT8 A;  4KD5 A;  3CSG A;  3JYR A;  2Y7W A;  3PMV A;  4U4S A;  4OEU A;  2F7C A;  2REJ A;  3HHG A;  3SEW A;  2GHA A;  4ZE8 A;  3OEM A;  4OFJ A;  4H67 A;  5AA2 D;  4DCY A;  3KSX A;  3QAX A;  2Z23 A;  2V3Q A;  5FTH A;  4YAH X;  5AA4 A;  2ESN A;  4XKP A;  3KFM A;  2ZYN A;  5H8Q A;  2ANJ A;  1SW2 A;  4IO2 A;  1LAH E;  2I49 A;  1B3L A;  3IB0 A;  4QSD A;  1B5J A;  3T9U A;  5DEX A;  4HCW A;  3KOS A;  4NF8 A;  3CG3 A;  3G3K A;  2QRY A;  2ONK E;  2QMW A;  3FAS A;  3PPQ A;  3S9L C;  1ZLQ A;  3H6W A;  2YLN A;  2R9J A;  3A3U A;  4OET A;  4KQP A;  4N6P A;  4AB6 A;  4RK2 A;  3LSL A;  3UGW A;  4R74 A;  4HTG A;  4G68 A;  3OO6 A;  4QHQ A;  4C1U A;  4DLD A;  2ZNS A;  3MZ9 A;  2ZNT A;  4GXS B;  4NMY A;  1OQG A;  5EHM A;  3IK6 B;  2OZZ A;  3BFU A;  2DXY A;  3MVZ A;  3LC8 A;  4F29 A;  2PX1 A;  5DVF A;  2B3B A;  5IAI A;  1TFA A;  1S50 A;  1VSO A;  5ICQ A;  5I2N A;  1FQC A;  3TCG A;  1UTH B;  2Z8D A;  3I3V A;  1A7L A;  3MZ1 A;  2AL5 A;  1MXY A;  4OZ9 A;  4EQ7 A;  4LQ5 A;  4FEB A;  3B6W A;  1PDA A;  4F1V A;  2H99 A;  3KJ7 A;  3MJN A;  4F31 B;  4OTE A;  2HZL A;  4XKQ A;  1M5C A;  1R1N A;  2O7I A;  4R2B A;  4ZEK A;  4YMA A;  3TYH A;  3OSR A;  4JWX A;  1WDN A;  3RUM A;  4N07 A;  3H6T A;  4Q30 B;  5L9O A;  5CMC A;  5LOM A;  4WEP A;  4ESW A;  1LFI A;  1XOC A;  3R6U A;  2I3V A;  3C34 A;  3SEV A;  1NKX A;  4F3B A;  3VFJ A;  5JTY B;  1B58 A;  3B6T A;  2AYS A;  4MFI A;  4H8J A;  4ELO A;  2Q2C A;  4C0R A;  5BWJ A;  3IOU A;  4RY1 A;  2IEE A;  1N3X A;  1CB6 A;  1US5 A;  1O7T A;  1QUK A;  3IR1 A;  5H8F A;  3H03 A;  4X9T A;  4QFN A;  5I2K A;  1FW0 A;  1AL3 A;  3H06 B;  1GGG A;  3EQ1 A;  1URS A;  2I0C A;  4G77 A;  1MY0 A;  3VE1 B;  1FQA A;  4BDM A;  2ABH A;  5A5X A;  1GTK A;  5KCJ A;  5DT6 A;  4NF4 A;  4YB6 A;  4ZDM A;  2NWJ A;  3TTK A;  3L6G A;  2XXV A;  2O68 A;  2F78 A;  4RK9 A;  3O28 A;  5DVJ A;  2Q2A A;  3MWB A;  1VE4 A;  1DOT A;  3K01 A;  1SW5 A;  4PP0 A;  3RNN A;  3VVD A;  5DYH A;  4U22 A;  2DYX A;  4YB5 A;  4TOZ A;  4GXA A;  1N84 A;  1RKM A;  2DS9 A;  4KYS A;  3FJM A;  3M8U A;  4PFT A;  3O29 A;  1UIV A;  4LQ2 A;  3CFL A;  3VVF A;  4AB5 A;  1BTJ A;  2E1S A;  3TTM A;  1QVS A; 
#chains in the Genus database with same CATH topology
 2XX9 A;  4G61 A;  1EH3 A;  4GWU A;  3E13 X;  1D9V A;  2QS3 A;  4QSE A;  2O51 A;  4XKR A;  3IJO B;  2F6G A;  3U65 A;  4U21 A;  1NNT A;  4F22 A;  3T9V A;  4GBV A;  4OHN A;  3FXR A;  2QSX A;  3SEY A;  4RA1 A;  4Q0C A;  1YXI A;  4XF5 A;  4MCO A;  2RCB A;  2X7P A;  4WXJ A;  3O97 A;  1M5F A;  2QFL A;  5I57 B;  2QVV A;  1MXU A;  1NV3 A;  1ZIU A;  1XI6 A;  4N91 A;  1NV5 A;  1FCK A;  2Q89 A;  3DP6 A;  4HXV A;  1JW1 A;  2ONS A;  5ESY A;  4OEV A;  3LV0 A;  5HPQ A;  3CRB A;  3RQT A;  1FBD A;  3H4Z A;  3TZA A;  2RCA A;  5I7I A;  4ZED A;  1FTJ A;  1EU8 A;  4RYA A;  4MJO A;  4GL0 A;  3C35 A;  4LZ5 A;  5HM4 B;  4QFO A;  3KN7 A;  2QS4 A;  4LAT A;  1JNF A;  3CR9 A;  4OA4 A;  1N04 A;  2HHM A;  3LBS A;  3OMB A;  4ZEB A;  1RYO A;  2H5Y A;  3OEN A;  3QYT A;  3THI A;  2DOJ A;  2F7B A;  1TT1 A;  4NG7 A;  3MBP A;  1A8E A;  3IO6 A;  4OES A;  3RPW A;  1IQ7 A;  1H45 A;  4R6Y A;  2Z22 A;  4QXD A;  2PMS A;  2UVI A;  1NNK A;  1Q1K A;  3G3H A;  4QFK A;  1FPD A;  1YZ0 A;  3IX1 A;  4H8I A;  2VOZ A;  3ECR A;  5I5P A;  1FQE A;  2QMX A;  4QF9 A;  3RY3 A;  1B32 A;  1GR2 A;  5JK4 A;  3FJ7 A;  4HS7 A;  4JBZ A;  3MPL A;  1MM7 A;  4KFQ A;  1FPG A;  1LBY A;  3MP6 A;  1LBC A;  4LUB A;  2ZMB A;  2I0B A;  4NWC A;  5FHM A;  5H8N A;  3Q27 A;  3O66 A;  5ELV A;  1I6A A;  3KG2 A;  3T96 B;  3TOD A;  4HE2 A;  3Q25 A;  4MAG A;  3MP8 A;  4MX6 A;  3W9V A;  3VLV A;  1IIW A;  4Q8R A;  4NF5 B;  3HCQ A;  2KQZ A;  1M5B A;  3VVE A;  4DCX A;  1CNQ A;  3PD8 A;  4UAC A;  1N7W A;  3C33 A;  2R6G E;  1TWY A;  1NV4 A;  4F2O A;  3OD7 A;  5M2V A;  2OWS A;  3MST A;  5B7D A;  2L5V A;  1D9Q A;  3ONM A;  3QIM A;  3M3L A;  3AXF A;  3PUV E;  5F1Q A;  5F24 A;  4TQU Q;  3RPL A;  1WVJ A;  4GL8 A;  3RLF E;  3K1N A;  4GLI A;  1L5T A;  3K1P A;  1IXI A;  1Z7N E;  1N0T A;  2KLF A;  2THI A;  3HV1 A;  3TCF A;  2PCR A;  1FJ9 A;  1Z7M E;  3KBZ A;  4PDH A;  2P0S A;  3OO8 A;  5EQ8 A;  4NF6 A;  1MPD A;  3EHS A;  1LFG A;  3JZJ A;  5DVI A;  3T22 A;  1AH5 A;  4KYD A;  1NUX A;  4R6H A;  4EXK A;  5J1D A;  4IGT A;  2ZZV A;  3ZS6 A;  3O9P A;  4MMP A;  1FPF A;  3DLN A;  4H65 A;  4KCC A;  3TPA A;  4DI4 B;  4GX4 A;  2H9B A;  4FAJ A;  3R7X A;  3ISP A;  3CHG A;  2O7U A;  1Y9U A;  1ZTY A;  3K2D A;  5L9S A;  4OEN A;  2HXR A;  4OFO A;  5EYG A;  2XXR A;  3Q26 A;  3RGY A;  2F7A A;  4DXU A;  1G0I A;  3A29 A;  1ZU0 A;  3H3G A;  3H7M A;  4PFR A;  4IY5 A;  5TPA B;  2HZK A;  3QK6 A;  4P1E A;  4WED A;  2DQV A;  1D4N A;  1A55 A;  3PUX E;  1B5I A;  4GX6 A;  3F11 A;  4Q5T A;  1LBV A;  1OVB A;  1UQW A;  2RC8 A;  2W7Y A;  1JEU A;  1HSL A;  2OCU A;  2ZNU A;  5FBP A;  4PFI A;  5KZT A;  2H98 A;  2GFE A;  4F3P A;  2HPG A;  5EYF A;  1B52 A;  3FZV A;  5EHS A;  2PBW A;  1Y1Z A;  3DP4 A;  4NHB A;  2FYI A;  2WYK A;  1PBQ A;  3P7I A;  3RYD A;  1MXV A;  2D3I A;  1P1W A;  3W15 C;  1RDY A;  1WOD A;  2HCA A;  4ZEF A;  2R8T A;  1MXZ A;  3PUZ E;  2DDK A;  1FQB A;  3G3I A;  5IM2 A;  2VD2 A;  3PUW E;  4YKK A;  3UK4 A;  3KN3 A;  4GOT A;  2GH9 A;  5H8H A;  3IOW A;  4BDO A;  3MAM A;  1HSJ A;  2KR0 A;  3U8Q A;  5ITP A;  3OEL A;  1Y3P A;  4HE1 A;  2OJT A;  2QPQ A;  1IXC A;  2REG A;  5AE4 A;  2XWO A;  4NTL A;  5AA4 B;  4JWO A;  3HN0 A;  1B3H A;  4TLL B;  5H8Q B;  1SW4 A;  4GX3 A;  3O6I A;  4PFB A;  1KA0 A;  4EF1 A;  1OLC A;  4PCD A;  2FBP A;  3PUY E;  2OBG A;  2VT5 A;  3C9H A;  4GWZ A;  4IR8 A;  1MY4 A;  1LAF E;  1PB8 A;  1M5D A;  2HFB A;  5IZ3 A;  1NUY A;  4JVD A;  4EF2 A;  1FPB A;  4PC9 A;  5DEX B;  2DWH A;  4HW8 A;  4QFL A;  5JEI A;  3ZKK A;  4NF8 B;  5B70 A;  1Y20 A;  4LZ8 A;  3E9X A;  4MIJ A;  4F39 A;  2CZH A;  1Q35 A;  4U1Z A;  4I3E A;  1MY3 A;  1D9Y A;  1FBP A;  3O6G A;  4G68 B;  4PFU A;  5AA1 A;  2RC9 A;  2Y7R A;  5I58 A;  4RXL A;  3N5L A;  3TCH A;  2F34 A;  2FHY A;  4DXB A;  4JB7 A;  3ILT B;  2AL4 A;  1T0K A;  1VFE A;  2DVC A;  1DTG A;  3L6H A;  1FPI A;  2DE2 A;  4DZ1 A;  5I2N B;  4PAF A;  4R72 A;  2ZYO A;  4KI0 E;  3S9E A;  2P1S A;  1HSE A;  1H44 A;  1IMF A;  4G8H A;  4JSD A;  5IKB A;  4RPN A;  2VPO A;  4K3F A;  2WEF A;  4F2Q A;  1RDX A;  3LSW A;  4X8R A;  1NH7 A;  1FTL A;  3PMW A;  4O3B A;  4ISU A;  1JP4 A;  1SBP A;  1F9B A;  1TFD A;  4JWY A;  5AA3 A;  2P2A A;  4EXL A;  4UAB A;  3PD9 A;  4FOR A;  1NUZ A;  1B46 A;  1BKA A;  1ZJL A;  2F97 A;  3T0J A;  4GF8 A;  3KOT A;  5I56 B;  4GD5 A;  3GLB A;  3PPR A;  1QW0 A;  1NV7 A;  3M3F A;  2O1M A;  3T9H B;  1A40 A;  1NV1 A;  2ONR A;  5H8F B;  4F3S A;  5I2K B;  4XKN A;  1YAE A;  2G93 A;  2OK2 A;  1IME A;  1URG A;  3MZB A;  2RKM A;  3N94 A;  4P11 A;  5I59 A;  1N7X A;  4YZZ A;  2V3U A;  4F1U A;  3IOR A;  4I62 A;  4BDQ A;  4NED A;  2AIX A;  3U94 A;  2YJP A;  4OXV A;  3C32 A;  4UA8 A;  2XX7 A;  4THI A;  1DPP A;  5A5X B;  1BLF A;  2XWK A;  5KCJ B;  1LGB C;  4NF4 B;  4XTC Q;  2RIN A;  1A54 A;  4MBP A;  3UP9 A;  3RT8 A;  3FIR A;  5ET7 A;  5AA2 A;  5EQ7 A;  1SW1 A;  4IO3 A;  1LCF A;  1G0H A;  2Q8J A;  5TP9 A;  3VXC A;  4FE8 A;  3PPO A;  4DI3 D;  1FPK A;  4DDD A;  2VP1 A;  4BDR A;  2QS1 A;  4QBA A;  4H5F A;  4RJZ A;  4IY6 A;  5T3J A;  4ZZA A;  3IB1 A;  3JV9 A;  2UXA A;  1SI1 A;  4OVR A;  1FBG A;  2FNC A;  1ZMG A;  3TKD A;  1H76 A;  2WKY A;  4PFW A;  2F6P A;  2UYF A;  2FA7 A;  3FVO A;  2PFZ A;  1VDW A;  2Q8M A;  1M5E A;  4U23 A;  1INP A;  4IO4 A;  2VD3 A;  2QJE A;  1R6Z A;  1R9L A;  4LP2 B;  4H1X A;  4JVI A;  1S9T A;  1LEV A;  3PV0 E;  4OER A;  4NN3 A;  1B0L A;  1IIT A;  2A5T A;  2HEU A;  4YU0 A;  3ODB A;  4G8N A;  3E3K A;  2XXQ A;  3S4U A;  1JQF A;  5I84 A;  4O94 A;  4AS4 A;  4FAT A;  4I8C A;  3HST A;  2E0S A;  2UVJ A;  1FTO A;  1LBZ A;  3MW0 A;  2ZYM A;  3SEX A;  2FVZ A;  1LST A;  1LFH A;  2DWA A;  4GWX A;  3V89 B;  5CBR A;  1P1Q A;  2DE4 A;  1UTB A;  2O6A A;  3HPI A;  3CFX A;  4P8B A;  3IFC A;  4PBH A;  2V3T A;  2YPN A;  4LN5 A;  1IEJ A;  3G3J A;  4N17 A;  4PGN A;  4EQB A;  2OLB A;  1FTA A;  3I6V A;  3K0V A;  3I5O A;  5CMM A;  5CC2 A;  3QXM A;  4P56 A;  1S7Y A;  4PBQ A;  3KJT A;  1IMA A;  2FIE A;  3KZG A;  4MF3 A;  5KDT A;  1MXW A;  4H6D A;  4XIG Q;  1FPE A;  4HCY A;  3IL1 B;  1FSA A;  2GHB A;  2ZZW A;  4NWD A;  4GFR A;  1B7U A;  1MXX A;  3SER A;  3UA8 A;  2WYP A;  4GVO A;  3N6T A;  2JJK A;  4XXU A;  2XXT A;  3N26 A;  3TTN A;  1MQI A;  3MVY A;  3BFT A;  3FGS A;  4FIM A;  3EKI A;  1JVX A;  1SQY A;  4Z7E A;  3TTL A;  5K2Y A;  3OOA A;  4FBP A;  3HHF A;  2LAO A;  3RN8 A;  1FQF A;  1O64 A;  3VXB A;  1LB8 A;  1YTV A;  1B5H A;  4LON B;  2DE3 A;  1B9J A;  3FXQ A;  4MNC A;  3A09 A;  1PB9 A;  2DXR A;  5H8N B;  3EHT A;  3EN3 A;  1LLS A;  1OQH A;  2CEX A;  3BIH A;  4YKI A;  4L17 A;  5CMK A;  4N8G A;  3Q29 A;  4IGR A;  1MY1 A;  1JW4 A;  1SYI A;  1NV2 A;  3WAE A;  1B0H A;  4KCD A;  1ATG A;  3V5A A;  3HFU A;  1MG1 A;  3HO7 A;  4MH5 A;  3TMG A;  1YYZ A;  4JSO A;  2Z8E A;  5L9M A;  1JET A;  1UIU A;  3IB2 A;  5IGA A;  4M1V A;  3B50 A;  5H8S A;  1B6H A;  4N15 A;  1VR5 A;  4G2Z A;  2B3F A;  3K6U A;  3UIF A;  2X26 A;  3K6W A;  3RPL B;  1AWB A;  1FPJ A;  1ELJ A;  3G3G A;  5ET6 A;  4OVQ A;  2UVH A;  3SEU A;  2A5S A;  4HE0 A;  1DCU A;  2PYY A;  2XXP A;  4OVS A;  4P1L A;  1URD A;  1B3F A;  1JW5 A;  3H6V A;  1B4H A;  4AQ4 A;  1I69 A;  1LBW A;  4NF6 B;  1Y4T A;  3G3F A;  1POT A;  1EYK A;  5L8D A;  4I9D A;  3V8X B;  4XEQ A;  2B65 A;  4G4P A;  1IZ1 A;  1LBX A;  2OWZ A;  2Q9T A;  4QRZ A;  1B51 A;  4FED A;  4PAK A;  2Y7K A;  4POW A;  1SYH A;  3B6Q A;  3FUZ A;  3FJG A;  1KWH A;  5CI5 A;  4OVP A;  4F18 A;  3FD3 A;  4PTK A;  4LA9 A;  1JVY A;  1I6Q A;  1IMB A;  2H4I A;  4ELQ A;  5F7V A;  1MQD A;  2I58 A;  3DM0 A;  4PF8 A;  1Y3Q A;  3FVK A;  3GZG A;  3E79 A;  3B7D A;  3FXB A;  1RYX A;  1KA1 A;  1QUJ A;  1XHY A;  2PT2 A;  3E78 A;  3K00 A;  4OWD A;  1B1X A;  4GBW A;  3D1R A;  4QSC A;  5ET5 A;  2DWI A;  4GRK A;  3NOH A;  3OSQ A;  1JEV A;  1MRP A;  4GIZ A;  1MPB A;  2HQ0 A;  1UTH A;  4MEV A;  2PT1 A;  1ZBM A;  3DEL B;  2Y7P A;  2XXY A;  2XXK A;  2V4C A;  4PAI A;  3FVG A;  1XVX A;  1FJ6 A;  2XWV A;  3LUZ A;  4EQ9 A;  2Y84 A;  2HXW A;  4Z0I A;  4PQJ A;  1IUD A;  2XA5 A;  4AS5 A;  2Q74 A;  3N6U A;  3FXU A;  3S9N C;  4E0W A;  4U2R A;  1P1U A;  1I6B A;  5H8H B;  5CM6 A;  3CSB A;  4PGP A;  2P3N A;  4ESX A;  1LAX A;  1MDQ A;  2PFY A;  3GBA A;  5BUU A;  5ET8 A;  1DK4 A;  2GQ1 A;  2UYE A;  4DIG A;  2NXO A;  2XD3 A;  3CIJ A;  4KYE A;  3S2V A;  4RNS A;  1R9Q A;  5JTY A;  2VGQ A;  4PET A;  1TXF A;  4H45 A;  4DE8 A;  4X48 A;  1FTK A;  1QUL A;  2RC7 A;  3QUF A;  1AMF A;  1P99 A;  3R26 A;  1FTM A;  4IO5 A;  4ZS9 A;  5IZ3 B;  2B4M A;  1SI0 A;  2I48 A;  3CFZ A;  2F5X A;  4MNI A;  4C1T A;  4MLV A;  1B4Z A;  3K02 A;  4IO7 A;  1P1N A;  1FBE A;  3WAF A;  1DTZ A;  3D4G A;  3TUS A;  4NF0 A;  1NL5 A;  1Y1M A;  2B4L A;  1A99 A;  1B05 A;  4JDF A;  1QKB A;  4ECF A;  1NH8 A;  4GQO A;  4YIC A;  4U4X A;  5I56 A;  3CI8 A;  3ILU B;  2D21 A;  3RTF B;  1AOV A;  3OXN A;  2ALU A;  1XVY A;  2ZZX A;  4X1B A;  3ZSF A;  2GRV A;  3VLU A;  5I58 B;  3QUJ A;  4YB7 A;  3K1M A;  4FEC A;  3K4U A;  1SDX A;  2Y5K A;  4E0X A;  2D5W A;  4P47 A;  4F19 A;  3EF7 A;  1XS5 A;  4EDP A;  3C36 A;  4P0G A;  1IXG A;  2F3B A;  4R2F A;  2IA4 A;  2X7Q A;  3T93 B;  4ONY A;  2VPN A;  1A8F A;  3K6X A;  4U1O A;  2HAV A;  3GYY A;  1OVT A;  4H46 A;  2Q88 A;  4OVJ A;  5TU0 A;  2ZXT A;  1XC1 A;  5IZZ A;  2WX9 A;  1QKA A;  2F8D A;  1EZP A;  4N13 A;  3MQ9 A;  1OLA A;  1MH3 A;  2ZYK A;  4WKM A;  2I4C A;  4LZ7 A;  2O84 X;  4MNP A;  3IOT A;  3SZP A;  1NNP A;  3MC2 A;  1MQJ A;  4O7I A;  1NV0 A;  3G7W A;  3TEP A;  3SKP A;  4YKJ A;  4OQO A;  2I4B A;  4I1D A;  2BJJ X;  5I57 A;  3TQW A;  3T9X B;  1N76 A;  1LCT A;  1MS7 A;  3KSJ A;  1QJM A;  2O69 A;  1MPC A;  4H0W A;  2XXX A;  3IJX B;  3LR1 A;  3U92 A;  2DP8 A;  5ITO A;  4MHF A;  4H5G A;  4O7M A;  1MY2 A;  2WBB A;  4O3C A;  1B2H A;  3RT6 B;  1H3D A;  3MYU A;  1AIV A;  3USD A;  3UN6 A;  4ZEC A;  1PEB A;  4QFP A;  2G29 A;  4PFY A;  1P1O A;  1LAG E;  1USY H;  3FVN A;  4JXI A;  1CE2 A;  3D4C A;  4ELR A;  4X1D A;  1EYJ A;  2O1L A;  5I59 B;  2XXH A;  4DXC A;  3TEL A;  2QS2 A;  3MP1 A;  3O2A A;  5FHO A;  1QUI A;  1BIY A;  3TDJ A;  2HAU A;  2QVR A;  4R75 A;  2DSF A;  3ROJ A;  3VDF A;  4KHZ E;  2NOO A;  5FTI A;  5DTB A;  3UOR A;  1N3W A;  3OO7 A;  2V25 A;  1EZO A;  2M8C A;  2MKZ A;  4YKP A;  5AA2 B;  2H25 A;  3OO9 A;  2V84 A;  3QSL A;  3FV2 A;  5TP9 B;  4OYV A;  3EHU A;  1BK4 A;  1PB7 A;  2UVG A;  2OWT A;  3BIG A;  3A3C A;  3LUY A;  3PPP A;  1QGX A;  3PMX A;  5LDZ A;  4LVQ A;  1B7Z A;  3CG1 A;  2I6E A;  1B40 A;  2F35 A;  1B7H A;  4R6K A;  1MDP 1;  3BBR A;  1MQG A;  2DVZ A;  3H6U A;  4N4U A;  3EPE A;  4PE5 B;  1EZ9 A;  3PU5 A;  4P9K A;  4RPO A;  4ZE9 A;  4R9G A;  2Z8F A;  3M3K A;  4BDN A;  3U1O A;  3U93 A;  4O3A A;  3RTW B;  5ICT A;  3MVW A;  2XX8 A;  3VLW A;  1OMP A;  3TFL A;  3KGC A;  3C4M A;  4OFL A;  2XHD A;  1IMD A;  5CMB A;  3U72 A;  2XXU A;  1Y3N A;  3IAZ A;  4G8M A;  2F36 A;  2XXW A;  1D3K A;  4IB2 A;  3KEI A;  3ZKL A;  4F1Y A;  2RF1 A;  4NF5 A;  1US4 A;  3DP8 A;  3E4R A;  2A5T B;  4NQ8 A;  3VV5 A;  2NVU B;  1LBB A;  4BDL A;  4M4G A;  4MLQ A;  4NX1 A;  1SVX B;  3OEK A;  3T66 A;  3LSX A;  5A5L A;  4EUO A;  3CVG A;  3Q28 A;  1GVC A;  1NMU A;  4FJP A;  4TLM B;  1FBC A;  3SET A;  5EYH A;  4F3G A;  4OVT A;  1NNF A;  1POY 1;  3PGF A;  1YCJ A;  4G68 C;  4ELP A;  1OIB A;  3BKI B;  1FBH A;  3PPN A;  4R73 A;  1ZKB A;  3IO4 A;  4N6D A;  4KXP A;  2XD2 A;  1UTB B;  4YMB A;  3GXA A;  4IO6 A;  3TTR A;  4KPT A;  2I3W A;  5HBC A;  4GWS A;  3KC0 A;  3B8B A;  3FV1 A;  4P0I A;  2QVU A;  4GWO A;  4NGU A;  1MH4 A;  3KBR A;  3W9W A;  2R71 A;  1K9Y A;  4N6K A;  2QL3 A;  1GV8 A;  4I40 A;  3S9M C;  3TQL A;  1Q9D A;  4NE4 A;  4OMB A;  3O6H A;  1NFT A;  2CMO A;  3KN8 A;  5FHN A;  3LSF B;  5KDT B;  1H43 A;  4PF6 A;  1PC3 A;  3MPK A;  1MQH A;  4BLA A;  1IXH A;  1DPE A;  1II5 A;  3MVX A;  3MUQ A;  4ND9 A;  2P3V A;  4KR5 A;  1B3E A;  5TPA A;  2Y7I A;  3TAJ A;  2XXI A;  1RDZ A;  2NUV A;  1FQD A;  1BP5 A;  2PVU A;  1DMB A;  1SD3 A;  5J16 A;  5K2X A;  1MM6 A;  1B3G A;  1Y4C A;  1ANF A;  1PBP A;  4O8M A;  2CZL A;  4ZEI A;  3K6V A;  2DWJ A;  1VFD A;  1FRP A;  1J1N A;  1USY E;  3V83 A;  2CZI A;  5CBS A;  1DSN A;  3SDF A;  1YPN A;  4X04 A;  4ZZE A;  2V93 A;  1LB9 A;  3FAT A;  3GBB A;  3SES A;  3C31 A;  4POX A;  3IOV A;  5ISU A;  1B1H A;  2VHA A;  4R9F A;  5CRY A;  1O63 A;  1XT8 A;  4JVC A;  4KD5 A;  2Y5L A;  3CSG A;  2CEY A;  3JYR A;  2Y7W A;  4XFE A;  3PMV A;  4U4S A;  4OEU A;  2F7C A;  2REJ A;  3HHG A;  5I3S A;  3SEW A;  2GHA A;  4ZE8 A;  3OEM A;  4OFJ A;  4H67 A;  5AA2 D;  4DCY A;  3KSX A;  3QAX A;  2Z23 A;  2V3Q A;  5FTH A;  4YAH X;  5AA4 A;  2ESN A;  1KZ8 A;  4XKP A;  3KFM A;  2ZYN A;  5H8Q A;  4OAN A;  1NI9 A;  5LTC A;  2ANJ A;  1SW2 A;  1K9Z A;  3IFA A;  4IO2 A;  1LAH E;  2I49 A;  1B3L A;  3IB0 A;  4QSD A;  1B5J A;  3T9U A;  5DEX A;  4HCW A;  3KOS A;  4NF8 A;  3CG3 A;  3G3K A;  2QRY A;  1EYI A;  2ONK E;  2QMW A;  3FAS A;  4N8Y A;  3PPQ A;  3PTY A;  3S9L C;  1ZLQ A;  1SPI A;  3H6W A;  2YLN A;  2R9J A;  3A3U A;  4OET A;  4P3L A;  4KQP A;  4N6P A;  4AB6 A;  4RK2 A;  3LSL A;  3T1B A;  2FIX A;  3UGW A;  4R74 A;  4HTG A;  4G68 A;  3OO6 A;  4QHQ A;  4C1U A;  4PDD A;  4DLD A;  2ZNS A;  3MZ9 A;  2ZNT A;  4GXS B;  4NMY A;  1OQG A;  5EHM A;  3IK6 B;  2OZZ A;  3BFU A;  2DXY A;  3MVZ A;  3LC8 A;  1DBZ A;  4F29 A;  1IMC A;  2PX1 A;  5IZ1 A;  1NV6 A;  5DVF A;  2B3B A;  5IAI A;  1TFA A;  2F3D A;  1S50 A;  2OX3 A;  1VSO A;  5ICQ A;  5I2N A;  1FQC A;  3TCG A;  1UTH B;  2Z8D A;  3I3V A;  1A7L A;  4N81 A;  3FBP A;  3MZ1 A;  2AL5 A;  1MXY A;  4OZ9 A;  4EQ7 A;  4LQ5 A;  4FEB A;  3B6W A;  1PDA A;  2WBD A;  4F1V A;  2BJI A;  2H99 A;  3KJ7 A;  3MJN A;  4F31 B;  4OTE A;  2HZL A;  4XKQ A;  1M5C A;  1R1N A;  4PE3 A;  2O7I A;  4R2B A;  5EQ9 A;  4ZEK A;  4YMA A;  3TYH A;  5EQA A;  3OSR A;  4JWX A;  1WDN A;  3RUM A;  4N07 A;  3H6T A;  1FBF A;  4Q30 B;  5L9O A;  5CMC A;  1NUW A;  5LOM A;  4WEP A;  4ESW A;  4GWY A;  1LFI A;  1XOC A;  3R6U A;  2I3V A;  3C34 A;  3SEV A;  1NKX A;  4F3B A;  2XWI A;  3VFJ A;  5JTY B;  1B58 A;  3B6T A;  2AYS A;  4MFI A;  4H8J A;  5DW8 A;  4ELO A;  2Q2C A;  4C0R A;  5BWJ A;  3IOU A;  4RY1 A;  2IEE A;  1N3X A;  1CB6 A;  1US5 A;  1FPL A;  1O7T A;  1QUK A;  3IR1 A;  5H8F A;  3H03 A;  3KC1 A;  4QFN A;  4X9T A;  4I3Y A;  5I2K A;  1FW0 A;  1AL3 A;  3H06 B;  1GGG A;  3EQ1 A;  1URS A;  2I0C A;  4G77 A;  1MY0 A;  3VE1 B;  1FQA A;  4BDM A;  2ABH A;  5A5X A;  1GTK A;  5KCJ A;  5DT6 A;  4NF4 A;  4YB6 A;  4GWW A;  4ZDM A;  2NWJ A;  3TTK A;  3L6G A;  2XXV A;  2O68 A;  2F78 A;  4RK9 A;  3O28 A;  5DVJ A;  2Q2A A;  3MWB A;  1VE4 A;  1DOT A;  3K01 A;  3QMF A;  1SW5 A;  4PP0 A;  3RNN A;  3VVD A;  5DYH A;  4U22 A;  2DYX A;  4YB5 A;  4TOZ A;  4GXA A;  1N84 A;  1RKM A;  2DS9 A;  4KYS A;  3FJM A;  3M8U A;  4PFT A;  3O29 A;  1UIV A;  4LQ2 A;  3CFL A;  4NAP A;  3VVF A;  4AB5 A;  1BTJ A;  2E1S A;  2CZK A;  3TTM A;  1QVS A; 
#chains in the Genus database with same CATH homology
 2XX9 A;  1EH3 A;  3E13 X;  1D9V A;  2QS3 A;  4QSE A;  2O51 A;  4XKR A;  3IJO B;  2F6G A;  4U21 A;  1NNT A;  4F22 A;  3T9V A;  4OHN A;  3FXR A;  2QSX A;  3SEY A;  4RA1 A;  4Q0C A;  2RCB A;  2X7P A;  4WXJ A;  3O97 A;  1M5F A;  5I57 B;  1MXU A;  1ZIU A;  1FCK A;  2Q89 A;  3DP6 A;  1JW1 A;  2ONS A;  4OEV A;  5HPQ A;  3CRB A;  3RQT A;  3H4Z A;  3TZA A;  2RCA A;  4ZED A;  1FTJ A;  1EU8 A;  4RYA A;  4GL0 A;  3C35 A;  4LZ5 A;  5HM4 B;  4QFO A;  3KN7 A;  2QS4 A;  4LAT A;  1JNF A;  3CR9 A;  1N04 A;  3LBS A;  3OMB A;  4ZEB A;  1RYO A;  2H5Y A;  3OEN A;  3QYT A;  3THI A;  2DOJ A;  2F7B A;  1TT1 A;  3MBP A;  1A8E A;  3IO6 A;  4OES A;  3RPW A;  1IQ7 A;  1H45 A;  4R6Y A;  2Z22 A;  2PMS A;  2UVI A;  1NNK A;  1Q1K A;  3G3H A;  4QFK A;  3IX1 A;  4H8I A;  2VOZ A;  3ECR A;  1FQE A;  2QMX A;  4QF9 A;  3RY3 A;  1B32 A;  1GR2 A;  5JK4 A;  3FJ7 A;  4HS7 A;  4JBZ A;  3MPL A;  1MM7 A;  4KFQ A;  3MP6 A;  1LBC A;  4LUB A;  2ZMB A;  2I0B A;  4NWC A;  5FHM A;  5H8N A;  3Q27 A;  3O66 A;  5ELV A;  1I6A A;  3KG2 A;  3T96 B;  3TOD A;  3Q25 A;  3MP8 A;  3W9V A;  3VLV A;  1IIW A;  4Q8R A;  4NF5 B;  3HCQ A;  1M5B A;  3VVE A;  4DCX A;  3PD8 A;  4UAC A;  1N7W A;  3C33 A;  2R6G E;  1TWY A;  4F2O A;  3OD7 A;  5M2V A;  2OWS A;  5B7D A;  3ONM A;  3QIM A;  3M3L A;  3AXF A;  3PUV E;  5F1Q A;  4TQU Q;  1WVJ A;  4GL8 A;  3RLF E;  3K1N A;  4GLI A;  1L5T A;  3K1P A;  1IXI A;  1Z7N E;  1N0T A;  2KLF A;  2THI A;  3HV1 A;  3TCF A;  1Z7M E;  2P0S A;  3OO8 A;  4NF6 A;  1MPD A;  3EHS A;  1LFG A;  3JZJ A;  5DVI A;  3T22 A;  1AH5 A;  4KYD A;  4R6H A;  4EXK A;  5J1D A;  4IGT A;  3ZS6 A;  3O9P A;  3DLN A;  4H65 A;  4KCC A;  3TPA A;  2H9B A;  4FAJ A;  3R7X A;  2O7U A;  1Y9U A;  1ZTY A;  3K2D A;  5L9S A;  4OEN A;  4OFO A;  2XXR A;  3Q26 A;  3RGY A;  2F7A A;  4DXU A;  1ZU0 A;  3H3G A;  3H7M A;  4IY5 A;  5TPA B;  2HZK A;  3QK6 A;  4WED A;  2DQV A;  1D4N A;  1A55 A;  3PUX E;  1B5I A;  3F11 A;  4Q5T A;  1OVB A;  1UQW A;  2RC8 A;  2W7Y A;  1JEU A;  1HSL A;  2OCU A;  2ZNU A;  5KZT A;  2H98 A;  2GFE A;  4F3P A;  5EYF A;  1B52 A;  3FZV A;  5EHS A;  2PBW A;  1Y1Z A;  3DP4 A;  2FYI A;  1PBQ A;  3P7I A;  1MXV A;  2D3I A;  1P1W A;  3W15 C;  1WOD A;  2HCA A;  4ZEF A;  1MXZ A;  3PUZ E;  1FQB A;  3G3I A;  2VD2 A;  3PUW E;  4YKK A;  3UK4 A;  3KN3 A;  4GOT A;  2GH9 A;  5H8H A;  3IOW A;  4BDO A;  3MAM A;  1HSJ A;  3U8Q A;  5ITP A;  3OEL A;  1Y3P A;  2OJT A;  2QPQ A;  1IXC A;  2REG A;  5AE4 A;  4NTL A;  5AA4 B;  4JWO A;  3HN0 A;  1B3H A;  4TLL B;  5H8Q B;  1SW4 A;  3O6I A;  4EF1 A;  1OLC A;  3PUY E;  2OBG A;  3C9H A;  1MY4 A;  1LAF E;  1PB8 A;  1M5D A;  2HFB A;  4EF2 A;  5DEX B;  2DWH A;  4HW8 A;  4QFL A;  5JEI A;  3ZKK A;  4NF8 B;  5B70 A;  1Y20 A;  4LZ8 A;  3E9X A;  4F39 A;  1Q35 A;  4U1Z A;  1MY3 A;  1D9Y A;  3O6G A;  4G68 B;  4PFU A;  5AA1 A;  2RC9 A;  2Y7R A;  5I58 A;  4RXL A;  3N5L A;  3TCH A;  2F34 A;  4DXB A;  4JB7 A;  3ILT B;  2AL4 A;  1T0K A;  1VFE A;  2DVC A;  1DTG A;  3L6H A;  2DE2 A;  4DZ1 A;  5I2N B;  4R72 A;  2ZYO A;  4KI0 E;  3S9E A;  2P1S A;  1HSE A;  1H44 A;  4G8H A;  4JSD A;  5IKB A;  4RPN A;  4K3F A;  4F2Q A;  3LSW A;  1NH7 A;  1FTL A;  3PMW A;  4O3B A;  4ISU A;  1SBP A;  1F9B A;  1TFD A;  4JWY A;  5AA3 A;  2P2A A;  4EXL A;  3PD9 A;  4FOR A;  1B46 A;  1BKA A;  1ZJL A;  2F97 A;  4GF8 A;  3KOT A;  5I56 B;  4GD5 A;  3GLB A;  3PPR A;  1QW0 A;  3M3F A;  2O1M A;  3T9H B;  1A40 A;  2ONR A;  5H8F B;  4F3S A;  5I2K B;  4XKN A;  1YAE A;  2G93 A;  2OK2 A;  1URG A;  3MZB A;  2RKM A;  3N94 A;  4P11 A;  5I59 A;  1N7X A;  4YZZ A;  2V3U A;  4F1U A;  3IOR A;  4I62 A;  4BDQ A;  4NED A;  2AIX A;  3U94 A;  2YJP A;  4OXV A;  3C32 A;  4UA8 A;  2XX7 A;  4THI A;  1DPP A;  5A5X B;  1BLF A;  5KCJ B;  1LGB C;  4NF4 B;  4XTC Q;  2RIN A;  1A54 A;  4MBP A;  3UP9 A;  3RT8 A;  3FIR A;  5AA2 A;  1SW1 A;  4IO3 A;  1LCF A;  2Q8J A;  5TP9 A;  3VXC A;  4FE8 A;  3PPO A;  4DDD A;  2VP1 A;  4BDR A;  2QS1 A;  4H5F A;  4RJZ A;  4IY6 A;  4ZZA A;  3IB1 A;  3JV9 A;  2UXA A;  1SI1 A;  2FNC A;  1ZMG A;  3TKD A;  1H76 A;  2WKY A;  4PFW A;  2F6P A;  2UYF A;  2FA7 A;  3FVO A;  1M5E A;  4U23 A;  4IO4 A;  2VD3 A;  2QJE A;  1R6Z A;  1R9L A;  4LP2 B;  4H1X A;  1S9T A;  3PV0 E;  4OER A;  1B0L A;  1IIT A;  2A5T A;  2HEU A;  4YU0 A;  3ODB A;  4G8N A;  3E3K A;  2XXQ A;  3S4U A;  1JQF A;  5I84 A;  4FAT A;  4I8C A;  3HST A;  2E0S A;  2UVJ A;  1FTO A;  3MW0 A;  2ZYM A;  3SEX A;  1LST A;  1LFH A;  2DWA A;  3V89 B;  5CBR A;  1P1Q A;  2DE4 A;  1UTB A;  2O6A A;  3HPI A;  3CFX A;  2V3T A;  2YPN A;  1IEJ A;  3G3J A;  4EQB A;  2OLB A;  3I6V A;  3K0V A;  3I5O A;  5CMM A;  5CC2 A;  3QXM A;  1S7Y A;  3KJT A;  3KZG A;  4MF3 A;  5KDT A;  1MXW A;  4H6D A;  4XIG Q;  4HCY A;  3IL1 B;  2GHB A;  4NWD A;  4GFR A;  1B7U A;  1MXX A;  3SER A;  3UA8 A;  4GVO A;  3N6T A;  4XXU A;  2XXT A;  3N26 A;  3TTN A;  1MQI A;  3MVY A;  3BFT A;  3FGS A;  4FIM A;  1JVX A;  1SQY A;  4Z7E A;  3TTL A;  5K2Y A;  3OOA A;  3HHF A;  2LAO A;  3RN8 A;  1FQF A;  1O64 A;  3VXB A;  1LB8 A;  1YTV A;  1B5H A;  4LON B;  2DE3 A;  1B9J A;  3FXQ A;  3A09 A;  1PB9 A;  2DXR A;  5H8N B;  3EHT A;  3EN3 A;  1LLS A;  1OQH A;  4YKI A;  4L17 A;  5CMK A;  3Q29 A;  4IGR A;  1MY1 A;  1JW4 A;  1SYI A;  3WAE A;  1B0H A;  4KCD A;  1ATG A;  3V5A A;  4MH5 A;  1MG1 A;  3HO7 A;  3TMG A;  4JSO A;  2Z8E A;  5L9M A;  1JET A;  1UIU A;  3IB2 A;  4M1V A;  5H8S A;  1B6H A;  1VR5 A;  4G2Z A;  2B3F A;  3K6U A;  3UIF A;  2X26 A;  3K6W A;  1ELJ A;  3G3G A;  2UVH A;  3SEU A;  2A5S A;  2PYY A;  2XXP A;  1URD A;  1B3F A;  1JW5 A;  3H6V A;  1B4H A;  4AQ4 A;  1I69 A;  4NF6 B;  1Y4T A;  3G3F A;  1POT A;  5L8D A;  4I9D A;  3V8X B;  2B65 A;  4G4P A;  1IZ1 A;  2Q9T A;  4QRZ A;  1B51 A;  4FED A;  2Y7K A;  4POW A;  1SYH A;  3B6Q A;  3FUZ A;  3FJG A;  1KWH A;  5CI5 A;  4F18 A;  3FD3 A;  4LA9 A;  1JVY A;  1I6Q A;  2H4I A;  4ELQ A;  5F7V A;  1MQD A;  2I58 A;  3DM0 A;  1Y3Q A;  3FVK A;  3GZG A;  3B7D A;  1RYX A;  1QUJ A;  1XHY A;  2PT2 A;  3K00 A;  4OWD A;  1B1X A;  4QSC A;  2DWI A;  4GRK A;  3OSQ A;  1JEV A;  1MRP A;  4GIZ A;  1MPB A;  2HQ0 A;  1UTH A;  2PT1 A;  1ZBM A;  3DEL B;  2Y7P A;  2XXY A;  3FVG A;  1XVX A;  4EQ9 A;  2Y84 A;  2HXW A;  4Z0I A;  4PQJ A;  1IUD A;  3N6U A;  3FXU A;  3S9N C;  4E0W A;  4U2R A;  1P1U A;  1I6B A;  5H8H B;  5CM6 A;  3CSB A;  4ESX A;  1LAX A;  1MDQ A;  3GBA A;  5BUU A;  2UYE A;  4DIG A;  2NXO A;  2XD3 A;  3CIJ A;  4KYE A;  3S2V A;  4RNS A;  1R9Q A;  5JTY A;  2VGQ A;  4PET A;  1TXF A;  4DE8 A;  4X48 A;  1FTK A;  1QUL A;  2RC7 A;  3QUF A;  1AMF A;  1P99 A;  3R26 A;  1FTM A;  4IO5 A;  4ZS9 A;  2I48 A;  1SI0 A;  3CFZ A;  2F5X A;  4C1T A;  4MLV A;  1B4Z A;  3K02 A;  4IO7 A;  1P1N A;  3WAF A;  1DTZ A;  3D4G A;  3TUS A;  1NL5 A;  1Y1M A;  1A99 A;  1B05 A;  4JDF A;  1QKB A;  4ECF A;  1NH8 A;  4GQO A;  4YIC A;  4U4X A;  5I56 A;  3CI8 A;  3ILU B;  2D21 A;  3RTF B;  1AOV A;  3OXN A;  2ALU A;  1XVY A;  4X1B A;  3ZSF A;  2GRV A;  3VLU A;  5I58 B;  3QUJ A;  4YB7 A;  3K1M A;  4FEC A;  3K4U A;  1SDX A;  4E0X A;  2D5W A;  4F19 A;  3EF7 A;  1XS5 A;  4EDP A;  3C36 A;  4P0G A;  1IXG A;  4R2F A;  2IA4 A;  2X7Q A;  3T93 B;  4ONY A;  1A8F A;  3K6X A;  4U1O A;  2HAV A;  1OVT A;  2Q88 A;  4OVJ A;  5TU0 A;  2ZXT A;  1XC1 A;  1QKA A;  2F8D A;  1EZP A;  4N13 A;  3MQ9 A;  1OLA A;  1MH3 A;  2ZYK A;  4WKM A;  2I4C A;  4LZ7 A;  2O84 X;  3IOT A;  1NNP A;  3MC2 A;  1MQJ A;  3G7W A;  3TEP A;  3SKP A;  4YKJ A;  4OQO A;  2I4B A;  4I1D A;  2BJJ X;  5I57 A;  3TQW A;  3T9X B;  1N76 A;  1LCT A;  1MS7 A;  3KSJ A;  1QJM A;  2O69 A;  1MPC A;  4H0W A;  2XXX A;  3IJX B;  3LR1 A;  3U92 A;  2DP8 A;  5ITO A;  4H5G A;  1MY2 A;  4O3C A;  1B2H A;  3RT6 B;  1H3D A;  1AIV A;  3USD A;  3UN6 A;  4ZEC A;  1PEB A;  4QFP A;  2G29 A;  4PFY A;  1P1O A;  1LAG E;  1USY H;  3FVN A;  4JXI A;  1CE2 A;  3D4C A;  4ELR A;  4X1D A;  2O1L A;  5I59 B;  2XXH A;  4DXC A;  3TEL A;  2QS2 A;  3MP1 A;  3O2A A;  5FHO A;  1QUI A;  1BIY A;  3TDJ A;  2HAU A;  4R75 A;  2DSF A;  3VDF A;  4KHZ E;  2NOO A;  5FTI A;  5DTB A;  3UOR A;  1N3W A;  3OO7 A;  2V25 A;  1EZO A;  2M8C A;  4YKP A;  5AA2 B;  2H25 A;  3OO9 A;  2V84 A;  3QSL A;  3FV2 A;  5TP9 B;  4OYV A;  3EHU A;  1PB7 A;  2UVG A;  2OWT A;  3A3C A;  3LUY A;  3PPP A;  3PMX A;  4LVQ A;  1B7Z A;  3CG1 A;  2I6E A;  1B40 A;  2F35 A;  1B7H A;  4R6K A;  1MDP 1;  3BBR A;  1MQG A;  2DVZ A;  3H6U A;  3EPE A;  4PE5 B;  1EZ9 A;  3PU5 A;  4RPO A;  4ZE9 A;  4R9G A;  2Z8F A;  3M3K A;  4BDN A;  3U1O A;  3U93 A;  4O3A A;  3RTW B;  5ICT A;  3MVW A;  2XX8 A;  3VLW A;  1OMP A;  3TFL A;  3KGC A;  3C4M A;  4OFL A;  2XHD A;  5CMB A;  3U72 A;  2XXU A;  1Y3N A;  3IAZ A;  4G8M A;  2F36 A;  2XXW A;  1D3K A;  4IB2 A;  3KEI A;  3ZKL A;  4F1Y A;  2RF1 A;  4NF5 A;  1US4 A;  3DP8 A;  3E4R A;  2A5T B;  3VV5 A;  2NVU B;  1LBB A;  4BDL A;  4M4G A;  4MLQ A;  1SVX B;  3OEK A;  3T66 A;  3LSX A;  4EUO A;  3CVG A;  3Q28 A;  1GVC A;  1NMU A;  4FJP A;  4TLM B;  3SET A;  4F3G A;  1NNF A;  1POY 1;  3PGF A;  1YCJ A;  4G68 C;  4ELP A;  1OIB A;  3BKI B;  3PPN A;  4R73 A;  1ZKB A;  3IO4 A;  2XD2 A;  1UTB B;  4YMB A;  3GXA A;  4IO6 A;  3TTR A;  4KPT A;  2I3W A;  5HBC A;  3FV1 A;  4P0I A;  4GWO A;  1MH4 A;  3KBR A;  3W9W A;  2R71 A;  2QL3 A;  1GV8 A;  3S9M C;  3TQL A;  4NE4 A;  4OMB A;  3O6H A;  1NFT A;  2CMO A;  3KN8 A;  5FHN A;  3LSF B;  5KDT B;  1H43 A;  1PC3 A;  3MPK A;  1MQH A;  4BLA A;  1IXH A;  1DPE A;  1II5 A;  3MVX A;  3MUQ A;  4ND9 A;  4KR5 A;  1B3E A;  5TPA A;  2Y7I A;  3TAJ A;  2XXI A;  2NUV A;  1FQD A;  1BP5 A;  2PVU A;  1DMB A;  1SD3 A;  5K2X A;  1MM6 A;  1B3G A;  1Y4C A;  1ANF A;  1PBP A;  2CZL A;  4ZEI A;  3K6V A;  2DWJ A;  1VFD A;  1J1N A;  1USY E;  3V83 A;  5CBS A;  1DSN A;  3SDF A;  1YPN A;  4ZZE A;  2V93 A;  1LB9 A;  3FAT A;  3GBB A;  3SES A;  3C31 A;  4POX A;  3IOV A;  5ISU A;  1B1H A;  2VHA A;  4R9F A;  5CRY A;  1O63 A;  1XT8 A;  4KD5 A;  3CSG A;  3JYR A;  2Y7W A;  3PMV A;  4U4S A;  4OEU A;  2F7C A;  2REJ A;  3HHG A;  3SEW A;  2GHA A;  4ZE8 A;  3OEM A;  4OFJ A;  4H67 A;  5AA2 D;  4DCY A;  3KSX A;  3QAX A;  2Z23 A;  2V3Q A;  5FTH A;  4YAH X;  5AA4 A;  2ESN A;  4XKP A;  3KFM A;  2ZYN A;  5H8Q A;  2ANJ A;  1SW2 A;  4IO2 A;  1LAH E;  2I49 A;  1B3L A;  3IB0 A;  4QSD A;  1B5J A;  3T9U A;  5DEX A;  4HCW A;  3KOS A;  4NF8 A;  3CG3 A;  3G3K A;  2QRY A;  2ONK E;  2QMW A;  3FAS A;  3PPQ A;  3S9L C;  1ZLQ A;  3H6W A;  2YLN A;  2R9J A;  3A3U A;  4OET A;  4KQP A;  4N6P A;  4AB6 A;  4RK2 A;  3LSL A;  3UGW A;  4R74 A;  4HTG A;  4G68 A;  3OO6 A;  4QHQ A;  4C1U A;  4DLD A;  2ZNS A;  3MZ9 A;  2ZNT A;  4GXS B;  4NMY A;  1OQG A;  5EHM A;  3IK6 B;  2OZZ A;  3BFU A;  2DXY A;  3MVZ A;  3LC8 A;  4F29 A;  2PX1 A;  5DVF A;  2B3B A;  5IAI A;  1TFA A;  1S50 A;  1VSO A;  5ICQ A;  5I2N A;  1FQC A;  3TCG A;  1UTH B;  2Z8D A;  3I3V A;  1A7L A;  3MZ1 A;  2AL5 A;  1MXY A;  4OZ9 A;  4EQ7 A;  4LQ5 A;  4FEB A;  3B6W A;  1PDA A;  4F1V A;  2H99 A;  3KJ7 A;  3MJN A;  4F31 B;  4OTE A;  2HZL A;  4XKQ A;  1M5C A;  1R1N A;  2O7I A;  4R2B A;  4ZEK A;  4YMA A;  3TYH A;  3OSR A;  4JWX A;  1WDN A;  3RUM A;  4N07 A;  3H6T A;  4Q30 B;  5L9O A;  5CMC A;  5LOM A;  4WEP A;  4ESW A;  1LFI A;  1XOC A;  3R6U A;  2I3V A;  3C34 A;  3SEV A;  1NKX A;  4F3B A;  3VFJ A;  5JTY B;  1B58 A;  3B6T A;  2AYS A;  4MFI A;  4H8J A;  4ELO A;  2Q2C A;  4C0R A;  5BWJ A;  3IOU A;  4RY1 A;  2IEE A;  1N3X A;  1CB6 A;  1US5 A;  1O7T A;  1QUK A;  3IR1 A;  5H8F A;  3H03 A;  4X9T A;  4QFN A;  5I2K A;  1FW0 A;  1AL3 A;  3H06 B;  1GGG A;  3EQ1 A;  1URS A;  2I0C A;  4G77 A;  1MY0 A;  3VE1 B;  1FQA A;  4BDM A;  2ABH A;  5A5X A;  1GTK A;  5KCJ A;  5DT6 A;  4NF4 A;  4YB6 A;  4ZDM A;  2NWJ A;  3TTK A;  3L6G A;  2XXV A;  2O68 A;  2F78 A;  4RK9 A;  3O28 A;  5DVJ A;  2Q2A A;  3MWB A;  1VE4 A;  1DOT A;  3K01 A;  1SW5 A;  4PP0 A;  3RNN A;  3VVD A;  5DYH A;  4U22 A;  2DYX A;  4YB5 A;  4TOZ A;  4GXA A;  1N84 A;  1RKM A;  2DS9 A;  4KYS A;  3FJM A;  3M8U A;  4PFT A;  3O29 A;  1UIV A;  4LQ2 A;  3CFL A;  3VVF A;  4AB5 A;  1BTJ A;  2E1S A;  3TTM A;  1QVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...