1XT8A

Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
248
structure length
248
Chain Sequence
LNSLDKIKQNGVVRIGVFGDKPPFGYVDEKGNNQGYDIALAKRIAKELFGDENKVQFVLVEAANRVEFLKSNKVDIILANFTQTPQRAEQVDFCSPYMKVALGVAVPKDSNITSVEDLKDKTLLLNKGTTADAYFTQNYPNIKTLKYDQNTETFAALMDKRGDALSHDNTLLFAWVKDHPDFKMGIKELGNKDVIAPAVKKGDKELKEFIDNLIIKLGQEQFFHKAYDETLKAHFGDDVKADDVVIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative amino-acid transporter periplasmic solute-binding p
publication title An ATP-binding cassette-type cysteine transporter in Campylobacter jejuni inferred from the structure of an extracytoplasmic solute receptor protein.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
total genus 74
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1xt8A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1xt8A02
3N94A 5HM4B 1B3FA 3CI8A 3TDJA 2RCAA 1EH3A 3HHFA 2Y84A 4Z0IA 4TOZA 3MAMA 2DYXA 3BFUA 1LAHE 2Z8DA 2OWTA 1MS7A 1POTA 1HSEA 1A7LA 4EXKA 4KHZE 4U1ZA 1UIUA 2R9JA 1GV8A 3BKIB 2NOOA 1A8FA 3D4GA 1N7WA 3CVGA 3MW0A 4F3GA 3DELB 3ZKKA 4G2ZA 2G93A 1N3WA 4JBZA 3B6TA 1QW0A 1LB9A 2XXXA 2PVUA 4ZE9A 1BLFA 4FE8A 3ILTB 3FV1A 4YU0A 4ELQA 5L9SA 3R6UA 1IEJA 4FIMA 3TCFA 3PPRA 2NWJA 3RTWB 4JXIA 1I6QA 3E13X 3H06B 4RK2A 3H4ZA 2XXQA 5DVIA 2XXWA 3TAJA 3EPEA 5L9MA 3O66A 4R2FA 4F1YA 1TFAA 4I8CA 3O6GA 2DWIA 3G3JA 2ZXTA 3O6IA 2B3BA 1OVBA 2RF1A 5TPAA 3K1NA 2O68A 2QS4A 3QIMA 4KD5A 1YCJA 5B70A 2D21A 3MP8A 3OO8A 4XKRA 1B9JA 1N04A 1MXVA 2O51A 4FECA 3SESA 4C0RA 4U23A 4OESA 1VE4A 1EU8A 1OMPA 4P0IA 4EQBA 2I0BA 4F3BA 1PB9A 2ZNSA 1SBPA 4QFOA 4EQ7A 1LCFA 4Q0CA 3MJNA 3OO7A 3K2DA 3PPOA 1QUIA 1JW5A 4QFLA 3TCHA 4OHNA 1IXIA 3USDA 3K6UA 4G68C 4F29A 4IGRA 4OEVA 3UA8A 4I1DA 4UACA 1Y20A 1UIVA 2B65A 2H98A 3SEWA 1SW2A 4ELRA 3UIFA 5EHSA 3IO6A 3V8XB 3JYRA 1CB6A 2R71A 3FXRA 2UVGA 1B58A 2O7IA 5I2NA 1Z7ME 4OETA 1ZTYA 4F18A 3FJ7A 4NF8B 3V89B 4YB5A 1D9VA 4GOTA 5H8HB 3TQWA 3MVWA 3V5AA 1DMBA 3ECRA 4ELPA 2F7BA 2UVIA 1UTBB 4KI0E 3CG1A 2UXAA 2QS2A 5I57A 1LFIA 2HZLA 1XHYA 4MLVA 4DE8A 1SYHA 4EDPA 2RC9A 5M2VA 4H8IA 2PBWA 3VVEA 1MM7A 3FJMA 2PX1A 4O3BA 4DXUA 1FW0A 5H8NB 1JW1A 2O69A 4QFNA 1Y3NA 1ZIUA 1FQBA 1S50A 4G68B 3HSTA 3E3KA 2F78A 3W15C 4AQ4A 3D4CA 1M5DA 4OTEA 3OSQA 4RJZA 4KYDA 3S9NC 3FUZA 1H44A 2P1SA 3IK6B 5DT6A 5I2KB 1WODA 1SYIA 3K00A 2XXVA 4OFLA 3T66A 3MVZA 1P99A 2QSXA 4LA9A 5LOMA 2Q2CA 3KSJA 1FQDA 4ZEKA 2ONKE 4BDLA 2UVHA 3MPKA 1MQGA 1IZ1A 1MY3A 1I6BA 1B7UA 1SW4A 3OELA 2P2AA 5H8NA 3O6HA 2V84A 5AA1A 4G68A 4R6KA 2XD2A 1NH8A 5ICTA 5JEIA 3IB2A 2F6PA 4KYSA 5JTYB 1MPDA 4FEDA 3VVFA 1FTKA 2DXRA 5H8SA 4JWOA 1N7XA 3OOAA 2DQVA 5I2KA 1MM6A 3OXNA 1ATGA 3OMBA 3SETA 1JNFA 3EHTA 1RYXA 1A55A 1FTOA 3K0VA 4LONB 4QSEA 2XXUA 2DVZA 2F6GA 3FVNA 4H1XA 2H4IA 1NNKA 4NWCA 1IUDA 2HAUA 3MZBA 3MPLA 3QUFA 4G4PA 1A40A 1B1XA 3TZAA 2H9BA 2G29A 1H43A 4KYEA 1Y1ZA 4IO4A 1IXCA 5JTYA 3QXMA 3HHGA 1SI1A 3CSGA 4BLAA 1PDAA 1DTGA 2OZZA 5FHOA 1TXFA 5CBRA 3K6WA 2Y7PA 3HV1A 5K2XA 4DCXA 4BDOA 1JEUA 1TT1A 1P1UA 5J1DA 5I84A 4JB7A 2DE3A 1LAGE 4MFIA 3C34A 1QVSA 4HCYA 3MUQA 2H25A 4YKJA 4FAJA 3RN8A 4IGTA 1GR2A 4PE5B 1Y3QA 4N13A 4KR5A 3PGFA 1JEVA 1I6AA 5AA4B 3KN7A 4GF8A 1WVJA 4GL0A 2V25A 4YKIA 3ILUB 3M3FA 4OVJA 1RYOA 2DVCA 2Q2AA 3RT6B 2FYIA 3TMGA 3O9PA 3OEMA 2DE4A 1QKBA 4WEPA 3SERA 4U4SA 4OENA 3VFJA 3AXFA 3FZVA 2QJEA 4X1DA 3G3IA 3K1MA 3L6HA 2V93A 1LB8A 4N07A 4EQ9A 1POY1 1D9YA 2ZMBA 2ZYKA 4GL8A 3FD3A 1NNFA 4O3CA 2XX8A 3VXBA 2B3FA 3LBSA 3VE1B 1FQFA 4GQOA 2F35A 3C9HA 4IB2A 3PPPA 4OQOA 5CMMA 2V3QA 5AA4A 1B3LA 1R1NA 1PB7A 2RINA 1MY2A 1EZ9A 1LBBA 1ELJA 2HQ0A 4KPTA 4IO7A 4TLLB 3RY3A 2DWHA 4QF9A 3VLUA 5TP9B 1AH5A 2PT1A 1B5IA 5KCJB 3KBRA 4Q8RA 1URDA 3Q29A 3B7DA 1AOVA 4F31B 4DCYA 3RNNA 3KJ7A 4DLDA 4MLQA 2I6EA 4JWYA 1TWYA 5TPAB 3LC8A 2HZKA 2ONRA 4YKPA 3K02A 5CMCA 2XX9A 2GH9A 2Q9TA 2X7QA 1O64A 3DLNA 2Y7RA 3S4UA 3UORA 3FXUA 5DVFA 3K1PA 1VFEA 4NF6B 3VVDA 1B3GA 1NKXA 3C31A 4H65A 1MXYA 1SW1A 2I3WA 4GXSB 5TP9A 4N6PA 1P1WA 1B0HA 4G8NA 1I69A 3RPWA 4HS7A 5L8DA 5KCJA 3FXQA 4ZEFA 3LUYA 1Y4TA 3F11A 2XD3A 1FQEA 1B4ZA 2O84X 2I49A 4K3FA 3LSWA 4X9TA 4F1VA 2YJPA 3DP8A 4XKQA 2GHAA 1B5JA 3CSBA 1ANFA 4NTLA 1B3EA 3ONMA 2QMWA 5I2NB 1B4HA 1XVXA 1NNTA 3H3GA 3N26A 5KDTB 5L9OA 1Y9UA 1TFDA 4NEDA 2F7CA 4NF6A 1N0TA 3M3LA 3KOSA 4QFPA 4R6HA 4HCWA 1ZMGA 2RCBA 5I57B 4G77A 2Z8EA 3RQTA 3CFXA 4F3PA 2HXWA 2REJA 1SI0A 4XIGQ 1T0KA 1SVXB 5ICQA 1VFDA 2YPNA 4QHQA 1UTHB 3OO6A 4IO2A 1MG1A 3G3HA 4ESWA 4GVOA 2I4CA 3FASA 3C32A 4ZZAA 1YTVA 2CZLA 4DXBA 1M5CA 4JSDA 4IO6A 3R7XA 3TTLA 2P0SA 4F19A 2HFBA 3ODBA 3DP4A 4RA1A 1OLAA 3H6WA 4GD5A 4OFJA 3EN3A 1YPNA 3PV0E 5KDTA 2CMOA 4GLIA 3CFLA 3IX1A 4WEDA 5I56B 3PUWE 3PMVA 3PUZE 4NF5B 1O7TA 3WAEA 2ABHA 4H67A 1Q35A 3Q26A 2ANJA 2Z23A 1EZPA 5JK4A 1HSLA 4ZEBA 3SEUA 1OIBA 3MC2A 4ZEDA 1A8EA 1PB8A 1NH7A 3DP6A 1JW4A 1UTHA 4JSOA 3T9VA 4KCCA 3IL1B 5AA2B 4YAHX 3CRBA 1R6ZA 2QS3A 5KZTA 3WAFA 3TTMA 3GBBA 3N6TA 3PD9A 5DVJA 1MXUA 4GFRA 1LFHA 3FV2A 1FTMA 3VLVA 4EF1A 5F7VA 4LVQA 2QS1A 4AB5A 4OERA 3U72A 1XC1A 3GLBA 3Q25A 1MH3A 1B05A 5I56A 4NF5A 5AA2D 2XXTA 4JWXA 2QMXA 4WKMA 2RC8A 1USYH 1II5A 4G8MA 3IO4A 1SDXA 4FEBA 3ZKLA 3MP6A 3TKDA 5AA2A 1UQWA 2DSFA 1ZBMA 3W9VA 4L17A 2X26A 2Y7WA 2Q8JA 3S2VA 2HAVA 3G3FA 4H5FA 3LSLA 2V3UA 1AIVA 5A5XB 1MQDA 3O2AA 1LLSA 2NUVA 4P11A 3TODA 3JZJA 4MH5A 1Y1MA 4KQPA 2OK2A 4MBPA 1URGA 3KFMA 2RKMA 3RT8A 4U4XA 2NVUB 1PC3A 3MVXA 1MQHA 3U94A 3B6WA 3ZS6A 3MVYA 3VXCA 4RPNA 5DEXB 3C4MA 5H8FB 3TQLA 2DP8A 3IB1A 1URSA 3TTKA 1F9BA 4OFOA 3JV9A 4OMBA 4OZ9A 1MDQA 3O29A 2XXYA 1DPEA 4DIGA 3T9XB 1Q1KA 2O1MA 4NWDA 3T93B 3PUYE 4F22A 2VGQA 2AL4A 4MF3A 4FJPA 1D3KA 3MZ9A 5HPQA 1H3DA 3KSXA 5A5XA 1FQCA 1BKAA 1NFTA 4F1UA 4RNSA 1N84A 5B7DA 1B1HA 4F39A 2IA4A 1B32A 2PT2A 1B46A 1FTJA 2OBGA 3U92A 2Z8FA 2XXIA 4TQUQ 3VDFA 1DTZA 2THIA 5DEXA 5H8FA 1VSOA 1IITA 3Q28A 3H6TA 2F8DA 4XKPA 3TFLA 4ND9A 2M8CA 3OENA 4HW8A 3C36A 3K6XA 1MY1A 3HN0A 3THIA 2OWSA 3S9MC 4QFKA 3IR1A 2ZYOA 3L6GA 5DTBA 2ZYNA 4F2OA 2LAOA 2HCAA 1SQYA 1B7HA 1WDNA 3GZGA 3MQ9A 1MXWA 3UK4A 1HSJA 4UA8A 3QYTA 2YLNA 1FTLA 4M4GA 1P1OA 4ISUA 1FQAA 4KCDA 3I3VA 4M1VA 3QAXA 3CFZA 2V3TA 5FHNA 3CIJA 4NMYA 1QJMA 4R9GA 2F7AA 3BFTA 4GWOA 3MWBA 4ZECA 1QULA 4ESXA 3IOTA 4LATA 4PETA 3RTFB 1NMUA 3W9WA 1Y3PA 4XKNA 1LBCA 4G8HA 3UP9A 2F97A 4QSDA 4U21A 3KJTA 1M5EA 1R9LA 4R72A 4YKKA 1KWHA 4RY1A 1N76A 4PFUA 2F5XA 2PYYA 3G7WA 1SD3A 3IB0A 4F2QA 3KGCA 3H6UA 1MQIA 4LZ8A 4GXAA 4ZDMA 3IAZA 2DXYA 3Q27A 3VLWA 4NE4A 4LZ7A 3U1OA 4U2RA 4X1BA 3RGYA 1BP5A 4RYAA 2VHAA 1GGGA 1VR5A 4IY5A 1MDP1 2XXPA 2OCUA 3A3UA 3IJOB 5I58B 5EHMA 1MXZA 1B5HA 2QPQA 4DDDA 3N6UA 3PPNA 4OXVA 1NNPA 4QSCA 1OQHA 4BDQA 2Y7KA 2DS9A 4H8JA 3BBRA 3U93A 2Z22A 4H6DA 3IOVA 3QSLA 5F1QA 3QUJA 3EF7A 1ZJLA 3KEIA 3EHUA 4FORA 4GRKA 4YB7A 1L5TA 4R9FA 1S9TA 4QRZA 3PPQA 1OVTA 3ZSFA 1PEBA 4TLMB 4ZS9A 1B3HA 2I4BA 2OLBA 4POWA 3G3KA 1LCTA 1MXXA 3TCGA 3H03A 3SEXA 3VV5A 4I9DA 3EHSA 2O6AA 2Y7IA 2DWAA 4OWDA 1H76A 4I62A 3SKPA 5I58A 2X7PA 3M3KA 1EZOA 3K01A 4RXLA 1JETA 4YICA 2GHBA 3PD8A 3B6QA 3SEVA 4PQJA 4H5GA 1PBPA 4ELOA 1US5A 2D3IA 3FVGA 2VD2A 2A5SA 4IO5A 2AYSA 2XXHA 4XTCQ 5BWJA 2XHDA 2Q88A 2BJJX 3N5LA 3TEPA 1ZU0A 3UGWA 1S7YA 3T9HB 1B51A 3T9UA 1QUJA 1BIYA 4POXA 5CMKA 3T96B 1LGBC 3V83A 3LSXA 3PU5A 2AL5A 4ONYA 2R6GE 4LP2B 4YMBA 3TTNA 1MQJA 4BDNA 1A99A 1NL5A 5CBSA 4LQ5A 4YMAA 3G3GA 2O1LA 1BTJA 1MRPA 2ALUA 3TPAA 4LUBA 3HPIA 3FIRA 2QRYA 3IORA 5EYFA 3FVOA 1B2HA 4X48A 1GTKA 1LAXA 5AE4A 3TTRA 1RKMA 1MY4A 4DXCA 3MZ1A 2ESNA 2PMSA 5I59B 3OO9A 4NF4B 3CR9A 5TU0A 2A5TB 3A3CA 1QKAA 1OLCA 2OJTA 4F3SA 3C35A 4U1OA 1CE2A 4Q30B 3I6VA 5IAIA 2DE2A 3C33A 1FCKA 2AIXA 3KZGA 1YAEA 1R9QA 3E4RA 3IOUA 2ONSA 3GBAA 5ITPA 3R26A 3PMWA 1XT8A 1LSTA 1O63A 3S9LC 1PBQA 3FATA 1N3XA 5CM6A 3H6VA 4GIZA 5CI5A 2QL3A 2REGA 2H5YA 5H8QB 1JVXA 4EF2A 5BUUA 1M5FA 3KG2A 1DPPA 2KLFA 5ELVA 5CC2A 1B40A 2NXOA 2H99A 2E0SA 5I59A 4O3AA 1MPCA 4EUOA 4NF4A 4NF8A 1JQFA 2A5TA 5H8HA 4LZ5A 3K6VA 1H45A 1P1NA 4BDMA 4IY6A 4KFQA 3MBPA 3KN8A 2VOZA 2VD3A 5ITOA 1UTBA 1MY0A 1JVYA 3PUVE 3PMXA 4BDRA 2I3VA 4OYVA 2I0CA 4DZ1A 2W7YA 3PUXE 4R75A 1J1NA 1ZLQA 3K4UA 4RK9A 5CRYA 1GVCA 2D5WA 1LAFE 1ZKBA 2DWJA 5AA3A 5ISUA 5H8QA 1DSNA 5HBCA 1AMFA 2IEEA 2XXRA 2O7UA 4IO3A 1IXHA 4E0XA 5IKBA 1XOCA 2Q89A 3RLFE 5K2YA 1B6HA 1IIWA 2I48A 3HO7A 2UYEA 1OQGA 3IOWA 1B7ZA 2F36A 4R6YA 4HTGA 4PFTA 3A09A 3RUMA 1AL3A 3FGSA 2GFEA 3LR1A 3O97A 1M5BA 3T22A 1LFGA 1IQ7A 2RC7A 3KN3A 2DOJA 3UN6A 5FTIA 1US4A 1D4NA 4PFYA 3SDFA 3P7IA 4YB6A 1QUKA 4ZE8A 4EXLA 2F34A 4ZEIA 1B0LA 4LQ2A 2E1SA 4P0GA 4PP0A 5FHMA 2ZNUA 1Y4CA 4XXUA 4JDFA 1SW5A 4E0WA 4WXJA 1MH4A 3E9XA 1MPBA 3QK6A 3EQ1A 1DOTA 2ZNTA 2HEUA 5CMBA 5DYHA 3LSFB 2XX7A 1P1QA 2I58A 1B52A 2FA7A 3S9EA 1IXGA 3I5OA 1XVYA 4R73A 4PFWA 4Z7EA 3KOTA 3U8QA 3HCQA 4U22A 3TUSA 3SEYA 1A54A 2VP1A 4RPOA 3CG3A 3TYHA 2GRVA 4H0WA 1XS5A 3O28A 5FTHA 4THIA 2WKYA 4C1UA 3OD7A 2UVJA 3MP1A 4AB6A 2FNCA 4FATA 3OSRA 4OEUA 3OEKA 3H7MA 3TELA 4C1TA 3IJXB 4R74A 3FVKA 3M8UA 2ZYMA 3FJGA 1Z7NE 1USYE 2UYFA 3GXAA 4Q5TA 4R2BA 3DM0A 4ZZEA 4ECFA 4YZZA
chains in the Genus database with same CATH superfamily
3N94A 5HM4B 1B3FA 3CI8A 3TDJA 2RCAA 1EH3A 3HHFA 2Y84A 4Z0IA 4TOZA 4O8MA 3MAMA 2DYXA 3BFUA 1FJ6A 1LAHE 2Z8DA 2OWTA 1MS7A 1POTA 1HSEA 3HFUA 1A7LA 4EXKA 4KHZE 4U1ZA 1UIUA 2R9JA 1GV8A 3BKIB 1KZ8A 4N91A 2NOOA 1A8FA 3D4GA 1N7WA 3CVGA 3MW0A 4F3GA 3DELB 3ZKKA 4G2ZA 2G93A 1N3WA 5J16A 4JBZA 3B6TA 1FTAA 2ZZVA 1QW0A 4DI3D 1LB9A 2XXXA 4PFRA 2PVUA 4ZE9A 1BLFA 2Y5LA 4FE8A 3ILTB 3FV1A 4YU0A 4ELQA 5L9SA 2Q8MA 3R6UA 1IEJA 5I3SA 4FIMA 3TCFA 3IFCA 3PPRA 2NWJA 3RTWB 1IMBA 4JXIA 1I6QA 3E13X 3H06B 4RK2A 3H4ZA 2XXQA 4GBVA 5DVIA 2XXWA 3TAJA 3EPEA 5L9MA 3O66A 4R2FA 3RPLB 1NUYA 4F1YA 1TFAA 4I8CA 2CZHA 3O6GA 2DWIA 2WBDA 3G3JA 2ZXTA 4OVTA 3O6IA 2B3BA 1OVBA 2RF1A 5TPAA 3K1NA 2O68A 2QS4A 3QIMA 4KD5A 1YCJA 5B70A 2D21A 3MP8A 3OO8A 4XKRA 1B9JA 1N04A 1MXVA 2O51A 4FECA 3SESA 4C0RA 4U23A 4OESA 1VE4A 3KC0A 1EU8A 1OMPA 4P0IA 4EQBA 4PDDA 2I0BA 4F3BA 1PB9A 2ZNSA 1SBPA 4QFOA 4EQ7A 1LCFA 1JP4A 4Q0CA 3MJNA 3OO7A 3K2DA 3PPOA 1QUIA 1JW5A 2V4CA 4QFLA 3TCHA 1DCUA 4OHNA 1IXIA 3USDA 3K6UA 4G68C 4PTKA 4F29A 4IGRA 4OEVA 3UA8A 4I1DA 4UACA 3RPLA 1Y20A 1UIVA 2B65A 1FPIA 2H98A 2FIEA 3SEWA 4P1EA 1IMDA 4XFEA 1SW2A 4ELRA 1FPDA 3UIFA 5EHSA 3IO6A 3V8XB 3JYRA 1CB6A 2R71A 4HXVA 3FXRA 2UVGA 1B58A 2O7IA 5I2NA 1Z7ME 2JJKA 4OETA 1ZTYA 4F18A 3FJ7A 4NF8B 3V89B 4OVPA 4YB5A 1D9VA 4AS5A 4GOTA 5H8HB 3TQWA 3MVWA 3ROJA 4LN5A 3V5AA 3KC1A 1DMBA 3ECRA 4ELPA 2F7BA 2UVIA 1UTBB 2ZZWA 4KI0E 4QXDA 3CG1A 2UXAA 5ET5A 3FXBA 2QS2A 5I57A 1LFIA 2HZLA 1RDYA 1XHYA 4MLVA 4DE8A 1SYHA 4EDPA 5EYGA 4GX6A 2RC9A 5M2VA 4H8IA 2PBWA 3VVEA 1MM7A 4IR8A 3FJMA 4O7MA 4O94A 3T0JA 2PX1A 4O3BA 1FBFA 4P9KA 4DXUA 1FW0A 5H8NB 1JW1A 2O69A 4QFNA 1Y3NA 1ZIUA 1FQBA 1S50A 4G68B 3HSTA 3E3KA 2F78A 4MEVA 3KBZA 3W15C 4AQ4A 2OWZA 3D4CA 1NV0A 1FPKA 1M5DA 4OTEA 3OSQA 4RJZA 1IMAA 4KYDA 3S9NC 3FUZA 1H44A 2P1SA 4GX3A 3IK6B 5DT6A 5I2KB 2WX9A 1WODA 4H46A 1SYIA 3K00A 1FSAA 2XXVA 3A29A 5ET6A 4OFLA 1LBZA 3T66A 3MVZA 3EKIA 1P99A 2QSXA 4LA9A 5LOMA 2Q2CA 3KSJA 1FQDA 4ZEKA 2ONKE 4BDLA 2UVHA 1INPA 3MPKA 1MQGA 1IZ1A 1MY3A 1I6BA 1B7UA 1SW4A 3OELA 1VDWA 2P2AA 5H8NA 3O6HA 3D1RA 2V84A 5AA1A 2QVUA 4G68A 4R6KA 2XD2A 3MYUA 1NH8A 5ICTA 5JEIA 3IB2A 2P3NA 2F6PA 5IZ1A 4KYSA 5JTYB 1MPDA 4FEDA 3VVFA 1FTKA 2DXRA 5H8SA 1IMFA 4JWOA 1N7XA 1NUXA 3OOAA 2DQVA 5I2KA 1MM6A 3OXNA 5IGAA 1ATGA 3OMBA 3SETA 1JNFA 3EHTA 1RYXA 1A55A 2CZKA 1FTOA 3K0VA 4LONB 4X8RA 4QSEA 2XXUA 2DVZA 2F6GA 3FVNA 4H1XA 2H4IA 1NNKA 4NWCA 1IUDA 2HAUA 3MZBA 3IFAA 3MPLA 3QUFA 4G4PA 1A40A 1B1XA 3TZAA 2H9BA 5EQ9A 2G29A 4N4UA 5A5LA 1H43A 4KYEA 1Y1ZA 4IO4A 1CNQA 1IXCA 4N81A 4I3EA 5JTYA 3QXMA 3HHGA 1SI1A 3CSGA 4BLAA 1PDAA 1DTGA 2OZZA 5FHOA 2WYKA 4I3YA 1TXFA 5CBRA 3K6WA 2Y7PA 3HV1A 5EQAA 5K2XA 4DCXA 4BDOA 1JEUA 1TT1A 1P1UA 5J1DA 5I84A 4JB7A 2DE3A 1LAGE 4MFIA 3C34A 5ESYA 1QVSA 4HCYA 3MUQA 2H25A 4YKJA 4FAJA 3RN8A 4IGTA 1GR2A 4PE5B 1Y3QA 4N13A 4AS4A 4KR5A 3PGFA 1JEVA 1I6AA 5AA4B 3KN7A 4GF8A 1WVJA 4GL0A 2V25A 4YKIA 3ILUB 3M3FA 4OVJA 3QMFA 1RYOA 2DVCA 2Q2AA 3RT6B 2FYIA 3TMGA 3O9PA 3OEMA 4HE0A 2DE4A 1QKBA 4WEPA 3SERA 4U4SA 4MNCA 4OENA 3VFJA 3AXFA 3FZVA 2QJEA 1FBHA 4X1DA 3G3IA 4PDHA 3K1MA 3L6HA 2V93A 1LB8A 4N07A 4EQ9A 1POY1 1LBYA 1D9YA 2ZMBA 1LEVA 2ZYKA 5EQ8A 4GL8A 3FD3A 1NNFA 4O3CA 2XX8A 3VXBA 2KQZA 4JVIA 2B3FA 1D9QA 3LBSA 3VE1B 1FQFA 4PFIA 4GQOA 1NV5A 2F35A 3RYDA 3C9HA 4IB2A 3PPPA 4OQOA 5CMMA 3FBPA 2V3QA 5AA4A 1B3LA 1R1NA 1PB7A 2B4LA 2RINA 1MY2A 1EZ9A 1LBBA 1ELJA 1XI6A 2HQ0A 4KPTA 4IO7A 4TLLB 4P8BA 3RY3A 2DWHA 4QF9A 3VLUA 5TP9B 1AH5A 2PT1A 1B5IA 5KCJB 3KBRA 4Q8RA 1URDA 3Q29A 3B7DA 1AOVA 4F31B 4DCYA 3RNNA 3KJ7A 3B8BA 4PGPA 4DLDA 4MLQA 2I6EA 4JWYA 1TWYA 5TPAB 3LC8A 2HZKA 5DW8A 2ONRA 2FHYA 1LBWA 4YKPA 3K02A 5CMCA 2XX9A 2GH9A 2Q9TA 2X7QA 1O64A 3DLNA 2Y7RA 4G61A 4P1LA 1NV3A 3S4UA 3UORA 1KA1A 3FXUA 2XWKA 5DVFA 2QFLA 3K1PA 1VFEA 4NF6B 3VVDA 1B3GA 1NKXA 1K9YA 3C31A 3E78A 4H65A 1MXYA 1SW1A 2I3WA 4GXSB 5TP9A 4N6PA 1P1WA 1B0HA 4G8NA 1I69A 3RPWA 4HS7A 2GQ1A 5L8DA 5KCJA 2Q74A 3FXQA 4ZEFA 2XWVA 3LUYA 1Y4TA 3F11A 2XD3A 1FQEA 1B4ZA 2O84X 4N8YA 4MNIA 2I49A 4K3FA 3LSWA 4X9TA 4F1VA 2YJPA 3DP8A 4XKQA 2GHAA 1B5JA 2XWIA 3CSBA 1ANFA 4NTLA 1B3EA 3ONMA 5F24A 2QMWA 5I2NB 3LUZA 4PAFA 1B4HA 2PFZA 2ZZXA 1XVXA 1NNTA 3CHGA 3H3GA 3N26A 5KDTB 5L9OA 1Y9UA 1FJ9A 1TFDA 4NEDA 2F7CA 4NF6A 1N0TA 3M3LA 3KOSA 1G0HA 4QFPA 4R6HA 4HCWA 1ZMGA 2RCBA 5I57B 4G77A 2Z8EA 4N17A 3RQTA 3CFXA 4F3PA 2HXWA 2REJA 1SI0A 4XIGQ 2FVZA 2Y5KA 1T0KA 1SVXB 5ICQA 1VFDA 1BK4A 4QHQA 2YPNA 1UTHB 3OO6A 4IO2A 1MG1A 3G3HA 4ESWA 4GVOA 2I4CA 3FASA 3C32A 1EYJA 4ZZAA 1YTVA 2CZLA 4DXBA 1M5CA 4JSDA 4IO6A 3R7XA 3TTLA 2P0SA 4F19A 2HFBA 4DI4B 3ODBA 3DP4A 4RA1A 1EYIA 1OLAA 3H6WA 4GD5A 4OFJA 3EN3A 1YPNA 3PV0E 5KDTA 2CMOA 4GLIA 3CFLA 3IX1A 4WEDA 5I56B 4H45A 3PUWE 3PMVA 3PUZE 4NF5B 1O7TA 3WAEA 2ABHA 2BJIA 1IMEA 1Q35A 3Q26A 4H67A 2ANJA 2Z23A 1EZPA 5JK4A 1HSLA 4ZEBA 3SEUA 4GX4A 1OIBA 3MC2A 4ZEDA 1LBXA 1A8EA 1PB8A 1NH7A 4MIJA 3DP6A 1JW4A 1UTHA 4JSOA 3T1BA 4KCCA 3T9VA 3IL1B 3BIGA 5AA2B 4OANA 1NV1A 2PCRA 4YAHX 1FBPA 3CRBA 1R6ZA 2QS3A 5KZTA 3WAFA 3TTMA 3GBBA 3N6TA 3PD9A 5DVJA 3BIHA 1MXUA 4GFRA 1LFHA 3FV2A 1FTMA 2KR0A 3VLVA 4EF1A 5F7VA 4LVQA 4PAKA 2QS1A 4AB5A 4OERA 3U72A 1XC1A 2QVVA 3GLBA 3Q25A 1MH3A 1B05A 5I56A 4NF5A 5AA2D 4JVDA 3B50A 2XXTA 4JWXA 2QMXA 2HHMA 4WKMA 5FBPA 2RC8A 1USYH 1II5A 4G8MA 3IO4A 1SDXA 5IZZA 4FEBA 3ZKLA 3MP6A 3TKDA 5AA2A 1UQWA 2DSFA 1ZBMA 3W9VA 4L17A 2X26A 2Y7WA 2Q8JA 3S2VA 2HAVA 3G3FA 4H5FA 1FRPA 3LSLA 2V3UA 1AIVA 5A5XB 4NF0A 1MQDA 3O2AA 1LLSA 2NUVA 4P11A 3TODA 3JZJA 4MNPA 4MH5A 1Y1MA 4N6DA 4KQPA 2OK2A 4MBPA 1URGA 3KFMA 2RKMA 3RT8A 4U4XA 2NVUB 4GWWA 1YZ0A 1PC3A 1FPJA 3MVXA 1MQHA 3U94A 3B6WA 3ISPA 3ZS6A 3MVYA 3VXCA 4RPNA 5DEXB 3C4MA 5H8FB 3TQLA 1SPIA 2DP8A 3IB1A 4HE2A 1URSA 3TTKA 1F9BA 4OFOA 3JV9A 4GWSA 4OMBA 4OZ9A 1MDQA 3O29A 2XXYA 4PE3A 4QBAA 1DPEA 4DIGA 3T9XB 1Q1KA 2O1MA 4NWDA 3T93B 3PUYE 4F22A 2VGQA 2AL4A 4MF3A 4FJPA 1D3KA 1FPBA 3MZ9A 5HPQA 1H3DA 3KSXA 5A5XA 1FQCA 1BKAA 1NFTA 4F1UA 4RNSA 1IMCA 1N84A 5B7DA 4PCDA 1B1HA 4F39A 2IA4A 1B32A 2PT2A 1B46A 1FTJA 2OBGA 4MHFA 3U92A 2WBBA 2Z8FA 4X04A 2XXIA 4TQUQ 3VDFA 4OA4A 1DTZA 2THIA 5DEXA 4XEQA 5H8FA 1VSOA 1IITA 3Q28A 3H6TA 5LTCA 2F8DA 2B4MA 5LDZA 4NQ8A 4XKPA 3TFLA 1NV6A 4ND9A 2M8CA 3OENA 4HW8A 3C36A 3K6XA 1MY1A 3HN0A 3THIA 2OWSA 3S9MC 2VPOA 4QFKA 3IR1A 4MJOA 2ZYOA 3L6GA 5DTBA 2ZYNA 4F2OA 2LAOA 2HCAA 1SQYA 1B7HA 1WDNA 5IZ3B 3GZGA 3MQ9A 1MXWA 3UK4A 4UABA 1HSJA 4UA8A 3QYTA 4OVRA 2YLNA 1EYKA 1FTLA 4M4GA 1P1OA 4ISUA 1FQAA 4KCDA 3I3VA 4M1VA 1RDXA 3QAXA 3CFZA 2V3TA 5FHNA 3CIJA 4NMYA 1QJMA 4R9GA 2F7AA 3BFTA 4GWOA 2HXRA 3MWBA 2L5VA 1NV7A 4ZECA 1QULA 4ESXA 3IOTA 4LATA 4MCOA 4PETA 3RTFB 1NMUA 3W9WA 1Y3PA 4XKNA 5IM2A 4GWXA 1LBCA 4G8HA 3UP9A 2F97A 4QSDA 4U21A 3KJTA 1M5EA 1R9LA 4R72A 4YKKA 1KWHA 4RY1A 1N76A 4HE1A 4PFUA 2F5XA 2PYYA 3G7WA 1SD3A 3IB0A 1NV2A 5IZ3A 4F2QA 3KGCA 3H6UA 1MQIA 4LZ8A 4GXAA 4ZDMA 3IAZA 1FPEA 2DXYA 3Q27A 3VLWA 4NE4A 4LZ7A 3U1OA 4U2RA 4X1BA 3RGYA 1BP5A 4RYAA 2VHAA 1GGGA 1KA0A 1VR5A 4P3LA 3U65A 4IY5A 1MDP1 2XXPA 2OCUA 3A3UA 3IJOB 5I58B 5EHMA 1MXZA 1B5HA 2QPQA 4DDDA 3N6UA 3PPNA 4OXVA 1NNPA 4QSCA 4O7IA 1OQHA 4BDQA 2Y7KA 2DS9A 4H8JA 3BBRA 4NG7A 3U93A 2Z22A 4H6DA 5I7IA 3IOVA 3QSLA 5F1QA 3QUJA 3EF7A 1ZJLA 3KEIA 4PGNA 3EHUA 4FORA 4GRKA 4YB7A 1YXIA 1L5TA 4R9FA 1S9TA 4QRZA 3PPQA 1OVTA 3ZSFA 3MSTA 1PEBA 3E79A 4TLMB 4ZS9A 1FPFA 1B3HA 2I4BA 2OLBA 4POWA 3G3KA 1LCTA 1MXXA 3TCGA 5EQ7A 4NN3A 3H03A 4N15A 2CEYA 3SEXA 3VV5A 4I9DA 5EYHA 3EHSA 2O6AA 2Y7IA 2DWAA 2DDKA 4N6KA 4OWDA 1H76A 4I62A 3SKPA 5I58A 1NI9A 2X7PA 3M3KA 1EZOA 3K01A 4RXLA 1JETA 4YICA 2GHBA 3PD8A 3B6QA 3SEVA 4PQJA 4H5GA 1PBPA 1US5A 4ELOA 2D3IA 3FVGA 2VD2A 2A5SA 4IO5A 2AYSA 2F3BA 2XXHA 4XTCQ 2VPNA 5BWJA 2XHDA 1QGXA 2Q88A 2BJJX 4N8GA 3N5LA 3TEPA 1ZU0A 3UGWA 1S7YA 3T9HB 1B51A 3T9UA 1QUJA 1BIYA 2F3DA 4POXA 2OX3A 5CMKA 3T96B 1LGBC 3V83A 4XF5A 3LSXA 4NX1A 3PU5A 2AL5A 1FBCA 4JVCA 4ONYA 2CEXA 2R6GE 4LP2B 4YMBA 3TTNA 4FBPA 1MQJA 4BDNA 1A99A 1NL5A 5CBSA 4LQ5A 4PFBA 4YMAA 3G3GA 2O1LA 1BTJA 1MRPA 2ALUA 3TPAA 3GYYA 4LUBA 3HPIA 3FIRA 2QRYA 3IORA 1DBZA 5EYFA 3FVOA 1B2HA 2MKZA 4X48A 1GTKA 1LAXA 5AE4A 3TTRA 1RKMA 1MY4A 4DXCA 3MZ1A 2ESNA 2PMSA 5I59B 3OO9A 4NF4B 3CR9A 5TU0A 2A5TB 1FBEA 3A3CA 1QKAA 1OLCA 2OJTA 4F3SA 3C35A 4U1OA 1CE2A 2WYPA 4GWUA 4Q30B 3I6VA 1FBGA 5IAIA 2DE2A 3C33A 1FCKA 2AIXA 3KZGA 1YAEA 1R9QA 3E4RA 1FPLA 3IOUA 2ONSA 3GBAA 1YYZA 5ITPA 3R26A 4NAPA 3PMWA 4GWZA 1XT8A 2CZIA 1LSTA 1O63A 3S9LC 1PBQA 3FATA 1N3XA 5CM6A 3H6VA 4GIZA 5T3JA 5CI5A 2QL3A 2REGA 2H5YA 5H8QB 1JVXA 4EF2A 5ET8A 1M5FA 5BUUA 3KG2A 4NHBA 1DPPA 2KLFA 5ELVA 5CC2A 1B40A 1FPGA 2NXOA 2H99A 2E0SA 5I59A 4O3AA 1MPCA 4EUOA 4NF4A 2R8TA 1JQFA 4NF8A 2A5TA 4GWYA 4LZ5A 5H8HA 3K6VA 1H45A 1P1NA 4BDMA 4IY6A 4KFQA 3MBPA 3KN8A 2VOZA 2VD3A 5ITOA 1UTBA 1MY0A 1JVYA 3PUVE 3PMXA 4BDRA 2I3VA 4OYVA 2I0CA 4DZ1A 2W7YA 3PUXE 4R75A 4I40A 4PF6A 1J1NA 1ZLQA 3K4UA 4RK9A 4NGUA 5CRYA 1GVCA 2D5WA 2XXKA 1LAFE 1ZKBA 2DWJA 5AA3A 1RDZA 5ISUA 5H8QA 1DSNA 5HBCA 1AMFA 2IEEA 2XXRA 3LV0A 2P3VA 2FBPA 2O7UA 4IO3A 1IXHA 4E0XA 5IKBA 1XOCA 4GBWA 2Q89A 3RLFE 1Q9DA 5K2YA 1B6HA 1IIWA 2I48A 3HO7A 1NV4A 2UYEA 1FBDA 1OQGA 3IOWA 1B7ZA 4PBHA 2F36A 4R6YA 4HTGA 4PFTA 3SZPA 3A09A 3RUMA 1AL3A 3NOHA 1LBVA 2XA5A 3FGSA 2GFEA 3LR1A 1AWBA 3O97A 4OVSA 1M5BA 3T22A 2HPGA 1LFGA 1IQ7A 2RC7A 4PC9A 3KN3A 2DOJA 3UN6A 4PBQA 5FTIA 2WEFA 4MX6A 1US4A 1D4NA 4PFYA 1G0IA 3SDFA 4PF8A 3P7IA 4YB6A 1QUKA 2XWOA 4ZE8A 4EXLA 2F34A 2FIXA 4ZEIA 1B0LA 4LQ2A 2E1SA 4P0GA 5I5PA 4PP0A 5FHMA 2ZNUA 1Y4CA 4P56A 4XXUA 4JDFA 1SW5A 4E0WA 4WXJA 1MH4A 3E9XA 1MPBA 3QK6A 2VT5A 3EQ1A 1DOTA 4KXPA 2ZNTA 2HEUA 5CMBA 5DYHA 1NUZA 3LSFB 2XX7A 1P1QA 2I58A 1B52A 1K9ZA 2FA7A 3S9EA 1IXGA 3I5OA 1XVYA 4R73A 4PFWA 4Z7EA 3KOTA 3U8QA 3HCQA 4U22A 1DK4A 4P47A 3TUSA 2QVRA 3SEYA 1A54A 2VP1A 4RPOA 3CG3A 4PAIA 3TYHA 2GRVA 4MAGA 4H0WA 1XS5A 3O28A 5FTHA 4THIA 3PTYA 2WKYA 4C1UA 3OD7A 5ET7A 2UVJA 3MP1A 4AB6A 2PFYA 2FNCA 4FATA 3OSRA 4MMPA 4OEUA 1NUWA 3H7MA 3OEKA 3TELA 4C1TA 3IJXB 4R74A 3FVKA 3M8UA 2ZYMA 3FJGA 1Z7NE 1USYE 4OVQA 2UYFA 3GXAA 4Q5TA 4R2BA 3DM0A 4ZZEA 4ECFA 4YZZA
chains in the Genus database with same CATH topology
3N94A 5HM4B 1B3FA 3CI8A 3TDJA 2RCAA 1EH3A 3HHFA 2Y84A 4Z0IA 4TOZA 3MAMA 2DYXA 3BFUA 1LAHE 2Z8DA 2OWTA 1MS7A 1POTA 1HSEA 1A7LA 4EXKA 4KHZE 4U1ZA 1UIUA 2R9JA 1GV8A 3BKIB 2NOOA 1A8FA 3D4GA 1N7WA 3CVGA 3MW0A 4F3GA 3DELB 3ZKKA 4G2ZA 2G93A 1N3WA 4JBZA 3B6TA 1QW0A 1LB9A 2XXXA 2PVUA 4ZE9A 1BLFA 4FE8A 3ILTB 3FV1A 4YU0A 4ELQA 5L9SA 3R6UA 1IEJA 4FIMA 3TCFA 3PPRA 2NWJA 3RTWB 4JXIA 1I6QA 3E13X 3H06B 4RK2A 3H4ZA 2XXQA 5DVIA 2XXWA 3TAJA 3EPEA 5L9MA 3O66A 4R2FA 4F1YA 1TFAA 4I8CA 3O6GA 2DWIA 3G3JA 2ZXTA 3O6IA 2B3BA 1OVBA 2RF1A 5TPAA 3K1NA 2O68A 2QS4A 3QIMA 4KD5A 1YCJA 5B70A 2D21A 3MP8A 3OO8A 4XKRA 1B9JA 1N04A 1MXVA 2O51A 4FECA 3SESA 4C0RA 4U23A 4OESA 1VE4A 1EU8A 1OMPA 4P0IA 4EQBA 2I0BA 4F3BA 1PB9A 2ZNSA 1SBPA 4QFOA 4EQ7A 1LCFA 4Q0CA 3MJNA 3OO7A 3K2DA 3PPOA 1QUIA 1JW5A 4QFLA 3TCHA 4OHNA 1IXIA 3USDA 3K6UA 4G68C 4F29A 4IGRA 4OEVA 3UA8A 4I1DA 4UACA 1Y20A 1UIVA 2B65A 2H98A 3SEWA 1SW2A 4ELRA 3UIFA 5EHSA 3IO6A 3V8XB 3JYRA 1CB6A 2R71A 3FXRA 2UVGA 1B58A 2O7IA 5I2NA 1Z7ME 4OETA 1ZTYA 4F18A 3FJ7A 4NF8B 3V89B 4YB5A 1D9VA 4GOTA 5H8HB 3TQWA 3MVWA 3V5AA 1DMBA 3ECRA 4ELPA 2F7BA 2UVIA 1UTBB 4KI0E 3CG1A 2UXAA 2QS2A 5I57A 1LFIA 2HZLA 1XHYA 4MLVA 4DE8A 1SYHA 4EDPA 2RC9A 5M2VA 4H8IA 2PBWA 3VVEA 1MM7A 3FJMA 2PX1A 4O3BA 4DXUA 1FW0A 5H8NB 1JW1A 2O69A 4QFNA 1Y3NA 1ZIUA 1FQBA 1S50A 4G68B 3HSTA 3E3KA 2F78A 3W15C 4AQ4A 3D4CA 1M5DA 4OTEA 3OSQA 4RJZA 4KYDA 3S9NC 3FUZA 1H44A 2P1SA 3IK6B 5DT6A 5I2KB 1WODA 1SYIA 3K00A 2XXVA 4OFLA 3T66A 3MVZA 1P99A 2QSXA 4LA9A 5LOMA 2Q2CA 3KSJA 1FQDA 4ZEKA 2ONKE 4BDLA 2UVHA 3MPKA 1MQGA 1IZ1A 1MY3A 1I6BA 1B7UA 1SW4A 3OELA 2P2AA 5H8NA 3O6HA 2V84A 5AA1A 4G68A 4R6KA 2XD2A 1NH8A 5ICTA 5JEIA 3IB2A 2F6PA 4KYSA 5JTYB 1MPDA 4FEDA 3VVFA 1FTKA 2DXRA 5H8SA 4JWOA 1N7XA 3OOAA 2DQVA 5I2KA 1MM6A 3OXNA 1ATGA 3OMBA 3SETA 1JNFA 3EHTA 1RYXA 1A55A 1FTOA 3K0VA 4LONB 4QSEA 2XXUA 2DVZA 2F6GA 3FVNA 4H1XA 2H4IA 1NNKA 4NWCA 1IUDA 2HAUA 3MZBA 3MPLA 3QUFA 4G4PA 1A40A 1B1XA 3TZAA 2H9BA 2G29A 1H43A 4KYEA 1Y1ZA 4IO4A 1IXCA 5JTYA 3QXMA 3HHGA 1SI1A 3CSGA 4BLAA 1PDAA 1DTGA 2OZZA 5FHOA 1TXFA 5CBRA 3K6WA 2Y7PA 3HV1A 5K2XA 4DCXA 4BDOA 1JEUA 1TT1A 1P1UA 5J1DA 5I84A 4JB7A 2DE3A 1LAGE 4MFIA 3C34A 1QVSA 4HCYA 3MUQA 2H25A 4YKJA 4FAJA 3RN8A 4IGTA 1GR2A 4PE5B 1Y3QA 4N13A 4KR5A 3PGFA 1JEVA 1I6AA 5AA4B 3KN7A 4GF8A 1WVJA 4GL0A 2V25A 4YKIA 3ILUB 3M3FA 4OVJA 1RYOA 2DVCA 2Q2AA 3RT6B 2FYIA 3TMGA 3O9PA 3OEMA 2DE4A 1QKBA 4WEPA 3SERA 4U4SA 4OENA 3VFJA 3AXFA 3FZVA 2QJEA 4X1DA 3G3IA 3K1MA 3L6HA 2V93A 1LB8A 4N07A 4EQ9A 1POY1 1D9YA 2ZMBA 2ZYKA 4GL8A 3FD3A 1NNFA 4O3CA 2XX8A 3VXBA 2B3FA 3LBSA 3VE1B 1FQFA 4GQOA 2F35A 3C9HA 4IB2A 3PPPA 4OQOA 5CMMA 2V3QA 5AA4A 1B3LA 1R1NA 1PB7A 2RINA 1MY2A 1EZ9A 1LBBA 1ELJA 2HQ0A 4KPTA 4IO7A 4TLLB 3RY3A 2DWHA 4QF9A 3VLUA 5TP9B 1AH5A 2PT1A 1B5IA 5KCJB 3KBRA 4Q8RA 1URDA 3Q29A 3B7DA 1AOVA 4F31B 4DCYA 3RNNA 3KJ7A 4DLDA 4MLQA 2I6EA 4JWYA 1TWYA 5TPAB 3LC8A 2HZKA 2ONRA 4YKPA 3K02A 5CMCA 2XX9A 2GH9A 2Q9TA 2X7QA 1O64A 3DLNA 2Y7RA 3S4UA 3UORA 3FXUA 5DVFA 3K1PA 1VFEA 4NF6B 3VVDA 1B3GA 1NKXA 3C31A 4H65A 1MXYA 1SW1A 2I3WA 4GXSB 5TP9A 4N6PA 1P1WA 1B0HA 4G8NA 1I69A 3RPWA 4HS7A 5L8DA 5KCJA 3FXQA 4ZEFA 3LUYA 1Y4TA 3F11A 2XD3A 1FQEA 1B4ZA 2O84X 2I49A 4K3FA 3LSWA 4X9TA 4F1VA 2YJPA 3DP8A 4XKQA 2GHAA 1B5JA 3CSBA 1ANFA 4NTLA 1B3EA 3ONMA 2QMWA 5I2NB 1B4HA 1XVXA 1NNTA 3H3GA 3N26A 5KDTB 5L9OA 1Y9UA 1TFDA 4NEDA 2F7CA 4NF6A 1N0TA 3M3LA 3KOSA 4QFPA 4R6HA 4HCWA 1ZMGA 2RCBA 5I57B 4G77A 2Z8EA 3RQTA 3CFXA 4F3PA 2HXWA 2REJA 1SI0A 4XIGQ 1T0KA 1SVXB 5ICQA 1VFDA 2YPNA 4QHQA 1UTHB 3OO6A 4IO2A 1MG1A 3G3HA 4ESWA 4GVOA 2I4CA 3FASA 3C32A 4ZZAA 1YTVA 2CZLA 4DXBA 1M5CA 4JSDA 4IO6A 3R7XA 3TTLA 2P0SA 4F19A 2HFBA 3ODBA 3DP4A 4RA1A 1OLAA 3H6WA 4GD5A 4OFJA 3EN3A 1YPNA 3PV0E 5KDTA 2CMOA 4GLIA 3CFLA 3IX1A 4WEDA 5I56B 3PUWE 3PMVA 3PUZE 4NF5B 1O7TA 3WAEA 2ABHA 4H67A 1Q35A 3Q26A 2ANJA 2Z23A 1EZPA 5JK4A 1HSLA 4ZEBA 3SEUA 1OIBA 3MC2A 4ZEDA 1A8EA 1PB8A 1NH7A 3DP6A 1JW4A 1UTHA 4JSOA 3T9VA 4KCCA 3IL1B 5AA2B 4YAHX 3CRBA 1R6ZA 2QS3A 5KZTA 3WAFA 3TTMA 3GBBA 3N6TA 3PD9A 5DVJA 1MXUA 4GFRA 1LFHA 3FV2A 1FTMA 3VLVA 4EF1A 5F7VA 4LVQA 2QS1A 4AB5A 4OERA 3U72A 1XC1A 3GLBA 3Q25A 1MH3A 1B05A 5I56A 4NF5A 5AA2D 2XXTA 4JWXA 2QMXA 4WKMA 2RC8A 1USYH 1II5A 4G8MA 3IO4A 1SDXA 4FEBA 3ZKLA 3MP6A 3TKDA 5AA2A 1UQWA 2DSFA 1ZBMA 3W9VA 4L17A 2X26A 2Y7WA 2Q8JA 3S2VA 2HAVA 3G3FA 4H5FA 3LSLA 2V3UA 1AIVA 5A5XB 1MQDA 3O2AA 1LLSA 2NUVA 4P11A 3TODA 3JZJA 4MH5A 1Y1MA 4KQPA 2OK2A 4MBPA 1URGA 3KFMA 2RKMA 3RT8A 4U4XA 2NVUB 1PC3A 3MVXA 1MQHA 3U94A 3B6WA 3ZS6A 3MVYA 3VXCA 4RPNA 5DEXB 3C4MA 5H8FB 3TQLA 2DP8A 3IB1A 1URSA 3TTKA 1F9BA 4OFOA 3JV9A 4OMBA 4OZ9A 1MDQA 3O29A 2XXYA 1DPEA 4DIGA 3T9XB 1Q1KA 2O1MA 4NWDA 3T93B 3PUYE 4F22A 2VGQA 2AL4A 4MF3A 4FJPA 1D3KA 3MZ9A 5HPQA 1H3DA 3KSXA 5A5XA 1FQCA 1BKAA 1NFTA 4F1UA 4RNSA 1N84A 5B7DA 1B1HA 4F39A 2IA4A 1B32A 2PT2A 1B46A 1FTJA 2OBGA 3U92A 2Z8FA 2XXIA 4TQUQ 3VDFA 1DTZA 2THIA 5DEXA 5H8FA 1VSOA 1IITA 3Q28A 3H6TA 2F8DA 4XKPA 3TFLA 4ND9A 2M8CA 3OENA 4HW8A 3C36A 3K6XA 1MY1A 3HN0A 3THIA 2OWSA 3S9MC 4QFKA 3IR1A 2ZYOA 3L6GA 5DTBA 2ZYNA 4F2OA 2LAOA 2HCAA 1SQYA 1B7HA 1WDNA 3GZGA 3MQ9A 1MXWA 3UK4A 1HSJA 4UA8A 3QYTA 2YLNA 1FTLA 4M4GA 1P1OA 4ISUA 1FQAA 4KCDA 3I3VA 4M1VA 3QAXA 3CFZA 2V3TA 5FHNA 3CIJA 4NMYA 1QJMA 4R9GA 2F7AA 3BFTA 4GWOA 3MWBA 4ZECA 1QULA 4ESXA 3IOTA 4LATA 4PETA 3RTFB 1NMUA 3W9WA 1Y3PA 4XKNA 1LBCA 4G8HA 3UP9A 2F97A 4QSDA 4U21A 3KJTA 1M5EA 1R9LA 4R72A 4YKKA 1KWHA 4RY1A 1N76A 4PFUA 2F5XA 2PYYA 3G7WA 1SD3A 3IB0A 4F2QA 3KGCA 3H6UA 1MQIA 4LZ8A 4GXAA 4ZDMA 3IAZA 2DXYA 3Q27A 3VLWA 4NE4A 4LZ7A 3U1OA 4U2RA 4X1BA 3RGYA 1BP5A 4RYAA 2VHAA 1GGGA 1VR5A 4IY5A 1MDP1 2XXPA 2OCUA 3A3UA 3IJOB 5I58B 5EHMA 1MXZA 1B5HA 2QPQA 4DDDA 3N6UA 3PPNA 4OXVA 1NNPA 4QSCA 1OQHA 4BDQA 2Y7KA 2DS9A 4H8JA 3BBRA 3U93A 2Z22A 4H6DA 3IOVA 3QSLA 5F1QA 3QUJA 3EF7A 1ZJLA 3KEIA 3EHUA 4FORA 4GRKA 4YB7A 1L5TA 4R9FA 1S9TA 4QRZA 3PPQA 1OVTA 3ZSFA 1PEBA 4TLMB 4ZS9A 1B3HA 2I4BA 2OLBA 4POWA 3G3KA 1LCTA 1MXXA 3TCGA 3H03A 3SEXA 3VV5A 4I9DA 3EHSA 2O6AA 2Y7IA 2DWAA 4OWDA 1H76A 4I62A 3SKPA 5I58A 2X7PA 3M3KA 1EZOA 3K01A 4RXLA 1JETA 4YICA 2GHBA 3PD8A 3B6QA 3SEVA 4PQJA 4H5GA 1PBPA 4ELOA 1US5A 2D3IA 3FVGA 2VD2A 2A5SA 4IO5A 2AYSA 2XXHA 4XTCQ 5BWJA 2XHDA 2Q88A 2BJJX 3N5LA 3TEPA 1ZU0A 3UGWA 1S7YA 3T9HB 1B51A 3T9UA 1QUJA 1BIYA 4POXA 5CMKA 3T96B 1LGBC 3V83A 3LSXA 3PU5A 2AL5A 4ONYA 2R6GE 4LP2B 4YMBA 3TTNA 1MQJA 4BDNA 1A99A 1NL5A 5CBSA 4LQ5A 4YMAA 3G3GA 2O1LA 1BTJA 1MRPA 2ALUA 3TPAA 4LUBA 3HPIA 3FIRA 2QRYA 3IORA 5EYFA 3FVOA 1B2HA 4X48A 1GTKA 1LAXA 5AE4A 3TTRA 1RKMA 1MY4A 4DXCA 3MZ1A 2ESNA 2PMSA 5I59B 3OO9A 4NF4B 3CR9A 5TU0A 2A5TB 3A3CA 1QKAA 1OLCA 2OJTA 4F3SA 3C35A 4U1OA 1CE2A 4Q30B 3I6VA 5IAIA 2DE2A 3C33A 1FCKA 2AIXA 3KZGA 1YAEA 1R9QA 3E4RA 3IOUA 2ONSA 3GBAA 5ITPA 3R26A 3PMWA 1XT8A 1LSTA 1O63A 3S9LC 1PBQA 3FATA 1N3XA 5CM6A 3H6VA 4GIZA 5CI5A 2QL3A 2REGA 2H5YA 5H8QB 1JVXA 4EF2A 5BUUA 1M5FA 3KG2A 1DPPA 2KLFA 5ELVA 5CC2A 1B40A 2NXOA 2H99A 2E0SA 5I59A 4O3AA 1MPCA 4EUOA 4NF4A 4NF8A 1JQFA 2A5TA 5H8HA 4LZ5A 3K6VA 1H45A 1P1NA 4BDMA 4IY6A 4KFQA 3MBPA 3KN8A 2VOZA 2VD3A 5ITOA 1UTBA 1MY0A 1JVYA 3PUVE 3PMXA 4BDRA 2I3VA 4OYVA 2I0CA 4DZ1A 2W7YA 3PUXE 4R75A 1J1NA 1ZLQA 3K4UA 4RK9A 5CRYA 1GVCA 2D5WA 1LAFE 1ZKBA 2DWJA 5AA3A 5ISUA 5H8QA 1DSNA 5HBCA 1AMFA 2IEEA 2XXRA 2O7UA 4IO3A 1IXHA 4E0XA 5IKBA 1XOCA 2Q89A 3RLFE 5K2YA 1B6HA 1IIWA 2I48A 3HO7A 2UYEA 1OQGA 3IOWA 1B7ZA 2F36A 4R6YA 4HTGA 4PFTA 3A09A 3RUMA 1AL3A 3FGSA 2GFEA 3LR1A 3O97A 1M5BA 3T22A 1LFGA 1IQ7A 2RC7A 3KN3A 2DOJA 3UN6A 5FTIA 1US4A 1D4NA 4PFYA 3SDFA 3P7IA 4YB6A 1QUKA 4ZE8A 4EXLA 2F34A 4ZEIA 1B0LA 4LQ2A 2E1SA 4P0GA 4PP0A 5FHMA 2ZNUA 1Y4CA 4XXUA 4JDFA 1SW5A 4E0WA 4WXJA 1MH4A 3E9XA 1MPBA 3QK6A 3EQ1A 1DOTA 2ZNTA 2HEUA 5CMBA 5DYHA 3LSFB 2XX7A 1P1QA 2I58A 1B52A 2FA7A 3S9EA 1IXGA 3I5OA 1XVYA 4R73A 4PFWA 4Z7EA 3KOTA 3U8QA 3HCQA 4U22A 3TUSA 3SEYA 1A54A 2VP1A 4RPOA 3CG3A 3TYHA 2GRVA 4H0WA 1XS5A 3O28A 5FTHA 4THIA 2WKYA 4C1UA 3OD7A 2UVJA 3MP1A 4AB6A 2FNCA 4FATA 3OSRA 4OEUA 3OEKA 3H7MA 3TELA 4C1TA 3IJXB 4R74A 3FVKA 3M8UA 2ZYMA 3FJGA 1Z7NE 1USYE 2UYFA 3GXAA 4Q5TA 4R2BA 3DM0A 4ZZEA 4ECFA 4YZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N94 A;  5HM4 B;  1B3F A;  3CI8 A;  3TDJ A;  2RCA A;  1EH3 A;  3HHF A;  2Y84 A;  4Z0I A;  4TOZ A;  3MAM A;  2DYX A;  3BFU A;  1LAH E;  2Z8D A;  2OWT A;  1MS7 A;  1POT A;  1HSE A;  1A7L A;  4EXK A;  4KHZ E;  4U1Z A;  1UIU A;  2R9J A;  1GV8 A;  3BKI B;  2NOO A;  1A8F A;  3D4G A;  1N7W A;  3CVG A;  3MW0 A;  4F3G A;  3DEL B;  3ZKK A;  4G2Z A;  2G93 A;  1N3W A;  4JBZ A;  3B6T A;  1QW0 A;  1LB9 A;  2XXX A;  2PVU A;  4ZE9 A;  1BLF A;  4FE8 A;  3ILT B;  3FV1 A;  4YU0 A;  4ELQ A;  5L9S A;  3R6U A;  1IEJ A;  4FIM A;  3TCF A;  3PPR A;  2NWJ A;  3RTW B;  4JXI A;  1I6Q A;  3E13 X;  3H06 B;  4RK2 A;  3H4Z A;  2XXQ A;  5DVI A;  2XXW A;  3TAJ A;  3EPE A;  5L9M A;  3O66 A;  4R2F A;  4F1Y A;  1TFA A;  4I8C A;  3O6G A;  2DWI A;  3G3J A;  2ZXT A;  3O6I A;  2B3B A;  1OVB A;  2RF1 A;  5TPA A;  3K1N A;  2O68 A;  2QS4 A;  3QIM A;  4KD5 A;  1YCJ A;  5B70 A;  2D21 A;  3MP8 A;  3OO8 A;  4XKR A;  1B9J A;  1N04 A;  1MXV A;  2O51 A;  4FEC A;  3SES A;  4C0R A;  4U23 A;  4OES A;  1VE4 A;  1EU8 A;  1OMP A;  4P0I A;  4EQB A;  2I0B A;  4F3B A;  1PB9 A;  2ZNS A;  1SBP A;  4QFO A;  4EQ7 A;  1LCF A;  4Q0C A;  3MJN A;  3OO7 A;  3K2D A;  3PPO A;  1QUI A;  1JW5 A;  4QFL A;  3TCH A;  4OHN A;  1IXI A;  3USD A;  3K6U A;  4G68 C;  4F29 A;  4IGR A;  4OEV A;  3UA8 A;  4I1D A;  4UAC A;  1Y20 A;  1UIV A;  2B65 A;  2H98 A;  3SEW A;  1SW2 A;  4ELR A;  3UIF A;  5EHS A;  3IO6 A;  3V8X B;  3JYR A;  1CB6 A;  2R71 A;  3FXR A;  2UVG A;  1B58 A;  2O7I A;  5I2N A;  1Z7M E;  4OET A;  1ZTY A;  4F18 A;  3FJ7 A;  4NF8 B;  3V89 B;  4YB5 A;  1D9V A;  4GOT A;  5H8H B;  3TQW A;  3MVW A;  3V5A A;  1DMB A;  3ECR A;  4ELP A;  2F7B A;  2UVI A;  1UTB B;  4KI0 E;  3CG1 A;  2UXA A;  2QS2 A;  5I57 A;  1LFI A;  2HZL A;  1XHY A;  4MLV A;  4DE8 A;  1SYH A;  4EDP A;  2RC9 A;  5M2V A;  4H8I A;  2PBW A;  3VVE A;  1MM7 A;  3FJM A;  2PX1 A;  4O3B A;  4DXU A;  1FW0 A;  5H8N B;  1JW1 A;  2O69 A;  4QFN A;  1Y3N A;  1ZIU A;  1FQB A;  1S50 A;  4G68 B;  3HST A;  3E3K A;  2F78 A;  3W15 C;  4AQ4 A;  3D4C A;  1M5D A;  4OTE A;  3OSQ A;  4RJZ A;  4KYD A;  3S9N C;  3FUZ A;  1H44 A;  2P1S A;  3IK6 B;  5DT6 A;  5I2K B;  1WOD A;  1SYI A;  3K00 A;  2XXV A;  4OFL A;  3T66 A;  3MVZ A;  1P99 A;  2QSX A;  4LA9 A;  5LOM A;  2Q2C A;  3KSJ A;  1FQD A;  4ZEK A;  2ONK E;  4BDL A;  2UVH A;  3MPK A;  1MQG A;  1IZ1 A;  1MY3 A;  1I6B A;  1B7U A;  1SW4 A;  3OEL A;  2P2A A;  5H8N A;  3O6H A;  2V84 A;  5AA1 A;  4G68 A;  4R6K A;  2XD2 A;  1NH8 A;  5ICT A;  5JEI A;  3IB2 A;  2F6P A;  4KYS A;  5JTY B;  1MPD A;  4FED A;  3VVF A;  1FTK A;  2DXR A;  5H8S A;  4JWO A;  1N7X A;  3OOA A;  2DQV A;  5I2K A;  1MM6 A;  3OXN A;  1ATG A;  3OMB A;  3SET A;  1JNF A;  3EHT A;  1RYX A;  1A55 A;  1FTO A;  3K0V A;  4LON B;  4QSE A;  2XXU A;  2DVZ A;  2F6G A;  3FVN A;  4H1X A;  2H4I A;  1NNK A;  4NWC A;  1IUD A;  2HAU A;  3MZB A;  3MPL A;  3QUF A;  4G4P A;  1A40 A;  1B1X A;  3TZA A;  2H9B A;  2G29 A;  1H43 A;  4KYE A;  1Y1Z A;  4IO4 A;  1IXC A;  5JTY A;  3QXM A;  3HHG A;  1SI1 A;  3CSG A;  4BLA A;  1PDA A;  1DTG A;  2OZZ A;  5FHO A;  1TXF A;  5CBR A;  3K6W A;  2Y7P A;  3HV1 A;  5K2X A;  4DCX A;  4BDO A;  1JEU A;  1TT1 A;  1P1U A;  5J1D A;  5I84 A;  4JB7 A;  2DE3 A;  1LAG E;  4MFI A;  3C34 A;  1QVS A;  4HCY A;  3MUQ A;  2H25 A;  4YKJ A;  4FAJ A;  3RN8 A;  4IGT A;  1GR2 A;  4PE5 B;  1Y3Q A;  4N13 A;  4KR5 A;  3PGF A;  1JEV A;  1I6A A;  5AA4 B;  3KN7 A;  4GF8 A;  1WVJ A;  4GL0 A;  2V25 A;  4YKI A;  3ILU B;  3M3F A;  4OVJ A;  1RYO A;  2DVC A;  2Q2A A;  3RT6 B;  2FYI A;  3TMG A;  3O9P A;  3OEM A;  2DE4 A;  1QKB A;  4WEP A;  3SER A;  4U4S A;  4OEN A;  3VFJ A;  3AXF A;  3FZV A;  2QJE A;  4X1D A;  3G3I A;  3K1M A;  3L6H A;  2V93 A;  1LB8 A;  4N07 A;  4EQ9 A;  1POY 1;  1D9Y A;  2ZMB A;  2ZYK A;  4GL8 A;  3FD3 A;  1NNF A;  4O3C A;  2XX8 A;  3VXB A;  2B3F A;  3LBS A;  3VE1 B;  1FQF A;  4GQO A;  2F35 A;  3C9H A;  4IB2 A;  3PPP A;  4OQO A;  5CMM A;  2V3Q A;  5AA4 A;  1B3L A;  1R1N A;  1PB7 A;  2RIN A;  1MY2 A;  1EZ9 A;  1LBB A;  1ELJ A;  2HQ0 A;  4KPT A;  4IO7 A;  4TLL B;  3RY3 A;  2DWH A;  4QF9 A;  3VLU A;  5TP9 B;  1AH5 A;  2PT1 A;  1B5I A;  5KCJ B;  3KBR A;  4Q8R A;  1URD A;  3Q29 A;  3B7D A;  1AOV A;  4F31 B;  4DCY A;  3RNN A;  3KJ7 A;  4DLD A;  4MLQ A;  2I6E A;  4JWY A;  1TWY A;  5TPA B;  3LC8 A;  2HZK A;  2ONR A;  4YKP A;  3K02 A;  5CMC A;  2XX9 A;  2GH9 A;  2Q9T A;  2X7Q A;  1O64 A;  3DLN A;  2Y7R A;  3S4U A;  3UOR A;  3FXU A;  5DVF A;  3K1P A;  1VFE A;  4NF6 B;  3VVD A;  1B3G A;  1NKX A;  3C31 A;  4H65 A;  1MXY A;  1SW1 A;  2I3W A;  4GXS B;  5TP9 A;  4N6P A;  1P1W A;  1B0H A;  4G8N A;  1I69 A;  3RPW A;  4HS7 A;  5L8D A;  5KCJ A;  3FXQ A;  4ZEF A;  3LUY A;  1Y4T A;  3F11 A;  2XD3 A;  1FQE A;  1B4Z A;  2O84 X;  2I49 A;  4K3F A;  3LSW A;  4X9T A;  4F1V A;  2YJP A;  3DP8 A;  4XKQ A;  2GHA A;  1B5J A;  3CSB A;  1ANF A;  4NTL A;  1B3E A;  3ONM A;  2QMW A;  5I2N B;  1B4H A;  1XVX A;  1NNT A;  3H3G A;  3N26 A;  5KDT B;  5L9O A;  1Y9U A;  1TFD A;  4NED A;  2F7C A;  4NF6 A;  1N0T A;  3M3L A;  3KOS A;  4QFP A;  4R6H A;  4HCW A;  1ZMG A;  2RCB A;  5I57 B;  4G77 A;  2Z8E A;  3RQT A;  3CFX A;  4F3P A;  2HXW A;  2REJ A;  1SI0 A;  4XIG Q;  1T0K A;  1SVX B;  5ICQ A;  1VFD A;  2YPN A;  4QHQ A;  1UTH B;  3OO6 A;  4IO2 A;  1MG1 A;  3G3H A;  4ESW A;  4GVO A;  2I4C A;  3FAS A;  3C32 A;  4ZZA A;  1YTV A;  2CZL A;  4DXB A;  1M5C A;  4JSD A;  4IO6 A;  3R7X A;  3TTL A;  2P0S A;  4F19 A;  2HFB A;  3ODB A;  3DP4 A;  4RA1 A;  1OLA A;  3H6W A;  4GD5 A;  4OFJ A;  3EN3 A;  1YPN A;  3PV0 E;  5KDT A;  2CMO A;  4GLI A;  3CFL A;  3IX1 A;  4WED A;  5I56 B;  3PUW E;  3PMV A;  3PUZ E;  4NF5 B;  1O7T A;  3WAE A;  2ABH A;  4H67 A;  1Q35 A;  3Q26 A;  2ANJ A;  2Z23 A;  1EZP A;  5JK4 A;  1HSL A;  4ZEB A;  3SEU A;  1OIB A;  3MC2 A;  4ZED A;  1A8E A;  1PB8 A;  1NH7 A;  3DP6 A;  1JW4 A;  1UTH A;  4JSO A;  3T9V A;  4KCC A;  3IL1 B;  5AA2 B;  4YAH X;  3CRB A;  1R6Z A;  2QS3 A;  5KZT A;  3WAF A;  3TTM A;  3GBB A;  3N6T A;  3PD9 A;  5DVJ A;  1MXU A;  4GFR A;  1LFH A;  3FV2 A;  1FTM A;  3VLV A;  4EF1 A;  5F7V A;  4LVQ A;  2QS1 A;  4AB5 A;  4OER A;  3U72 A;  1XC1 A;  3GLB A;  3Q25 A;  1MH3 A;  1B05 A;  5I56 A;  4NF5 A;  5AA2 D;  2XXT A;  4JWX A;  2QMX A;  4WKM A;  2RC8 A;  1USY H;  1II5 A;  4G8M A;  3IO4 A;  1SDX A;  4FEB A;  3ZKL A;  3MP6 A;  3TKD A;  5AA2 A;  1UQW A;  2DSF A;  1ZBM A;  3W9V A;  4L17 A;  2X26 A;  2Y7W A;  2Q8J A;  3S2V A;  2HAV A;  3G3F A;  4H5F A;  3LSL A;  2V3U A;  1AIV A;  5A5X B;  1MQD A;  3O2A A;  1LLS A;  2NUV A;  4P11 A;  3TOD A;  3JZJ A;  4MH5 A;  1Y1M A;  4KQP A;  2OK2 A;  4MBP A;  1URG A;  3KFM A;  2RKM A;  3RT8 A;  4U4X A;  2NVU B;  1PC3 A;  3MVX A;  1MQH A;  3U94 A;  3B6W A;  3ZS6 A;  3MVY A;  3VXC A;  4RPN A;  5DEX B;  3C4M A;  5H8F B;  3TQL A;  2DP8 A;  3IB1 A;  1URS A;  3TTK A;  1F9B A;  4OFO A;  3JV9 A;  4OMB A;  4OZ9 A;  1MDQ A;  3O29 A;  2XXY A;  1DPE A;  4DIG A;  3T9X B;  1Q1K A;  2O1M A;  4NWD A;  3T93 B;  3PUY E;  4F22 A;  2VGQ A;  2AL4 A;  4MF3 A;  4FJP A;  1D3K A;  3MZ9 A;  5HPQ A;  1H3D A;  3KSX A;  5A5X A;  1FQC A;  1BKA A;  1NFT A;  4F1U A;  4RNS A;  1N84 A;  5B7D A;  1B1H A;  4F39 A;  2IA4 A;  1B32 A;  2PT2 A;  1B46 A;  1FTJ A;  2OBG A;  3U92 A;  2Z8F A;  2XXI A;  4TQU Q;  3VDF A;  1DTZ A;  2THI A;  5DEX A;  5H8F A;  1VSO A;  1IIT A;  3Q28 A;  3H6T A;  2F8D A;  4XKP A;  3TFL A;  4ND9 A;  2M8C A;  3OEN A;  4HW8 A;  3C36 A;  3K6X A;  1MY1 A;  3HN0 A;  3THI A;  2OWS A;  3S9M C;  4QFK A;  3IR1 A;  2ZYO A;  3L6G A;  5DTB A;  2ZYN A;  4F2O A;  2LAO A;  2HCA A;  1SQY A;  1B7H A;  1WDN A;  3GZG A;  3MQ9 A;  1MXW A;  3UK4 A;  1HSJ A;  4UA8 A;  3QYT A;  2YLN A;  1FTL A;  4M4G A;  1P1O A;  4ISU A;  1FQA A;  4KCD A;  3I3V A;  4M1V A;  3QAX A;  3CFZ A;  2V3T A;  5FHN A;  3CIJ A;  4NMY A;  1QJM A;  4R9G A;  2F7A A;  3BFT A;  4GWO A;  3MWB A;  4ZEC A;  1QUL A;  4ESX A;  3IOT A;  4LAT A;  4PET A;  3RTF B;  1NMU A;  3W9W A;  1Y3P A;  4XKN A;  1LBC A;  4G8H A;  3UP9 A;  2F97 A;  4QSD A;  4U21 A;  3KJT A;  1M5E A;  1R9L A;  4R72 A;  4YKK A;  1KWH A;  4RY1 A;  1N76 A;  4PFU A;  2F5X A;  2PYY A;  3G7W A;  1SD3 A;  3IB0 A;  4F2Q A;  3KGC A;  3H6U A;  1MQI A;  4LZ8 A;  4GXA A;  4ZDM A;  3IAZ A;  2DXY A;  3Q27 A;  3VLW A;  4NE4 A;  4LZ7 A;  3U1O A;  4U2R A;  4X1B A;  3RGY A;  1BP5 A;  4RYA A;  2VHA A;  1GGG A;  1VR5 A;  4IY5 A;  1MDP 1;  2XXP A;  2OCU A;  3A3U A;  3IJO B;  5I58 B;  5EHM A;  1MXZ A;  1B5H A;  2QPQ A;  4DDD A;  3N6U A;  3PPN A;  4OXV A;  1NNP A;  4QSC A;  1OQH A;  4BDQ A;  2Y7K A;  2DS9 A;  4H8J A;  3BBR A;  3U93 A;  2Z22 A;  4H6D A;  3IOV A;  3QSL A;  5F1Q A;  3QUJ A;  3EF7 A;  1ZJL A;  3KEI A;  3EHU A;  4FOR A;  4GRK A;  4YB7 A;  1L5T A;  4R9F A;  1S9T A;  4QRZ A;  3PPQ A;  1OVT A;  3ZSF A;  1PEB A;  4TLM B;  4ZS9 A;  1B3H A;  2I4B A;  2OLB A;  4POW A;  3G3K A;  1LCT A;  1MXX A;  3TCG A;  3H03 A;  3SEX A;  3VV5 A;  4I9D A;  3EHS A;  2O6A A;  2Y7I A;  2DWA A;  4OWD A;  1H76 A;  4I62 A;  3SKP A;  5I58 A;  2X7P A;  3M3K A;  1EZO A;  3K01 A;  4RXL A;  1JET A;  4YIC A;  2GHB A;  3PD8 A;  3B6Q A;  3SEV A;  4PQJ A;  4H5G A;  1PBP A;  4ELO A;  1US5 A;  2D3I A;  3FVG A;  2VD2 A;  2A5S A;  4IO5 A;  2AYS A;  2XXH A;  4XTC Q;  5BWJ A;  2XHD A;  2Q88 A;  2BJJ X;  3N5L A;  3TEP A;  1ZU0 A;  3UGW A;  1S7Y A;  3T9H B;  1B51 A;  3T9U A;  1QUJ A;  1BIY A;  4POX A;  5CMK A;  3T96 B;  1LGB C;  3V83 A;  3LSX A;  3PU5 A;  2AL5 A;  4ONY A;  2R6G E;  4LP2 B;  4YMB A;  3TTN A;  1MQJ A;  4BDN A;  1A99 A;  1NL5 A;  5CBS A;  4LQ5 A;  4YMA A;  3G3G A;  2O1L A;  1BTJ A;  1MRP A;  2ALU A;  3TPA A;  4LUB A;  3HPI A;  3FIR A;  2QRY A;  3IOR A;  5EYF A;  3FVO A;  1B2H A;  4X48 A;  1GTK A;  1LAX A;  5AE4 A;  3TTR A;  1RKM A;  1MY4 A;  4DXC A;  3MZ1 A;  2ESN A;  2PMS A;  5I59 B;  3OO9 A;  4NF4 B;  3CR9 A;  5TU0 A;  2A5T B;  3A3C A;  1QKA A;  1OLC A;  2OJT A;  4F3S A;  3C35 A;  4U1O A;  1CE2 A;  4Q30 B;  3I6V A;  5IAI A;  2DE2 A;  3C33 A;  1FCK A;  2AIX A;  3KZG A;  1YAE A;  1R9Q A;  3E4R A;  3IOU A;  2ONS A;  3GBA A;  5ITP A;  3R26 A;  3PMW A;  1XT8 A;  1LST A;  1O63 A;  3S9L C;  1PBQ A;  3FAT A;  1N3X A;  5CM6 A;  3H6V A;  4GIZ A;  5CI5 A;  2QL3 A;  2REG A;  2H5Y A;  5H8Q B;  1JVX A;  4EF2 A;  5BUU A;  1M5F A;  3KG2 A;  1DPP A;  2KLF A;  5ELV A;  5CC2 A;  1B40 A;  2NXO A;  2H99 A;  2E0S A;  5I59 A;  4O3A A;  1MPC A;  4EUO A;  4NF4 A;  4NF8 A;  1JQF A;  2A5T A;  5H8H A;  4LZ5 A;  3K6V A;  1H45 A;  1P1N A;  4BDM A;  4IY6 A;  4KFQ A;  3MBP A;  3KN8 A;  2VOZ A;  2VD3 A;  5ITO A;  1UTB A;  1MY0 A;  1JVY A;  3PUV E;  3PMX A;  4BDR A;  2I3V A;  4OYV A;  2I0C A;  4DZ1 A;  2W7Y A;  3PUX E;  4R75 A;  1J1N A;  1ZLQ A;  3K4U A;  4RK9 A;  5CRY A;  1GVC A;  2D5W A;  1LAF E;  1ZKB A;  2DWJ A;  5AA3 A;  5ISU A;  5H8Q A;  1DSN A;  5HBC A;  1AMF A;  2IEE A;  2XXR A;  2O7U A;  4IO3 A;  1IXH A;  4E0X A;  5IKB A;  1XOC A;  2Q89 A;  3RLF E;  5K2Y A;  1B6H A;  1IIW A;  2I48 A;  3HO7 A;  2UYE A;  1OQG A;  3IOW A;  1B7Z A;  2F36 A;  4R6Y A;  4HTG A;  4PFT A;  3A09 A;  3RUM A;  1AL3 A;  3FGS A;  2GFE A;  3LR1 A;  3O97 A;  1M5B A;  3T22 A;  1LFG A;  1IQ7 A;  2RC7 A;  3KN3 A;  2DOJ A;  3UN6 A;  5FTI A;  1US4 A;  1D4N A;  4PFY A;  3SDF A;  3P7I A;  4YB6 A;  1QUK A;  4ZE8 A;  4EXL A;  2F34 A;  4ZEI A;  1B0L A;  4LQ2 A;  2E1S A;  4P0G A;  4PP0 A;  5FHM A;  2ZNU A;  1Y4C A;  4XXU A;  4JDF A;  1SW5 A;  4E0W A;  4WXJ A;  1MH4 A;  3E9X A;  1MPB A;  3QK6 A;  3EQ1 A;  1DOT A;  2ZNT A;  2HEU A;  5CMB A;  5DYH A;  3LSF B;  2XX7 A;  1P1Q A;  2I58 A;  1B52 A;  2FA7 A;  3S9E A;  1IXG A;  3I5O A;  1XVY A;  4R73 A;  4PFW A;  4Z7E A;  3KOT A;  3U8Q A;  3HCQ A;  4U22 A;  3TUS A;  3SEY A;  1A54 A;  2VP1 A;  4RPO A;  3CG3 A;  3TYH A;  2GRV A;  4H0W A;  1XS5 A;  3O28 A;  5FTH A;  4THI A;  2WKY A;  4C1U A;  3OD7 A;  2UVJ A;  3MP1 A;  4AB6 A;  2FNC A;  4FAT A;  3OSR A;  4OEU A;  3OEK A;  3H7M A;  3TEL A;  4C1T A;  3IJX B;  4R74 A;  3FVK A;  3M8U A;  2ZYM A;  3FJG A;  1Z7N E;  1USY E;  2UYF A;  3GXA A;  4Q5T A;  4R2B A;  3DM0 A;  4ZZE A;  4ECF A;  4YZZ A; 
#chains in the Genus database with same CATH topology
 3N94 A;  5HM4 B;  1B3F A;  3CI8 A;  3TDJ A;  2RCA A;  1EH3 A;  3HHF A;  2Y84 A;  4Z0I A;  4TOZ A;  4O8M A;  3MAM A;  2DYX A;  3BFU A;  1FJ6 A;  1LAH E;  2Z8D A;  2OWT A;  1MS7 A;  1POT A;  1HSE A;  3HFU A;  1A7L A;  4EXK A;  4KHZ E;  4U1Z A;  1UIU A;  2R9J A;  1GV8 A;  3BKI B;  1KZ8 A;  4N91 A;  2NOO A;  1A8F A;  3D4G A;  1N7W A;  3CVG A;  3MW0 A;  4F3G A;  3DEL B;  3ZKK A;  4G2Z A;  2G93 A;  1N3W A;  5J16 A;  4JBZ A;  3B6T A;  1FTA A;  2ZZV A;  1QW0 A;  4DI3 D;  1LB9 A;  2XXX A;  4PFR A;  2PVU A;  4ZE9 A;  1BLF A;  2Y5L A;  4FE8 A;  3ILT B;  3FV1 A;  4YU0 A;  4ELQ A;  5L9S A;  2Q8M A;  3R6U A;  1IEJ A;  5I3S A;  4FIM A;  3TCF A;  3IFC A;  3PPR A;  2NWJ A;  3RTW B;  1IMB A;  4JXI A;  1I6Q A;  3E13 X;  3H06 B;  4RK2 A;  3H4Z A;  2XXQ A;  4GBV A;  5DVI A;  2XXW A;  3TAJ A;  3EPE A;  5L9M A;  3O66 A;  4R2F A;  3RPL B;  1NUY A;  4F1Y A;  1TFA A;  4I8C A;  2CZH A;  3O6G A;  2DWI A;  2WBD A;  3G3J A;  2ZXT A;  4OVT A;  3O6I A;  2B3B A;  1OVB A;  2RF1 A;  5TPA A;  3K1N A;  2O68 A;  2QS4 A;  3QIM A;  4KD5 A;  1YCJ A;  5B70 A;  2D21 A;  3MP8 A;  3OO8 A;  4XKR A;  1B9J A;  1N04 A;  1MXV A;  2O51 A;  4FEC A;  3SES A;  4C0R A;  4U23 A;  4OES A;  1VE4 A;  3KC0 A;  1EU8 A;  1OMP A;  4P0I A;  4EQB A;  4PDD A;  2I0B A;  4F3B A;  1PB9 A;  2ZNS A;  1SBP A;  4QFO A;  4EQ7 A;  1LCF A;  1JP4 A;  4Q0C A;  3MJN A;  3OO7 A;  3K2D A;  3PPO A;  1QUI A;  1JW5 A;  2V4C A;  4QFL A;  3TCH A;  1DCU A;  4OHN A;  1IXI A;  3USD A;  3K6U A;  4G68 C;  4PTK A;  4F29 A;  4IGR A;  4OEV A;  3UA8 A;  4I1D A;  4UAC A;  3RPL A;  1Y20 A;  1UIV A;  2B65 A;  1FPI A;  2H98 A;  2FIE A;  3SEW A;  4P1E A;  1IMD A;  4XFE A;  1SW2 A;  4ELR A;  1FPD A;  3UIF A;  5EHS A;  3IO6 A;  3V8X B;  3JYR A;  1CB6 A;  2R71 A;  4HXV A;  3FXR A;  2UVG A;  1B58 A;  2O7I A;  5I2N A;  1Z7M E;  2JJK A;  4OET A;  1ZTY A;  4F18 A;  3FJ7 A;  4NF8 B;  3V89 B;  4OVP A;  4YB5 A;  1D9V A;  4AS5 A;  4GOT A;  5H8H B;  3TQW A;  3MVW A;  3ROJ A;  4LN5 A;  3V5A A;  3KC1 A;  1DMB A;  3ECR A;  4ELP A;  2F7B A;  2UVI A;  1UTB B;  2ZZW A;  4KI0 E;  4QXD A;  3CG1 A;  2UXA A;  5ET5 A;  3FXB A;  2QS2 A;  5I57 A;  1LFI A;  2HZL A;  1RDY A;  1XHY A;  4MLV A;  4DE8 A;  1SYH A;  4EDP A;  5EYG A;  4GX6 A;  2RC9 A;  5M2V A;  4H8I A;  2PBW A;  3VVE A;  1MM7 A;  4IR8 A;  3FJM A;  4O7M A;  4O94 A;  3T0J A;  2PX1 A;  4O3B A;  1FBF A;  4P9K A;  4DXU A;  1FW0 A;  5H8N B;  1JW1 A;  2O69 A;  4QFN A;  1Y3N A;  1ZIU A;  1FQB A;  1S50 A;  4G68 B;  3HST A;  3E3K A;  2F78 A;  4MEV A;  3KBZ A;  3W15 C;  4AQ4 A;  2OWZ A;  3D4C A;  1NV0 A;  1FPK A;  1M5D A;  4OTE A;  3OSQ A;  4RJZ A;  1IMA A;  4KYD A;  3S9N C;  3FUZ A;  1H44 A;  2P1S A;  4GX3 A;  3IK6 B;  5DT6 A;  5I2K B;  2WX9 A;  1WOD A;  4H46 A;  1SYI A;  3K00 A;  1FSA A;  2XXV A;  3A29 A;  5ET6 A;  4OFL A;  1LBZ A;  3T66 A;  3MVZ A;  3EKI A;  1P99 A;  2QSX A;  4LA9 A;  5LOM A;  2Q2C A;  3KSJ A;  1FQD A;  4ZEK A;  2ONK E;  4BDL A;  2UVH A;  1INP A;  3MPK A;  1MQG A;  1IZ1 A;  1MY3 A;  1I6B A;  1B7U A;  1SW4 A;  3OEL A;  1VDW A;  2P2A A;  5H8N A;  3O6H A;  3D1R A;  2V84 A;  5AA1 A;  2QVU A;  4G68 A;  4R6K A;  2XD2 A;  3MYU A;  1NH8 A;  5ICT A;  5JEI A;  3IB2 A;  2P3N A;  2F6P A;  5IZ1 A;  4KYS A;  5JTY B;  1MPD A;  4FED A;  3VVF A;  1FTK A;  2DXR A;  5H8S A;  1IMF A;  4JWO A;  1N7X A;  1NUX A;  3OOA A;  2DQV A;  5I2K A;  1MM6 A;  3OXN A;  5IGA A;  1ATG A;  3OMB A;  3SET A;  1JNF A;  3EHT A;  1RYX A;  1A55 A;  2CZK A;  1FTO A;  3K0V A;  4LON B;  4X8R A;  4QSE A;  2XXU A;  2DVZ A;  2F6G A;  3FVN A;  4H1X A;  2H4I A;  1NNK A;  4NWC A;  1IUD A;  2HAU A;  3MZB A;  3IFA A;  3MPL A;  3QUF A;  4G4P A;  1A40 A;  1B1X A;  3TZA A;  2H9B A;  5EQ9 A;  2G29 A;  4N4U A;  5A5L A;  1H43 A;  4KYE A;  1Y1Z A;  4IO4 A;  1CNQ A;  1IXC A;  4N81 A;  4I3E A;  5JTY A;  3QXM A;  3HHG A;  1SI1 A;  3CSG A;  4BLA A;  1PDA A;  1DTG A;  2OZZ A;  5FHO A;  2WYK A;  4I3Y A;  1TXF A;  5CBR A;  3K6W A;  2Y7P A;  3HV1 A;  5EQA A;  5K2X A;  4DCX A;  4BDO A;  1JEU A;  1TT1 A;  1P1U A;  5J1D A;  5I84 A;  4JB7 A;  2DE3 A;  1LAG E;  4MFI A;  3C34 A;  5ESY A;  1QVS A;  4HCY A;  3MUQ A;  2H25 A;  4YKJ A;  4FAJ A;  3RN8 A;  4IGT A;  1GR2 A;  4PE5 B;  1Y3Q A;  4N13 A;  4AS4 A;  4KR5 A;  3PGF A;  1JEV A;  1I6A A;  5AA4 B;  3KN7 A;  4GF8 A;  1WVJ A;  4GL0 A;  2V25 A;  4YKI A;  3ILU B;  3M3F A;  4OVJ A;  3QMF A;  1RYO A;  2DVC A;  2Q2A A;  3RT6 B;  2FYI A;  3TMG A;  3O9P A;  3OEM A;  4HE0 A;  2DE4 A;  1QKB A;  4WEP A;  3SER A;  4U4S A;  4MNC A;  4OEN A;  3VFJ A;  3AXF A;  3FZV A;  2QJE A;  1FBH A;  4X1D A;  3G3I A;  4PDH A;  3K1M A;  3L6H A;  2V93 A;  1LB8 A;  4N07 A;  4EQ9 A;  1POY 1;  1LBY A;  1D9Y A;  2ZMB A;  1LEV A;  2ZYK A;  5EQ8 A;  4GL8 A;  3FD3 A;  1NNF A;  4O3C A;  2XX8 A;  3VXB A;  2KQZ A;  4JVI A;  2B3F A;  1D9Q A;  3LBS A;  3VE1 B;  1FQF A;  4PFI A;  4GQO A;  1NV5 A;  2F35 A;  3RYD A;  3C9H A;  4IB2 A;  3PPP A;  4OQO A;  5CMM A;  3FBP A;  2V3Q A;  5AA4 A;  1B3L A;  1R1N A;  1PB7 A;  2B4L A;  2RIN A;  1MY2 A;  1EZ9 A;  1LBB A;  1ELJ A;  1XI6 A;  2HQ0 A;  4KPT A;  4IO7 A;  4TLL B;  4P8B A;  3RY3 A;  2DWH A;  4QF9 A;  3VLU A;  5TP9 B;  1AH5 A;  2PT1 A;  1B5I A;  5KCJ B;  3KBR A;  4Q8R A;  1URD A;  3Q29 A;  3B7D A;  1AOV A;  4F31 B;  4DCY A;  3RNN A;  3KJ7 A;  3B8B A;  4PGP A;  4DLD A;  4MLQ A;  2I6E A;  4JWY A;  1TWY A;  5TPA B;  3LC8 A;  2HZK A;  5DW8 A;  2ONR A;  2FHY A;  1LBW A;  4YKP A;  3K02 A;  5CMC A;  2XX9 A;  2GH9 A;  2Q9T A;  2X7Q A;  1O64 A;  3DLN A;  2Y7R A;  4G61 A;  4P1L A;  1NV3 A;  3S4U A;  3UOR A;  1KA1 A;  3FXU A;  2XWK A;  5DVF A;  2QFL A;  3K1P A;  1VFE A;  4NF6 B;  3VVD A;  1B3G A;  1NKX A;  1K9Y A;  3C31 A;  3E78 A;  4H65 A;  1MXY A;  1SW1 A;  2I3W A;  4GXS B;  5TP9 A;  4N6P A;  1P1W A;  1B0H A;  4G8N A;  1I69 A;  3RPW A;  4HS7 A;  2GQ1 A;  5L8D A;  5KCJ A;  2Q74 A;  3FXQ A;  4ZEF A;  2XWV A;  3LUY A;  1Y4T A;  3F11 A;  2XD3 A;  1FQE A;  1B4Z A;  2O84 X;  4N8Y A;  4MNI A;  2I49 A;  4K3F A;  3LSW A;  4X9T A;  4F1V A;  2YJP A;  3DP8 A;  4XKQ A;  2GHA A;  1B5J A;  2XWI A;  3CSB A;  1ANF A;  4NTL A;  1B3E A;  3ONM A;  5F24 A;  2QMW A;  5I2N B;  3LUZ A;  4PAF A;  1B4H A;  2PFZ A;  2ZZX A;  1XVX A;  1NNT A;  3CHG A;  3H3G A;  3N26 A;  5KDT B;  5L9O A;  1Y9U A;  1FJ9 A;  1TFD A;  4NED A;  2F7C A;  4NF6 A;  1N0T A;  3M3L A;  3KOS A;  1G0H A;  4QFP A;  4R6H A;  4HCW A;  1ZMG A;  2RCB A;  5I57 B;  4G77 A;  2Z8E A;  4N17 A;  3RQT A;  3CFX A;  4F3P A;  2HXW A;  2REJ A;  1SI0 A;  4XIG Q;  2FVZ A;  2Y5K A;  1T0K A;  1SVX B;  5ICQ A;  1VFD A;  1BK4 A;  4QHQ A;  2YPN A;  1UTH B;  3OO6 A;  4IO2 A;  1MG1 A;  3G3H A;  4ESW A;  4GVO A;  2I4C A;  3FAS A;  3C32 A;  1EYJ A;  4ZZA A;  1YTV A;  2CZL A;  4DXB A;  1M5C A;  4JSD A;  4IO6 A;  3R7X A;  3TTL A;  2P0S A;  4F19 A;  2HFB A;  4DI4 B;  3ODB A;  3DP4 A;  4RA1 A;  1EYI A;  1OLA A;  3H6W A;  4GD5 A;  4OFJ A;  3EN3 A;  1YPN A;  3PV0 E;  5KDT A;  2CMO A;  4GLI A;  3CFL A;  3IX1 A;  4WED A;  5I56 B;  4H45 A;  3PUW E;  3PMV A;  3PUZ E;  4NF5 B;  1O7T A;  3WAE A;  2ABH A;  2BJI A;  1IME A;  1Q35 A;  3Q26 A;  4H67 A;  2ANJ A;  2Z23 A;  1EZP A;  5JK4 A;  1HSL A;  4ZEB A;  3SEU A;  4GX4 A;  1OIB A;  3MC2 A;  4ZED A;  1LBX A;  1A8E A;  1PB8 A;  1NH7 A;  4MIJ A;  3DP6 A;  1JW4 A;  1UTH A;  4JSO A;  3T1B A;  4KCC A;  3T9V A;  3IL1 B;  3BIG A;  5AA2 B;  4OAN A;  1NV1 A;  2PCR A;  4YAH X;  1FBP A;  3CRB A;  1R6Z A;  2QS3 A;  5KZT A;  3WAF A;  3TTM A;  3GBB A;  3N6T A;  3PD9 A;  5DVJ A;  3BIH A;  1MXU A;  4GFR A;  1LFH A;  3FV2 A;  1FTM A;  2KR0 A;  3VLV A;  4EF1 A;  5F7V A;  4LVQ A;  4PAK A;  2QS1 A;  4AB5 A;  4OER A;  3U72 A;  1XC1 A;  2QVV A;  3GLB A;  3Q25 A;  1MH3 A;  1B05 A;  5I56 A;  4NF5 A;  5AA2 D;  4JVD A;  3B50 A;  2XXT A;  4JWX A;  2QMX A;  2HHM A;  4WKM A;  5FBP A;  2RC8 A;  1USY H;  1II5 A;  4G8M A;  3IO4 A;  1SDX A;  5IZZ A;  4FEB A;  3ZKL A;  3MP6 A;  3TKD A;  5AA2 A;  1UQW A;  2DSF A;  1ZBM A;  3W9V A;  4L17 A;  2X26 A;  2Y7W A;  2Q8J A;  3S2V A;  2HAV A;  3G3F A;  4H5F A;  1FRP A;  3LSL A;  2V3U A;  1AIV A;  5A5X B;  4NF0 A;  1MQD A;  3O2A A;  1LLS A;  2NUV A;  4P11 A;  3TOD A;  3JZJ A;  4MNP A;  4MH5 A;  1Y1M A;  4N6D A;  4KQP A;  2OK2 A;  4MBP A;  1URG A;  3KFM A;  2RKM A;  3RT8 A;  4U4X A;  2NVU B;  4GWW A;  1YZ0 A;  1PC3 A;  1FPJ A;  3MVX A;  1MQH A;  3U94 A;  3B6W A;  3ISP A;  3ZS6 A;  3MVY A;  3VXC A;  4RPN A;  5DEX B;  3C4M A;  5H8F B;  3TQL A;  1SPI A;  2DP8 A;  3IB1 A;  4HE2 A;  1URS A;  3TTK A;  1F9B A;  4OFO A;  3JV9 A;  4GWS A;  4OMB A;  4OZ9 A;  1MDQ A;  3O29 A;  2XXY A;  4PE3 A;  4QBA A;  1DPE A;  4DIG A;  3T9X B;  1Q1K A;  2O1M A;  4NWD A;  3T93 B;  3PUY E;  4F22 A;  2VGQ A;  2AL4 A;  4MF3 A;  4FJP A;  1D3K A;  1FPB A;  3MZ9 A;  5HPQ A;  1H3D A;  3KSX A;  5A5X A;  1FQC A;  1BKA A;  1NFT A;  4F1U A;  4RNS A;  1IMC A;  1N84 A;  5B7D A;  4PCD A;  1B1H A;  4F39 A;  2IA4 A;  1B32 A;  2PT2 A;  1B46 A;  1FTJ A;  2OBG A;  4MHF A;  3U92 A;  2WBB A;  2Z8F A;  4X04 A;  2XXI A;  4TQU Q;  3VDF A;  4OA4 A;  1DTZ A;  2THI A;  5DEX A;  4XEQ A;  5H8F A;  1VSO A;  1IIT A;  3Q28 A;  3H6T A;  5LTC A;  2F8D A;  2B4M A;  5LDZ A;  4NQ8 A;  4XKP A;  3TFL A;  1NV6 A;  4ND9 A;  2M8C A;  3OEN A;  4HW8 A;  3C36 A;  3K6X A;  1MY1 A;  3HN0 A;  3THI A;  2OWS A;  3S9M C;  2VPO A;  4QFK A;  3IR1 A;  4MJO A;  2ZYO A;  3L6G A;  5DTB A;  2ZYN A;  4F2O A;  2LAO A;  2HCA A;  1SQY A;  1B7H A;  1WDN A;  5IZ3 B;  3GZG A;  3MQ9 A;  1MXW A;  3UK4 A;  4UAB A;  1HSJ A;  4UA8 A;  3QYT A;  4OVR A;  2YLN A;  1EYK A;  1FTL A;  4M4G A;  1P1O A;  4ISU A;  1FQA A;  4KCD A;  3I3V A;  4M1V A;  1RDX A;  3QAX A;  3CFZ A;  2V3T A;  5FHN A;  3CIJ A;  4NMY A;  1QJM A;  4R9G A;  2F7A A;  3BFT A;  4GWO A;  2HXR A;  3MWB A;  2L5V A;  1NV7 A;  4ZEC A;  1QUL A;  4ESX A;  3IOT A;  4LAT A;  4MCO A;  4PET A;  3RTF B;  1NMU A;  3W9W A;  1Y3P A;  4XKN A;  5IM2 A;  4GWX A;  1LBC A;  4G8H A;  3UP9 A;  2F97 A;  4QSD A;  4U21 A;  3KJT A;  1M5E A;  1R9L A;  4R72 A;  4YKK A;  1KWH A;  4RY1 A;  1N76 A;  4HE1 A;  4PFU A;  2F5X A;  2PYY A;  3G7W A;  1SD3 A;  3IB0 A;  1NV2 A;  5IZ3 A;  4F2Q A;  3KGC A;  3H6U A;  1MQI A;  4LZ8 A;  4GXA A;  4ZDM A;  3IAZ A;  1FPE A;  2DXY A;  3Q27 A;  3VLW A;  4NE4 A;  4LZ7 A;  3U1O A;  4U2R A;  4X1B A;  3RGY A;  1BP5 A;  4RYA A;  2VHA A;  1GGG A;  1KA0 A;  1VR5 A;  4P3L A;  3U65 A;  4IY5 A;  1MDP 1;  2XXP A;  2OCU A;  3A3U A;  3IJO B;  5I58 B;  5EHM A;  1MXZ A;  1B5H A;  2QPQ A;  4DDD A;  3N6U A;  3PPN A;  4OXV A;  1NNP A;  4QSC A;  4O7I A;  1OQH A;  4BDQ A;  2Y7K A;  2DS9 A;  4H8J A;  3BBR A;  4NG7 A;  3U93 A;  2Z22 A;  4H6D A;  5I7I A;  3IOV A;  3QSL A;  5F1Q A;  3QUJ A;  3EF7 A;  1ZJL A;  3KEI A;  4PGN A;  3EHU A;  4FOR A;  4GRK A;  4YB7 A;  1YXI A;  1L5T A;  4R9F A;  1S9T A;  4QRZ A;  3PPQ A;  1OVT A;  3ZSF A;  3MST A;  1PEB A;  3E79 A;  4TLM B;  4ZS9 A;  1FPF A;  1B3H A;  2I4B A;  2OLB A;  4POW A;  3G3K A;  1LCT A;  1MXX A;  3TCG A;  5EQ7 A;  4NN3 A;  3H03 A;  4N15 A;  2CEY A;  3SEX A;  3VV5 A;  4I9D A;  5EYH A;  3EHS A;  2O6A A;  2Y7I A;  2DWA A;  2DDK A;  4N6K A;  4OWD A;  1H76 A;  4I62 A;  3SKP A;  5I58 A;  1NI9 A;  2X7P A;  3M3K A;  1EZO A;  3K01 A;  4RXL A;  1JET A;  4YIC A;  2GHB A;  3PD8 A;  3B6Q A;  3SEV A;  4PQJ A;  4H5G A;  1PBP A;  1US5 A;  4ELO A;  2D3I A;  3FVG A;  2VD2 A;  2A5S A;  4IO5 A;  2AYS A;  2F3B A;  2XXH A;  4XTC Q;  2VPN A;  5BWJ A;  2XHD A;  1QGX A;  2Q88 A;  2BJJ X;  4N8G A;  3N5L A;  3TEP A;  1ZU0 A;  3UGW A;  1S7Y A;  3T9H B;  1B51 A;  3T9U A;  1QUJ A;  1BIY A;  2F3D A;  4POX A;  2OX3 A;  5CMK A;  3T96 B;  1LGB C;  3V83 A;  4XF5 A;  3LSX A;  4NX1 A;  3PU5 A;  2AL5 A;  1FBC A;  4JVC A;  4ONY A;  2CEX A;  2R6G E;  4LP2 B;  4YMB A;  3TTN A;  4FBP A;  1MQJ A;  4BDN A;  1A99 A;  1NL5 A;  5CBS A;  4LQ5 A;  4PFB A;  4YMA A;  3G3G A;  2O1L A;  1BTJ A;  1MRP A;  2ALU A;  3TPA A;  3GYY A;  4LUB A;  3HPI A;  3FIR A;  2QRY A;  3IOR A;  1DBZ A;  5EYF A;  3FVO A;  1B2H A;  2MKZ A;  4X48 A;  1GTK A;  1LAX A;  5AE4 A;  3TTR A;  1RKM A;  1MY4 A;  4DXC A;  3MZ1 A;  2ESN A;  2PMS A;  5I59 B;  3OO9 A;  4NF4 B;  3CR9 A;  5TU0 A;  2A5T B;  1FBE A;  3A3C A;  1QKA A;  1OLC A;  2OJT A;  4F3S A;  3C35 A;  4U1O A;  1CE2 A;  2WYP A;  4GWU A;  4Q30 B;  3I6V A;  1FBG A;  5IAI A;  2DE2 A;  3C33 A;  1FCK A;  2AIX A;  3KZG A;  1YAE A;  1R9Q A;  3E4R A;  1FPL A;  3IOU A;  2ONS A;  3GBA A;  1YYZ A;  5ITP A;  3R26 A;  4NAP A;  3PMW A;  4GWZ A;  1XT8 A;  2CZI A;  1LST A;  1O63 A;  3S9L C;  1PBQ A;  3FAT A;  1N3X A;  5CM6 A;  3H6V A;  4GIZ A;  5T3J A;  5CI5 A;  2QL3 A;  2REG A;  2H5Y A;  5H8Q B;  1JVX A;  4EF2 A;  5ET8 A;  1M5F A;  5BUU A;  3KG2 A;  4NHB A;  1DPP A;  2KLF A;  5ELV A;  5CC2 A;  1B40 A;  1FPG A;  2NXO A;  2H99 A;  2E0S A;  5I59 A;  4O3A A;  1MPC A;  4EUO A;  4NF4 A;  2R8T A;  1JQF A;  4NF8 A;  2A5T A;  4GWY A;  4LZ5 A;  5H8H A;  3K6V A;  1H45 A;  1P1N A;  4BDM A;  4IY6 A;  4KFQ A;  3MBP A;  3KN8 A;  2VOZ A;  2VD3 A;  5ITO A;  1UTB A;  1MY0 A;  1JVY A;  3PUV E;  3PMX A;  4BDR A;  2I3V A;  4OYV A;  2I0C A;  4DZ1 A;  2W7Y A;  3PUX E;  4R75 A;  4I40 A;  4PF6 A;  1J1N A;  1ZLQ A;  3K4U A;  4RK9 A;  4NGU A;  5CRY A;  1GVC A;  2D5W A;  2XXK A;  1LAF E;  1ZKB A;  2DWJ A;  5AA3 A;  1RDZ A;  5ISU A;  5H8Q A;  1DSN A;  5HBC A;  1AMF A;  2IEE A;  2XXR A;  3LV0 A;  2P3V A;  2FBP A;  2O7U A;  4IO3 A;  1IXH A;  4E0X A;  5IKB A;  1XOC A;  4GBW A;  2Q89 A;  3RLF E;  1Q9D A;  5K2Y A;  1B6H A;  1IIW A;  2I48 A;  3HO7 A;  1NV4 A;  2UYE A;  1FBD A;  1OQG A;  3IOW A;  1B7Z A;  4PBH A;  2F36 A;  4R6Y A;  4HTG A;  4PFT A;  3SZP A;  3A09 A;  3RUM A;  1AL3 A;  3NOH A;  1LBV A;  2XA5 A;  3FGS A;  2GFE A;  3LR1 A;  1AWB A;  3O97 A;  4OVS A;  1M5B A;  3T22 A;  2HPG A;  1LFG A;  1IQ7 A;  2RC7 A;  4PC9 A;  3KN3 A;  2DOJ A;  3UN6 A;  4PBQ A;  5FTI A;  2WEF A;  4MX6 A;  1US4 A;  1D4N A;  4PFY A;  1G0I A;  3SDF A;  4PF8 A;  3P7I A;  4YB6 A;  1QUK A;  2XWO A;  4ZE8 A;  4EXL A;  2F34 A;  2FIX A;  4ZEI A;  1B0L A;  4LQ2 A;  2E1S A;  4P0G A;  5I5P A;  4PP0 A;  5FHM A;  2ZNU A;  1Y4C A;  4P56 A;  4XXU A;  4JDF A;  1SW5 A;  4E0W A;  4WXJ A;  1MH4 A;  3E9X A;  1MPB A;  3QK6 A;  2VT5 A;  3EQ1 A;  1DOT A;  4KXP A;  2ZNT A;  2HEU A;  5CMB A;  5DYH A;  1NUZ A;  3LSF B;  2XX7 A;  1P1Q A;  2I58 A;  1B52 A;  1K9Z A;  2FA7 A;  3S9E A;  1IXG A;  3I5O A;  1XVY A;  4R73 A;  4PFW A;  4Z7E A;  3KOT A;  3U8Q A;  3HCQ A;  4U22 A;  1DK4 A;  4P47 A;  3TUS A;  2QVR A;  3SEY A;  1A54 A;  2VP1 A;  4RPO A;  3CG3 A;  4PAI A;  3TYH A;  2GRV A;  4MAG A;  4H0W A;  1XS5 A;  3O28 A;  5FTH A;  4THI A;  3PTY A;  2WKY A;  4C1U A;  3OD7 A;  5ET7 A;  2UVJ A;  3MP1 A;  4AB6 A;  2PFY A;  2FNC A;  4FAT A;  3OSR A;  4MMP A;  4OEU A;  1NUW A;  3H7M A;  3OEK A;  3TEL A;  4C1T A;  3IJX B;  4R74 A;  3FVK A;  3M8U A;  2ZYM A;  3FJG A;  1Z7N E;  1USY E;  4OVQ A;  2UYF A;  3GXA A;  4Q5T A;  4R2B A;  3DM0 A;  4ZZE A;  4ECF A;  4YZZ A; 
#chains in the Genus database with same CATH homology
 3N94 A;  5HM4 B;  1B3F A;  3CI8 A;  3TDJ A;  2RCA A;  1EH3 A;  3HHF A;  2Y84 A;  4Z0I A;  4TOZ A;  3MAM A;  2DYX A;  3BFU A;  1LAH E;  2Z8D A;  2OWT A;  1MS7 A;  1POT A;  1HSE A;  1A7L A;  4EXK A;  4KHZ E;  4U1Z A;  1UIU A;  2R9J A;  1GV8 A;  3BKI B;  2NOO A;  1A8F A;  3D4G A;  1N7W A;  3CVG A;  3MW0 A;  4F3G A;  3DEL B;  3ZKK A;  4G2Z A;  2G93 A;  1N3W A;  4JBZ A;  3B6T A;  1QW0 A;  1LB9 A;  2XXX A;  2PVU A;  4ZE9 A;  1BLF A;  4FE8 A;  3ILT B;  3FV1 A;  4YU0 A;  4ELQ A;  5L9S A;  3R6U A;  1IEJ A;  4FIM A;  3TCF A;  3PPR A;  2NWJ A;  3RTW B;  4JXI A;  1I6Q A;  3E13 X;  3H06 B;  4RK2 A;  3H4Z A;  2XXQ A;  5DVI A;  2XXW A;  3TAJ A;  3EPE A;  5L9M A;  3O66 A;  4R2F A;  4F1Y A;  1TFA A;  4I8C A;  3O6G A;  2DWI A;  3G3J A;  2ZXT A;  3O6I A;  2B3B A;  1OVB A;  2RF1 A;  5TPA A;  3K1N A;  2O68 A;  2QS4 A;  3QIM A;  4KD5 A;  1YCJ A;  5B70 A;  2D21 A;  3MP8 A;  3OO8 A;  4XKR A;  1B9J A;  1N04 A;  1MXV A;  2O51 A;  4FEC A;  3SES A;  4C0R A;  4U23 A;  4OES A;  1VE4 A;  1EU8 A;  1OMP A;  4P0I A;  4EQB A;  2I0B A;  4F3B A;  1PB9 A;  2ZNS A;  1SBP A;  4QFO A;  4EQ7 A;  1LCF A;  4Q0C A;  3MJN A;  3OO7 A;  3K2D A;  3PPO A;  1QUI A;  1JW5 A;  4QFL A;  3TCH A;  4OHN A;  1IXI A;  3USD A;  3K6U A;  4G68 C;  4F29 A;  4IGR A;  4OEV A;  3UA8 A;  4I1D A;  4UAC A;  1Y20 A;  1UIV A;  2B65 A;  2H98 A;  3SEW A;  1SW2 A;  4ELR A;  3UIF A;  5EHS A;  3IO6 A;  3V8X B;  3JYR A;  1CB6 A;  2R71 A;  3FXR A;  2UVG A;  1B58 A;  2O7I A;  5I2N A;  1Z7M E;  4OET A;  1ZTY A;  4F18 A;  3FJ7 A;  4NF8 B;  3V89 B;  4YB5 A;  1D9V A;  4GOT A;  5H8H B;  3TQW A;  3MVW A;  3V5A A;  1DMB A;  3ECR A;  4ELP A;  2F7B A;  2UVI A;  1UTB B;  4KI0 E;  3CG1 A;  2UXA A;  2QS2 A;  5I57 A;  1LFI A;  2HZL A;  1XHY A;  4MLV A;  4DE8 A;  1SYH A;  4EDP A;  2RC9 A;  5M2V A;  4H8I A;  2PBW A;  3VVE A;  1MM7 A;  3FJM A;  2PX1 A;  4O3B A;  4DXU A;  1FW0 A;  5H8N B;  1JW1 A;  2O69 A;  4QFN A;  1Y3N A;  1ZIU A;  1FQB A;  1S50 A;  4G68 B;  3HST A;  3E3K A;  2F78 A;  3W15 C;  4AQ4 A;  3D4C A;  1M5D A;  4OTE A;  3OSQ A;  4RJZ A;  4KYD A;  3S9N C;  3FUZ A;  1H44 A;  2P1S A;  3IK6 B;  5DT6 A;  5I2K B;  1WOD A;  1SYI A;  3K00 A;  2XXV A;  4OFL A;  3T66 A;  3MVZ A;  1P99 A;  2QSX A;  4LA9 A;  5LOM A;  2Q2C A;  3KSJ A;  1FQD A;  4ZEK A;  2ONK E;  4BDL A;  2UVH A;  3MPK A;  1MQG A;  1IZ1 A;  1MY3 A;  1I6B A;  1B7U A;  1SW4 A;  3OEL A;  2P2A A;  5H8N A;  3O6H A;  2V84 A;  5AA1 A;  4G68 A;  4R6K A;  2XD2 A;  1NH8 A;  5ICT A;  5JEI A;  3IB2 A;  2F6P A;  4KYS A;  5JTY B;  1MPD A;  4FED A;  3VVF A;  1FTK A;  2DXR A;  5H8S A;  4JWO A;  1N7X A;  3OOA A;  2DQV A;  5I2K A;  1MM6 A;  3OXN A;  1ATG A;  3OMB A;  3SET A;  1JNF A;  3EHT A;  1RYX A;  1A55 A;  1FTO A;  3K0V A;  4LON B;  4QSE A;  2XXU A;  2DVZ A;  2F6G A;  3FVN A;  4H1X A;  2H4I A;  1NNK A;  4NWC A;  1IUD A;  2HAU A;  3MZB A;  3MPL A;  3QUF A;  4G4P A;  1A40 A;  1B1X A;  3TZA A;  2H9B A;  2G29 A;  1H43 A;  4KYE A;  1Y1Z A;  4IO4 A;  1IXC A;  5JTY A;  3QXM A;  3HHG A;  1SI1 A;  3CSG A;  4BLA A;  1PDA A;  1DTG A;  2OZZ A;  5FHO A;  1TXF A;  5CBR A;  3K6W A;  2Y7P A;  3HV1 A;  5K2X A;  4DCX A;  4BDO A;  1JEU A;  1TT1 A;  1P1U A;  5J1D A;  5I84 A;  4JB7 A;  2DE3 A;  1LAG E;  4MFI A;  3C34 A;  1QVS A;  4HCY A;  3MUQ A;  2H25 A;  4YKJ A;  4FAJ A;  3RN8 A;  4IGT A;  1GR2 A;  4PE5 B;  1Y3Q A;  4N13 A;  4KR5 A;  3PGF A;  1JEV A;  1I6A A;  5AA4 B;  3KN7 A;  4GF8 A;  1WVJ A;  4GL0 A;  2V25 A;  4YKI A;  3ILU B;  3M3F A;  4OVJ A;  1RYO A;  2DVC A;  2Q2A A;  3RT6 B;  2FYI A;  3TMG A;  3O9P A;  3OEM A;  2DE4 A;  1QKB A;  4WEP A;  3SER A;  4U4S A;  4OEN A;  3VFJ A;  3AXF A;  3FZV A;  2QJE A;  4X1D A;  3G3I A;  3K1M A;  3L6H A;  2V93 A;  1LB8 A;  4N07 A;  4EQ9 A;  1POY 1;  1D9Y A;  2ZMB A;  2ZYK A;  4GL8 A;  3FD3 A;  1NNF A;  4O3C A;  2XX8 A;  3VXB A;  2B3F A;  3LBS A;  3VE1 B;  1FQF A;  4GQO A;  2F35 A;  3C9H A;  4IB2 A;  3PPP A;  4OQO A;  5CMM A;  2V3Q A;  5AA4 A;  1B3L A;  1R1N A;  1PB7 A;  2RIN A;  1MY2 A;  1EZ9 A;  1LBB A;  1ELJ A;  2HQ0 A;  4KPT A;  4IO7 A;  4TLL B;  3RY3 A;  2DWH A;  4QF9 A;  3VLU A;  5TP9 B;  1AH5 A;  2PT1 A;  1B5I A;  5KCJ B;  3KBR A;  4Q8R A;  1URD A;  3Q29 A;  3B7D A;  1AOV A;  4F31 B;  4DCY A;  3RNN A;  3KJ7 A;  4DLD A;  4MLQ A;  2I6E A;  4JWY A;  1TWY A;  5TPA B;  3LC8 A;  2HZK A;  2ONR A;  4YKP A;  3K02 A;  5CMC A;  2XX9 A;  2GH9 A;  2Q9T A;  2X7Q A;  1O64 A;  3DLN A;  2Y7R A;  3S4U A;  3UOR A;  3FXU A;  5DVF A;  3K1P A;  1VFE A;  4NF6 B;  3VVD A;  1B3G A;  1NKX A;  3C31 A;  4H65 A;  1MXY A;  1SW1 A;  2I3W A;  4GXS B;  5TP9 A;  4N6P A;  1P1W A;  1B0H A;  4G8N A;  1I69 A;  3RPW A;  4HS7 A;  5L8D A;  5KCJ A;  3FXQ A;  4ZEF A;  3LUY A;  1Y4T A;  3F11 A;  2XD3 A;  1FQE A;  1B4Z A;  2O84 X;  2I49 A;  4K3F A;  3LSW A;  4X9T A;  4F1V A;  2YJP A;  3DP8 A;  4XKQ A;  2GHA A;  1B5J A;  3CSB A;  1ANF A;  4NTL A;  1B3E A;  3ONM A;  2QMW A;  5I2N B;  1B4H A;  1XVX A;  1NNT A;  3H3G A;  3N26 A;  5KDT B;  5L9O A;  1Y9U A;  1TFD A;  4NED A;  2F7C A;  4NF6 A;  1N0T A;  3M3L A;  3KOS A;  4QFP A;  4R6H A;  4HCW A;  1ZMG A;  2RCB A;  5I57 B;  4G77 A;  2Z8E A;  3RQT A;  3CFX A;  4F3P A;  2HXW A;  2REJ A;  1SI0 A;  4XIG Q;  1T0K A;  1SVX B;  5ICQ A;  1VFD A;  2YPN A;  4QHQ A;  1UTH B;  3OO6 A;  4IO2 A;  1MG1 A;  3G3H A;  4ESW A;  4GVO A;  2I4C A;  3FAS A;  3C32 A;  4ZZA A;  1YTV A;  2CZL A;  4DXB A;  1M5C A;  4JSD A;  4IO6 A;  3R7X A;  3TTL A;  2P0S A;  4F19 A;  2HFB A;  3ODB A;  3DP4 A;  4RA1 A;  1OLA A;  3H6W A;  4GD5 A;  4OFJ A;  3EN3 A;  1YPN A;  3PV0 E;  5KDT A;  2CMO A;  4GLI A;  3CFL A;  3IX1 A;  4WED A;  5I56 B;  3PUW E;  3PMV A;  3PUZ E;  4NF5 B;  1O7T A;  3WAE A;  2ABH A;  4H67 A;  1Q35 A;  3Q26 A;  2ANJ A;  2Z23 A;  1EZP A;  5JK4 A;  1HSL A;  4ZEB A;  3SEU A;  1OIB A;  3MC2 A;  4ZED A;  1A8E A;  1PB8 A;  1NH7 A;  3DP6 A;  1JW4 A;  1UTH A;  4JSO A;  3T9V A;  4KCC A;  3IL1 B;  5AA2 B;  4YAH X;  3CRB A;  1R6Z A;  2QS3 A;  5KZT A;  3WAF A;  3TTM A;  3GBB A;  3N6T A;  3PD9 A;  5DVJ A;  1MXU A;  4GFR A;  1LFH A;  3FV2 A;  1FTM A;  3VLV A;  4EF1 A;  5F7V A;  4LVQ A;  2QS1 A;  4AB5 A;  4OER A;  3U72 A;  1XC1 A;  3GLB A;  3Q25 A;  1MH3 A;  1B05 A;  5I56 A;  4NF5 A;  5AA2 D;  2XXT A;  4JWX A;  2QMX A;  4WKM A;  2RC8 A;  1USY H;  1II5 A;  4G8M A;  3IO4 A;  1SDX A;  4FEB A;  3ZKL A;  3MP6 A;  3TKD A;  5AA2 A;  1UQW A;  2DSF A;  1ZBM A;  3W9V A;  4L17 A;  2X26 A;  2Y7W A;  2Q8J A;  3S2V A;  2HAV A;  3G3F A;  4H5F A;  3LSL A;  2V3U A;  1AIV A;  5A5X B;  1MQD A;  3O2A A;  1LLS A;  2NUV A;  4P11 A;  3TOD A;  3JZJ A;  4MH5 A;  1Y1M A;  4KQP A;  2OK2 A;  4MBP A;  1URG A;  3KFM A;  2RKM A;  3RT8 A;  4U4X A;  2NVU B;  1PC3 A;  3MVX A;  1MQH A;  3U94 A;  3B6W A;  3ZS6 A;  3MVY A;  3VXC A;  4RPN A;  5DEX B;  3C4M A;  5H8F B;  3TQL A;  2DP8 A;  3IB1 A;  1URS A;  3TTK A;  1F9B A;  4OFO A;  3JV9 A;  4OMB A;  4OZ9 A;  1MDQ A;  3O29 A;  2XXY A;  1DPE A;  4DIG A;  3T9X B;  1Q1K A;  2O1M A;  4NWD A;  3T93 B;  3PUY E;  4F22 A;  2VGQ A;  2AL4 A;  4MF3 A;  4FJP A;  1D3K A;  3MZ9 A;  5HPQ A;  1H3D A;  3KSX A;  5A5X A;  1FQC A;  1BKA A;  1NFT A;  4F1U A;  4RNS A;  1N84 A;  5B7D A;  1B1H A;  4F39 A;  2IA4 A;  1B32 A;  2PT2 A;  1B46 A;  1FTJ A;  2OBG A;  3U92 A;  2Z8F A;  2XXI A;  4TQU Q;  3VDF A;  1DTZ A;  2THI A;  5DEX A;  5H8F A;  1VSO A;  1IIT A;  3Q28 A;  3H6T A;  2F8D A;  4XKP A;  3TFL A;  4ND9 A;  2M8C A;  3OEN A;  4HW8 A;  3C36 A;  3K6X A;  1MY1 A;  3HN0 A;  3THI A;  2OWS A;  3S9M C;  4QFK A;  3IR1 A;  2ZYO A;  3L6G A;  5DTB A;  2ZYN A;  4F2O A;  2LAO A;  2HCA A;  1SQY A;  1B7H A;  1WDN A;  3GZG A;  3MQ9 A;  1MXW A;  3UK4 A;  1HSJ A;  4UA8 A;  3QYT A;  2YLN A;  1FTL A;  4M4G A;  1P1O A;  4ISU A;  1FQA A;  4KCD A;  3I3V A;  4M1V A;  3QAX A;  3CFZ A;  2V3T A;  5FHN A;  3CIJ A;  4NMY A;  1QJM A;  4R9G A;  2F7A A;  3BFT A;  4GWO A;  3MWB A;  4ZEC A;  1QUL A;  4ESX A;  3IOT A;  4LAT A;  4PET A;  3RTF B;  1NMU A;  3W9W A;  1Y3P A;  4XKN A;  1LBC A;  4G8H A;  3UP9 A;  2F97 A;  4QSD A;  4U21 A;  3KJT A;  1M5E A;  1R9L A;  4R72 A;  4YKK A;  1KWH A;  4RY1 A;  1N76 A;  4PFU A;  2F5X A;  2PYY A;  3G7W A;  1SD3 A;  3IB0 A;  4F2Q A;  3KGC A;  3H6U A;  1MQI A;  4LZ8 A;  4GXA A;  4ZDM A;  3IAZ A;  2DXY A;  3Q27 A;  3VLW A;  4NE4 A;  4LZ7 A;  3U1O A;  4U2R A;  4X1B A;  3RGY A;  1BP5 A;  4RYA A;  2VHA A;  1GGG A;  1VR5 A;  4IY5 A;  1MDP 1;  2XXP A;  2OCU A;  3A3U A;  3IJO B;  5I58 B;  5EHM A;  1MXZ A;  1B5H A;  2QPQ A;  4DDD A;  3N6U A;  3PPN A;  4OXV A;  1NNP A;  4QSC A;  1OQH A;  4BDQ A;  2Y7K A;  2DS9 A;  4H8J A;  3BBR A;  3U93 A;  2Z22 A;  4H6D A;  3IOV A;  3QSL A;  5F1Q A;  3QUJ A;  3EF7 A;  1ZJL A;  3KEI A;  3EHU A;  4FOR A;  4GRK A;  4YB7 A;  1L5T A;  4R9F A;  1S9T A;  4QRZ A;  3PPQ A;  1OVT A;  3ZSF A;  1PEB A;  4TLM B;  4ZS9 A;  1B3H A;  2I4B A;  2OLB A;  4POW A;  3G3K A;  1LCT A;  1MXX A;  3TCG A;  3H03 A;  3SEX A;  3VV5 A;  4I9D A;  3EHS A;  2O6A A;  2Y7I A;  2DWA A;  4OWD A;  1H76 A;  4I62 A;  3SKP A;  5I58 A;  2X7P A;  3M3K A;  1EZO A;  3K01 A;  4RXL A;  1JET A;  4YIC A;  2GHB A;  3PD8 A;  3B6Q A;  3SEV A;  4PQJ A;  4H5G A;  1PBP A;  4ELO A;  1US5 A;  2D3I A;  3FVG A;  2VD2 A;  2A5S A;  4IO5 A;  2AYS A;  2XXH A;  4XTC Q;  5BWJ A;  2XHD A;  2Q88 A;  2BJJ X;  3N5L A;  3TEP A;  1ZU0 A;  3UGW A;  1S7Y A;  3T9H B;  1B51 A;  3T9U A;  1QUJ A;  1BIY A;  4POX A;  5CMK A;  3T96 B;  1LGB C;  3V83 A;  3LSX A;  3PU5 A;  2AL5 A;  4ONY A;  2R6G E;  4LP2 B;  4YMB A;  3TTN A;  1MQJ A;  4BDN A;  1A99 A;  1NL5 A;  5CBS A;  4LQ5 A;  4YMA A;  3G3G A;  2O1L A;  1BTJ A;  1MRP A;  2ALU A;  3TPA A;  4LUB A;  3HPI A;  3FIR A;  2QRY A;  3IOR A;  5EYF A;  3FVO A;  1B2H A;  4X48 A;  1GTK A;  1LAX A;  5AE4 A;  3TTR A;  1RKM A;  1MY4 A;  4DXC A;  3MZ1 A;  2ESN A;  2PMS A;  5I59 B;  3OO9 A;  4NF4 B;  3CR9 A;  5TU0 A;  2A5T B;  3A3C A;  1QKA A;  1OLC A;  2OJT A;  4F3S A;  3C35 A;  4U1O A;  1CE2 A;  4Q30 B;  3I6V A;  5IAI A;  2DE2 A;  3C33 A;  1FCK A;  2AIX A;  3KZG A;  1YAE A;  1R9Q A;  3E4R A;  3IOU A;  2ONS A;  3GBA A;  5ITP A;  3R26 A;  3PMW A;  1XT8 A;  1LST A;  1O63 A;  3S9L C;  1PBQ A;  3FAT A;  1N3X A;  5CM6 A;  3H6V A;  4GIZ A;  5CI5 A;  2QL3 A;  2REG A;  2H5Y A;  5H8Q B;  1JVX A;  4EF2 A;  5BUU A;  1M5F A;  3KG2 A;  1DPP A;  2KLF A;  5ELV A;  5CC2 A;  1B40 A;  2NXO A;  2H99 A;  2E0S A;  5I59 A;  4O3A A;  1MPC A;  4EUO A;  4NF4 A;  4NF8 A;  1JQF A;  2A5T A;  5H8H A;  4LZ5 A;  3K6V A;  1H45 A;  1P1N A;  4BDM A;  4IY6 A;  4KFQ A;  3MBP A;  3KN8 A;  2VOZ A;  2VD3 A;  5ITO A;  1UTB A;  1MY0 A;  1JVY A;  3PUV E;  3PMX A;  4BDR A;  2I3V A;  4OYV A;  2I0C A;  4DZ1 A;  2W7Y A;  3PUX E;  4R75 A;  1J1N A;  1ZLQ A;  3K4U A;  4RK9 A;  5CRY A;  1GVC A;  2D5W A;  1LAF E;  1ZKB A;  2DWJ A;  5AA3 A;  5ISU A;  5H8Q A;  1DSN A;  5HBC A;  1AMF A;  2IEE A;  2XXR A;  2O7U A;  4IO3 A;  1IXH A;  4E0X A;  5IKB A;  1XOC A;  2Q89 A;  3RLF E;  5K2Y A;  1B6H A;  1IIW A;  2I48 A;  3HO7 A;  2UYE A;  1OQG A;  3IOW A;  1B7Z A;  2F36 A;  4R6Y A;  4HTG A;  4PFT A;  3A09 A;  3RUM A;  1AL3 A;  3FGS A;  2GFE A;  3LR1 A;  3O97 A;  1M5B A;  3T22 A;  1LFG A;  1IQ7 A;  2RC7 A;  3KN3 A;  2DOJ A;  3UN6 A;  5FTI A;  1US4 A;  1D4N A;  4PFY A;  3SDF A;  3P7I A;  4YB6 A;  1QUK A;  4ZE8 A;  4EXL A;  2F34 A;  4ZEI A;  1B0L A;  4LQ2 A;  2E1S A;  4P0G A;  4PP0 A;  5FHM A;  2ZNU A;  1Y4C A;  4XXU A;  4JDF A;  1SW5 A;  4E0W A;  4WXJ A;  1MH4 A;  3E9X A;  1MPB A;  3QK6 A;  3EQ1 A;  1DOT A;  2ZNT A;  2HEU A;  5CMB A;  5DYH A;  3LSF B;  2XX7 A;  1P1Q A;  2I58 A;  1B52 A;  2FA7 A;  3S9E A;  1IXG A;  3I5O A;  1XVY A;  4R73 A;  4PFW A;  4Z7E A;  3KOT A;  3U8Q A;  3HCQ A;  4U22 A;  3TUS A;  3SEY A;  1A54 A;  2VP1 A;  4RPO A;  3CG3 A;  3TYH A;  2GRV A;  4H0W A;  1XS5 A;  3O28 A;  5FTH A;  4THI A;  2WKY A;  4C1U A;  3OD7 A;  2UVJ A;  3MP1 A;  4AB6 A;  2FNC A;  4FAT A;  3OSR A;  4OEU A;  3OEK A;  3H7M A;  3TEL A;  4C1T A;  3IJX B;  4R74 A;  3FVK A;  3M8U A;  2ZYM A;  3FJG A;  1Z7N E;  1USY E;  2UYF A;  3GXA A;  4Q5T A;  4R2B A;  3DM0 A;  4ZZE A;  4ECF A;  4YZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...