5H8QB

Structure of the human glun1/glun2a lbd in complex with gne8324
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
284
structure length
281
Chain Sequence
TRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Glutamate receptor ionotropic, NMDA 2A,Glutamate receptor io
publication title Positive Allosteric Modulators of GluN2A-Containing NMDARs with Distinct Modes of Action and Impacts on Circuit Function.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 281
sequence length 284
ec nomenclature
pdb deposition date 2015-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5h8qB01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5h8qB02
2ONRA 4IY5A 3S4UA 5H8QA 1RKMA 4JWXA 5FHNA 5H8NB 3EHUA 4OXVA 1NNPA 2GH9A 2R71A 4NTLA 4Q30B 1AIVA 1LB9A 3SKPA 4M1VA 3DM0A 1M5EA 3JZJA 1JW1A 1MDP1 5I2NB 1XHYA 5IAIA 3TTNA 3OENA 3SEVA 2Q9TA 3C4MA 1LAHE 4GD5A 3M3FA 4OQOA 4YB6A 3HHGA 3RN8A 3Q27A 3FGSA 4Q0CA 2HZKA 3VLWA 3EF7A 3EHTA 2I4CA 3IOUA 2Z22A 2RF1A 2UXAA 4EUOA 3C32A 3UIFA 1B5IA 4E0WA 3MPLA 1URSA 1KWHA 3BKIB 2XXHA 3H6TA 4DLDA 3F11A 1AMFA 1RYOA 3HO7A 4FE8A 3PPQA 1NNTA 5JEIA 1ANFA 5CMBA 3OSQA 1H44A 3T9VA 2G29A 1MQDA 1EZPA 5I58B 1NKXA 1B5HA 1WVJA 3EPEA 1POTA 3CVGA 3WAEA 1UIUA 3OO7A 4AB6A 5JTYA 3IAZA 4G8MA 2Q89A 3PPRA 4RJZA 1SDXA 4NF6B 5AA2B 2A5SA 5IKBA 3VLUA 5TU0A 1QJMA 2P2AA 5FTIA 4EXLA 1MH3A 4KPTA 4I8CA 3V83A 1Z7NE 3FVNA 1TFAA 4I62A 5KDTA 2B3BA 1LAFE 3ZKKA 2X26A 3SESA 2DP8A 5ICTA 4EQ9A 1S9TA 3RY3A 4GVOA 4FAJA 1A55A 1EH3A 1SYIA 5JK4A 2VHAA 4HS7A 1YCJA 4R72A 1IXCA 1M5BA 3K1PA 3CRBA 4F2QA 1Y20A 3LBSA 1D3KA 2I3WA 2ABHA 5L8DA 1ZTYA 1SW5A 4LATA 1FQBA 2QS3A 2NUVA 4ZEKA 3KSXA 3O9PA 4YICA 5H8FB 4G2ZA 4OEVA 3C34A 4H65A 4TOZA 1SBPA 4ZE8A 2F35A 3MUQA 3PV0E 4RK2A 2ZYOA 3OEMA 4EDPA 3DELB 4GRKA 3PPPA 5TP9A 5ELVA 3ECRA 4DZ1A 3FVOA 5KCJA 2AIXA 1SW4A 4WEDA 1A54A 1XVYA 3PUVE 3T9HB 2ZYMA 4F22A 3FXQA 1DPPA 2H25A 2VD3A 2XXPA 3MC2A 5FHMA 3GLBA 5FTHA 1TXFA 5I2KB 3IORA 3U1OA 3TDJA 4E0XA 3N26A 3S9LC 4RPNA 1IUDA 2Y7WA 3IJOB 3T9XB 4MLQA 4R73A 1IQ7A 2RINA 3MW0A 1YTVA 2Z8EA 2XD3A 3RTFB 3O97A 1USYH 3N94A 3FJMA 4JSOA 4BDQA 2H4IA 4OMBA 3U93A 1B0LA 1Q1KA 3G7WA 3DP8A 4KHZE 2XXTA 3EQ1A 1UQWA 3TQLA 4IO4A 4X48A 3TZAA 2F34A 4MF3A 4ELRA 3HHFA 5H8NA 3QAXA 1MY4A 5CMCA 2XXRA 1B3FA 3S9NC 1RYXA 3K01A 5I59B 4QFKA 3OO9A 1XVXA 3V5AA 5KDTB 4O3BA 3R26A 3N6TA 1ZLQA 4XTCQ 2PT2A 1QKAA 1LGBC 2F7AA 2XD2A 2XX9A 2ZYNA 3OSRA 3TAJA 3TCGA 1R1NA 1PBQA 4KYDA 1POY1 3KZGA 4GOTA 2UYEA 4DXCA 4GFRA 3KEIA 1XC1A 1ZIUA 4G68C 2VGQA 1MQJA 4EF1A 2QMWA 3KJTA 3PPNA 3O6GA 3DLNA 1H45A 3LUYA 1OLAA 4WKMA 2I49A 1Y1ZA 3FASA 3T66A 4PFTA 4OFJA 2I0CA 1L5TA 3FJGA 4KCCA 2DXRA 3VDFA 1PB7A 2I6EA 4U21A 5I58A 4R6HA 5FHOA 4U4SA 3IK6B 4H5GA 4OVJA 3KOTA 1BIYA 4ZE9A 3TTKA 4OWDA 5AE4A 2VOZA 1LFHA 4RPOA 4NF6A 5AA2A 2XXXA 4IGTA 5L9OA 3RT6B 3C36A 1FQDA 3K6XA 2QS1A 1M5FA 1MY2A 4ECFA 1AL3A 3OELA 1N04A 3MVZA 4LUBA 2VP1A 4NE4A 2P1SA 4BDOA 1QW0A 2RC8A 4R75A 1LBBA 1MRPA 3QYTA 3RNNA 4BDRA 2OCUA 1A40A 4Z7EA 1MY0A 3TMGA 4QF9A 1LCFA 3K1MA 1EZ9A 3JYRA 2DYXA 2Q8JA 4F3GA 1O7TA 2E0SA 1MXYA 2M8CA 2I58A 4F39A 1TT1A 2F78A 1FQFA 1MPCA 1P1QA 4F3BA 1LCTA 1IXGA 2PX1A 1B3LA 1A8FA 5F7VA 4POXA 3KBRA 5H8FA 5EHMA 1P1WA 2RCAA 4DXUA 4I1DA 5F1QA 3ODBA 1B7HA 3QK6A 2OBGA 4ZDMA 1N7XA 2PBWA 2D5WA 4YKIA 3L6HA 4KI0E 3VXBA 2UVGA 4QFOA 1II5A 2GHAA 3GZGA 4NF8B 4R6YA 2DSFA 3EN3A 2R6GE 3VLVA 3T93B 2GFEA 4PETA 2RKMA 3K2DA 4OEUA 2DE4A 4GLIA 5B70A 5DEXA 3RTWB 1B1HA 3W15C 1HSJA 4XIGQ 1N0TA 3LSFB 5L9SA 5AA2D 2Y7IA 1S7YA 1DPEA 4PFYA 2Q2CA 3E9XA 3RQTA 1T0KA 2YPNA 3KN7A 4N07A 3U72A 1B6HA 1N76A 4BDNA 4OESA 5ITPA 2E1SA 5I2KA 1LFGA 1NMUA 2H99A 4ZEBA 1P1NA 3G3HA 3QIMA 1DSNA 1A7LA 4G8NA 1R6ZA 2V93A 4GL8A 5EHSA 3VVEA 1B51A 3G3JA 3IJXB 5M2VA 4F3PA 3UP9A 3H6WA 5DVIA 1F9BA 3R6UA 1MXVA 3Q26A 1B9JA 3M3LA 1GV8A 3IB1A 2DWIA 5CBRA 1QULA 2Y84A 1UTHB 3FIRA 2F8DA 2PVUA 4TQUQ 1QKBA 3E4RA 3EHSA 2Q88A 4ZZAA 3B7DA 2V25A 5I84A 1BKAA 4ESXA 4F1UA 1MPDA 2BJJX 1Y4CA 3RGYA 1MQHA 4KYSA 5CMKA 4GIZA 3C31A 1OIBA 4DXBA 4NMYA 3O2AA 2HAVA 5I59A 4X1DA 2XXUA 3H6VA 2V3UA 5DVFA 3B6QA 3MZBA 2DXYA 2ZNSA 4H1XA 1ZJLA 4RXLA 4XKRA 1US4A 1OQGA 1CB6A 3KFMA 3GXAA 3RLFE 3UN6A 1JNFA 2UVJA 1FTMA 2CMOA 4QHQA 1OMPA 3MP8A 3M3KA 4OTEA 2ZXTA 2UVHA 2B65A 3N5LA 2NXOA 4F29A 3DP4A 4H0WA 4OYVA 3FXRA 1N3XA 1FQCA 3FV2A 1URDA 1B3EA 3QUFA 3A3UA 2O7UA 1Y3PA 1QUIA 3G3IA 5DTBA 4LZ5A 5I57B 3TTRA 3K6VA 4DCXA 4JXIA 3IR1A 5HBCA 5DEXB 1FTKA 4GQOA 3MBPA 3UA8A 1LFIA 1OVTA 4R6KA 2AL4A 4FIMA 2P0SA 4OETA 1DTZA 4PP0A 2FYIA 4JBZA 3BFTA 2IEEA 2XX7A 3ZS6A 5AA4B 4ND9A 3OO8A 3MP6A 1ZKBA 3TTMA 5DT6A 1Y3QA 4IO3A 2QS4A 1B4HA 2V3TA 3LSWA 3O29A 2DWJA 1XOCA 1B32A 3MZ9A 2Z23A 4MH5A 5AA1A 2O6AA 1B0HA 4ELQA 4G68B 3HSTA 3MVXA 2I4BA 2ANJA 4KYEA 5BUUA 3FV1A 4MLVA 3IO6A 4YB5A 4FEBA 3O6HA 2ALUA 1NH8A 3LC8A 1SI1A 3MJNA 1HSEA 3IOVA 2ESNA 1TWYA 1B4ZA 4LP2B 4U1ZA 4HTGA 4FORA 3Q29A 3LSXA 3W9WA 1US5A 1IITA 1VFDA 1MPBA 2PT1A 3PUWE 4NF8A 3IOTA 1B7ZA 1IXHA 2ONKE 3P7IA 1SVXB 5ICQA 2I48A 1MY1A 4QFPA 3IO4A 2F6GA 5CM6A 1H3DA 3MAMA 1PC3A 4OHNA 2Z8DA 4U23A 4YAHX 3IOWA 3O6IA 2FNCA 3IX1A 1JVYA 3FVKA 2H5YA 5DVJA 3SEXA 1JVXA 4IB2A 2QRYA 4BDLA 5TPAA 2DWHA 1B3GA 3L6GA 3I3VA 4U4XA 4IO6A 3TTLA 4KCDA 4H6DA 5H8HB 1VE4A 1I6AA 3TFLA 3ONMA 3E3KA 4PQJA 3QXMA 3UGWA 4JWYA 1FW0A 1BTJA 1MG1A 5LOMA 3V89B 3VXCA 4G8HA 3H3GA 4NF4B 4FJPA 5KZTA 5ITOA 1DOTA 1Y1MA 1UTHA 1IZ1A 2HFBA 3TCFA 2KLFA 1B7UA 3CG1A 3K6UA 4RY1A 4P0IA 2UVIA 1I6QA 4YB7A 1MXZA 2H9BA 3HN0A 1NL5A 1D4NA 4X9TA 4LQ5A 4LZ8A 1B2HA 2V3QA 1CE2A 4N13A 1UTBB 4U1OA 3VVDA 4G77A 2W7YA 4XKQA 1OVBA 1N3WA 1GGGA 3MZ1A 4LZ7A 4F1YA 3KN8A 3VVFA 4F31B 2FA7A 4O3AA 4XKPA 3CR9A 4ISUA 1VSOA 3D4CA 1LAGE 2HEUA 1MXWA 4F3SA 1NFTA 4H8IA 3S9EA 1AOVA 2F36A 2OZZA 1S50A 3S2VA 3OEKA 3FD3A 3G3FA 5EYFA 1JETA 3HCQA 5I56B 1B05A 1PB8A 2F7CA 2REGA 2DE2A 1LB8A 5CBSA 4FECA 2HXWA 2OLBA 2DE3A 1MM6A 4JDFA 2HCAA 2ONSA 1SQYA 4C1TA 1ZBMA 2WKYA 1JEUA 4OFOA 2DWAA 3IB2A 4NF5A 3M8UA 1ATGA 2ZNUA 5I57A 4F18A 1A8EA 4EF2A 3FVGA 1XT8A 2Y7RA 4QRZA 3O66A 4EQBA 4NEDA 3MVWA 3KG2A 3RPWA 3SEWA 2QS2A 4Q8RA 5K2YA 5CI5A 5A5XA 3BFUA 3PMXA 2DOJA 4GWOA 1O64A 1FQAA 1IXIA 2F7BA 4I9DA 3QSLA 3VV5A 4L17A 1GTKA 1JW5A 2DVCA 2O68A 3T9UA 1LAXA 1LLSA 3TUSA 1Y9UA 2F97A 1PDAA 2F5XA 4IGRA 3TODA 3WAFA 2LAOA 5AA4A 3Q28A 4HCWA 1A99A 5TPAB 2XXVA 2PMSA 2HZLA 1DMBA 4OZ9A 1H43A 4WEPA 3PUXE 1GR2A 1HSLA 1P1OA 1P99A 1SW2A 3CSGA 1EU8A 1J1NA 4ZEIA 4POWA 4G68A 2X7QA 4DIGA 4R2FA 3CFXA 4UACA 4C1UA 1B58A 3A09A 4IO2A 3LR1A 3KSJA 1ELJA 1Z7ME 4BDMA 3DP6A 3G3KA 3OD7A 3PU5A 2I3VA 3T96B 2UYFA 3H06B 4QSDA 4ZEFA 3SDFA 2XHDA 3KOSA 2RC7A 2ZMBA 1N7WA 3OMBA 4ELOA 3TYHA 3MP1A 4YMAA 1URGA 4HCYA 2ZNTA 2QSXA 1NH7A 1MXUA 2Y7PA 1XS5A 5J1DA 3OXNA 1MXXA 4THIA 3PGFA 1JEVA 5DYHA 3PD8A 3MQ9A 2O1LA 1SYHA 3KJ7A 2OWTA 3RT8A 1PEBA 3HPIA 2I0BA 5HM4B 1Y4TA 3C35A 4U22A 2D21A 5CRYA 2DVZA 2O1MA 4RK9A 2QPQA 4R2BA 2B3FA 1B3HA 3OOAA 3I6VA 2QL3A 3CSBA 1MS7A 4LVQA 1B46A 2A5TA 1FTOA 3D4GA 3HV1A 5ISUA 3LSLA 2AL5A 3K4UA 1N84A 2V84A 1IIWA 3U8QA 3FXUA 5H8HA 1MQGA 2O51A 4NF5B 4O3CA 3U94A 4R9GA 3TCHA 3OO6A 5H8QB 4FATA 4PE5B 3CFZA 3K6WA 2NWJA 4NF4A 1NNKA 5CMMA 3TQWA 5A5XB 4YZZA 1BLFA 4DE8A 4YU0A 2NVUB 4OERA 3AXFA 3V8XB 4QSEA 4LA9A 4H5FA 4X1BA 3TELA 3E13X 1WODA 4P11A 5BWJA 4LQ2A 3B6TA 4MBPA 1UTBA 4TLMB 3C9HA 3CG3A 1TFDA 3O28A 2IA4A 3GBBA 1FQEA 4AB5A 4AQ4A 2X7PA 4UA8A 4F2OA 4EXKA 2Y7KA 4WXJA 3PPOA 4U2RA 1QUJA 4M4GA 2OK2A 3VE1B 3R7XA 2THIA 1M5CA 4BLAA 3H03A 1MM7A 2OJTA 4FEDA 5HPQA 1I69A 3SETA 2HAUA 2YJPA 3PMWA 2O7IA 4QFLA 3S9MC 1H76A 4C0RA 1P1UA 4N6PA 2O69A 1AH5A 2GHBA 5I56A 4F1VA 2XX8A 4YMBA 4ZZEA 3TPAA 3PUYE 1PBPA 2YLNA 5JTYB 2D3IA 4H67A 1MQIA 1WDNA 3SEUA 1SW1A 1EZOA 1Q35A 1YPNA 1B1XA 3UORA 5B7DA 3TKDA 1QUKA 4MFIA 4LONB 4KFQA 3USDA 3KN3A 1SI0A 2AYSA 1MDQA 4JSDA 4JB7A 3PUZE 4DDDA 3PMVA 2PYYA 4RA1A 1JQFA 4PFWA 3Q25A 1LBCA 5I2NA 2DQVA 5CC2A 1OLCA 4EQ7A 4KR5A 4P0GA 3IB0A 3ZKLA 4GF8A 1I6BA 3K1NA 4TLLB 2XXYA 3QUJA 1FTJA 2DS9A 5L9MA 3RUMA 2A5TB 2REJA 3MVYA 1B5JA 4OFLA 1NNFA 4OENA 4Q5TA 1O63A 2R9JA 3U92A 1B52A 2Z8FA 3JV9A 3IL1B 3H7MA 4XXUA 4NWCA 3SEYA 3H4ZA 4RNSA 3BBRA 2Q2AA 4Z0IA 4YKJA 3C33A 2XXQA 4PFUA 2QJEA 1USYE 1BP5A 4ELPA 3CI8A 5AA3A 3VFJA 2NOOA 3A3CA 4F19A 3FUZA 1VR5A 3THIA 3MWBA 4HW8A 4QSCA 1R9QA 2H98A 4DCYA 2RC9A 5K2XA 3ILTB 4ESWA 1M5DA 5TP9B 4H8JA 3I5OA 4G4PA 5KCJB 2GRVA 3H6UA 1IEJA 3ZSFA 1YAEA 4IO5A 1MH4A 1FCKA 3CIJA 1VFEA 4RYAA 4QFNA 3UK4A 3ILUB 3FATA 1FTLA 1DTGA 4K3FA 1Y3NA 1QVSA 3K00A 3K0VA 4ONYA 4R74A 3K02A 1LSTA 1SD3A 3B6WA 3SERA 3G3GA 3MPKA 4JWOA 3TEPA 4GXAA 4ZECA 4R9FA 3W9VA 2O84X 2ZYKA 2G93A 3T22A 4ZEDA 1ZMGA 3KGCA 1UIVA 4ZS9A 2VD2A 4NWDA 1GVCA 5H8SA 3CFLA 3FZVA 3GBAA 2QMXA 2XXIA 2F6PA 4YKPA 4XKNA 4IY6A 3PD9A 1OQHA 3FJ7A 2XXWA 1MY3A 2HQ0A 4YKKA 1D9YA 2CZLA 2OWSA 1JW4A 1D9VA 4GL0A 4IO7A 1B40A 2RCBA 4KD5A 3N6UA 1ZU0A 1R9LA 4GXSB 4KQPA 1PB9A
chains in the Genus database with same CATH superfamily
2ONRA 4IY5A 3S4UA 5H8QA 1RKMA 4JWXA 5FHNA 1NV5A 5H8NB 3EHUA 4OXVA 1NNPA 4PFIA 2GH9A 2R71A 4NTLA 4Q30B 1AIVA 1LB9A 3SKPA 4M1VA 3DM0A 1M5EA 5EQ8A 3JZJA 1JW1A 1MDP1 5I2NB 1XHYA 4OVTA 2F3BA 5J16A 5IAIA 3TTNA 3OENA 3SEVA 2Q9TA 3C4MA 1LAHE 2V4CA 4GD5A 3M3FA 4P3LA 4OQOA 4YB6A 3HHGA 3RN8A 3Q27A 3FGSA 4Q0CA 2P3NA 2HZKA 1YXIA 3VLWA 3EF7A 3EHTA 2I4CA 3IOUA 2Z22A 1FTAA 2RF1A 2UXAA 4EUOA 3C32A 3UIFA 1B5IA 4E0WA 3MPLA 1URSA 2VT5A 1KWHA 3BKIB 2XXHA 4MX6A 3H6TA 2ZZVA 3D1RA 3KC1A 4OVRA 4DLDA 3F11A 1AMFA 1RYOA 3HO7A 4FE8A 3PPQA 1NNTA 5JEIA 1ANFA 5CMBA 3OSQA 1H44A 3T9VA 2G29A 1MQDA 5LDZA 1EZPA 5I58B 1NKXA 1B5HA 1WVJA 3BIGA 1POTA 1QGXA 3EPEA 3CVGA 3WAEA 1UIUA 3OO7A 4AB6A 5JTYA 3IAZA 4G8MA 2Q89A 3PPRA 2VPOA 4RJZA 1SDXA 4GWSA 1NUZA 4NF6B 5AA2B 2A5SA 5IKBA 3VLUA 5TU0A 4GBVA 1QJMA 4IR8A 2P2AA 5FTIA 4EXLA 1G0IA 1MH3A 4KPTA 4I8CA 5ET8A 3V83A 1Z7NE 3FVNA 4X04A 1TFAA 3KC0A 4I62A 5ET5A 5KDTA 2B3BA 1LAFE 3ZKKA 4G61A 2X26A 3SESA 4DI4B 2DP8A 5ICTA 4EQ9A 1S9TA 1IMBA 3RY3A 4GVOA 4FAJA 1A55A 1EH3A 1SYIA 5ET7A 5JK4A 2VHAA 4HS7A 1YCJA 4GBWA 4R72A 1IXCA 1M5BA 2WYKA 2QVRA 3K1PA 3CRBA 4PBHA 4F2QA 1Y20A 3LBSA 1D3KA 2I3WA 2ABHA 5FBPA 5L8DA 1NV1A 3ISPA 1ZTYA 1SW5A 4LATA 1FQBA 2QS3A 2NUVA 4ZEKA 3KSXA 3O9PA 1Q9DA 4YICA 5H8FB 4G2ZA 4OEVA 4HE0A 3C34A 4H65A 4TOZA 3FBPA 1SBPA 4PBQA 4ZE8A 2F35A 3MUQA 3PV0E 4RK2A 2ZYOA 3OEMA 2KQZA 2L5VA 4EDPA 3DELB 5IM2A 4GRKA 4QXDA 3PPPA 5TP9A 5ELVA 3ECRA 3HFUA 4DZ1A 3FVOA 5KCJA 2AIXA 1SW4A 4PFRA 3SZPA 4WEDA 3QMFA 1XVYA 3PUVE 1FBDA 3T9HB 2ZYMA 4F22A 3FXQA 1DPPA 2H25A 2VD3A 1DBZA 2XXPA 4PGPA 3MC2A 5FHMA 3GLBA 5FTHA 1TXFA 5I2KB 3IORA 3U1OA 4HE2A 3TDJA 4E0XA 3N26A 3S9LC 4RPNA 1IUDA 2Y7WA 3IJOB 3T9XB 4XFEA 4MLQA 4R73A 1IQ7A 2RINA 1NV7A 3MW0A 4P1EA 1YTVA 2Z8EA 2XD3A 3RTFB 3O97A 1USYH 3N94A 4MNPA 2CZIA 4GX6A 2Y5LA 3FJMA 4JSOA 4BDQA 5IGAA 2H4IA 4OMBA 2FIEA 3U93A 1B0LA 1Q1KA 3G7WA 3DP8A 1FPKA 1CNQA 4KHZE 2CZHA 5IZ1A 4HE1A 1RDZA 2XXTA 2XWIA 4P9KA 3EQ1A 2QFLA 1UQWA 3TQLA 4IO4A 4X48A 3TZAA 2F34A 4MF3A 4ELRA 3HHFA 5H8NA 3RYDA 3QAXA 1MY4A 5CMCA 2XXRA 1B3FA 3S9NC 1RYXA 3K01A 5I59B 4QFKA 3E78A 3OO9A 1LBWA 2XWOA 1XVXA 4OVSA 4XEQA 3V5AA 5KDTB 4O3BA 4JVCA 3R26A 3N6TA 1ZLQA 4XTCQ 2PT2A 1QKAA 3MYUA 4P56A 1LGBC 2F7AA 2XD2A 1VDWA 2XX9A 2ZYNA 3OSRA 3TAJA 3TCGA 1R1NA 1PBQA 4KYDA 1POY1 3KZGA 4GOTA 5LTCA 2UYEA 4DXCA 4GFRA 3KEIA 1XC1A 2HXRA 1ZIUA 4G68C 2VGQA 1MQJA 4EF1A 2QMWA 3KJTA 3PPNA 3O6GA 3DLNA 1FBEA 1H45A 3LUYA 1OLAA 4WKMA 2I49A 1Y1ZA 3FASA 1JP4A 3T66A 2XWKA 5EQ9A 4PFTA 4OFJA 2I0CA 3CHGA 1L5TA 3IFAA 3FJGA 4KCCA 2DXRA 3VDFA 1PB7A 2I6EA 4U21A 4I3EA 5I58A 1XI6A 4R6HA 5FHOA 4U4SA 2OX3A 3IK6B 4H5GA 4OVJA 3KOTA 1BIYA 4ZE9A 3TTKA 4OWDA 5AE4A 2VOZA 1LFHA 2WEFA 4MAGA 1D9QA 4RPOA 4NF6A 5AA2A 2XXXA 4IGTA 2BJIA 5L9OA 3RT6B 3C36A 1FQDA 3K6XA 4O7MA 3T0JA 2QS1A 1M5FA 1LEVA 1MY2A 4ECFA 1AL3A 3OELA 1N04A 3MVZA 4LUBA 2VP1A 4NE4A 2P1SA 2WBBA 4BDOA 1EYKA 1QW0A 4AS4A 2KR0A 2RC8A 2WX9A 4R75A 1LBBA 4OANA 1MRPA 3QYTA 3B50A 1IMDA 3RNNA 4BDRA 2QVUA 2OCUA 1A40A 4Z7EA 1MY0A 3TMGA 5I3SA 4QF9A 1LCFA 3K1MA 1EZ9A 3JYRA 2DYXA 2Q8JA 1FJ6A 4F3GA 2CEXA 1O7TA 2P3VA 2E0SA 1MXYA 1NV6A 2M8CA 2I58A 4NGUA 4F39A 1TT1A 2F78A 1FQFA 1MPCA 1P1QA 4F3BA 1LCTA 1IXGA 2PX1A 1B3LA 1A8FA 5F7VA 4POXA 3KBRA 5H8FA 5EHMA 1P1WA 2RCAA 4DXUA 4I1DA 1NV4A 5F1QA 3ODBA 1B7HA 3QK6A 4I40A 2OBGA 4ZDMA 1N7XA 2PBWA 2D5WA 4YKIA 3L6HA 4KI0E 3VXBA 1DK4A 2UVGA 4QFOA 4O7IA 4N8YA 1II5A 2GHAA 3GZGA 4NF8B 4R6YA 1YZ0A 2DSFA 3EN3A 2R6GE 3VLVA 2GFEA 4PETA 2RKMA 3T93B 3K2DA 4OEUA 2DE4A 4GLIA 5B70A 5DEXA 3RTWB 1B1HA 3W15C 1HSJA 4XIGQ 1N0TA 3LSFB 5L9SA 5ET6A 5AA2D 2Y7IA 1S7YA 1DPEA 4PFYA 2Q2CA 3E9XA 3RQTA 1T0KA 2YPNA 3KN7A 4N07A 3U72A 1B6HA 1N76A 4PE3A 4BDNA 4OESA 4O94A 4PF6A 5EQ7A 1IMFA 5ITPA 2E1SA 5I2KA 1LFGA 5ESYA 1NMUA 4MCOA 2H99A 4ZEBA 1P1NA 3G3HA 3QIMA 1DSNA 1A7LA 4G8NA 1R6ZA 2V93A 4GL8A 5EHSA 4GWYA 3VVEA 1B51A 4NN3A 3G3JA 3IJXB 5M2VA 4F3PA 5I5PA 3UP9A 3H6WA 4P8BA 5DVIA 1F9BA 3R6UA 1MXVA 3Q26A 1B9JA 3M3LA 4FBPA 1GV8A 3IB1A 2DWIA 5CBRA 1QULA 2Y84A 1UTHB 3FIRA 2F8DA 4MIJA 2PVUA 4PDHA 4TQUQ 4OA4A 4GX3A 1QKBA 3E4RA 3EHSA 2Q88A 4ZZAA 3B7DA 2V25A 5I84A 1BKAA 4ESXA 4F1UA 1MPDA 2BJJX 1Y4CA 3RGYA 1MQHA 4KYSA 5CMKA 4GIZA 3C31A 1OIBA 4DXBA 4NMYA 3O2AA 2HAVA 5I59A 4X1DA 2XXUA 3H6VA 2V3UA 5DVFA 3B6QA 3MZBA 2DXYA 2ZNSA 4H1XA 4PFBA 2JJKA 1ZJLA 4RXLA 4XKRA 1US4A 1OQGA 2WBDA 1FBGA 1CB6A 1FBHA 3KFMA 3GXAA 3RLFE 3UN6A 1JNFA 2UVJA 1FJ9A 1FTMA 1RDYA 2CMOA 4QHQA 1OMPA 1KZ8A 3MP8A 3M3KA 4OTEA 3A29A 2ZXTA 2UVHA 1AWBA 2B65A 1LBXA 2XWVA 3N5LA 2NXOA 4F29A 3DP4A 4H0WA 3LV0A 4OYVA 3FXRA 1N3XA 1FQCA 3FV2A 1URDA 2ZZWA 1B3EA 1NUWA 3QUFA 3A3UA 2O7UA 1Y3PA 1QUIA 3G3IA 5DTBA 4LZ5A 5I57B 3TTRA 3K6VA 2FBPA 3E79A 4DCXA 4JXIA 4OVQA 3IR1A 5HBCA 5DEXB 1FTKA 4GQOA 3MBPA 3UA8A 1LFIA 1FBFA 1OVTA 4R6KA 4PC9A 3U65A 2AL4A 4FIMA 2P0SA 4NX1A 4OETA 1DTZA 4PP0A 2FYIA 4JBZA 3BFTA 4GWUA 2IEEA 2XX7A 3ZS6A 5AA4B 4ND9A 3OO8A 3MP6A 1ZKBA 3TTMA 4MNIA 1G0HA 5DT6A 1Y3QA 4IO3A 2QS4A 1B4HA 2V3TA 3LSWA 3O29A 1RDXA 2DWJA 1XOCA 1B32A 3MZ9A 2Z23A 4MH5A 4LN5A 5AA1A 2O6AA 1B0HA 4ELQA 4G68B 3HSTA 3MVXA 4N17A 2I4BA 2ANJA 2B4MA 4KYEA 5BUUA 3FV1A 4MLVA 3IO6A 2DDKA 4N8GA 4YB5A 1IMEA 4FEBA 3O6HA 2ALUA 1NH8A 3LC8A 1SI1A 1KA0A 3MJNA 1HSEA 3RPLB 1NV0A 3IOVA 1DCUA 2ESNA 1TWYA 1B4ZA 1INPA 4LP2B 4NF0A 4U1ZA 4HTGA 2Q8MA 1FPDA 4FORA 3Q29A 3LSXA 3W9WA 4XF5A 1US5A 1IITA 1VFDA 4NQ8A 1MPBA 2PT1A 3PUWE 4NF8A 3IOTA 1B7ZA 1IXHA 2XXKA 2ONKE 3P7IA 1SVXB 5ICQA 2I48A 5IZ3B 1MY1A 4QFPA 3IO4A 2F6GA 5CM6A 1H3DA 3MAMA 1PC3A 4OHNA 2Z8DA 4N91A 4PCDA 1SPIA 4U23A 1K9ZA 4YAHX 3IOWA 3O6IA 2FNCA 3IX1A 1JVYA 3FVKA 2H5YA 4X8RA 5DVJA 3SEXA 1JVXA 4IB2A 4MEVA 2OWZA 2QRYA 4O8MA 1IMAA 4BDLA 5TPAA 2DWHA 1B3GA 3L6GA 3I3VA 4U4XA 4IO6A 4QBAA 4P1LA 3TTLA 4KCDA 4H6DA 5H8HB 1PB9A 1VE4A 1I6AA 4NAPA 3TFLA 3ONMA 3E3KA 4PQJA 3QXMA 3UGWA 4JWYA 1FW0A 1BTJA 1MG1A 5LOMA 3NOHA 3V89B 3VXCA 4G8HA 1FRPA 3B8BA 3H3GA 4NF4B 4FJPA 5KZTA 5ITOA 1DOTA 1Y1MA 1UTHA 1IZ1A 2HFBA 3TCFA 2KLFA 1B7UA 3CG1A 3K6UA 4RY1A 4P0IA 2UVIA 4N6DA 1I6QA 4YB7A 1MXZA 2H9BA 3HN0A 2PCRA 4OVPA 1NL5A 4MHFA 1D4NA 4X9TA 4LQ5A 4LZ8A 4PAKA 1B2HA 2V3QA 1CE2A 4N13A 1UTBB 4U1OA 1LBZA 3VVDA 4G77A 2W7YA 4XKQA 1OVBA 1N3WA 1GGGA 3MZ1A 4LZ7A 4F1YA 3KN8A 3VVFA 4F31B 2FA7A 4O3AA 4XKPA 3CR9A 4ISUA 4PAIA 1VSOA 3D4CA 1LAGE 2HEUA 3KBZA 1MXWA 2F3DA 5IZZA 4F3SA 1NFTA 4KXPA 4H8IA 3S9EA 1AOVA 2F36A 2OZZA 1S50A 3S2VA 3OEKA 3FD3A 3G3FA 5EYFA 1JETA 3HCQA 5I56B 1B05A 1PB8A 2F7CA 2REGA 2DE2A 1LB8A 5CBSA 1FPEA 4FECA 2HXWA 2OLBA 2DE3A 2FHYA 1FPFA 1MM6A 4JDFA 2HCAA 2ONSA 1SQYA 4C1TA 4PTKA 2QVVA 1ZBMA 2WKYA 1JEUA 4OFOA 2DWAA 2CEYA 3IB2A 3EKIA 4NF5A 3M8UA 5EYGA 1ATGA 2ZNUA 5I57A 4F18A 1A8EA 4EF2A 3FVGA 1XT8A 3ROJA 4QRZA 2Y7RA 3O66A 4EQBA 4NEDA 3MVWA 3KG2A 3RPWA 3SEWA 2QS2A 3PTYA 4Q8RA 5K2YA 5CI5A 3PMXA 3BFUA 5A5XA 2DOJA 4GWOA 1O64A 1FQAA 1IXIA 1KA1A 1NI9A 2F7BA 4I9DA 3QSLA 3VV5A 4L17A 1GTKA 1K9YA 1JW5A 2DVCA 2O68A 3T9UA 1LAXA 1LLSA 3TUSA 1Y9UA 2F97A 1PDAA 2F5XA 4IGRA 3TODA 3WAFA 1NUYA 4GX4A 2LAOA 5AA4A 3Q28A 4HCWA 1A99A 5TPAB 2XXVA 2PMSA 2HZLA 3FXBA 1DMBA 4OZ9A 4UABA 1H43A 4WEPA 3PUXE 1GR2A 4GWXA 1HSLA 1P1OA 1P99A 1SW2A 3CSGA 1EU8A 4AS5A 1J1NA 2ZZXA 4ZEIA 4POWA 5EYHA 4G68A 2X7QA 4DIGA 2Q74A 4R2FA 3CFXA 4UACA 4MMPA 4C1UA 1B58A 3A09A 4IO2A 3LR1A 3KSJA 1ELJA 1Z7ME 4BDMA 3DP6A 3G3KA 3OD7A 3PU5A 2I3VA 3H06B 2UYFA 3T96B 4QSDA 4ZEFA 4N4UA 3SDFA 2XHDA 3KOSA 2RC7A 3RPLA 1LBVA 4H46A 3BIHA 2ZMBA 4PGNA 2WYPA 1N7WA 3OMBA 4ELOA 2Y5KA 3TYHA 3MP1A 3T1BA 4YMAA 4PAFA 1URGA 4HCYA 2ZNTA 2QSXA 1NH7A 1MXUA 2Y7PA 1XS5A 5J1DA 3OXNA 1MXXA 1FBCA 4THIA 3PGFA 4H45A 5IZ3A 1JEVA 5DYHA 3PD8A 3MQ9A 2O1LA 1SYHA 3KJ7A 2OWTA 3RT8A 5I7IA 1PEBA 4PF8A 1FPBA 3HPIA 2I0BA 5HM4B 1Y4TA 4NG7A 4JVDA 3C35A 4U22A 2D21A 5CRYA 2DVZA 2O1MA 4RK9A 2QPQA 1FPLA 4R2BA 2B3FA 1B3HA 3OOAA 3I6VA 2QL3A 3CSBA 1MS7A 4LVQA 2PFYA 1B46A 2A5TA 4GWWA 1FTOA 3D4GA 3HV1A 5ISUA 3LSLA 2AL5A 3K4UA 1N84A 2V84A 1IIWA 3U8QA 3FXUA 5H8HA 1MQGA 2O51A 4NF5B 4O3CA 3U94A 4R9GA 3TCHA 4JVIA 3OO6A 1EYIA 5H8QB 4FATA 4PE5B 1YYZA 4MNCA 2HPGA 3CFZA 3K6WA 2NWJA 4NF4A 2CZKA 1NNKA 5CMMA 3TQWA 5A5XB 4YZZA 1BLFA 4DE8A 4YU0A 2NVUB 4OERA 3AXFA 3V8XB 4QSEA 4LA9A 4H5FA 4X1BA 3TELA 3E13X 1WODA 4P11A 5BWJA 4LQ2A 3B6TA 4MBPA 1NV3A 3LUZA 1UTBA 4TLMB 3C9HA 3CG3A 1TFDA 3O28A 2IA4A 3GBBA 1FQEA 4AB5A 2PFZA 4AQ4A 2X7PA 4UA8A 4F2OA 4EXKA 2Y7KA 4WXJA 3PPOA 4U2RA 1QUJA 5T3JA 4M4GA 2OK2A 3VE1B 3R7XA 2THIA 1M5CA 1IMCA 4BLAA 1EYJA 3H03A 2VPNA 1MM7A 2OJTA 4FEDA 5HPQA 1I69A 3SETA 2HAUA 2YJPA 3PMWA 2O7IA 4QFLA 3S9MC 1H76A 4C0RA 1NUXA 1P1UA 4N6PA 2O69A 1AH5A 2GHBA 5A5LA 5I56A 4F1VA 2XX8A 4MJOA 4YMBA 4ZZEA 3TPAA 3PUYE 1PBPA 2YLNA 5JTYB 2D3IA 4H67A 1MQIA 1WDNA 5EQAA 3SEUA 5F24A 1SW1A 1EZOA 1Q35A 1YPNA 1B1XA 4I3YA 3UORA 5B7DA 3TKDA 1QUKA 4MFIA 4LONB 4KFQA 3USDA 3KN3A 1SI0A 4N81A 5DW8A 2AYSA 1MDQA 4JSDA 4JB7A 4DI3D 3PUZE 4DDDA 4GWZA 3PMVA 2PYYA 4RA1A 1JQFA 4PFWA 3Q25A 1LBCA 5I2NA 2DQVA 5CC2A 1FSAA 1OLCA 4EQ7A 4KR5A 4P0GA 2GQ1A 3IB0A 3ZKLA 4NHBA 4GF8A 1I6BA 3K1NA 1FPJA 4TLLB 2FVZA 2XXYA 3QUJA 1LBYA 1FTJA 2DS9A 5L9MA 3RUMA 2A5TB 2REJA 3MVYA 1B5JA 4OFLA 1NNFA 4OENA 4Q5TA 1O63A 2R9JA 3U92A 1B52A 2Z8FA 3JV9A 3IL1B 3H7MA 1FPIA 4NWCA 4XXUA 3SEYA 3H4ZA 4RNSA 3BBRA 2Q2AA 4Z0IA 4YKJA 3C33A 2XXQA 4PFUA 2QJEA 1USYE 1BP5A 2XA5A 4ELPA 3CI8A 5AA3A 3VFJA 2NOOA 3A3CA 4N15A 4F19A 3FUZA 1VR5A 3THIA 3MWBA 4HW8A 4QSCA 1R9QA 2H98A 4DCYA 3MSTA 3GYYA 2RC9A 5K2XA 3ILTB 4ESWA 1M5DA 5TP9B 4H8JA 3I5OA 4G4PA 5KCJB 2GRVA 3H6UA 1IEJA 3ZSFA 1FBPA 2B4LA 1YAEA 4IO5A 1MH4A 1FCKA 3CIJA 1VFEA 4RYAA 4QFNA 3UK4A 3ILUB 3FATA 1FTLA 1DTGA 4K3FA 1Y3NA 1QVSA 3K00A 3K0VA 4ONYA 4R74A 3K02A 1LSTA 1SD3A 2HHMA 3B6WA 3SERA 3G3GA 3MPKA 4JWOA 3TEPA 4GXAA 4ZECA 4R9FA 3W9VA 2O84X 2ZYKA 2MKZA 2G93A 3T22A 4ZEDA 1ZMGA 3KGCA 1UIVA 4HXVA 4P47A 4ZS9A 2VD2A 4NWDA 1GVCA 5H8SA 4N6KA 3IFCA 3CFLA 3FZVA 4PDDA 3GBAA 2QMXA 2XXIA 2F6PA 2FIXA 4YKPA 1FPGA 4XKNA 4IY6A 3PD9A 1OQHA 3FJ7A 2XXWA 1MY3A 2HQ0A 4YKKA 1D9YA 2CZLA 2OWSA 1JW4A 2R8TA 1D9VA 1BK4A 4GL0A 4IO7A 1B40A 2RCBA 4KD5A 3N6UA 1ZU0A 1NV2A 1R9LA 4GXSB 4KQPA 1A54A
chains in the Genus database with same CATH topology
2ONRA 4IY5A 3S4UA 5H8QA 1RKMA 4JWXA 5FHNA 5H8NB 3EHUA 4OXVA 1NNPA 2GH9A 2R71A 4NTLA 4Q30B 1AIVA 1LB9A 3SKPA 4M1VA 3DM0A 1M5EA 3JZJA 1JW1A 1MDP1 5I2NB 1XHYA 5IAIA 3TTNA 3OENA 3SEVA 2Q9TA 3C4MA 1LAHE 4GD5A 3M3FA 4OQOA 4YB6A 3HHGA 3RN8A 3Q27A 3FGSA 4Q0CA 2HZKA 3VLWA 3EF7A 3EHTA 2I4CA 3IOUA 2Z22A 2RF1A 2UXAA 4EUOA 3C32A 3UIFA 1B5IA 4E0WA 3MPLA 1URSA 1KWHA 3BKIB 2XXHA 3H6TA 4DLDA 3F11A 1AMFA 1RYOA 3HO7A 4FE8A 3PPQA 1NNTA 5JEIA 1ANFA 5CMBA 3OSQA 1H44A 3T9VA 2G29A 1MQDA 1EZPA 5I58B 1NKXA 1B5HA 1WVJA 3EPEA 1POTA 3CVGA 3WAEA 1UIUA 3OO7A 4AB6A 5JTYA 3IAZA 4G8MA 2Q89A 3PPRA 4RJZA 1SDXA 4NF6B 5AA2B 2A5SA 5IKBA 3VLUA 5TU0A 1QJMA 2P2AA 5FTIA 4EXLA 1MH3A 4KPTA 4I8CA 3V83A 1Z7NE 3FVNA 1TFAA 4I62A 5KDTA 2B3BA 1LAFE 3ZKKA 2X26A 3SESA 2DP8A 5ICTA 4EQ9A 1S9TA 3RY3A 4GVOA 4FAJA 1A55A 1EH3A 1SYIA 5JK4A 2VHAA 4HS7A 1YCJA 4R72A 1IXCA 1M5BA 3K1PA 3CRBA 4F2QA 1Y20A 3LBSA 1D3KA 2I3WA 2ABHA 5L8DA 1ZTYA 1SW5A 4LATA 1FQBA 2QS3A 2NUVA 4ZEKA 3KSXA 3O9PA 4YICA 5H8FB 4G2ZA 4OEVA 3C34A 4H65A 4TOZA 1SBPA 4ZE8A 2F35A 3MUQA 3PV0E 4RK2A 2ZYOA 3OEMA 4EDPA 3DELB 4GRKA 3PPPA 5TP9A 5ELVA 3ECRA 4DZ1A 3FVOA 5KCJA 2AIXA 1SW4A 4WEDA 1A54A 1XVYA 3PUVE 3T9HB 2ZYMA 4F22A 3FXQA 1DPPA 2H25A 2VD3A 2XXPA 3MC2A 5FHMA 3GLBA 5FTHA 1TXFA 5I2KB 3IORA 3U1OA 3TDJA 4E0XA 3N26A 3S9LC 4RPNA 1IUDA 2Y7WA 3IJOB 3T9XB 4MLQA 4R73A 1IQ7A 2RINA 3MW0A 1YTVA 2Z8EA 2XD3A 3RTFB 3O97A 1USYH 3N94A 3FJMA 4JSOA 4BDQA 2H4IA 4OMBA 3U93A 1B0LA 1Q1KA 3G7WA 3DP8A 4KHZE 2XXTA 3EQ1A 1UQWA 3TQLA 4IO4A 4X48A 3TZAA 2F34A 4MF3A 4ELRA 3HHFA 5H8NA 3QAXA 1MY4A 5CMCA 2XXRA 1B3FA 3S9NC 1RYXA 3K01A 5I59B 4QFKA 3OO9A 1XVXA 3V5AA 5KDTB 4O3BA 3R26A 3N6TA 1ZLQA 4XTCQ 2PT2A 1QKAA 1LGBC 2F7AA 2XD2A 2XX9A 2ZYNA 3OSRA 3TAJA 3TCGA 1R1NA 1PBQA 4KYDA 1POY1 3KZGA 4GOTA 2UYEA 4DXCA 4GFRA 3KEIA 1XC1A 1ZIUA 4G68C 2VGQA 1MQJA 4EF1A 2QMWA 3KJTA 3PPNA 3O6GA 3DLNA 1H45A 3LUYA 1OLAA 4WKMA 2I49A 1Y1ZA 3FASA 3T66A 4PFTA 4OFJA 2I0CA 1L5TA 3FJGA 4KCCA 2DXRA 3VDFA 1PB7A 2I6EA 4U21A 5I58A 4R6HA 5FHOA 4U4SA 3IK6B 4H5GA 4OVJA 3KOTA 1BIYA 4ZE9A 3TTKA 4OWDA 5AE4A 2VOZA 1LFHA 4RPOA 4NF6A 5AA2A 2XXXA 4IGTA 5L9OA 3RT6B 3C36A 1FQDA 3K6XA 2QS1A 1M5FA 1MY2A 4ECFA 1AL3A 3OELA 1N04A 3MVZA 4LUBA 2VP1A 4NE4A 2P1SA 4BDOA 1QW0A 2RC8A 4R75A 1LBBA 1MRPA 3QYTA 3RNNA 4BDRA 2OCUA 1A40A 4Z7EA 1MY0A 3TMGA 4QF9A 1LCFA 3K1MA 1EZ9A 3JYRA 2DYXA 2Q8JA 4F3GA 1O7TA 2E0SA 1MXYA 2M8CA 2I58A 4F39A 1TT1A 2F78A 1FQFA 1MPCA 1P1QA 4F3BA 1LCTA 1IXGA 2PX1A 1B3LA 1A8FA 5F7VA 4POXA 3KBRA 5H8FA 5EHMA 1P1WA 2RCAA 4DXUA 4I1DA 5F1QA 3ODBA 1B7HA 3QK6A 2OBGA 4ZDMA 1N7XA 2PBWA 2D5WA 4YKIA 3L6HA 4KI0E 3VXBA 2UVGA 4QFOA 1II5A 2GHAA 3GZGA 4NF8B 4R6YA 2DSFA 3EN3A 2R6GE 3VLVA 3T93B 2GFEA 4PETA 2RKMA 3K2DA 4OEUA 2DE4A 4GLIA 5B70A 5DEXA 3RTWB 1B1HA 3W15C 1HSJA 4XIGQ 1N0TA 3LSFB 5L9SA 5AA2D 2Y7IA 1S7YA 1DPEA 4PFYA 2Q2CA 3E9XA 3RQTA 1T0KA 2YPNA 3KN7A 4N07A 3U72A 1B6HA 1N76A 4BDNA 4OESA 5ITPA 2E1SA 5I2KA 1LFGA 1NMUA 2H99A 4ZEBA 1P1NA 3G3HA 3QIMA 1DSNA 1A7LA 4G8NA 1R6ZA 2V93A 4GL8A 5EHSA 3VVEA 1B51A 3G3JA 3IJXB 5M2VA 4F3PA 3UP9A 3H6WA 5DVIA 1F9BA 3R6UA 1MXVA 3Q26A 1B9JA 3M3LA 1GV8A 3IB1A 2DWIA 5CBRA 1QULA 2Y84A 1UTHB 3FIRA 2F8DA 2PVUA 4TQUQ 1QKBA 3E4RA 3EHSA 2Q88A 4ZZAA 3B7DA 2V25A 5I84A 1BKAA 4ESXA 4F1UA 1MPDA 2BJJX 1Y4CA 3RGYA 1MQHA 4KYSA 5CMKA 4GIZA 3C31A 1OIBA 4DXBA 4NMYA 3O2AA 2HAVA 5I59A 4X1DA 2XXUA 3H6VA 2V3UA 5DVFA 3B6QA 3MZBA 2DXYA 2ZNSA 4H1XA 1ZJLA 4RXLA 4XKRA 1US4A 1OQGA 1CB6A 3KFMA 3GXAA 3RLFE 3UN6A 1JNFA 2UVJA 1FTMA 2CMOA 4QHQA 1OMPA 3MP8A 3M3KA 4OTEA 2ZXTA 2UVHA 2B65A 3N5LA 2NXOA 4F29A 3DP4A 4H0WA 4OYVA 3FXRA 1N3XA 1FQCA 3FV2A 1URDA 1B3EA 3QUFA 3A3UA 2O7UA 1Y3PA 1QUIA 3G3IA 5DTBA 4LZ5A 5I57B 3TTRA 3K6VA 4DCXA 4JXIA 3IR1A 5HBCA 5DEXB 1FTKA 4GQOA 3MBPA 3UA8A 1LFIA 1OVTA 4R6KA 2AL4A 4FIMA 2P0SA 4OETA 1DTZA 4PP0A 2FYIA 4JBZA 3BFTA 2IEEA 2XX7A 3ZS6A 5AA4B 4ND9A 3OO8A 3MP6A 1ZKBA 3TTMA 5DT6A 1Y3QA 4IO3A 2QS4A 1B4HA 2V3TA 3LSWA 3O29A 2DWJA 1XOCA 1B32A 3MZ9A 2Z23A 4MH5A 5AA1A 2O6AA 1B0HA 4ELQA 4G68B 3HSTA 3MVXA 2I4BA 2ANJA 4KYEA 5BUUA 3FV1A 4MLVA 3IO6A 4YB5A 4FEBA 3O6HA 2ALUA 1NH8A 3LC8A 1SI1A 3MJNA 1HSEA 3IOVA 2ESNA 1TWYA 1B4ZA 4LP2B 4U1ZA 4HTGA 4FORA 3Q29A 3LSXA 3W9WA 1US5A 1IITA 1VFDA 1MPBA 2PT1A 3PUWE 4NF8A 3IOTA 1B7ZA 1IXHA 2ONKE 3P7IA 1SVXB 5ICQA 2I48A 1MY1A 4QFPA 3IO4A 2F6GA 5CM6A 1H3DA 3MAMA 1PC3A 4OHNA 2Z8DA 4U23A 4YAHX 3IOWA 3O6IA 2FNCA 3IX1A 1JVYA 3FVKA 2H5YA 5DVJA 3SEXA 1JVXA 4IB2A 2QRYA 4BDLA 5TPAA 2DWHA 1B3GA 3L6GA 3I3VA 4U4XA 4IO6A 3TTLA 4KCDA 4H6DA 5H8HB 1VE4A 1I6AA 3TFLA 3ONMA 3E3KA 4PQJA 3QXMA 3UGWA 4JWYA 1FW0A 1BTJA 1MG1A 5LOMA 3V89B 3VXCA 4G8HA 3H3GA 4NF4B 4FJPA 5KZTA 5ITOA 1DOTA 1Y1MA 1UTHA 1IZ1A 2HFBA 3TCFA 2KLFA 1B7UA 3CG1A 3K6UA 4RY1A 4P0IA 2UVIA 1I6QA 4YB7A 1MXZA 2H9BA 3HN0A 1NL5A 1D4NA 4X9TA 4LQ5A 4LZ8A 1B2HA 2V3QA 1CE2A 4N13A 1UTBB 4U1OA 3VVDA 4G77A 2W7YA 4XKQA 1OVBA 1N3WA 1GGGA 3MZ1A 4LZ7A 4F1YA 3KN8A 3VVFA 4F31B 2FA7A 4O3AA 4XKPA 3CR9A 4ISUA 1VSOA 3D4CA 1LAGE 2HEUA 1MXWA 4F3SA 1NFTA 4H8IA 3S9EA 1AOVA 2F36A 2OZZA 1S50A 3S2VA 3OEKA 3FD3A 3G3FA 5EYFA 1JETA 3HCQA 5I56B 1B05A 1PB8A 2F7CA 2REGA 2DE2A 1LB8A 5CBSA 4FECA 2HXWA 2OLBA 2DE3A 1MM6A 4JDFA 2HCAA 2ONSA 1SQYA 4C1TA 1ZBMA 2WKYA 1JEUA 4OFOA 2DWAA 3IB2A 4NF5A 3M8UA 1ATGA 2ZNUA 5I57A 4F18A 1A8EA 4EF2A 3FVGA 1XT8A 2Y7RA 4QRZA 3O66A 4EQBA 4NEDA 3MVWA 3KG2A 3RPWA 3SEWA 2QS2A 4Q8RA 5K2YA 5CI5A 5A5XA 3BFUA 3PMXA 2DOJA 4GWOA 1O64A 1FQAA 1IXIA 2F7BA 4I9DA 3QSLA 3VV5A 4L17A 1GTKA 1JW5A 2DVCA 2O68A 3T9UA 1LAXA 1LLSA 3TUSA 1Y9UA 2F97A 1PDAA 2F5XA 4IGRA 3TODA 3WAFA 2LAOA 5AA4A 3Q28A 4HCWA 1A99A 5TPAB 2XXVA 2PMSA 2HZLA 1DMBA 4OZ9A 1H43A 4WEPA 3PUXE 1GR2A 1HSLA 1P1OA 1P99A 1SW2A 3CSGA 1EU8A 1J1NA 4ZEIA 4POWA 4G68A 2X7QA 4DIGA 4R2FA 3CFXA 4UACA 4C1UA 1B58A 3A09A 4IO2A 3LR1A 3KSJA 1ELJA 1Z7ME 4BDMA 3DP6A 3G3KA 3OD7A 3PU5A 2I3VA 3T96B 2UYFA 3H06B 4QSDA 4ZEFA 3SDFA 2XHDA 3KOSA 2RC7A 2ZMBA 1N7WA 3OMBA 4ELOA 3TYHA 3MP1A 4YMAA 1URGA 4HCYA 2ZNTA 2QSXA 1NH7A 1MXUA 2Y7PA 1XS5A 5J1DA 3OXNA 1MXXA 4THIA 3PGFA 1JEVA 5DYHA 3PD8A 3MQ9A 2O1LA 1SYHA 3KJ7A 2OWTA 3RT8A 1PEBA 3HPIA 2I0BA 5HM4B 1Y4TA 3C35A 4U22A 2D21A 5CRYA 2DVZA 2O1MA 4RK9A 2QPQA 4R2BA 2B3FA 1B3HA 3OOAA 3I6VA 2QL3A 3CSBA 1MS7A 4LVQA 1B46A 2A5TA 1FTOA 3D4GA 3HV1A 5ISUA 3LSLA 2AL5A 3K4UA 1N84A 2V84A 1IIWA 3U8QA 3FXUA 5H8HA 1MQGA 2O51A 4NF5B 4O3CA 3U94A 4R9GA 3TCHA 3OO6A 5H8QB 4FATA 4PE5B 3CFZA 3K6WA 2NWJA 4NF4A 1NNKA 5CMMA 3TQWA 5A5XB 4YZZA 1BLFA 4DE8A 4YU0A 2NVUB 4OERA 3AXFA 3V8XB 4QSEA 4LA9A 4H5FA 4X1BA 3TELA 3E13X 1WODA 4P11A 5BWJA 4LQ2A 3B6TA 4MBPA 1UTBA 4TLMB 3C9HA 3CG3A 1TFDA 3O28A 2IA4A 3GBBA 1FQEA 4AB5A 4AQ4A 2X7PA 4UA8A 4F2OA 4EXKA 2Y7KA 4WXJA 3PPOA 4U2RA 1QUJA 4M4GA 2OK2A 3VE1B 3R7XA 2THIA 1M5CA 4BLAA 3H03A 1MM7A 2OJTA 4FEDA 5HPQA 1I69A 3SETA 2HAUA 2YJPA 3PMWA 2O7IA 4QFLA 3S9MC 1H76A 4C0RA 1P1UA 4N6PA 2O69A 1AH5A 2GHBA 5I56A 4F1VA 2XX8A 4YMBA 4ZZEA 3TPAA 3PUYE 1PBPA 2YLNA 5JTYB 2D3IA 4H67A 1MQIA 1WDNA 3SEUA 1SW1A 1EZOA 1Q35A 1YPNA 1B1XA 3UORA 5B7DA 3TKDA 1QUKA 4MFIA 4LONB 4KFQA 3USDA 3KN3A 1SI0A 2AYSA 1MDQA 4JSDA 4JB7A 3PUZE 4DDDA 3PMVA 2PYYA 4RA1A 1JQFA 4PFWA 3Q25A 1LBCA 5I2NA 2DQVA 5CC2A 1OLCA 4EQ7A 4KR5A 4P0GA 3IB0A 3ZKLA 4GF8A 1I6BA 3K1NA 4TLLB 2XXYA 3QUJA 1FTJA 2DS9A 5L9MA 3RUMA 2A5TB 2REJA 3MVYA 1B5JA 4OFLA 1NNFA 4OENA 4Q5TA 1O63A 2R9JA 3U92A 1B52A 2Z8FA 3JV9A 3IL1B 3H7MA 4XXUA 4NWCA 3SEYA 3H4ZA 4RNSA 3BBRA 2Q2AA 4Z0IA 4YKJA 3C33A 2XXQA 4PFUA 2QJEA 1USYE 1BP5A 4ELPA 3CI8A 5AA3A 3VFJA 2NOOA 3A3CA 4F19A 3FUZA 1VR5A 3THIA 3MWBA 4HW8A 4QSCA 1R9QA 2H98A 4DCYA 2RC9A 5K2XA 3ILTB 4ESWA 1M5DA 5TP9B 4H8JA 3I5OA 4G4PA 5KCJB 2GRVA 3H6UA 1IEJA 3ZSFA 1YAEA 4IO5A 1MH4A 1FCKA 3CIJA 1VFEA 4RYAA 4QFNA 3UK4A 3ILUB 3FATA 1FTLA 1DTGA 4K3FA 1Y3NA 1QVSA 3K00A 3K0VA 4ONYA 4R74A 3K02A 1LSTA 1SD3A 3B6WA 3SERA 3G3GA 3MPKA 4JWOA 3TEPA 4GXAA 4ZECA 4R9FA 3W9VA 2O84X 2ZYKA 2G93A 3T22A 4ZEDA 1ZMGA 3KGCA 1UIVA 4ZS9A 2VD2A 4NWDA 1GVCA 5H8SA 3CFLA 3FZVA 3GBAA 2QMXA 2XXIA 2F6PA 4YKPA 4XKNA 4IY6A 3PD9A 1OQHA 3FJ7A 2XXWA 1MY3A 2HQ0A 4YKKA 1D9YA 2CZLA 2OWSA 1JW4A 1D9VA 4GL0A 4IO7A 1B40A 2RCBA 4KD5A 3N6UA 1ZU0A 1R9LA 4GXSB 4KQPA 1PB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ONR A;  4IY5 A;  3S4U A;  5H8Q A;  1RKM A;  4JWX A;  5FHN A;  5H8N B;  3EHU A;  4OXV A;  1NNP A;  2GH9 A;  2R71 A;  4NTL A;  4Q30 B;  1AIV A;  1LB9 A;  3SKP A;  4M1V A;  3DM0 A;  1M5E A;  3JZJ A;  1JW1 A;  1MDP 1;  5I2N B;  1XHY A;  5IAI A;  3TTN A;  3OEN A;  3SEV A;  2Q9T A;  3C4M A;  1LAH E;  4GD5 A;  3M3F A;  4OQO A;  4YB6 A;  3HHG A;  3RN8 A;  3Q27 A;  3FGS A;  4Q0C A;  2HZK A;  3VLW A;  3EF7 A;  3EHT A;  2I4C A;  3IOU A;  2Z22 A;  2RF1 A;  2UXA A;  4EUO A;  3C32 A;  3UIF A;  1B5I A;  4E0W A;  3MPL A;  1URS A;  1KWH A;  3BKI B;  2XXH A;  3H6T A;  4DLD A;  3F11 A;  1AMF A;  1RYO A;  3HO7 A;  4FE8 A;  3PPQ A;  1NNT A;  5JEI A;  1ANF A;  5CMB A;  3OSQ A;  1H44 A;  3T9V A;  2G29 A;  1MQD A;  1EZP A;  5I58 B;  1NKX A;  1B5H A;  1WVJ A;  3EPE A;  1POT A;  3CVG A;  3WAE A;  1UIU A;  3OO7 A;  4AB6 A;  5JTY A;  3IAZ A;  4G8M A;  2Q89 A;  3PPR A;  4RJZ A;  1SDX A;  4NF6 B;  5AA2 B;  2A5S A;  5IKB A;  3VLU A;  5TU0 A;  1QJM A;  2P2A A;  5FTI A;  4EXL A;  1MH3 A;  4KPT A;  4I8C A;  3V83 A;  1Z7N E;  3FVN A;  1TFA A;  4I62 A;  5KDT A;  2B3B A;  1LAF E;  3ZKK A;  2X26 A;  3SES A;  2DP8 A;  5ICT A;  4EQ9 A;  1S9T A;  3RY3 A;  4GVO A;  4FAJ A;  1A55 A;  1EH3 A;  1SYI A;  5JK4 A;  2VHA A;  4HS7 A;  1YCJ A;  4R72 A;  1IXC A;  1M5B A;  3K1P A;  3CRB A;  4F2Q A;  1Y20 A;  3LBS A;  1D3K A;  2I3W A;  2ABH A;  5L8D A;  1ZTY A;  1SW5 A;  4LAT A;  1FQB A;  2QS3 A;  2NUV A;  4ZEK A;  3KSX A;  3O9P A;  4YIC A;  5H8F B;  4G2Z A;  4OEV A;  3C34 A;  4H65 A;  4TOZ A;  1SBP A;  4ZE8 A;  2F35 A;  3MUQ A;  3PV0 E;  4RK2 A;  2ZYO A;  3OEM A;  4EDP A;  3DEL B;  4GRK A;  3PPP A;  5TP9 A;  5ELV A;  3ECR A;  4DZ1 A;  3FVO A;  5KCJ A;  2AIX A;  1SW4 A;  4WED A;  1A54 A;  1XVY A;  3PUV E;  3T9H B;  2ZYM A;  4F22 A;  3FXQ A;  1DPP A;  2H25 A;  2VD3 A;  2XXP A;  3MC2 A;  5FHM A;  3GLB A;  5FTH A;  1TXF A;  5I2K B;  3IOR A;  3U1O A;  3TDJ A;  4E0X A;  3N26 A;  3S9L C;  4RPN A;  1IUD A;  2Y7W A;  3IJO B;  3T9X B;  4MLQ A;  4R73 A;  1IQ7 A;  2RIN A;  3MW0 A;  1YTV A;  2Z8E A;  2XD3 A;  3RTF B;  3O97 A;  1USY H;  3N94 A;  3FJM A;  4JSO A;  4BDQ A;  2H4I A;  4OMB A;  3U93 A;  1B0L A;  1Q1K A;  3G7W A;  3DP8 A;  4KHZ E;  2XXT A;  3EQ1 A;  1UQW A;  3TQL A;  4IO4 A;  4X48 A;  3TZA A;  2F34 A;  4MF3 A;  4ELR A;  3HHF A;  5H8N A;  3QAX A;  1MY4 A;  5CMC A;  2XXR A;  1B3F A;  3S9N C;  1RYX A;  3K01 A;  5I59 B;  4QFK A;  3OO9 A;  1XVX A;  3V5A A;  5KDT B;  4O3B A;  3R26 A;  3N6T A;  1ZLQ A;  4XTC Q;  2PT2 A;  1QKA A;  1LGB C;  2F7A A;  2XD2 A;  2XX9 A;  2ZYN A;  3OSR A;  3TAJ A;  3TCG A;  1R1N A;  1PBQ A;  4KYD A;  1POY 1;  3KZG A;  4GOT A;  2UYE A;  4DXC A;  4GFR A;  3KEI A;  1XC1 A;  1ZIU A;  4G68 C;  2VGQ A;  1MQJ A;  4EF1 A;  2QMW A;  3KJT A;  3PPN A;  3O6G A;  3DLN A;  1H45 A;  3LUY A;  1OLA A;  4WKM A;  2I49 A;  1Y1Z A;  3FAS A;  3T66 A;  4PFT A;  4OFJ A;  2I0C A;  1L5T A;  3FJG A;  4KCC A;  2DXR A;  3VDF A;  1PB7 A;  2I6E A;  4U21 A;  5I58 A;  4R6H A;  5FHO A;  4U4S A;  3IK6 B;  4H5G A;  4OVJ A;  3KOT A;  1BIY A;  4ZE9 A;  3TTK A;  4OWD A;  5AE4 A;  2VOZ A;  1LFH A;  4RPO A;  4NF6 A;  5AA2 A;  2XXX A;  4IGT A;  5L9O A;  3RT6 B;  3C36 A;  1FQD A;  3K6X A;  2QS1 A;  1M5F A;  1MY2 A;  4ECF A;  1AL3 A;  3OEL A;  1N04 A;  3MVZ A;  4LUB A;  2VP1 A;  4NE4 A;  2P1S A;  4BDO A;  1QW0 A;  2RC8 A;  4R75 A;  1LBB A;  1MRP A;  3QYT A;  3RNN A;  4BDR A;  2OCU A;  1A40 A;  4Z7E A;  1MY0 A;  3TMG A;  4QF9 A;  1LCF A;  3K1M A;  1EZ9 A;  3JYR A;  2DYX A;  2Q8J A;  4F3G A;  1O7T A;  2E0S A;  1MXY A;  2M8C A;  2I58 A;  4F39 A;  1TT1 A;  2F78 A;  1FQF A;  1MPC A;  1P1Q A;  4F3B A;  1LCT A;  1IXG A;  2PX1 A;  1B3L A;  1A8F A;  5F7V A;  4POX A;  3KBR A;  5H8F A;  5EHM A;  1P1W A;  2RCA A;  4DXU A;  4I1D A;  5F1Q A;  3ODB A;  1B7H A;  3QK6 A;  2OBG A;  4ZDM A;  1N7X A;  2PBW A;  2D5W A;  4YKI A;  3L6H A;  4KI0 E;  3VXB A;  2UVG A;  4QFO A;  1II5 A;  2GHA A;  3GZG A;  4NF8 B;  4R6Y A;  2DSF A;  3EN3 A;  2R6G E;  3VLV A;  3T93 B;  2GFE A;  4PET A;  2RKM A;  3K2D A;  4OEU A;  2DE4 A;  4GLI A;  5B70 A;  5DEX A;  3RTW B;  1B1H A;  3W15 C;  1HSJ A;  4XIG Q;  1N0T A;  3LSF B;  5L9S A;  5AA2 D;  2Y7I A;  1S7Y A;  1DPE A;  4PFY A;  2Q2C A;  3E9X A;  3RQT A;  1T0K A;  2YPN A;  3KN7 A;  4N07 A;  3U72 A;  1B6H A;  1N76 A;  4BDN A;  4OES A;  5ITP A;  2E1S A;  5I2K A;  1LFG A;  1NMU A;  2H99 A;  4ZEB A;  1P1N A;  3G3H A;  3QIM A;  1DSN A;  1A7L A;  4G8N A;  1R6Z A;  2V93 A;  4GL8 A;  5EHS A;  3VVE A;  1B51 A;  3G3J A;  3IJX B;  5M2V A;  4F3P A;  3UP9 A;  3H6W A;  5DVI A;  1F9B A;  3R6U A;  1MXV A;  3Q26 A;  1B9J A;  3M3L A;  1GV8 A;  3IB1 A;  2DWI A;  5CBR A;  1QUL A;  2Y84 A;  1UTH B;  3FIR A;  2F8D A;  2PVU A;  4TQU Q;  1QKB A;  3E4R A;  3EHS A;  2Q88 A;  4ZZA A;  3B7D A;  2V25 A;  5I84 A;  1BKA A;  4ESX A;  4F1U A;  1MPD A;  2BJJ X;  1Y4C A;  3RGY A;  1MQH A;  4KYS A;  5CMK A;  4GIZ A;  3C31 A;  1OIB A;  4DXB A;  4NMY A;  3O2A A;  2HAV A;  5I59 A;  4X1D A;  2XXU A;  3H6V A;  2V3U A;  5DVF A;  3B6Q A;  3MZB A;  2DXY A;  2ZNS A;  4H1X A;  1ZJL A;  4RXL A;  4XKR A;  1US4 A;  1OQG A;  1CB6 A;  3KFM A;  3GXA A;  3RLF E;  3UN6 A;  1JNF A;  2UVJ A;  1FTM A;  2CMO A;  4QHQ A;  1OMP A;  3MP8 A;  3M3K A;  4OTE A;  2ZXT A;  2UVH A;  2B65 A;  3N5L A;  2NXO A;  4F29 A;  3DP4 A;  4H0W A;  4OYV A;  3FXR A;  1N3X A;  1FQC A;  3FV2 A;  1URD A;  1B3E A;  3QUF A;  3A3U A;  2O7U A;  1Y3P A;  1QUI A;  3G3I A;  5DTB A;  4LZ5 A;  5I57 B;  3TTR A;  3K6V A;  4DCX A;  4JXI A;  3IR1 A;  5HBC A;  5DEX B;  1FTK A;  4GQO A;  3MBP A;  3UA8 A;  1LFI A;  1OVT A;  4R6K A;  2AL4 A;  4FIM A;  2P0S A;  4OET A;  1DTZ A;  4PP0 A;  2FYI A;  4JBZ A;  3BFT A;  2IEE A;  2XX7 A;  3ZS6 A;  5AA4 B;  4ND9 A;  3OO8 A;  3MP6 A;  1ZKB A;  3TTM A;  5DT6 A;  1Y3Q A;  4IO3 A;  2QS4 A;  1B4H A;  2V3T A;  3LSW A;  3O29 A;  2DWJ A;  1XOC A;  1B32 A;  3MZ9 A;  2Z23 A;  4MH5 A;  5AA1 A;  2O6A A;  1B0H A;  4ELQ A;  4G68 B;  3HST A;  3MVX A;  2I4B A;  2ANJ A;  4KYE A;  5BUU A;  3FV1 A;  4MLV A;  3IO6 A;  4YB5 A;  4FEB A;  3O6H A;  2ALU A;  1NH8 A;  3LC8 A;  1SI1 A;  3MJN A;  1HSE A;  3IOV A;  2ESN A;  1TWY A;  1B4Z A;  4LP2 B;  4U1Z A;  4HTG A;  4FOR A;  3Q29 A;  3LSX A;  3W9W A;  1US5 A;  1IIT A;  1VFD A;  1MPB A;  2PT1 A;  3PUW E;  4NF8 A;  3IOT A;  1B7Z A;  1IXH A;  2ONK E;  3P7I A;  1SVX B;  5ICQ A;  2I48 A;  1MY1 A;  4QFP A;  3IO4 A;  2F6G A;  5CM6 A;  1H3D A;  3MAM A;  1PC3 A;  4OHN A;  2Z8D A;  4U23 A;  4YAH X;  3IOW A;  3O6I A;  2FNC A;  3IX1 A;  1JVY A;  3FVK A;  2H5Y A;  5DVJ A;  3SEX A;  1JVX A;  4IB2 A;  2QRY A;  4BDL A;  5TPA A;  2DWH A;  1B3G A;  3L6G A;  3I3V A;  4U4X A;  4IO6 A;  3TTL A;  4KCD A;  4H6D A;  5H8H B;  1VE4 A;  1I6A A;  3TFL A;  3ONM A;  3E3K A;  4PQJ A;  3QXM A;  3UGW A;  4JWY A;  1FW0 A;  1BTJ A;  1MG1 A;  5LOM A;  3V89 B;  3VXC A;  4G8H A;  3H3G A;  4NF4 B;  4FJP A;  5KZT A;  5ITO A;  1DOT A;  1Y1M A;  1UTH A;  1IZ1 A;  2HFB A;  3TCF A;  2KLF A;  1B7U A;  3CG1 A;  3K6U A;  4RY1 A;  4P0I A;  2UVI A;  1I6Q A;  4YB7 A;  1MXZ A;  2H9B A;  3HN0 A;  1NL5 A;  1D4N A;  4X9T A;  4LQ5 A;  4LZ8 A;  1B2H A;  2V3Q A;  1CE2 A;  4N13 A;  1UTB B;  4U1O A;  3VVD A;  4G77 A;  2W7Y A;  4XKQ A;  1OVB A;  1N3W A;  1GGG A;  3MZ1 A;  4LZ7 A;  4F1Y A;  3KN8 A;  3VVF A;  4F31 B;  2FA7 A;  4O3A A;  4XKP A;  3CR9 A;  4ISU A;  1VSO A;  3D4C A;  1LAG E;  2HEU A;  1MXW A;  4F3S A;  1NFT A;  4H8I A;  3S9E A;  1AOV A;  2F36 A;  2OZZ A;  1S50 A;  3S2V A;  3OEK A;  3FD3 A;  3G3F A;  5EYF A;  1JET A;  3HCQ A;  5I56 B;  1B05 A;  1PB8 A;  2F7C A;  2REG A;  2DE2 A;  1LB8 A;  5CBS A;  4FEC A;  2HXW A;  2OLB A;  2DE3 A;  1MM6 A;  4JDF A;  2HCA A;  2ONS A;  1SQY A;  4C1T A;  1ZBM A;  2WKY A;  1JEU A;  4OFO A;  2DWA A;  3IB2 A;  4NF5 A;  3M8U A;  1ATG A;  2ZNU A;  5I57 A;  4F18 A;  1A8E A;  4EF2 A;  3FVG A;  1XT8 A;  2Y7R A;  4QRZ A;  3O66 A;  4EQB A;  4NED A;  3MVW A;  3KG2 A;  3RPW A;  3SEW A;  2QS2 A;  4Q8R A;  5K2Y A;  5CI5 A;  5A5X A;  3BFU A;  3PMX A;  2DOJ A;  4GWO A;  1O64 A;  1FQA A;  1IXI A;  2F7B A;  4I9D A;  3QSL A;  3VV5 A;  4L17 A;  1GTK A;  1JW5 A;  2DVC A;  2O68 A;  3T9U A;  1LAX A;  1LLS A;  3TUS A;  1Y9U A;  2F97 A;  1PDA A;  2F5X A;  4IGR A;  3TOD A;  3WAF A;  2LAO A;  5AA4 A;  3Q28 A;  4HCW A;  1A99 A;  5TPA B;  2XXV A;  2PMS A;  2HZL A;  1DMB A;  4OZ9 A;  1H43 A;  4WEP A;  3PUX E;  1GR2 A;  1HSL A;  1P1O A;  1P99 A;  1SW2 A;  3CSG A;  1EU8 A;  1J1N A;  4ZEI A;  4POW A;  4G68 A;  2X7Q A;  4DIG A;  4R2F A;  3CFX A;  4UAC A;  4C1U A;  1B58 A;  3A09 A;  4IO2 A;  3LR1 A;  3KSJ A;  1ELJ A;  1Z7M E;  4BDM A;  3DP6 A;  3G3K A;  3OD7 A;  3PU5 A;  2I3V A;  3T96 B;  2UYF A;  3H06 B;  4QSD A;  4ZEF A;  3SDF A;  2XHD A;  3KOS A;  2RC7 A;  2ZMB A;  1N7W A;  3OMB A;  4ELO A;  3TYH A;  3MP1 A;  4YMA A;  1URG A;  4HCY A;  2ZNT A;  2QSX A;  1NH7 A;  1MXU A;  2Y7P A;  1XS5 A;  5J1D A;  3OXN A;  1MXX A;  4THI A;  3PGF A;  1JEV A;  5DYH A;  3PD8 A;  3MQ9 A;  2O1L A;  1SYH A;  3KJ7 A;  2OWT A;  3RT8 A;  1PEB A;  3HPI A;  2I0B A;  5HM4 B;  1Y4T A;  3C35 A;  4U22 A;  2D21 A;  5CRY A;  2DVZ A;  2O1M A;  4RK9 A;  2QPQ A;  4R2B A;  2B3F A;  1B3H A;  3OOA A;  3I6V A;  2QL3 A;  3CSB A;  1MS7 A;  4LVQ A;  1B46 A;  2A5T A;  1FTO A;  3D4G A;  3HV1 A;  5ISU A;  3LSL A;  2AL5 A;  3K4U A;  1N84 A;  2V84 A;  1IIW A;  3U8Q A;  3FXU A;  5H8H A;  1MQG A;  2O51 A;  4NF5 B;  4O3C A;  3U94 A;  4R9G A;  3TCH A;  3OO6 A;  5H8Q B;  4FAT A;  4PE5 B;  3CFZ A;  3K6W A;  2NWJ A;  4NF4 A;  1NNK A;  5CMM A;  3TQW A;  5A5X B;  4YZZ A;  1BLF A;  4DE8 A;  4YU0 A;  2NVU B;  4OER A;  3AXF A;  3V8X B;  4QSE A;  4LA9 A;  4H5F A;  4X1B A;  3TEL A;  3E13 X;  1WOD A;  4P11 A;  5BWJ A;  4LQ2 A;  3B6T A;  4MBP A;  1UTB A;  4TLM B;  3C9H A;  3CG3 A;  1TFD A;  3O28 A;  2IA4 A;  3GBB A;  1FQE A;  4AB5 A;  4AQ4 A;  2X7P A;  4UA8 A;  4F2O A;  4EXK A;  2Y7K A;  4WXJ A;  3PPO A;  4U2R A;  1QUJ A;  4M4G A;  2OK2 A;  3VE1 B;  3R7X A;  2THI A;  1M5C A;  4BLA A;  3H03 A;  1MM7 A;  2OJT A;  4FED A;  5HPQ A;  1I69 A;  3SET A;  2HAU A;  2YJP A;  3PMW A;  2O7I A;  4QFL A;  3S9M C;  1H76 A;  4C0R A;  1P1U A;  4N6P A;  2O69 A;  1AH5 A;  2GHB A;  5I56 A;  4F1V A;  2XX8 A;  4YMB A;  4ZZE A;  3TPA A;  3PUY E;  1PBP A;  2YLN A;  5JTY B;  2D3I A;  4H67 A;  1MQI A;  1WDN A;  3SEU A;  1SW1 A;  1EZO A;  1Q35 A;  1YPN A;  1B1X A;  3UOR A;  5B7D A;  3TKD A;  1QUK A;  4MFI A;  4LON B;  4KFQ A;  3USD A;  3KN3 A;  1SI0 A;  2AYS A;  1MDQ A;  4JSD A;  4JB7 A;  3PUZ E;  4DDD A;  3PMV A;  2PYY A;  4RA1 A;  1JQF A;  4PFW A;  3Q25 A;  1LBC A;  5I2N A;  2DQV A;  5CC2 A;  1OLC A;  4EQ7 A;  4KR5 A;  4P0G A;  3IB0 A;  3ZKL A;  4GF8 A;  1I6B A;  3K1N A;  4TLL B;  2XXY A;  3QUJ A;  1FTJ A;  2DS9 A;  5L9M A;  3RUM A;  2A5T B;  2REJ A;  3MVY A;  1B5J A;  4OFL A;  1NNF A;  4OEN A;  4Q5T A;  1O63 A;  2R9J A;  3U92 A;  1B52 A;  2Z8F A;  3JV9 A;  3IL1 B;  3H7M A;  4XXU A;  4NWC A;  3SEY A;  3H4Z A;  4RNS A;  3BBR A;  2Q2A A;  4Z0I A;  4YKJ A;  3C33 A;  2XXQ A;  4PFU A;  2QJE A;  1USY E;  1BP5 A;  4ELP A;  3CI8 A;  5AA3 A;  3VFJ A;  2NOO A;  3A3C A;  4F19 A;  3FUZ A;  1VR5 A;  3THI A;  3MWB A;  4HW8 A;  4QSC A;  1R9Q A;  2H98 A;  4DCY A;  2RC9 A;  5K2X A;  3ILT B;  4ESW A;  1M5D A;  5TP9 B;  4H8J A;  3I5O A;  4G4P A;  5KCJ B;  2GRV A;  3H6U A;  1IEJ A;  3ZSF A;  1YAE A;  4IO5 A;  1MH4 A;  1FCK A;  3CIJ A;  1VFE A;  4RYA A;  4QFN A;  3UK4 A;  3ILU B;  3FAT A;  1FTL A;  1DTG A;  4K3F A;  1Y3N A;  1QVS A;  3K00 A;  3K0V A;  4ONY A;  4R74 A;  3K02 A;  1LST A;  1SD3 A;  3B6W A;  3SER A;  3G3G A;  3MPK A;  4JWO A;  3TEP A;  4GXA A;  4ZEC A;  4R9F A;  3W9V A;  2O84 X;  2ZYK A;  2G93 A;  3T22 A;  4ZED A;  1ZMG A;  3KGC A;  1UIV A;  4ZS9 A;  2VD2 A;  4NWD A;  1GVC A;  5H8S A;  3CFL A;  3FZV A;  3GBA A;  2QMX A;  2XXI A;  2F6P A;  4YKP A;  4XKN A;  4IY6 A;  3PD9 A;  1OQH A;  3FJ7 A;  2XXW A;  1MY3 A;  2HQ0 A;  4YKK A;  1D9Y A;  2CZL A;  2OWS A;  1JW4 A;  1D9V A;  4GL0 A;  4IO7 A;  1B40 A;  2RCB A;  4KD5 A;  3N6U A;  1ZU0 A;  1R9L A;  4GXS B;  4KQP A;  1PB9 A; 
#chains in the Genus database with same CATH topology
 2ONR A;  4IY5 A;  3S4U A;  5H8Q A;  1RKM A;  4JWX A;  5FHN A;  1NV5 A;  5H8N B;  3EHU A;  4OXV A;  1NNP A;  4PFI A;  2GH9 A;  2R71 A;  4NTL A;  4Q30 B;  1AIV A;  1LB9 A;  3SKP A;  4M1V A;  3DM0 A;  1M5E A;  5EQ8 A;  3JZJ A;  1JW1 A;  1MDP 1;  5I2N B;  1XHY A;  4OVT A;  2F3B A;  5J16 A;  5IAI A;  3TTN A;  3OEN A;  3SEV A;  2Q9T A;  3C4M A;  1LAH E;  2V4C A;  4GD5 A;  3M3F A;  4P3L A;  4OQO A;  4YB6 A;  3HHG A;  3RN8 A;  3Q27 A;  3FGS A;  4Q0C A;  2P3N A;  2HZK A;  1YXI A;  3VLW A;  3EF7 A;  3EHT A;  2I4C A;  3IOU A;  2Z22 A;  1FTA A;  2RF1 A;  2UXA A;  4EUO A;  3C32 A;  3UIF A;  1B5I A;  4E0W A;  3MPL A;  1URS A;  2VT5 A;  1KWH A;  3BKI B;  2XXH A;  4MX6 A;  3H6T A;  2ZZV A;  3D1R A;  3KC1 A;  4OVR A;  4DLD A;  3F11 A;  1AMF A;  1RYO A;  3HO7 A;  4FE8 A;  3PPQ A;  1NNT A;  5JEI A;  1ANF A;  5CMB A;  3OSQ A;  1H44 A;  3T9V A;  2G29 A;  1MQD A;  5LDZ A;  1EZP A;  5I58 B;  1NKX A;  1B5H A;  1WVJ A;  3BIG A;  1POT A;  1QGX A;  3EPE A;  3CVG A;  3WAE A;  1UIU A;  3OO7 A;  4AB6 A;  5JTY A;  3IAZ A;  4G8M A;  2Q89 A;  3PPR A;  2VPO A;  4RJZ A;  1SDX A;  4GWS A;  1NUZ A;  4NF6 B;  5AA2 B;  2A5S A;  5IKB A;  3VLU A;  5TU0 A;  4GBV A;  1QJM A;  4IR8 A;  2P2A A;  5FTI A;  4EXL A;  1G0I A;  1MH3 A;  4KPT A;  4I8C A;  5ET8 A;  3V83 A;  1Z7N E;  3FVN A;  4X04 A;  1TFA A;  3KC0 A;  4I62 A;  5ET5 A;  5KDT A;  2B3B A;  1LAF E;  3ZKK A;  4G61 A;  2X26 A;  3SES A;  4DI4 B;  2DP8 A;  5ICT A;  4EQ9 A;  1S9T A;  1IMB A;  3RY3 A;  4GVO A;  4FAJ A;  1A55 A;  1EH3 A;  1SYI A;  5ET7 A;  5JK4 A;  2VHA A;  4HS7 A;  1YCJ A;  4GBW A;  4R72 A;  1IXC A;  1M5B A;  2WYK A;  2QVR A;  3K1P A;  3CRB A;  4PBH A;  4F2Q A;  1Y20 A;  3LBS A;  1D3K A;  2I3W A;  2ABH A;  5FBP A;  5L8D A;  1NV1 A;  3ISP A;  1ZTY A;  1SW5 A;  4LAT A;  1FQB A;  2QS3 A;  2NUV A;  4ZEK A;  3KSX A;  3O9P A;  1Q9D A;  4YIC A;  5H8F B;  4G2Z A;  4OEV A;  4HE0 A;  3C34 A;  4H65 A;  4TOZ A;  3FBP A;  1SBP A;  4PBQ A;  4ZE8 A;  2F35 A;  3MUQ A;  3PV0 E;  4RK2 A;  2ZYO A;  3OEM A;  2KQZ A;  2L5V A;  4EDP A;  3DEL B;  5IM2 A;  4GRK A;  4QXD A;  3PPP A;  5TP9 A;  5ELV A;  3ECR A;  3HFU A;  4DZ1 A;  3FVO A;  5KCJ A;  2AIX A;  1SW4 A;  4PFR A;  3SZP A;  4WED A;  3QMF A;  1XVY A;  3PUV E;  1FBD A;  3T9H B;  2ZYM A;  4F22 A;  3FXQ A;  1DPP A;  2H25 A;  2VD3 A;  1DBZ A;  2XXP A;  4PGP A;  3MC2 A;  5FHM A;  3GLB A;  5FTH A;  1TXF A;  5I2K B;  3IOR A;  3U1O A;  4HE2 A;  3TDJ A;  4E0X A;  3N26 A;  3S9L C;  4RPN A;  1IUD A;  2Y7W A;  3IJO B;  3T9X B;  4XFE A;  4MLQ A;  4R73 A;  1IQ7 A;  2RIN A;  1NV7 A;  3MW0 A;  4P1E A;  1YTV A;  2Z8E A;  2XD3 A;  3RTF B;  3O97 A;  1USY H;  3N94 A;  4MNP A;  2CZI A;  4GX6 A;  2Y5L A;  3FJM A;  4JSO A;  4BDQ A;  5IGA A;  2H4I A;  4OMB A;  2FIE A;  3U93 A;  1B0L A;  1Q1K A;  3G7W A;  3DP8 A;  1FPK A;  1CNQ A;  4KHZ E;  2CZH A;  5IZ1 A;  4HE1 A;  1RDZ A;  2XXT A;  2XWI A;  4P9K A;  3EQ1 A;  2QFL A;  1UQW A;  3TQL A;  4IO4 A;  4X48 A;  3TZA A;  2F34 A;  4MF3 A;  4ELR A;  3HHF A;  5H8N A;  3RYD A;  3QAX A;  1MY4 A;  5CMC A;  2XXR A;  1B3F A;  3S9N C;  1RYX A;  3K01 A;  5I59 B;  4QFK A;  3E78 A;  3OO9 A;  1LBW A;  2XWO A;  1XVX A;  4OVS A;  4XEQ A;  3V5A A;  5KDT B;  4O3B A;  4JVC A;  3R26 A;  3N6T A;  1ZLQ A;  4XTC Q;  2PT2 A;  1QKA A;  3MYU A;  4P56 A;  1LGB C;  2F7A A;  2XD2 A;  1VDW A;  2XX9 A;  2ZYN A;  3OSR A;  3TAJ A;  3TCG A;  1R1N A;  1PBQ A;  4KYD A;  1POY 1;  3KZG A;  4GOT A;  5LTC A;  2UYE A;  4DXC A;  4GFR A;  3KEI A;  1XC1 A;  2HXR A;  1ZIU A;  4G68 C;  2VGQ A;  1MQJ A;  4EF1 A;  2QMW A;  3KJT A;  3PPN A;  3O6G A;  3DLN A;  1FBE A;  1H45 A;  3LUY A;  1OLA A;  4WKM A;  2I49 A;  1Y1Z A;  3FAS A;  1JP4 A;  3T66 A;  2XWK A;  5EQ9 A;  4PFT A;  4OFJ A;  2I0C A;  3CHG A;  1L5T A;  3IFA A;  3FJG A;  4KCC A;  2DXR A;  3VDF A;  1PB7 A;  2I6E A;  4U21 A;  4I3E A;  5I58 A;  1XI6 A;  4R6H A;  5FHO A;  4U4S A;  2OX3 A;  3IK6 B;  4H5G A;  4OVJ A;  3KOT A;  1BIY A;  4ZE9 A;  3TTK A;  4OWD A;  5AE4 A;  2VOZ A;  1LFH A;  2WEF A;  4MAG A;  1D9Q A;  4RPO A;  4NF6 A;  5AA2 A;  2XXX A;  4IGT A;  2BJI A;  5L9O A;  3RT6 B;  3C36 A;  1FQD A;  3K6X A;  4O7M A;  3T0J A;  2QS1 A;  1M5F A;  1LEV A;  1MY2 A;  4ECF A;  1AL3 A;  3OEL A;  1N04 A;  3MVZ A;  4LUB A;  2VP1 A;  4NE4 A;  2P1S A;  2WBB A;  4BDO A;  1EYK A;  1QW0 A;  4AS4 A;  2KR0 A;  2RC8 A;  2WX9 A;  4R75 A;  1LBB A;  4OAN A;  1MRP A;  3QYT A;  3B50 A;  1IMD A;  3RNN A;  4BDR A;  2QVU A;  2OCU A;  1A40 A;  4Z7E A;  1MY0 A;  3TMG A;  5I3S A;  4QF9 A;  1LCF A;  3K1M A;  1EZ9 A;  3JYR A;  2DYX A;  2Q8J A;  1FJ6 A;  4F3G A;  2CEX A;  1O7T A;  2P3V A;  2E0S A;  1MXY A;  1NV6 A;  2M8C A;  2I58 A;  4NGU A;  4F39 A;  1TT1 A;  2F78 A;  1FQF A;  1MPC A;  1P1Q A;  4F3B A;  1LCT A;  1IXG A;  2PX1 A;  1B3L A;  1A8F A;  5F7V A;  4POX A;  3KBR A;  5H8F A;  5EHM A;  1P1W A;  2RCA A;  4DXU A;  4I1D A;  1NV4 A;  5F1Q A;  3ODB A;  1B7H A;  3QK6 A;  4I40 A;  2OBG A;  4ZDM A;  1N7X A;  2PBW A;  2D5W A;  4YKI A;  3L6H A;  4KI0 E;  3VXB A;  1DK4 A;  2UVG A;  4QFO A;  4O7I A;  4N8Y A;  1II5 A;  2GHA A;  3GZG A;  4NF8 B;  4R6Y A;  1YZ0 A;  2DSF A;  3EN3 A;  2R6G E;  3VLV A;  2GFE A;  4PET A;  2RKM A;  3T93 B;  3K2D A;  4OEU A;  2DE4 A;  4GLI A;  5B70 A;  5DEX A;  3RTW B;  1B1H A;  3W15 C;  1HSJ A;  4XIG Q;  1N0T A;  3LSF B;  5L9S A;  5ET6 A;  5AA2 D;  2Y7I A;  1S7Y A;  1DPE A;  4PFY A;  2Q2C A;  3E9X A;  3RQT A;  1T0K A;  2YPN A;  3KN7 A;  4N07 A;  3U72 A;  1B6H A;  1N76 A;  4PE3 A;  4BDN A;  4OES A;  4O94 A;  4PF6 A;  5EQ7 A;  1IMF A;  5ITP A;  2E1S A;  5I2K A;  1LFG A;  5ESY A;  1NMU A;  4MCO A;  2H99 A;  4ZEB A;  1P1N A;  3G3H A;  3QIM A;  1DSN A;  1A7L A;  4G8N A;  1R6Z A;  2V93 A;  4GL8 A;  5EHS A;  4GWY A;  3VVE A;  1B51 A;  4NN3 A;  3G3J A;  3IJX B;  5M2V A;  4F3P A;  5I5P A;  3UP9 A;  3H6W A;  4P8B A;  5DVI A;  1F9B A;  3R6U A;  1MXV A;  3Q26 A;  1B9J A;  3M3L A;  4FBP A;  1GV8 A;  3IB1 A;  2DWI A;  5CBR A;  1QUL A;  2Y84 A;  1UTH B;  3FIR A;  2F8D A;  4MIJ A;  2PVU A;  4PDH A;  4TQU Q;  4OA4 A;  4GX3 A;  1QKB A;  3E4R A;  3EHS A;  2Q88 A;  4ZZA A;  3B7D A;  2V25 A;  5I84 A;  1BKA A;  4ESX A;  4F1U A;  1MPD A;  2BJJ X;  1Y4C A;  3RGY A;  1MQH A;  4KYS A;  5CMK A;  4GIZ A;  3C31 A;  1OIB A;  4DXB A;  4NMY A;  3O2A A;  2HAV A;  5I59 A;  4X1D A;  2XXU A;  3H6V A;  2V3U A;  5DVF A;  3B6Q A;  3MZB A;  2DXY A;  2ZNS A;  4H1X A;  4PFB A;  2JJK A;  1ZJL A;  4RXL A;  4XKR A;  1US4 A;  1OQG A;  2WBD A;  1FBG A;  1CB6 A;  1FBH A;  3KFM A;  3GXA A;  3RLF E;  3UN6 A;  1JNF A;  2UVJ A;  1FJ9 A;  1FTM A;  1RDY A;  2CMO A;  4QHQ A;  1OMP A;  1KZ8 A;  3MP8 A;  3M3K A;  4OTE A;  3A29 A;  2ZXT A;  2UVH A;  1AWB A;  2B65 A;  1LBX A;  2XWV A;  3N5L A;  2NXO A;  4F29 A;  3DP4 A;  4H0W A;  3LV0 A;  4OYV A;  3FXR A;  1N3X A;  1FQC A;  3FV2 A;  1URD A;  2ZZW A;  1B3E A;  1NUW A;  3QUF A;  3A3U A;  2O7U A;  1Y3P A;  1QUI A;  3G3I A;  5DTB A;  4LZ5 A;  5I57 B;  3TTR A;  3K6V A;  2FBP A;  3E79 A;  4DCX A;  4JXI A;  4OVQ A;  3IR1 A;  5HBC A;  5DEX B;  1FTK A;  4GQO A;  3MBP A;  3UA8 A;  1LFI A;  1FBF A;  1OVT A;  4R6K A;  4PC9 A;  3U65 A;  2AL4 A;  4FIM A;  2P0S A;  4NX1 A;  4OET A;  1DTZ A;  4PP0 A;  2FYI A;  4JBZ A;  3BFT A;  4GWU A;  2IEE A;  2XX7 A;  3ZS6 A;  5AA4 B;  4ND9 A;  3OO8 A;  3MP6 A;  1ZKB A;  3TTM A;  4MNI A;  1G0H A;  5DT6 A;  1Y3Q A;  4IO3 A;  2QS4 A;  1B4H A;  2V3T A;  3LSW A;  3O29 A;  1RDX A;  2DWJ A;  1XOC A;  1B32 A;  3MZ9 A;  2Z23 A;  4MH5 A;  4LN5 A;  5AA1 A;  2O6A A;  1B0H A;  4ELQ A;  4G68 B;  3HST A;  3MVX A;  4N17 A;  2I4B A;  2ANJ A;  2B4M A;  4KYE A;  5BUU A;  3FV1 A;  4MLV A;  3IO6 A;  2DDK A;  4N8G A;  4YB5 A;  1IME A;  4FEB A;  3O6H A;  2ALU A;  1NH8 A;  3LC8 A;  1SI1 A;  1KA0 A;  3MJN A;  1HSE A;  3RPL B;  1NV0 A;  3IOV A;  1DCU A;  2ESN A;  1TWY A;  1B4Z A;  1INP A;  4LP2 B;  4NF0 A;  4U1Z A;  4HTG A;  2Q8M A;  1FPD A;  4FOR A;  3Q29 A;  3LSX A;  3W9W A;  4XF5 A;  1US5 A;  1IIT A;  1VFD A;  4NQ8 A;  1MPB A;  2PT1 A;  3PUW E;  4NF8 A;  3IOT A;  1B7Z A;  1IXH A;  2XXK A;  2ONK E;  3P7I A;  1SVX B;  5ICQ A;  2I48 A;  5IZ3 B;  1MY1 A;  4QFP A;  3IO4 A;  2F6G A;  5CM6 A;  1H3D A;  3MAM A;  1PC3 A;  4OHN A;  2Z8D A;  4N91 A;  4PCD A;  1SPI A;  4U23 A;  1K9Z A;  4YAH X;  3IOW A;  3O6I A;  2FNC A;  3IX1 A;  1JVY A;  3FVK A;  2H5Y A;  4X8R A;  5DVJ A;  3SEX A;  1JVX A;  4IB2 A;  4MEV A;  2OWZ A;  2QRY A;  4O8M A;  1IMA A;  4BDL A;  5TPA A;  2DWH A;  1B3G A;  3L6G A;  3I3V A;  4U4X A;  4IO6 A;  4QBA A;  4P1L A;  3TTL A;  4KCD A;  4H6D A;  5H8H B;  1PB9 A;  1VE4 A;  1I6A A;  4NAP A;  3TFL A;  3ONM A;  3E3K A;  4PQJ A;  3QXM A;  3UGW A;  4JWY A;  1FW0 A;  1BTJ A;  1MG1 A;  5LOM A;  3NOH A;  3V89 B;  3VXC A;  4G8H A;  1FRP A;  3B8B A;  3H3G A;  4NF4 B;  4FJP A;  5KZT A;  5ITO A;  1DOT A;  1Y1M A;  1UTH A;  1IZ1 A;  2HFB A;  3TCF A;  2KLF A;  1B7U A;  3CG1 A;  3K6U A;  4RY1 A;  4P0I A;  2UVI A;  4N6D A;  1I6Q A;  4YB7 A;  1MXZ A;  2H9B A;  3HN0 A;  2PCR A;  4OVP A;  1NL5 A;  4MHF A;  1D4N A;  4X9T A;  4LQ5 A;  4LZ8 A;  4PAK A;  1B2H A;  2V3Q A;  1CE2 A;  4N13 A;  1UTB B;  4U1O A;  1LBZ A;  3VVD A;  4G77 A;  2W7Y A;  4XKQ A;  1OVB A;  1N3W A;  1GGG A;  3MZ1 A;  4LZ7 A;  4F1Y A;  3KN8 A;  3VVF A;  4F31 B;  2FA7 A;  4O3A A;  4XKP A;  3CR9 A;  4ISU A;  4PAI A;  1VSO A;  3D4C A;  1LAG E;  2HEU A;  3KBZ A;  1MXW A;  2F3D A;  5IZZ A;  4F3S A;  1NFT A;  4KXP A;  4H8I A;  3S9E A;  1AOV A;  2F36 A;  2OZZ A;  1S50 A;  3S2V A;  3OEK A;  3FD3 A;  3G3F A;  5EYF A;  1JET A;  3HCQ A;  5I56 B;  1B05 A;  1PB8 A;  2F7C A;  2REG A;  2DE2 A;  1LB8 A;  5CBS A;  1FPE A;  4FEC A;  2HXW A;  2OLB A;  2DE3 A;  2FHY A;  1FPF A;  1MM6 A;  4JDF A;  2HCA A;  2ONS A;  1SQY A;  4C1T A;  4PTK A;  2QVV A;  1ZBM A;  2WKY A;  1JEU A;  4OFO A;  2DWA A;  2CEY A;  3IB2 A;  3EKI A;  4NF5 A;  3M8U A;  5EYG A;  1ATG A;  2ZNU A;  5I57 A;  4F18 A;  1A8E A;  4EF2 A;  3FVG A;  1XT8 A;  3ROJ A;  4QRZ A;  2Y7R A;  3O66 A;  4EQB A;  4NED A;  3MVW A;  3KG2 A;  3RPW A;  3SEW A;  2QS2 A;  3PTY A;  4Q8R A;  5K2Y A;  5CI5 A;  3PMX A;  3BFU A;  5A5X A;  2DOJ A;  4GWO A;  1O64 A;  1FQA A;  1IXI A;  1KA1 A;  1NI9 A;  2F7B A;  4I9D A;  3QSL A;  3VV5 A;  4L17 A;  1GTK A;  1K9Y A;  1JW5 A;  2DVC A;  2O68 A;  3T9U A;  1LAX A;  1LLS A;  3TUS A;  1Y9U A;  2F97 A;  1PDA A;  2F5X A;  4IGR A;  3TOD A;  3WAF A;  1NUY A;  4GX4 A;  2LAO A;  5AA4 A;  3Q28 A;  4HCW A;  1A99 A;  5TPA B;  2XXV A;  2PMS A;  2HZL A;  3FXB A;  1DMB A;  4OZ9 A;  4UAB A;  1H43 A;  4WEP A;  3PUX E;  1GR2 A;  4GWX A;  1HSL A;  1P1O A;  1P99 A;  1SW2 A;  3CSG A;  1EU8 A;  4AS5 A;  1J1N A;  2ZZX A;  4ZEI A;  4POW A;  5EYH A;  4G68 A;  2X7Q A;  4DIG A;  2Q74 A;  4R2F A;  3CFX A;  4UAC A;  4MMP A;  4C1U A;  1B58 A;  3A09 A;  4IO2 A;  3LR1 A;  3KSJ A;  1ELJ A;  1Z7M E;  4BDM A;  3DP6 A;  3G3K A;  3OD7 A;  3PU5 A;  2I3V A;  3H06 B;  2UYF A;  3T96 B;  4QSD A;  4ZEF A;  4N4U A;  3SDF A;  2XHD A;  3KOS A;  2RC7 A;  3RPL A;  1LBV A;  4H46 A;  3BIH A;  2ZMB A;  4PGN A;  2WYP A;  1N7W A;  3OMB A;  4ELO A;  2Y5K A;  3TYH A;  3MP1 A;  3T1B A;  4YMA A;  4PAF A;  1URG A;  4HCY A;  2ZNT A;  2QSX A;  1NH7 A;  1MXU A;  2Y7P A;  1XS5 A;  5J1D A;  3OXN A;  1MXX A;  1FBC A;  4THI A;  3PGF A;  4H45 A;  5IZ3 A;  1JEV A;  5DYH A;  3PD8 A;  3MQ9 A;  2O1L A;  1SYH A;  3KJ7 A;  2OWT A;  3RT8 A;  5I7I A;  1PEB A;  4PF8 A;  1FPB A;  3HPI A;  2I0B A;  5HM4 B;  1Y4T A;  4NG7 A;  4JVD A;  3C35 A;  4U22 A;  2D21 A;  5CRY A;  2DVZ A;  2O1M A;  4RK9 A;  2QPQ A;  1FPL A;  4R2B A;  2B3F A;  1B3H A;  3OOA A;  3I6V A;  2QL3 A;  3CSB A;  1MS7 A;  4LVQ A;  2PFY A;  1B46 A;  2A5T A;  4GWW A;  1FTO A;  3D4G A;  3HV1 A;  5ISU A;  3LSL A;  2AL5 A;  3K4U A;  1N84 A;  2V84 A;  1IIW A;  3U8Q A;  3FXU A;  5H8H A;  1MQG A;  2O51 A;  4NF5 B;  4O3C A;  3U94 A;  4R9G A;  3TCH A;  4JVI A;  3OO6 A;  1EYI A;  5H8Q B;  4FAT A;  4PE5 B;  1YYZ A;  4MNC A;  2HPG A;  3CFZ A;  3K6W A;  2NWJ A;  4NF4 A;  2CZK A;  1NNK A;  5CMM A;  3TQW A;  5A5X B;  4YZZ A;  1BLF A;  4DE8 A;  4YU0 A;  2NVU B;  4OER A;  3AXF A;  3V8X B;  4QSE A;  4LA9 A;  4H5F A;  4X1B A;  3TEL A;  3E13 X;  1WOD A;  4P11 A;  5BWJ A;  4LQ2 A;  3B6T A;  4MBP A;  1NV3 A;  3LUZ A;  1UTB A;  4TLM B;  3C9H A;  3CG3 A;  1TFD A;  3O28 A;  2IA4 A;  3GBB A;  1FQE A;  4AB5 A;  2PFZ A;  4AQ4 A;  2X7P A;  4UA8 A;  4F2O A;  4EXK A;  2Y7K A;  4WXJ A;  3PPO A;  4U2R A;  1QUJ A;  5T3J A;  4M4G A;  2OK2 A;  3VE1 B;  3R7X A;  2THI A;  1M5C A;  1IMC A;  4BLA A;  1EYJ A;  3H03 A;  2VPN A;  1MM7 A;  2OJT A;  4FED A;  5HPQ A;  1I69 A;  3SET A;  2HAU A;  2YJP A;  3PMW A;  2O7I A;  4QFL A;  3S9M C;  1H76 A;  4C0R A;  1NUX A;  1P1U A;  4N6P A;  2O69 A;  1AH5 A;  2GHB A;  5A5L A;  5I56 A;  4F1V A;  2XX8 A;  4MJO A;  4YMB A;  4ZZE A;  3TPA A;  3PUY E;  1PBP A;  2YLN A;  5JTY B;  2D3I A;  4H67 A;  1MQI A;  1WDN A;  5EQA A;  3SEU A;  5F24 A;  1SW1 A;  1EZO A;  1Q35 A;  1YPN A;  1B1X A;  4I3Y A;  3UOR A;  5B7D A;  3TKD A;  1QUK A;  4MFI A;  4LON B;  4KFQ A;  3USD A;  3KN3 A;  1SI0 A;  4N81 A;  5DW8 A;  2AYS A;  1MDQ A;  4JSD A;  4JB7 A;  4DI3 D;  3PUZ E;  4DDD A;  4GWZ A;  3PMV A;  2PYY A;  4RA1 A;  1JQF A;  4PFW A;  3Q25 A;  1LBC A;  5I2N A;  2DQV A;  5CC2 A;  1FSA A;  1OLC A;  4EQ7 A;  4KR5 A;  4P0G A;  2GQ1 A;  3IB0 A;  3ZKL A;  4NHB A;  4GF8 A;  1I6B A;  3K1N A;  1FPJ A;  4TLL B;  2FVZ A;  2XXY A;  3QUJ A;  1LBY A;  1FTJ A;  2DS9 A;  5L9M A;  3RUM A;  2A5T B;  2REJ A;  3MVY A;  1B5J A;  4OFL A;  1NNF A;  4OEN A;  4Q5T A;  1O63 A;  2R9J A;  3U92 A;  1B52 A;  2Z8F A;  3JV9 A;  3IL1 B;  3H7M A;  1FPI A;  4NWC A;  4XXU A;  3SEY A;  3H4Z A;  4RNS A;  3BBR A;  2Q2A A;  4Z0I A;  4YKJ A;  3C33 A;  2XXQ A;  4PFU A;  2QJE A;  1USY E;  1BP5 A;  2XA5 A;  4ELP A;  3CI8 A;  5AA3 A;  3VFJ A;  2NOO A;  3A3C A;  4N15 A;  4F19 A;  3FUZ A;  1VR5 A;  3THI A;  3MWB A;  4HW8 A;  4QSC A;  1R9Q A;  2H98 A;  4DCY A;  3MST A;  3GYY A;  2RC9 A;  5K2X A;  3ILT B;  4ESW A;  1M5D A;  5TP9 B;  4H8J A;  3I5O A;  4G4P A;  5KCJ B;  2GRV A;  3H6U A;  1IEJ A;  3ZSF A;  1FBP A;  2B4L A;  1YAE A;  4IO5 A;  1MH4 A;  1FCK A;  3CIJ A;  1VFE A;  4RYA A;  4QFN A;  3UK4 A;  3ILU B;  3FAT A;  1FTL A;  1DTG A;  4K3F A;  1Y3N A;  1QVS A;  3K00 A;  3K0V A;  4ONY A;  4R74 A;  3K02 A;  1LST A;  1SD3 A;  2HHM A;  3B6W A;  3SER A;  3G3G A;  3MPK A;  4JWO A;  3TEP A;  4GXA A;  4ZEC A;  4R9F A;  3W9V A;  2O84 X;  2ZYK A;  2MKZ A;  2G93 A;  3T22 A;  4ZED A;  1ZMG A;  3KGC A;  1UIV A;  4HXV A;  4P47 A;  4ZS9 A;  2VD2 A;  4NWD A;  1GVC A;  5H8S A;  4N6K A;  3IFC A;  3CFL A;  3FZV A;  4PDD A;  3GBA A;  2QMX A;  2XXI A;  2F6P A;  2FIX A;  4YKP A;  1FPG A;  4XKN A;  4IY6 A;  3PD9 A;  1OQH A;  3FJ7 A;  2XXW A;  1MY3 A;  2HQ0 A;  4YKK A;  1D9Y A;  2CZL A;  2OWS A;  1JW4 A;  2R8T A;  1D9V A;  1BK4 A;  4GL0 A;  4IO7 A;  1B40 A;  2RCB A;  4KD5 A;  3N6U A;  1ZU0 A;  1NV2 A;  1R9L A;  4GXS B;  4KQP A;  1A54 A; 
#chains in the Genus database with same CATH homology
 2ONR A;  4IY5 A;  3S4U A;  5H8Q A;  1RKM A;  4JWX A;  5FHN A;  5H8N B;  3EHU A;  4OXV A;  1NNP A;  2GH9 A;  2R71 A;  4NTL A;  4Q30 B;  1AIV A;  1LB9 A;  3SKP A;  4M1V A;  3DM0 A;  1M5E A;  3JZJ A;  1JW1 A;  1MDP 1;  5I2N B;  1XHY A;  5IAI A;  3TTN A;  3OEN A;  3SEV A;  2Q9T A;  3C4M A;  1LAH E;  4GD5 A;  3M3F A;  4OQO A;  4YB6 A;  3HHG A;  3RN8 A;  3Q27 A;  3FGS A;  4Q0C A;  2HZK A;  3VLW A;  3EF7 A;  3EHT A;  2I4C A;  3IOU A;  2Z22 A;  2RF1 A;  2UXA A;  4EUO A;  3C32 A;  3UIF A;  1B5I A;  4E0W A;  3MPL A;  1URS A;  1KWH A;  3BKI B;  2XXH A;  3H6T A;  4DLD A;  3F11 A;  1AMF A;  1RYO A;  3HO7 A;  4FE8 A;  3PPQ A;  1NNT A;  5JEI A;  1ANF A;  5CMB A;  3OSQ A;  1H44 A;  3T9V A;  2G29 A;  1MQD A;  1EZP A;  5I58 B;  1NKX A;  1B5H A;  1WVJ A;  3EPE A;  1POT A;  3CVG A;  3WAE A;  1UIU A;  3OO7 A;  4AB6 A;  5JTY A;  3IAZ A;  4G8M A;  2Q89 A;  3PPR A;  4RJZ A;  1SDX A;  4NF6 B;  5AA2 B;  2A5S A;  5IKB A;  3VLU A;  5TU0 A;  1QJM A;  2P2A A;  5FTI A;  4EXL A;  1MH3 A;  4KPT A;  4I8C A;  3V83 A;  1Z7N E;  3FVN A;  1TFA A;  4I62 A;  5KDT A;  2B3B A;  1LAF E;  3ZKK A;  2X26 A;  3SES A;  2DP8 A;  5ICT A;  4EQ9 A;  1S9T A;  3RY3 A;  4GVO A;  4FAJ A;  1A55 A;  1EH3 A;  1SYI A;  5JK4 A;  2VHA A;  4HS7 A;  1YCJ A;  4R72 A;  1IXC A;  1M5B A;  3K1P A;  3CRB A;  4F2Q A;  1Y20 A;  3LBS A;  1D3K A;  2I3W A;  2ABH A;  5L8D A;  1ZTY A;  1SW5 A;  4LAT A;  1FQB A;  2QS3 A;  2NUV A;  4ZEK A;  3KSX A;  3O9P A;  4YIC A;  5H8F B;  4G2Z A;  4OEV A;  3C34 A;  4H65 A;  4TOZ A;  1SBP A;  4ZE8 A;  2F35 A;  3MUQ A;  3PV0 E;  4RK2 A;  2ZYO A;  3OEM A;  4EDP A;  3DEL B;  4GRK A;  3PPP A;  5TP9 A;  5ELV A;  3ECR A;  4DZ1 A;  3FVO A;  5KCJ A;  2AIX A;  1SW4 A;  4WED A;  1A54 A;  1XVY A;  3PUV E;  3T9H B;  2ZYM A;  4F22 A;  3FXQ A;  1DPP A;  2H25 A;  2VD3 A;  2XXP A;  3MC2 A;  5FHM A;  3GLB A;  5FTH A;  1TXF A;  5I2K B;  3IOR A;  3U1O A;  3TDJ A;  4E0X A;  3N26 A;  3S9L C;  4RPN A;  1IUD A;  2Y7W A;  3IJO B;  3T9X B;  4MLQ A;  4R73 A;  1IQ7 A;  2RIN A;  3MW0 A;  1YTV A;  2Z8E A;  2XD3 A;  3RTF B;  3O97 A;  1USY H;  3N94 A;  3FJM A;  4JSO A;  4BDQ A;  2H4I A;  4OMB A;  3U93 A;  1B0L A;  1Q1K A;  3G7W A;  3DP8 A;  4KHZ E;  2XXT A;  3EQ1 A;  1UQW A;  3TQL A;  4IO4 A;  4X48 A;  3TZA A;  2F34 A;  4MF3 A;  4ELR A;  3HHF A;  5H8N A;  3QAX A;  1MY4 A;  5CMC A;  2XXR A;  1B3F A;  3S9N C;  1RYX A;  3K01 A;  5I59 B;  4QFK A;  3OO9 A;  1XVX A;  3V5A A;  5KDT B;  4O3B A;  3R26 A;  3N6T A;  1ZLQ A;  4XTC Q;  2PT2 A;  1QKA A;  1LGB C;  2F7A A;  2XD2 A;  2XX9 A;  2ZYN A;  3OSR A;  3TAJ A;  3TCG A;  1R1N A;  1PBQ A;  4KYD A;  1POY 1;  3KZG A;  4GOT A;  2UYE A;  4DXC A;  4GFR A;  3KEI A;  1XC1 A;  1ZIU A;  4G68 C;  2VGQ A;  1MQJ A;  4EF1 A;  2QMW A;  3KJT A;  3PPN A;  3O6G A;  3DLN A;  1H45 A;  3LUY A;  1OLA A;  4WKM A;  2I49 A;  1Y1Z A;  3FAS A;  3T66 A;  4PFT A;  4OFJ A;  2I0C A;  1L5T A;  3FJG A;  4KCC A;  2DXR A;  3VDF A;  1PB7 A;  2I6E A;  4U21 A;  5I58 A;  4R6H A;  5FHO A;  4U4S A;  3IK6 B;  4H5G A;  4OVJ A;  3KOT A;  1BIY A;  4ZE9 A;  3TTK A;  4OWD A;  5AE4 A;  2VOZ A;  1LFH A;  4RPO A;  4NF6 A;  5AA2 A;  2XXX A;  4IGT A;  5L9O A;  3RT6 B;  3C36 A;  1FQD A;  3K6X A;  2QS1 A;  1M5F A;  1MY2 A;  4ECF A;  1AL3 A;  3OEL A;  1N04 A;  3MVZ A;  4LUB A;  2VP1 A;  4NE4 A;  2P1S A;  4BDO A;  1QW0 A;  2RC8 A;  4R75 A;  1LBB A;  1MRP A;  3QYT A;  3RNN A;  4BDR A;  2OCU A;  1A40 A;  4Z7E A;  1MY0 A;  3TMG A;  4QF9 A;  1LCF A;  3K1M A;  1EZ9 A;  3JYR A;  2DYX A;  2Q8J A;  4F3G A;  1O7T A;  2E0S A;  1MXY A;  2M8C A;  2I58 A;  4F39 A;  1TT1 A;  2F78 A;  1FQF A;  1MPC A;  1P1Q A;  4F3B A;  1LCT A;  1IXG A;  2PX1 A;  1B3L A;  1A8F A;  5F7V A;  4POX A;  3KBR A;  5H8F A;  5EHM A;  1P1W A;  2RCA A;  4DXU A;  4I1D A;  5F1Q A;  3ODB A;  1B7H A;  3QK6 A;  2OBG A;  4ZDM A;  1N7X A;  2PBW A;  2D5W A;  4YKI A;  3L6H A;  4KI0 E;  3VXB A;  2UVG A;  4QFO A;  1II5 A;  2GHA A;  3GZG A;  4NF8 B;  4R6Y A;  2DSF A;  3EN3 A;  2R6G E;  3VLV A;  3T93 B;  2GFE A;  4PET A;  2RKM A;  3K2D A;  4OEU A;  2DE4 A;  4GLI A;  5B70 A;  5DEX A;  3RTW B;  1B1H A;  3W15 C;  1HSJ A;  4XIG Q;  1N0T A;  3LSF B;  5L9S A;  5AA2 D;  2Y7I A;  1S7Y A;  1DPE A;  4PFY A;  2Q2C A;  3E9X A;  3RQT A;  1T0K A;  2YPN A;  3KN7 A;  4N07 A;  3U72 A;  1B6H A;  1N76 A;  4BDN A;  4OES A;  5ITP A;  2E1S A;  5I2K A;  1LFG A;  1NMU A;  2H99 A;  4ZEB A;  1P1N A;  3G3H A;  3QIM A;  1DSN A;  1A7L A;  4G8N A;  1R6Z A;  2V93 A;  4GL8 A;  5EHS A;  3VVE A;  1B51 A;  3G3J A;  3IJX B;  5M2V A;  4F3P A;  3UP9 A;  3H6W A;  5DVI A;  1F9B A;  3R6U A;  1MXV A;  3Q26 A;  1B9J A;  3M3L A;  1GV8 A;  3IB1 A;  2DWI A;  5CBR A;  1QUL A;  2Y84 A;  1UTH B;  3FIR A;  2F8D A;  2PVU A;  4TQU Q;  1QKB A;  3E4R A;  3EHS A;  2Q88 A;  4ZZA A;  3B7D A;  2V25 A;  5I84 A;  1BKA A;  4ESX A;  4F1U A;  1MPD A;  2BJJ X;  1Y4C A;  3RGY A;  1MQH A;  4KYS A;  5CMK A;  4GIZ A;  3C31 A;  1OIB A;  4DXB A;  4NMY A;  3O2A A;  2HAV A;  5I59 A;  4X1D A;  2XXU A;  3H6V A;  2V3U A;  5DVF A;  3B6Q A;  3MZB A;  2DXY A;  2ZNS A;  4H1X A;  1ZJL A;  4RXL A;  4XKR A;  1US4 A;  1OQG A;  1CB6 A;  3KFM A;  3GXA A;  3RLF E;  3UN6 A;  1JNF A;  2UVJ A;  1FTM A;  2CMO A;  4QHQ A;  1OMP A;  3MP8 A;  3M3K A;  4OTE A;  2ZXT A;  2UVH A;  2B65 A;  3N5L A;  2NXO A;  4F29 A;  3DP4 A;  4H0W A;  4OYV A;  3FXR A;  1N3X A;  1FQC A;  3FV2 A;  1URD A;  1B3E A;  3QUF A;  3A3U A;  2O7U A;  1Y3P A;  1QUI A;  3G3I A;  5DTB A;  4LZ5 A;  5I57 B;  3TTR A;  3K6V A;  4DCX A;  4JXI A;  3IR1 A;  5HBC A;  5DEX B;  1FTK A;  4GQO A;  3MBP A;  3UA8 A;  1LFI A;  1OVT A;  4R6K A;  2AL4 A;  4FIM A;  2P0S A;  4OET A;  1DTZ A;  4PP0 A;  2FYI A;  4JBZ A;  3BFT A;  2IEE A;  2XX7 A;  3ZS6 A;  5AA4 B;  4ND9 A;  3OO8 A;  3MP6 A;  1ZKB A;  3TTM A;  5DT6 A;  1Y3Q A;  4IO3 A;  2QS4 A;  1B4H A;  2V3T A;  3LSW A;  3O29 A;  2DWJ A;  1XOC A;  1B32 A;  3MZ9 A;  2Z23 A;  4MH5 A;  5AA1 A;  2O6A A;  1B0H A;  4ELQ A;  4G68 B;  3HST A;  3MVX A;  2I4B A;  2ANJ A;  4KYE A;  5BUU A;  3FV1 A;  4MLV A;  3IO6 A;  4YB5 A;  4FEB A;  3O6H A;  2ALU A;  1NH8 A;  3LC8 A;  1SI1 A;  3MJN A;  1HSE A;  3IOV A;  2ESN A;  1TWY A;  1B4Z A;  4LP2 B;  4U1Z A;  4HTG A;  4FOR A;  3Q29 A;  3LSX A;  3W9W A;  1US5 A;  1IIT A;  1VFD A;  1MPB A;  2PT1 A;  3PUW E;  4NF8 A;  3IOT A;  1B7Z A;  1IXH A;  2ONK E;  3P7I A;  1SVX B;  5ICQ A;  2I48 A;  1MY1 A;  4QFP A;  3IO4 A;  2F6G A;  5CM6 A;  1H3D A;  3MAM A;  1PC3 A;  4OHN A;  2Z8D A;  4U23 A;  4YAH X;  3IOW A;  3O6I A;  2FNC A;  3IX1 A;  1JVY A;  3FVK A;  2H5Y A;  5DVJ A;  3SEX A;  1JVX A;  4IB2 A;  2QRY A;  4BDL A;  5TPA A;  2DWH A;  1B3G A;  3L6G A;  3I3V A;  4U4X A;  4IO6 A;  3TTL A;  4KCD A;  4H6D A;  5H8H B;  1VE4 A;  1I6A A;  3TFL A;  3ONM A;  3E3K A;  4PQJ A;  3QXM A;  3UGW A;  4JWY A;  1FW0 A;  1BTJ A;  1MG1 A;  5LOM A;  3V89 B;  3VXC A;  4G8H A;  3H3G A;  4NF4 B;  4FJP A;  5KZT A;  5ITO A;  1DOT A;  1Y1M A;  1UTH A;  1IZ1 A;  2HFB A;  3TCF A;  2KLF A;  1B7U A;  3CG1 A;  3K6U A;  4RY1 A;  4P0I A;  2UVI A;  1I6Q A;  4YB7 A;  1MXZ A;  2H9B A;  3HN0 A;  1NL5 A;  1D4N A;  4X9T A;  4LQ5 A;  4LZ8 A;  1B2H A;  2V3Q A;  1CE2 A;  4N13 A;  1UTB B;  4U1O A;  3VVD A;  4G77 A;  2W7Y A;  4XKQ A;  1OVB A;  1N3W A;  1GGG A;  3MZ1 A;  4LZ7 A;  4F1Y A;  3KN8 A;  3VVF A;  4F31 B;  2FA7 A;  4O3A A;  4XKP A;  3CR9 A;  4ISU A;  1VSO A;  3D4C A;  1LAG E;  2HEU A;  1MXW A;  4F3S A;  1NFT A;  4H8I A;  3S9E A;  1AOV A;  2F36 A;  2OZZ A;  1S50 A;  3S2V A;  3OEK A;  3FD3 A;  3G3F A;  5EYF A;  1JET A;  3HCQ A;  5I56 B;  1B05 A;  1PB8 A;  2F7C A;  2REG A;  2DE2 A;  1LB8 A;  5CBS A;  4FEC A;  2HXW A;  2OLB A;  2DE3 A;  1MM6 A;  4JDF A;  2HCA A;  2ONS A;  1SQY A;  4C1T A;  1ZBM A;  2WKY A;  1JEU A;  4OFO A;  2DWA A;  3IB2 A;  4NF5 A;  3M8U A;  1ATG A;  2ZNU A;  5I57 A;  4F18 A;  1A8E A;  4EF2 A;  3FVG A;  1XT8 A;  2Y7R A;  4QRZ A;  3O66 A;  4EQB A;  4NED A;  3MVW A;  3KG2 A;  3RPW A;  3SEW A;  2QS2 A;  4Q8R A;  5K2Y A;  5CI5 A;  5A5X A;  3BFU A;  3PMX A;  2DOJ A;  4GWO A;  1O64 A;  1FQA A;  1IXI A;  2F7B A;  4I9D A;  3QSL A;  3VV5 A;  4L17 A;  1GTK A;  1JW5 A;  2DVC A;  2O68 A;  3T9U A;  1LAX A;  1LLS A;  3TUS A;  1Y9U A;  2F97 A;  1PDA A;  2F5X A;  4IGR A;  3TOD A;  3WAF A;  2LAO A;  5AA4 A;  3Q28 A;  4HCW A;  1A99 A;  5TPA B;  2XXV A;  2PMS A;  2HZL A;  1DMB A;  4OZ9 A;  1H43 A;  4WEP A;  3PUX E;  1GR2 A;  1HSL A;  1P1O A;  1P99 A;  1SW2 A;  3CSG A;  1EU8 A;  1J1N A;  4ZEI A;  4POW A;  4G68 A;  2X7Q A;  4DIG A;  4R2F A;  3CFX A;  4UAC A;  4C1U A;  1B58 A;  3A09 A;  4IO2 A;  3LR1 A;  3KSJ A;  1ELJ A;  1Z7M E;  4BDM A;  3DP6 A;  3G3K A;  3OD7 A;  3PU5 A;  2I3V A;  3T96 B;  2UYF A;  3H06 B;  4QSD A;  4ZEF A;  3SDF A;  2XHD A;  3KOS A;  2RC7 A;  2ZMB A;  1N7W A;  3OMB A;  4ELO A;  3TYH A;  3MP1 A;  4YMA A;  1URG A;  4HCY A;  2ZNT A;  2QSX A;  1NH7 A;  1MXU A;  2Y7P A;  1XS5 A;  5J1D A;  3OXN A;  1MXX A;  4THI A;  3PGF A;  1JEV A;  5DYH A;  3PD8 A;  3MQ9 A;  2O1L A;  1SYH A;  3KJ7 A;  2OWT A;  3RT8 A;  1PEB A;  3HPI A;  2I0B A;  5HM4 B;  1Y4T A;  3C35 A;  4U22 A;  2D21 A;  5CRY A;  2DVZ A;  2O1M A;  4RK9 A;  2QPQ A;  4R2B A;  2B3F A;  1B3H A;  3OOA A;  3I6V A;  2QL3 A;  3CSB A;  1MS7 A;  4LVQ A;  1B46 A;  2A5T A;  1FTO A;  3D4G A;  3HV1 A;  5ISU A;  3LSL A;  2AL5 A;  3K4U A;  1N84 A;  2V84 A;  1IIW A;  3U8Q A;  3FXU A;  5H8H A;  1MQG A;  2O51 A;  4NF5 B;  4O3C A;  3U94 A;  4R9G A;  3TCH A;  3OO6 A;  5H8Q B;  4FAT A;  4PE5 B;  3CFZ A;  3K6W A;  2NWJ A;  4NF4 A;  1NNK A;  5CMM A;  3TQW A;  5A5X B;  4YZZ A;  1BLF A;  4DE8 A;  4YU0 A;  2NVU B;  4OER A;  3AXF A;  3V8X B;  4QSE A;  4LA9 A;  4H5F A;  4X1B A;  3TEL A;  3E13 X;  1WOD A;  4P11 A;  5BWJ A;  4LQ2 A;  3B6T A;  4MBP A;  1UTB A;  4TLM B;  3C9H A;  3CG3 A;  1TFD A;  3O28 A;  2IA4 A;  3GBB A;  1FQE A;  4AB5 A;  4AQ4 A;  2X7P A;  4UA8 A;  4F2O A;  4EXK A;  2Y7K A;  4WXJ A;  3PPO A;  4U2R A;  1QUJ A;  4M4G A;  2OK2 A;  3VE1 B;  3R7X A;  2THI A;  1M5C A;  4BLA A;  3H03 A;  1MM7 A;  2OJT A;  4FED A;  5HPQ A;  1I69 A;  3SET A;  2HAU A;  2YJP A;  3PMW A;  2O7I A;  4QFL A;  3S9M C;  1H76 A;  4C0R A;  1P1U A;  4N6P A;  2O69 A;  1AH5 A;  2GHB A;  5I56 A;  4F1V A;  2XX8 A;  4YMB A;  4ZZE A;  3TPA A;  3PUY E;  1PBP A;  2YLN A;  5JTY B;  2D3I A;  4H67 A;  1MQI A;  1WDN A;  3SEU A;  1SW1 A;  1EZO A;  1Q35 A;  1YPN A;  1B1X A;  3UOR A;  5B7D A;  3TKD A;  1QUK A;  4MFI A;  4LON B;  4KFQ A;  3USD A;  3KN3 A;  1SI0 A;  2AYS A;  1MDQ A;  4JSD A;  4JB7 A;  3PUZ E;  4DDD A;  3PMV A;  2PYY A;  4RA1 A;  1JQF A;  4PFW A;  3Q25 A;  1LBC A;  5I2N A;  2DQV A;  5CC2 A;  1OLC A;  4EQ7 A;  4KR5 A;  4P0G A;  3IB0 A;  3ZKL A;  4GF8 A;  1I6B A;  3K1N A;  4TLL B;  2XXY A;  3QUJ A;  1FTJ A;  2DS9 A;  5L9M A;  3RUM A;  2A5T B;  2REJ A;  3MVY A;  1B5J A;  4OFL A;  1NNF A;  4OEN A;  4Q5T A;  1O63 A;  2R9J A;  3U92 A;  1B52 A;  2Z8F A;  3JV9 A;  3IL1 B;  3H7M A;  4XXU A;  4NWC A;  3SEY A;  3H4Z A;  4RNS A;  3BBR A;  2Q2A A;  4Z0I A;  4YKJ A;  3C33 A;  2XXQ A;  4PFU A;  2QJE A;  1USY E;  1BP5 A;  4ELP A;  3CI8 A;  5AA3 A;  3VFJ A;  2NOO A;  3A3C A;  4F19 A;  3FUZ A;  1VR5 A;  3THI A;  3MWB A;  4HW8 A;  4QSC A;  1R9Q A;  2H98 A;  4DCY A;  2RC9 A;  5K2X A;  3ILT B;  4ESW A;  1M5D A;  5TP9 B;  4H8J A;  3I5O A;  4G4P A;  5KCJ B;  2GRV A;  3H6U A;  1IEJ A;  3ZSF A;  1YAE A;  4IO5 A;  1MH4 A;  1FCK A;  3CIJ A;  1VFE A;  4RYA A;  4QFN A;  3UK4 A;  3ILU B;  3FAT A;  1FTL A;  1DTG A;  4K3F A;  1Y3N A;  1QVS A;  3K00 A;  3K0V A;  4ONY A;  4R74 A;  3K02 A;  1LST A;  1SD3 A;  3B6W A;  3SER A;  3G3G A;  3MPK A;  4JWO A;  3TEP A;  4GXA A;  4ZEC A;  4R9F A;  3W9V A;  2O84 X;  2ZYK A;  2G93 A;  3T22 A;  4ZED A;  1ZMG A;  3KGC A;  1UIV A;  4ZS9 A;  2VD2 A;  4NWD A;  1GVC A;  5H8S A;  3CFL A;  3FZV A;  3GBA A;  2QMX A;  2XXI A;  2F6P A;  4YKP A;  4XKN A;  4IY6 A;  3PD9 A;  1OQH A;  3FJ7 A;  2XXW A;  1MY3 A;  2HQ0 A;  4YKK A;  1D9Y A;  2CZL A;  2OWS A;  1JW4 A;  1D9V A;  4GL0 A;  4IO7 A;  1B40 A;  2RCB A;  4KD5 A;  3N6U A;  1ZU0 A;  1R9L A;  4GXS B;  4KQP A;  1PB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...