5H8QB

Structure of the human glun1/glun2a lbd in complex with gne8324
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
284
structure length
281
Chain Sequence
b'TRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor ionotropic, NMDA 2A,Glutamate receptor io
publication title Positive Allosteric Modulators of GluN2A-Containing NMDARs with Distinct Modes of Action and Impacts on Circuit Function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 80
structure length 281
sequence length 284
ec nomenclature
pdb deposition date 2015-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5h8qB01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5h8qB02
4H5FA 2V25A 2RINA 4GXSB 1YAEA 3C33A 3OEMA 1IEJA 4FORA 3HPIA 2OLBA 1R9LA 2PT2A 3B7DA 4QFOA 1B5JA 3G3IA 3MVYA 2HQ0A 1TXFA 3IOUA 4RNSA 1IITA 1SI0A 3B6WA 3FUZA 4OMBA 3K6VA 4H1XA 4DDDA 3ODBA 1ATGA 1MPDA 2ANJA 3IO4A 4NF8A 1PB7A 2ONKE 2PMSA 3IORA 3H3GA 2AIXA 3TAJA 4JWXA 3H6TA 2HZLA 1R1NA 1GR2A 4H67A 1FTLA 3VVDA 1FQDA 4YKKA 2HAUA 4G2ZA 1MY2A 1LCFA 4JB7A 1B7UA 4U21A 5H8SA 1N04A 3MP6A 4N13A 1B7ZA 5DEXB 4R6KA 1MQHA 1PBPA 1FTKA 1MXXA 3ZSFA 4GF8A 4F3PA 4GRKA 3KSXA 2DQVA 1XOCA 3USDA 4ZEKA 4JDFA 4KCCA 2RC7A 3SEVA 2P0SA 3MVWA 4PP0A 4IO2A 3K1NA 2VOZA 1MG1A 4NE4A 4G68B 4RJZA 3CFLA 5BWJA 4ZECA 3IL1B 2ZMBA 2ZYKA 4H5GA 5AA4B 1N84A 2I0CA 1B5HA 4JWOA 3W9VA 1DMBA 4HW8A 4U1ZA 1EU8A 1ZIUA 3T9HB 3U94A 4GOTA 3ILUB 3DELB 2X7PA 3S9LC 3FZVA 1QUKA 2VD3A 3OO7A 2Z22A 3PGFA 1MY1A 4YAHX 5CMMA 3TTMA 3OENA 4GIZA 1BTJA 2F34A 3T9UA 1OVBA 4JSDA 4IY6A 2Q9TA 4YKIA 3WAFA 1NNFA 3QAXA 1MQDA 4RK2A 2RC8A 3LSXA 3OD7A 1B3HA 3KOSA 1MH4A 5CMKA 2UVGA 1AMFA 2HXWA 2ZYOA 5IAIA 3CFXA 4RK9A 2GHBA 1S7YA 1MH3A 4JSOA 2ONRA 1R6ZA 4GLIA 4EF2A 1B4ZA 2Q88A 2F6GA 5I57A 1II5A 1P1QA 4UA8A 3ECRA 1SW5A 4FATA 3LBSA 1H43A 2YJPA 3M3FA 3OMBA 3R7XA 2I4BA 2QPQA 1IIWA 3K01A 3TELA 3MUQA 2QMWA 3PMVA 1MQJA 3LSWA 3TQLA 1LB9A 3T66A 5CC2A 4F18A 4AQ4A 1LGBC 1ZKBA 1SW1A 1Y20A 1Y9UA 2DSFA 5F7VA 1XT8A 3KSJA 2V84A 3DP4A 4F22A 2R9JA 3SETA 3VLVA 2QS3A 3N6TA 3IJOB 3TTKA 3LUYA 3FATA 3H03A 5DYHA 4C1TA 1BKAA 4NF8B 5H8NB 1JNFA 3PUWE 5IKBA 3JYRA 4G77A 2QS2A 4MH5A 3ONMA 4OYVA 5TPAB 1VSOA 4HCYA 2F36A 1H44A 5JTYB 3FJ7A 4O3AA 4ELPA 5A5XB 5KCJB 3HHGA 4NF4A 1JEVA 3V89B 4DLDA 5FTIA 4GVOA 4P0IA 4R2FA 4ZZAA 3FASA 4EXKA 3UIFA 3IK6B 1NNKA 2Z23A 4MFIA 4LUBA 2QRYA 3V8XB 5CBSA 3RT6B 4OVJA 3IB0A 1MM6A 3F11A 4DXBA 4EXLA 5K2YA 3P7IA 1NH8A 1JETA 1US4A 1SW4A 4LONB 1VFEA 2DWHA 1UIVA 4YB5A 4YZZA 1ZBMA 1RYOA 3T22A 3I6VA 1B1HA 4XKRA 4WEDA 1HSJA 4FAJA 4EQ7A 1FQEA 3VFJA 5I2NB 2XHDA 5ICQA 2DS9A 5AA2B 1LFHA 3K1PA 1O64A 4BDLA 1JW1A 4Q0CA 1F9BA 1Q35A 2V3TA 1MPCA 2O69A 4XKQA 1M5DA 3LSLA 4ECFA 3K02A 1B3GA 5H8HA 1B58A 4BLAA 2REJA 4PFTA 4NWCA 5H8FB 3QYTA 2XXQA 1MPBA 5I58A 3MZ1A 3W15C 4H0WA 3TCHA 2I48A 2OWTA 1D4NA 3PD9A 1UTBB 5L9OA 2O1LA 2HZKA 1O7TA 2UXAA 4RPNA 3OOAA 4AB5A 4H65A 1FTOA 4R9GA 1PDAA 1LFGA 2UVIA 4ND9A 1LFIA 3A09A 2HEUA 2D3IA 2XXIA 2VHAA 2O51A 1UTHA 4R75A 2VD2A 3HO7A 2Y7KA 1VR5A 4NF6A 4U23A 3G3FA 2IEEA 4OESA 2B3FA 2OBGA 1FQFA 4DCYA 1AL3A 4F39A 5I59A 2NOOA 3U92A 2ZXTA 3AXFA 4FEDA 2ZNTA 5AE4A 3QSLA 3QUFA 4IO4A 4N6PA 1NL5A 3FGSA 3MJNA 3KN3A 1FQBA 1JW5A 3OO9A 1M5EA 1DTGA 5DTBA 2KLFA 3N26A 4NEDA 4NF5A 4NMYA 4RA1A 2FYIA 2XXUA 3PUZE 2V93A 1FCKA 1SYHA 2D21A 2F8DA 2DWAA 1ZJLA 4KR5A 3OXNA 3CR9A 1GGGA 3PMWA 4I62A 4NF4B 2YLNA 2OJTA 4LZ8A 2QS4A 4IO7A 4WXJA 2DWIA 2FA7A 5CRYA 4LP2B 1LLSA 1M5FA 4IY5A 4JBZA 4LATA 3CRBA 3ZKLA 4O3CA 4MLQA 1D9YA 2O1MA 3JZJA 2Y7PA 4UACA 3CVGA 3QUJA 3FD3A 3EHTA 3PUVE 4MF3A 3TFLA 3Q26A 3DP6A 5FHOA 4XKPA 3MPKA 4PFYA 4Q30B 2P2AA 2ZYMA 1N0TA 3K00A 3OO8A 3EHSA 2AYSA 3BFTA 3K0VA 1URSA 1AOVA 1JW4A 4QSDA 4JWYA 2ZYNA 1A54A 3MAMA 4OQOA 2Z8EA 2PT1A 3I3VA 3V5AA 4U4SA 5I84A 1USYH 3CG3A 2XX7A 4OFOA 3PPOA 2DWJA 3U1OA 1SW2A 3K2DA 1URGA 3HSTA 1ZTYA 1IXHA 1Y4TA 3R6UA 3E13X 4EQBA 1MY0A 4R6HA 3E3KA 3ILTB 3TTRA 2NXOA 1IUDA 4QFPA 4QFLA 1WDNA 3RQTA 4E0XA 3FXUA 3RPWA 3G3JA 1A55A 3G3HA 4NTLA 2DXYA 1PC3A 2G93A 4ZZEA 4KQPA 3MZBA 2OCUA 3Q28A 4M4GA 4U1OA 4POXA 4GD5A 4BDRA 4WKMA 1EZPA 2F97A 3QIMA 1R9QA 3PV0E 1UTHB 3RLFE 2RCAA 2HCAA 1SBPA 5ELVA 4ZEIA 3D4GA 1Y1MA 4R74A 4FE8A 2D5WA 1P1WA 1P1OA 3HN0A 5CMCA 1LAFE 2VP1A 2X26A 4KD5A 4C0RA 3IOWA 4Z7EA 1B3FA 2VGQA 4HCWA 2E1SA 1N7XA 2DE2A 4AB6A 1SDXA 2I4CA 3G3GA 4NF5B 2O7IA 4EUOA 1LCTA 1JEUA 1SD3A 1FTMA 3Q25A 1D3KA 2H25A 5JK4A 3OSRA 2O6AA 1XVYA 1AH5A 4IO6A 1B2HA 5J1DA 4QSCA 5DVJA 2H5YA 1TFAA 3N6UA 5F1QA 3GZGA 3UN6A 1QKAA 1Y1ZA 1J1NA 2XXHA 2O68A 1MQIA 3TCGA 2DXRA 4F2QA 2HFBA 4HS7A 1EZOA 2IA4A 1JQFA 2F78A 2H98A 4YMAA 3G7WA 1Z7NE 1TWYA 3SEWA 4I9DA 1US5A 3K6WA 2NWJA 2F6PA 4OFJA 1SVXB 4P11A 4OENA 4IGTA 4EQ9A 2Y7RA 3MBPA 5FTHA 3S9NC 5FHMA 4FECA 1OMPA 1B46A 3RTFB 2PVUA 3H6UA 4BDNA 4OFLA 5H8QA 3KBRA 1L5TA 1LAXA 2DP8A 1JVXA 4POWA 1B6HA 3JV9A 4OXVA 4KYDA 3T9VA 1NKXA 4DIGA 2XD2A 3TZAA 3H6WA 3HCQA 4FIMA 1MXYA 1DPEA 3V83A 3TTLA 5AA2D 4YU0A 3FVNA 4M1VA 3EN3A 1FQCA 2UVHA 3SDFA 1CB6A 1A8EA 3GXAA 3FV2A 4ZEBA 2V3UA 3FXRA 4LQ5A 4OEVA 5DT6A 3UA8A 3K1MA 1T0KA 3U93A 4JXIA 3M3LA 3CIJA 4C1UA 1POY1 2GHAA 1GTKA 4O3BA 5JEIA 4G8NA 4QFKA 3FXQA 1Z7ME 1XVXA 3MWBA 1NNTA 1WVJA 4ELRA 1BP5A 4DE8A 1OIBA 2H99A 3VLWA 2XXYA 2F7AA 3CSBA 1M5BA 2CZLA 2QJEA 1RYXA 2QSXA 3VDFA 4MLVA 3PPRA 1RKMA 3IX1A 1IZ1A 3K4UA 1QULA 1XHYA 3HHFA 1B5IA 1P1NA 1SQYA 4KHZE 4F1UA 3ZKKA 5BUUA 1B4HA 4U2RA 3PUXE 4G4PA 3CSGA 2M8CA 3VE1B 2UYFA 4PFWA 3IJXB 3O28A 1A8FA 1WODA 5ITPA 4G8MA 5CMBA 2ONSA 5I57B 4X48A 4X1BA 3VXBA 3RTWB 3K6UA 1OVTA 4OZ9A 3S2VA 2NVUB 3FJGA 4YB6A 4ELQA 3L6HA 1DSNA 3MZ9A 2XXPA 3A3CA 2OK2A 3UK4A 5KZTA 3HV1A 3LC8A 2V3QA 2QS1A 1NNPA 1VE4A 2RC9A 1PBQA 4U22A 1A40A 1FW0A 4XIGQ 3D4CA 5I2KA 2UYEA 1MY3A 1B05A 1PEBA 2PYYA 2ALUA 4KCDA 3MP1A 1JVYA 3MC2A 3G3KA 4P0GA 2Q2CA 2F5XA 3PPQA 4H8JA 2XXVA 2F7BA 1ELJA 3CI8A 4RPOA 2Y7IA 3MVZA 4BDMA 2E0SA 1YCJA 2I3VA 2Z8FA 1A99A 1N3XA 3S9EA 3S9MC 2Q2AA 3E9XA 4YICA 3OSQA 1H45A 4Q5TA 4LZ5A 2OZZA 2G29A 1XS5A 4DZ1A 1MXUA 3TODA 3PUYE 1OLCA 4N07A 5B7DA 1P99A 3RUMA 3M8UA 3N94A 1HSLA 3TMGA 2X7QA 3T93B 4RY1A 4K3FA 3B6TA 4IGRA 4GXAA 3GBBA 1EZ9A 1USYE 2WKYA 3MP8A 2QMXA 3C34A 3IB2A 4FJPA 4DXUA 1B3EA 1M5CA 4PE5B 3UORA 4OERA 1ZLQA 5I56A 2THIA 3FJMA 4LVQA 3KG2A 4I8CA 5KDTA 2CMOA 3S4UA 3L6GA 3PPNA 4F19A 3O6GA 3O9PA 2RCBA 3RY3A 1DPPA 2ABHA 2I3WA 4ZEDA 5H8NA 1HSEA 4TOZA 3THIA 3MVXA 3TYHA 1SI1A 1ZMGA 2UVJA 5H8HB 4GQOA 1NMUA 4H6DA 5TPAA 1MXVA 4XKNA 3TDJA 1DTZA 1MDP1 1SYIA 4ZDMA 5I58B 1GV8A 1I6BA 5JTYA 4FEBA 1QVSA 5A5XA 1XC1A 5KCJA 3RT8A 3PU5A 4R2BA 1PB9A 1IXIA 1H3DA 3OEKA 2R6GE 4OEUA 1FTJA 3R26A 3O6HA 3U8QA 1KWHA 1LAGE 4QRZA 4ONYA 4R73A 3GLBA 1BLFA 3Q27A 3K6XA 4IB2A 4PFUA 1MDQA 3RNNA 2ESNA 1LSTA 2DE3A 2HAVA 5EHSA 2F35A 4LA9A 1AIVA 3TPAA 3I5OA 2DYXA 2O7UA 2RF1A 4NF6B 3TQWA 1IXCA 4KFQA 1Q1KA 2FNCA 4OHNA 5I59B 2A5TA 1MM7A 5I2KB 2AL4A 3TCFA 2DOJA 3O6IA 5DVIA 1B9JA 4ESXA 5ISUA 1N7WA 2YPNA 1Y3PA 3KZGA 4KI0E 2QL3A 4YB7A 5EYFA 5I2NA 3ZS6A 2OWSA 3IO6A 5AA2A 3A3UA 3QXMA 2R71A 1O63A 1QKBA 2I58A 3E4RA 3KFMA 3EPEA 3IOVA 2F7CA 5H8FA 4KYSA 1IXGA 4HTGA 1B1XA 4DCXA 4GL8A 3IR1A 2AL5A 1UTBA 1B51A 1OQHA 4OTEA 2BJJX 3EF7A 1H76A 2XXXA 4YMBA 1B32A 3LSFB 2H4IA 4L17A 4Z0IA 1B0LA 5TP9A 1MXZA 2NUVA 3WAEA 3SEXA 3OELA 5DVFA 3H4ZA 4MBPA 2PBWA 1UQWA 5TU0A 3CFZA 5B70A 1Y3QA 4R9FA 1B40A 1NH7A 3GBAA 4PETA 5I56B 5HPQA 3SEUA 4GFRA 3MQ9A 5KDTB 2DVZA 3C36A 3O97A 1LBBA 4QFNA 4H8IA 1LB8A 5AA1A 4GL0A 3VVFA 3FV1A 4YKJA 1N76A 2GRVA 3B6QA 4RYAA 4F1YA 3FVGA 3UGWA 1FQAA 4IO5A 3C9HA 3KN8A 5K2XA 3CG1A 3SEYA 4U4XA 3C31A 1D9VA 1QUIA 2XXRA 3LR1A 4BDQA 4ZS9A 1S50A 4YKPA 4X9TA 3VV5A 4QHQA 2I6EA 4ZE9A 3RN8A 1I6QA 3DP8A 4E0WA 3QK6A 3VVEA 1DOTA 2ZNSA 3KJTA 3MPLA 5CM6A 1N3WA 2GH9A 3OO6A 3VXCA 4F31B 4KPTA 4TLLB 1ANFA 1B0HA 4XXUA 3T9XB 3H06B 4GWOA 5LOMA 2W7YA 3FIRA 5M2VA 5AA3A 2XX9A 3BKIB 2A5TB 2GFEA 4ZE8A 2DE4A 3BFUA 4IO3A 2B3BA 3IB1A 4EDPA 4G8HA 1UIUA 4TLMB 3SERA 3O29A 5ICTA 1EH3A 5HM4B 3DLNA 2P1SA 4DXCA 4PQJA 3H7MA 3W9WA 3FVKA 3PMXA 2REGA 3PPPA 4I1DA 3Q29A 4R72A 4OWDA 1S9TA 2H9BA 4TQUQ 1MQGA 1B7HA 3FVOA 2Q8JA 2Z8DA 3KJ7A 3M3KA 2ZNUA 2A5SA 1PB8A 4ZEFA 1MY4A 3C35A 2LAOA 1TT1A 1URDA 3C4MA 4G68C 3O66A 3SKPA 5DEXA 3EHUA 4F2OA 4LQ2A 4F29A 5CI5A 1Y4CA 3TKDA 4F3SA 3C32A 4R6YA 5ITOA 4X1DA 1QW0A 1I69A 4G68A 4F3GA 4Q8RA 4OETA 2RKMA 3EQ1A 3PD8A 2XD3A 3TEPA 5HBCA 5TP9B 1IQ7A 3U72A 3KN7A 5AA4A 2XXTA 3KGCA 2I49A 3RGYA 4THIA 4QSEA 3KEIA 1MXWA 1MS7A 4RXLA 1QUJA 5L8DA 2Y84A 4BDOA 5L9MA 4WEPA 2DVCA 1NFTA 3VLUA 2O84X 2Y7WA 1MRPA 4XTCQ 1P1UA 1I6AA 1YPNA 1OLAA 1GVCA 5H8QB 5EHMA 3IAZA 2Q89A 1YTVA 3TUSA 1OQGA 1B52A 1LBCA 5FHNA 2XXWA 3O2AA 4F3BA 2I0BA 2PX1A 3N5LA 1BIYA 3IOTA 1Y3NA 1ZU0A 3T96B 1VFDA 2B65A 3MW0A 3BBRA 4LZ7A 1QJMA 4ESWA 4KYEA 5CBRA 1TFDA 4ISUA 1POTA 4F1VA 4NWDA 1LAHE 2XX8A 3DM0A 4QF9A 3TTNA 1B3LA 4EF1A 1CE2A 4ELOA 5L9SA 1A7LA 3H6VA 3SESA 3KOTA 3UP9A
chains in the Genus database with same CATH superfamily
4H5FA 5J16A 2V25A 2RINA 4GXSB 1YAEA 3C33A 3OEMA 1IEJA 4FORA 3HPIA 4PBHA 2OLBA 1R9LA 2PT2A 3B7DA 4QFOA 1B5JA 3G3IA 3MVYA 2HQ0A 1TXFA 3IOUA 4RNSA 1IITA 1SI0A 3B6WA 3FUZA 4OMBA 5I5PA 3K6VA 4H1XA 4DDDA 3ODBA 1FSAA 1ATGA 1MPDA 2ANJA 2ZZWA 3IO4A 4NF8A 1PB7A 2ONKE 2PMSA 3IORA 3H3GA 2AIXA 1QGXA 3TAJA 4JWXA 3H6TA 2HZLA 1R1NA 4NF0A 1GR2A 4H67A 1FTLA 3VVDA 1FQDA 4YKKA 5A5LA 4MMPA 2HAUA 4G2ZA 1MY2A 4PF6A 1LCFA 4O8MA 4JB7A 3LV0A 1B7UA 4U21A 5H8SA 1N04A 3MP6A 4N13A 1B7ZA 5DEXB 4R6KA 1MQHA 1PBPA 1FTKA 1MXXA 3ZSFA 4GF8A 4F3PA 2XWVA 4GRKA 2Q8MA 3KSXA 2DQVA 1XOCA 3USDA 4ZEKA 4JDFA 2FHYA 4PDHA 4KCCA 2RC7A 3SEVA 4X04A 4P47A 2P0SA 3MVWA 4PP0A 4IO2A 4N6KA 3K1NA 2KQZA 2VOZA 1MG1A 4NE4A 4G68B 4RJZA 3CFLA 5BWJA 4ZECA 3IL1B 2ZMBA 2ZYKA 4H5GA 5AA4B 1N84A 2I0CA 1B5HA 2JJKA 4JWOA 3W9VA 1DMBA 4HW8A 4U1ZA 1EU8A 4PFIA 1ZIUA 3T9HB 3U94A 4GOTA 2WYPA 4MEVA 3ILUB 3DELB 5ET8A 2X7PA 2XXKA 3S9LC 3FZVA 1QUKA 2VD3A 3OO7A 2Z22A 3PGFA 1MY1A 4YAHX 5CMMA 3TTMA 2GQ1A 3OENA 2XWIA 4GIZA 1BTJA 1FPDA 4FBPA 2F34A 1DCUA 3T9UA 1OVBA 4JSDA 1FBEA 4IY6A 2Q9TA 4YKIA 3WAFA 1NNFA 3FXBA 3QAXA 1MQDA 4RK2A 2RC8A 3LSXA 4P3LA 3OD7A 1B3HA 1KA1A 2FBPA 3KOSA 1MH4A 5CMKA 2UVGA 1AMFA 2HXWA 2ZYOA 5IAIA 3CFXA 4RK9A 4XEQA 2GHBA 1S7YA 1MH3A 4JSOA 2ONRA 4OVTA 1R6ZA 4GLIA 4EF2A 1B4ZA 2Q88A 2F6GA 5I57A 1II5A 2OX3A 4UABA 1P1QA 5FBPA 4UA8A 3ECRA 1SW5A 4FATA 5IZZA 3LBSA 1H43A 2YJPA 3M3FA 3OMBA 3R7XA 2I4BA 2QPQA 1IIWA 3K01A 3TELA 3MUQA 2CEXA 2QMWA 3PMVA 1MQJA 3LSWA 3TQLA 1LB9A 3T66A 5CC2A 4F18A 4AQ4A 1LGBC 1ZKBA 2XA5A 1SW1A 1Y20A 2VT5A 2DDKA 1Y9UA 2DSFA 5F7VA 4O7IA 1XT8A 1LBYA 3KSJA 2V84A 3DP4A 4F22A 2R9JA 3SETA 3VLVA 2QS3A 3N6TA 2XWOA 3IJOB 3TTKA 3LUYA 3FATA 3H03A 5DYHA 4C1TA 1BKAA 4NF8B 5H8NB 1JNFA 3PUWE 1FPFA 4N6DA 5IKBA 3JYRA 4G77A 4MH5A 2QS2A 3ONMA 4OYVA 5TPAB 1VSOA 4HCYA 2CZKA 2F36A 4X8RA 1H44A 5JTYB 3FJ7A 4O3AA 4ELPA 5A5XB 5KCJB 3HHGA 4NF4A 1JEVA 3V89B 4DLDA 2PFYA 5FTIA 4GVOA 1FJ9A 4P0IA 4R2FA 4ZZAA 3FASA 4EXKA 3UIFA 3IK6B 1NNKA 2Z23A 4MFIA 4LUBA 2QRYA 3V8XB 4OVQA 5CBSA 3RT6B 4OVJA 2Y5LA 3IB0A 1MM6A 3F11A 4DXBA 4EXLA 3B50A 5K2YA 3P7IA 3HFUA 1NH8A 1JETA 1US4A 2QVVA 1SW4A 4LONB 1VFEA 2DWHA 1UIVA 4YB5A 1FPJA 4YZZA 3IFAA 4MNPA 1ZBMA 1RYOA 4P1EA 3T22A 2Y5KA 3I6VA 1B1HA 4XKRA 4WEDA 1HSJA 4FAJA 4EQ7A 1FQEA 3VFJA 5I2NB 2XHDA 3E78A 5ICQA 2DS9A 1BK4A 2VPNA 5AA2B 1LFHA 3K1PA 1O64A 4BDLA 1JW1A 4Q0CA 1F9BA 1Q35A 2V3TA 1MPCA 2MKZA 2O69A 4XKQA 4MHFA 1M5DA 3LSLA 4ECFA 3K02A 1B3GA 5H8HA 1B58A 4BLAA 4N8YA 2REJA 4PFTA 4NWCA 5H8FB 3QYTA 2XXQA 1MPBA 5I58A 3MZ1A 3W15C 4H0WA 3TCHA 2I48A 1FBFA 2OWTA 1D4NA 3PD9A 1UTBB 5L9OA 2O1LA 2HZKA 4OVPA 1O7TA 2UXAA 4GBVA 1IMFA 4RPNA 3ROJA 3OOAA 4AB5A 4H65A 1FTOA 4R9GA 1PDAA 2F3DA 1LFGA 2UVIA 4ND9A 1FBHA 1DBZA 1LFIA 4OA4A 3A09A 2HEUA 3BIGA 4GX3A 2D3IA 2XXIA 2VHAA 2O51A 4HE2A 1UTHA 4R75A 2VD2A 3HO7A 2Y7KA 1VR5A 4NF6A 4O94A 4U23A 2XWKA 3G3FA 2IEEA 4OESA 2B3FA 2OBGA 1FQFA 4DCYA 1AL3A 5EQ8A 4F39A 5I59A 2NOOA 4I3EA 3U92A 2ZXTA 3AXFA 4FEDA 2ZNTA 5AE4A 3QSLA 3QUFA 4IO4A 4N6PA 1NL5A 3FGSA 3MJNA 3KN3A 1FQBA 1JW5A 3OO9A 1M5EA 1DTGA 4OANA 5DTBA 2KLFA 3N26A 4NEDA 1IMBA 4NF5A 4NMYA 4RA1A 2FYIA 2B4LA 2XXUA 3PUZE 2V93A 1FCKA 1SYHA 2D21A 2F8DA 2DWAA 1ZJLA 4KR5A 3OXNA 3CR9A 1GGGA 3PMWA 4I62A 1FRPA 4NF4B 5ET7A 2F3BA 2QFLA 2YLNA 2OJTA 4LZ8A 2QS4A 2OWZA 4IO7A 4WXJA 2DWIA 2FA7A 4NQ8A 5CRYA 4LP2B 1LLSA 1M5FA 3EKIA 4HXVA 4IY5A 4JBZA 4LATA 3CRBA 1AWBA 3ZKLA 4O3CA 4MLQA 1D9YA 2O1MA 3JZJA 2Y7PA 4UACA 1FPKA 3CVGA 3QUJA 3FD3A 3EHTA 3PUVE 4MF3A 3TFLA 3Q26A 3DP6A 4XKPA 5FHOA 3MPKA 4PFYA 4Q30B 4NAPA 2P2AA 2ZYMA 1N0TA 3K00A 3OO8A 3EHSA 2AYSA 1RDXA 3BFTA 3K0VA 1URSA 1AOVA 1JW4A 4MJOA 4QSDA 4JWYA 2ZYNA 1A54A 3MAMA 4OQOA 2Z8EA 2PT1A 3I3VA 3V5AA 4N15A 4U4SA 1NV2A 1K9YA 3ISPA 3IFCA 1RDZA 5I84A 1USYH 3CG3A 2XX7A 4OFOA 3PPOA 3QMFA 2DWJA 3U1OA 1SW2A 3K2DA 1URGA 3HSTA 1ZTYA 1G0HA 1IXHA 1Y4TA 3R6UA 3E13X 4EQBA 1MY0A 4R6HA 3E3KA 3MYUA 3ILTB 3TTRA 1CNQA 2WBBA 2NXOA 1IUDA 4QFPA 4QFLA 1WDNA 1VDWA 3RQTA 4E0XA 3FXUA 3RPWA 3G3JA 1NV6A 1A55A 1LBVA 3G3HA 4NTLA 4PGPA 4DI4B 2DXYA 1PC3A 2G93A 4ZZEA 1XI6A 4KQPA 3MZBA 2OCUA 3Q28A 4M4GA 4U1OA 4PBQA 1NV0A 4POXA 4GD5A 4BDRA 4WKMA 1EZPA 3RPLB 2F97A 3QIMA 1R9QA 3PV0E 1UTHB 3RLFE 2RCAA 2HCAA 1SBPA 5ELVA 4ZEIA 3D4GA 3MSTA 1Y1MA 1FPEA 4R74A 4FE8A 2D5WA 1P1WA 1P1OA 3HN0A 5CMCA 1LAFE 2VP1A 2X26A 4KD5A 4C0RA 3IOWA 4Z7EA 1B3FA 4PFBA 2VGQA 4MCOA 4HCWA 2E1SA 1N7XA 2DE2A 5ET5A 4AB6A 1SDXA 2I4CA 3G3GA 4NF5B 2O7IA 4EUOA 2FIEA 2ZZXA 1LCTA 1JEUA 1SD3A 4AS5A 3RYDA 1FTMA 1IMEA 3Q25A 1D3KA 2H25A 5JK4A 1INPA 3OSRA 2O6AA 1XVYA 1AH5A 4IO6A 1B2HA 4QBAA 4JVDA 4QSCA 5EYHA 5J1DA 5DVJA 2H5YA 1TFAA 3N6UA 3T1BA 5F1QA 3GZGA 3UN6A 1QKAA 1Y1ZA 1J1NA 4GWSA 2XXHA 2O68A 1MQIA 4G61A 3TCGA 2DXRA 4F2QA 2HFBA 1FPBA 4HS7A 1EZOA 2IA4A 4P1LA 1JQFA 2F78A 2H98A 4YMAA 3G7WA 1Z7NE 1TWYA 1IMAA 3SEWA 4PC9A 1K9ZA 1JP4A 4I9DA 1US5A 3K6WA 2NWJA 4N91A 4MNCA 2F6PA 4OFJA 1YYZA 1SVXB 4P11A 4OENA 4IGTA 4EQ9A 5EQ7A 2Y7RA 1YZ0A 3MBPA 1NV5A 5FTHA 3S9NC 5FHMA 4FECA 1OMPA 1B46A 3RTFB 2PVUA 1EYKA 3H6UA 5EYGA 4BDNA 4OFLA 5H8QA 3KBRA 1L5TA 2KR0A 1LAXA 2DP8A 1JVXA 4POWA 1B6HA 1IMCA 3JV9A 4OXVA 4KYDA 3T9VA 1NKXA 4DIGA 4N17A 2XD2A 3TZAA 2WBDA 3H6WA 3HCQA 1NUXA 4OVRA 4FIMA 1MXYA 1DPEA 4PE3A 3V83A 3TTLA 1D9QA 5AA2D 4YU0A 3FVNA 4M1VA 3PTYA 3EN3A 1FQCA 2UVHA 3SDFA 1CB6A 1A8EA 3GXAA 3FV2A 5T3JA 4ZEBA 2V3UA 3FXRA 4LQ5A 4OEVA 4PFRA 5DT6A 3UA8A 3K1MA 4MX6A 1T0KA 2FVZA 3U93A 4JXIA 2QVRA 3M3LA 3CIJA 4C1UA 1POY1 2GHAA 1GTKA 4O3BA 5F24A 1EYJA 4PF8A 5JEIA 4G8NA 4QFKA 3FXQA 1Z7ME 4H46A 1XVXA 4GWZA 3MWBA 1NNTA 1WVJA 4ELRA 1LEVA 1BP5A 4DE8A 1OIBA 2H99A 3VLWA 2XXYA 2F7AA 3CSBA 1IMDA 1M5BA 2CZLA 2QJEA 1RYXA 1FBCA 3T0JA 2QSXA 3VDFA 4MLVA 3PPRA 1RKMA 3IX1A 1IZ1A 3K4UA 2P3NA 1QULA 1XHYA 3HHFA 1B5IA 1P1NA 3LUZA 1SQYA 4KHZE 4F1UA 3ZKKA 5BUUA 1B4HA 4U2RA 5LTCA 3PUXE 4G4PA 3CSGA 2M8CA 3CHGA 3VE1B 2UYFA 4PFWA 1KA0A 3IJXB 3O28A 1A8FA 1WODA 5ITPA 4G8MA 5CMBA 2ONSA 5I57B 4X48A 4X1BA 3VXBA 3RTWB 3K6UA 1OVTA 4OZ9A 3S2VA 2NVUB 3FJGA 4MNIA 4YB6A 4ELQA 1FTAA 3L6HA 1DSNA 3MZ9A 2XXPA 3A3CA 4H45A 2OK2A 3UK4A 5KZTA 1FPLA 3HV1A 3LC8A 2V3QA 2QS1A 1NNPA 1VE4A 5I7IA 1LBZA 2RC9A 1PBQA 4U22A 1A40A 1FW0A 4XIGQ 3D4CA 5I2KA 2UYEA 4MIJA 1MY3A 4PDDA 1B05A 1PEBA 2PYYA 2CZIA 2ALUA 4KCDA 3MP1A 1JVYA 3MC2A 3G3KA 4P0GA 2Q2CA 1YXIA 2F5XA 3PPQA 4H8JA 2XXVA 2F7BA 2FIXA 1ELJA 4AS4A 3CI8A 4RPOA 2Y7IA 3MVZA 4NGUA 4BDMA 2E0SA 4NHBA 1YCJA 2I3VA 2Z8FA 3KC1A 1A99A 1N3XA 3S9EA 3S9MC 2Q2AA 3E9XA 4YICA 3OSQA 1H45A 4Q5TA 4LZ5A 2OZZA 2G29A 1XS5A 4PTKA 4DZ1A 1MXUA 3TODA 3PUYE 1OLCA 4N07A 1LBXA 5B7DA 1P99A 3RUMA 1FPGA 3M8UA 3N94A 1HSLA 3TMGA 5I3SA 1FBGA 2X7QA 3T93B 4RY1A 4NX1A 4GWUA 4K3FA 3B6TA 4IGRA 1NV4A 4JVCA 4GXAA 4GWXA 3GBBA 1EZ9A 1USYE 2WKYA 3MP8A 2QMXA 3C34A 3IB2A 4FJPA 4DXUA 1B3EA 1M5CA 4KXPA 4PE5B 3UORA 4PAIA 4OERA 4JVIA 1ZLQA 5I56A 2THIA 3FJMA 1NV1A 4LVQA 3KG2A 4I8CA 5KDTA 2CMOA 5DW8A 4IR8A 3S4UA 3L6GA 3PPNA 4F19A 3O6GA 3O9PA 2RCBA 3RY3A 4I3YA 1DPPA 2ABHA 2I3WA 4ZEDA 5H8NA 1HSEA 4TOZA 3THIA 3MVXA 4OVSA 3TYHA 4HE0A 1SI1A 2ZZVA 1ZMGA 2UVJA 4GX4A 5H8HB 4GQOA 1NMUA 4H6DA 5TPAA 2WX9A 1MXVA 4XKNA 3TDJA 1DTZA 1MDP1 1SYIA 4ZDMA 5I58B 1GV8A 1I6BA 5JTYA 1FJ6A 4FEBA 1QVSA 5A5XA 1XC1A 5KCJA 4N81A 3RT8A 3PU5A 4R2BA 1PB9A 1IXIA 3KBZA 1H3DA 3OEKA 2R6GE 4OEUA 1FTJA 3R26A 5LDZA 2PFZA 3O6HA 3U8QA 1KWHA 1LAGE 3D1RA 4QRZA 4ONYA 4R73A 3GLBA 1BLFA 3Q27A 3K6XA 4IB2A 4HE1A 4PFUA 1MDQA 3RNNA 2ESNA 1LSTA 2DE3A 2HAVA 5IZ3A 5EHSA 2F35A 4LA9A 2QVUA 1AIVA 3TPAA 3I5OA 2DYXA 4QXDA 2O7UA 2RF1A 4NF6B 3TQWA 1IXCA 4KFQA 1Q1KA 2FNCA 4OHNA 5I59B 2A5TA 1MM7A 5I2KB 2AL4A 3TCFA 2DOJA 1FBPA 3O6IA 5DVIA 2HXRA 1B9JA 4ESXA 5ISUA 1NUZA 4NG7A 1N7WA 2YPNA 1Y3PA 3KZGA 4KI0E 2QL3A 4YB7A 5EYFA 5I2NA 3ZS6A 2OWSA 3FBPA 3IO6A 5AA2A 1SPIA 3A3UA 3QXMA 2R71A 1O63A 1NI9A 4PAFA 1QKBA 2I58A 3E4RA 3KFMA 3EPEA 3IOVA 4GWYA 2F7CA 5H8FA 4KYSA 2L5VA 1IXGA 4DI3D 4HTGA 4XFEA 1B1XA 4N8GA 4DCXA 1FPIA 4GL8A 3IR1A 2AL5A 1UTBA 1B51A 2WYKA 1OQHA 4OTEA 1NV3A 2BJJX 3EF7A 1H76A 2V4CA 2XXXA 4YMBA 1LBWA 1B32A 3LSFB 2H4IA 4N4UA 4L17A 5IZ1A 4Z0IA 1B0LA 5TP9A 1MXZA 2NUVA 3WAEA 3SEXA 3OELA 5DVFA 3H4ZA 4MBPA 2PBWA 1UQWA 5TU0A 3CFZA 5B70A 1Y3QA 4R9FA 1B40A 1NH7A 3GBAA 4PETA 5I56B 5HPQA 3SEUA 4GFRA 3NOHA 3MQ9A 4PCDA 5KDTB 2DVZA 1G0IA 3C36A 3O97A 1LBBA 4QFNA 4GBWA 4H8IA 1LB8A 5EQAA 5AA1A 4GL0A 3VVFA 5ET6A 3FV1A 4YKJA 1N76A 2GRVA 3B6QA 4RYAA 4F1YA 3FVGA 3UGWA 1FQAA 4IO5A 3C9HA 3KN8A 5K2XA 3CG1A 3SEYA 4U4XA 3C31A 1D9VA 1NUYA 2B4MA 1QUIA 2XXRA 3LR1A 4BDQA 4ZS9A 1S50A 3B8BA 4YKPA 4X9TA 3VV5A 4QHQA 2I6EA 4ZE9A 5EQ9A 3RN8A 1I6QA 3DP8A 4E0WA 3QK6A 3VVEA 1DOTA 4P56A 2ZNSA 3KJTA 4GWWA 3MPLA 5CM6A 1N3WA 5IGAA 2GH9A 3OO6A 3VXCA 2Q74A 4F31B 1DK4A 4KPTA 4TLLB 1ANFA 5IZ3B 1B0HA 4XXUA 1NUWA 3T9XB 3H06B 4GX6A 4GWOA 5LOMA 2W7YA 3FIRA 5M2VA 5AA3A 2XX9A 3BKIB 2A5TB 2GFEA 4ZE8A 2DE4A 3BFUA 4IO3A 5IM2A 2B3BA 3IB1A 4P8BA 4EDPA 4G8HA 4I40A 1UIUA 3BIHA 4TLMB 1RDYA 3SERA 3O29A 5ICTA 1EH3A 1EYIA 5HM4B 4MAGA 3DLNA 2P1SA 4DXCA 4PQJA 3H7MA 3W9WA 3FVKA 3PMXA 2REGA 3PPPA 4I1DA 3Q29A 4R72A 4OWDA 1S9TA 2H9BA 4PGNA 4TQUQ 1MQGA 2P3VA 1B7HA 3FVOA 3SZPA 2Q8JA 2Z8DA 3KJ7A 4O7MA 3M3KA 2ZNUA 2A5SA 2HPGA 1PB8A 4ZEFA 1MY4A 3C35A 2LAOA 1TT1A 1URDA 3C4MA 4G68C 3O66A 3SKPA 5DEXA 4XF5A 1FBDA 2HHMA 3EHUA 4F2OA 4LQ2A 4F29A 5CI5A 1Y4CA 3GYYA 3TKDA 4F3SA 3C32A 4R6YA 1NV7A 5ITOA 4X1DA 1QW0A 1I69A 4G68A 4F3GA 4Q8RA 4OETA 2RKMA 3EQ1A 3PD8A 2XD3A 3TEPA 5HBCA 3RPLA 5TP9B 1IQ7A 3U72A 3KN7A 5AA4A 2XXTA 3KGCA 2I49A 3RGYA 4THIA 4QSEA 3KEIA 2CZHA 1MXWA 2WEFA 1MS7A 4RXLA 1QUJA 5L8DA 2Y84A 4BDOA 5L9MA 4WEPA 2DVCA 1NFTA 3VLUA 1KZ8A 2O84X 2Y7WA 1Q9DA 1MRPA 4PAKA 4XTCQ 1P1UA 1I6AA 1YPNA 2VPOA 4NN3A 1OLAA 1GVCA 5H8QB 5EHMA 2BJIA 3IAZA 2Q89A 1YTVA 3A29A 3TUSA 1OQGA 1B52A 1LBCA 5FHNA 2XXWA 3O2AA 2CEYA 4F3BA 2I0BA 2PX1A 3N5LA 1BIYA 3IOTA 3E79A 1Y3NA 1ZU0A 3U65A 3T96B 1VFDA 2B65A 3MW0A 5ESYA 3BBRA 4LZ7A 1QJMA 4ESWA 4KYEA 5CBRA 1TFDA 4ISUA 1POTA 4F1VA 4NWDA 1LAHE 2R8TA 2XX8A 3DM0A 4QF9A 3TTNA 2PCRA 1B3LA 4LN5A 3KC0A 4EF1A 1CE2A 4ELOA 5L9SA 1A7LA 3H6VA 4P9KA 3SESA 3KOTA 3UP9A
chains in the Genus database with same CATH topology
4H5FA 2V25A 2RINA 4GXSB 1YAEA 3C33A 3OEMA 1IEJA 4FORA 3HPIA 2OLBA 1R9LA 2PT2A 3B7DA 4QFOA 1B5JA 3G3IA 3MVYA 2HQ0A 1TXFA 3IOUA 4RNSA 1IITA 1SI0A 3B6WA 3FUZA 4OMBA 3K6VA 4H1XA 4DDDA 3ODBA 1ATGA 1MPDA 2ANJA 3IO4A 4NF8A 1PB7A 2ONKE 2PMSA 3IORA 3H3GA 2AIXA 3TAJA 4JWXA 3H6TA 2HZLA 1R1NA 1GR2A 4H67A 1FTLA 3VVDA 1FQDA 4YKKA 2HAUA 4G2ZA 1MY2A 1LCFA 4JB7A 1B7UA 4U21A 5H8SA 1N04A 3MP6A 4N13A 1B7ZA 5DEXB 4R6KA 1MQHA 1PBPA 1FTKA 1MXXA 3ZSFA 4GF8A 4F3PA 4GRKA 3KSXA 2DQVA 1XOCA 3USDA 4ZEKA 4JDFA 4KCCA 2RC7A 3SEVA 2P0SA 3MVWA 4PP0A 4IO2A 3K1NA 2VOZA 1MG1A 4NE4A 4G68B 4RJZA 3CFLA 5BWJA 4ZECA 3IL1B 2ZMBA 2ZYKA 4H5GA 5AA4B 1N84A 2I0CA 1B5HA 4JWOA 3W9VA 1DMBA 4HW8A 4U1ZA 1EU8A 1ZIUA 3T9HB 3U94A 4GOTA 3ILUB 3DELB 2X7PA 3S9LC 3FZVA 1QUKA 2VD3A 3OO7A 2Z22A 3PGFA 1MY1A 4YAHX 5CMMA 3TTMA 3OENA 4GIZA 1BTJA 2F34A 3T9UA 1OVBA 4JSDA 4IY6A 2Q9TA 4YKIA 3WAFA 1NNFA 3QAXA 1MQDA 4RK2A 2RC8A 3LSXA 3OD7A 1B3HA 3KOSA 1MH4A 5CMKA 2UVGA 1AMFA 2HXWA 2ZYOA 5IAIA 3CFXA 4RK9A 2GHBA 1S7YA 1MH3A 4JSOA 2ONRA 1R6ZA 4GLIA 4EF2A 1B4ZA 2Q88A 2F6GA 5I57A 1II5A 1P1QA 4UA8A 3ECRA 1SW5A 4FATA 3LBSA 1H43A 2YJPA 3M3FA 3OMBA 3R7XA 2I4BA 2QPQA 1IIWA 3K01A 3TELA 3MUQA 2QMWA 3PMVA 1MQJA 3LSWA 3TQLA 1LB9A 3T66A 5CC2A 4F18A 4AQ4A 1LGBC 1ZKBA 1SW1A 1Y20A 1Y9UA 2DSFA 5F7VA 1XT8A 3KSJA 2V84A 3DP4A 4F22A 2R9JA 3SETA 3VLVA 2QS3A 3N6TA 3IJOB 3TTKA 3LUYA 3FATA 3H03A 5DYHA 4C1TA 1BKAA 4NF8B 5H8NB 1JNFA 3PUWE 5IKBA 3JYRA 4G77A 2QS2A 4MH5A 3ONMA 4OYVA 5TPAB 1VSOA 4HCYA 2F36A 1H44A 5JTYB 3FJ7A 4O3AA 4ELPA 5A5XB 5KCJB 3HHGA 4NF4A 1JEVA 3V89B 4DLDA 5FTIA 4GVOA 4P0IA 4R2FA 4ZZAA 3FASA 4EXKA 3UIFA 3IK6B 1NNKA 2Z23A 4MFIA 4LUBA 2QRYA 3V8XB 5CBSA 3RT6B 4OVJA 3IB0A 1MM6A 3F11A 4DXBA 4EXLA 5K2YA 3P7IA 1NH8A 1JETA 1US4A 1SW4A 4LONB 1VFEA 2DWHA 1UIVA 4YB5A 4YZZA 1ZBMA 1RYOA 3T22A 3I6VA 1B1HA 4XKRA 4WEDA 1HSJA 4FAJA 4EQ7A 1FQEA 3VFJA 5I2NB 2XHDA 5ICQA 2DS9A 5AA2B 1LFHA 3K1PA 1O64A 4BDLA 1JW1A 4Q0CA 1F9BA 1Q35A 2V3TA 1MPCA 2O69A 4XKQA 1M5DA 3LSLA 4ECFA 3K02A 1B3GA 5H8HA 1B58A 4BLAA 2REJA 4PFTA 4NWCA 5H8FB 3QYTA 2XXQA 1MPBA 5I58A 3MZ1A 3W15C 4H0WA 3TCHA 2I48A 2OWTA 1D4NA 3PD9A 1UTBB 5L9OA 2O1LA 2HZKA 1O7TA 2UXAA 4RPNA 3OOAA 4AB5A 4H65A 1FTOA 4R9GA 1PDAA 1LFGA 2UVIA 4ND9A 1LFIA 3A09A 2HEUA 2D3IA 2XXIA 2VHAA 2O51A 1UTHA 4R75A 2VD2A 3HO7A 2Y7KA 1VR5A 4NF6A 4U23A 3G3FA 2IEEA 4OESA 2B3FA 2OBGA 1FQFA 4DCYA 1AL3A 4F39A 5I59A 2NOOA 3U92A 2ZXTA 3AXFA 4FEDA 2ZNTA 5AE4A 3QSLA 3QUFA 4IO4A 4N6PA 1NL5A 3FGSA 3MJNA 3KN3A 1FQBA 1JW5A 3OO9A 1M5EA 1DTGA 5DTBA 2KLFA 3N26A 4NEDA 4NF5A 4NMYA 4RA1A 2FYIA 2XXUA 3PUZE 2V93A 1FCKA 1SYHA 2D21A 2F8DA 2DWAA 1ZJLA 4KR5A 3OXNA 3CR9A 1GGGA 3PMWA 4I62A 4NF4B 2YLNA 2OJTA 4LZ8A 2QS4A 4IO7A 4WXJA 2DWIA 2FA7A 5CRYA 4LP2B 1LLSA 1M5FA 4IY5A 4JBZA 4LATA 3CRBA 3ZKLA 4O3CA 4MLQA 1D9YA 2O1MA 3JZJA 2Y7PA 4UACA 3CVGA 3QUJA 3FD3A 3EHTA 3PUVE 4MF3A 3TFLA 3Q26A 3DP6A 5FHOA 4XKPA 3MPKA 4PFYA 4Q30B 2P2AA 2ZYMA 1N0TA 3K00A 3OO8A 3EHSA 2AYSA 3BFTA 3K0VA 1URSA 1AOVA 1JW4A 4QSDA 4JWYA 2ZYNA 1A54A 3MAMA 4OQOA 2Z8EA 2PT1A 3I3VA 3V5AA 4U4SA 5I84A 1USYH 3CG3A 2XX7A 4OFOA 3PPOA 2DWJA 3U1OA 1SW2A 3K2DA 1URGA 3HSTA 1ZTYA 1IXHA 1Y4TA 3R6UA 3E13X 4EQBA 1MY0A 4R6HA 3E3KA 3ILTB 3TTRA 2NXOA 1IUDA 4QFPA 4QFLA 1WDNA 3RQTA 4E0XA 3FXUA 3RPWA 3G3JA 1A55A 3G3HA 4NTLA 2DXYA 1PC3A 2G93A 4ZZEA 4KQPA 3MZBA 2OCUA 3Q28A 4M4GA 4U1OA 4POXA 4GD5A 4BDRA 4WKMA 1EZPA 2F97A 3QIMA 1R9QA 3PV0E 1UTHB 3RLFE 2RCAA 2HCAA 1SBPA 5ELVA 4ZEIA 3D4GA 1Y1MA 4R74A 4FE8A 2D5WA 1P1WA 1P1OA 3HN0A 5CMCA 1LAFE 2VP1A 2X26A 4KD5A 4C0RA 3IOWA 4Z7EA 1B3FA 2VGQA 4HCWA 2E1SA 1N7XA 2DE2A 4AB6A 1SDXA 2I4CA 3G3GA 4NF5B 2O7IA 4EUOA 1LCTA 1JEUA 1SD3A 1FTMA 3Q25A 1D3KA 2H25A 5JK4A 3OSRA 2O6AA 1XVYA 1AH5A 4IO6A 1B2HA 5J1DA 4QSCA 5DVJA 2H5YA 1TFAA 3N6UA 5F1QA 3GZGA 3UN6A 1QKAA 1Y1ZA 1J1NA 2XXHA 2O68A 1MQIA 3TCGA 2DXRA 4F2QA 2HFBA 4HS7A 1EZOA 2IA4A 1JQFA 2F78A 2H98A 4YMAA 3G7WA 1Z7NE 1TWYA 3SEWA 4I9DA 1US5A 3K6WA 2NWJA 2F6PA 4OFJA 1SVXB 4P11A 4OENA 4IGTA 4EQ9A 2Y7RA 3MBPA 5FTHA 3S9NC 5FHMA 4FECA 1OMPA 1B46A 3RTFB 2PVUA 3H6UA 4BDNA 4OFLA 5H8QA 3KBRA 1L5TA 1LAXA 2DP8A 1JVXA 4POWA 1B6HA 3JV9A 4OXVA 4KYDA 3T9VA 1NKXA 4DIGA 2XD2A 3TZAA 3H6WA 3HCQA 4FIMA 1MXYA 1DPEA 3V83A 3TTLA 5AA2D 4YU0A 3FVNA 4M1VA 3EN3A 1FQCA 2UVHA 3SDFA 1CB6A 1A8EA 3GXAA 3FV2A 4ZEBA 2V3UA 3FXRA 4LQ5A 4OEVA 5DT6A 3UA8A 3K1MA 1T0KA 3U93A 4JXIA 3M3LA 3CIJA 4C1UA 1POY1 2GHAA 1GTKA 4O3BA 5JEIA 4G8NA 4QFKA 3FXQA 1Z7ME 1XVXA 3MWBA 1NNTA 1WVJA 4ELRA 1BP5A 4DE8A 1OIBA 2H99A 3VLWA 2XXYA 2F7AA 3CSBA 1M5BA 2CZLA 2QJEA 1RYXA 2QSXA 3VDFA 4MLVA 3PPRA 1RKMA 3IX1A 1IZ1A 3K4UA 1QULA 1XHYA 3HHFA 1B5IA 1P1NA 1SQYA 4KHZE 4F1UA 3ZKKA 5BUUA 1B4HA 4U2RA 3PUXE 4G4PA 3CSGA 2M8CA 3VE1B 2UYFA 4PFWA 3IJXB 3O28A 1A8FA 1WODA 5ITPA 4G8MA 5CMBA 2ONSA 5I57B 4X48A 4X1BA 3VXBA 3RTWB 3K6UA 1OVTA 4OZ9A 3S2VA 2NVUB 3FJGA 4YB6A 4ELQA 3L6HA 1DSNA 3MZ9A 2XXPA 3A3CA 2OK2A 3UK4A 5KZTA 3HV1A 3LC8A 2V3QA 2QS1A 1NNPA 1VE4A 2RC9A 1PBQA 4U22A 1A40A 1FW0A 4XIGQ 3D4CA 5I2KA 2UYEA 1MY3A 1B05A 1PEBA 2PYYA 2ALUA 4KCDA 3MP1A 1JVYA 3MC2A 3G3KA 4P0GA 2Q2CA 2F5XA 3PPQA 4H8JA 2XXVA 2F7BA 1ELJA 3CI8A 4RPOA 2Y7IA 3MVZA 4BDMA 2E0SA 1YCJA 2I3VA 2Z8FA 1A99A 1N3XA 3S9EA 3S9MC 2Q2AA 3E9XA 4YICA 3OSQA 1H45A 4Q5TA 4LZ5A 2OZZA 2G29A 1XS5A 4DZ1A 1MXUA 3TODA 3PUYE 1OLCA 4N07A 5B7DA 1P99A 3RUMA 3M8UA 3N94A 1HSLA 3TMGA 2X7QA 3T93B 4RY1A 4K3FA 3B6TA 4IGRA 4GXAA 3GBBA 1EZ9A 1USYE 2WKYA 3MP8A 2QMXA 3C34A 3IB2A 4FJPA 4DXUA 1B3EA 1M5CA 4PE5B 3UORA 4OERA 1ZLQA 5I56A 2THIA 3FJMA 4LVQA 3KG2A 4I8CA 5KDTA 2CMOA 3S4UA 3L6GA 3PPNA 4F19A 3O6GA 3O9PA 2RCBA 3RY3A 1DPPA 2ABHA 2I3WA 4ZEDA 5H8NA 1HSEA 4TOZA 3THIA 3MVXA 3TYHA 1SI1A 1ZMGA 2UVJA 5H8HB 4GQOA 1NMUA 4H6DA 5TPAA 1MXVA 4XKNA 3TDJA 1DTZA 1MDP1 1SYIA 4ZDMA 5I58B 1GV8A 1I6BA 5JTYA 4FEBA 1QVSA 5A5XA 1XC1A 5KCJA 3RT8A 3PU5A 4R2BA 1PB9A 1IXIA 1H3DA 3OEKA 2R6GE 4OEUA 1FTJA 3R26A 3O6HA 3U8QA 1KWHA 1LAGE 4QRZA 4ONYA 4R73A 3GLBA 1BLFA 3Q27A 3K6XA 4IB2A 4PFUA 1MDQA 3RNNA 2ESNA 1LSTA 2DE3A 2HAVA 5EHSA 2F35A 4LA9A 1AIVA 3TPAA 3I5OA 2DYXA 2O7UA 2RF1A 4NF6B 3TQWA 1IXCA 4KFQA 1Q1KA 2FNCA 4OHNA 5I59B 2A5TA 1MM7A 5I2KB 2AL4A 3TCFA 2DOJA 3O6IA 5DVIA 1B9JA 4ESXA 5ISUA 1N7WA 2YPNA 1Y3PA 3KZGA 4KI0E 2QL3A 4YB7A 5EYFA 5I2NA 3ZS6A 2OWSA 3IO6A 5AA2A 3A3UA 3QXMA 2R71A 1O63A 1QKBA 2I58A 3E4RA 3KFMA 3EPEA 3IOVA 2F7CA 5H8FA 4KYSA 1IXGA 4HTGA 1B1XA 4DCXA 4GL8A 3IR1A 2AL5A 1UTBA 1B51A 1OQHA 4OTEA 2BJJX 3EF7A 1H76A 2XXXA 4YMBA 1B32A 3LSFB 2H4IA 4L17A 4Z0IA 1B0LA 5TP9A 1MXZA 2NUVA 3WAEA 3SEXA 3OELA 5DVFA 3H4ZA 4MBPA 2PBWA 1UQWA 5TU0A 3CFZA 5B70A 1Y3QA 4R9FA 1B40A 1NH7A 3GBAA 4PETA 5I56B 5HPQA 3SEUA 4GFRA 3MQ9A 5KDTB 2DVZA 3C36A 3O97A 1LBBA 4QFNA 4H8IA 1LB8A 5AA1A 4GL0A 3VVFA 3FV1A 4YKJA 1N76A 2GRVA 3B6QA 4RYAA 4F1YA 3FVGA 3UGWA 1FQAA 4IO5A 3C9HA 3KN8A 5K2XA 3CG1A 3SEYA 4U4XA 3C31A 1D9VA 1QUIA 2XXRA 3LR1A 4BDQA 4ZS9A 1S50A 4YKPA 4X9TA 3VV5A 4QHQA 2I6EA 4ZE9A 3RN8A 1I6QA 3DP8A 4E0WA 3QK6A 3VVEA 1DOTA 2ZNSA 3KJTA 3MPLA 5CM6A 1N3WA 2GH9A 3OO6A 3VXCA 4F31B 4KPTA 4TLLB 1ANFA 1B0HA 4XXUA 3T9XB 3H06B 4GWOA 5LOMA 2W7YA 3FIRA 5M2VA 5AA3A 2XX9A 3BKIB 2A5TB 2GFEA 4ZE8A 2DE4A 3BFUA 4IO3A 2B3BA 3IB1A 4EDPA 4G8HA 1UIUA 4TLMB 3SERA 3O29A 5ICTA 1EH3A 5HM4B 3DLNA 2P1SA 4DXCA 4PQJA 3H7MA 3W9WA 3FVKA 3PMXA 2REGA 3PPPA 4I1DA 3Q29A 4R72A 4OWDA 1S9TA 2H9BA 4TQUQ 1MQGA 1B7HA 3FVOA 2Q8JA 2Z8DA 3KJ7A 3M3KA 2ZNUA 2A5SA 1PB8A 4ZEFA 1MY4A 3C35A 2LAOA 1TT1A 1URDA 3C4MA 4G68C 3O66A 3SKPA 5DEXA 3EHUA 4F2OA 4LQ2A 4F29A 5CI5A 1Y4CA 3TKDA 4F3SA 3C32A 4R6YA 5ITOA 4X1DA 1QW0A 1I69A 4G68A 4F3GA 4Q8RA 4OETA 2RKMA 3EQ1A 3PD8A 2XD3A 3TEPA 5HBCA 5TP9B 1IQ7A 3U72A 3KN7A 5AA4A 2XXTA 3KGCA 2I49A 3RGYA 4THIA 4QSEA 3KEIA 1MXWA 1MS7A 4RXLA 1QUJA 5L8DA 2Y84A 4BDOA 5L9MA 4WEPA 2DVCA 1NFTA 3VLUA 2O84X 2Y7WA 1MRPA 4XTCQ 1P1UA 1I6AA 1YPNA 1OLAA 1GVCA 5H8QB 5EHMA 3IAZA 2Q89A 1YTVA 3TUSA 1OQGA 1B52A 1LBCA 5FHNA 2XXWA 3O2AA 4F3BA 2I0BA 2PX1A 3N5LA 1BIYA 3IOTA 1Y3NA 1ZU0A 3T96B 1VFDA 2B65A 3MW0A 3BBRA 4LZ7A 1QJMA 4ESWA 4KYEA 5CBRA 1TFDA 4ISUA 1POTA 4F1VA 4NWDA 1LAHE 2XX8A 3DM0A 4QF9A 3TTNA 1B3LA 4EF1A 1CE2A 4ELOA 5L9SA 1A7LA 3H6VA 3SESA 3KOTA 3UP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H5F A;  2V25 A;  2RIN A;  4GXS B;  1YAE A;  3C33 A;  3OEM A;  1IEJ A;  4FOR A;  3HPI A;  2OLB A;  1R9L A;  2PT2 A;  3B7D A;  4QFO A;  1B5J A;  3G3I A;  3MVY A;  2HQ0 A;  1TXF A;  3IOU A;  4RNS A;  1IIT A;  1SI0 A;  3B6W A;  3FUZ A;  4OMB A;  3K6V A;  4H1X A;  4DDD A;  3ODB A;  1ATG A;  1MPD A;  2ANJ A;  3IO4 A;  4NF8 A;  1PB7 A;  2ONK E;  2PMS A;  3IOR A;  3H3G A;  2AIX A;  3TAJ A;  4JWX A;  3H6T A;  2HZL A;  1R1N A;  1GR2 A;  4H67 A;  1FTL A;  3VVD A;  1FQD A;  4YKK A;  2HAU A;  4G2Z A;  1MY2 A;  1LCF A;  4JB7 A;  1B7U A;  4U21 A;  5H8S A;  1N04 A;  3MP6 A;  4N13 A;  1B7Z A;  5DEX B;  4R6K A;  1MQH A;  1PBP A;  1FTK A;  1MXX A;  3ZSF A;  4GF8 A;  4F3P A;  4GRK A;  3KSX A;  2DQV A;  1XOC A;  3USD A;  4ZEK A;  4JDF A;  4KCC A;  2RC7 A;  3SEV A;  2P0S A;  3MVW A;  4PP0 A;  4IO2 A;  3K1N A;  2VOZ A;  1MG1 A;  4NE4 A;  4G68 B;  4RJZ A;  3CFL A;  5BWJ A;  4ZEC A;  3IL1 B;  2ZMB A;  2ZYK A;  4H5G A;  5AA4 B;  1N84 A;  2I0C A;  1B5H A;  4JWO A;  3W9V A;  1DMB A;  4HW8 A;  4U1Z A;  1EU8 A;  1ZIU A;  3T9H B;  3U94 A;  4GOT A;  3ILU B;  3DEL B;  2X7P A;  3S9L C;  3FZV A;  1QUK A;  2VD3 A;  3OO7 A;  2Z22 A;  3PGF A;  1MY1 A;  4YAH X;  5CMM A;  3TTM A;  3OEN A;  4GIZ A;  1BTJ A;  2F34 A;  3T9U A;  1OVB A;  4JSD A;  4IY6 A;  2Q9T A;  4YKI A;  3WAF A;  1NNF A;  3QAX A;  1MQD A;  4RK2 A;  2RC8 A;  3LSX A;  3OD7 A;  1B3H A;  3KOS A;  1MH4 A;  5CMK A;  2UVG A;  1AMF A;  2HXW A;  2ZYO A;  5IAI A;  3CFX A;  4RK9 A;  2GHB A;  1S7Y A;  1MH3 A;  4JSO A;  2ONR A;  1R6Z A;  4GLI A;  4EF2 A;  1B4Z A;  2Q88 A;  2F6G A;  5I57 A;  1II5 A;  1P1Q A;  4UA8 A;  3ECR A;  1SW5 A;  4FAT A;  3LBS A;  1H43 A;  2YJP A;  3M3F A;  3OMB A;  3R7X A;  2I4B A;  2QPQ A;  1IIW A;  3K01 A;  3TEL A;  3MUQ A;  2QMW A;  3PMV A;  1MQJ A;  3LSW A;  3TQL A;  1LB9 A;  3T66 A;  5CC2 A;  4F18 A;  4AQ4 A;  1LGB C;  1ZKB A;  1SW1 A;  1Y20 A;  1Y9U A;  2DSF A;  5F7V A;  1XT8 A;  3KSJ A;  2V84 A;  3DP4 A;  4F22 A;  2R9J A;  3SET A;  3VLV A;  2QS3 A;  3N6T A;  3IJO B;  3TTK A;  3LUY A;  3FAT A;  3H03 A;  5DYH A;  4C1T A;  1BKA A;  4NF8 B;  5H8N B;  1JNF A;  3PUW E;  5IKB A;  3JYR A;  4G77 A;  2QS2 A;  4MH5 A;  3ONM A;  4OYV A;  5TPA B;  1VSO A;  4HCY A;  2F36 A;  1H44 A;  5JTY B;  3FJ7 A;  4O3A A;  4ELP A;  5A5X B;  5KCJ B;  3HHG A;  4NF4 A;  1JEV A;  3V89 B;  4DLD A;  5FTI A;  4GVO A;  4P0I A;  4R2F A;  4ZZA A;  3FAS A;  4EXK A;  3UIF A;  3IK6 B;  1NNK A;  2Z23 A;  4MFI A;  4LUB A;  2QRY A;  3V8X B;  5CBS A;  3RT6 B;  4OVJ A;  3IB0 A;  1MM6 A;  3F11 A;  4DXB A;  4EXL A;  5K2Y A;  3P7I A;  1NH8 A;  1JET A;  1US4 A;  1SW4 A;  4LON B;  1VFE A;  2DWH A;  1UIV A;  4YB5 A;  4YZZ A;  1ZBM A;  1RYO A;  3T22 A;  3I6V A;  1B1H A;  4XKR A;  4WED A;  1HSJ A;  4FAJ A;  4EQ7 A;  1FQE A;  3VFJ A;  5I2N B;  2XHD A;  5ICQ A;  2DS9 A;  5AA2 B;  1LFH A;  3K1P A;  1O64 A;  4BDL A;  1JW1 A;  4Q0C A;  1F9B A;  1Q35 A;  2V3T A;  1MPC A;  2O69 A;  4XKQ A;  1M5D A;  3LSL A;  4ECF A;  3K02 A;  1B3G A;  5H8H A;  1B58 A;  4BLA A;  2REJ A;  4PFT A;  4NWC A;  5H8F B;  3QYT A;  2XXQ A;  1MPB A;  5I58 A;  3MZ1 A;  3W15 C;  4H0W A;  3TCH A;  2I48 A;  2OWT A;  1D4N A;  3PD9 A;  1UTB B;  5L9O A;  2O1L A;  2HZK A;  1O7T A;  2UXA A;  4RPN A;  3OOA A;  4AB5 A;  4H65 A;  1FTO A;  4R9G A;  1PDA A;  1LFG A;  2UVI A;  4ND9 A;  1LFI A;  3A09 A;  2HEU A;  2D3I A;  2XXI A;  2VHA A;  2O51 A;  1UTH A;  4R75 A;  2VD2 A;  3HO7 A;  2Y7K A;  1VR5 A;  4NF6 A;  4U23 A;  3G3F A;  2IEE A;  4OES A;  2B3F A;  2OBG A;  1FQF A;  4DCY A;  1AL3 A;  4F39 A;  5I59 A;  2NOO A;  3U92 A;  2ZXT A;  3AXF A;  4FED A;  2ZNT A;  5AE4 A;  3QSL A;  3QUF A;  4IO4 A;  4N6P A;  1NL5 A;  3FGS A;  3MJN A;  3KN3 A;  1FQB A;  1JW5 A;  3OO9 A;  1M5E A;  1DTG A;  5DTB A;  2KLF A;  3N26 A;  4NED A;  4NF5 A;  4NMY A;  4RA1 A;  2FYI A;  2XXU A;  3PUZ E;  2V93 A;  1FCK A;  1SYH A;  2D21 A;  2F8D A;  2DWA A;  1ZJL A;  4KR5 A;  3OXN A;  3CR9 A;  1GGG A;  3PMW A;  4I62 A;  4NF4 B;  2YLN A;  2OJT A;  4LZ8 A;  2QS4 A;  4IO7 A;  4WXJ A;  2DWI A;  2FA7 A;  5CRY A;  4LP2 B;  1LLS A;  1M5F A;  4IY5 A;  4JBZ A;  4LAT A;  3CRB A;  3ZKL A;  4O3C A;  4MLQ A;  1D9Y A;  2O1M A;  3JZJ A;  2Y7P A;  4UAC A;  3CVG A;  3QUJ A;  3FD3 A;  3EHT A;  3PUV E;  4MF3 A;  3TFL A;  3Q26 A;  3DP6 A;  5FHO A;  4XKP A;  3MPK A;  4PFY A;  4Q30 B;  2P2A A;  2ZYM A;  1N0T A;  3K00 A;  3OO8 A;  3EHS A;  2AYS A;  3BFT A;  3K0V A;  1URS A;  1AOV A;  1JW4 A;  4QSD A;  4JWY A;  2ZYN A;  1A54 A;  3MAM A;  4OQO A;  2Z8E A;  2PT1 A;  3I3V A;  3V5A A;  4U4S A;  5I84 A;  1USY H;  3CG3 A;  2XX7 A;  4OFO A;  3PPO A;  2DWJ A;  3U1O A;  1SW2 A;  3K2D A;  1URG A;  3HST A;  1ZTY A;  1IXH A;  1Y4T A;  3R6U A;  3E13 X;  4EQB A;  1MY0 A;  4R6H A;  3E3K A;  3ILT B;  3TTR A;  2NXO A;  1IUD A;  4QFP A;  4QFL A;  1WDN A;  3RQT A;  4E0X A;  3FXU A;  3RPW A;  3G3J A;  1A55 A;  3G3H A;  4NTL A;  2DXY A;  1PC3 A;  2G93 A;  4ZZE A;  4KQP A;  3MZB A;  2OCU A;  3Q28 A;  4M4G A;  4U1O A;  4POX A;  4GD5 A;  4BDR A;  4WKM A;  1EZP A;  2F97 A;  3QIM A;  1R9Q A;  3PV0 E;  1UTH B;  3RLF E;  2RCA A;  2HCA A;  1SBP A;  5ELV A;  4ZEI A;  3D4G A;  1Y1M A;  4R74 A;  4FE8 A;  2D5W A;  1P1W A;  1P1O A;  3HN0 A;  5CMC A;  1LAF E;  2VP1 A;  2X26 A;  4KD5 A;  4C0R A;  3IOW A;  4Z7E A;  1B3F A;  2VGQ A;  4HCW A;  2E1S A;  1N7X A;  2DE2 A;  4AB6 A;  1SDX A;  2I4C A;  3G3G A;  4NF5 B;  2O7I A;  4EUO A;  1LCT A;  1JEU A;  1SD3 A;  1FTM A;  3Q25 A;  1D3K A;  2H25 A;  5JK4 A;  3OSR A;  2O6A A;  1XVY A;  1AH5 A;  4IO6 A;  1B2H A;  5J1D A;  4QSC A;  5DVJ A;  2H5Y A;  1TFA A;  3N6U A;  5F1Q A;  3GZG A;  3UN6 A;  1QKA A;  1Y1Z A;  1J1N A;  2XXH A;  2O68 A;  1MQI A;  3TCG A;  2DXR A;  4F2Q A;  2HFB A;  4HS7 A;  1EZO A;  2IA4 A;  1JQF A;  2F78 A;  2H98 A;  4YMA A;  3G7W A;  1Z7N E;  1TWY A;  3SEW A;  4I9D A;  1US5 A;  3K6W A;  2NWJ A;  2F6P A;  4OFJ A;  1SVX B;  4P11 A;  4OEN A;  4IGT A;  4EQ9 A;  2Y7R A;  3MBP A;  5FTH A;  3S9N C;  5FHM A;  4FEC A;  1OMP A;  1B46 A;  3RTF B;  2PVU A;  3H6U A;  4BDN A;  4OFL A;  5H8Q A;  3KBR A;  1L5T A;  1LAX A;  2DP8 A;  1JVX A;  4POW A;  1B6H A;  3JV9 A;  4OXV A;  4KYD A;  3T9V A;  1NKX A;  4DIG A;  2XD2 A;  3TZA A;  3H6W A;  3HCQ A;  4FIM A;  1MXY A;  1DPE A;  3V83 A;  3TTL A;  5AA2 D;  4YU0 A;  3FVN A;  4M1V A;  3EN3 A;  1FQC A;  2UVH A;  3SDF A;  1CB6 A;  1A8E A;  3GXA A;  3FV2 A;  4ZEB A;  2V3U A;  3FXR A;  4LQ5 A;  4OEV A;  5DT6 A;  3UA8 A;  3K1M A;  1T0K A;  3U93 A;  4JXI A;  3M3L A;  3CIJ A;  4C1U A;  1POY 1;  2GHA A;  1GTK A;  4O3B A;  5JEI A;  4G8N A;  4QFK A;  3FXQ A;  1Z7M E;  1XVX A;  3MWB A;  1NNT A;  1WVJ A;  4ELR A;  1BP5 A;  4DE8 A;  1OIB A;  2H99 A;  3VLW A;  2XXY A;  2F7A A;  3CSB A;  1M5B A;  2CZL A;  2QJE A;  1RYX A;  2QSX A;  3VDF A;  4MLV A;  3PPR A;  1RKM A;  3IX1 A;  1IZ1 A;  3K4U A;  1QUL A;  1XHY A;  3HHF A;  1B5I A;  1P1N A;  1SQY A;  4KHZ E;  4F1U A;  3ZKK A;  5BUU A;  1B4H A;  4U2R A;  3PUX E;  4G4P A;  3CSG A;  2M8C A;  3VE1 B;  2UYF A;  4PFW A;  3IJX B;  3O28 A;  1A8F A;  1WOD A;  5ITP A;  4G8M A;  5CMB A;  2ONS A;  5I57 B;  4X48 A;  4X1B A;  3VXB A;  3RTW B;  3K6U A;  1OVT A;  4OZ9 A;  3S2V A;  2NVU B;  3FJG A;  4YB6 A;  4ELQ A;  3L6H A;  1DSN A;  3MZ9 A;  2XXP A;  3A3C A;  2OK2 A;  3UK4 A;  5KZT A;  3HV1 A;  3LC8 A;  2V3Q A;  2QS1 A;  1NNP A;  1VE4 A;  2RC9 A;  1PBQ A;  4U22 A;  1A40 A;  1FW0 A;  4XIG Q;  3D4C A;  5I2K A;  2UYE A;  1MY3 A;  1B05 A;  1PEB A;  2PYY A;  2ALU A;  4KCD A;  3MP1 A;  1JVY A;  3MC2 A;  3G3K A;  4P0G A;  2Q2C A;  2F5X A;  3PPQ A;  4H8J A;  2XXV A;  2F7B A;  1ELJ A;  3CI8 A;  4RPO A;  2Y7I A;  3MVZ A;  4BDM A;  2E0S A;  1YCJ A;  2I3V A;  2Z8F A;  1A99 A;  1N3X A;  3S9E A;  3S9M C;  2Q2A A;  3E9X A;  4YIC A;  3OSQ A;  1H45 A;  4Q5T A;  4LZ5 A;  2OZZ A;  2G29 A;  1XS5 A;  4DZ1 A;  1MXU A;  3TOD A;  3PUY E;  1OLC A;  4N07 A;  5B7D A;  1P99 A;  3RUM A;  3M8U A;  3N94 A;  1HSL A;  3TMG A;  2X7Q A;  3T93 B;  4RY1 A;  4K3F A;  3B6T A;  4IGR A;  4GXA A;  3GBB A;  1EZ9 A;  1USY E;  2WKY A;  3MP8 A;  2QMX A;  3C34 A;  3IB2 A;  4FJP A;  4DXU A;  1B3E A;  1M5C A;  4PE5 B;  3UOR A;  4OER A;  1ZLQ A;  5I56 A;  2THI A;  3FJM A;  4LVQ A;  3KG2 A;  4I8C A;  5KDT A;  2CMO A;  3S4U A;  3L6G A;  3PPN A;  4F19 A;  3O6G A;  3O9P A;  2RCB A;  3RY3 A;  1DPP A;  2ABH A;  2I3W A;  4ZED A;  5H8N A;  1HSE A;  4TOZ A;  3THI A;  3MVX A;  3TYH A;  1SI1 A;  1ZMG A;  2UVJ A;  5H8H B;  4GQO A;  1NMU A;  4H6D A;  5TPA A;  1MXV A;  4XKN A;  3TDJ A;  1DTZ A;  1MDP 1;  1SYI A;  4ZDM A;  5I58 B;  1GV8 A;  1I6B A;  5JTY A;  4FEB A;  1QVS A;  5A5X A;  1XC1 A;  5KCJ A;  3RT8 A;  3PU5 A;  4R2B A;  1PB9 A;  1IXI A;  1H3D A;  3OEK A;  2R6G E;  4OEU A;  1FTJ A;  3R26 A;  3O6H A;  3U8Q A;  1KWH A;  1LAG E;  4QRZ A;  4ONY A;  4R73 A;  3GLB A;  1BLF A;  3Q27 A;  3K6X A;  4IB2 A;  4PFU A;  1MDQ A;  3RNN A;  2ESN A;  1LST A;  2DE3 A;  2HAV A;  5EHS A;  2F35 A;  4LA9 A;  1AIV A;  3TPA A;  3I5O A;  2DYX A;  2O7U A;  2RF1 A;  4NF6 B;  3TQW A;  1IXC A;  4KFQ A;  1Q1K A;  2FNC A;  4OHN A;  5I59 B;  2A5T A;  1MM7 A;  5I2K B;  2AL4 A;  3TCF A;  2DOJ A;  3O6I A;  5DVI A;  1B9J A;  4ESX A;  5ISU A;  1N7W A;  2YPN A;  1Y3P A;  3KZG A;  4KI0 E;  2QL3 A;  4YB7 A;  5EYF A;  5I2N A;  3ZS6 A;  2OWS A;  3IO6 A;  5AA2 A;  3A3U A;  3QXM A;  2R71 A;  1O63 A;  1QKB A;  2I58 A;  3E4R A;  3KFM A;  3EPE A;  3IOV A;  2F7C A;  5H8F A;  4KYS A;  1IXG A;  4HTG A;  1B1X A;  4DCX A;  4GL8 A;  3IR1 A;  2AL5 A;  1UTB A;  1B51 A;  1OQH A;  4OTE A;  2BJJ X;  3EF7 A;  1H76 A;  2XXX A;  4YMB A;  1B32 A;  3LSF B;  2H4I A;  4L17 A;  4Z0I A;  1B0L A;  5TP9 A;  1MXZ A;  2NUV A;  3WAE A;  3SEX A;  3OEL A;  5DVF A;  3H4Z A;  4MBP A;  2PBW A;  1UQW A;  5TU0 A;  3CFZ A;  5B70 A;  1Y3Q A;  4R9F A;  1B40 A;  1NH7 A;  3GBA A;  4PET A;  5I56 B;  5HPQ A;  3SEU A;  4GFR A;  3MQ9 A;  5KDT B;  2DVZ A;  3C36 A;  3O97 A;  1LBB A;  4QFN A;  4H8I A;  1LB8 A;  5AA1 A;  4GL0 A;  3VVF A;  3FV1 A;  4YKJ A;  1N76 A;  2GRV A;  3B6Q A;  4RYA A;  4F1Y A;  3FVG A;  3UGW A;  1FQA A;  4IO5 A;  3C9H A;  3KN8 A;  5K2X A;  3CG1 A;  3SEY A;  4U4X A;  3C31 A;  1D9V A;  1QUI A;  2XXR A;  3LR1 A;  4BDQ A;  4ZS9 A;  1S50 A;  4YKP A;  4X9T A;  3VV5 A;  4QHQ A;  2I6E A;  4ZE9 A;  3RN8 A;  1I6Q A;  3DP8 A;  4E0W A;  3QK6 A;  3VVE A;  1DOT A;  2ZNS A;  3KJT A;  3MPL A;  5CM6 A;  1N3W A;  2GH9 A;  3OO6 A;  3VXC A;  4F31 B;  4KPT A;  4TLL B;  1ANF A;  1B0H A;  4XXU A;  3T9X B;  3H06 B;  4GWO A;  5LOM A;  2W7Y A;  3FIR A;  5M2V A;  5AA3 A;  2XX9 A;  3BKI B;  2A5T B;  2GFE A;  4ZE8 A;  2DE4 A;  3BFU A;  4IO3 A;  2B3B A;  3IB1 A;  4EDP A;  4G8H A;  1UIU A;  4TLM B;  3SER A;  3O29 A;  5ICT A;  1EH3 A;  5HM4 B;  3DLN A;  2P1S A;  4DXC A;  4PQJ A;  3H7M A;  3W9W A;  3FVK A;  3PMX A;  2REG A;  3PPP A;  4I1D A;  3Q29 A;  4R72 A;  4OWD A;  1S9T A;  2H9B A;  4TQU Q;  1MQG A;  1B7H A;  3FVO A;  2Q8J A;  2Z8D A;  3KJ7 A;  3M3K A;  2ZNU A;  2A5S A;  1PB8 A;  4ZEF A;  1MY4 A;  3C35 A;  2LAO A;  1TT1 A;  1URD A;  3C4M A;  4G68 C;  3O66 A;  3SKP A;  5DEX A;  3EHU A;  4F2O A;  4LQ2 A;  4F29 A;  5CI5 A;  1Y4C A;  3TKD A;  4F3S A;  3C32 A;  4R6Y A;  5ITO A;  4X1D A;  1QW0 A;  1I69 A;  4G68 A;  4F3G A;  4Q8R A;  4OET A;  2RKM A;  3EQ1 A;  3PD8 A;  2XD3 A;  3TEP A;  5HBC A;  5TP9 B;  1IQ7 A;  3U72 A;  3KN7 A;  5AA4 A;  2XXT A;  3KGC A;  2I49 A;  3RGY A;  4THI A;  4QSE A;  3KEI A;  1MXW A;  1MS7 A;  4RXL A;  1QUJ A;  5L8D A;  2Y84 A;  4BDO A;  5L9M A;  4WEP A;  2DVC A;  1NFT A;  3VLU A;  2O84 X;  2Y7W A;  1MRP A;  4XTC Q;  1P1U A;  1I6A A;  1YPN A;  1OLA A;  1GVC A;  5H8Q B;  5EHM A;  3IAZ A;  2Q89 A;  1YTV A;  3TUS A;  1OQG A;  1B52 A;  1LBC A;  5FHN A;  2XXW A;  3O2A A;  4F3B A;  2I0B A;  2PX1 A;  3N5L A;  1BIY A;  3IOT A;  1Y3N A;  1ZU0 A;  3T96 B;  1VFD A;  2B65 A;  3MW0 A;  3BBR A;  4LZ7 A;  1QJM A;  4ESW A;  4KYE A;  5CBR A;  1TFD A;  4ISU A;  1POT A;  4F1V A;  4NWD A;  1LAH E;  2XX8 A;  3DM0 A;  4QF9 A;  3TTN A;  1B3L A;  4EF1 A;  1CE2 A;  4ELO A;  5L9S A;  1A7L A;  3H6V A;  3SES A;  3KOT A;  3UP9 A; 
#chains in the Genus database with same CATH topology
 4H5F A;  5J16 A;  2V25 A;  2RIN A;  4GXS B;  1YAE A;  3C33 A;  3OEM A;  1IEJ A;  4FOR A;  3HPI A;  4PBH A;  2OLB A;  1R9L A;  2PT2 A;  3B7D A;  4QFO A;  1B5J A;  3G3I A;  3MVY A;  2HQ0 A;  1TXF A;  3IOU A;  4RNS A;  1IIT A;  1SI0 A;  3B6W A;  3FUZ A;  4OMB A;  5I5P A;  3K6V A;  4H1X A;  4DDD A;  3ODB A;  1FSA A;  1ATG A;  1MPD A;  2ANJ A;  2ZZW A;  3IO4 A;  4NF8 A;  1PB7 A;  2ONK E;  2PMS A;  3IOR A;  3H3G A;  2AIX A;  1QGX A;  3TAJ A;  4JWX A;  3H6T A;  2HZL A;  1R1N A;  4NF0 A;  1GR2 A;  4H67 A;  1FTL A;  3VVD A;  1FQD A;  4YKK A;  5A5L A;  4MMP A;  2HAU A;  4G2Z A;  1MY2 A;  4PF6 A;  1LCF A;  4O8M A;  4JB7 A;  3LV0 A;  1B7U A;  4U21 A;  5H8S A;  1N04 A;  3MP6 A;  4N13 A;  1B7Z A;  5DEX B;  4R6K A;  1MQH A;  1PBP A;  1FTK A;  1MXX A;  3ZSF A;  4GF8 A;  4F3P A;  2XWV A;  4GRK A;  2Q8M A;  3KSX A;  2DQV A;  1XOC A;  3USD A;  4ZEK A;  4JDF A;  2FHY A;  4PDH A;  4KCC A;  2RC7 A;  3SEV A;  4X04 A;  4P47 A;  2P0S A;  3MVW A;  4PP0 A;  4IO2 A;  4N6K A;  3K1N A;  2KQZ A;  2VOZ A;  1MG1 A;  4NE4 A;  4G68 B;  4RJZ A;  3CFL A;  5BWJ A;  4ZEC A;  3IL1 B;  2ZMB A;  2ZYK A;  4H5G A;  5AA4 B;  1N84 A;  2I0C A;  1B5H A;  2JJK A;  4JWO A;  3W9V A;  1DMB A;  4HW8 A;  4U1Z A;  1EU8 A;  4PFI A;  1ZIU A;  3T9H B;  3U94 A;  4GOT A;  2WYP A;  4MEV A;  3ILU B;  3DEL B;  5ET8 A;  2X7P A;  2XXK A;  3S9L C;  3FZV A;  1QUK A;  2VD3 A;  3OO7 A;  2Z22 A;  3PGF A;  1MY1 A;  4YAH X;  5CMM A;  3TTM A;  2GQ1 A;  3OEN A;  2XWI A;  4GIZ A;  1BTJ A;  1FPD A;  4FBP A;  2F34 A;  1DCU A;  3T9U A;  1OVB A;  4JSD A;  1FBE A;  4IY6 A;  2Q9T A;  4YKI A;  3WAF A;  1NNF A;  3FXB A;  3QAX A;  1MQD A;  4RK2 A;  2RC8 A;  3LSX A;  4P3L A;  3OD7 A;  1B3H A;  1KA1 A;  2FBP A;  3KOS A;  1MH4 A;  5CMK A;  2UVG A;  1AMF A;  2HXW A;  2ZYO A;  5IAI A;  3CFX A;  4RK9 A;  4XEQ A;  2GHB A;  1S7Y A;  1MH3 A;  4JSO A;  2ONR A;  4OVT A;  1R6Z A;  4GLI A;  4EF2 A;  1B4Z A;  2Q88 A;  2F6G A;  5I57 A;  1II5 A;  2OX3 A;  4UAB A;  1P1Q A;  5FBP A;  4UA8 A;  3ECR A;  1SW5 A;  4FAT A;  5IZZ A;  3LBS A;  1H43 A;  2YJP A;  3M3F A;  3OMB A;  3R7X A;  2I4B A;  2QPQ A;  1IIW A;  3K01 A;  3TEL A;  3MUQ A;  2CEX A;  2QMW A;  3PMV A;  1MQJ A;  3LSW A;  3TQL A;  1LB9 A;  3T66 A;  5CC2 A;  4F18 A;  4AQ4 A;  1LGB C;  1ZKB A;  2XA5 A;  1SW1 A;  1Y20 A;  2VT5 A;  2DDK A;  1Y9U A;  2DSF A;  5F7V A;  4O7I A;  1XT8 A;  1LBY A;  3KSJ A;  2V84 A;  3DP4 A;  4F22 A;  2R9J A;  3SET A;  3VLV A;  2QS3 A;  3N6T A;  2XWO A;  3IJO B;  3TTK A;  3LUY A;  3FAT A;  3H03 A;  5DYH A;  4C1T A;  1BKA A;  4NF8 B;  5H8N B;  1JNF A;  3PUW E;  1FPF A;  4N6D A;  5IKB A;  3JYR A;  4G77 A;  4MH5 A;  2QS2 A;  3ONM A;  4OYV A;  5TPA B;  1VSO A;  4HCY A;  2CZK A;  2F36 A;  4X8R A;  1H44 A;  5JTY B;  3FJ7 A;  4O3A A;  4ELP A;  5A5X B;  5KCJ B;  3HHG A;  4NF4 A;  1JEV A;  3V89 B;  4DLD A;  2PFY A;  5FTI A;  4GVO A;  1FJ9 A;  4P0I A;  4R2F A;  4ZZA A;  3FAS A;  4EXK A;  3UIF A;  3IK6 B;  1NNK A;  2Z23 A;  4MFI A;  4LUB A;  2QRY A;  3V8X B;  4OVQ A;  5CBS A;  3RT6 B;  4OVJ A;  2Y5L A;  3IB0 A;  1MM6 A;  3F11 A;  4DXB A;  4EXL A;  3B50 A;  5K2Y A;  3P7I A;  3HFU A;  1NH8 A;  1JET A;  1US4 A;  2QVV A;  1SW4 A;  4LON B;  1VFE A;  2DWH A;  1UIV A;  4YB5 A;  1FPJ A;  4YZZ A;  3IFA A;  4MNP A;  1ZBM A;  1RYO A;  4P1E A;  3T22 A;  2Y5K A;  3I6V A;  1B1H A;  4XKR A;  4WED A;  1HSJ A;  4FAJ A;  4EQ7 A;  1FQE A;  3VFJ A;  5I2N B;  2XHD A;  3E78 A;  5ICQ A;  2DS9 A;  1BK4 A;  2VPN A;  5AA2 B;  1LFH A;  3K1P A;  1O64 A;  4BDL A;  1JW1 A;  4Q0C A;  1F9B A;  1Q35 A;  2V3T A;  1MPC A;  2MKZ A;  2O69 A;  4XKQ A;  4MHF A;  1M5D A;  3LSL A;  4ECF A;  3K02 A;  1B3G A;  5H8H A;  1B58 A;  4BLA A;  4N8Y A;  2REJ A;  4PFT A;  4NWC A;  5H8F B;  3QYT A;  2XXQ A;  1MPB A;  5I58 A;  3MZ1 A;  3W15 C;  4H0W A;  3TCH A;  2I48 A;  1FBF A;  2OWT A;  1D4N A;  3PD9 A;  1UTB B;  5L9O A;  2O1L A;  2HZK A;  4OVP A;  1O7T A;  2UXA A;  4GBV A;  1IMF A;  4RPN A;  3ROJ A;  3OOA A;  4AB5 A;  4H65 A;  1FTO A;  4R9G A;  1PDA A;  2F3D A;  1LFG A;  2UVI A;  4ND9 A;  1FBH A;  1DBZ A;  1LFI A;  4OA4 A;  3A09 A;  2HEU A;  3BIG A;  4GX3 A;  2D3I A;  2XXI A;  2VHA A;  2O51 A;  4HE2 A;  1UTH A;  4R75 A;  2VD2 A;  3HO7 A;  2Y7K A;  1VR5 A;  4NF6 A;  4O94 A;  4U23 A;  2XWK A;  3G3F A;  2IEE A;  4OES A;  2B3F A;  2OBG A;  1FQF A;  4DCY A;  1AL3 A;  5EQ8 A;  4F39 A;  5I59 A;  2NOO A;  4I3E A;  3U92 A;  2ZXT A;  3AXF A;  4FED A;  2ZNT A;  5AE4 A;  3QSL A;  3QUF A;  4IO4 A;  4N6P A;  1NL5 A;  3FGS A;  3MJN A;  3KN3 A;  1FQB A;  1JW5 A;  3OO9 A;  1M5E A;  1DTG A;  4OAN A;  5DTB A;  2KLF A;  3N26 A;  4NED A;  1IMB A;  4NF5 A;  4NMY A;  4RA1 A;  2FYI A;  2B4L A;  2XXU A;  3PUZ E;  2V93 A;  1FCK A;  1SYH A;  2D21 A;  2F8D A;  2DWA A;  1ZJL A;  4KR5 A;  3OXN A;  3CR9 A;  1GGG A;  3PMW A;  4I62 A;  1FRP A;  4NF4 B;  5ET7 A;  2F3B A;  2QFL A;  2YLN A;  2OJT A;  4LZ8 A;  2QS4 A;  2OWZ A;  4IO7 A;  4WXJ A;  2DWI A;  2FA7 A;  4NQ8 A;  5CRY A;  4LP2 B;  1LLS A;  1M5F A;  3EKI A;  4HXV A;  4IY5 A;  4JBZ A;  4LAT A;  3CRB A;  1AWB A;  3ZKL A;  4O3C A;  4MLQ A;  1D9Y A;  2O1M A;  3JZJ A;  2Y7P A;  4UAC A;  1FPK A;  3CVG A;  3QUJ A;  3FD3 A;  3EHT A;  3PUV E;  4MF3 A;  3TFL A;  3Q26 A;  3DP6 A;  4XKP A;  5FHO A;  3MPK A;  4PFY A;  4Q30 B;  4NAP A;  2P2A A;  2ZYM A;  1N0T A;  3K00 A;  3OO8 A;  3EHS A;  2AYS A;  1RDX A;  3BFT A;  3K0V A;  1URS A;  1AOV A;  1JW4 A;  4MJO A;  4QSD A;  4JWY A;  2ZYN A;  1A54 A;  3MAM A;  4OQO A;  2Z8E A;  2PT1 A;  3I3V A;  3V5A A;  4N15 A;  4U4S A;  1NV2 A;  1K9Y A;  3ISP A;  3IFC A;  1RDZ A;  5I84 A;  1USY H;  3CG3 A;  2XX7 A;  4OFO A;  3PPO A;  3QMF A;  2DWJ A;  3U1O A;  1SW2 A;  3K2D A;  1URG A;  3HST A;  1ZTY A;  1G0H A;  1IXH A;  1Y4T A;  3R6U A;  3E13 X;  4EQB A;  1MY0 A;  4R6H A;  3E3K A;  3MYU A;  3ILT B;  3TTR A;  1CNQ A;  2WBB A;  2NXO A;  1IUD A;  4QFP A;  4QFL A;  1WDN A;  1VDW A;  3RQT A;  4E0X A;  3FXU A;  3RPW A;  3G3J A;  1NV6 A;  1A55 A;  1LBV A;  3G3H A;  4NTL A;  4PGP A;  4DI4 B;  2DXY A;  1PC3 A;  2G93 A;  4ZZE A;  1XI6 A;  4KQP A;  3MZB A;  2OCU A;  3Q28 A;  4M4G A;  4U1O A;  4PBQ A;  1NV0 A;  4POX A;  4GD5 A;  4BDR A;  4WKM A;  1EZP A;  3RPL B;  2F97 A;  3QIM A;  1R9Q A;  3PV0 E;  1UTH B;  3RLF E;  2RCA A;  2HCA A;  1SBP A;  5ELV A;  4ZEI A;  3D4G A;  3MST A;  1Y1M A;  1FPE A;  4R74 A;  4FE8 A;  2D5W A;  1P1W A;  1P1O A;  3HN0 A;  5CMC A;  1LAF E;  2VP1 A;  2X26 A;  4KD5 A;  4C0R A;  3IOW A;  4Z7E A;  1B3F A;  4PFB A;  2VGQ A;  4MCO A;  4HCW A;  2E1S A;  1N7X A;  2DE2 A;  5ET5 A;  4AB6 A;  1SDX A;  2I4C A;  3G3G A;  4NF5 B;  2O7I A;  4EUO A;  2FIE A;  2ZZX A;  1LCT A;  1JEU A;  1SD3 A;  4AS5 A;  3RYD A;  1FTM A;  1IME A;  3Q25 A;  1D3K A;  2H25 A;  5JK4 A;  1INP A;  3OSR A;  2O6A A;  1XVY A;  1AH5 A;  4IO6 A;  1B2H A;  4QBA A;  4JVD A;  4QSC A;  5EYH A;  5J1D A;  5DVJ A;  2H5Y A;  1TFA A;  3N6U A;  3T1B A;  5F1Q A;  3GZG A;  3UN6 A;  1QKA A;  1Y1Z A;  1J1N A;  4GWS A;  2XXH A;  2O68 A;  1MQI A;  4G61 A;  3TCG A;  2DXR A;  4F2Q A;  2HFB A;  1FPB A;  4HS7 A;  1EZO A;  2IA4 A;  4P1L A;  1JQF A;  2F78 A;  2H98 A;  4YMA A;  3G7W A;  1Z7N E;  1TWY A;  1IMA A;  3SEW A;  4PC9 A;  1K9Z A;  1JP4 A;  4I9D A;  1US5 A;  3K6W A;  2NWJ A;  4N91 A;  4MNC A;  2F6P A;  4OFJ A;  1YYZ A;  1SVX B;  4P11 A;  4OEN A;  4IGT A;  4EQ9 A;  5EQ7 A;  2Y7R A;  1YZ0 A;  3MBP A;  1NV5 A;  5FTH A;  3S9N C;  5FHM A;  4FEC A;  1OMP A;  1B46 A;  3RTF B;  2PVU A;  1EYK A;  3H6U A;  5EYG A;  4BDN A;  4OFL A;  5H8Q A;  3KBR A;  1L5T A;  2KR0 A;  1LAX A;  2DP8 A;  1JVX A;  4POW A;  1B6H A;  1IMC A;  3JV9 A;  4OXV A;  4KYD A;  3T9V A;  1NKX A;  4DIG A;  4N17 A;  2XD2 A;  3TZA A;  2WBD A;  3H6W A;  3HCQ A;  1NUX A;  4OVR A;  4FIM A;  1MXY A;  1DPE A;  4PE3 A;  3V83 A;  3TTL A;  1D9Q A;  5AA2 D;  4YU0 A;  3FVN A;  4M1V A;  3PTY A;  3EN3 A;  1FQC A;  2UVH A;  3SDF A;  1CB6 A;  1A8E A;  3GXA A;  3FV2 A;  5T3J A;  4ZEB A;  2V3U A;  3FXR A;  4LQ5 A;  4OEV A;  4PFR A;  5DT6 A;  3UA8 A;  3K1M A;  4MX6 A;  1T0K A;  2FVZ A;  3U93 A;  4JXI A;  2QVR A;  3M3L A;  3CIJ A;  4C1U A;  1POY 1;  2GHA A;  1GTK A;  4O3B A;  5F24 A;  1EYJ A;  4PF8 A;  5JEI A;  4G8N A;  4QFK A;  3FXQ A;  1Z7M E;  4H46 A;  1XVX A;  4GWZ A;  3MWB A;  1NNT A;  1WVJ A;  4ELR A;  1LEV A;  1BP5 A;  4DE8 A;  1OIB A;  2H99 A;  3VLW A;  2XXY A;  2F7A A;  3CSB A;  1IMD A;  1M5B A;  2CZL A;  2QJE A;  1RYX A;  1FBC A;  3T0J A;  2QSX A;  3VDF A;  4MLV A;  3PPR A;  1RKM A;  3IX1 A;  1IZ1 A;  3K4U A;  2P3N A;  1QUL A;  1XHY A;  3HHF A;  1B5I A;  1P1N A;  3LUZ A;  1SQY A;  4KHZ E;  4F1U A;  3ZKK A;  5BUU A;  1B4H A;  4U2R A;  5LTC A;  3PUX E;  4G4P A;  3CSG A;  2M8C A;  3CHG A;  3VE1 B;  2UYF A;  4PFW A;  1KA0 A;  3IJX B;  3O28 A;  1A8F A;  1WOD A;  5ITP A;  4G8M A;  5CMB A;  2ONS A;  5I57 B;  4X48 A;  4X1B A;  3VXB A;  3RTW B;  3K6U A;  1OVT A;  4OZ9 A;  3S2V A;  2NVU B;  3FJG A;  4MNI A;  4YB6 A;  4ELQ A;  1FTA A;  3L6H A;  1DSN A;  3MZ9 A;  2XXP A;  3A3C A;  4H45 A;  2OK2 A;  3UK4 A;  5KZT A;  1FPL A;  3HV1 A;  3LC8 A;  2V3Q A;  2QS1 A;  1NNP A;  1VE4 A;  5I7I A;  1LBZ A;  2RC9 A;  1PBQ A;  4U22 A;  1A40 A;  1FW0 A;  4XIG Q;  3D4C A;  5I2K A;  2UYE A;  4MIJ A;  1MY3 A;  4PDD A;  1B05 A;  1PEB A;  2PYY A;  2CZI A;  2ALU A;  4KCD A;  3MP1 A;  1JVY A;  3MC2 A;  3G3K A;  4P0G A;  2Q2C A;  1YXI A;  2F5X A;  3PPQ A;  4H8J A;  2XXV A;  2F7B A;  2FIX A;  1ELJ A;  4AS4 A;  3CI8 A;  4RPO A;  2Y7I A;  3MVZ A;  4NGU A;  4BDM A;  2E0S A;  4NHB A;  1YCJ A;  2I3V A;  2Z8F A;  3KC1 A;  1A99 A;  1N3X A;  3S9E A;  3S9M C;  2Q2A A;  3E9X A;  4YIC A;  3OSQ A;  1H45 A;  4Q5T A;  4LZ5 A;  2OZZ A;  2G29 A;  1XS5 A;  4PTK A;  4DZ1 A;  1MXU A;  3TOD A;  3PUY E;  1OLC A;  4N07 A;  1LBX A;  5B7D A;  1P99 A;  3RUM A;  1FPG A;  3M8U A;  3N94 A;  1HSL A;  3TMG A;  5I3S A;  1FBG A;  2X7Q A;  3T93 B;  4RY1 A;  4NX1 A;  4GWU A;  4K3F A;  3B6T A;  4IGR A;  1NV4 A;  4JVC A;  4GXA A;  4GWX A;  3GBB A;  1EZ9 A;  1USY E;  2WKY A;  3MP8 A;  2QMX A;  3C34 A;  3IB2 A;  4FJP A;  4DXU A;  1B3E A;  1M5C A;  4KXP A;  4PE5 B;  3UOR A;  4PAI A;  4OER A;  4JVI A;  1ZLQ A;  5I56 A;  2THI A;  3FJM A;  1NV1 A;  4LVQ A;  3KG2 A;  4I8C A;  5KDT A;  2CMO A;  5DW8 A;  4IR8 A;  3S4U A;  3L6G A;  3PPN A;  4F19 A;  3O6G A;  3O9P A;  2RCB A;  3RY3 A;  4I3Y A;  1DPP A;  2ABH A;  2I3W A;  4ZED A;  5H8N A;  1HSE A;  4TOZ A;  3THI A;  3MVX A;  4OVS A;  3TYH A;  4HE0 A;  1SI1 A;  2ZZV A;  1ZMG A;  2UVJ A;  4GX4 A;  5H8H B;  4GQO A;  1NMU A;  4H6D A;  5TPA A;  2WX9 A;  1MXV A;  4XKN A;  3TDJ A;  1DTZ A;  1MDP 1;  1SYI A;  4ZDM A;  5I58 B;  1GV8 A;  1I6B A;  5JTY A;  1FJ6 A;  4FEB A;  1QVS A;  5A5X A;  1XC1 A;  5KCJ A;  4N81 A;  3RT8 A;  3PU5 A;  4R2B A;  1PB9 A;  1IXI A;  3KBZ A;  1H3D A;  3OEK A;  2R6G E;  4OEU A;  1FTJ A;  3R26 A;  5LDZ A;  2PFZ A;  3O6H A;  3U8Q A;  1KWH A;  1LAG E;  3D1R A;  4QRZ A;  4ONY A;  4R73 A;  3GLB A;  1BLF A;  3Q27 A;  3K6X A;  4IB2 A;  4HE1 A;  4PFU A;  1MDQ A;  3RNN A;  2ESN A;  1LST A;  2DE3 A;  2HAV A;  5IZ3 A;  5EHS A;  2F35 A;  4LA9 A;  2QVU A;  1AIV A;  3TPA A;  3I5O A;  2DYX A;  4QXD A;  2O7U A;  2RF1 A;  4NF6 B;  3TQW A;  1IXC A;  4KFQ A;  1Q1K A;  2FNC A;  4OHN A;  5I59 B;  2A5T A;  1MM7 A;  5I2K B;  2AL4 A;  3TCF A;  2DOJ A;  1FBP A;  3O6I A;  5DVI A;  2HXR A;  1B9J A;  4ESX A;  5ISU A;  1NUZ A;  4NG7 A;  1N7W A;  2YPN A;  1Y3P A;  3KZG A;  4KI0 E;  2QL3 A;  4YB7 A;  5EYF A;  5I2N A;  3ZS6 A;  2OWS A;  3FBP A;  3IO6 A;  5AA2 A;  1SPI A;  3A3U A;  3QXM A;  2R71 A;  1O63 A;  1NI9 A;  4PAF A;  1QKB A;  2I58 A;  3E4R A;  3KFM A;  3EPE A;  3IOV A;  4GWY A;  2F7C A;  5H8F A;  4KYS A;  2L5V A;  1IXG A;  4DI3 D;  4HTG A;  4XFE A;  1B1X A;  4N8G A;  4DCX A;  1FPI A;  4GL8 A;  3IR1 A;  2AL5 A;  1UTB A;  1B51 A;  2WYK A;  1OQH A;  4OTE A;  1NV3 A;  2BJJ X;  3EF7 A;  1H76 A;  2V4C A;  2XXX A;  4YMB A;  1LBW A;  1B32 A;  3LSF B;  2H4I A;  4N4U A;  4L17 A;  5IZ1 A;  4Z0I A;  1B0L A;  5TP9 A;  1MXZ A;  2NUV A;  3WAE A;  3SEX A;  3OEL A;  5DVF A;  3H4Z A;  4MBP A;  2PBW A;  1UQW A;  5TU0 A;  3CFZ A;  5B70 A;  1Y3Q A;  4R9F A;  1B40 A;  1NH7 A;  3GBA A;  4PET A;  5I56 B;  5HPQ A;  3SEU A;  4GFR A;  3NOH A;  3MQ9 A;  4PCD A;  5KDT B;  2DVZ A;  1G0I A;  3C36 A;  3O97 A;  1LBB A;  4QFN A;  4GBW A;  4H8I A;  1LB8 A;  5EQA A;  5AA1 A;  4GL0 A;  3VVF A;  5ET6 A;  3FV1 A;  4YKJ A;  1N76 A;  2GRV A;  3B6Q A;  4RYA A;  4F1Y A;  3FVG A;  3UGW A;  1FQA A;  4IO5 A;  3C9H A;  3KN8 A;  5K2X A;  3CG1 A;  3SEY A;  4U4X A;  3C31 A;  1D9V A;  1NUY A;  2B4M A;  1QUI A;  2XXR A;  3LR1 A;  4BDQ A;  4ZS9 A;  1S50 A;  3B8B A;  4YKP A;  4X9T A;  3VV5 A;  4QHQ A;  2I6E A;  4ZE9 A;  5EQ9 A;  3RN8 A;  1I6Q A;  3DP8 A;  4E0W A;  3QK6 A;  3VVE A;  1DOT A;  4P56 A;  2ZNS A;  3KJT A;  4GWW A;  3MPL A;  5CM6 A;  1N3W A;  5IGA A;  2GH9 A;  3OO6 A;  3VXC A;  2Q74 A;  4F31 B;  1DK4 A;  4KPT A;  4TLL B;  1ANF A;  5IZ3 B;  1B0H A;  4XXU A;  1NUW A;  3T9X B;  3H06 B;  4GX6 A;  4GWO A;  5LOM A;  2W7Y A;  3FIR A;  5M2V A;  5AA3 A;  2XX9 A;  3BKI B;  2A5T B;  2GFE A;  4ZE8 A;  2DE4 A;  3BFU A;  4IO3 A;  5IM2 A;  2B3B A;  3IB1 A;  4P8B A;  4EDP A;  4G8H A;  4I40 A;  1UIU A;  3BIH A;  4TLM B;  1RDY A;  3SER A;  3O29 A;  5ICT A;  1EH3 A;  1EYI A;  5HM4 B;  4MAG A;  3DLN A;  2P1S A;  4DXC A;  4PQJ A;  3H7M A;  3W9W A;  3FVK A;  3PMX A;  2REG A;  3PPP A;  4I1D A;  3Q29 A;  4R72 A;  4OWD A;  1S9T A;  2H9B A;  4PGN A;  4TQU Q;  1MQG A;  2P3V A;  1B7H A;  3FVO A;  3SZP A;  2Q8J A;  2Z8D A;  3KJ7 A;  4O7M A;  3M3K A;  2ZNU A;  2A5S A;  2HPG A;  1PB8 A;  4ZEF A;  1MY4 A;  3C35 A;  2LAO A;  1TT1 A;  1URD A;  3C4M A;  4G68 C;  3O66 A;  3SKP A;  5DEX A;  4XF5 A;  1FBD A;  2HHM A;  3EHU A;  4F2O A;  4LQ2 A;  4F29 A;  5CI5 A;  1Y4C A;  3GYY A;  3TKD A;  4F3S A;  3C32 A;  4R6Y A;  1NV7 A;  5ITO A;  4X1D A;  1QW0 A;  1I69 A;  4G68 A;  4F3G A;  4Q8R A;  4OET A;  2RKM A;  3EQ1 A;  3PD8 A;  2XD3 A;  3TEP A;  5HBC A;  3RPL A;  5TP9 B;  1IQ7 A;  3U72 A;  3KN7 A;  5AA4 A;  2XXT A;  3KGC A;  2I49 A;  3RGY A;  4THI A;  4QSE A;  3KEI A;  2CZH A;  1MXW A;  2WEF A;  1MS7 A;  4RXL A;  1QUJ A;  5L8D A;  2Y84 A;  4BDO A;  5L9M A;  4WEP A;  2DVC A;  1NFT A;  3VLU A;  1KZ8 A;  2O84 X;  2Y7W A;  1Q9D A;  1MRP A;  4PAK A;  4XTC Q;  1P1U A;  1I6A A;  1YPN A;  2VPO A;  4NN3 A;  1OLA A;  1GVC A;  5H8Q B;  5EHM A;  2BJI A;  3IAZ A;  2Q89 A;  1YTV A;  3A29 A;  3TUS A;  1OQG A;  1B52 A;  1LBC A;  5FHN A;  2XXW A;  3O2A A;  2CEY A;  4F3B A;  2I0B A;  2PX1 A;  3N5L A;  1BIY A;  3IOT A;  3E79 A;  1Y3N A;  1ZU0 A;  3U65 A;  3T96 B;  1VFD A;  2B65 A;  3MW0 A;  5ESY A;  3BBR A;  4LZ7 A;  1QJM A;  4ESW A;  4KYE A;  5CBR A;  1TFD A;  4ISU A;  1POT A;  4F1V A;  4NWD A;  1LAH E;  2R8T A;  2XX8 A;  3DM0 A;  4QF9 A;  3TTN A;  2PCR A;  1B3L A;  4LN5 A;  3KC0 A;  4EF1 A;  1CE2 A;  4ELO A;  5L9S A;  1A7L A;  3H6V A;  4P9K A;  3SES A;  3KOT A;  3UP9 A; 
#chains in the Genus database with same CATH homology
 4H5F A;  2V25 A;  2RIN A;  4GXS B;  1YAE A;  3C33 A;  3OEM A;  1IEJ A;  4FOR A;  3HPI A;  2OLB A;  1R9L A;  2PT2 A;  3B7D A;  4QFO A;  1B5J A;  3G3I A;  3MVY A;  2HQ0 A;  1TXF A;  3IOU A;  4RNS A;  1IIT A;  1SI0 A;  3B6W A;  3FUZ A;  4OMB A;  3K6V A;  4H1X A;  4DDD A;  3ODB A;  1ATG A;  1MPD A;  2ANJ A;  3IO4 A;  4NF8 A;  1PB7 A;  2ONK E;  2PMS A;  3IOR A;  3H3G A;  2AIX A;  3TAJ A;  4JWX A;  3H6T A;  2HZL A;  1R1N A;  1GR2 A;  4H67 A;  1FTL A;  3VVD A;  1FQD A;  4YKK A;  2HAU A;  4G2Z A;  1MY2 A;  1LCF A;  4JB7 A;  1B7U A;  4U21 A;  5H8S A;  1N04 A;  3MP6 A;  4N13 A;  1B7Z A;  5DEX B;  4R6K A;  1MQH A;  1PBP A;  1FTK A;  1MXX A;  3ZSF A;  4GF8 A;  4F3P A;  4GRK A;  3KSX A;  2DQV A;  1XOC A;  3USD A;  4ZEK A;  4JDF A;  4KCC A;  2RC7 A;  3SEV A;  2P0S A;  3MVW A;  4PP0 A;  4IO2 A;  3K1N A;  2VOZ A;  1MG1 A;  4NE4 A;  4G68 B;  4RJZ A;  3CFL A;  5BWJ A;  4ZEC A;  3IL1 B;  2ZMB A;  2ZYK A;  4H5G A;  5AA4 B;  1N84 A;  2I0C A;  1B5H A;  4JWO A;  3W9V A;  1DMB A;  4HW8 A;  4U1Z A;  1EU8 A;  1ZIU A;  3T9H B;  3U94 A;  4GOT A;  3ILU B;  3DEL B;  2X7P A;  3S9L C;  3FZV A;  1QUK A;  2VD3 A;  3OO7 A;  2Z22 A;  3PGF A;  1MY1 A;  4YAH X;  5CMM A;  3TTM A;  3OEN A;  4GIZ A;  1BTJ A;  2F34 A;  3T9U A;  1OVB A;  4JSD A;  4IY6 A;  2Q9T A;  4YKI A;  3WAF A;  1NNF A;  3QAX A;  1MQD A;  4RK2 A;  2RC8 A;  3LSX A;  3OD7 A;  1B3H A;  3KOS A;  1MH4 A;  5CMK A;  2UVG A;  1AMF A;  2HXW A;  2ZYO A;  5IAI A;  3CFX A;  4RK9 A;  2GHB A;  1S7Y A;  1MH3 A;  4JSO A;  2ONR A;  1R6Z A;  4GLI A;  4EF2 A;  1B4Z A;  2Q88 A;  2F6G A;  5I57 A;  1II5 A;  1P1Q A;  4UA8 A;  3ECR A;  1SW5 A;  4FAT A;  3LBS A;  1H43 A;  2YJP A;  3M3F A;  3OMB A;  3R7X A;  2I4B A;  2QPQ A;  1IIW A;  3K01 A;  3TEL A;  3MUQ A;  2QMW A;  3PMV A;  1MQJ A;  3LSW A;  3TQL A;  1LB9 A;  3T66 A;  5CC2 A;  4F18 A;  4AQ4 A;  1LGB C;  1ZKB A;  1SW1 A;  1Y20 A;  1Y9U A;  2DSF A;  5F7V A;  1XT8 A;  3KSJ A;  2V84 A;  3DP4 A;  4F22 A;  2R9J A;  3SET A;  3VLV A;  2QS3 A;  3N6T A;  3IJO B;  3TTK A;  3LUY A;  3FAT A;  3H03 A;  5DYH A;  4C1T A;  1BKA A;  4NF8 B;  5H8N B;  1JNF A;  3PUW E;  5IKB A;  3JYR A;  4G77 A;  2QS2 A;  4MH5 A;  3ONM A;  4OYV A;  5TPA B;  1VSO A;  4HCY A;  2F36 A;  1H44 A;  5JTY B;  3FJ7 A;  4O3A A;  4ELP A;  5A5X B;  5KCJ B;  3HHG A;  4NF4 A;  1JEV A;  3V89 B;  4DLD A;  5FTI A;  4GVO A;  4P0I A;  4R2F A;  4ZZA A;  3FAS A;  4EXK A;  3UIF A;  3IK6 B;  1NNK A;  2Z23 A;  4MFI A;  4LUB A;  2QRY A;  3V8X B;  5CBS A;  3RT6 B;  4OVJ A;  3IB0 A;  1MM6 A;  3F11 A;  4DXB A;  4EXL A;  5K2Y A;  3P7I A;  1NH8 A;  1JET A;  1US4 A;  1SW4 A;  4LON B;  1VFE A;  2DWH A;  1UIV A;  4YB5 A;  4YZZ A;  1ZBM A;  1RYO A;  3T22 A;  3I6V A;  1B1H A;  4XKR A;  4WED A;  1HSJ A;  4FAJ A;  4EQ7 A;  1FQE A;  3VFJ A;  5I2N B;  2XHD A;  5ICQ A;  2DS9 A;  5AA2 B;  1LFH A;  3K1P A;  1O64 A;  4BDL A;  1JW1 A;  4Q0C A;  1F9B A;  1Q35 A;  2V3T A;  1MPC A;  2O69 A;  4XKQ A;  1M5D A;  3LSL A;  4ECF A;  3K02 A;  1B3G A;  5H8H A;  1B58 A;  4BLA A;  2REJ A;  4PFT A;  4NWC A;  5H8F B;  3QYT A;  2XXQ A;  1MPB A;  5I58 A;  3MZ1 A;  3W15 C;  4H0W A;  3TCH A;  2I48 A;  2OWT A;  1D4N A;  3PD9 A;  1UTB B;  5L9O A;  2O1L A;  2HZK A;  1O7T A;  2UXA A;  4RPN A;  3OOA A;  4AB5 A;  4H65 A;  1FTO A;  4R9G A;  1PDA A;  1LFG A;  2UVI A;  4ND9 A;  1LFI A;  3A09 A;  2HEU A;  2D3I A;  2XXI A;  2VHA A;  2O51 A;  1UTH A;  4R75 A;  2VD2 A;  3HO7 A;  2Y7K A;  1VR5 A;  4NF6 A;  4U23 A;  3G3F A;  2IEE A;  4OES A;  2B3F A;  2OBG A;  1FQF A;  4DCY A;  1AL3 A;  4F39 A;  5I59 A;  2NOO A;  3U92 A;  2ZXT A;  3AXF A;  4FED A;  2ZNT A;  5AE4 A;  3QSL A;  3QUF A;  4IO4 A;  4N6P A;  1NL5 A;  3FGS A;  3MJN A;  3KN3 A;  1FQB A;  1JW5 A;  3OO9 A;  1M5E A;  1DTG A;  5DTB A;  2KLF A;  3N26 A;  4NED A;  4NF5 A;  4NMY A;  4RA1 A;  2FYI A;  2XXU A;  3PUZ E;  2V93 A;  1FCK A;  1SYH A;  2D21 A;  2F8D A;  2DWA A;  1ZJL A;  4KR5 A;  3OXN A;  3CR9 A;  1GGG A;  3PMW A;  4I62 A;  4NF4 B;  2YLN A;  2OJT A;  4LZ8 A;  2QS4 A;  4IO7 A;  4WXJ A;  2DWI A;  2FA7 A;  5CRY A;  4LP2 B;  1LLS A;  1M5F A;  4IY5 A;  4JBZ A;  4LAT A;  3CRB A;  3ZKL A;  4O3C A;  4MLQ A;  1D9Y A;  2O1M A;  3JZJ A;  2Y7P A;  4UAC A;  3CVG A;  3QUJ A;  3FD3 A;  3EHT A;  3PUV E;  4MF3 A;  3TFL A;  3Q26 A;  3DP6 A;  5FHO A;  4XKP A;  3MPK A;  4PFY A;  4Q30 B;  2P2A A;  2ZYM A;  1N0T A;  3K00 A;  3OO8 A;  3EHS A;  2AYS A;  3BFT A;  3K0V A;  1URS A;  1AOV A;  1JW4 A;  4QSD A;  4JWY A;  2ZYN A;  1A54 A;  3MAM A;  4OQO A;  2Z8E A;  2PT1 A;  3I3V A;  3V5A A;  4U4S A;  5I84 A;  1USY H;  3CG3 A;  2XX7 A;  4OFO A;  3PPO A;  2DWJ A;  3U1O A;  1SW2 A;  3K2D A;  1URG A;  3HST A;  1ZTY A;  1IXH A;  1Y4T A;  3R6U A;  3E13 X;  4EQB A;  1MY0 A;  4R6H A;  3E3K A;  3ILT B;  3TTR A;  2NXO A;  1IUD A;  4QFP A;  4QFL A;  1WDN A;  3RQT A;  4E0X A;  3FXU A;  3RPW A;  3G3J A;  1A55 A;  3G3H A;  4NTL A;  2DXY A;  1PC3 A;  2G93 A;  4ZZE A;  4KQP A;  3MZB A;  2OCU A;  3Q28 A;  4M4G A;  4U1O A;  4POX A;  4GD5 A;  4BDR A;  4WKM A;  1EZP A;  2F97 A;  3QIM A;  1R9Q A;  3PV0 E;  1UTH B;  3RLF E;  2RCA A;  2HCA A;  1SBP A;  5ELV A;  4ZEI A;  3D4G A;  1Y1M A;  4R74 A;  4FE8 A;  2D5W A;  1P1W A;  1P1O A;  3HN0 A;  5CMC A;  1LAF E;  2VP1 A;  2X26 A;  4KD5 A;  4C0R A;  3IOW A;  4Z7E A;  1B3F A;  2VGQ A;  4HCW A;  2E1S A;  1N7X A;  2DE2 A;  4AB6 A;  1SDX A;  2I4C A;  3G3G A;  4NF5 B;  2O7I A;  4EUO A;  1LCT A;  1JEU A;  1SD3 A;  1FTM A;  3Q25 A;  1D3K A;  2H25 A;  5JK4 A;  3OSR A;  2O6A A;  1XVY A;  1AH5 A;  4IO6 A;  1B2H A;  5J1D A;  4QSC A;  5DVJ A;  2H5Y A;  1TFA A;  3N6U A;  5F1Q A;  3GZG A;  3UN6 A;  1QKA A;  1Y1Z A;  1J1N A;  2XXH A;  2O68 A;  1MQI A;  3TCG A;  2DXR A;  4F2Q A;  2HFB A;  4HS7 A;  1EZO A;  2IA4 A;  1JQF A;  2F78 A;  2H98 A;  4YMA A;  3G7W A;  1Z7N E;  1TWY A;  3SEW A;  4I9D A;  1US5 A;  3K6W A;  2NWJ A;  2F6P A;  4OFJ A;  1SVX B;  4P11 A;  4OEN A;  4IGT A;  4EQ9 A;  2Y7R A;  3MBP A;  5FTH A;  3S9N C;  5FHM A;  4FEC A;  1OMP A;  1B46 A;  3RTF B;  2PVU A;  3H6U A;  4BDN A;  4OFL A;  5H8Q A;  3KBR A;  1L5T A;  1LAX A;  2DP8 A;  1JVX A;  4POW A;  1B6H A;  3JV9 A;  4OXV A;  4KYD A;  3T9V A;  1NKX A;  4DIG A;  2XD2 A;  3TZA A;  3H6W A;  3HCQ A;  4FIM A;  1MXY A;  1DPE A;  3V83 A;  3TTL A;  5AA2 D;  4YU0 A;  3FVN A;  4M1V A;  3EN3 A;  1FQC A;  2UVH A;  3SDF A;  1CB6 A;  1A8E A;  3GXA A;  3FV2 A;  4ZEB A;  2V3U A;  3FXR A;  4LQ5 A;  4OEV A;  5DT6 A;  3UA8 A;  3K1M A;  1T0K A;  3U93 A;  4JXI A;  3M3L A;  3CIJ A;  4C1U A;  1POY 1;  2GHA A;  1GTK A;  4O3B A;  5JEI A;  4G8N A;  4QFK A;  3FXQ A;  1Z7M E;  1XVX A;  3MWB A;  1NNT A;  1WVJ A;  4ELR A;  1BP5 A;  4DE8 A;  1OIB A;  2H99 A;  3VLW A;  2XXY A;  2F7A A;  3CSB A;  1M5B A;  2CZL A;  2QJE A;  1RYX A;  2QSX A;  3VDF A;  4MLV A;  3PPR A;  1RKM A;  3IX1 A;  1IZ1 A;  3K4U A;  1QUL A;  1XHY A;  3HHF A;  1B5I A;  1P1N A;  1SQY A;  4KHZ E;  4F1U A;  3ZKK A;  5BUU A;  1B4H A;  4U2R A;  3PUX E;  4G4P A;  3CSG A;  2M8C A;  3VE1 B;  2UYF A;  4PFW A;  3IJX B;  3O28 A;  1A8F A;  1WOD A;  5ITP A;  4G8M A;  5CMB A;  2ONS A;  5I57 B;  4X48 A;  4X1B A;  3VXB A;  3RTW B;  3K6U A;  1OVT A;  4OZ9 A;  3S2V A;  2NVU B;  3FJG A;  4YB6 A;  4ELQ A;  3L6H A;  1DSN A;  3MZ9 A;  2XXP A;  3A3C A;  2OK2 A;  3UK4 A;  5KZT A;  3HV1 A;  3LC8 A;  2V3Q A;  2QS1 A;  1NNP A;  1VE4 A;  2RC9 A;  1PBQ A;  4U22 A;  1A40 A;  1FW0 A;  4XIG Q;  3D4C A;  5I2K A;  2UYE A;  1MY3 A;  1B05 A;  1PEB A;  2PYY A;  2ALU A;  4KCD A;  3MP1 A;  1JVY A;  3MC2 A;  3G3K A;  4P0G A;  2Q2C A;  2F5X A;  3PPQ A;  4H8J A;  2XXV A;  2F7B A;  1ELJ A;  3CI8 A;  4RPO A;  2Y7I A;  3MVZ A;  4BDM A;  2E0S A;  1YCJ A;  2I3V A;  2Z8F A;  1A99 A;  1N3X A;  3S9E A;  3S9M C;  2Q2A A;  3E9X A;  4YIC A;  3OSQ A;  1H45 A;  4Q5T A;  4LZ5 A;  2OZZ A;  2G29 A;  1XS5 A;  4DZ1 A;  1MXU A;  3TOD A;  3PUY E;  1OLC A;  4N07 A;  5B7D A;  1P99 A;  3RUM A;  3M8U A;  3N94 A;  1HSL A;  3TMG A;  2X7Q A;  3T93 B;  4RY1 A;  4K3F A;  3B6T A;  4IGR A;  4GXA A;  3GBB A;  1EZ9 A;  1USY E;  2WKY A;  3MP8 A;  2QMX A;  3C34 A;  3IB2 A;  4FJP A;  4DXU A;  1B3E A;  1M5C A;  4PE5 B;  3UOR A;  4OER A;  1ZLQ A;  5I56 A;  2THI A;  3FJM A;  4LVQ A;  3KG2 A;  4I8C A;  5KDT A;  2CMO A;  3S4U A;  3L6G A;  3PPN A;  4F19 A;  3O6G A;  3O9P A;  2RCB A;  3RY3 A;  1DPP A;  2ABH A;  2I3W A;  4ZED A;  5H8N A;  1HSE A;  4TOZ A;  3THI A;  3MVX A;  3TYH A;  1SI1 A;  1ZMG A;  2UVJ A;  5H8H B;  4GQO A;  1NMU A;  4H6D A;  5TPA A;  1MXV A;  4XKN A;  3TDJ A;  1DTZ A;  1MDP 1;  1SYI A;  4ZDM A;  5I58 B;  1GV8 A;  1I6B A;  5JTY A;  4FEB A;  1QVS A;  5A5X A;  1XC1 A;  5KCJ A;  3RT8 A;  3PU5 A;  4R2B A;  1PB9 A;  1IXI A;  1H3D A;  3OEK A;  2R6G E;  4OEU A;  1FTJ A;  3R26 A;  3O6H A;  3U8Q A;  1KWH A;  1LAG E;  4QRZ A;  4ONY A;  4R73 A;  3GLB A;  1BLF A;  3Q27 A;  3K6X A;  4IB2 A;  4PFU A;  1MDQ A;  3RNN A;  2ESN A;  1LST A;  2DE3 A;  2HAV A;  5EHS A;  2F35 A;  4LA9 A;  1AIV A;  3TPA A;  3I5O A;  2DYX A;  2O7U A;  2RF1 A;  4NF6 B;  3TQW A;  1IXC A;  4KFQ A;  1Q1K A;  2FNC A;  4OHN A;  5I59 B;  2A5T A;  1MM7 A;  5I2K B;  2AL4 A;  3TCF A;  2DOJ A;  3O6I A;  5DVI A;  1B9J A;  4ESX A;  5ISU A;  1N7W A;  2YPN A;  1Y3P A;  3KZG A;  4KI0 E;  2QL3 A;  4YB7 A;  5EYF A;  5I2N A;  3ZS6 A;  2OWS A;  3IO6 A;  5AA2 A;  3A3U A;  3QXM A;  2R71 A;  1O63 A;  1QKB A;  2I58 A;  3E4R A;  3KFM A;  3EPE A;  3IOV A;  2F7C A;  5H8F A;  4KYS A;  1IXG A;  4HTG A;  1B1X A;  4DCX A;  4GL8 A;  3IR1 A;  2AL5 A;  1UTB A;  1B51 A;  1OQH A;  4OTE A;  2BJJ X;  3EF7 A;  1H76 A;  2XXX A;  4YMB A;  1B32 A;  3LSF B;  2H4I A;  4L17 A;  4Z0I A;  1B0L A;  5TP9 A;  1MXZ A;  2NUV A;  3WAE A;  3SEX A;  3OEL A;  5DVF A;  3H4Z A;  4MBP A;  2PBW A;  1UQW A;  5TU0 A;  3CFZ A;  5B70 A;  1Y3Q A;  4R9F A;  1B40 A;  1NH7 A;  3GBA A;  4PET A;  5I56 B;  5HPQ A;  3SEU A;  4GFR A;  3MQ9 A;  5KDT B;  2DVZ A;  3C36 A;  3O97 A;  1LBB A;  4QFN A;  4H8I A;  1LB8 A;  5AA1 A;  4GL0 A;  3VVF A;  3FV1 A;  4YKJ A;  1N76 A;  2GRV A;  3B6Q A;  4RYA A;  4F1Y A;  3FVG A;  3UGW A;  1FQA A;  4IO5 A;  3C9H A;  3KN8 A;  5K2X A;  3CG1 A;  3SEY A;  4U4X A;  3C31 A;  1D9V A;  1QUI A;  2XXR A;  3LR1 A;  4BDQ A;  4ZS9 A;  1S50 A;  4YKP A;  4X9T A;  3VV5 A;  4QHQ A;  2I6E A;  4ZE9 A;  3RN8 A;  1I6Q A;  3DP8 A;  4E0W A;  3QK6 A;  3VVE A;  1DOT A;  2ZNS A;  3KJT A;  3MPL A;  5CM6 A;  1N3W A;  2GH9 A;  3OO6 A;  3VXC A;  4F31 B;  4KPT A;  4TLL B;  1ANF A;  1B0H A;  4XXU A;  3T9X B;  3H06 B;  4GWO A;  5LOM A;  2W7Y A;  3FIR A;  5M2V A;  5AA3 A;  2XX9 A;  3BKI B;  2A5T B;  2GFE A;  4ZE8 A;  2DE4 A;  3BFU A;  4IO3 A;  2B3B A;  3IB1 A;  4EDP A;  4G8H A;  1UIU A;  4TLM B;  3SER A;  3O29 A;  5ICT A;  1EH3 A;  5HM4 B;  3DLN A;  2P1S A;  4DXC A;  4PQJ A;  3H7M A;  3W9W A;  3FVK A;  3PMX A;  2REG A;  3PPP A;  4I1D A;  3Q29 A;  4R72 A;  4OWD A;  1S9T A;  2H9B A;  4TQU Q;  1MQG A;  1B7H A;  3FVO A;  2Q8J A;  2Z8D A;  3KJ7 A;  3M3K A;  2ZNU A;  2A5S A;  1PB8 A;  4ZEF A;  1MY4 A;  3C35 A;  2LAO A;  1TT1 A;  1URD A;  3C4M A;  4G68 C;  3O66 A;  3SKP A;  5DEX A;  3EHU A;  4F2O A;  4LQ2 A;  4F29 A;  5CI5 A;  1Y4C A;  3TKD A;  4F3S A;  3C32 A;  4R6Y A;  5ITO A;  4X1D A;  1QW0 A;  1I69 A;  4G68 A;  4F3G A;  4Q8R A;  4OET A;  2RKM A;  3EQ1 A;  3PD8 A;  2XD3 A;  3TEP A;  5HBC A;  5TP9 B;  1IQ7 A;  3U72 A;  3KN7 A;  5AA4 A;  2XXT A;  3KGC A;  2I49 A;  3RGY A;  4THI A;  4QSE A;  3KEI A;  1MXW A;  1MS7 A;  4RXL A;  1QUJ A;  5L8D A;  2Y84 A;  4BDO A;  5L9M A;  4WEP A;  2DVC A;  1NFT A;  3VLU A;  2O84 X;  2Y7W A;  1MRP A;  4XTC Q;  1P1U A;  1I6A A;  1YPN A;  1OLA A;  1GVC A;  5H8Q B;  5EHM A;  3IAZ A;  2Q89 A;  1YTV A;  3TUS A;  1OQG A;  1B52 A;  1LBC A;  5FHN A;  2XXW A;  3O2A A;  4F3B A;  2I0B A;  2PX1 A;  3N5L A;  1BIY A;  3IOT A;  1Y3N A;  1ZU0 A;  3T96 B;  1VFD A;  2B65 A;  3MW0 A;  3BBR A;  4LZ7 A;  1QJM A;  4ESW A;  4KYE A;  5CBR A;  1TFD A;  4ISU A;  1POT A;  4F1V A;  4NWD A;  1LAH E;  2XX8 A;  3DM0 A;  4QF9 A;  3TTN A;  1B3L A;  4EF1 A;  1CE2 A;  4ELO A;  5L9S A;  1A7L A;  3H6V A;  3SES A;  3KOT A;  3UP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...