1JQFA

Human transferrin n-lobe mutant h249q
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSQTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand variation in the transferrin family: the crystal structure of the H249Q mutant of the human transferrin N-lobe as a model for iron binding in insect transferrins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords TRANSFERRIN
total genus 105
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2001-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1jqfA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1jqfA02
1POY1 4OEVA 4TLMB 1TWYA 1WVJA 1ANFA 2DE4A 2ESNA 3S9EA 3DP4A 3KJTA 3FZVA 1N3WA 4E0XA 3PUZE 1QUKA 3IB1A 3SERA 3IR1A 4ONYA 4P0GA 4QF9A 1M5BA 5DVIA 4NTLA 1OVBA 2FA7A 2Y7WA 3KSXA 3C31A 4Q0CA 1BKAA 2VHAA 1URDA 3A09A 3VVEA 1QW0A 1MDQA 2Q89A 1IXHA 1Y3QA 3C34A 3MZ1A 5H8NA 3UIFA 3FVOA 5HM4B 5I58A 1MM7A 1JEVA 1R1NA 3SDFA 4OESA 4JSDA 3WAEA 2PT2A 5ELVA 1D9VA 1R6ZA 3D4GA 3ZKKA 1PEBA 1B2HA 1HSEA 3H7MA 3T9HB 4Q30B 3N5LA 3DP6A 2O6AA 4OMBA 1FQBA 5BUUA 5CC2A 1B3EA 4P0IA 3O28A 2R71A 3DELB 1MH4A 4H1XA 4M4GA 4ELRA 1SW4A 2UXAA 4IO4A 1R9QA 4G4PA 1B3LA 2F7CA 2YJPA 5JTYA 3CR9A 3N94A 2OLBA 1QULA 4RPOA 1DOTA 4GLIA 5TP9A 3EHSA 3PUYE 4L17A 3TCGA 1KWHA 1JQFA 1MXVA 2QPQA 5M2VA 3T96B 1M5CA 1QKAA 1ELJA 3K1PA 2UVGA 3LC8A 4R6YA 1LAHE 1I6BA 3ZSFA 4F2OA 3GZGA 1DPPA 1SD3A 2XXVA 4GF8A 1I6QA 1MQGA 3SEWA 4JBZA 4RNSA 4PE5B 4ECFA 1XS5A 1P1QA 4QRZA 4XKQA 1QUJA 3A3CA 5H8FB 3VLUA 2DWAA 5DT6A 3VVFA 4BDQA 5AA2D 3C36A 3MC2A 4YKIA 4IO7A 5F1QA 3PGFA 3QYTA 2V84A 2XXHA 4R72A 2DP8A 2G93A 3MP6A 5K2YA 2HZKA 2Q2CA 3W15C 4AQ4A 2FYIA 1AIVA 1FTLA 3CSBA 3PUWE 3SEYA 1ZIUA 3O6HA 5L9OA 1MXWA 3IB0A 3GBBA 3Q27A 5FHOA 3RTFB 2GRVA 2O7UA 3Q29A 1DTZA 1N76A 1QUIA 4FE8A 4DLDA 3JZJA 4GRKA 4LZ7A 4ZEIA 3E9XA 2P1SA 3R6UA 1SI1A 5CI5A 2H9BA 1VFDA 3S9LC 4I8CA 2G29A 4KR5A 2PX1A 4XKRA 1MRPA 3SESA 4PFUA 1SQYA 1NNFA 3FD3A 2DE3A 4WKMA 3OO8A 1ZTYA 3HO7A 4GVOA 4OFOA 4THIA 5ISUA 2UVJA 1UTHB 1ZBMA 3FJ7A 3HHGA 2QMWA 3MAMA 4H0WA 4YICA 4BDLA 1PBPA 1US5A 2I0CA 1SW2A 2O69A 3I3VA 4F1YA 2RINA 4BLAA 4F29A 4RY1A 1BTJA 1XVYA 4AB5A 2Y7PA 3U94A 3PU5A 1FQAA 4NF5B 4NF8A 5AA4B 4DIGA 5AA3A 1FW0A 2XXTA 4AB6A 1NNKA 1P1OA 2NUVA 1LLSA 3OMBA 5EHSA 2HEUA 3IL1B 2ABHA 3H3GA 3IORA 3S9NC 1MPDA 3RNNA 1IXGA 4U22A 4Q8RA 2Z8FA 2P2AA 4F3GA 4KYEA 4H67A 1B7ZA 1Y4TA 4X9TA 5TU0A 4KI0E 3BFUA 3CRBA 4EF2A 1UIUA 3PPNA 4LP2B 4H5GA 4RXLA 5AA2A 3KBRA 4KCDA 5FHNA 5LOMA 4F3SA 1Y3PA 2XXWA 4GXAA 1O64A 1S9TA 4LA9A 4R9GA 1WDNA 1B32A 2QSXA 3R7XA 1URSA 1OLCA 3IOUA 1M5DA 3P7IA 4KFQA 4BDMA 2OZZA 1JVYA 3A3UA 3TCHA 1MPCA 2F8DA 3W9WA 4QFPA 1BLFA 1URGA 1J1NA 3OOAA 1D3KA 2I58A 2W7YA 3OELA 5EHMA 3VXCA 3PPOA 3RN8A 4O3BA 3BBRA 3OENA 3K4UA 1AL3A 2H25A 2QS1A 1IIWA 1A8EA 2RCAA 3KEIA 4R9FA 3TTRA 4X1DA 2ONSA 4DDDA 4R75A 3C4MA 3G3FA 4FIMA 1VE4A 3FASA 4MLVA 4EQ7A 1LBCA 3K01A 3EPEA 4H8IA 3MP8A 3MVYA 4GOTA 1MXZA 1IXIA 4Q5TA 2Q88A 1LFHA 3KG2A 4DZ1A 1OQHA 4IGRA 5DEXA 1HSLA 1D9YA 2NXOA 1N7WA 3IOVA 4GXSB 4YAHX 2O68A 3CG1A 1B0HA 4C0RA 1GGGA 2Z23A 1LCFA 3PPPA 4KCCA 4QSEA 3N6TA 1MPBA 4OFJA 4NWCA 1H43A 2DWJA 5H8FA 3FVKA 2GHAA 4ZE8A 1B1HA 4U2RA 2RC8A 5L9SA 2P0SA 3TQLA 4ZZAA 2I0BA 3FVGA 4OFLA 2V25A 4E0WA 4I1DA 1ATGA 3AXFA 3O6GA 4PP0A 4M1VA 2D21A 2F35A 3D4CA 4KQPA 1FTMA 1DPEA 5F7VA 3T9UA 3IJOB 2X7PA 4LZ5A 2D5WA 5H8HA 1FQEA 1D4NA 3FV2A 3LSXA 4HCYA 4YU0A 3KGCA 4FORA 5CMCA 1AMFA 3RGYA 3T9XB 1VR5A 1P1NA 2V93A 3PMVA 2R9JA 4OZ9A 2NOOA 2Q2AA 2AYSA 2F78A 4GD5A 5CBSA 3W9VA 4KPTA 3V5AA 2PT1A 4FJPA 4RYAA 1HSJA 4YMBA 5I57B 1OLAA 1MY4A 1JNFA 3MJNA 2HZLA 2IA4A 4BDOA 4OWDA 3VV5A 3H4ZA 1RKMA 3FXUA 2DYXA 2F34A 1POTA 1B6HA 4OETA 1B7UA 1MDP1 1Y20A 1N7XA 1B9JA 1USYE 4TQUQ 3RY3A 4PETA 3BFTA 1LB9A 3IJXB 5IKBA 2F97A 3ILTB 4HCWA 3MZBA 1PB7A 2RC9A 3H6TA 3OSQA 3FATA 1H45A 1RYOA 5KDTB 1Y3NA 4YKJA 1TXFA 5TPAB 1QKBA 2RC7A 1SYHA 4FAJA 3RT6B 2DWHA 3QUJA 4I62A 3TAJA 3UN6A 2GFEA 1QVSA 3N6UA 4EUOA 4N13A 4LUBA 5FHMA 1AH5A 2REGA 3HCQA 4O3CA 1MY2A 1NKXA 3U72A 4GQOA 5CBRA 4Z7EA 1XHYA 2VD2A 4H5FA 4N07A 1EZPA 1LGBC 1H3DA 1MXXA 1Y1ZA 2B3BA 2V3QA 2OBGA 2HCAA 2BJJX 4F18A 2ANJA 3H6VA 2F5XA 4OENA 2V3UA 1LAFE 4IO3A 2UVIA 4ELOA 5AE4A 5ICQA 1MY1A 5KZTA 3LSFB 3TQWA 1B4HA 1TFAA 2ZNUA 1SW5A 4LONB 3FUZA 4U4SA 5ITPA 1YTVA 1DMBA 1BP5A 3LUYA 3K6UA 2I49A 2UYEA 4R2BA 5DTBA 1SYIA 2Y7KA 1FQFA 3TEPA 3K2DA 4NF4B 2XHDA 1LBBA 4LQ2A 2AL5A 1IUDA 4KYDA 2QS3A 1Q35A 3O2AA 1H44A 4P11A 3FXQA 1B3FA 1N84A 1B58A 2V3TA 3IO6A 5HBCA 3USDA 1EZ9A 2O7IA 3Q28A 5TP9B 3RLFE 4MLQA 1B4ZA 1GTKA 3OO7A 4G77A 2H98A 3KOTA 2UYFA 3CG3A 3BKIB 2NVUB 3KJ7A 3G3GA 5HPQA 4JDFA 3HV1A 4YB6A 5JEIA 3VLWA 2I4CA 1BIYA 1PDAA 1UTBA 3EHTA 3PD8A 1B3HA 1P1WA 4ZEDA 3K1MA 4RJZA 3VXBA 3PMXA 4JWOA 3TFLA 4UA8A 3WAFA 2XX9A 3O29A 2QS4A 2REJA 3VFJA 1IITA 2VD3A 1JETA 3DP8A 3O97A 4KHZE 1N04A 3V89B 2ZYKA 4F3BA 1I69A 3PUXE 4U1ZA 4YB5A 2Y7RA 3TUSA 1NH7A 1H76A 3GLBA 1EZOA 4YKKA 1B3GA 5KCJA 1MH3A 1DSNA 2XXPA 1FTJA 4QFOA 1YCJA 2F36A 3ONMA 4EXKA 4IY6A 4K3FA 2WKYA 3U93A 2PBWA 3QUFA 4OQOA 1GV8A 2E1SA 3MP1A 3PPQA 4F19A 2H4IA 4G8MA 2O1LA 3OO6A 4IO5A 4NEDA 5I59A 1US4A 4GL8A 3T93B 4F31B 4ZECA 1A7LA 1EH3A 1MS7A 1LFGA 2ZMBA 3MBPA 4OTEA 1S50A 2OK2A 3LSLA 2QMXA 3FV1A 2DS9A 3K02A 5DVFA 3TYHA 4NF5A 1PC3A 3GBAA 5AA1A 2H99A 3UP9A 3UA8A 3VVDA 4DXBA 5FTIA 5H8HB 4U23A 4X48A 1SW1A 4ZEBA 4NF6B 4F1VA 4R74A 1SDXA 3OD7A 4LATA 4POXA 4U21A 4ESXA 3TTLA 4PFYA 3S4UA 5I2NA 4HS7A 4BDRA 3K6VA 3TCFA 4H6DA 3G3HA 4OVJA 3MZ9A 1TFDA 1B05A 2F7BA 4QFLA 5I56B 4RK9A 4F22A 1PB8A 3L6HA 3CFXA 1OIBA 3Q25A 4N6PA 3B7DA 4NWDA 4POWA 5BWJA 1M5EA 1SBPA 3RPWA 2XXIA 2KLFA 3M3KA 3H03A 2O51A 3O9PA 5CMBA 1B5IA 2ZNTA 3G3JA 4NF8B 5AA4A 1ZJLA 1MQIA 2XD2A 3GXAA 5H8QB 1YAEA 2Q9TA 3FVNA 3B6TA 3FXRA 1OVTA 3I5OA 4PQJA 4F39A 3MQ9A 5I2KA 3M3FA 1B52A 5K2XA 1FCKA 3MUQA 1JW4A 1MXUA 4H65A 3G3IA 4U4XA 4ISUA 3UK4A 1YPNA 2PYYA 3OEMA 4QFKA 2ONRA 4WEDA 1Y4CA 4XKNA 4I9DA 1XVXA 4YKPA 3UGWA 4GWOA 4TLLB 3M8UA 1LCTA 1LAGE 4LVQA 4O3AA 3RUMA 3THIA 3MPLA 2DSFA 3EHUA 2GH9A 2QRYA 2HAUA 1CE2A 4JB7A 4OEUA 3RQTA 3TPAA 1Y9UA 3B6WA 5I56A 3UORA 3C9HA 3T66A 5I2NB 1FTOA 2AL4A 1L5TA 3RT8A 3KSJA 3FJGA 3JYRA 3TTKA 3G3KA 3K6WA 3I6VA 4XTCQ 4ELQA 4ZEFA 2F7AA 3EN3A 1UTHA 5CMMA 4F2QA 3IK6B 4BDNA 5H8QA 5JK4A 3IX1A 3KZGA 5DVJA 2XXUA 3TTNA 4H8JA 4R6HA 3U8QA 2R6GE 1M5FA 4GFRA 3TZAA 2A5SA 3ODBA 2A5TA 1Y1MA 2VGQA 3C35A 1ZKBA 3PV0E 4G8HA 1MXYA 1QJMA 2OCUA 2XD3A 1P99A 3IB2A 3K0VA 2DVCA 3O66A 3E3KA 3QAXA 4G8NA 4IY5A 4LQ5A 4EF1A 1B51A 3L6GA 3SEVA 3ECRA 2XXQA 2A5TB 3FGSA 4LZ8A 4QSDA 4ND9A 4QSCA 3SETA 4R73A 1SVXB 2RF1A 3KN8A 3TTMA 4EQ9A 3C32A 3IAZA 1WODA 3CIJA 3KN7A 4EQBA 5I59B 1P1UA 2QS2A 3IO4A 4WXJA 1TT1A 5CMKA 1Z7NE 4GIZA 4KYSA 3OXNA 3CFZA 3HHFA 5I58B 5A5XB 2H5YA 3QSLA 1CB6A 2HAVA 1EU8A 2UVHA 3VDFA 1ZU0A 2OJTA 3MVWA 3PUVE 5IAIA 1NH8A 1JW5A 1N0TA 2Y7IA 4WEPA 2Z8EA 1OQGA 5I84A 1LSTA 3SEUA 1IZ1A 1PB9A 4MF3A 3K6XA 1LAXA 2F6GA 3SEXA 2OWTA 5EYFA 1I6AA 2LAOA 3PMWA 4PFWA 1II5A 3KOSA 3Q26A 2ZNSA 3OO9A 2HXWA 1ZMGA 2ZYOA 4ZZEA 2XXRA 1O7TA 3CI8A 4QHQA 3MWBA 3DLNA 3TDJA 4OYVA 4RPNA 3CVGA 2Y84A 2PVUA 3IOWA 4EDPA 4C1TA 3H06B 3DM0A 5J1DA 4JXIA 3MW0A 4OXVA 3RTWB 3TELA 5I57A 2DQVA 2VP1A 1JVXA 4DCXA 4FATA 3ILUB 4YMAA 4OERA 4OHNA 5H8NB 3K1NA 2E0SA 1FTKA 1PBQA 3N26A 5L8DA 1NFTA 3T9VA 1VFEA 5I2KB 2OWSA 2THIA 1GVCA 1SI0A 1O63A 5ITOA 4XXUA 4MFIA 2VOZA 2Q8JA 3TMGA 4GL0A 1XOCA 4FEBA 3SKPA 2FNCA 4DXCA 4JWYA 2GHBA 3K00A 3PPRA 2YPNA 1GR2A 4NF6A 4YB7A 1UIVA 3MVZA 4F1UA 3QXMA 4X1BA 3VE1B 5H8SA 2I4BA 3TODA 2X26A 3MPKA 3FIRA 4FEDA 5FTHA 3LBSA 4ESWA 1MY0A 3T22A 2IEEA 5CRYA 1MQJA 1MY3A 4DXUA 4R6KA 3ZKLA 3O6IA 3LSWA 1A54A 4JSOA 1RYXA 1B1XA 5JTYB 1FQCA 1T0KA 1NNPA 4IB2A 2YLNA 5L9MA 2QL3A 3V8XB 4DCYA 4F3PA 1NL5A 1R9LA 1A55A 2X7QA 3HN0A 1XT8A 2DXRA 2HFBA 3G7WA 5DEXB 3B6QA 1B5HA 4G68C 2HQ0A 2O84X 3KN3A 1UQWA 4QFNA 3C33A 1MQHA 4UACA 4EXLA 2I3WA 4FECA 3M3LA 2F6PA 2XX7A 3FJMA 3CFLA 3IOTA 4RK2A 3U92A 4C1UA 2CMOA 4G2ZA 1ZLQA 4HTGA 5DYHA 4ZE9A 2RCBA 1NMUA 3V83A 1FQDA 4NE4A 1IEJA 3PD9A 4JWXA 2I48A 5ICTA 1VSOA 3TKDA 3U1OA 2O1MA 1LB8A 1MQDA 1S7YA 1B7HA 1F9BA 2DWIA 2I6EA 5A5XA 2ZYNA 4MH5A 5TPAA 4IO2A 5KCJB 3EQ1A 1OMPA 4HW8A 3QK6A 1B0LA 3LR1A 3ZS6A 1AOVA 4KD5A 2CZLA 3OEKA 5CM6A 2M8CA 2RKMA 3E4RA 5B7DA 3HSTA 2ZXTA 1A99A 4NMYA 3E13X 2QJEA 4TOZA 2XXXA 4U1OA 4XKPA 4ZS9A 3S9MC 1A40A 3F11A 5AA2B 1B46A 4IO6A 2I3VA 3EF7A 2Z22A 2DOJA 5B70A 3HPIA 4NF4A 1B40A 1LFIA 2DXYA 2DVZA 3H6WA 4XIGQ 3R26A 1XC1A 1JW1A 3H6UA 3JV9A 2D3IA 1A8FA 1DTGA 1USYH 3KFMA 1IQ7A 2AIXA 1MM6A 2B3FA 1JEUA 3CSGA 4G68B 2DE2A 3OSRA 4IGTA 3QIMA 3VLVA 2NWJA 4ELPA 3S2VA 2ONKE 4ZEKA 4DE8A 2XXYA 2B65A 1IXCA 2Z8DA 4PFTA 4Z0IA 5KDTA 1Z7ME 4ZDMA 4G68A 2ALUA 1UTBB 2ZYMA 1N3XA 4RA1A 4YZZA 2XX8A 1MG1A 1NNTA 1Q1KA 4MBPA 4R2FA 1B5JA 2PMSA 3MVXA
chains in the Genus database with same CATH superfamily
1FBGA 1POY1 1EYIA 4OEVA 4TLMB 1WVJA 3HFUA 3B50A 5DVIA 4QXDA 2FA7A 1QW0A 1BK4A 4MEVA 1JEVA 1RDZA 1R6ZA 3D4GA 1K9ZA 4MCOA 2Q74A 4Q30B 4MJOA 4P0IA 3DELB 4H1XA 1LEVA 3EHSA 3PUYE 1KWHA 1MXVA 4PDDA 5M2VA 4MNIA 3T96B 1ELJA 4R6YA 4GF8A 3SEWA 2Y5LA 4XKQA 1QUJA 3VLUA 3VVFA 3C36A 3MC2A 2OWZA 4IO7A 5IZZA 2XXHA 2FYIA 5L9OA 3GBBA 3Q29A 1N76A 3JZJA 4ZEIA 4LZ7A 3FXBA 1SI1A 2H9BA 1VFDA 1MRPA 3FD3A 4OA4A 3OO8A 4OFOA 4BDLA 5ET5A 4BLAA 1BTJA 3PU5A 1AWBA 1FQAA 5LDZA 4DIGA 1NNKA 3H3GA 3S9NC 3RNNA 5EQ8A 4Q8RA 2Z8FA 2P2AA 3IFAA 4X9TA 4KI0E 4GBWA 4KCDA 4F3SA 1Y3PA 1S9TA 1WDNA 3R7XA 1OLCA 1FRPA 3A29A 5A5LA 4QFPA 2W7YA 3BBRA 1A8EA 2RCAA 3G3FA 4FIMA 1VE4A 3FASA 1LBCA 3K01A 4H8IA 4GOTA 1IXIA 4DZ1A 4IGRA 1D9YA 2NXOA 1N7WA 2XWVA 1FJ9A 1GGGA 4KCCA 4OFJA 2DWJA 2GHAA 4ZE8A 5L9SA 2QVVA 2V25A 1ATGA 2ZZWA 4M1VA 4KQPA 3T9UA 5H8HA 3FV2A 3LSXA 4HCYA 4YU0A 5CMCA 2R9JA 1NV5A 2R8TA 3H4ZA 4HXVA 1POTA 1USYE 4PETA 3IJXB 1NV2A 5ET6A 4YKJA 4PF8A 2DWHA 3TAJA 4EUOA 5FHMA 1AH5A 1MY2A 1FPIA 1XHYA 1NUXA 1Y1ZA 2V3QA 5IGAA 2F5XA 4ELOA 1LAFE 4IO3A 3B8BA 4OVQA 3TQWA 1B4HA 1DMBA 1BP5A 3K6UA 2UYEA 5DTBA 1IUDA 4N91A 4P11A 1H44A 4PDHA 1VDWA 1EZ9A 2H98A 2UYFA 2FIXA 5JEIA 1NV7A 3EHTA 1FBHA 4NF0A 4UA8A 2XX9A 3O29A 2REJA 3VFJA 2VD3A 1JETA 3ISPA 4PGPA 3O97A 2OX3A 2ZYKA 3PUXE 2FIEA 4YB5A 2Y7RA 1XI6A 4YKKA 1B3GA 2XXPA 1FTJA 4QFOA 2PBWA 3QUFA 1GV8A 4F19A 4NEDA 1MS7A 4ELRA 3TYHA 3UP9A 2H99A 5FTIA 4NF6B 2QFLA 2WYPA 4R74A 4LATA 4QFLA 4RK9A 4F22A 1PB8A 4POWA 5BWJA 3B7DA 2XXIA 3GXAA 4GX6A 2Q9TA 3FVNA 1JW4A 2Y5KA 2PYYA 4QFKA 4WEDA 1Y4CA 1XVXA 1LCTA 3THIA 2DSFA 3EHUA 3C9HA 4GWWA 2AL4A 5JK4A 3KZGA 2QVRA 5DVJA 2R6GE 3TZAA 3ODBA 2VGQA 1ZKBA 1MXYA 2OCUA 3TQLA 1P99A 4IY5A 1B51A 1FBDA 3SEVA 3ECRA 4LZ8A 4R73A 4EQ9A 3TTMA 3C32A 4EQBA 5CMKA 1Z7NE 3OXNA 1LBZA 2H5YA 1EU8A 3VDFA 2OJTA 3PUVE 1NH8A 4WEPA 2Z8EA 3SEUA 4MF3A 4XF5A 3SEXA 4O94A 4PFWA 3Q26A 1ZMGA 2XXRA 4QHQA 3DLNA 3TDJA 2Y84A 1FBEA 4EDPA 4C1TA 4N6DA 4O7MA 4OVRA 3ILUB 5H8NB 1FTKA 4DI3D 3T9VA 1VFEA 2THIA 3K00A 3MVZA 4HE1A 3TODA 4FEDA 3FIRA 3T22A 2IEEA 4H46A 4R6KA 3LSWA 1NI9A 4JSOA 4AS5A 5JTYB 2QL3A 1R9LA 5F7VA 2DXRA 3B6QA 4QFNA 3IFCA 3C33A 1MQHA 2F6PA 4HE2A 3CFLA 3IOTA 3V83A 2I48A 5LTCA 1B7HA 4MNCA 1LBXA 3LR1A 4PAIA 5EYHA 2M8CA 4PBHA 4NMYA 2QJEA 2XXXA 4XKPA 1A40A 5AA2B 3RPLB 3HPIA 2WBDA 3KFMA 1USYH 3CSGA 2DE2A 4IGTA 2NWJA 4NX1A 3S2VA 2XXYA 4G68A 2ZZVA 2ZYMA 4YZZA 1MG1A 1Q1KA 4MBPA 4P8BA 1TWYA 2DE4A 2ESNA 3DP4A 1QUKA 4QF9A 2Y7WA 3C31A 3VVEA 4FAJA 3A09A 4NAPA 3C34A 5H8NA 5EQAA 3FVOA 5HM4B 1MM7A 1YXIA 4JSDA 1B2HA 3T9HB 1FQBA 1B3EA 2R71A 2UXAA 4G4PA 2F7CA 2YJPA 5JTYA 1QULA 4RPOA 1M5CA 3K1PA 2UVGA 4PFIA 5EYGA 1MQGA 1XS5A 3A3CA 5DT6A 4BDQA 5AA2D 4YKIA 4NGUA 2V84A 2DP8A 2G93A 2HZKA 3SEYA 3IB0A 5FHOA 3RTFB 2GRVA 2O7UA 4DLDA 4GRKA 4N8YA 3E9XA 2P1SA 3R6UA 2G29A 2PX1A 3SESA 2DE3A 1ZTYA 4THIA 4GWYA 3HHGA 1PBPA 2O69A 1SW2A 2RINA 4F29A 2VT5A 4AB5A 2Y7PA 4NF8A 5AA4B 1FW0A 1P1OA 1LLSA 5ET7A 1MPDA 1IXGA 4U22A 1EYKA 4KYEA 4H67A 1Y4TA 3BFUA 4EF2A 4RXLA 4H5GA 5AA2A 5FHNA 2WX9A 5LOMA 1O64A 4R9GA 3P7IA 3A3UA 3TCHA 1MPCA 1BLFA 1URGA 1RDXA 4GWUA 1INPA 2I58A 4O3BA 2H25A 2ONSA 3C4MA 4EQ7A 3MP8A 1LFHA 2Q88A 4GXSB 3CG1A 2Z23A 3PPPA 4QSEA 1MPBA 3FVKA 2RC8A 2P0SA 3FVGA 2PFYA 4I1DA 4PAKA 2D21A 1FTMA 4LZ5A 2D5WA 1FQEA 4N15A 5I56B 3KGCA 2NOOA 2Q2AA 4GD5A 2F78A 5CBSA 3W9VA 4KPTA 3V5AA 4FJPA 4RYAA 1OLAA 1MY4A 1JNFA 4BDOA 4OWDA 3VV5A 1RKMA 4GX4A 1B6HA 4OETA 1RDYA 3BFTA 1LB9A 2F97A 1H45A 2VPOA 5KDTB 1Y3NA 2RC7A 3RT6B 3QUJA 2GFEA 1QVSA 2REGA 3HCQA 2VPNA 4Z7EA 4N07A 1H3DA 2B3BA 3H6VA 3LSFB 5ESYA 4U4SA 3LUYA 4R2BA 2XHDA 2QS3A 3O2AA 2V3TA 3IO6A 2O7IA 5TP9B 1B4ZA 3BKIB 3G3GA 1BIYA 1UTBA 3PD8A 4ZEDA 3K1MA 2KR0A 4RJZA 3LUZA 4MMPA 1DBZA 1IITA 1EYJA 4KHZE 1H76A 3GLBA 1EZOA 1MH3A 1YCJA 3ONMA 2Q8MA 2H4IA 4OVSA 4GL8A 4F31B 1EH3A 4OTEA 2ZMBA 5A5XA 1S50A 2QMXA 3K02A 4N6KA 3GBAA 5AA1A 4F1VA 1SW1A 4U21A 4PFYA 3S4UA 3CFXA 1OIBA 3Q25A 3KC0A 3H03A 3G3JA 4NF8B 5AA4A 4OANA 1ZJLA 5H8QB 1NUYA 4F39A 1B52A 5K2XA 1FCKA 1FBPA 3UK4A 3OEMA 4YKPA 3UGWA 4GWOA 3M8UA 4JVDA 4LVQA 3RQTA 4OEUA 2HAUA 4JVIA 5I56A 3B6WA 4MX6A 3KSJA 3TTKA 5AE4A 3EN3A 3IK6B 3TTNA 4R6HA 1M5FA 2XD3A 1QJMA 3IB2A 3QAXA 4G8NA 4EF1A 3W15C 2XXQA 4QSCA 3FGSA 4GX3A 3KN8A 1P1UA 4KYSA 5I58B 3HHFA 3QSLA 1CB6A 5IAIA 1JW5A 1N0TA 2Y7IA 1LBVA 3BIGA 3K6XA 1KZ8A 2F6GA 3PMWA 2HXWA 4ZZEA 1IMEA 3MWBA 5IZ3B 5J1DA 3IOWA 1FTAA 4JXIA 3MW0A 3TELA 1JVXA 1PBQA 2HHMA 5ITOA 4MFIA 2VOZA 2Q8JA 3TMGA 1XOCA 4FEBA 3SKPA 4JWYA 3PPRA 4F1UA 2YPNA 1UIVA 3QXMA 5H8SA 5FTHA 4ESWA 5FBPA 1MY3A 1RYXA 5EQ9A 1B1XA 1NV4A 4IB2A 3V8XB 1NL5A 3HN0A 2HFBA 3VLWA 4FECA 2XX7A 3FJMA 4RK2A 4C1UA 3PTYA 4G2ZA 1ZLQA 4HTGA 4XFEA 1FQDA 5ICTA 1LB8A 1MQDA 2I6EA 4MH5A 4PAFA 5TPAA 4IO2A 4KXPA 3QK6A 1B0LA 3ZS6A 5CM6A 4N17A 4U1OA 4QBAA 4ZS9A 3E13X 3EF7A 2Z22A 1LFIA 2CEXA 1XC1A 3JV9A 2L5VA 1MM6A 3QIMA 4ELPA 2Z8DA 1IXCA 1Z7ME 4G61A 4RA1A 4PC9A 3PPOA 1NNTA 4R2FA 3OO9A 2PMSA 3MVXA 4X8RA 3KJTA 1N3WA 4E0XA 3IB1A 3SERA 3IR1A 4ONYA 4P0GA 4NTLA 1OVBA 4Q0CA 4DI4B 2VHAA 1URDA 2Q89A 1MDQA 3MZ1A 1IXHA 2PFZA 5I58A 1NV6A 1R1NA 3SDFA 3WAEA 5ELVA 1D9VA 3ZKKA 3H7MA 4N8GA 3DP6A 5ET8A 2O6AA 4OMBA 5BUUA 2XWKA 3O28A 4M4GA 4IO4A 1NV3A 1B3LA 3N94A 2OLBA 1DOTA 4GLIA 4P56A 4L17A 3TCGA 1JQFA 4MAGA 1QKAA 2WYKA 1I6BA 3GZGA 2XXVA 1I6QA 4RNSA 4PE5B 2DWAA 5IM2A 5F1QA 1FPDA 3RPLA 4AQ4A 3CSBA 1ZIUA 1MXWA 1DTZA 1QUIA 4FE8A 3T1BA 4PGNA 2P3NA 4I8CA 4KR5A 1SQYA 1NNFA 3BIHA 3HO7A 4GVOA 5IZ3A 5ISUA 1UTHB 1ZBMA 2I0CA 4F1YA 3I3VA 3U94A 3MSTA 4AB6A 2NUVA 5EHSA 3IL1B 4F3GA 2QVUA 1B7ZA 5TU0A 3CRBA 1UIUA 3PPNA 3KBRA 4GXAA 2QSXA 1M5DA 4BDMA 2F8DA 3W9WA 1J1NA 1D3KA 3OELA 3VXCA 3OENA 1AL3A 1IIWA 3QMFA 4DDDA 4R75A 4MLVA 3EPEA 4N4UA 3MVYA 4Q5TA 1DCUA 3IOVA 3EKIA 1B0HA 4C0RA 1D9QA 4FBPA 4P1LA 2MKZA 1B1HA 2WBBA 4U2RA 4OFLA 3AXFA 3D4CA 4O8MA 3IJOB 2X7PA 3RGYA 1VR5A 1P1NA 2V93A 2AYSA 1QGXA 2PT1A 1HSJA 4YMBA 5I57B 3MJNA 1IMAA 1Y20A 1N7XA 1B9JA 3RY3A 4P9KA 5IKBA 4HCWA 3MZBA 3H6TA 1TXFA 5TPAB 1QKBA 1SYHA 4I62A 3UN6A 3N6UA 5T3JA 4N13A 4LUBA 1K9YA 4O3CA 3U72A 1NKXA 1NV0A 5CBRA 2VD2A 1EZPA 1LGBC 4F18A 1FPKA 2BJJX 4OENA 2V3UA 5KZTA 1MY1A 4GBVA 1TFAA 2ZNUA 1SW5A 4NN3A 3FUZA 1SYIA 1FQFA 1G0IA 3TEPA 3K2DA 1FPJA 4LQ2A 4PFRA 4KYDA 3KC1A 3FXQA 1B3FA 1N84A 5HBCA 3USDA 3S9LC 3Q28A 4MLQA 5I7IA 1GTKA 4G77A 1FJ6A 2KQZA 2NVUB 3CG3A 3KJ7A 3HV1A 2I4CA 1P1WA 4N81A 3VXBA 3WAFA 3TFLA 1KA0A 1N04A 4F3BA 4PFBA 3ROJA 1DSNA 2WKYA 1FPBA 2E1SA 3PPQA 2O1LA 2HPGA 3OO6A 5I59A 1US4A 2XWOA 3T93B 1A7LA 3MBPA 4YAHX 1LFGA 3LSLA 2OK2A 4P3LA 5DVFA 3FV1A 2DS9A 1FSAA 4DXBA 3UA8A 4ZEBA 4ESXA 3TTLA 5I2NA 4HS7A 4BDRA 3K6VA 4GWXA 3TCFA 4H6DA 4OVJA 3MZ9A 1TFDA 1B05A 2F7BA 1IMDA 3L6HA 1M5EA 1SBPA 2KLFA 3M3KA 3O9PA 2O51A 2XD2A 1MQIA 5F24A 1YAEA 2BJIA 3B6TA 5I2KA 3M3FA 1FPLA 4H65A 3G3IA 1NV1A 1YPNA 4XKNA 2ONRA 4I9DA 4TLLB 4O3AA 1LAGE 3RUMA 2QRYA 1CE2A 1Y9UA 3UORA 3T66A 5I2NB 1FTOA 1L5TA 3RT8A 3JYRA 3U65A 3K6WA 3I6VA 4ELQA 4F2QA 2F7AA 5CMMA 1UTHA 5H8QA 3IX1A 2XXUA 3U8QA 4GFRA 1Y1MA 5I3SA 3C35A 4G8HA 3K0VA 3E3KA 4LQ5A 2A5TB 3SETA 4ND9A 1SVXB 3E78A 1WODA 3CIJA 5I59B 1TT1A 5A5XB 2UVHA 1ZU0A 1OQGA 1IZ1A 1PB9A 1LAXA 5EYFA 2LAOA 2ZNSA 5I5PA 3CI8A 1KA1A 4OYVA 3CVGA 3H06B 3DM0A 3RTWB 2DQVA 4YMAA 4OERA 3N26A 1NFTA 1GVCA 2OWSA 1SI0A 1JP4A 1O63A 2FNCA 4DXCA 4MIJA 4NF6A 2XA5A 4X1BA 3VE1B 2X26A 3MPKA 3LBSA 1MY0A 2CZKA 5CRYA 4DXUA 3O6IA 1A54A 1FQCA 1T0KA 5L9MA 5EQ7A 4F3PA 2X7QA 1IMCA 1A55A 4I3EA 5DEXB 2B4MA 3G7WA 1B5HA 4G68C 2HQ0A 2O84X 3KN3A 2I3WA 3U92A 2CMOA 3CHGA 4ZE9A 5DYHA 2RCBA 1NMUA 4NE4A 3TKDA 3U1OA 1F9BA 2ZYNA 4I40A 5KCJB 1OMPA 4HW8A 3OEKA 5B7DA 2RKMA 3E4RA 3HSTA 1A99A 4TOZA 4IO6A 2DOJA 2DXYA 2DVZA 4XIGQ 3R26A 2D3IA 1A8FA 1DTGA 2B3FA 3VLVA 1JEUA 2ONKE 1Q9DA 4ZEKA 4PFTA 5KDTA 4ZDMA 2XX8A 4DCXA 3GYYA 1B5JA 4OVPA 5J16A 1ANFA 3D1RA 3S9EA 3FZVA 2CEYA 3PUZE 1M5BA 3RYDA 3KSXA 1BKAA 1Y3QA 3UIFA 2XWIA 4OESA 2PT2A 1PEBA 1HSEA 3N5LA 5CC2A 4LN5A 1MH4A 1SW4A 1R9QA 4NG7A 3CR9A 5TP9A 2QPQA 3LC8A 1NUZA 1LAHE 3ZSFA 4F2OA 1DPPA 1SD3A 4JBZA 1DK4A 4ECFA 1P1QA 4QRZA 3KBZA 5H8FB 1YYZA 3PGFA 3QYTA 4R72A 3MP6A 5K2YA 2Q2CA 1AIVA 1FTLA 3PUWE 3O6HA 3Q27A 3FBPA 4X04A 5CI5A 4XKRA 4PFUA 4WKMA 2HXRA 2UVJA 3FJ7A 2QMWA 3MAMA 4H0WA 4YICA 1US5A 4RY1A 1XVYA 4NF5B 5AA3A 2XXTA 4P1EA 3OMBA 2HEUA 2ABHA 3IORA 4LP2B 2B4LA 2XXWA 4LA9A 5IZ1A 1B32A 1URSA 3IOUA 3LV0A 4KFQA 2OZZA 1JVYA 4NHBA 3OOAA 5EHMA 3RN8A 4GWSA 3K4UA 3KEIA 2QS1A 4R9FA 3TTRA 2V4CA 4X1DA 4PBQA 1MXZA 3KG2A 1OQHA 5DEXA 1HSLA 2XXKA 4PF6A 2O68A 4AS4A 1LCFA 3N6TA 4OVTA 4NWCA 1H43A 5H8FA 4ZZAA 2I0BA 4E0WA 3O6GA 4PP0A 2F35A 1DPEA 1D4NA 3T9XB 4FORA 1AMFA 3PMVA 4OZ9A 1LBYA 1SPIA 1IMBA 2HZLA 2IA4A 3FXUA 2DYXA 2F34A 1B7UA 1MDP1 4TQUQ 3ILTB 1PB7A 2RC9A 3OSQA 3FATA 3SZPA 1RYOA 2ZZXA 2PCRA 4H45A 2WEFA 4GQOA 4H5FA 1FPEA 4MNPA 1MXXA 1YZ0A 2HCAA 2OBGA 2ANJA 2UVIA 2FVZA 4LONB 5ITPA 1YTVA 4NQ8A 2I49A 2Y7KA 4NF4B 1LBBA 2AL5A 1Q35A 2F3BA 5DW8A 1B58A 3RLFE 3OO7A 3KOTA 5HPQA 4JDFA 4YB6A 1PDAA 1B3HA 2GQ1A 3PMXA 4JWOA 4PCDA 2QS4A 3DP8A 3V89B 1I69A 4U1ZA 3TUSA 4GWZA 1NH7A 4I3YA 5KCJA 2F36A 4EXKA 4IY6A 4K3FA 4OQOA 3MP1A 4G8MA 4IO5A 4ZECA 3VVDA 4NF5A 1PC3A 5H8HB 4U23A 4X48A 1SDXA 3OD7A 4POXA 3G3HA 4NWDA 4N6PA 5CMBA 1B5IA 2ZNTA 4PE3A 2F3DA 3I5OA 3FXRA 1OVTA 4PQJA 3MQ9A 3MUQA 1MXUA 4U4XA 4ISUA 2CZIA 3MPLA 4JB7A 2GH9A 3TPAA 1CNQA 3MYUA 3FJGA 3G3KA 4XTCQ 3E79A 4ZEFA 4BDNA 4H8JA 2A5SA 2A5TA 3PV0E 1NUWA 3O66A 2DVCA 3L6GA 2P3VA 4QSDA 5ICQA 2JJKA 2RF1A 3IAZA 4PTKA 3KN7A 2QS2A 3IO4A 4WXJA 4GIZA 3CFZA 2HAVA 3MVWA 4O7IA 4JVCA 1LSTA 5I84A 4HE0A 2OWTA 1I6AA 2DDKA 3RPWA 1II5A 3KOSA 3T0JA 2ZYOA 3NOHA 1O7TA 4MHFA 4RPNA 1FPGA 2PVUA 4OXVA 5I57A 4P47A 1FPFA 2VP1A 2FHYA 4FATA 4OHNA 3K1NA 2E0SA 5L8DA 5I2KB 4XXUA 2FBPA 4GL0A 2GHBA 4YB7A 1GR2A 1G0HA 2I4BA 1MQJA 1IMFA 3ZKLA 1NNPA 4DCYA 2YLNA 3U93A 1XT8A 4EXLA 1UQWA 4UACA 1FBFA 3M3LA 4XEQA 1FBCA 1IEJA 3PD9A 4UABA 4JWXA 1VSOA 2O1MA 1S7YA 2DWIA 3EQ1A 1AOVA 4KD5A 2CZLA 4IR8A 1LBWA 2ZXTA 3S9MC 3F11A 5B70A 1B46A 2CZHA 2I3VA 4NF4A 1B40A 3H6WA 3H6UA 1JW1A 1IQ7A 2AIXA 4G68B 3OSRA 4DE8A 2B65A 4Z0IA 2ALUA 1UTBB 1N3XA
chains in the Genus database with same CATH topology
1POY1 4OEVA 4TLMB 1TWYA 1WVJA 1ANFA 2DE4A 2ESNA 3S9EA 3DP4A 3KJTA 3FZVA 1N3WA 4E0XA 3PUZE 1QUKA 3IB1A 3SERA 3IR1A 4ONYA 4P0GA 4QF9A 1M5BA 5DVIA 4NTLA 1OVBA 2FA7A 2Y7WA 3KSXA 3C31A 4Q0CA 1BKAA 2VHAA 1URDA 3A09A 3VVEA 1QW0A 1MDQA 2Q89A 1IXHA 1Y3QA 3C34A 3MZ1A 5H8NA 3UIFA 3FVOA 5HM4B 5I58A 1MM7A 1JEVA 1R1NA 3SDFA 4OESA 4JSDA 3WAEA 2PT2A 5ELVA 1D9VA 1R6ZA 3D4GA 3ZKKA 1PEBA 1B2HA 1HSEA 3H7MA 3T9HB 4Q30B 3N5LA 3DP6A 2O6AA 4OMBA 1FQBA 5BUUA 5CC2A 1B3EA 4P0IA 3O28A 2R71A 3DELB 1MH4A 4H1XA 4M4GA 4ELRA 1SW4A 2UXAA 4IO4A 1R9QA 4G4PA 1B3LA 2F7CA 2YJPA 5JTYA 3CR9A 3N94A 2OLBA 1QULA 4RPOA 1DOTA 4GLIA 5TP9A 3EHSA 3PUYE 4L17A 3TCGA 1KWHA 1JQFA 1MXVA 2QPQA 5M2VA 3T96B 1M5CA 1QKAA 1ELJA 3K1PA 2UVGA 3LC8A 4R6YA 1LAHE 1I6BA 3ZSFA 4F2OA 3GZGA 1DPPA 1SD3A 2XXVA 4GF8A 1I6QA 1MQGA 3SEWA 4JBZA 4RNSA 4PE5B 4ECFA 1XS5A 1P1QA 4QRZA 4XKQA 1QUJA 3A3CA 5H8FB 3VLUA 2DWAA 5DT6A 3VVFA 4BDQA 5AA2D 3C36A 3MC2A 4YKIA 4IO7A 5F1QA 3PGFA 3QYTA 2V84A 2XXHA 4R72A 2DP8A 2G93A 3MP6A 5K2YA 2HZKA 2Q2CA 3W15C 4AQ4A 2FYIA 1AIVA 1FTLA 3CSBA 3PUWE 3SEYA 1ZIUA 3O6HA 5L9OA 1MXWA 3IB0A 3GBBA 3Q27A 5FHOA 3RTFB 2GRVA 2O7UA 3Q29A 1DTZA 1N76A 1QUIA 4FE8A 4DLDA 3JZJA 4GRKA 4LZ7A 4ZEIA 3E9XA 2P1SA 3R6UA 1SI1A 5CI5A 2H9BA 1VFDA 3S9LC 4I8CA 2G29A 4KR5A 2PX1A 4XKRA 1MRPA 3SESA 4PFUA 1SQYA 1NNFA 3FD3A 2DE3A 4WKMA 3OO8A 1ZTYA 3HO7A 4GVOA 4OFOA 4THIA 5ISUA 2UVJA 1UTHB 1ZBMA 3FJ7A 3HHGA 2QMWA 3MAMA 4H0WA 4YICA 4BDLA 1PBPA 1US5A 2I0CA 1SW2A 2O69A 3I3VA 4F1YA 2RINA 4BLAA 4F29A 4RY1A 1BTJA 1XVYA 4AB5A 2Y7PA 3U94A 3PU5A 1FQAA 4NF5B 4NF8A 5AA4B 4DIGA 5AA3A 1FW0A 2XXTA 4AB6A 1NNKA 1P1OA 2NUVA 1LLSA 3OMBA 5EHSA 2HEUA 3IL1B 2ABHA 3H3GA 3IORA 3S9NC 1MPDA 3RNNA 1IXGA 4U22A 4Q8RA 2Z8FA 2P2AA 4F3GA 4KYEA 4H67A 1B7ZA 1Y4TA 4X9TA 5TU0A 4KI0E 3BFUA 3CRBA 4EF2A 1UIUA 3PPNA 4LP2B 4H5GA 4RXLA 5AA2A 3KBRA 4KCDA 5FHNA 5LOMA 4F3SA 1Y3PA 2XXWA 4GXAA 1O64A 1S9TA 4LA9A 4R9GA 1WDNA 1B32A 2QSXA 3R7XA 1URSA 1OLCA 3IOUA 1M5DA 3P7IA 4KFQA 4BDMA 2OZZA 1JVYA 3A3UA 3TCHA 1MPCA 2F8DA 3W9WA 4QFPA 1BLFA 1URGA 1J1NA 3OOAA 1D3KA 2I58A 2W7YA 3OELA 5EHMA 3VXCA 3PPOA 3RN8A 4O3BA 3BBRA 3OENA 3K4UA 1AL3A 2H25A 2QS1A 1IIWA 1A8EA 2RCAA 3KEIA 4R9FA 3TTRA 4X1DA 2ONSA 4DDDA 4R75A 3C4MA 3G3FA 4FIMA 1VE4A 3FASA 4MLVA 4EQ7A 1LBCA 3K01A 3EPEA 4H8IA 3MP8A 3MVYA 4GOTA 1MXZA 1IXIA 4Q5TA 2Q88A 1LFHA 3KG2A 4DZ1A 1OQHA 4IGRA 5DEXA 1HSLA 1D9YA 2NXOA 1N7WA 3IOVA 4GXSB 4YAHX 2O68A 3CG1A 1B0HA 4C0RA 1GGGA 2Z23A 1LCFA 3PPPA 4KCCA 4QSEA 3N6TA 1MPBA 4OFJA 4NWCA 1H43A 2DWJA 5H8FA 3FVKA 2GHAA 4ZE8A 1B1HA 4U2RA 2RC8A 5L9SA 2P0SA 3TQLA 4ZZAA 2I0BA 3FVGA 4OFLA 2V25A 4E0WA 4I1DA 1ATGA 3AXFA 3O6GA 4PP0A 4M1VA 2D21A 2F35A 3D4CA 4KQPA 1FTMA 1DPEA 5F7VA 3T9UA 3IJOB 2X7PA 4LZ5A 2D5WA 5H8HA 1FQEA 1D4NA 3FV2A 3LSXA 4HCYA 4YU0A 3KGCA 4FORA 5CMCA 1AMFA 3RGYA 3T9XB 1VR5A 1P1NA 2V93A 3PMVA 2R9JA 4OZ9A 2NOOA 2Q2AA 2AYSA 2F78A 4GD5A 5CBSA 3W9VA 4KPTA 3V5AA 2PT1A 4FJPA 4RYAA 1HSJA 4YMBA 5I57B 1OLAA 1MY4A 1JNFA 3MJNA 2HZLA 2IA4A 4BDOA 4OWDA 3VV5A 3H4ZA 1RKMA 3FXUA 2DYXA 2F34A 1POTA 1B6HA 4OETA 1B7UA 1MDP1 1Y20A 1N7XA 1B9JA 1USYE 4TQUQ 3RY3A 4PETA 3BFTA 1LB9A 3IJXB 5IKBA 2F97A 3ILTB 4HCWA 3MZBA 1PB7A 2RC9A 3H6TA 3OSQA 3FATA 1H45A 1RYOA 5KDTB 1Y3NA 4YKJA 1TXFA 5TPAB 1QKBA 2RC7A 1SYHA 4FAJA 3RT6B 2DWHA 3QUJA 4I62A 3TAJA 3UN6A 2GFEA 1QVSA 3N6UA 4EUOA 4N13A 4LUBA 5FHMA 1AH5A 2REGA 3HCQA 4O3CA 1MY2A 1NKXA 3U72A 4GQOA 5CBRA 4Z7EA 1XHYA 2VD2A 4H5FA 4N07A 1EZPA 1LGBC 1H3DA 1MXXA 1Y1ZA 2B3BA 2V3QA 2OBGA 2HCAA 2BJJX 4F18A 2ANJA 3H6VA 2F5XA 4OENA 2V3UA 1LAFE 4IO3A 2UVIA 4ELOA 5AE4A 5ICQA 1MY1A 5KZTA 3LSFB 3TQWA 1B4HA 1TFAA 2ZNUA 1SW5A 4LONB 3FUZA 4U4SA 5ITPA 1YTVA 1DMBA 1BP5A 3LUYA 3K6UA 2I49A 2UYEA 4R2BA 5DTBA 1SYIA 2Y7KA 1FQFA 3TEPA 3K2DA 4NF4B 2XHDA 1LBBA 4LQ2A 2AL5A 1IUDA 4KYDA 2QS3A 1Q35A 3O2AA 1H44A 4P11A 3FXQA 1B3FA 1N84A 1B58A 2V3TA 3IO6A 5HBCA 3USDA 1EZ9A 2O7IA 3Q28A 5TP9B 3RLFE 4MLQA 1B4ZA 1GTKA 3OO7A 4G77A 2H98A 3KOTA 2UYFA 3CG3A 3BKIB 2NVUB 3KJ7A 3G3GA 5HPQA 4JDFA 3HV1A 4YB6A 5JEIA 3VLWA 2I4CA 1BIYA 1PDAA 1UTBA 3EHTA 3PD8A 1B3HA 1P1WA 4ZEDA 3K1MA 4RJZA 3VXBA 3PMXA 4JWOA 3TFLA 4UA8A 3WAFA 2XX9A 3O29A 2QS4A 2REJA 3VFJA 1IITA 2VD3A 1JETA 3DP8A 3O97A 4KHZE 1N04A 3V89B 2ZYKA 4F3BA 1I69A 3PUXE 4U1ZA 4YB5A 2Y7RA 3TUSA 1NH7A 1H76A 3GLBA 1EZOA 4YKKA 1B3GA 5KCJA 1MH3A 1DSNA 2XXPA 1FTJA 4QFOA 1YCJA 2F36A 3ONMA 4EXKA 4IY6A 4K3FA 2WKYA 3U93A 2PBWA 3QUFA 4OQOA 1GV8A 2E1SA 3MP1A 3PPQA 4F19A 2H4IA 4G8MA 2O1LA 3OO6A 4IO5A 4NEDA 5I59A 1US4A 4GL8A 3T93B 4F31B 4ZECA 1A7LA 1EH3A 1MS7A 1LFGA 2ZMBA 3MBPA 4OTEA 1S50A 2OK2A 3LSLA 2QMXA 3FV1A 2DS9A 3K02A 5DVFA 3TYHA 4NF5A 1PC3A 3GBAA 5AA1A 2H99A 3UP9A 3UA8A 3VVDA 4DXBA 5FTIA 5H8HB 4U23A 4X48A 1SW1A 4ZEBA 4NF6B 4F1VA 4R74A 1SDXA 3OD7A 4LATA 4POXA 4U21A 4ESXA 3TTLA 4PFYA 3S4UA 5I2NA 4HS7A 4BDRA 3K6VA 3TCFA 4H6DA 3G3HA 4OVJA 3MZ9A 1TFDA 1B05A 2F7BA 4QFLA 5I56B 4RK9A 4F22A 1PB8A 3L6HA 3CFXA 1OIBA 3Q25A 4N6PA 3B7DA 4NWDA 4POWA 5BWJA 1M5EA 1SBPA 3RPWA 2XXIA 2KLFA 3M3KA 3H03A 2O51A 3O9PA 5CMBA 1B5IA 2ZNTA 3G3JA 4NF8B 5AA4A 1ZJLA 1MQIA 2XD2A 3GXAA 5H8QB 1YAEA 2Q9TA 3FVNA 3B6TA 3FXRA 1OVTA 3I5OA 4PQJA 4F39A 3MQ9A 5I2KA 3M3FA 1B52A 5K2XA 1FCKA 3MUQA 1JW4A 1MXUA 4H65A 3G3IA 4U4XA 4ISUA 3UK4A 1YPNA 2PYYA 3OEMA 4QFKA 2ONRA 4WEDA 1Y4CA 4XKNA 4I9DA 1XVXA 4YKPA 3UGWA 4GWOA 4TLLB 3M8UA 1LCTA 1LAGE 4LVQA 4O3AA 3RUMA 3THIA 3MPLA 2DSFA 3EHUA 2GH9A 2QRYA 2HAUA 1CE2A 4JB7A 4OEUA 3RQTA 3TPAA 1Y9UA 3B6WA 5I56A 3UORA 3C9HA 3T66A 5I2NB 1FTOA 2AL4A 1L5TA 3RT8A 3KSJA 3FJGA 3JYRA 3TTKA 3G3KA 3K6WA 3I6VA 4XTCQ 4ELQA 4ZEFA 2F7AA 3EN3A 1UTHA 5CMMA 4F2QA 3IK6B 4BDNA 5H8QA 5JK4A 3IX1A 3KZGA 5DVJA 2XXUA 3TTNA 4H8JA 4R6HA 3U8QA 2R6GE 1M5FA 4GFRA 3TZAA 2A5SA 3ODBA 2A5TA 1Y1MA 2VGQA 3C35A 1ZKBA 3PV0E 4G8HA 1MXYA 1QJMA 2OCUA 2XD3A 1P99A 3IB2A 3K0VA 2DVCA 3O66A 3E3KA 3QAXA 4G8NA 4IY5A 4LQ5A 4EF1A 1B51A 3L6GA 3SEVA 3ECRA 2XXQA 2A5TB 3FGSA 4LZ8A 4QSDA 4ND9A 4QSCA 3SETA 4R73A 1SVXB 2RF1A 3KN8A 3TTMA 4EQ9A 3C32A 3IAZA 1WODA 3CIJA 3KN7A 4EQBA 5I59B 1P1UA 2QS2A 3IO4A 4WXJA 1TT1A 5CMKA 1Z7NE 4GIZA 4KYSA 3OXNA 3CFZA 3HHFA 5I58B 5A5XB 2H5YA 3QSLA 1CB6A 2HAVA 1EU8A 2UVHA 3VDFA 1ZU0A 2OJTA 3MVWA 3PUVE 5IAIA 1NH8A 1JW5A 1N0TA 2Y7IA 4WEPA 2Z8EA 1OQGA 5I84A 1LSTA 3SEUA 1IZ1A 1PB9A 4MF3A 3K6XA 1LAXA 2F6GA 3SEXA 2OWTA 5EYFA 1I6AA 2LAOA 3PMWA 4PFWA 1II5A 3KOSA 3Q26A 2ZNSA 3OO9A 2HXWA 1ZMGA 2ZYOA 4ZZEA 2XXRA 1O7TA 3CI8A 4QHQA 3MWBA 3DLNA 3TDJA 4OYVA 4RPNA 3CVGA 2Y84A 2PVUA 3IOWA 4EDPA 4C1TA 3H06B 3DM0A 5J1DA 4JXIA 3MW0A 4OXVA 3RTWB 3TELA 5I57A 2DQVA 2VP1A 1JVXA 4DCXA 4FATA 3ILUB 4YMAA 4OERA 4OHNA 5H8NB 3K1NA 2E0SA 1FTKA 1PBQA 3N26A 5L8DA 1NFTA 3T9VA 1VFEA 5I2KB 2OWSA 2THIA 1GVCA 1SI0A 1O63A 5ITOA 4XXUA 4MFIA 2VOZA 2Q8JA 3TMGA 4GL0A 1XOCA 4FEBA 3SKPA 2FNCA 4DXCA 4JWYA 2GHBA 3K00A 3PPRA 2YPNA 1GR2A 4NF6A 4YB7A 1UIVA 3MVZA 4F1UA 3QXMA 4X1BA 3VE1B 5H8SA 2I4BA 3TODA 2X26A 3MPKA 3FIRA 4FEDA 5FTHA 3LBSA 4ESWA 1MY0A 3T22A 2IEEA 5CRYA 1MQJA 1MY3A 4DXUA 4R6KA 3ZKLA 3O6IA 3LSWA 1A54A 4JSOA 1RYXA 1B1XA 5JTYB 1FQCA 1T0KA 1NNPA 4IB2A 2YLNA 5L9MA 2QL3A 3V8XB 4DCYA 4F3PA 1NL5A 1R9LA 1A55A 2X7QA 3HN0A 1XT8A 2DXRA 2HFBA 3G7WA 5DEXB 3B6QA 1B5HA 4G68C 2HQ0A 2O84X 3KN3A 1UQWA 4QFNA 3C33A 1MQHA 4UACA 4EXLA 2I3WA 4FECA 3M3LA 2F6PA 2XX7A 3FJMA 3CFLA 3IOTA 4RK2A 3U92A 4C1UA 2CMOA 4G2ZA 1ZLQA 4HTGA 5DYHA 4ZE9A 2RCBA 1NMUA 3V83A 1FQDA 4NE4A 1IEJA 3PD9A 4JWXA 2I48A 5ICTA 1VSOA 3TKDA 3U1OA 2O1MA 1LB8A 1MQDA 1S7YA 1B7HA 1F9BA 2DWIA 2I6EA 5A5XA 2ZYNA 4MH5A 5TPAA 4IO2A 5KCJB 3EQ1A 1OMPA 4HW8A 3QK6A 1B0LA 3LR1A 3ZS6A 1AOVA 4KD5A 2CZLA 3OEKA 5CM6A 2M8CA 2RKMA 3E4RA 5B7DA 3HSTA 2ZXTA 1A99A 4NMYA 3E13X 2QJEA 4TOZA 2XXXA 4U1OA 4XKPA 4ZS9A 3S9MC 1A40A 3F11A 5AA2B 1B46A 4IO6A 2I3VA 3EF7A 2Z22A 2DOJA 5B70A 3HPIA 4NF4A 1B40A 1LFIA 2DXYA 2DVZA 3H6WA 4XIGQ 3R26A 1XC1A 1JW1A 3H6UA 3JV9A 2D3IA 1A8FA 1DTGA 1USYH 3KFMA 1IQ7A 2AIXA 1MM6A 2B3FA 1JEUA 3CSGA 4G68B 2DE2A 3OSRA 4IGTA 3QIMA 3VLVA 2NWJA 4ELPA 3S2VA 2ONKE 4ZEKA 4DE8A 2XXYA 2B65A 1IXCA 2Z8DA 4PFTA 4Z0IA 5KDTA 1Z7ME 4ZDMA 4G68A 2ALUA 1UTBB 2ZYMA 1N3XA 4RA1A 4YZZA 2XX8A 1MG1A 1NNTA 1Q1KA 4MBPA 4R2FA 1B5JA 2PMSA 3MVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POY 1;  4OEV A;  4TLM B;  1TWY A;  1WVJ A;  1ANF A;  2DE4 A;  2ESN A;  3S9E A;  3DP4 A;  3KJT A;  3FZV A;  1N3W A;  4E0X A;  3PUZ E;  1QUK A;  3IB1 A;  3SER A;  3IR1 A;  4ONY A;  4P0G A;  4QF9 A;  1M5B A;  5DVI A;  4NTL A;  1OVB A;  2FA7 A;  2Y7W A;  3KSX A;  3C31 A;  4Q0C A;  1BKA A;  2VHA A;  1URD A;  3A09 A;  3VVE A;  1QW0 A;  1MDQ A;  2Q89 A;  1IXH A;  1Y3Q A;  3C34 A;  3MZ1 A;  5H8N A;  3UIF A;  3FVO A;  5HM4 B;  5I58 A;  1MM7 A;  1JEV A;  1R1N A;  3SDF A;  4OES A;  4JSD A;  3WAE A;  2PT2 A;  5ELV A;  1D9V A;  1R6Z A;  3D4G A;  3ZKK A;  1PEB A;  1B2H A;  1HSE A;  3H7M A;  3T9H B;  4Q30 B;  3N5L A;  3DP6 A;  2O6A A;  4OMB A;  1FQB A;  5BUU A;  5CC2 A;  1B3E A;  4P0I A;  3O28 A;  2R71 A;  3DEL B;  1MH4 A;  4H1X A;  4M4G A;  4ELR A;  1SW4 A;  2UXA A;  4IO4 A;  1R9Q A;  4G4P A;  1B3L A;  2F7C A;  2YJP A;  5JTY A;  3CR9 A;  3N94 A;  2OLB A;  1QUL A;  4RPO A;  1DOT A;  4GLI A;  5TP9 A;  3EHS A;  3PUY E;  4L17 A;  3TCG A;  1KWH A;  1JQF A;  1MXV A;  2QPQ A;  5M2V A;  3T96 B;  1M5C A;  1QKA A;  1ELJ A;  3K1P A;  2UVG A;  3LC8 A;  4R6Y A;  1LAH E;  1I6B A;  3ZSF A;  4F2O A;  3GZG A;  1DPP A;  1SD3 A;  2XXV A;  4GF8 A;  1I6Q A;  1MQG A;  3SEW A;  4JBZ A;  4RNS A;  4PE5 B;  4ECF A;  1XS5 A;  1P1Q A;  4QRZ A;  4XKQ A;  1QUJ A;  3A3C A;  5H8F B;  3VLU A;  2DWA A;  5DT6 A;  3VVF A;  4BDQ A;  5AA2 D;  3C36 A;  3MC2 A;  4YKI A;  4IO7 A;  5F1Q A;  3PGF A;  3QYT A;  2V84 A;  2XXH A;  4R72 A;  2DP8 A;  2G93 A;  3MP6 A;  5K2Y A;  2HZK A;  2Q2C A;  3W15 C;  4AQ4 A;  2FYI A;  1AIV A;  1FTL A;  3CSB A;  3PUW E;  3SEY A;  1ZIU A;  3O6H A;  5L9O A;  1MXW A;  3IB0 A;  3GBB A;  3Q27 A;  5FHO A;  3RTF B;  2GRV A;  2O7U A;  3Q29 A;  1DTZ A;  1N76 A;  1QUI A;  4FE8 A;  4DLD A;  3JZJ A;  4GRK A;  4LZ7 A;  4ZEI A;  3E9X A;  2P1S A;  3R6U A;  1SI1 A;  5CI5 A;  2H9B A;  1VFD A;  3S9L C;  4I8C A;  2G29 A;  4KR5 A;  2PX1 A;  4XKR A;  1MRP A;  3SES A;  4PFU A;  1SQY A;  1NNF A;  3FD3 A;  2DE3 A;  4WKM A;  3OO8 A;  1ZTY A;  3HO7 A;  4GVO A;  4OFO A;  4THI A;  5ISU A;  2UVJ A;  1UTH B;  1ZBM A;  3FJ7 A;  3HHG A;  2QMW A;  3MAM A;  4H0W A;  4YIC A;  4BDL A;  1PBP A;  1US5 A;  2I0C A;  1SW2 A;  2O69 A;  3I3V A;  4F1Y A;  2RIN A;  4BLA A;  4F29 A;  4RY1 A;  1BTJ A;  1XVY A;  4AB5 A;  2Y7P A;  3U94 A;  3PU5 A;  1FQA A;  4NF5 B;  4NF8 A;  5AA4 B;  4DIG A;  5AA3 A;  1FW0 A;  2XXT A;  4AB6 A;  1NNK A;  1P1O A;  2NUV A;  1LLS A;  3OMB A;  5EHS A;  2HEU A;  3IL1 B;  2ABH A;  3H3G A;  3IOR A;  3S9N C;  1MPD A;  3RNN A;  1IXG A;  4U22 A;  4Q8R A;  2Z8F A;  2P2A A;  4F3G A;  4KYE A;  4H67 A;  1B7Z A;  1Y4T A;  4X9T A;  5TU0 A;  4KI0 E;  3BFU A;  3CRB A;  4EF2 A;  1UIU A;  3PPN A;  4LP2 B;  4H5G A;  4RXL A;  5AA2 A;  3KBR A;  4KCD A;  5FHN A;  5LOM A;  4F3S A;  1Y3P A;  2XXW A;  4GXA A;  1O64 A;  1S9T A;  4LA9 A;  4R9G A;  1WDN A;  1B32 A;  2QSX A;  3R7X A;  1URS A;  1OLC A;  3IOU A;  1M5D A;  3P7I A;  4KFQ A;  4BDM A;  2OZZ A;  1JVY A;  3A3U A;  3TCH A;  1MPC A;  2F8D A;  3W9W A;  4QFP A;  1BLF A;  1URG A;  1J1N A;  3OOA A;  1D3K A;  2I58 A;  2W7Y A;  3OEL A;  5EHM A;  3VXC A;  3PPO A;  3RN8 A;  4O3B A;  3BBR A;  3OEN A;  3K4U A;  1AL3 A;  2H25 A;  2QS1 A;  1IIW A;  1A8E A;  2RCA A;  3KEI A;  4R9F A;  3TTR A;  4X1D A;  2ONS A;  4DDD A;  4R75 A;  3C4M A;  3G3F A;  4FIM A;  1VE4 A;  3FAS A;  4MLV A;  4EQ7 A;  1LBC A;  3K01 A;  3EPE A;  4H8I A;  3MP8 A;  3MVY A;  4GOT A;  1MXZ A;  1IXI A;  4Q5T A;  2Q88 A;  1LFH A;  3KG2 A;  4DZ1 A;  1OQH A;  4IGR A;  5DEX A;  1HSL A;  1D9Y A;  2NXO A;  1N7W A;  3IOV A;  4GXS B;  4YAH X;  2O68 A;  3CG1 A;  1B0H A;  4C0R A;  1GGG A;  2Z23 A;  1LCF A;  3PPP A;  4KCC A;  4QSE A;  3N6T A;  1MPB A;  4OFJ A;  4NWC A;  1H43 A;  2DWJ A;  5H8F A;  3FVK A;  2GHA A;  4ZE8 A;  1B1H A;  4U2R A;  2RC8 A;  5L9S A;  2P0S A;  3TQL A;  4ZZA A;  2I0B A;  3FVG A;  4OFL A;  2V25 A;  4E0W A;  4I1D A;  1ATG A;  3AXF A;  3O6G A;  4PP0 A;  4M1V A;  2D21 A;  2F35 A;  3D4C A;  4KQP A;  1FTM A;  1DPE A;  5F7V A;  3T9U A;  3IJO B;  2X7P A;  4LZ5 A;  2D5W A;  5H8H A;  1FQE A;  1D4N A;  3FV2 A;  3LSX A;  4HCY A;  4YU0 A;  3KGC A;  4FOR A;  5CMC A;  1AMF A;  3RGY A;  3T9X B;  1VR5 A;  1P1N A;  2V93 A;  3PMV A;  2R9J A;  4OZ9 A;  2NOO A;  2Q2A A;  2AYS A;  2F78 A;  4GD5 A;  5CBS A;  3W9V A;  4KPT A;  3V5A A;  2PT1 A;  4FJP A;  4RYA A;  1HSJ A;  4YMB A;  5I57 B;  1OLA A;  1MY4 A;  1JNF A;  3MJN A;  2HZL A;  2IA4 A;  4BDO A;  4OWD A;  3VV5 A;  3H4Z A;  1RKM A;  3FXU A;  2DYX A;  2F34 A;  1POT A;  1B6H A;  4OET A;  1B7U A;  1MDP 1;  1Y20 A;  1N7X A;  1B9J A;  1USY E;  4TQU Q;  3RY3 A;  4PET A;  3BFT A;  1LB9 A;  3IJX B;  5IKB A;  2F97 A;  3ILT B;  4HCW A;  3MZB A;  1PB7 A;  2RC9 A;  3H6T A;  3OSQ A;  3FAT A;  1H45 A;  1RYO A;  5KDT B;  1Y3N A;  4YKJ A;  1TXF A;  5TPA B;  1QKB A;  2RC7 A;  1SYH A;  4FAJ A;  3RT6 B;  2DWH A;  3QUJ A;  4I62 A;  3TAJ A;  3UN6 A;  2GFE A;  1QVS A;  3N6U A;  4EUO A;  4N13 A;  4LUB A;  5FHM A;  1AH5 A;  2REG A;  3HCQ A;  4O3C A;  1MY2 A;  1NKX A;  3U72 A;  4GQO A;  5CBR A;  4Z7E A;  1XHY A;  2VD2 A;  4H5F A;  4N07 A;  1EZP A;  1LGB C;  1H3D A;  1MXX A;  1Y1Z A;  2B3B A;  2V3Q A;  2OBG A;  2HCA A;  2BJJ X;  4F18 A;  2ANJ A;  3H6V A;  2F5X A;  4OEN A;  2V3U A;  1LAF E;  4IO3 A;  2UVI A;  4ELO A;  5AE4 A;  5ICQ A;  1MY1 A;  5KZT A;  3LSF B;  3TQW A;  1B4H A;  1TFA A;  2ZNU A;  1SW5 A;  4LON B;  3FUZ A;  4U4S A;  5ITP A;  1YTV A;  1DMB A;  1BP5 A;  3LUY A;  3K6U A;  2I49 A;  2UYE A;  4R2B A;  5DTB A;  1SYI A;  2Y7K A;  1FQF A;  3TEP A;  3K2D A;  4NF4 B;  2XHD A;  1LBB A;  4LQ2 A;  2AL5 A;  1IUD A;  4KYD A;  2QS3 A;  1Q35 A;  3O2A A;  1H44 A;  4P11 A;  3FXQ A;  1B3F A;  1N84 A;  1B58 A;  2V3T A;  3IO6 A;  5HBC A;  3USD A;  1EZ9 A;  2O7I A;  3Q28 A;  5TP9 B;  3RLF E;  4MLQ A;  1B4Z A;  1GTK A;  3OO7 A;  4G77 A;  2H98 A;  3KOT A;  2UYF A;  3CG3 A;  3BKI B;  2NVU B;  3KJ7 A;  3G3G A;  5HPQ A;  4JDF A;  3HV1 A;  4YB6 A;  5JEI A;  3VLW A;  2I4C A;  1BIY A;  1PDA A;  1UTB A;  3EHT A;  3PD8 A;  1B3H A;  1P1W A;  4ZED A;  3K1M A;  4RJZ A;  3VXB A;  3PMX A;  4JWO A;  3TFL A;  4UA8 A;  3WAF A;  2XX9 A;  3O29 A;  2QS4 A;  2REJ A;  3VFJ A;  1IIT A;  2VD3 A;  1JET A;  3DP8 A;  3O97 A;  4KHZ E;  1N04 A;  3V89 B;  2ZYK A;  4F3B A;  1I69 A;  3PUX E;  4U1Z A;  4YB5 A;  2Y7R A;  3TUS A;  1NH7 A;  1H76 A;  3GLB A;  1EZO A;  4YKK A;  1B3G A;  5KCJ A;  1MH3 A;  1DSN A;  2XXP A;  1FTJ A;  4QFO A;  1YCJ A;  2F36 A;  3ONM A;  4EXK A;  4IY6 A;  4K3F A;  2WKY A;  3U93 A;  2PBW A;  3QUF A;  4OQO A;  1GV8 A;  2E1S A;  3MP1 A;  3PPQ A;  4F19 A;  2H4I A;  4G8M A;  2O1L A;  3OO6 A;  4IO5 A;  4NED A;  5I59 A;  1US4 A;  4GL8 A;  3T93 B;  4F31 B;  4ZEC A;  1A7L A;  1EH3 A;  1MS7 A;  1LFG A;  2ZMB A;  3MBP A;  4OTE A;  1S50 A;  2OK2 A;  3LSL A;  2QMX A;  3FV1 A;  2DS9 A;  3K02 A;  5DVF A;  3TYH A;  4NF5 A;  1PC3 A;  3GBA A;  5AA1 A;  2H99 A;  3UP9 A;  3UA8 A;  3VVD A;  4DXB A;  5FTI A;  5H8H B;  4U23 A;  4X48 A;  1SW1 A;  4ZEB A;  4NF6 B;  4F1V A;  4R74 A;  1SDX A;  3OD7 A;  4LAT A;  4POX A;  4U21 A;  4ESX A;  3TTL A;  4PFY A;  3S4U A;  5I2N A;  4HS7 A;  4BDR A;  3K6V A;  3TCF A;  4H6D A;  3G3H A;  4OVJ A;  3MZ9 A;  1TFD A;  1B05 A;  2F7B A;  4QFL A;  5I56 B;  4RK9 A;  4F22 A;  1PB8 A;  3L6H A;  3CFX A;  1OIB A;  3Q25 A;  4N6P A;  3B7D A;  4NWD A;  4POW A;  5BWJ A;  1M5E A;  1SBP A;  3RPW A;  2XXI A;  2KLF A;  3M3K A;  3H03 A;  2O51 A;  3O9P A;  5CMB A;  1B5I A;  2ZNT A;  3G3J A;  4NF8 B;  5AA4 A;  1ZJL A;  1MQI A;  2XD2 A;  3GXA A;  5H8Q B;  1YAE A;  2Q9T A;  3FVN A;  3B6T A;  3FXR A;  1OVT A;  3I5O A;  4PQJ A;  4F39 A;  3MQ9 A;  5I2K A;  3M3F A;  1B52 A;  5K2X A;  1FCK A;  3MUQ A;  1JW4 A;  1MXU A;  4H65 A;  3G3I A;  4U4X A;  4ISU A;  3UK4 A;  1YPN A;  2PYY A;  3OEM A;  4QFK A;  2ONR A;  4WED A;  1Y4C A;  4XKN A;  4I9D A;  1XVX A;  4YKP A;  3UGW A;  4GWO A;  4TLL B;  3M8U A;  1LCT A;  1LAG E;  4LVQ A;  4O3A A;  3RUM A;  3THI A;  3MPL A;  2DSF A;  3EHU A;  2GH9 A;  2QRY A;  2HAU A;  1CE2 A;  4JB7 A;  4OEU A;  3RQT A;  3TPA A;  1Y9U A;  3B6W A;  5I56 A;  3UOR A;  3C9H A;  3T66 A;  5I2N B;  1FTO A;  2AL4 A;  1L5T A;  3RT8 A;  3KSJ A;  3FJG A;  3JYR A;  3TTK A;  3G3K A;  3K6W A;  3I6V A;  4XTC Q;  4ELQ A;  4ZEF A;  2F7A A;  3EN3 A;  1UTH A;  5CMM A;  4F2Q A;  3IK6 B;  4BDN A;  5H8Q A;  5JK4 A;  3IX1 A;  3KZG A;  5DVJ A;  2XXU A;  3TTN A;  4H8J A;  4R6H A;  3U8Q A;  2R6G E;  1M5F A;  4GFR A;  3TZA A;  2A5S A;  3ODB A;  2A5T A;  1Y1M A;  2VGQ A;  3C35 A;  1ZKB A;  3PV0 E;  4G8H A;  1MXY A;  1QJM A;  2OCU A;  2XD3 A;  1P99 A;  3IB2 A;  3K0V A;  2DVC A;  3O66 A;  3E3K A;  3QAX A;  4G8N A;  4IY5 A;  4LQ5 A;  4EF1 A;  1B51 A;  3L6G A;  3SEV A;  3ECR A;  2XXQ A;  2A5T B;  3FGS A;  4LZ8 A;  4QSD A;  4ND9 A;  4QSC A;  3SET A;  4R73 A;  1SVX B;  2RF1 A;  3KN8 A;  3TTM A;  4EQ9 A;  3C32 A;  3IAZ A;  1WOD A;  3CIJ A;  3KN7 A;  4EQB A;  5I59 B;  1P1U A;  2QS2 A;  3IO4 A;  4WXJ A;  1TT1 A;  5CMK A;  1Z7N E;  4GIZ A;  4KYS A;  3OXN A;  3CFZ A;  3HHF A;  5I58 B;  5A5X B;  2H5Y A;  3QSL A;  1CB6 A;  2HAV A;  1EU8 A;  2UVH A;  3VDF A;  1ZU0 A;  2OJT A;  3MVW A;  3PUV E;  5IAI A;  1NH8 A;  1JW5 A;  1N0T A;  2Y7I A;  4WEP A;  2Z8E A;  1OQG A;  5I84 A;  1LST A;  3SEU A;  1IZ1 A;  1PB9 A;  4MF3 A;  3K6X A;  1LAX A;  2F6G A;  3SEX A;  2OWT A;  5EYF A;  1I6A A;  2LAO A;  3PMW A;  4PFW A;  1II5 A;  3KOS A;  3Q26 A;  2ZNS A;  3OO9 A;  2HXW A;  1ZMG A;  2ZYO A;  4ZZE A;  2XXR A;  1O7T A;  3CI8 A;  4QHQ A;  3MWB A;  3DLN A;  3TDJ A;  4OYV A;  4RPN A;  3CVG A;  2Y84 A;  2PVU A;  3IOW A;  4EDP A;  4C1T A;  3H06 B;  3DM0 A;  5J1D A;  4JXI A;  3MW0 A;  4OXV A;  3RTW B;  3TEL A;  5I57 A;  2DQV A;  2VP1 A;  1JVX A;  4DCX A;  4FAT A;  3ILU B;  4YMA A;  4OER A;  4OHN A;  5H8N B;  3K1N A;  2E0S A;  1FTK A;  1PBQ A;  3N26 A;  5L8D A;  1NFT A;  3T9V A;  1VFE A;  5I2K B;  2OWS A;  2THI A;  1GVC A;  1SI0 A;  1O63 A;  5ITO A;  4XXU A;  4MFI A;  2VOZ A;  2Q8J A;  3TMG A;  4GL0 A;  1XOC A;  4FEB A;  3SKP A;  2FNC A;  4DXC A;  4JWY A;  2GHB A;  3K00 A;  3PPR A;  2YPN A;  1GR2 A;  4NF6 A;  4YB7 A;  1UIV A;  3MVZ A;  4F1U A;  3QXM A;  4X1B A;  3VE1 B;  5H8S A;  2I4B A;  3TOD A;  2X26 A;  3MPK A;  3FIR A;  4FED A;  5FTH A;  3LBS A;  4ESW A;  1MY0 A;  3T22 A;  2IEE A;  5CRY A;  1MQJ A;  1MY3 A;  4DXU A;  4R6K A;  3ZKL A;  3O6I A;  3LSW A;  1A54 A;  4JSO A;  1RYX A;  1B1X A;  5JTY B;  1FQC A;  1T0K A;  1NNP A;  4IB2 A;  2YLN A;  5L9M A;  2QL3 A;  3V8X B;  4DCY A;  4F3P A;  1NL5 A;  1R9L A;  1A55 A;  2X7Q A;  3HN0 A;  1XT8 A;  2DXR A;  2HFB A;  3G7W A;  5DEX B;  3B6Q A;  1B5H A;  4G68 C;  2HQ0 A;  2O84 X;  3KN3 A;  1UQW A;  4QFN A;  3C33 A;  1MQH A;  4UAC A;  4EXL A;  2I3W A;  4FEC A;  3M3L A;  2F6P A;  2XX7 A;  3FJM A;  3CFL A;  3IOT A;  4RK2 A;  3U92 A;  4C1U A;  2CMO A;  4G2Z A;  1ZLQ A;  4HTG A;  5DYH A;  4ZE9 A;  2RCB A;  1NMU A;  3V83 A;  1FQD A;  4NE4 A;  1IEJ A;  3PD9 A;  4JWX A;  2I48 A;  5ICT A;  1VSO A;  3TKD A;  3U1O A;  2O1M A;  1LB8 A;  1MQD A;  1S7Y A;  1B7H A;  1F9B A;  2DWI A;  2I6E A;  5A5X A;  2ZYN A;  4MH5 A;  5TPA A;  4IO2 A;  5KCJ B;  3EQ1 A;  1OMP A;  4HW8 A;  3QK6 A;  1B0L A;  3LR1 A;  3ZS6 A;  1AOV A;  4KD5 A;  2CZL A;  3OEK A;  5CM6 A;  2M8C A;  2RKM A;  3E4R A;  5B7D A;  3HST A;  2ZXT A;  1A99 A;  4NMY A;  3E13 X;  2QJE A;  4TOZ A;  2XXX A;  4U1O A;  4XKP A;  4ZS9 A;  3S9M C;  1A40 A;  3F11 A;  5AA2 B;  1B46 A;  4IO6 A;  2I3V A;  3EF7 A;  2Z22 A;  2DOJ A;  5B70 A;  3HPI A;  4NF4 A;  1B40 A;  1LFI A;  2DXY A;  2DVZ A;  3H6W A;  4XIG Q;  3R26 A;  1XC1 A;  1JW1 A;  3H6U A;  3JV9 A;  2D3I A;  1A8F A;  1DTG A;  1USY H;  3KFM A;  1IQ7 A;  2AIX A;  1MM6 A;  2B3F A;  1JEU A;  3CSG A;  4G68 B;  2DE2 A;  3OSR A;  4IGT A;  3QIM A;  3VLV A;  2NWJ A;  4ELP A;  3S2V A;  2ONK E;  4ZEK A;  4DE8 A;  2XXY A;  2B65 A;  1IXC A;  2Z8D A;  4PFT A;  4Z0I A;  5KDT A;  1Z7M E;  4ZDM A;  4G68 A;  2ALU A;  1UTB B;  2ZYM A;  1N3X A;  4RA1 A;  4YZZ A;  2XX8 A;  1MG1 A;  1NNT A;  1Q1K A;  4MBP A;  4R2F A;  1B5J A;  2PMS A;  3MVX A; 
#chains in the Genus database with same CATH topology
 1FBG A;  1POY 1;  1EYI A;  4OEV A;  4TLM B;  1WVJ A;  3HFU A;  3B50 A;  5DVI A;  4QXD A;  2FA7 A;  1QW0 A;  1BK4 A;  4MEV A;  1JEV A;  1RDZ A;  1R6Z A;  3D4G A;  1K9Z A;  4MCO A;  2Q74 A;  4Q30 B;  4MJO A;  4P0I A;  3DEL B;  4H1X A;  1LEV A;  3EHS A;  3PUY E;  1KWH A;  1MXV A;  4PDD A;  5M2V A;  4MNI A;  3T96 B;  1ELJ A;  4R6Y A;  4GF8 A;  3SEW A;  2Y5L A;  4XKQ A;  1QUJ A;  3VLU A;  3VVF A;  3C36 A;  3MC2 A;  2OWZ A;  4IO7 A;  5IZZ A;  2XXH A;  2FYI A;  5L9O A;  3GBB A;  3Q29 A;  1N76 A;  3JZJ A;  4ZEI A;  4LZ7 A;  3FXB A;  1SI1 A;  2H9B A;  1VFD A;  1MRP A;  3FD3 A;  4OA4 A;  3OO8 A;  4OFO A;  4BDL A;  5ET5 A;  4BLA A;  1BTJ A;  3PU5 A;  1AWB A;  1FQA A;  5LDZ A;  4DIG A;  1NNK A;  3H3G A;  3S9N C;  3RNN A;  5EQ8 A;  4Q8R A;  2Z8F A;  2P2A A;  3IFA A;  4X9T A;  4KI0 E;  4GBW A;  4KCD A;  4F3S A;  1Y3P A;  1S9T A;  1WDN A;  3R7X A;  1OLC A;  1FRP A;  3A29 A;  5A5L A;  4QFP A;  2W7Y A;  3BBR A;  1A8E A;  2RCA A;  3G3F A;  4FIM A;  1VE4 A;  3FAS A;  1LBC A;  3K01 A;  4H8I A;  4GOT A;  1IXI A;  4DZ1 A;  4IGR A;  1D9Y A;  2NXO A;  1N7W A;  2XWV A;  1FJ9 A;  1GGG A;  4KCC A;  4OFJ A;  2DWJ A;  2GHA A;  4ZE8 A;  5L9S A;  2QVV A;  2V25 A;  1ATG A;  2ZZW A;  4M1V A;  4KQP A;  3T9U A;  5H8H A;  3FV2 A;  3LSX A;  4HCY A;  4YU0 A;  5CMC A;  2R9J A;  1NV5 A;  2R8T A;  3H4Z A;  4HXV A;  1POT A;  1USY E;  4PET A;  3IJX B;  1NV2 A;  5ET6 A;  4YKJ A;  4PF8 A;  2DWH A;  3TAJ A;  4EUO A;  5FHM A;  1AH5 A;  1MY2 A;  1FPI A;  1XHY A;  1NUX A;  1Y1Z A;  2V3Q A;  5IGA A;  2F5X A;  4ELO A;  1LAF E;  4IO3 A;  3B8B A;  4OVQ A;  3TQW A;  1B4H A;  1DMB A;  1BP5 A;  3K6U A;  2UYE A;  5DTB A;  1IUD A;  4N91 A;  4P11 A;  1H44 A;  4PDH A;  1VDW A;  1EZ9 A;  2H98 A;  2UYF A;  2FIX A;  5JEI A;  1NV7 A;  3EHT A;  1FBH A;  4NF0 A;  4UA8 A;  2XX9 A;  3O29 A;  2REJ A;  3VFJ A;  2VD3 A;  1JET A;  3ISP A;  4PGP A;  3O97 A;  2OX3 A;  2ZYK A;  3PUX E;  2FIE A;  4YB5 A;  2Y7R A;  1XI6 A;  4YKK A;  1B3G A;  2XXP A;  1FTJ A;  4QFO A;  2PBW A;  3QUF A;  1GV8 A;  4F19 A;  4NED A;  1MS7 A;  4ELR A;  3TYH A;  3UP9 A;  2H99 A;  5FTI A;  4NF6 B;  2QFL A;  2WYP A;  4R74 A;  4LAT A;  4QFL A;  4RK9 A;  4F22 A;  1PB8 A;  4POW A;  5BWJ A;  3B7D A;  2XXI A;  3GXA A;  4GX6 A;  2Q9T A;  3FVN A;  1JW4 A;  2Y5K A;  2PYY A;  4QFK A;  4WED A;  1Y4C A;  1XVX A;  1LCT A;  3THI A;  2DSF A;  3EHU A;  3C9H A;  4GWW A;  2AL4 A;  5JK4 A;  3KZG A;  2QVR A;  5DVJ A;  2R6G E;  3TZA A;  3ODB A;  2VGQ A;  1ZKB A;  1MXY A;  2OCU A;  3TQL A;  1P99 A;  4IY5 A;  1B51 A;  1FBD A;  3SEV A;  3ECR A;  4LZ8 A;  4R73 A;  4EQ9 A;  3TTM A;  3C32 A;  4EQB A;  5CMK A;  1Z7N E;  3OXN A;  1LBZ A;  2H5Y A;  1EU8 A;  3VDF A;  2OJT A;  3PUV E;  1NH8 A;  4WEP A;  2Z8E A;  3SEU A;  4MF3 A;  4XF5 A;  3SEX A;  4O94 A;  4PFW A;  3Q26 A;  1ZMG A;  2XXR A;  4QHQ A;  3DLN A;  3TDJ A;  2Y84 A;  1FBE A;  4EDP A;  4C1T A;  4N6D A;  4O7M A;  4OVR A;  3ILU B;  5H8N B;  1FTK A;  4DI3 D;  3T9V A;  1VFE A;  2THI A;  3K00 A;  3MVZ A;  4HE1 A;  3TOD A;  4FED A;  3FIR A;  3T22 A;  2IEE A;  4H46 A;  4R6K A;  3LSW A;  1NI9 A;  4JSO A;  4AS5 A;  5JTY B;  2QL3 A;  1R9L A;  5F7V A;  2DXR A;  3B6Q A;  4QFN A;  3IFC A;  3C33 A;  1MQH A;  2F6P A;  4HE2 A;  3CFL A;  3IOT A;  3V83 A;  2I48 A;  5LTC A;  1B7H A;  4MNC A;  1LBX A;  3LR1 A;  4PAI A;  5EYH A;  2M8C A;  4PBH A;  4NMY A;  2QJE A;  2XXX A;  4XKP A;  1A40 A;  5AA2 B;  3RPL B;  3HPI A;  2WBD A;  3KFM A;  1USY H;  3CSG A;  2DE2 A;  4IGT A;  2NWJ A;  4NX1 A;  3S2V A;  2XXY A;  4G68 A;  2ZZV A;  2ZYM A;  4YZZ A;  1MG1 A;  1Q1K A;  4MBP A;  4P8B A;  1TWY A;  2DE4 A;  2ESN A;  3DP4 A;  1QUK A;  4QF9 A;  2Y7W A;  3C31 A;  3VVE A;  4FAJ A;  3A09 A;  4NAP A;  3C34 A;  5H8N A;  5EQA A;  3FVO A;  5HM4 B;  1MM7 A;  1YXI A;  4JSD A;  1B2H A;  3T9H B;  1FQB A;  1B3E A;  2R71 A;  2UXA A;  4G4P A;  2F7C A;  2YJP A;  5JTY A;  1QUL A;  4RPO A;  1M5C A;  3K1P A;  2UVG A;  4PFI A;  5EYG A;  1MQG A;  1XS5 A;  3A3C A;  5DT6 A;  4BDQ A;  5AA2 D;  4YKI A;  4NGU A;  2V84 A;  2DP8 A;  2G93 A;  2HZK A;  3SEY A;  3IB0 A;  5FHO A;  3RTF B;  2GRV A;  2O7U A;  4DLD A;  4GRK A;  4N8Y A;  3E9X A;  2P1S A;  3R6U A;  2G29 A;  2PX1 A;  3SES A;  2DE3 A;  1ZTY A;  4THI A;  4GWY A;  3HHG A;  1PBP A;  2O69 A;  1SW2 A;  2RIN A;  4F29 A;  2VT5 A;  4AB5 A;  2Y7P A;  4NF8 A;  5AA4 B;  1FW0 A;  1P1O A;  1LLS A;  5ET7 A;  1MPD A;  1IXG A;  4U22 A;  1EYK A;  4KYE A;  4H67 A;  1Y4T A;  3BFU A;  4EF2 A;  4RXL A;  4H5G A;  5AA2 A;  5FHN A;  2WX9 A;  5LOM A;  1O64 A;  4R9G A;  3P7I A;  3A3U A;  3TCH A;  1MPC A;  1BLF A;  1URG A;  1RDX A;  4GWU A;  1INP A;  2I58 A;  4O3B A;  2H25 A;  2ONS A;  3C4M A;  4EQ7 A;  3MP8 A;  1LFH A;  2Q88 A;  4GXS B;  3CG1 A;  2Z23 A;  3PPP A;  4QSE A;  1MPB A;  3FVK A;  2RC8 A;  2P0S A;  3FVG A;  2PFY A;  4I1D A;  4PAK A;  2D21 A;  1FTM A;  4LZ5 A;  2D5W A;  1FQE A;  4N15 A;  5I56 B;  3KGC A;  2NOO A;  2Q2A A;  4GD5 A;  2F78 A;  5CBS A;  3W9V A;  4KPT A;  3V5A A;  4FJP A;  4RYA A;  1OLA A;  1MY4 A;  1JNF A;  4BDO A;  4OWD A;  3VV5 A;  1RKM A;  4GX4 A;  1B6H A;  4OET A;  1RDY A;  3BFT A;  1LB9 A;  2F97 A;  1H45 A;  2VPO A;  5KDT B;  1Y3N A;  2RC7 A;  3RT6 B;  3QUJ A;  2GFE A;  1QVS A;  2REG A;  3HCQ A;  2VPN A;  4Z7E A;  4N07 A;  1H3D A;  2B3B A;  3H6V A;  3LSF B;  5ESY A;  4U4S A;  3LUY A;  4R2B A;  2XHD A;  2QS3 A;  3O2A A;  2V3T A;  3IO6 A;  2O7I A;  5TP9 B;  1B4Z A;  3BKI B;  3G3G A;  1BIY A;  1UTB A;  3PD8 A;  4ZED A;  3K1M A;  2KR0 A;  4RJZ A;  3LUZ A;  4MMP A;  1DBZ A;  1IIT A;  1EYJ A;  4KHZ E;  1H76 A;  3GLB A;  1EZO A;  1MH3 A;  1YCJ A;  3ONM A;  2Q8M A;  2H4I A;  4OVS A;  4GL8 A;  4F31 B;  1EH3 A;  4OTE A;  2ZMB A;  5A5X A;  1S50 A;  2QMX A;  3K02 A;  4N6K A;  3GBA A;  5AA1 A;  4F1V A;  1SW1 A;  4U21 A;  4PFY A;  3S4U A;  3CFX A;  1OIB A;  3Q25 A;  3KC0 A;  3H03 A;  3G3J A;  4NF8 B;  5AA4 A;  4OAN A;  1ZJL A;  5H8Q B;  1NUY A;  4F39 A;  1B52 A;  5K2X A;  1FCK A;  1FBP A;  3UK4 A;  3OEM A;  4YKP A;  3UGW A;  4GWO A;  3M8U A;  4JVD A;  4LVQ A;  3RQT A;  4OEU A;  2HAU A;  4JVI A;  5I56 A;  3B6W A;  4MX6 A;  3KSJ A;  3TTK A;  5AE4 A;  3EN3 A;  3IK6 B;  3TTN A;  4R6H A;  1M5F A;  2XD3 A;  1QJM A;  3IB2 A;  3QAX A;  4G8N A;  4EF1 A;  3W15 C;  2XXQ A;  4QSC A;  3FGS A;  4GX3 A;  3KN8 A;  1P1U A;  4KYS A;  5I58 B;  3HHF A;  3QSL A;  1CB6 A;  5IAI A;  1JW5 A;  1N0T A;  2Y7I A;  1LBV A;  3BIG A;  3K6X A;  1KZ8 A;  2F6G A;  3PMW A;  2HXW A;  4ZZE A;  1IME A;  3MWB A;  5IZ3 B;  5J1D A;  3IOW A;  1FTA A;  4JXI A;  3MW0 A;  3TEL A;  1JVX A;  1PBQ A;  2HHM A;  5ITO A;  4MFI A;  2VOZ A;  2Q8J A;  3TMG A;  1XOC A;  4FEB A;  3SKP A;  4JWY A;  3PPR A;  4F1U A;  2YPN A;  1UIV A;  3QXM A;  5H8S A;  5FTH A;  4ESW A;  5FBP A;  1MY3 A;  1RYX A;  5EQ9 A;  1B1X A;  1NV4 A;  4IB2 A;  3V8X B;  1NL5 A;  3HN0 A;  2HFB A;  3VLW A;  4FEC A;  2XX7 A;  3FJM A;  4RK2 A;  4C1U A;  3PTY A;  4G2Z A;  1ZLQ A;  4HTG A;  4XFE A;  1FQD A;  5ICT A;  1LB8 A;  1MQD A;  2I6E A;  4MH5 A;  4PAF A;  5TPA A;  4IO2 A;  4KXP A;  3QK6 A;  1B0L A;  3ZS6 A;  5CM6 A;  4N17 A;  4U1O A;  4QBA A;  4ZS9 A;  3E13 X;  3EF7 A;  2Z22 A;  1LFI A;  2CEX A;  1XC1 A;  3JV9 A;  2L5V A;  1MM6 A;  3QIM A;  4ELP A;  2Z8D A;  1IXC A;  1Z7M E;  4G61 A;  4RA1 A;  4PC9 A;  3PPO A;  1NNT A;  4R2F A;  3OO9 A;  2PMS A;  3MVX A;  4X8R A;  3KJT A;  1N3W A;  4E0X A;  3IB1 A;  3SER A;  3IR1 A;  4ONY A;  4P0G A;  4NTL A;  1OVB A;  4Q0C A;  4DI4 B;  2VHA A;  1URD A;  2Q89 A;  1MDQ A;  3MZ1 A;  1IXH A;  2PFZ A;  5I58 A;  1NV6 A;  1R1N A;  3SDF A;  3WAE A;  5ELV A;  1D9V A;  3ZKK A;  3H7M A;  4N8G A;  3DP6 A;  5ET8 A;  2O6A A;  4OMB A;  5BUU A;  2XWK A;  3O28 A;  4M4G A;  4IO4 A;  1NV3 A;  1B3L A;  3N94 A;  2OLB A;  1DOT A;  4GLI A;  4P56 A;  4L17 A;  3TCG A;  1JQF A;  4MAG A;  1QKA A;  2WYK A;  1I6B A;  3GZG A;  2XXV A;  1I6Q A;  4RNS A;  4PE5 B;  2DWA A;  5IM2 A;  5F1Q A;  1FPD A;  3RPL A;  4AQ4 A;  3CSB A;  1ZIU A;  1MXW A;  1DTZ A;  1QUI A;  4FE8 A;  3T1B A;  4PGN A;  2P3N A;  4I8C A;  4KR5 A;  1SQY A;  1NNF A;  3BIH A;  3HO7 A;  4GVO A;  5IZ3 A;  5ISU A;  1UTH B;  1ZBM A;  2I0C A;  4F1Y A;  3I3V A;  3U94 A;  3MST A;  4AB6 A;  2NUV A;  5EHS A;  3IL1 B;  4F3G A;  2QVU A;  1B7Z A;  5TU0 A;  3CRB A;  1UIU A;  3PPN A;  3KBR A;  4GXA A;  2QSX A;  1M5D A;  4BDM A;  2F8D A;  3W9W A;  1J1N A;  1D3K A;  3OEL A;  3VXC A;  3OEN A;  1AL3 A;  1IIW A;  3QMF A;  4DDD A;  4R75 A;  4MLV A;  3EPE A;  4N4U A;  3MVY A;  4Q5T A;  1DCU A;  3IOV A;  3EKI A;  1B0H A;  4C0R A;  1D9Q A;  4FBP A;  4P1L A;  2MKZ A;  1B1H A;  2WBB A;  4U2R A;  4OFL A;  3AXF A;  3D4C A;  4O8M A;  3IJO B;  2X7P A;  3RGY A;  1VR5 A;  1P1N A;  2V93 A;  2AYS A;  1QGX A;  2PT1 A;  1HSJ A;  4YMB A;  5I57 B;  3MJN A;  1IMA A;  1Y20 A;  1N7X A;  1B9J A;  3RY3 A;  4P9K A;  5IKB A;  4HCW A;  3MZB A;  3H6T A;  1TXF A;  5TPA B;  1QKB A;  1SYH A;  4I62 A;  3UN6 A;  3N6U A;  5T3J A;  4N13 A;  4LUB A;  1K9Y A;  4O3C A;  3U72 A;  1NKX A;  1NV0 A;  5CBR A;  2VD2 A;  1EZP A;  1LGB C;  4F18 A;  1FPK A;  2BJJ X;  4OEN A;  2V3U A;  5KZT A;  1MY1 A;  4GBV A;  1TFA A;  2ZNU A;  1SW5 A;  4NN3 A;  3FUZ A;  1SYI A;  1FQF A;  1G0I A;  3TEP A;  3K2D A;  1FPJ A;  4LQ2 A;  4PFR A;  4KYD A;  3KC1 A;  3FXQ A;  1B3F A;  1N84 A;  5HBC A;  3USD A;  3S9L C;  3Q28 A;  4MLQ A;  5I7I A;  1GTK A;  4G77 A;  1FJ6 A;  2KQZ A;  2NVU B;  3CG3 A;  3KJ7 A;  3HV1 A;  2I4C A;  1P1W A;  4N81 A;  3VXB A;  3WAF A;  3TFL A;  1KA0 A;  1N04 A;  4F3B A;  4PFB A;  3ROJ A;  1DSN A;  2WKY A;  1FPB A;  2E1S A;  3PPQ A;  2O1L A;  2HPG A;  3OO6 A;  5I59 A;  1US4 A;  2XWO A;  3T93 B;  1A7L A;  3MBP A;  4YAH X;  1LFG A;  3LSL A;  2OK2 A;  4P3L A;  5DVF A;  3FV1 A;  2DS9 A;  1FSA A;  4DXB A;  3UA8 A;  4ZEB A;  4ESX A;  3TTL A;  5I2N A;  4HS7 A;  4BDR A;  3K6V A;  4GWX A;  3TCF A;  4H6D A;  4OVJ A;  3MZ9 A;  1TFD A;  1B05 A;  2F7B A;  1IMD A;  3L6H A;  1M5E A;  1SBP A;  2KLF A;  3M3K A;  3O9P A;  2O51 A;  2XD2 A;  1MQI A;  5F24 A;  1YAE A;  2BJI A;  3B6T A;  5I2K A;  3M3F A;  1FPL A;  4H65 A;  3G3I A;  1NV1 A;  1YPN A;  4XKN A;  2ONR A;  4I9D A;  4TLL B;  4O3A A;  1LAG E;  3RUM A;  2QRY A;  1CE2 A;  1Y9U A;  3UOR A;  3T66 A;  5I2N B;  1FTO A;  1L5T A;  3RT8 A;  3JYR A;  3U65 A;  3K6W A;  3I6V A;  4ELQ A;  4F2Q A;  2F7A A;  5CMM A;  1UTH A;  5H8Q A;  3IX1 A;  2XXU A;  3U8Q A;  4GFR A;  1Y1M A;  5I3S A;  3C35 A;  4G8H A;  3K0V A;  3E3K A;  4LQ5 A;  2A5T B;  3SET A;  4ND9 A;  1SVX B;  3E78 A;  1WOD A;  3CIJ A;  5I59 B;  1TT1 A;  5A5X B;  2UVH A;  1ZU0 A;  1OQG A;  1IZ1 A;  1PB9 A;  1LAX A;  5EYF A;  2LAO A;  2ZNS A;  5I5P A;  3CI8 A;  1KA1 A;  4OYV A;  3CVG A;  3H06 B;  3DM0 A;  3RTW B;  2DQV A;  4YMA A;  4OER A;  3N26 A;  1NFT A;  1GVC A;  2OWS A;  1SI0 A;  1JP4 A;  1O63 A;  2FNC A;  4DXC A;  4MIJ A;  4NF6 A;  2XA5 A;  4X1B A;  3VE1 B;  2X26 A;  3MPK A;  3LBS A;  1MY0 A;  2CZK A;  5CRY A;  4DXU A;  3O6I A;  1A54 A;  1FQC A;  1T0K A;  5L9M A;  5EQ7 A;  4F3P A;  2X7Q A;  1IMC A;  1A55 A;  4I3E A;  5DEX B;  2B4M A;  3G7W A;  1B5H A;  4G68 C;  2HQ0 A;  2O84 X;  3KN3 A;  2I3W A;  3U92 A;  2CMO A;  3CHG A;  4ZE9 A;  5DYH A;  2RCB A;  1NMU A;  4NE4 A;  3TKD A;  3U1O A;  1F9B A;  2ZYN A;  4I40 A;  5KCJ B;  1OMP A;  4HW8 A;  3OEK A;  5B7D A;  2RKM A;  3E4R A;  3HST A;  1A99 A;  4TOZ A;  4IO6 A;  2DOJ A;  2DXY A;  2DVZ A;  4XIG Q;  3R26 A;  2D3I A;  1A8F A;  1DTG A;  2B3F A;  3VLV A;  1JEU A;  2ONK E;  1Q9D A;  4ZEK A;  4PFT A;  5KDT A;  4ZDM A;  2XX8 A;  4DCX A;  3GYY A;  1B5J A;  4OVP A;  5J16 A;  1ANF A;  3D1R A;  3S9E A;  3FZV A;  2CEY A;  3PUZ E;  1M5B A;  3RYD A;  3KSX A;  1BKA A;  1Y3Q A;  3UIF A;  2XWI A;  4OES A;  2PT2 A;  1PEB A;  1HSE A;  3N5L A;  5CC2 A;  4LN5 A;  1MH4 A;  1SW4 A;  1R9Q A;  4NG7 A;  3CR9 A;  5TP9 A;  2QPQ A;  3LC8 A;  1NUZ A;  1LAH E;  3ZSF A;  4F2O A;  1DPP A;  1SD3 A;  4JBZ A;  1DK4 A;  4ECF A;  1P1Q A;  4QRZ A;  3KBZ A;  5H8F B;  1YYZ A;  3PGF A;  3QYT A;  4R72 A;  3MP6 A;  5K2Y A;  2Q2C A;  1AIV A;  1FTL A;  3PUW E;  3O6H A;  3Q27 A;  3FBP A;  4X04 A;  5CI5 A;  4XKR A;  4PFU A;  4WKM A;  2HXR A;  2UVJ A;  3FJ7 A;  2QMW A;  3MAM A;  4H0W A;  4YIC A;  1US5 A;  4RY1 A;  1XVY A;  4NF5 B;  5AA3 A;  2XXT A;  4P1E A;  3OMB A;  2HEU A;  2ABH A;  3IOR A;  4LP2 B;  2B4L A;  2XXW A;  4LA9 A;  5IZ1 A;  1B32 A;  1URS A;  3IOU A;  3LV0 A;  4KFQ A;  2OZZ A;  1JVY A;  4NHB A;  3OOA A;  5EHM A;  3RN8 A;  4GWS A;  3K4U A;  3KEI A;  2QS1 A;  4R9F A;  3TTR A;  2V4C A;  4X1D A;  4PBQ A;  1MXZ A;  3KG2 A;  1OQH A;  5DEX A;  1HSL A;  2XXK A;  4PF6 A;  2O68 A;  4AS4 A;  1LCF A;  3N6T A;  4OVT A;  4NWC A;  1H43 A;  5H8F A;  4ZZA A;  2I0B A;  4E0W A;  3O6G A;  4PP0 A;  2F35 A;  1DPE A;  1D4N A;  3T9X B;  4FOR A;  1AMF A;  3PMV A;  4OZ9 A;  1LBY A;  1SPI A;  1IMB A;  2HZL A;  2IA4 A;  3FXU A;  2DYX A;  2F34 A;  1B7U A;  1MDP 1;  4TQU Q;  3ILT B;  1PB7 A;  2RC9 A;  3OSQ A;  3FAT A;  3SZP A;  1RYO A;  2ZZX A;  2PCR A;  4H45 A;  2WEF A;  4GQO A;  4H5F A;  1FPE A;  4MNP A;  1MXX A;  1YZ0 A;  2HCA A;  2OBG A;  2ANJ A;  2UVI A;  2FVZ A;  4LON B;  5ITP A;  1YTV A;  4NQ8 A;  2I49 A;  2Y7K A;  4NF4 B;  1LBB A;  2AL5 A;  1Q35 A;  2F3B A;  5DW8 A;  1B58 A;  3RLF E;  3OO7 A;  3KOT A;  5HPQ A;  4JDF A;  4YB6 A;  1PDA A;  1B3H A;  2GQ1 A;  3PMX A;  4JWO A;  4PCD A;  2QS4 A;  3DP8 A;  3V89 B;  1I69 A;  4U1Z A;  3TUS A;  4GWZ A;  1NH7 A;  4I3Y A;  5KCJ A;  2F36 A;  4EXK A;  4IY6 A;  4K3F A;  4OQO A;  3MP1 A;  4G8M A;  4IO5 A;  4ZEC A;  3VVD A;  4NF5 A;  1PC3 A;  5H8H B;  4U23 A;  4X48 A;  1SDX A;  3OD7 A;  4POX A;  3G3H A;  4NWD A;  4N6P A;  5CMB A;  1B5I A;  2ZNT A;  4PE3 A;  2F3D A;  3I5O A;  3FXR A;  1OVT A;  4PQJ A;  3MQ9 A;  3MUQ A;  1MXU A;  4U4X A;  4ISU A;  2CZI A;  3MPL A;  4JB7 A;  2GH9 A;  3TPA A;  1CNQ A;  3MYU A;  3FJG A;  3G3K A;  4XTC Q;  3E79 A;  4ZEF A;  4BDN A;  4H8J A;  2A5S A;  2A5T A;  3PV0 E;  1NUW A;  3O66 A;  2DVC A;  3L6G A;  2P3V A;  4QSD A;  5ICQ A;  2JJK A;  2RF1 A;  3IAZ A;  4PTK A;  3KN7 A;  2QS2 A;  3IO4 A;  4WXJ A;  4GIZ A;  3CFZ A;  2HAV A;  3MVW A;  4O7I A;  4JVC A;  1LST A;  5I84 A;  4HE0 A;  2OWT A;  1I6A A;  2DDK A;  3RPW A;  1II5 A;  3KOS A;  3T0J A;  2ZYO A;  3NOH A;  1O7T A;  4MHF A;  4RPN A;  1FPG A;  2PVU A;  4OXV A;  5I57 A;  4P47 A;  1FPF A;  2VP1 A;  2FHY A;  4FAT A;  4OHN A;  3K1N A;  2E0S A;  5L8D A;  5I2K B;  4XXU A;  2FBP A;  4GL0 A;  2GHB A;  4YB7 A;  1GR2 A;  1G0H A;  2I4B A;  1MQJ A;  1IMF A;  3ZKL A;  1NNP A;  4DCY A;  2YLN A;  3U93 A;  1XT8 A;  4EXL A;  1UQW A;  4UAC A;  1FBF A;  3M3L A;  4XEQ A;  1FBC A;  1IEJ A;  3PD9 A;  4UAB A;  4JWX A;  1VSO A;  2O1M A;  1S7Y A;  2DWI A;  3EQ1 A;  1AOV A;  4KD5 A;  2CZL A;  4IR8 A;  1LBW A;  2ZXT A;  3S9M C;  3F11 A;  5B70 A;  1B46 A;  2CZH A;  2I3V A;  4NF4 A;  1B40 A;  3H6W A;  3H6U A;  1JW1 A;  1IQ7 A;  2AIX A;  4G68 B;  3OSR A;  4DE8 A;  2B65 A;  4Z0I A;  2ALU A;  1UTB B;  1N3X A; 
#chains in the Genus database with same CATH homology
 1POY 1;  4OEV A;  4TLM B;  1TWY A;  1WVJ A;  1ANF A;  2DE4 A;  2ESN A;  3S9E A;  3DP4 A;  3KJT A;  3FZV A;  1N3W A;  4E0X A;  3PUZ E;  1QUK A;  3IB1 A;  3SER A;  3IR1 A;  4ONY A;  4P0G A;  4QF9 A;  1M5B A;  5DVI A;  4NTL A;  1OVB A;  2FA7 A;  2Y7W A;  3KSX A;  3C31 A;  4Q0C A;  1BKA A;  2VHA A;  1URD A;  3A09 A;  3VVE A;  1QW0 A;  1MDQ A;  2Q89 A;  1IXH A;  1Y3Q A;  3C34 A;  3MZ1 A;  5H8N A;  3UIF A;  3FVO A;  5HM4 B;  5I58 A;  1MM7 A;  1JEV A;  1R1N A;  3SDF A;  4OES A;  4JSD A;  3WAE A;  2PT2 A;  5ELV A;  1D9V A;  1R6Z A;  3D4G A;  3ZKK A;  1PEB A;  1B2H A;  1HSE A;  3H7M A;  3T9H B;  4Q30 B;  3N5L A;  3DP6 A;  2O6A A;  4OMB A;  1FQB A;  5BUU A;  5CC2 A;  1B3E A;  4P0I A;  3O28 A;  2R71 A;  3DEL B;  1MH4 A;  4H1X A;  4M4G A;  4ELR A;  1SW4 A;  2UXA A;  4IO4 A;  1R9Q A;  4G4P A;  1B3L A;  2F7C A;  2YJP A;  5JTY A;  3CR9 A;  3N94 A;  2OLB A;  1QUL A;  4RPO A;  1DOT A;  4GLI A;  5TP9 A;  3EHS A;  3PUY E;  4L17 A;  3TCG A;  1KWH A;  1JQF A;  1MXV A;  2QPQ A;  5M2V A;  3T96 B;  1M5C A;  1QKA A;  1ELJ A;  3K1P A;  2UVG A;  3LC8 A;  4R6Y A;  1LAH E;  1I6B A;  3ZSF A;  4F2O A;  3GZG A;  1DPP A;  1SD3 A;  2XXV A;  4GF8 A;  1I6Q A;  1MQG A;  3SEW A;  4JBZ A;  4RNS A;  4PE5 B;  4ECF A;  1XS5 A;  1P1Q A;  4QRZ A;  4XKQ A;  1QUJ A;  3A3C A;  5H8F B;  3VLU A;  2DWA A;  5DT6 A;  3VVF A;  4BDQ A;  5AA2 D;  3C36 A;  3MC2 A;  4YKI A;  4IO7 A;  5F1Q A;  3PGF A;  3QYT A;  2V84 A;  2XXH A;  4R72 A;  2DP8 A;  2G93 A;  3MP6 A;  5K2Y A;  2HZK A;  2Q2C A;  3W15 C;  4AQ4 A;  2FYI A;  1AIV A;  1FTL A;  3CSB A;  3PUW E;  3SEY A;  1ZIU A;  3O6H A;  5L9O A;  1MXW A;  3IB0 A;  3GBB A;  3Q27 A;  5FHO A;  3RTF B;  2GRV A;  2O7U A;  3Q29 A;  1DTZ A;  1N76 A;  1QUI A;  4FE8 A;  4DLD A;  3JZJ A;  4GRK A;  4LZ7 A;  4ZEI A;  3E9X A;  2P1S A;  3R6U A;  1SI1 A;  5CI5 A;  2H9B A;  1VFD A;  3S9L C;  4I8C A;  2G29 A;  4KR5 A;  2PX1 A;  4XKR A;  1MRP A;  3SES A;  4PFU A;  1SQY A;  1NNF A;  3FD3 A;  2DE3 A;  4WKM A;  3OO8 A;  1ZTY A;  3HO7 A;  4GVO A;  4OFO A;  4THI A;  5ISU A;  2UVJ A;  1UTH B;  1ZBM A;  3FJ7 A;  3HHG A;  2QMW A;  3MAM A;  4H0W A;  4YIC A;  4BDL A;  1PBP A;  1US5 A;  2I0C A;  1SW2 A;  2O69 A;  3I3V A;  4F1Y A;  2RIN A;  4BLA A;  4F29 A;  4RY1 A;  1BTJ A;  1XVY A;  4AB5 A;  2Y7P A;  3U94 A;  3PU5 A;  1FQA A;  4NF5 B;  4NF8 A;  5AA4 B;  4DIG A;  5AA3 A;  1FW0 A;  2XXT A;  4AB6 A;  1NNK A;  1P1O A;  2NUV A;  1LLS A;  3OMB A;  5EHS A;  2HEU A;  3IL1 B;  2ABH A;  3H3G A;  3IOR A;  3S9N C;  1MPD A;  3RNN A;  1IXG A;  4U22 A;  4Q8R A;  2Z8F A;  2P2A A;  4F3G A;  4KYE A;  4H67 A;  1B7Z A;  1Y4T A;  4X9T A;  5TU0 A;  4KI0 E;  3BFU A;  3CRB A;  4EF2 A;  1UIU A;  3PPN A;  4LP2 B;  4H5G A;  4RXL A;  5AA2 A;  3KBR A;  4KCD A;  5FHN A;  5LOM A;  4F3S A;  1Y3P A;  2XXW A;  4GXA A;  1O64 A;  1S9T A;  4LA9 A;  4R9G A;  1WDN A;  1B32 A;  2QSX A;  3R7X A;  1URS A;  1OLC A;  3IOU A;  1M5D A;  3P7I A;  4KFQ A;  4BDM A;  2OZZ A;  1JVY A;  3A3U A;  3TCH A;  1MPC A;  2F8D A;  3W9W A;  4QFP A;  1BLF A;  1URG A;  1J1N A;  3OOA A;  1D3K A;  2I58 A;  2W7Y A;  3OEL A;  5EHM A;  3VXC A;  3PPO A;  3RN8 A;  4O3B A;  3BBR A;  3OEN A;  3K4U A;  1AL3 A;  2H25 A;  2QS1 A;  1IIW A;  1A8E A;  2RCA A;  3KEI A;  4R9F A;  3TTR A;  4X1D A;  2ONS A;  4DDD A;  4R75 A;  3C4M A;  3G3F A;  4FIM A;  1VE4 A;  3FAS A;  4MLV A;  4EQ7 A;  1LBC A;  3K01 A;  3EPE A;  4H8I A;  3MP8 A;  3MVY A;  4GOT A;  1MXZ A;  1IXI A;  4Q5T A;  2Q88 A;  1LFH A;  3KG2 A;  4DZ1 A;  1OQH A;  4IGR A;  5DEX A;  1HSL A;  1D9Y A;  2NXO A;  1N7W A;  3IOV A;  4GXS B;  4YAH X;  2O68 A;  3CG1 A;  1B0H A;  4C0R A;  1GGG A;  2Z23 A;  1LCF A;  3PPP A;  4KCC A;  4QSE A;  3N6T A;  1MPB A;  4OFJ A;  4NWC A;  1H43 A;  2DWJ A;  5H8F A;  3FVK A;  2GHA A;  4ZE8 A;  1B1H A;  4U2R A;  2RC8 A;  5L9S A;  2P0S A;  3TQL A;  4ZZA A;  2I0B A;  3FVG A;  4OFL A;  2V25 A;  4E0W A;  4I1D A;  1ATG A;  3AXF A;  3O6G A;  4PP0 A;  4M1V A;  2D21 A;  2F35 A;  3D4C A;  4KQP A;  1FTM A;  1DPE A;  5F7V A;  3T9U A;  3IJO B;  2X7P A;  4LZ5 A;  2D5W A;  5H8H A;  1FQE A;  1D4N A;  3FV2 A;  3LSX A;  4HCY A;  4YU0 A;  3KGC A;  4FOR A;  5CMC A;  1AMF A;  3RGY A;  3T9X B;  1VR5 A;  1P1N A;  2V93 A;  3PMV A;  2R9J A;  4OZ9 A;  2NOO A;  2Q2A A;  2AYS A;  2F78 A;  4GD5 A;  5CBS A;  3W9V A;  4KPT A;  3V5A A;  2PT1 A;  4FJP A;  4RYA A;  1HSJ A;  4YMB A;  5I57 B;  1OLA A;  1MY4 A;  1JNF A;  3MJN A;  2HZL A;  2IA4 A;  4BDO A;  4OWD A;  3VV5 A;  3H4Z A;  1RKM A;  3FXU A;  2DYX A;  2F34 A;  1POT A;  1B6H A;  4OET A;  1B7U A;  1MDP 1;  1Y20 A;  1N7X A;  1B9J A;  1USY E;  4TQU Q;  3RY3 A;  4PET A;  3BFT A;  1LB9 A;  3IJX B;  5IKB A;  2F97 A;  3ILT B;  4HCW A;  3MZB A;  1PB7 A;  2RC9 A;  3H6T A;  3OSQ A;  3FAT A;  1H45 A;  1RYO A;  5KDT B;  1Y3N A;  4YKJ A;  1TXF A;  5TPA B;  1QKB A;  2RC7 A;  1SYH A;  4FAJ A;  3RT6 B;  2DWH A;  3QUJ A;  4I62 A;  3TAJ A;  3UN6 A;  2GFE A;  1QVS A;  3N6U A;  4EUO A;  4N13 A;  4LUB A;  5FHM A;  1AH5 A;  2REG A;  3HCQ A;  4O3C A;  1MY2 A;  1NKX A;  3U72 A;  4GQO A;  5CBR A;  4Z7E A;  1XHY A;  2VD2 A;  4H5F A;  4N07 A;  1EZP A;  1LGB C;  1H3D A;  1MXX A;  1Y1Z A;  2B3B A;  2V3Q A;  2OBG A;  2HCA A;  2BJJ X;  4F18 A;  2ANJ A;  3H6V A;  2F5X A;  4OEN A;  2V3U A;  1LAF E;  4IO3 A;  2UVI A;  4ELO A;  5AE4 A;  5ICQ A;  1MY1 A;  5KZT A;  3LSF B;  3TQW A;  1B4H A;  1TFA A;  2ZNU A;  1SW5 A;  4LON B;  3FUZ A;  4U4S A;  5ITP A;  1YTV A;  1DMB A;  1BP5 A;  3LUY A;  3K6U A;  2I49 A;  2UYE A;  4R2B A;  5DTB A;  1SYI A;  2Y7K A;  1FQF A;  3TEP A;  3K2D A;  4NF4 B;  2XHD A;  1LBB A;  4LQ2 A;  2AL5 A;  1IUD A;  4KYD A;  2QS3 A;  1Q35 A;  3O2A A;  1H44 A;  4P11 A;  3FXQ A;  1B3F A;  1N84 A;  1B58 A;  2V3T A;  3IO6 A;  5HBC A;  3USD A;  1EZ9 A;  2O7I A;  3Q28 A;  5TP9 B;  3RLF E;  4MLQ A;  1B4Z A;  1GTK A;  3OO7 A;  4G77 A;  2H98 A;  3KOT A;  2UYF A;  3CG3 A;  3BKI B;  2NVU B;  3KJ7 A;  3G3G A;  5HPQ A;  4JDF A;  3HV1 A;  4YB6 A;  5JEI A;  3VLW A;  2I4C A;  1BIY A;  1PDA A;  1UTB A;  3EHT A;  3PD8 A;  1B3H A;  1P1W A;  4ZED A;  3K1M A;  4RJZ A;  3VXB A;  3PMX A;  4JWO A;  3TFL A;  4UA8 A;  3WAF A;  2XX9 A;  3O29 A;  2QS4 A;  2REJ A;  3VFJ A;  1IIT A;  2VD3 A;  1JET A;  3DP8 A;  3O97 A;  4KHZ E;  1N04 A;  3V89 B;  2ZYK A;  4F3B A;  1I69 A;  3PUX E;  4U1Z A;  4YB5 A;  2Y7R A;  3TUS A;  1NH7 A;  1H76 A;  3GLB A;  1EZO A;  4YKK A;  1B3G A;  5KCJ A;  1MH3 A;  1DSN A;  2XXP A;  1FTJ A;  4QFO A;  1YCJ A;  2F36 A;  3ONM A;  4EXK A;  4IY6 A;  4K3F A;  2WKY A;  3U93 A;  2PBW A;  3QUF A;  4OQO A;  1GV8 A;  2E1S A;  3MP1 A;  3PPQ A;  4F19 A;  2H4I A;  4G8M A;  2O1L A;  3OO6 A;  4IO5 A;  4NED A;  5I59 A;  1US4 A;  4GL8 A;  3T93 B;  4F31 B;  4ZEC A;  1A7L A;  1EH3 A;  1MS7 A;  1LFG A;  2ZMB A;  3MBP A;  4OTE A;  1S50 A;  2OK2 A;  3LSL A;  2QMX A;  3FV1 A;  2DS9 A;  3K02 A;  5DVF A;  3TYH A;  4NF5 A;  1PC3 A;  3GBA A;  5AA1 A;  2H99 A;  3UP9 A;  3UA8 A;  3VVD A;  4DXB A;  5FTI A;  5H8H B;  4U23 A;  4X48 A;  1SW1 A;  4ZEB A;  4NF6 B;  4F1V A;  4R74 A;  1SDX A;  3OD7 A;  4LAT A;  4POX A;  4U21 A;  4ESX A;  3TTL A;  4PFY A;  3S4U A;  5I2N A;  4HS7 A;  4BDR A;  3K6V A;  3TCF A;  4H6D A;  3G3H A;  4OVJ A;  3MZ9 A;  1TFD A;  1B05 A;  2F7B A;  4QFL A;  5I56 B;  4RK9 A;  4F22 A;  1PB8 A;  3L6H A;  3CFX A;  1OIB A;  3Q25 A;  4N6P A;  3B7D A;  4NWD A;  4POW A;  5BWJ A;  1M5E A;  1SBP A;  3RPW A;  2XXI A;  2KLF A;  3M3K A;  3H03 A;  2O51 A;  3O9P A;  5CMB A;  1B5I A;  2ZNT A;  3G3J A;  4NF8 B;  5AA4 A;  1ZJL A;  1MQI A;  2XD2 A;  3GXA A;  5H8Q B;  1YAE A;  2Q9T A;  3FVN A;  3B6T A;  3FXR A;  1OVT A;  3I5O A;  4PQJ A;  4F39 A;  3MQ9 A;  5I2K A;  3M3F A;  1B52 A;  5K2X A;  1FCK A;  3MUQ A;  1JW4 A;  1MXU A;  4H65 A;  3G3I A;  4U4X A;  4ISU A;  3UK4 A;  1YPN A;  2PYY A;  3OEM A;  4QFK A;  2ONR A;  4WED A;  1Y4C A;  4XKN A;  4I9D A;  1XVX A;  4YKP A;  3UGW A;  4GWO A;  4TLL B;  3M8U A;  1LCT A;  1LAG E;  4LVQ A;  4O3A A;  3RUM A;  3THI A;  3MPL A;  2DSF A;  3EHU A;  2GH9 A;  2QRY A;  2HAU A;  1CE2 A;  4JB7 A;  4OEU A;  3RQT A;  3TPA A;  1Y9U A;  3B6W A;  5I56 A;  3UOR A;  3C9H A;  3T66 A;  5I2N B;  1FTO A;  2AL4 A;  1L5T A;  3RT8 A;  3KSJ A;  3FJG A;  3JYR A;  3TTK A;  3G3K A;  3K6W A;  3I6V A;  4XTC Q;  4ELQ A;  4ZEF A;  2F7A A;  3EN3 A;  1UTH A;  5CMM A;  4F2Q A;  3IK6 B;  4BDN A;  5H8Q A;  5JK4 A;  3IX1 A;  3KZG A;  5DVJ A;  2XXU A;  3TTN A;  4H8J A;  4R6H A;  3U8Q A;  2R6G E;  1M5F A;  4GFR A;  3TZA A;  2A5S A;  3ODB A;  2A5T A;  1Y1M A;  2VGQ A;  3C35 A;  1ZKB A;  3PV0 E;  4G8H A;  1MXY A;  1QJM A;  2OCU A;  2XD3 A;  1P99 A;  3IB2 A;  3K0V A;  2DVC A;  3O66 A;  3E3K A;  3QAX A;  4G8N A;  4IY5 A;  4LQ5 A;  4EF1 A;  1B51 A;  3L6G A;  3SEV A;  3ECR A;  2XXQ A;  2A5T B;  3FGS A;  4LZ8 A;  4QSD A;  4ND9 A;  4QSC A;  3SET A;  4R73 A;  1SVX B;  2RF1 A;  3KN8 A;  3TTM A;  4EQ9 A;  3C32 A;  3IAZ A;  1WOD A;  3CIJ A;  3KN7 A;  4EQB A;  5I59 B;  1P1U A;  2QS2 A;  3IO4 A;  4WXJ A;  1TT1 A;  5CMK A;  1Z7N E;  4GIZ A;  4KYS A;  3OXN A;  3CFZ A;  3HHF A;  5I58 B;  5A5X B;  2H5Y A;  3QSL A;  1CB6 A;  2HAV A;  1EU8 A;  2UVH A;  3VDF A;  1ZU0 A;  2OJT A;  3MVW A;  3PUV E;  5IAI A;  1NH8 A;  1JW5 A;  1N0T A;  2Y7I A;  4WEP A;  2Z8E A;  1OQG A;  5I84 A;  1LST A;  3SEU A;  1IZ1 A;  1PB9 A;  4MF3 A;  3K6X A;  1LAX A;  2F6G A;  3SEX A;  2OWT A;  5EYF A;  1I6A A;  2LAO A;  3PMW A;  4PFW A;  1II5 A;  3KOS A;  3Q26 A;  2ZNS A;  3OO9 A;  2HXW A;  1ZMG A;  2ZYO A;  4ZZE A;  2XXR A;  1O7T A;  3CI8 A;  4QHQ A;  3MWB A;  3DLN A;  3TDJ A;  4OYV A;  4RPN A;  3CVG A;  2Y84 A;  2PVU A;  3IOW A;  4EDP A;  4C1T A;  3H06 B;  3DM0 A;  5J1D A;  4JXI A;  3MW0 A;  4OXV A;  3RTW B;  3TEL A;  5I57 A;  2DQV A;  2VP1 A;  1JVX A;  4DCX A;  4FAT A;  3ILU B;  4YMA A;  4OER A;  4OHN A;  5H8N B;  3K1N A;  2E0S A;  1FTK A;  1PBQ A;  3N26 A;  5L8D A;  1NFT A;  3T9V A;  1VFE A;  5I2K B;  2OWS A;  2THI A;  1GVC A;  1SI0 A;  1O63 A;  5ITO A;  4XXU A;  4MFI A;  2VOZ A;  2Q8J A;  3TMG A;  4GL0 A;  1XOC A;  4FEB A;  3SKP A;  2FNC A;  4DXC A;  4JWY A;  2GHB A;  3K00 A;  3PPR A;  2YPN A;  1GR2 A;  4NF6 A;  4YB7 A;  1UIV A;  3MVZ A;  4F1U A;  3QXM A;  4X1B A;  3VE1 B;  5H8S A;  2I4B A;  3TOD A;  2X26 A;  3MPK A;  3FIR A;  4FED A;  5FTH A;  3LBS A;  4ESW A;  1MY0 A;  3T22 A;  2IEE A;  5CRY A;  1MQJ A;  1MY3 A;  4DXU A;  4R6K A;  3ZKL A;  3O6I A;  3LSW A;  1A54 A;  4JSO A;  1RYX A;  1B1X A;  5JTY B;  1FQC A;  1T0K A;  1NNP A;  4IB2 A;  2YLN A;  5L9M A;  2QL3 A;  3V8X B;  4DCY A;  4F3P A;  1NL5 A;  1R9L A;  1A55 A;  2X7Q A;  3HN0 A;  1XT8 A;  2DXR A;  2HFB A;  3G7W A;  5DEX B;  3B6Q A;  1B5H A;  4G68 C;  2HQ0 A;  2O84 X;  3KN3 A;  1UQW A;  4QFN A;  3C33 A;  1MQH A;  4UAC A;  4EXL A;  2I3W A;  4FEC A;  3M3L A;  2F6P A;  2XX7 A;  3FJM A;  3CFL A;  3IOT A;  4RK2 A;  3U92 A;  4C1U A;  2CMO A;  4G2Z A;  1ZLQ A;  4HTG A;  5DYH A;  4ZE9 A;  2RCB A;  1NMU A;  3V83 A;  1FQD A;  4NE4 A;  1IEJ A;  3PD9 A;  4JWX A;  2I48 A;  5ICT A;  1VSO A;  3TKD A;  3U1O A;  2O1M A;  1LB8 A;  1MQD A;  1S7Y A;  1B7H A;  1F9B A;  2DWI A;  2I6E A;  5A5X A;  2ZYN A;  4MH5 A;  5TPA A;  4IO2 A;  5KCJ B;  3EQ1 A;  1OMP A;  4HW8 A;  3QK6 A;  1B0L A;  3LR1 A;  3ZS6 A;  1AOV A;  4KD5 A;  2CZL A;  3OEK A;  5CM6 A;  2M8C A;  2RKM A;  3E4R A;  5B7D A;  3HST A;  2ZXT A;  1A99 A;  4NMY A;  3E13 X;  2QJE A;  4TOZ A;  2XXX A;  4U1O A;  4XKP A;  4ZS9 A;  3S9M C;  1A40 A;  3F11 A;  5AA2 B;  1B46 A;  4IO6 A;  2I3V A;  3EF7 A;  2Z22 A;  2DOJ A;  5B70 A;  3HPI A;  4NF4 A;  1B40 A;  1LFI A;  2DXY A;  2DVZ A;  3H6W A;  4XIG Q;  3R26 A;  1XC1 A;  1JW1 A;  3H6U A;  3JV9 A;  2D3I A;  1A8F A;  1DTG A;  1USY H;  3KFM A;  1IQ7 A;  2AIX A;  1MM6 A;  2B3F A;  1JEU A;  3CSG A;  4G68 B;  2DE2 A;  3OSR A;  4IGT A;  3QIM A;  3VLV A;  2NWJ A;  4ELP A;  3S2V A;  2ONK E;  4ZEK A;  4DE8 A;  2XXY A;  2B65 A;  1IXC A;  2Z8D A;  4PFT A;  4Z0I A;  5KDT A;  1Z7M E;  4ZDM A;  4G68 A;  2ALU A;  1UTB B;  2ZYM A;  1N3X A;  4RA1 A;  4YZZ A;  2XX8 A;  1MG1 A;  1NNT A;  1Q1K A;  4MBP A;  4R2F A;  1B5J A;  2PMS A;  3MVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...