1JQFA

Human transferrin n-lobe mutant h249q
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSQTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRANSFERRIN
publication title Ligand variation in the transferrin family: the crystal structure of the H249Q mutant of the human transferrin N-lobe as a model for iron binding in insect transferrins.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2001-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1jqfA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1jqfA02
3CIJA 4G4PA 3ODBA 1YAEA 3T22A 2R71A 4H5GA 1AL3A 3QAXA 2UVHA 2REJA 3KSJA 3IL1B 5DEXA 3N6TA 4H65A 1LAGE 3V89B 4NF5B 3T9UA 3G3FA 1JW1A 4HCYA 2THIA 1QUKA 2G29A 1A99A 3RN8A 4LQ2A 1NNKA 1VFEA 2YJPA 2F36A 4RA1A 4NF4B 3MZ1A 1PBQA 3PU5A 3DM0A 1S50A 3C36A 1ZIUA 3MPLA 2DE2A 3QUFA 2A5TB 3RUMA 3K6UA 1N04A 4FJPA 1SYIA 3LSFB 3T96B 4ZE8A 3TZAA 4EF2A 4Q5TA 1SD3A 4U23A 4GWOA 1D9VA 2OK2A 3B6QA 1B58A 4DXCA 4ZEDA 4Q0CA 2XD2A 1L5TA 1H3DA 1POTA 2G93A 3H6TA 3S4UA 2DP8A 3Q29A 1J1NA 4ESWA 2GHAA 3G3IA 2M8CA 3PPRA 2XD3A 3K00A 4LATA 2OLBA 2QMXA 3N6UA 2DXRA 1R9QA 1B3HA 3Q25A 4M1VA 2V3UA 3K1PA 1UTHB 3O66A 1Z7NE 1XT8A 3MVZA 4RNSA 4R75A 2QS2A 3Q27A 2F35A 4M4GA 3M3FA 3MP1A 3N5LA 4WKMA 4YB5A 3VXBA 4JXIA 1SW4A 3CG1A 4PFTA 4EXLA 5I59A 2R9JA 3I6VA 1B5HA 3CR9A 3IJOB 4MFIA 1QW0A 5H8SA 1MQIA 2WKYA 3S9EA 4F2OA 2DOJA 4QRZA 3E9XA 4F31B 2Q2CA 4IY6A 4RPNA 4G8MA 3JYRA 4G68C 1MPDA 3KJTA 3O6IA 4ZEBA 4MF3A 2O1MA 2Y84A 3RY3A 3R7XA 1VE4A 2O84X 3UN6A 2NVUB 3KOSA 3CRBA 4GQOA 2NWJA 4LA9A 4F29A 5B7DA 3E3KA 1LGBC 1LFGA 5K2XA 3HN0A 4OHNA 2ZYMA 2H9BA 3FV2A 4OETA 1Z7ME 3TTMA 1AOVA 4ONYA 3JZJA 3TFLA 1GVCA 1SVXB 1MQHA 5DYHA 1XOCA 3TELA 3H06B 3HO7A 5H8NA 1MXVA 3FIRA 2B3FA 4BDOA 1IITA 2I4BA 2OZZA 1MY0A 4X9TA 1ANFA 4QFNA 1B5JA 3U92A 2O6AA 3LBSA 4NTLA 2ESNA 5EHSA 4XKNA 3I3VA 1DMBA 4N07A 3OSQA 4Q8RA 2XXUA 4FE8A 3RT6B 2RCBA 1HSLA 4I8CA 2HAVA 4WEPA 4JWYA 4ISUA 4ZEIA 4F39A 2I6EA 2FYIA 3B6TA 1OLCA 4ZDMA 3B7DA 4O3CA 4U21A 1AIVA 1ELJA 1EU8A 2ONRA 2YPNA 1FQFA 3DLNA 1Y1MA 4G8NA 1AMFA 4RK9A 3EQ1A 3UK4A 1Y4TA 4JDFA 4EF1A 1URDA 1JEVA 1UTBB 2P1SA 3OEMA 1URGA 3IK6B 3FVOA 4GVOA 4GD5A 4G2ZA 1S7YA 2NXOA 4IY5A 3OO9A 1MH3A 5KDTB 4LQ5A 5KZTA 3SDFA 1MPBA 1N84A 5M2VA 3FJMA 4WXJA 1H44A 3N94A 3PPOA 3QK6A 4E0XA 3RNNA 1MRPA 1VSOA 3TEPA 2O51A 3TCGA 2B3BA 1ATGA 1H76A 5KCJB 2PVUA 5I56A 4IO5A 4OERA 1PEBA 2RKMA 5EYFA 3W9VA 3MAMA 3PPNA 2YLNA 3PUZE 1MDQA 2REGA 3KZGA 4NF6A 4BDNA 3A3CA 4JB7A 3C34A 2Z8EA 2I0BA 4IO6A 3K2DA 3PMVA 5I58B 2NUVA 3USDA 2ZNSA 2ONKE 4RXLA 1Y4CA 3KN7A 1M5DA 1B46A 4X1BA 5H8QB 2AL4A 4DXUA 5TPAB 5CC2A 3PUVE 1EH3A 3KGCA 1I6QA 4P11A 1MG1A 2F6PA 1OMPA 4GLIA 4N6PA 3SEVA 2PMSA 4U2RA 4DIGA 2VOZA 5JK4A 2X7QA 3QUJA 3B6WA 4ZEFA 3MJNA 5ICQA 5EHMA 3OOAA 3O9PA 1JETA 4POWA 1B1XA 1GGGA 2F8DA 3IOVA 2I3WA 5JTYB 1LLSA 1B1HA 4R9FA 2E1SA 4DZ1A 5F7VA 3S9MC 3EHUA 3VLVA 3EPEA 3VFJA 1TFDA 1N3XA 3IORA 4F2QA 3HPIA 2O69A 4XKQA 3MVYA 2RINA 3FXRA 2V3TA 4N13A 3RT8A 4OEUA 1NFTA 1B3FA 1QULA 1SYHA 3O97A 3FV1A 5TP9A 1MY2A 3W9WA 3DELB 3MPKA 4MLVA 4NMYA 2OWTA 4NWDA 4KI0E 4AQ4A 1H43A 3ZKKA 1SDXA 3EHTA 2XXYA 3UA8A 5AE4A 1IQ7A 4DCYA 1OQGA 4YAHX 2D21A 4KPTA 3V5AA 1Y3QA 2D5WA 3OENA 3G3GA 1QJMA 2V3QA 1QVSA 4C1UA 3TAJA 1ZU0A 1O64A 4OTEA 3T9VA 2HCAA 3MP8A 1B9JA 4R74A 4F1VA 1IIWA 1MY4A 3ILUB 2Z8FA 4TQUQ 5J1DA 1JNFA 3SKPA 4KD5A 2HQ0A 4YZZA 1FCKA 4ECFA 5AA2A 2H25A 2V84A 2XXWA 2UVGA 2OBGA 4O3BA 1PDAA 5IAIA 2VP1A 3OO6A 2AYSA 1DTGA 3FATA 4BDLA 4YKPA 4P0IA 1BTJA 1MQDA 2Z23A 4G77A 4R2FA 2XHDA 4OFOA 3TODA 1LB9A 3OSRA 4MLQA 1Y20A 2XX8A 4ND9A 3KBRA 5I57A 3D4GA 2CMOA 3CVGA 1R6ZA 1MPCA 3K1MA 4IO3A 1NNPA 2Q9TA 3PMWA 4IGTA 4F1YA 1SQYA 4FEBA 5DVJA 1YCJA 3RQTA 3TUSA 4O3AA 3Q26A 3PGFA 1CB6A 1UQWA 3TCHA 4KCCA 4G68A 4KHZE 4NEDA 4KYDA 4PFUA 4R6KA 1RYXA 3FVNA 4C1TA 2ZNTA 3RLFE 2LAOA 2RC9A 3WAEA 5I2NB 3GBBA 2XXQA 3TMGA 3C32A 3H4ZA 1Q35A 1JVXA 1NH8A 3IJXB 3SETA 3VDFA 3SEXA 1XVXA 2HAUA 1URSA 4FAJA 3LSWA 4OVJA 1US4A 3EHSA 1UIVA 2DVZA 1P1UA 4KYEA 4YB7A 3TTNA 1A8EA 1LBCA 3K02A 1M5BA 4I9DA 1B05A 4L17A 2DYXA 4NWCA 3UP9A 2E0SA 3KSXA 2QMWA 3BFUA 1A40A 2VD3A 3EF7A 2QPQA 5H8FA 2UVJA 1OLAA 5DVIA 4F3PA 3O28A 2UYEA 1N76A 3CFXA 3VE1B 1IUDA 2UYFA 3K6XA 3H6UA 1D9YA 3GZGA 1SI1A 5JEIA 3AXFA 3IR1A 2DE3A 4H6DA 2XXPA 3MBPA 4RJZA 1WVJA 3M3KA 4IGRA 4Q30B 4AB5A 3PUWE 3TDJA 2O1LA 4LZ7A 3OO7A 3P7IA 1GTKA 3V83A 4U1ZA 4NF5A 1TFAA 3E4RA 4RPOA 5HBCA 1LAXA 2P0SA 3U72A 2O68A 5A5XB 1MXWA 1US5A 3KJ7A 4HW8A 2VD2A 3RTWB 1FTLA 3C31A 5IKBA 3G3HA 4NF4A 3R6UA 3H7MA 2AIXA 3MC2A 1P1OA 2W7YA 4KR5A 4PP0A 3VVDA 2RC7A 2P2AA 4KCDA 1WDNA 2GH9A 2A5TA 3OELA 1NKXA 2DQVA 1LFIA 1R9LA 5AA4B 1I6BA 3QYTA 2Y7IA 3W15C 2F6GA 2VHAA 4MH5A 2X26A 3MW0A 3HSTA 4XKRA 2XXTA 3TTLA 5FTHA 5I2KB 3ECRA 2OWSA 1MXXA 1OQHA 2XX9A 3UGWA 4P0GA 3ONMA 1FQCA 5ICTA 4KFQA 3O6HA 4BLAA 3S9NC 1LAFE 3IO6A 1M5FA 5L9OA 3G3JA 4ZEKA 5DTBA 1MXZA 1RYOA 4BDQA 4FIMA 2I48A 4NF8B 3U8QA 1UTHA 5H8HB 3IB0A 3IAZA 4IO2A 4TOZA 1XHYA 4EUOA 4LONB 3PPQA 5CRYA 1SW1A 4EQBA 4YKJA 1UIUA 1Y9UA 3VV5A 4LZ5A 4TLMB 1FQAA 5I84A 1LCTA 5DEXB 1FQDA 2ABHA 3MVWA 1N7WA 5CMMA 4GOTA 3TQLA 4R2BA 1VR5A 2Z8DA 5AA2D 3M8UA 4LUBA 4PFWA 1XVYA 2Y7PA 4F18A 3K6WA 3PUYE 3TKDA 3A3UA 2HXWA 1B0HA 4XIGQ 2D3IA 4F1UA 1B3GA 2XXXA 2DXYA 1YPNA 1B0LA 1KWHA 3FZVA 4FECA 4GXSB 3VXCA 4XTCQ 5HPQA 1DSNA 4XKPA 1TXFA 2DE4A 2BJJX 4OQOA 1B2HA 3T66A 2H98A 4OWDA 5L9MA 3IOWA 3SEWA 5LOMA 3FVKA 4DCXA 4E0WA 1MH4A 4QSEA 3KEIA 4R6YA 1B3EA 3FXQA 3R26A 3TTKA 2DWIA 3QXMA 1AH5A 3G7WA 1JW5A 1D3KA 1R1NA 2Q2AA 1LCFA 1N7XA 2UVIA 3CFZA 1M5CA 4LP2B 4OMBA 5I59B 2VGQA 4PETA 1FW0A 4U4XA 4TLLB 4OYVA 4H1XA 2XXRA 3BBRA 1MS7A 1DOTA 1SW2A 4ELPA 3FJ7A 2CZLA 4R6HA 4QSDA 1FTJA 2B65A 4X48A 3DP6A 1USYE 1FTKA 1H45A 1IXGA 3KG2A 3GXAA 3IOTA 5F1QA 4UACA 2DS9A 1UTBA 3ILTB 3IO4A 1SW5A 2O7UA 1NNFA 3OMBA 1II5A 4XXUA 4OFLA 1M5EA 5AA3A 1N0TA 2I49A 2QS4A 3M3LA 5KDTA 1JVYA 2PT2A 4I1DA 3FXUA 4YU0A 2XX7A 1USYH 4H5FA 3OXNA 1IXCA 1I69A 1MXUA 2F34A 4GFRA 1LFHA 4ELRA 4F22A 2AL5A 1YTVA 2Y7WA 1MM7A 1BP5A 2F7BA 2Y7KA 5KCJA 3CG3A 3IOUA 1XS5A 3IB1A 3C4MA 1EZ9A 5BWJA 5L9SA 3RGYA 3K6VA 4QSCA 2X7PA 4F3GA 4AB6A 2O7IA 4DDDA 1XC1A 2I58A 2H99A 1PC3A 2UXAA 2HFBA 2IA4A 2OJTA 1B32A 1A54A 5HM4B 2H5YA 5H8NB 4HS7A 3PV0E 1DTZA 1MDP1 5CMKA 3QSLA 2I0CA 1LAHE 2KLFA 5I58A 1EZOA 3O29A 4PE5B 1T0KA 4YB6A 4KQPA 2FA7A 2A5SA 4YICA 2PBWA 5ITPA 1HSJA 5H8QA 1HSEA 5TPAA 4YMBA 4LVQA 3GLBA 3L6GA 2Y7RA 1P1QA 4KYSA 4UA8A 2QS1A 4ZZEA 1FTOA 3ZSFA 5DVFA 1MQGA 5CM6A 3VVEA 1QUJA 3KN3A 1EZPA 3G3KA 3UIFA 4OZ9A 4OENA 3H6VA 3MZBA 3C33A 3LSLA 3U93A 2DSFA 2F5XA 3HV1A 5JTYA 4JSDA 3ZKLA 4JWOA 2HEUA 1OVTA 4EXKA 2DWJA 1BLFA 1BKAA 1B6HA 2RCAA 1QKAA 3KN8A 3U1OA 1SBPA 2RF1A 2ZYOA 4RYAA 4JWXA 1TT1A 1NNTA 3TCFA 2OCUA 4R73A 2QS3A 3BFTA 1TWYA 5ISUA 2ZMBA 1IZ1A 2QSXA 3LR1A 4R9GA 3H6WA 3E13X 2GFEA 1FQEA 3CFLA 3TPAA 2XXVA 3PMXA 3C35A 3FVGA 4DXBA 2QJEA 4F3BA 1B5IA 3GBAA 4U4SA 4Z0IA 5I56B 4OFJA 1A55A 2HZKA 1WODA 1ZKBA 2RC8A 2QRYA 1OVBA 3SERA 1DPEA 3H3GA 3FASA 5DT6A 3LSXA 5CMCA 4NF6B 4GIZA 4QFPA 3MP6A 4ZS9A 5K2YA 3OD7A 3T9XB 3PPPA 2GRVA 4EQ7A 4ELQA 4HTGA 1DPPA 3ZS6A 3JV9A 2DWAA 4JBZA 1A7LA 3I5OA 5AA1A 4F3SA 2H4IA 3HCQA 3N26A 2PX1A 2PYYA 4JSOA 4PQJA 1Y3NA 2F7AA 1IXIA 4I62A 3K0VA 4HCWA 4YKIA 4H0WA 2IEEA 5CI5A 3S2VA 2Z22A 1MXYA 1MM6A 4GF8A 1QKBA 4ESXA 4GL8A 2FNCA 1ZJLA 5B70A 3T93B 1B51A 5CMBA 3Q28A 1B7UA 2ALUA 4DLDA 1ZLQA 1P1WA 2GHBA 2DWHA 2F7CA 2F97A 4GRKA 3IB2A 3MUQA 4OEVA 4Z7EA 1Q1KA 3KOTA 4BDMA 2PT1A 4YKKA 1B40A 1LSTA 1PBPA 5CBRA 4PFYA 1IXHA 3QIMA 1BIYA 1O63A 3FD3A 3HHGA 3LUYA 3SEUA 5L8DA 3T9HB 1NH7A 1FTMA 5TP9B 2ZXTA 5I2NA 3C9HA 2NOOA 4THIA 1PB8A 1B52A 1JEUA 4OESA 3PD8A 4ZZAA 1B4ZA 3VVFA 3TQWA 2V93A 4NE4A 1IEJA 1P99A 1OIBA 1B3LA 3OO8A 1B4HA 5TU0A 1ZMGA 1VFDA 1JQFA 1S9TA 1FQBA 3MZ9A 3K4UA 3EN3A 4WEDA 2R6GE 1N3WA 1GR2A 3O6GA 2HZLA 4QFLA 1MY3A 1QUIA 4H67A 1GV8A 1ZBMA 4QFKA 3VLWA 5FHNA 4YMAA 3WAFA 4G8HA 1I6AA 1NMUA 4QF9A 5AA2B 3RPWA 3MWBA 1A8FA 4U1OA 4ZECA 4POXA 3MQ9A 1D4NA 1LB8A 4R72A 3K1NA 4DE8A 4FATA 4FEDA 4GL0A 3TTRA 3LC8A 3HHFA 4IB2A 3O2AA 5A5XA 3F11A 5ELVA 3TYHA 4LZ8A 3CSGA 3MVXA 1MY1A 5I57B 4GXAA 5ITOA 1LBBA 2V25A 3U94A 4EDPA 1PB7A 1PB9A 2I4CA 2XXHA 3IX1A 1CE2A 2Q88A 4EQ9A 3K01A 5AA4A 1F9BA 4OXVA 3PUXE 4K3FA 5CBSA 4QHQA 4U22A 3SESA 4G68B 2I3VA 2Q89A 3L6HA 1B7HA 3CI8A 5FHMA 4IO4A 3OEKA 3RTFB 4RY1A 4FORA 5I2KA 3DP4A 3V8XB 3FJGA 2Q8JA 3VLUA 3KFMA 2ZYNA 3PD9A 2ZNUA 4H8IA 2ZYKA 4QFOA 3A09A 2ANJA 1O7TA 4RK2A 2F78A 2QL3A 1P1NA 3S9LC 2ONSA 3H03A 5FHOA 4ZE9A 1POY1 4NF8A 3UORA 5H8HA 4C0RA 3SEYA 4IO7A 4F19A 1Y1ZA 3CSBA 2DVCA 5BUUA 1SI0A 3D4CA 1ZTYA 3BKIB 4H8JA 1B7ZA 3FUZA 3FGSA 4ELOA 2XXIA 5H8FB 4X1DA 5FTIA 1RKMA 1Y3PA 1NL5A 4BDRA 4MBPA 1MQJA 3THIA 3DP8A 1JW4A
chains in the Genus database with same CATH superfamily
3CIJA 4G4PA 3ODBA 1YAEA 4NAPA 3T22A 2R71A 4H5GA 1AL3A 3QAXA 5I5PA 2UVHA 2REJA 3KSJA 3IL1B 5DEXA 3N6TA 4H65A 1LAGE 3V89B 4NF5B 3T9UA 3G3FA 1JW1A 4HCYA 1FPKA 2THIA 1NUXA 1QUKA 2G29A 1A99A 3RN8A 5A5LA 4LQ2A 1NNKA 1VFEA 2YJPA 2F36A 4RA1A 4NF4B 1LBVA 3MZ1A 1PBQA 3PU5A 3DM0A 1S50A 3C36A 4NX1A 3RPLB 1ZIUA 3MPLA 2DE2A 3QUFA 2A5TB 3RUMA 1FPDA 3K6UA 4HE2A 2PFYA 1N04A 4FJPA 4O7IA 1SYIA 3LSFB 3T96B 4ZE8A 5LDZA 3TZAA 5ET7A 4EF2A 4Q5TA 1SD3A 4U23A 4GWOA 3CHGA 4MNCA 1D9VA 2OK2A 2HHMA 3B6QA 1B58A 4DXCA 1XI6A 4ZEDA 4Q0CA 2XD2A 1L5TA 1H3DA 1POTA 2G93A 3H6TA 1BK4A 3S4UA 2DP8A 3Q29A 4N6KA 1J1NA 4ESWA 2GHAA 3G3IA 2M8CA 3PPRA 2XD3A 3K00A 4LATA 2OLBA 2QMXA 3N6UA 2DXRA 1R9QA 4H45A 1B3HA 2QVUA 3Q25A 4M1VA 2V3UA 3K1PA 1UTHB 3O66A 1Z7NE 1XT8A 3MVZA 4RNSA 4R75A 2QS2A 3Q27A 5EQ9A 2F35A 4M4GA 3M3FA 3MP1A 5FBPA 3N5LA 4N15A 4WKMA 4YB5A 3VXBA 4JXIA 1SW4A 3CG1A 4PFTA 4EXLA 5I59A 2R9JA 3I6VA 1B5HA 3CR9A 3IJOB 4MFIA 1QW0A 5H8SA 1MQIA 1FTAA 2WKYA 3S9EA 4F2OA 2DOJA 4QRZA 3E9XA 4F31B 2Q2CA 4O8MA 4IY6A 4RPNA 4G8MA 3PTYA 3JYRA 4G68C 1EYJA 1MPDA 3KJTA 3O6IA 4ZEBA 4MF3A 4NF0A 4PCDA 2FVZA 2O1MA 2Y84A 3RY3A 3R7XA 4OA4A 1VE4A 2O84X 3UN6A 2NVUB 3KOSA 3CRBA 4GQOA 2NWJA 2V4CA 4LA9A 2P3VA 4F29A 5B7DA 3E3KA 4PBHA 1LGBC 1LFGA 5K2XA 3HN0A 4OHNA 2ZYMA 4MAGA 2H9BA 3FV2A 4OETA 1Z7ME 3TTMA 1AOVA 4ONYA 2WX9A 1NV6A 3JZJA 3TFLA 1GVCA 1SVXB 1MQHA 5DYHA 1XOCA 3TELA 3H06B 3HO7A 4G61A 5H8NA 1YYZA 1MXVA 3FIRA 2B3FA 3BIGA 4BDOA 1IITA 4XFEA 2I4BA 2OZZA 1MY0A 4X9TA 4MNIA 1ANFA 4QFNA 1B5JA 3U92A 2F3DA 1EYIA 2O6AA 3LBSA 4NTLA 2ESNA 5I7IA 5EHSA 4XKNA 4JVIA 3I3VA 1DMBA 4N07A 3OSQA 4Q8RA 2XXUA 4FE8A 3RT6B 2BJIA 1HSLA 2RCBA 4NHBA 4I8CA 2HAVA 4WEPA 4JWYA 4ISUA 4ZEIA 3D1RA 4F39A 2I6EA 2FYIA 4PAFA 3B6TA 1OLCA 2B4MA 4ZDMA 5EQAA 3B7DA 4O3CA 5ET6A 1RDXA 3T0JA 4U21A 1AIVA 1ELJA 1EU8A 2ONRA 1EYKA 2YPNA 1INPA 1FQFA 3DLNA 2WYKA 1Y1MA 4G8NA 1FBFA 2QVVA 2R8TA 1AMFA 5ET5A 4RK9A 3EQ1A 3UK4A 1Y4TA 4HE1A 4JDFA 4EF1A 1URDA 4HXVA 1JEVA 4N81A 1UTBB 2FIXA 2P1SA 3OEMA 1URGA 3IK6B 3FVOA 4GVOA 4GD5A 4G2ZA 1S7YA 2NXOA 4IY5A 3OO9A 1MH3A 5KDTB 4LQ5A 5KZTA 3SDFA 1MPBA 1N84A 5M2VA 3FJMA 4WXJA 1H44A 3N94A 3PPOA 1NV7A 3QK6A 4E0XA 4DI4B 3RNNA 1MRPA 1VSOA 3TEPA 3HFUA 2O51A 3TCGA 2B3BA 1NUZA 1ATGA 1H76A 5KCJB 2PVUA 5I56A 4IO5A 4OERA 2F3BA 1PEBA 2RKMA 4XEQA 5EYFA 3W9VA 3MAMA 3PPNA 2YLNA 3PUZE 1MDQA 4GWUA 2REGA 3KZGA 4NF6A 4BDNA 3A3CA 4JB7A 3C34A 2Z8EA 2I0BA 4IO6A 3K2DA 3PMVA 5I58B 2NUVA 3USDA 2ZNSA 2ONKE 4RXLA 1Y4CA 3KN7A 1M5DA 1B46A 4X1BA 5H8QB 3B50A 2AL4A 4DXUA 5TPAB 5CC2A 3PUVE 1EH3A 3KGCA 1I6QA 4P11A 1MG1A 2FBPA 2F6PA 1OMPA 4GLIA 4N6PA 3SEVA 2PMSA 4U2RA 4DIGA 2VOZA 5JK4A 4DI3D 2X7QA 3QUJA 3B6WA 4P9KA 4ZEFA 4NN3A 3MJNA 1NV0A 4X04A 5ICQA 3E78A 5EHMA 3OOAA 3O9PA 1JETA 4POWA 1IMDA 1B1XA 2GQ1A 1GGGA 2F8DA 3IOVA 2I3WA 5JTYB 1LLSA 3NOHA 1B1HA 4R9FA 2E1SA 4DZ1A 5F7VA 3KC0A 3S9MC 3EHUA 3VLVA 3EPEA 4P3LA 3VFJA 1TFDA 1N3XA 3IORA 4F2QA 3HPIA 2O69A 2WYPA 4XKQA 3MVYA 2RINA 3FXRA 2V3TA 1IMBA 4N13A 3RT8A 4OEUA 1D9QA 1NFTA 1B3FA 1QULA 1SYHA 3O97A 3FV1A 5TP9A 1MY2A 3W9WA 3DELB 3MPKA 4MLVA 4NWDA 2OWTA 4NMYA 4KI0E 2B4LA 4AQ4A 1H43A 4MIJA 3ZKKA 1KA1A 1SDXA 3EHTA 2XXYA 3UA8A 5AE4A 1IQ7A 4DCYA 1OQGA 4YAHX 2D21A 4KPTA 4PGPA 3V5AA 1Y3QA 2D5WA 3OENA 3G3GA 1DK4A 1QJMA 2V3QA 1QVSA 4C1UA 1IMFA 3TAJA 1ZU0A 1O64A 5IZ3A 4OTEA 3T9VA 2HCAA 3MP8A 1B9JA 4R74A 4F1VA 1NV2A 1IIWA 1MY4A 3ILUB 4JVDA 4OVPA 2Z8FA 4TQUQ 5J1DA 1JNFA 2MKZA 3SKPA 4KD5A 2HQ0A 4YZZA 1FCKA 4ECFA 5AA2A 2H25A 2V84A 2XXWA 2UVGA 4NGUA 2OBGA 4I3EA 4O3BA 1PDAA 2XA5A 5IAIA 2VP1A 3OO6A 2AYSA 1DTGA 3FATA 4BDLA 5EYHA 4YKPA 4IR8A 4P0IA 1BTJA 1MQDA 2HPGA 2Z23A 5IGAA 4G77A 4R2FA 2XHDA 4OFOA 3TODA 1LB9A 3OSRA 4MLQA 1Y20A 2XX8A 4ND9A 4N8YA 1G0HA 3KBRA 5I57A 3D4GA 2CMOA 3CVGA 1R6ZA 1MPCA 3K1MA 4IO3A 1DCUA 1NNPA 2Q9TA 3PMWA 1FBDA 4IGTA 4F1YA 1SQYA 4FEBA 1JP4A 5DVJA 1YCJA 3RQTA 3TUSA 4O3AA 3Q26A 5EYGA 3PGFA 1CB6A 1UQWA 3TCHA 4KCCA 4G68A 4KHZE 4NEDA 1FPLA 4KYDA 4PFUA 2WEFA 4R6KA 1RYXA 2Y5LA 2VPNA 3FVNA 4C1TA 2ZNTA 3RLFE 2LAOA 2RC9A 3WAEA 5I2NB 3GBBA 2XXQA 4MMPA 3TMGA 3C32A 3H4ZA 1Q35A 1JVXA 1NH8A 3IJXB 3SETA 3VDFA 3SEXA 1XVXA 2HAUA 1URSA 4FAJA 3LSWA 4OVJA 5EQ8A 1US4A 3EHSA 1UIVA 2DVZA 1P1UA 4KYEA 4YB7A 3RYDA 3IFCA 3TTNA 1A8EA 1LBCA 3K02A 1M5BA 4I9DA 1B05A 4L17A 2DYXA 3B8BA 4NWCA 3UP9A 2E0SA 1QGXA 3KSXA 2QMWA 3BFUA 1A40A 2VD3A 3EF7A 2QPQA 2PCRA 5H8FA 2UVJA 1OLAA 5DVIA 4F3PA 3O28A 2UYEA 1N76A 3CFXA 3VE1B 1IUDA 2UYFA 3K6XA 3H6UA 1D9YA 3BIHA 3GZGA 1SI1A 1LBYA 5JEIA 3AXFA 3A29A 3IR1A 2DE3A 4H6DA 2XXPA 4HE0A 3MBPA 4RJZA 1WVJA 3M3KA 4IGRA 4Q30B 4AB5A 3PUWE 3TDJA 2O1LA 4LZ7A 3OO7A 3QMFA 3P7IA 1GTKA 3V83A 4U1ZA 4NF5A 1TFAA 3E4RA 4RPOA 5HBCA 5IZZA 1LAXA 2P0SA 3U72A 2O68A 4PBQA 5A5XB 1MXWA 1US5A 3KJ7A 4HW8A 2VD2A 3RTWB 1FTLA 3C31A 5IKBA 3G3HA 4NQ8A 4NF4A 3R6UA 3H7MA 2AIXA 3MC2A 1P1OA 1DBZA 2W7YA 4KR5A 3RPLA 4PP0A 2L5VA 3VVDA 2RC7A 2P2AA 4KCDA 1WDNA 2GH9A 2A5TA 3SZPA 3OELA 1NKXA 2DQVA 1LFIA 1R9LA 5AA4B 1I6BA 3QYTA 1LBXA 2Y7IA 3W15C 2F6GA 5LTCA 2VHAA 4MH5A 2X26A 5T3JA 3MW0A 3HSTA 2DDKA 5EQ7A 1FJ9A 4XKRA 1IMAA 2XXTA 3TTLA 5FTHA 5I2KB 3ECRA 5J16A 2OWSA 3U65A 1MXXA 1OQHA 1SPIA 2XX9A 3UGWA 4P0GA 3ONMA 1FQCA 5ICTA 1YZ0A 4KFQA 3O6HA 1FJ6A 2Y5KA 4BLAA 3S9NC 1LAFE 3IO6A 1M5FA 3GYYA 1G0IA 4GWSA 5L9OA 3G3JA 4OVTA 4ZEKA 5DTBA 1MXZA 1RYOA 4BDQA 4FIMA 2I48A 4NF8B 3U8QA 1UTHA 5H8HB 3IB0A 3IAZA 4IO2A 4TOZA 1XHYA 4EUOA 4LONB 3PPQA 5CRYA 1SW1A 4EQBA 1FPIA 4GBWA 1NUYA 4YKJA 5ET8A 1UIUA 1Y9UA 2Q74A 4O94A 3VV5A 4LZ5A 4TLMB 1FQAA 4OVSA 5I84A 1LCTA 5DEXB 1FQDA 2ABHA 3MVWA 1N7WA 5CMMA 4GOTA 3TQLA 1RDZA 4R2BA 1VR5A 3ISPA 2Z8DA 5AA2D 3M8UA 2FHYA 4MEVA 4LUBA 4PFWA 1XVYA 2Y7PA 4F18A 3K6WA 3PUYE 3TKDA 3A3UA 2HXWA 1B0HA 4GX3A 4XIGQ 2D3IA 4F1UA 1B3GA 4MJOA 2XXXA 3FXBA 2DXYA 1YPNA 2CZIA 1B0LA 1KWHA 3FZVA 4FECA 4GXSB 3VXCA 4XTCQ 5HPQA 1DSNA 4XKPA 1TXFA 2DE4A 2BJJX 4OQOA 1B2HA 3T66A 4GWZA 2H98A 4OWDA 5L9MA 3IOWA 4GWYA 3SEWA 5LOMA 2WBBA 3FVKA 4DCXA 4E0WA 1MH4A 4MCOA 4QSEA 4GBVA 2VPOA 3KEIA 4R6YA 1B3EA 3FXQA 3R26A 4PAIA 3TTKA 2DWIA 3QXMA 1AH5A 4I40A 3G7WA 1JW5A 3IFAA 1D3KA 1R1NA 2Q2AA 1LCFA 1N7XA 4PDDA 2UVIA 3CFZA 1M5CA 4LP2B 4OMBA 5I59B 2VGQA 4H46A 4PETA 1FW0A 4U4XA 4TLLB 4OYVA 4H1XA 2XXRA 3BBRA 1MS7A 1DOTA 1SW2A 4ELPA 3FJ7A 2CZLA 4PDHA 4R6HA 4QSDA 1FTJA 2B65A 4X48A 3DP6A 2CEYA 1USYE 1FTKA 1H45A 1NV1A 1IXGA 3KG2A 3GXAA 3IOTA 5F1QA 4PE3A 4UACA 2DS9A 1FSAA 1UTBA 4MHFA 3ILTB 3IO4A 4JVCA 1SW5A 2O7UA 1NNFA 2FIEA 3OMBA 2CEXA 2OX3A 1II5A 4XXUA 4OFLA 4PGNA 1M5EA 5AA3A 1N0TA 2I49A 2QS4A 3M3LA 5KDTA 1JVYA 2PT2A 4H5FA 4I1DA 3FXUA 2XX7A 1USYH 2KR0A 4PFRA 4YU0A 3OXNA 1IXCA 1I69A 1MXUA 2F34A 4GFRA 1LFHA 4ELRA 4QXDA 4F22A 2AL5A 2KQZA 1YTVA 2Y7WA 4P8BA 1MM7A 1BP5A 2F7BA 2Y7KA 5KCJA 1NV3A 2QVRA 3CG3A 3IOUA 1XS5A 3LV0A 3IB1A 3C4MA 1EZ9A 5BWJA 5L9SA 3K6VA 4QSCA 3RGYA 2X7PA 4F3GA 2O7IA 4AB6A 2CZKA 4DDDA 1XC1A 2I58A 2H99A 1PC3A 2UXAA 2HFBA 4AS5A 2IA4A 4XF5A 2OJTA 1B32A 1A54A 5HM4B 4PAKA 1FRPA 2H5YA 5H8NB 5DW8A 4HS7A 3PV0E 1DTZA 4N8GA 1MDP1 4P47A 2WBDA 5CMKA 3QSLA 2I0CA 1LAHE 2KLFA 5I58A 1EZOA 3O29A 4PE5B 1T0KA 4YB6A 1IMCA 4KQPA 2FA7A 2A5SA 4YICA 2PBWA 4LN5A 5ITPA 3MSTA 1HSJA 5H8QA 1K9ZA 1HSEA 5TPAA 4YMBA 4LVQA 2PFZA 3GLBA 3L6GA 2Y7RA 1P1QA 4KYSA 4UA8A 1RDYA 2QS1A 4ZZEA 4PC9A 1FTOA 3ZSFA 5DVFA 1MQGA 5CM6A 3VVEA 1QUJA 3KN3A 1EZPA 3G3KA 3UIFA 4OZ9A 4OENA 4NG7A 3H6VA 1LBWA 3MZBA 2XWKA 4AS4A 3C33A 3LSLA 3U93A 4X8RA 2DSFA 2F5XA 3HV1A 3KC1A 5JTYA 4JSDA 3T1BA 4KXPA 3ZKLA 4JWOA 4FBPA 2HEUA 1FPJA 1OVTA 4EXKA 2DWJA 2XXKA 1BLFA 1FBGA 1BKAA 1FBEA 1B6HA 2RCAA 1QKAA 3KN8A 3U1OA 1FPGA 1SBPA 2RF1A 1NV5A 2ZYOA 4RYAA 4JWXA 1TT1A 1NNTA 3TCFA 1IMEA 2OCUA 4N4UA 4R73A 2QS3A 4N17A 3BFTA 1TWYA 4GWWA 5ISUA 2ZMBA 1IZ1A 2QSXA 3LR1A 4R9GA 3H6WA 3E13X 2GFEA 1FQEA 4MX6A 3CFLA 3TPAA 2XXVA 3PMXA 3C35A 3FVGA 2XWVA 3MYUA 4DXBA 2QJEA 4F3BA 1B5IA 3GBAA 4U4SA 4Z0IA 5I56B 4OFJA 1A55A 2HZKA 4OANA 1WODA 1ZKBA 2RC8A 2QRYA 1OVBA 3SERA 1DPEA 1FPBA 3H3GA 3FASA 5DT6A 1LEVA 3LSXA 1NUWA 5CMCA 1KA0A 2VT5A 4NF6B 4GIZA 4QFPA 3ROJA 3MP6A 4ZS9A 5K2YA 3OD7A 5IM2A 3T9XB 3PPPA 2GRVA 2Q8MA 4EQ7A 4ELQA 2ZZXA 4HTGA 1FPEA 1DPPA 4P1EA 4GX4A 3ZS6A 3JV9A 2DWAA 4JBZA 1A7LA 3I5OA 5AA1A 4F3SA 2H4IA 3HCQA 3N26A 2PX1A 2PYYA 4JSOA 4PQJA 1Y3NA 2F7AA 1IXIA 4I62A 3K0VA 4HCWA 4YKIA 4H0WA 2IEEA 3EKIA 5CI5A 3S2VA 2Z22A 1MXYA 1MM6A 4GF8A 5IZ1A 1QKBA 1K9YA 4ESXA 4GL8A 2FNCA 5ESYA 4PF8A 1ZJLA 4GWXA 5B70A 3T93B 1B51A 5CMBA 3Q28A 1B7UA 5I3SA 2ALUA 4DLDA 1ZLQA 1P1WA 2GHBA 3E79A 2DWHA 2F7CA 2F97A 4MNPA 4GRKA 3IB2A 3MUQA 4OEVA 1KZ8A 1LBZA 4Z7EA 1Q1KA 3KOTA 4BDMA 2PT1A 4YKKA 1B40A 1LSTA 1PBPA 5CBRA 4PFYA 1IXHA 3QIMA 1BIYA 1O63A 3FD3A 3HHGA 4P56A 3LUYA 3SEUA 5L8DA 3T9HB 1FBHA 1NH7A 1FTMA 5TP9B 2ZXTA 5I2NA 2XWOA 3C9HA 2NOOA 4THIA 1PB8A 1B52A 1JEUA 4OESA 3PD8A 4ZZAA 1B4ZA 3VVFA 3TQWA 2JJKA 2V93A 4NE4A 1IEJA 1P99A 1OIBA 1B3LA 4PF6A 4N6DA 3OO8A 1B4HA 5TU0A 1ZMGA 5IZ3B 1VFDA 4N91A 1JQFA 1S9TA 1FQBA 3MZ9A 3K4UA 3EN3A 4WEDA 2R6GE 1FPFA 1N3WA 1GR2A 3O6GA 2HZLA 4QFLA 1MY3A 1QUIA 1AWBA 4H67A 1NI9A 1VDWA 1GV8A 1ZBMA 4QFKA 3VLWA 5FHNA 2OWZA 4YMAA 3WAFA 4G8HA 4O7MA 3LUZA 1I6AA 1NMUA 1FBCA 4QF9A 5AA2B 3RPWA 3MWBA 1A8FA 4U1OA 4ZECA 4POXA 3MQ9A 1D4NA 1LB8A 4R72A 4UABA 3K1NA 1NV4A 4DE8A 4FATA 4FEDA 4GL0A 3FBPA 3TTRA 3LC8A 3HHFA 4IB2A 3O2AA 5A5XA 3F11A 5ELVA 3TYHA 4I3YA 4LZ8A 3CSGA 3MVXA 4GX6A 1MY1A 2ZZVA 5I57B 4GXAA 5ITOA 1LBBA 2V25A 3U94A 2ZZWA 1CNQA 4EDPA 1PB7A 4PFIA 1PB9A 2I4CA 2XXHA 3IX1A 1CE2A 2Q88A 4EQ9A 3K01A 5AA4A 1F9BA 4OXVA 3PUXE 4K3FA 5CBSA 4U22A 4QHQA 2P3NA 3SESA 4G68B 2I3VA 2Q89A 1Q9DA 3L6HA 1B7HA 3CI8A 5FHMA 4IO4A 3OEKA 3RTFB 4RY1A 4FORA 5I2KA 1FBPA 3DP4A 3V8XB 3FJGA 5F24A 2Q8JA 4PTKA 2HXRA 3VLUA 3KFMA 4QBAA 1YXIA 2ZYNA 3PD9A 2ZNUA 4H8IA 2ZYKA 4QFOA 4P1LA 3KBZA 3A09A 2ANJA 1O7TA 4OVQA 2CZHA 4RK2A 2F78A 2QL3A 1P1NA 3S9LC 2ONSA 3H03A 5FHOA 4ZE9A 1POY1 4NF8A 2QFLA 3UORA 5H8HA 4C0RA 3SEYA 4IO7A 4OVRA 4F19A 1Y1ZA 3CSBA 2DVCA 5BUUA 1SI0A 3D4CA 1ZTYA 3BKIB 4H8JA 1B7ZA 3FUZA 2XWIA 3FGSA 4ELOA 2XXIA 5H8FB 4X1DA 5FTIA 1RKMA 1Y3PA 1NL5A 4BDRA 4MBPA 1MQJA 3THIA 3DP8A 4PFBA 1JW4A
chains in the Genus database with same CATH topology
3CIJA 4G4PA 3ODBA 1YAEA 3T22A 2R71A 4H5GA 1AL3A 3QAXA 2UVHA 2REJA 3KSJA 3IL1B 5DEXA 3N6TA 4H65A 1LAGE 3V89B 4NF5B 3T9UA 3G3FA 1JW1A 4HCYA 2THIA 1QUKA 2G29A 1A99A 3RN8A 4LQ2A 1NNKA 1VFEA 2YJPA 2F36A 4RA1A 4NF4B 3MZ1A 1PBQA 3PU5A 3DM0A 1S50A 3C36A 1ZIUA 3MPLA 2DE2A 3QUFA 2A5TB 3RUMA 3K6UA 1N04A 4FJPA 1SYIA 3LSFB 3T96B 4ZE8A 3TZAA 4EF2A 4Q5TA 1SD3A 4U23A 4GWOA 1D9VA 2OK2A 3B6QA 1B58A 4DXCA 4ZEDA 4Q0CA 2XD2A 1L5TA 1H3DA 1POTA 2G93A 3H6TA 3S4UA 2DP8A 3Q29A 1J1NA 4ESWA 2GHAA 3G3IA 2M8CA 3PPRA 2XD3A 3K00A 4LATA 2OLBA 2QMXA 3N6UA 2DXRA 1R9QA 1B3HA 3Q25A 4M1VA 2V3UA 3K1PA 1UTHB 3O66A 1Z7NE 1XT8A 3MVZA 4RNSA 4R75A 2QS2A 3Q27A 2F35A 4M4GA 3M3FA 3MP1A 3N5LA 4WKMA 4YB5A 3VXBA 4JXIA 1SW4A 3CG1A 4PFTA 4EXLA 5I59A 2R9JA 3I6VA 1B5HA 3CR9A 3IJOB 4MFIA 1QW0A 5H8SA 1MQIA 2WKYA 3S9EA 4F2OA 2DOJA 4QRZA 3E9XA 4F31B 2Q2CA 4IY6A 4RPNA 4G8MA 3JYRA 4G68C 1MPDA 3KJTA 3O6IA 4ZEBA 4MF3A 2O1MA 2Y84A 3RY3A 3R7XA 1VE4A 2O84X 3UN6A 2NVUB 3KOSA 3CRBA 4GQOA 2NWJA 4LA9A 4F29A 5B7DA 3E3KA 1LGBC 1LFGA 5K2XA 3HN0A 4OHNA 2ZYMA 2H9BA 3FV2A 4OETA 1Z7ME 3TTMA 1AOVA 4ONYA 3JZJA 3TFLA 1GVCA 1SVXB 1MQHA 5DYHA 1XOCA 3TELA 3H06B 3HO7A 5H8NA 1MXVA 3FIRA 2B3FA 4BDOA 1IITA 2I4BA 2OZZA 1MY0A 4X9TA 1ANFA 4QFNA 1B5JA 3U92A 2O6AA 3LBSA 4NTLA 2ESNA 5EHSA 4XKNA 3I3VA 1DMBA 4N07A 3OSQA 4Q8RA 2XXUA 4FE8A 3RT6B 2RCBA 1HSLA 4I8CA 2HAVA 4WEPA 4JWYA 4ISUA 4ZEIA 4F39A 2I6EA 2FYIA 3B6TA 1OLCA 4ZDMA 3B7DA 4O3CA 4U21A 1AIVA 1ELJA 1EU8A 2ONRA 2YPNA 1FQFA 3DLNA 1Y1MA 4G8NA 1AMFA 4RK9A 3EQ1A 3UK4A 1Y4TA 4JDFA 4EF1A 1URDA 1JEVA 1UTBB 2P1SA 3OEMA 1URGA 3IK6B 3FVOA 4GVOA 4GD5A 4G2ZA 1S7YA 2NXOA 4IY5A 3OO9A 1MH3A 5KDTB 4LQ5A 5KZTA 3SDFA 1MPBA 1N84A 5M2VA 3FJMA 4WXJA 1H44A 3N94A 3PPOA 3QK6A 4E0XA 3RNNA 1MRPA 1VSOA 3TEPA 2O51A 3TCGA 2B3BA 1ATGA 1H76A 5KCJB 2PVUA 5I56A 4IO5A 4OERA 1PEBA 2RKMA 5EYFA 3W9VA 3MAMA 3PPNA 2YLNA 3PUZE 1MDQA 2REGA 3KZGA 4NF6A 4BDNA 3A3CA 4JB7A 3C34A 2Z8EA 2I0BA 4IO6A 3K2DA 3PMVA 5I58B 2NUVA 3USDA 2ZNSA 2ONKE 4RXLA 1Y4CA 3KN7A 1M5DA 1B46A 4X1BA 5H8QB 2AL4A 4DXUA 5TPAB 5CC2A 3PUVE 1EH3A 3KGCA 1I6QA 4P11A 1MG1A 2F6PA 1OMPA 4GLIA 4N6PA 3SEVA 2PMSA 4U2RA 4DIGA 2VOZA 5JK4A 2X7QA 3QUJA 3B6WA 4ZEFA 3MJNA 5ICQA 5EHMA 3OOAA 3O9PA 1JETA 4POWA 1B1XA 1GGGA 2F8DA 3IOVA 2I3WA 5JTYB 1LLSA 1B1HA 4R9FA 2E1SA 4DZ1A 5F7VA 3S9MC 3EHUA 3VLVA 3EPEA 3VFJA 1TFDA 1N3XA 3IORA 4F2QA 3HPIA 2O69A 4XKQA 3MVYA 2RINA 3FXRA 2V3TA 4N13A 3RT8A 4OEUA 1NFTA 1B3FA 1QULA 1SYHA 3O97A 3FV1A 5TP9A 1MY2A 3W9WA 3DELB 3MPKA 4MLVA 4NMYA 2OWTA 4NWDA 4KI0E 4AQ4A 1H43A 3ZKKA 1SDXA 3EHTA 2XXYA 3UA8A 5AE4A 1IQ7A 4DCYA 1OQGA 4YAHX 2D21A 4KPTA 3V5AA 1Y3QA 2D5WA 3OENA 3G3GA 1QJMA 2V3QA 1QVSA 4C1UA 3TAJA 1ZU0A 1O64A 4OTEA 3T9VA 2HCAA 3MP8A 1B9JA 4R74A 4F1VA 1IIWA 1MY4A 3ILUB 2Z8FA 4TQUQ 5J1DA 1JNFA 3SKPA 4KD5A 2HQ0A 4YZZA 1FCKA 4ECFA 5AA2A 2H25A 2V84A 2XXWA 2UVGA 2OBGA 4O3BA 1PDAA 5IAIA 2VP1A 3OO6A 2AYSA 1DTGA 3FATA 4BDLA 4YKPA 4P0IA 1BTJA 1MQDA 2Z23A 4G77A 4R2FA 2XHDA 4OFOA 3TODA 1LB9A 3OSRA 4MLQA 1Y20A 2XX8A 4ND9A 3KBRA 5I57A 3D4GA 2CMOA 3CVGA 1R6ZA 1MPCA 3K1MA 4IO3A 1NNPA 2Q9TA 3PMWA 4IGTA 4F1YA 1SQYA 4FEBA 5DVJA 1YCJA 3RQTA 3TUSA 4O3AA 3Q26A 3PGFA 1CB6A 1UQWA 3TCHA 4KCCA 4G68A 4KHZE 4NEDA 4KYDA 4PFUA 4R6KA 1RYXA 3FVNA 4C1TA 2ZNTA 3RLFE 2LAOA 2RC9A 3WAEA 5I2NB 3GBBA 2XXQA 3TMGA 3C32A 3H4ZA 1Q35A 1JVXA 1NH8A 3IJXB 3SETA 3VDFA 3SEXA 1XVXA 2HAUA 1URSA 4FAJA 3LSWA 4OVJA 1US4A 3EHSA 1UIVA 2DVZA 1P1UA 4KYEA 4YB7A 3TTNA 1A8EA 1LBCA 3K02A 1M5BA 4I9DA 1B05A 4L17A 2DYXA 4NWCA 3UP9A 2E0SA 3KSXA 2QMWA 3BFUA 1A40A 2VD3A 3EF7A 2QPQA 5H8FA 2UVJA 1OLAA 5DVIA 4F3PA 3O28A 2UYEA 1N76A 3CFXA 3VE1B 1IUDA 2UYFA 3K6XA 3H6UA 1D9YA 3GZGA 1SI1A 5JEIA 3AXFA 3IR1A 2DE3A 4H6DA 2XXPA 3MBPA 4RJZA 1WVJA 3M3KA 4IGRA 4Q30B 4AB5A 3PUWE 3TDJA 2O1LA 4LZ7A 3OO7A 3P7IA 1GTKA 3V83A 4U1ZA 4NF5A 1TFAA 3E4RA 4RPOA 5HBCA 1LAXA 2P0SA 3U72A 2O68A 5A5XB 1MXWA 1US5A 3KJ7A 4HW8A 2VD2A 3RTWB 1FTLA 3C31A 5IKBA 3G3HA 4NF4A 3R6UA 3H7MA 2AIXA 3MC2A 1P1OA 2W7YA 4KR5A 4PP0A 3VVDA 2RC7A 2P2AA 4KCDA 1WDNA 2GH9A 2A5TA 3OELA 1NKXA 2DQVA 1LFIA 1R9LA 5AA4B 1I6BA 3QYTA 2Y7IA 3W15C 2F6GA 2VHAA 4MH5A 2X26A 3MW0A 3HSTA 4XKRA 2XXTA 3TTLA 5FTHA 5I2KB 3ECRA 2OWSA 1MXXA 1OQHA 2XX9A 3UGWA 4P0GA 3ONMA 1FQCA 5ICTA 4KFQA 3O6HA 4BLAA 3S9NC 1LAFE 3IO6A 1M5FA 5L9OA 3G3JA 4ZEKA 5DTBA 1MXZA 1RYOA 4BDQA 4FIMA 2I48A 4NF8B 3U8QA 1UTHA 5H8HB 3IB0A 3IAZA 4IO2A 4TOZA 1XHYA 4EUOA 4LONB 3PPQA 5CRYA 1SW1A 4EQBA 4YKJA 1UIUA 1Y9UA 3VV5A 4LZ5A 4TLMB 1FQAA 5I84A 1LCTA 5DEXB 1FQDA 2ABHA 3MVWA 1N7WA 5CMMA 4GOTA 3TQLA 4R2BA 1VR5A 2Z8DA 5AA2D 3M8UA 4LUBA 4PFWA 1XVYA 2Y7PA 4F18A 3K6WA 3PUYE 3TKDA 3A3UA 2HXWA 1B0HA 4XIGQ 2D3IA 4F1UA 1B3GA 2XXXA 2DXYA 1YPNA 1B0LA 1KWHA 3FZVA 4FECA 4GXSB 3VXCA 4XTCQ 5HPQA 1DSNA 4XKPA 1TXFA 2DE4A 2BJJX 4OQOA 1B2HA 3T66A 2H98A 4OWDA 5L9MA 3IOWA 3SEWA 5LOMA 3FVKA 4DCXA 4E0WA 1MH4A 4QSEA 3KEIA 4R6YA 1B3EA 3FXQA 3R26A 3TTKA 2DWIA 3QXMA 1AH5A 3G7WA 1JW5A 1D3KA 1R1NA 2Q2AA 1LCFA 1N7XA 2UVIA 3CFZA 1M5CA 4LP2B 4OMBA 5I59B 2VGQA 4PETA 1FW0A 4U4XA 4TLLB 4OYVA 4H1XA 2XXRA 3BBRA 1MS7A 1DOTA 1SW2A 4ELPA 3FJ7A 2CZLA 4R6HA 4QSDA 1FTJA 2B65A 4X48A 3DP6A 1USYE 1FTKA 1H45A 1IXGA 3KG2A 3GXAA 3IOTA 5F1QA 4UACA 2DS9A 1UTBA 3ILTB 3IO4A 1SW5A 2O7UA 1NNFA 3OMBA 1II5A 4XXUA 4OFLA 1M5EA 5AA3A 1N0TA 2I49A 2QS4A 3M3LA 5KDTA 1JVYA 2PT2A 4I1DA 3FXUA 4YU0A 2XX7A 1USYH 4H5FA 3OXNA 1IXCA 1I69A 1MXUA 2F34A 4GFRA 1LFHA 4ELRA 4F22A 2AL5A 1YTVA 2Y7WA 1MM7A 1BP5A 2F7BA 2Y7KA 5KCJA 3CG3A 3IOUA 1XS5A 3IB1A 3C4MA 1EZ9A 5BWJA 5L9SA 3RGYA 3K6VA 4QSCA 2X7PA 4F3GA 4AB6A 2O7IA 4DDDA 1XC1A 2I58A 2H99A 1PC3A 2UXAA 2HFBA 2IA4A 2OJTA 1B32A 1A54A 5HM4B 2H5YA 5H8NB 4HS7A 3PV0E 1DTZA 1MDP1 5CMKA 3QSLA 2I0CA 1LAHE 2KLFA 5I58A 1EZOA 3O29A 4PE5B 1T0KA 4YB6A 4KQPA 2FA7A 2A5SA 4YICA 2PBWA 5ITPA 1HSJA 5H8QA 1HSEA 5TPAA 4YMBA 4LVQA 3GLBA 3L6GA 2Y7RA 1P1QA 4KYSA 4UA8A 2QS1A 4ZZEA 1FTOA 3ZSFA 5DVFA 1MQGA 5CM6A 3VVEA 1QUJA 3KN3A 1EZPA 3G3KA 3UIFA 4OZ9A 4OENA 3H6VA 3MZBA 3C33A 3LSLA 3U93A 2DSFA 2F5XA 3HV1A 5JTYA 4JSDA 3ZKLA 4JWOA 2HEUA 1OVTA 4EXKA 2DWJA 1BLFA 1BKAA 1B6HA 2RCAA 1QKAA 3KN8A 3U1OA 1SBPA 2RF1A 2ZYOA 4RYAA 4JWXA 1TT1A 1NNTA 3TCFA 2OCUA 4R73A 2QS3A 3BFTA 1TWYA 5ISUA 2ZMBA 1IZ1A 2QSXA 3LR1A 4R9GA 3H6WA 3E13X 2GFEA 1FQEA 3CFLA 3TPAA 2XXVA 3PMXA 3C35A 3FVGA 4DXBA 2QJEA 4F3BA 1B5IA 3GBAA 4U4SA 4Z0IA 5I56B 4OFJA 1A55A 2HZKA 1WODA 1ZKBA 2RC8A 2QRYA 1OVBA 3SERA 1DPEA 3H3GA 3FASA 5DT6A 3LSXA 5CMCA 4NF6B 4GIZA 4QFPA 3MP6A 4ZS9A 5K2YA 3OD7A 3T9XB 3PPPA 2GRVA 4EQ7A 4ELQA 4HTGA 1DPPA 3ZS6A 3JV9A 2DWAA 4JBZA 1A7LA 3I5OA 5AA1A 4F3SA 2H4IA 3HCQA 3N26A 2PX1A 2PYYA 4JSOA 4PQJA 1Y3NA 2F7AA 1IXIA 4I62A 3K0VA 4HCWA 4YKIA 4H0WA 2IEEA 5CI5A 3S2VA 2Z22A 1MXYA 1MM6A 4GF8A 1QKBA 4ESXA 4GL8A 2FNCA 1ZJLA 5B70A 3T93B 1B51A 5CMBA 3Q28A 1B7UA 2ALUA 4DLDA 1ZLQA 1P1WA 2GHBA 2DWHA 2F7CA 2F97A 4GRKA 3IB2A 3MUQA 4OEVA 4Z7EA 1Q1KA 3KOTA 4BDMA 2PT1A 4YKKA 1B40A 1LSTA 1PBPA 5CBRA 4PFYA 1IXHA 3QIMA 1BIYA 1O63A 3FD3A 3HHGA 3LUYA 3SEUA 5L8DA 3T9HB 1NH7A 1FTMA 5TP9B 2ZXTA 5I2NA 3C9HA 2NOOA 4THIA 1PB8A 1B52A 1JEUA 4OESA 3PD8A 4ZZAA 1B4ZA 3VVFA 3TQWA 2V93A 4NE4A 1IEJA 1P99A 1OIBA 1B3LA 3OO8A 1B4HA 5TU0A 1ZMGA 1VFDA 1JQFA 1S9TA 1FQBA 3MZ9A 3K4UA 3EN3A 4WEDA 2R6GE 1N3WA 1GR2A 3O6GA 2HZLA 4QFLA 1MY3A 1QUIA 4H67A 1GV8A 1ZBMA 4QFKA 3VLWA 5FHNA 4YMAA 3WAFA 4G8HA 1I6AA 1NMUA 4QF9A 5AA2B 3RPWA 3MWBA 1A8FA 4U1OA 4ZECA 4POXA 3MQ9A 1D4NA 1LB8A 4R72A 3K1NA 4DE8A 4FATA 4FEDA 4GL0A 3TTRA 3LC8A 3HHFA 4IB2A 3O2AA 5A5XA 3F11A 5ELVA 3TYHA 4LZ8A 3CSGA 3MVXA 1MY1A 5I57B 4GXAA 5ITOA 1LBBA 2V25A 3U94A 4EDPA 1PB7A 1PB9A 2I4CA 2XXHA 3IX1A 1CE2A 2Q88A 4EQ9A 3K01A 5AA4A 1F9BA 4OXVA 3PUXE 4K3FA 5CBSA 4QHQA 4U22A 3SESA 4G68B 2I3VA 2Q89A 3L6HA 1B7HA 3CI8A 5FHMA 4IO4A 3OEKA 3RTFB 4RY1A 4FORA 5I2KA 3DP4A 3V8XB 3FJGA 2Q8JA 3VLUA 3KFMA 2ZYNA 3PD9A 2ZNUA 4H8IA 2ZYKA 4QFOA 3A09A 2ANJA 1O7TA 4RK2A 2F78A 2QL3A 1P1NA 3S9LC 2ONSA 3H03A 5FHOA 4ZE9A 1POY1 4NF8A 3UORA 5H8HA 4C0RA 3SEYA 4IO7A 4F19A 1Y1ZA 3CSBA 2DVCA 5BUUA 1SI0A 3D4CA 1ZTYA 3BKIB 4H8JA 1B7ZA 3FUZA 3FGSA 4ELOA 2XXIA 5H8FB 4X1DA 5FTIA 1RKMA 1Y3PA 1NL5A 4BDRA 4MBPA 1MQJA 3THIA 3DP8A 1JW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIJ A;  4G4P A;  3ODB A;  1YAE A;  3T22 A;  2R71 A;  4H5G A;  1AL3 A;  3QAX A;  2UVH A;  2REJ A;  3KSJ A;  3IL1 B;  5DEX A;  3N6T A;  4H65 A;  1LAG E;  3V89 B;  4NF5 B;  3T9U A;  3G3F A;  1JW1 A;  4HCY A;  2THI A;  1QUK A;  2G29 A;  1A99 A;  3RN8 A;  4LQ2 A;  1NNK A;  1VFE A;  2YJP A;  2F36 A;  4RA1 A;  4NF4 B;  3MZ1 A;  1PBQ A;  3PU5 A;  3DM0 A;  1S50 A;  3C36 A;  1ZIU A;  3MPL A;  2DE2 A;  3QUF A;  2A5T B;  3RUM A;  3K6U A;  1N04 A;  4FJP A;  1SYI A;  3LSF B;  3T96 B;  4ZE8 A;  3TZA A;  4EF2 A;  4Q5T A;  1SD3 A;  4U23 A;  4GWO A;  1D9V A;  2OK2 A;  3B6Q A;  1B58 A;  4DXC A;  4ZED A;  4Q0C A;  2XD2 A;  1L5T A;  1H3D A;  1POT A;  2G93 A;  3H6T A;  3S4U A;  2DP8 A;  3Q29 A;  1J1N A;  4ESW A;  2GHA A;  3G3I A;  2M8C A;  3PPR A;  2XD3 A;  3K00 A;  4LAT A;  2OLB A;  2QMX A;  3N6U A;  2DXR A;  1R9Q A;  1B3H A;  3Q25 A;  4M1V A;  2V3U A;  3K1P A;  1UTH B;  3O66 A;  1Z7N E;  1XT8 A;  3MVZ A;  4RNS A;  4R75 A;  2QS2 A;  3Q27 A;  2F35 A;  4M4G A;  3M3F A;  3MP1 A;  3N5L A;  4WKM A;  4YB5 A;  3VXB A;  4JXI A;  1SW4 A;  3CG1 A;  4PFT A;  4EXL A;  5I59 A;  2R9J A;  3I6V A;  1B5H A;  3CR9 A;  3IJO B;  4MFI A;  1QW0 A;  5H8S A;  1MQI A;  2WKY A;  3S9E A;  4F2O A;  2DOJ A;  4QRZ A;  3E9X A;  4F31 B;  2Q2C A;  4IY6 A;  4RPN A;  4G8M A;  3JYR A;  4G68 C;  1MPD A;  3KJT A;  3O6I A;  4ZEB A;  4MF3 A;  2O1M A;  2Y84 A;  3RY3 A;  3R7X A;  1VE4 A;  2O84 X;  3UN6 A;  2NVU B;  3KOS A;  3CRB A;  4GQO A;  2NWJ A;  4LA9 A;  4F29 A;  5B7D A;  3E3K A;  1LGB C;  1LFG A;  5K2X A;  3HN0 A;  4OHN A;  2ZYM A;  2H9B A;  3FV2 A;  4OET A;  1Z7M E;  3TTM A;  1AOV A;  4ONY A;  3JZJ A;  3TFL A;  1GVC A;  1SVX B;  1MQH A;  5DYH A;  1XOC A;  3TEL A;  3H06 B;  3HO7 A;  5H8N A;  1MXV A;  3FIR A;  2B3F A;  4BDO A;  1IIT A;  2I4B A;  2OZZ A;  1MY0 A;  4X9T A;  1ANF A;  4QFN A;  1B5J A;  3U92 A;  2O6A A;  3LBS A;  4NTL A;  2ESN A;  5EHS A;  4XKN A;  3I3V A;  1DMB A;  4N07 A;  3OSQ A;  4Q8R A;  2XXU A;  4FE8 A;  3RT6 B;  2RCB A;  1HSL A;  4I8C A;  2HAV A;  4WEP A;  4JWY A;  4ISU A;  4ZEI A;  4F39 A;  2I6E A;  2FYI A;  3B6T A;  1OLC A;  4ZDM A;  3B7D A;  4O3C A;  4U21 A;  1AIV A;  1ELJ A;  1EU8 A;  2ONR A;  2YPN A;  1FQF A;  3DLN A;  1Y1M A;  4G8N A;  1AMF A;  4RK9 A;  3EQ1 A;  3UK4 A;  1Y4T A;  4JDF A;  4EF1 A;  1URD A;  1JEV A;  1UTB B;  2P1S A;  3OEM A;  1URG A;  3IK6 B;  3FVO A;  4GVO A;  4GD5 A;  4G2Z A;  1S7Y A;  2NXO A;  4IY5 A;  3OO9 A;  1MH3 A;  5KDT B;  4LQ5 A;  5KZT A;  3SDF A;  1MPB A;  1N84 A;  5M2V A;  3FJM A;  4WXJ A;  1H44 A;  3N94 A;  3PPO A;  3QK6 A;  4E0X A;  3RNN A;  1MRP A;  1VSO A;  3TEP A;  2O51 A;  3TCG A;  2B3B A;  1ATG A;  1H76 A;  5KCJ B;  2PVU A;  5I56 A;  4IO5 A;  4OER A;  1PEB A;  2RKM A;  5EYF A;  3W9V A;  3MAM A;  3PPN A;  2YLN A;  3PUZ E;  1MDQ A;  2REG A;  3KZG A;  4NF6 A;  4BDN A;  3A3C A;  4JB7 A;  3C34 A;  2Z8E A;  2I0B A;  4IO6 A;  3K2D A;  3PMV A;  5I58 B;  2NUV A;  3USD A;  2ZNS A;  2ONK E;  4RXL A;  1Y4C A;  3KN7 A;  1M5D A;  1B46 A;  4X1B A;  5H8Q B;  2AL4 A;  4DXU A;  5TPA B;  5CC2 A;  3PUV E;  1EH3 A;  3KGC A;  1I6Q A;  4P11 A;  1MG1 A;  2F6P A;  1OMP A;  4GLI A;  4N6P A;  3SEV A;  2PMS A;  4U2R A;  4DIG A;  2VOZ A;  5JK4 A;  2X7Q A;  3QUJ A;  3B6W A;  4ZEF A;  3MJN A;  5ICQ A;  5EHM A;  3OOA A;  3O9P A;  1JET A;  4POW A;  1B1X A;  1GGG A;  2F8D A;  3IOV A;  2I3W A;  5JTY B;  1LLS A;  1B1H A;  4R9F A;  2E1S A;  4DZ1 A;  5F7V A;  3S9M C;  3EHU A;  3VLV A;  3EPE A;  3VFJ A;  1TFD A;  1N3X A;  3IOR A;  4F2Q A;  3HPI A;  2O69 A;  4XKQ A;  3MVY A;  2RIN A;  3FXR A;  2V3T A;  4N13 A;  3RT8 A;  4OEU A;  1NFT A;  1B3F A;  1QUL A;  1SYH A;  3O97 A;  3FV1 A;  5TP9 A;  1MY2 A;  3W9W A;  3DEL B;  3MPK A;  4MLV A;  4NMY A;  2OWT A;  4NWD A;  4KI0 E;  4AQ4 A;  1H43 A;  3ZKK A;  1SDX A;  3EHT A;  2XXY A;  3UA8 A;  5AE4 A;  1IQ7 A;  4DCY A;  1OQG A;  4YAH X;  2D21 A;  4KPT A;  3V5A A;  1Y3Q A;  2D5W A;  3OEN A;  3G3G A;  1QJM A;  2V3Q A;  1QVS A;  4C1U A;  3TAJ A;  1ZU0 A;  1O64 A;  4OTE A;  3T9V A;  2HCA A;  3MP8 A;  1B9J A;  4R74 A;  4F1V A;  1IIW A;  1MY4 A;  3ILU B;  2Z8F A;  4TQU Q;  5J1D A;  1JNF A;  3SKP A;  4KD5 A;  2HQ0 A;  4YZZ A;  1FCK A;  4ECF A;  5AA2 A;  2H25 A;  2V84 A;  2XXW A;  2UVG A;  2OBG A;  4O3B A;  1PDA A;  5IAI A;  2VP1 A;  3OO6 A;  2AYS A;  1DTG A;  3FAT A;  4BDL A;  4YKP A;  4P0I A;  1BTJ A;  1MQD A;  2Z23 A;  4G77 A;  4R2F A;  2XHD A;  4OFO A;  3TOD A;  1LB9 A;  3OSR A;  4MLQ A;  1Y20 A;  2XX8 A;  4ND9 A;  3KBR A;  5I57 A;  3D4G A;  2CMO A;  3CVG A;  1R6Z A;  1MPC A;  3K1M A;  4IO3 A;  1NNP A;  2Q9T A;  3PMW A;  4IGT A;  4F1Y A;  1SQY A;  4FEB A;  5DVJ A;  1YCJ A;  3RQT A;  3TUS A;  4O3A A;  3Q26 A;  3PGF A;  1CB6 A;  1UQW A;  3TCH A;  4KCC A;  4G68 A;  4KHZ E;  4NED A;  4KYD A;  4PFU A;  4R6K A;  1RYX A;  3FVN A;  4C1T A;  2ZNT A;  3RLF E;  2LAO A;  2RC9 A;  3WAE A;  5I2N B;  3GBB A;  2XXQ A;  3TMG A;  3C32 A;  3H4Z A;  1Q35 A;  1JVX A;  1NH8 A;  3IJX B;  3SET A;  3VDF A;  3SEX A;  1XVX A;  2HAU A;  1URS A;  4FAJ A;  3LSW A;  4OVJ A;  1US4 A;  3EHS A;  1UIV A;  2DVZ A;  1P1U A;  4KYE A;  4YB7 A;  3TTN A;  1A8E A;  1LBC A;  3K02 A;  1M5B A;  4I9D A;  1B05 A;  4L17 A;  2DYX A;  4NWC A;  3UP9 A;  2E0S A;  3KSX A;  2QMW A;  3BFU A;  1A40 A;  2VD3 A;  3EF7 A;  2QPQ A;  5H8F A;  2UVJ A;  1OLA A;  5DVI A;  4F3P A;  3O28 A;  2UYE A;  1N76 A;  3CFX A;  3VE1 B;  1IUD A;  2UYF A;  3K6X A;  3H6U A;  1D9Y A;  3GZG A;  1SI1 A;  5JEI A;  3AXF A;  3IR1 A;  2DE3 A;  4H6D A;  2XXP A;  3MBP A;  4RJZ A;  1WVJ A;  3M3K A;  4IGR A;  4Q30 B;  4AB5 A;  3PUW E;  3TDJ A;  2O1L A;  4LZ7 A;  3OO7 A;  3P7I A;  1GTK A;  3V83 A;  4U1Z A;  4NF5 A;  1TFA A;  3E4R A;  4RPO A;  5HBC A;  1LAX A;  2P0S A;  3U72 A;  2O68 A;  5A5X B;  1MXW A;  1US5 A;  3KJ7 A;  4HW8 A;  2VD2 A;  3RTW B;  1FTL A;  3C31 A;  5IKB A;  3G3H A;  4NF4 A;  3R6U A;  3H7M A;  2AIX A;  3MC2 A;  1P1O A;  2W7Y A;  4KR5 A;  4PP0 A;  3VVD A;  2RC7 A;  2P2A A;  4KCD A;  1WDN A;  2GH9 A;  2A5T A;  3OEL A;  1NKX A;  2DQV A;  1LFI A;  1R9L A;  5AA4 B;  1I6B A;  3QYT A;  2Y7I A;  3W15 C;  2F6G A;  2VHA A;  4MH5 A;  2X26 A;  3MW0 A;  3HST A;  4XKR A;  2XXT A;  3TTL A;  5FTH A;  5I2K B;  3ECR A;  2OWS A;  1MXX A;  1OQH A;  2XX9 A;  3UGW A;  4P0G A;  3ONM A;  1FQC A;  5ICT A;  4KFQ A;  3O6H A;  4BLA A;  3S9N C;  1LAF E;  3IO6 A;  1M5F A;  5L9O A;  3G3J A;  4ZEK A;  5DTB A;  1MXZ A;  1RYO A;  4BDQ A;  4FIM A;  2I48 A;  4NF8 B;  3U8Q A;  1UTH A;  5H8H B;  3IB0 A;  3IAZ A;  4IO2 A;  4TOZ A;  1XHY A;  4EUO A;  4LON B;  3PPQ A;  5CRY A;  1SW1 A;  4EQB A;  4YKJ A;  1UIU A;  1Y9U A;  3VV5 A;  4LZ5 A;  4TLM B;  1FQA A;  5I84 A;  1LCT A;  5DEX B;  1FQD A;  2ABH A;  3MVW A;  1N7W A;  5CMM A;  4GOT A;  3TQL A;  4R2B A;  1VR5 A;  2Z8D A;  5AA2 D;  3M8U A;  4LUB A;  4PFW A;  1XVY A;  2Y7P A;  4F18 A;  3K6W A;  3PUY E;  3TKD A;  3A3U A;  2HXW A;  1B0H A;  4XIG Q;  2D3I A;  4F1U A;  1B3G A;  2XXX A;  2DXY A;  1YPN A;  1B0L A;  1KWH A;  3FZV A;  4FEC A;  4GXS B;  3VXC A;  4XTC Q;  5HPQ A;  1DSN A;  4XKP A;  1TXF A;  2DE4 A;  2BJJ X;  4OQO A;  1B2H A;  3T66 A;  2H98 A;  4OWD A;  5L9M A;  3IOW A;  3SEW A;  5LOM A;  3FVK A;  4DCX A;  4E0W A;  1MH4 A;  4QSE A;  3KEI A;  4R6Y A;  1B3E A;  3FXQ A;  3R26 A;  3TTK A;  2DWI A;  3QXM A;  1AH5 A;  3G7W A;  1JW5 A;  1D3K A;  1R1N A;  2Q2A A;  1LCF A;  1N7X A;  2UVI A;  3CFZ A;  1M5C A;  4LP2 B;  4OMB A;  5I59 B;  2VGQ A;  4PET A;  1FW0 A;  4U4X A;  4TLL B;  4OYV A;  4H1X A;  2XXR A;  3BBR A;  1MS7 A;  1DOT A;  1SW2 A;  4ELP A;  3FJ7 A;  2CZL A;  4R6H A;  4QSD A;  1FTJ A;  2B65 A;  4X48 A;  3DP6 A;  1USY E;  1FTK A;  1H45 A;  1IXG A;  3KG2 A;  3GXA A;  3IOT A;  5F1Q A;  4UAC A;  2DS9 A;  1UTB A;  3ILT B;  3IO4 A;  1SW5 A;  2O7U A;  1NNF A;  3OMB A;  1II5 A;  4XXU A;  4OFL A;  1M5E A;  5AA3 A;  1N0T A;  2I49 A;  2QS4 A;  3M3L A;  5KDT A;  1JVY A;  2PT2 A;  4I1D A;  3FXU A;  4YU0 A;  2XX7 A;  1USY H;  4H5F A;  3OXN A;  1IXC A;  1I69 A;  1MXU A;  2F34 A;  4GFR A;  1LFH A;  4ELR A;  4F22 A;  2AL5 A;  1YTV A;  2Y7W A;  1MM7 A;  1BP5 A;  2F7B A;  2Y7K A;  5KCJ A;  3CG3 A;  3IOU A;  1XS5 A;  3IB1 A;  3C4M A;  1EZ9 A;  5BWJ A;  5L9S A;  3RGY A;  3K6V A;  4QSC A;  2X7P A;  4F3G A;  4AB6 A;  2O7I A;  4DDD A;  1XC1 A;  2I58 A;  2H99 A;  1PC3 A;  2UXA A;  2HFB A;  2IA4 A;  2OJT A;  1B32 A;  1A54 A;  5HM4 B;  2H5Y A;  5H8N B;  4HS7 A;  3PV0 E;  1DTZ A;  1MDP 1;  5CMK A;  3QSL A;  2I0C A;  1LAH E;  2KLF A;  5I58 A;  1EZO A;  3O29 A;  4PE5 B;  1T0K A;  4YB6 A;  4KQP A;  2FA7 A;  2A5S A;  4YIC A;  2PBW A;  5ITP A;  1HSJ A;  5H8Q A;  1HSE A;  5TPA A;  4YMB A;  4LVQ A;  3GLB A;  3L6G A;  2Y7R A;  1P1Q A;  4KYS A;  4UA8 A;  2QS1 A;  4ZZE A;  1FTO A;  3ZSF A;  5DVF A;  1MQG A;  5CM6 A;  3VVE A;  1QUJ A;  3KN3 A;  1EZP A;  3G3K A;  3UIF A;  4OZ9 A;  4OEN A;  3H6V A;  3MZB A;  3C33 A;  3LSL A;  3U93 A;  2DSF A;  2F5X A;  3HV1 A;  5JTY A;  4JSD A;  3ZKL A;  4JWO A;  2HEU A;  1OVT A;  4EXK A;  2DWJ A;  1BLF A;  1BKA A;  1B6H A;  2RCA A;  1QKA A;  3KN8 A;  3U1O A;  1SBP A;  2RF1 A;  2ZYO A;  4RYA A;  4JWX A;  1TT1 A;  1NNT A;  3TCF A;  2OCU A;  4R73 A;  2QS3 A;  3BFT A;  1TWY A;  5ISU A;  2ZMB A;  1IZ1 A;  2QSX A;  3LR1 A;  4R9G A;  3H6W A;  3E13 X;  2GFE A;  1FQE A;  3CFL A;  3TPA A;  2XXV A;  3PMX A;  3C35 A;  3FVG A;  4DXB A;  2QJE A;  4F3B A;  1B5I A;  3GBA A;  4U4S A;  4Z0I A;  5I56 B;  4OFJ A;  1A55 A;  2HZK A;  1WOD A;  1ZKB A;  2RC8 A;  2QRY A;  1OVB A;  3SER A;  1DPE A;  3H3G A;  3FAS A;  5DT6 A;  3LSX A;  5CMC A;  4NF6 B;  4GIZ A;  4QFP A;  3MP6 A;  4ZS9 A;  5K2Y A;  3OD7 A;  3T9X B;  3PPP A;  2GRV A;  4EQ7 A;  4ELQ A;  4HTG A;  1DPP A;  3ZS6 A;  3JV9 A;  2DWA A;  4JBZ A;  1A7L A;  3I5O A;  5AA1 A;  4F3S A;  2H4I A;  3HCQ A;  3N26 A;  2PX1 A;  2PYY A;  4JSO A;  4PQJ A;  1Y3N A;  2F7A A;  1IXI A;  4I62 A;  3K0V A;  4HCW A;  4YKI A;  4H0W A;  2IEE A;  5CI5 A;  3S2V A;  2Z22 A;  1MXY A;  1MM6 A;  4GF8 A;  1QKB A;  4ESX A;  4GL8 A;  2FNC A;  1ZJL A;  5B70 A;  3T93 B;  1B51 A;  5CMB A;  3Q28 A;  1B7U A;  2ALU A;  4DLD A;  1ZLQ A;  1P1W A;  2GHB A;  2DWH A;  2F7C A;  2F97 A;  4GRK A;  3IB2 A;  3MUQ A;  4OEV A;  4Z7E A;  1Q1K A;  3KOT A;  4BDM A;  2PT1 A;  4YKK A;  1B40 A;  1LST A;  1PBP A;  5CBR A;  4PFY A;  1IXH A;  3QIM A;  1BIY A;  1O63 A;  3FD3 A;  3HHG A;  3LUY A;  3SEU A;  5L8D A;  3T9H B;  1NH7 A;  1FTM A;  5TP9 B;  2ZXT A;  5I2N A;  3C9H A;  2NOO A;  4THI A;  1PB8 A;  1B52 A;  1JEU A;  4OES A;  3PD8 A;  4ZZA A;  1B4Z A;  3VVF A;  3TQW A;  2V93 A;  4NE4 A;  1IEJ A;  1P99 A;  1OIB A;  1B3L A;  3OO8 A;  1B4H A;  5TU0 A;  1ZMG A;  1VFD A;  1JQF A;  1S9T A;  1FQB A;  3MZ9 A;  3K4U A;  3EN3 A;  4WED A;  2R6G E;  1N3W A;  1GR2 A;  3O6G A;  2HZL A;  4QFL A;  1MY3 A;  1QUI A;  4H67 A;  1GV8 A;  1ZBM A;  4QFK A;  3VLW A;  5FHN A;  4YMA A;  3WAF A;  4G8H A;  1I6A A;  1NMU A;  4QF9 A;  5AA2 B;  3RPW A;  3MWB A;  1A8F A;  4U1O A;  4ZEC A;  4POX A;  3MQ9 A;  1D4N A;  1LB8 A;  4R72 A;  3K1N A;  4DE8 A;  4FAT A;  4FED A;  4GL0 A;  3TTR A;  3LC8 A;  3HHF A;  4IB2 A;  3O2A A;  5A5X A;  3F11 A;  5ELV A;  3TYH A;  4LZ8 A;  3CSG A;  3MVX A;  1MY1 A;  5I57 B;  4GXA A;  5ITO A;  1LBB A;  2V25 A;  3U94 A;  4EDP A;  1PB7 A;  1PB9 A;  2I4C A;  2XXH A;  3IX1 A;  1CE2 A;  2Q88 A;  4EQ9 A;  3K01 A;  5AA4 A;  1F9B A;  4OXV A;  3PUX E;  4K3F A;  5CBS A;  4QHQ A;  4U22 A;  3SES A;  4G68 B;  2I3V A;  2Q89 A;  3L6H A;  1B7H A;  3CI8 A;  5FHM A;  4IO4 A;  3OEK A;  3RTF B;  4RY1 A;  4FOR A;  5I2K A;  3DP4 A;  3V8X B;  3FJG A;  2Q8J A;  3VLU A;  3KFM A;  2ZYN A;  3PD9 A;  2ZNU A;  4H8I A;  2ZYK A;  4QFO A;  3A09 A;  2ANJ A;  1O7T A;  4RK2 A;  2F78 A;  2QL3 A;  1P1N A;  3S9L C;  2ONS A;  3H03 A;  5FHO A;  4ZE9 A;  1POY 1;  4NF8 A;  3UOR A;  5H8H A;  4C0R A;  3SEY A;  4IO7 A;  4F19 A;  1Y1Z A;  3CSB A;  2DVC A;  5BUU A;  1SI0 A;  3D4C A;  1ZTY A;  3BKI B;  4H8J A;  1B7Z A;  3FUZ A;  3FGS A;  4ELO A;  2XXI A;  5H8F B;  4X1D A;  5FTI A;  1RKM A;  1Y3P A;  1NL5 A;  4BDR A;  4MBP A;  1MQJ A;  3THI A;  3DP8 A;  1JW4 A; 
#chains in the Genus database with same CATH topology
 3CIJ A;  4G4P A;  3ODB A;  1YAE A;  4NAP A;  3T22 A;  2R71 A;  4H5G A;  1AL3 A;  3QAX A;  5I5P A;  2UVH A;  2REJ A;  3KSJ A;  3IL1 B;  5DEX A;  3N6T A;  4H65 A;  1LAG E;  3V89 B;  4NF5 B;  3T9U A;  3G3F A;  1JW1 A;  4HCY A;  1FPK A;  2THI A;  1NUX A;  1QUK A;  2G29 A;  1A99 A;  3RN8 A;  5A5L A;  4LQ2 A;  1NNK A;  1VFE A;  2YJP A;  2F36 A;  4RA1 A;  4NF4 B;  1LBV A;  3MZ1 A;  1PBQ A;  3PU5 A;  3DM0 A;  1S50 A;  3C36 A;  4NX1 A;  3RPL B;  1ZIU A;  3MPL A;  2DE2 A;  3QUF A;  2A5T B;  3RUM A;  1FPD A;  3K6U A;  4HE2 A;  2PFY A;  1N04 A;  4FJP A;  4O7I A;  1SYI A;  3LSF B;  3T96 B;  4ZE8 A;  5LDZ A;  3TZA A;  5ET7 A;  4EF2 A;  4Q5T A;  1SD3 A;  4U23 A;  4GWO A;  3CHG A;  4MNC A;  1D9V A;  2OK2 A;  2HHM A;  3B6Q A;  1B58 A;  4DXC A;  1XI6 A;  4ZED A;  4Q0C A;  2XD2 A;  1L5T A;  1H3D A;  1POT A;  2G93 A;  3H6T A;  1BK4 A;  3S4U A;  2DP8 A;  3Q29 A;  4N6K A;  1J1N A;  4ESW A;  2GHA A;  3G3I A;  2M8C A;  3PPR A;  2XD3 A;  3K00 A;  4LAT A;  2OLB A;  2QMX A;  3N6U A;  2DXR A;  1R9Q A;  4H45 A;  1B3H A;  2QVU A;  3Q25 A;  4M1V A;  2V3U A;  3K1P A;  1UTH B;  3O66 A;  1Z7N E;  1XT8 A;  3MVZ A;  4RNS A;  4R75 A;  2QS2 A;  3Q27 A;  5EQ9 A;  2F35 A;  4M4G A;  3M3F A;  3MP1 A;  5FBP A;  3N5L A;  4N15 A;  4WKM A;  4YB5 A;  3VXB A;  4JXI A;  1SW4 A;  3CG1 A;  4PFT A;  4EXL A;  5I59 A;  2R9J A;  3I6V A;  1B5H A;  3CR9 A;  3IJO B;  4MFI A;  1QW0 A;  5H8S A;  1MQI A;  1FTA A;  2WKY A;  3S9E A;  4F2O A;  2DOJ A;  4QRZ A;  3E9X A;  4F31 B;  2Q2C A;  4O8M A;  4IY6 A;  4RPN A;  4G8M A;  3PTY A;  3JYR A;  4G68 C;  1EYJ A;  1MPD A;  3KJT A;  3O6I A;  4ZEB A;  4MF3 A;  4NF0 A;  4PCD A;  2FVZ A;  2O1M A;  2Y84 A;  3RY3 A;  3R7X A;  4OA4 A;  1VE4 A;  2O84 X;  3UN6 A;  2NVU B;  3KOS A;  3CRB A;  4GQO A;  2NWJ A;  2V4C A;  4LA9 A;  2P3V A;  4F29 A;  5B7D A;  3E3K A;  4PBH A;  1LGB C;  1LFG A;  5K2X A;  3HN0 A;  4OHN A;  2ZYM A;  4MAG A;  2H9B A;  3FV2 A;  4OET A;  1Z7M E;  3TTM A;  1AOV A;  4ONY A;  2WX9 A;  1NV6 A;  3JZJ A;  3TFL A;  1GVC A;  1SVX B;  1MQH A;  5DYH A;  1XOC A;  3TEL A;  3H06 B;  3HO7 A;  4G61 A;  5H8N A;  1YYZ A;  1MXV A;  3FIR A;  2B3F A;  3BIG A;  4BDO A;  1IIT A;  4XFE A;  2I4B A;  2OZZ A;  1MY0 A;  4X9T A;  4MNI A;  1ANF A;  4QFN A;  1B5J A;  3U92 A;  2F3D A;  1EYI A;  2O6A A;  3LBS A;  4NTL A;  2ESN A;  5I7I A;  5EHS A;  4XKN A;  4JVI A;  3I3V A;  1DMB A;  4N07 A;  3OSQ A;  4Q8R A;  2XXU A;  4FE8 A;  3RT6 B;  2BJI A;  1HSL A;  2RCB A;  4NHB A;  4I8C A;  2HAV A;  4WEP A;  4JWY A;  4ISU A;  4ZEI A;  3D1R A;  4F39 A;  2I6E A;  2FYI A;  4PAF A;  3B6T A;  1OLC A;  2B4M A;  4ZDM A;  5EQA A;  3B7D A;  4O3C A;  5ET6 A;  1RDX A;  3T0J A;  4U21 A;  1AIV A;  1ELJ A;  1EU8 A;  2ONR A;  1EYK A;  2YPN A;  1INP A;  1FQF A;  3DLN A;  2WYK A;  1Y1M A;  4G8N A;  1FBF A;  2QVV A;  2R8T A;  1AMF A;  5ET5 A;  4RK9 A;  3EQ1 A;  3UK4 A;  1Y4T A;  4HE1 A;  4JDF A;  4EF1 A;  1URD A;  4HXV A;  1JEV A;  4N81 A;  1UTB B;  2FIX A;  2P1S A;  3OEM A;  1URG A;  3IK6 B;  3FVO A;  4GVO A;  4GD5 A;  4G2Z A;  1S7Y A;  2NXO A;  4IY5 A;  3OO9 A;  1MH3 A;  5KDT B;  4LQ5 A;  5KZT A;  3SDF A;  1MPB A;  1N84 A;  5M2V A;  3FJM A;  4WXJ A;  1H44 A;  3N94 A;  3PPO A;  1NV7 A;  3QK6 A;  4E0X A;  4DI4 B;  3RNN A;  1MRP A;  1VSO A;  3TEP A;  3HFU A;  2O51 A;  3TCG A;  2B3B A;  1NUZ A;  1ATG A;  1H76 A;  5KCJ B;  2PVU A;  5I56 A;  4IO5 A;  4OER A;  2F3B A;  1PEB A;  2RKM A;  4XEQ A;  5EYF A;  3W9V A;  3MAM A;  3PPN A;  2YLN A;  3PUZ E;  1MDQ A;  4GWU A;  2REG A;  3KZG A;  4NF6 A;  4BDN A;  3A3C A;  4JB7 A;  3C34 A;  2Z8E A;  2I0B A;  4IO6 A;  3K2D A;  3PMV A;  5I58 B;  2NUV A;  3USD A;  2ZNS A;  2ONK E;  4RXL A;  1Y4C A;  3KN7 A;  1M5D A;  1B46 A;  4X1B A;  5H8Q B;  3B50 A;  2AL4 A;  4DXU A;  5TPA B;  5CC2 A;  3PUV E;  1EH3 A;  3KGC A;  1I6Q A;  4P11 A;  1MG1 A;  2FBP A;  2F6P A;  1OMP A;  4GLI A;  4N6P A;  3SEV A;  2PMS A;  4U2R A;  4DIG A;  2VOZ A;  5JK4 A;  4DI3 D;  2X7Q A;  3QUJ A;  3B6W A;  4P9K A;  4ZEF A;  4NN3 A;  3MJN A;  1NV0 A;  4X04 A;  5ICQ A;  3E78 A;  5EHM A;  3OOA A;  3O9P A;  1JET A;  4POW A;  1IMD A;  1B1X A;  2GQ1 A;  1GGG A;  2F8D A;  3IOV A;  2I3W A;  5JTY B;  1LLS A;  3NOH A;  1B1H A;  4R9F A;  2E1S A;  4DZ1 A;  5F7V A;  3KC0 A;  3S9M C;  3EHU A;  3VLV A;  3EPE A;  4P3L A;  3VFJ A;  1TFD A;  1N3X A;  3IOR A;  4F2Q A;  3HPI A;  2O69 A;  2WYP A;  4XKQ A;  3MVY A;  2RIN A;  3FXR A;  2V3T A;  1IMB A;  4N13 A;  3RT8 A;  4OEU A;  1D9Q A;  1NFT A;  1B3F A;  1QUL A;  1SYH A;  3O97 A;  3FV1 A;  5TP9 A;  1MY2 A;  3W9W A;  3DEL B;  3MPK A;  4MLV A;  4NWD A;  2OWT A;  4NMY A;  4KI0 E;  2B4L A;  4AQ4 A;  1H43 A;  4MIJ A;  3ZKK A;  1KA1 A;  1SDX A;  3EHT A;  2XXY A;  3UA8 A;  5AE4 A;  1IQ7 A;  4DCY A;  1OQG A;  4YAH X;  2D21 A;  4KPT A;  4PGP A;  3V5A A;  1Y3Q A;  2D5W A;  3OEN A;  3G3G A;  1DK4 A;  1QJM A;  2V3Q A;  1QVS A;  4C1U A;  1IMF A;  3TAJ A;  1ZU0 A;  1O64 A;  5IZ3 A;  4OTE A;  3T9V A;  2HCA A;  3MP8 A;  1B9J A;  4R74 A;  4F1V A;  1NV2 A;  1IIW A;  1MY4 A;  3ILU B;  4JVD A;  4OVP A;  2Z8F A;  4TQU Q;  5J1D A;  1JNF A;  2MKZ A;  3SKP A;  4KD5 A;  2HQ0 A;  4YZZ A;  1FCK A;  4ECF A;  5AA2 A;  2H25 A;  2V84 A;  2XXW A;  2UVG A;  4NGU A;  2OBG A;  4I3E A;  4O3B A;  1PDA A;  2XA5 A;  5IAI A;  2VP1 A;  3OO6 A;  2AYS A;  1DTG A;  3FAT A;  4BDL A;  5EYH A;  4YKP A;  4IR8 A;  4P0I A;  1BTJ A;  1MQD A;  2HPG A;  2Z23 A;  5IGA A;  4G77 A;  4R2F A;  2XHD A;  4OFO A;  3TOD A;  1LB9 A;  3OSR A;  4MLQ A;  1Y20 A;  2XX8 A;  4ND9 A;  4N8Y A;  1G0H A;  3KBR A;  5I57 A;  3D4G A;  2CMO A;  3CVG A;  1R6Z A;  1MPC A;  3K1M A;  4IO3 A;  1DCU A;  1NNP A;  2Q9T A;  3PMW A;  1FBD A;  4IGT A;  4F1Y A;  1SQY A;  4FEB A;  1JP4 A;  5DVJ A;  1YCJ A;  3RQT A;  3TUS A;  4O3A A;  3Q26 A;  5EYG A;  3PGF A;  1CB6 A;  1UQW A;  3TCH A;  4KCC A;  4G68 A;  4KHZ E;  4NED A;  1FPL A;  4KYD A;  4PFU A;  2WEF A;  4R6K A;  1RYX A;  2Y5L A;  2VPN A;  3FVN A;  4C1T A;  2ZNT A;  3RLF E;  2LAO A;  2RC9 A;  3WAE A;  5I2N B;  3GBB A;  2XXQ A;  4MMP A;  3TMG A;  3C32 A;  3H4Z A;  1Q35 A;  1JVX A;  1NH8 A;  3IJX B;  3SET A;  3VDF A;  3SEX A;  1XVX A;  2HAU A;  1URS A;  4FAJ A;  3LSW A;  4OVJ A;  5EQ8 A;  1US4 A;  3EHS A;  1UIV A;  2DVZ A;  1P1U A;  4KYE A;  4YB7 A;  3RYD A;  3IFC A;  3TTN A;  1A8E A;  1LBC A;  3K02 A;  1M5B A;  4I9D A;  1B05 A;  4L17 A;  2DYX A;  3B8B A;  4NWC A;  3UP9 A;  2E0S A;  1QGX A;  3KSX A;  2QMW A;  3BFU A;  1A40 A;  2VD3 A;  3EF7 A;  2QPQ A;  2PCR A;  5H8F A;  2UVJ A;  1OLA A;  5DVI A;  4F3P A;  3O28 A;  2UYE A;  1N76 A;  3CFX A;  3VE1 B;  1IUD A;  2UYF A;  3K6X A;  3H6U A;  1D9Y A;  3BIH A;  3GZG A;  1SI1 A;  1LBY A;  5JEI A;  3AXF A;  3A29 A;  3IR1 A;  2DE3 A;  4H6D A;  2XXP A;  4HE0 A;  3MBP A;  4RJZ A;  1WVJ A;  3M3K A;  4IGR A;  4Q30 B;  4AB5 A;  3PUW E;  3TDJ A;  2O1L A;  4LZ7 A;  3OO7 A;  3QMF A;  3P7I A;  1GTK A;  3V83 A;  4U1Z A;  4NF5 A;  1TFA A;  3E4R A;  4RPO A;  5HBC A;  5IZZ A;  1LAX A;  2P0S A;  3U72 A;  2O68 A;  4PBQ A;  5A5X B;  1MXW A;  1US5 A;  3KJ7 A;  4HW8 A;  2VD2 A;  3RTW B;  1FTL A;  3C31 A;  5IKB A;  3G3H A;  4NQ8 A;  4NF4 A;  3R6U A;  3H7M A;  2AIX A;  3MC2 A;  1P1O A;  1DBZ A;  2W7Y A;  4KR5 A;  3RPL A;  4PP0 A;  2L5V A;  3VVD A;  2RC7 A;  2P2A A;  4KCD A;  1WDN A;  2GH9 A;  2A5T A;  3SZP A;  3OEL A;  1NKX A;  2DQV A;  1LFI A;  1R9L A;  5AA4 B;  1I6B A;  3QYT A;  1LBX A;  2Y7I A;  3W15 C;  2F6G A;  5LTC A;  2VHA A;  4MH5 A;  2X26 A;  5T3J A;  3MW0 A;  3HST A;  2DDK A;  5EQ7 A;  1FJ9 A;  4XKR A;  1IMA A;  2XXT A;  3TTL A;  5FTH A;  5I2K B;  3ECR A;  5J16 A;  2OWS A;  3U65 A;  1MXX A;  1OQH A;  1SPI A;  2XX9 A;  3UGW A;  4P0G A;  3ONM A;  1FQC A;  5ICT A;  1YZ0 A;  4KFQ A;  3O6H A;  1FJ6 A;  2Y5K A;  4BLA A;  3S9N C;  1LAF E;  3IO6 A;  1M5F A;  3GYY A;  1G0I A;  4GWS A;  5L9O A;  3G3J A;  4OVT A;  4ZEK A;  5DTB A;  1MXZ A;  1RYO A;  4BDQ A;  4FIM A;  2I48 A;  4NF8 B;  3U8Q A;  1UTH A;  5H8H B;  3IB0 A;  3IAZ A;  4IO2 A;  4TOZ A;  1XHY A;  4EUO A;  4LON B;  3PPQ A;  5CRY A;  1SW1 A;  4EQB A;  1FPI A;  4GBW A;  1NUY A;  4YKJ A;  5ET8 A;  1UIU A;  1Y9U A;  2Q74 A;  4O94 A;  3VV5 A;  4LZ5 A;  4TLM B;  1FQA A;  4OVS A;  5I84 A;  1LCT A;  5DEX B;  1FQD A;  2ABH A;  3MVW A;  1N7W A;  5CMM A;  4GOT A;  3TQL A;  1RDZ A;  4R2B A;  1VR5 A;  3ISP A;  2Z8D A;  5AA2 D;  3M8U A;  2FHY A;  4MEV A;  4LUB A;  4PFW A;  1XVY A;  2Y7P A;  4F18 A;  3K6W A;  3PUY E;  3TKD A;  3A3U A;  2HXW A;  1B0H A;  4GX3 A;  4XIG Q;  2D3I A;  4F1U A;  1B3G A;  4MJO A;  2XXX A;  3FXB A;  2DXY A;  1YPN A;  2CZI A;  1B0L A;  1KWH A;  3FZV A;  4FEC A;  4GXS B;  3VXC A;  4XTC Q;  5HPQ A;  1DSN A;  4XKP A;  1TXF A;  2DE4 A;  2BJJ X;  4OQO A;  1B2H A;  3T66 A;  4GWZ A;  2H98 A;  4OWD A;  5L9M A;  3IOW A;  4GWY A;  3SEW A;  5LOM A;  2WBB A;  3FVK A;  4DCX A;  4E0W A;  1MH4 A;  4MCO A;  4QSE A;  4GBV A;  2VPO A;  3KEI A;  4R6Y A;  1B3E A;  3FXQ A;  3R26 A;  4PAI A;  3TTK A;  2DWI A;  3QXM A;  1AH5 A;  4I40 A;  3G7W A;  1JW5 A;  3IFA A;  1D3K A;  1R1N A;  2Q2A A;  1LCF A;  1N7X A;  4PDD A;  2UVI A;  3CFZ A;  1M5C A;  4LP2 B;  4OMB A;  5I59 B;  2VGQ A;  4H46 A;  4PET A;  1FW0 A;  4U4X A;  4TLL B;  4OYV A;  4H1X A;  2XXR A;  3BBR A;  1MS7 A;  1DOT A;  1SW2 A;  4ELP A;  3FJ7 A;  2CZL A;  4PDH A;  4R6H A;  4QSD A;  1FTJ A;  2B65 A;  4X48 A;  3DP6 A;  2CEY A;  1USY E;  1FTK A;  1H45 A;  1NV1 A;  1IXG A;  3KG2 A;  3GXA A;  3IOT A;  5F1Q A;  4PE3 A;  4UAC A;  2DS9 A;  1FSA A;  1UTB A;  4MHF A;  3ILT B;  3IO4 A;  4JVC A;  1SW5 A;  2O7U A;  1NNF A;  2FIE A;  3OMB A;  2CEX A;  2OX3 A;  1II5 A;  4XXU A;  4OFL A;  4PGN A;  1M5E A;  5AA3 A;  1N0T A;  2I49 A;  2QS4 A;  3M3L A;  5KDT A;  1JVY A;  2PT2 A;  4H5F A;  4I1D A;  3FXU A;  2XX7 A;  1USY H;  2KR0 A;  4PFR A;  4YU0 A;  3OXN A;  1IXC A;  1I69 A;  1MXU A;  2F34 A;  4GFR A;  1LFH A;  4ELR A;  4QXD A;  4F22 A;  2AL5 A;  2KQZ A;  1YTV A;  2Y7W A;  4P8B A;  1MM7 A;  1BP5 A;  2F7B A;  2Y7K A;  5KCJ A;  1NV3 A;  2QVR A;  3CG3 A;  3IOU A;  1XS5 A;  3LV0 A;  3IB1 A;  3C4M A;  1EZ9 A;  5BWJ A;  5L9S A;  3K6V A;  4QSC A;  3RGY A;  2X7P A;  4F3G A;  2O7I A;  4AB6 A;  2CZK A;  4DDD A;  1XC1 A;  2I58 A;  2H99 A;  1PC3 A;  2UXA A;  2HFB A;  4AS5 A;  2IA4 A;  4XF5 A;  2OJT A;  1B32 A;  1A54 A;  5HM4 B;  4PAK A;  1FRP A;  2H5Y A;  5H8N B;  5DW8 A;  4HS7 A;  3PV0 E;  1DTZ A;  4N8G A;  1MDP 1;  4P47 A;  2WBD A;  5CMK A;  3QSL A;  2I0C A;  1LAH E;  2KLF A;  5I58 A;  1EZO A;  3O29 A;  4PE5 B;  1T0K A;  4YB6 A;  1IMC A;  4KQP A;  2FA7 A;  2A5S A;  4YIC A;  2PBW A;  4LN5 A;  5ITP A;  3MST A;  1HSJ A;  5H8Q A;  1K9Z A;  1HSE A;  5TPA A;  4YMB A;  4LVQ A;  2PFZ A;  3GLB A;  3L6G A;  2Y7R A;  1P1Q A;  4KYS A;  4UA8 A;  1RDY A;  2QS1 A;  4ZZE A;  4PC9 A;  1FTO A;  3ZSF A;  5DVF A;  1MQG A;  5CM6 A;  3VVE A;  1QUJ A;  3KN3 A;  1EZP A;  3G3K A;  3UIF A;  4OZ9 A;  4OEN A;  4NG7 A;  3H6V A;  1LBW A;  3MZB A;  2XWK A;  4AS4 A;  3C33 A;  3LSL A;  3U93 A;  4X8R A;  2DSF A;  2F5X A;  3HV1 A;  3KC1 A;  5JTY A;  4JSD A;  3T1B A;  4KXP A;  3ZKL A;  4JWO A;  4FBP A;  2HEU A;  1FPJ A;  1OVT A;  4EXK A;  2DWJ A;  2XXK A;  1BLF A;  1FBG A;  1BKA A;  1FBE A;  1B6H A;  2RCA A;  1QKA A;  3KN8 A;  3U1O A;  1FPG A;  1SBP A;  2RF1 A;  1NV5 A;  2ZYO A;  4RYA A;  4JWX A;  1TT1 A;  1NNT A;  3TCF A;  1IME A;  2OCU A;  4N4U A;  4R73 A;  2QS3 A;  4N17 A;  3BFT A;  1TWY A;  4GWW A;  5ISU A;  2ZMB A;  1IZ1 A;  2QSX A;  3LR1 A;  4R9G A;  3H6W A;  3E13 X;  2GFE A;  1FQE A;  4MX6 A;  3CFL A;  3TPA A;  2XXV A;  3PMX A;  3C35 A;  3FVG A;  2XWV A;  3MYU A;  4DXB A;  2QJE A;  4F3B A;  1B5I A;  3GBA A;  4U4S A;  4Z0I A;  5I56 B;  4OFJ A;  1A55 A;  2HZK A;  4OAN A;  1WOD A;  1ZKB A;  2RC8 A;  2QRY A;  1OVB A;  3SER A;  1DPE A;  1FPB A;  3H3G A;  3FAS A;  5DT6 A;  1LEV A;  3LSX A;  1NUW A;  5CMC A;  1KA0 A;  2VT5 A;  4NF6 B;  4GIZ A;  4QFP A;  3ROJ A;  3MP6 A;  4ZS9 A;  5K2Y A;  3OD7 A;  5IM2 A;  3T9X B;  3PPP A;  2GRV A;  2Q8M A;  4EQ7 A;  4ELQ A;  2ZZX A;  4HTG A;  1FPE A;  1DPP A;  4P1E A;  4GX4 A;  3ZS6 A;  3JV9 A;  2DWA A;  4JBZ A;  1A7L A;  3I5O A;  5AA1 A;  4F3S A;  2H4I A;  3HCQ A;  3N26 A;  2PX1 A;  2PYY A;  4JSO A;  4PQJ A;  1Y3N A;  2F7A A;  1IXI A;  4I62 A;  3K0V A;  4HCW A;  4YKI A;  4H0W A;  2IEE A;  3EKI A;  5CI5 A;  3S2V A;  2Z22 A;  1MXY A;  1MM6 A;  4GF8 A;  5IZ1 A;  1QKB A;  1K9Y A;  4ESX A;  4GL8 A;  2FNC A;  5ESY A;  4PF8 A;  1ZJL A;  4GWX A;  5B70 A;  3T93 B;  1B51 A;  5CMB A;  3Q28 A;  1B7U A;  5I3S A;  2ALU A;  4DLD A;  1ZLQ A;  1P1W A;  2GHB A;  3E79 A;  2DWH A;  2F7C A;  2F97 A;  4MNP A;  4GRK A;  3IB2 A;  3MUQ A;  4OEV A;  1KZ8 A;  1LBZ A;  4Z7E A;  1Q1K A;  3KOT A;  4BDM A;  2PT1 A;  4YKK A;  1B40 A;  1LST A;  1PBP A;  5CBR A;  4PFY A;  1IXH A;  3QIM A;  1BIY A;  1O63 A;  3FD3 A;  3HHG A;  4P56 A;  3LUY A;  3SEU A;  5L8D A;  3T9H B;  1FBH A;  1NH7 A;  1FTM A;  5TP9 B;  2ZXT A;  5I2N A;  2XWO A;  3C9H A;  2NOO A;  4THI A;  1PB8 A;  1B52 A;  1JEU A;  4OES A;  3PD8 A;  4ZZA A;  1B4Z A;  3VVF A;  3TQW A;  2JJK A;  2V93 A;  4NE4 A;  1IEJ A;  1P99 A;  1OIB A;  1B3L A;  4PF6 A;  4N6D A;  3OO8 A;  1B4H A;  5TU0 A;  1ZMG A;  5IZ3 B;  1VFD A;  4N91 A;  1JQF A;  1S9T A;  1FQB A;  3MZ9 A;  3K4U A;  3EN3 A;  4WED A;  2R6G E;  1FPF A;  1N3W A;  1GR2 A;  3O6G A;  2HZL A;  4QFL A;  1MY3 A;  1QUI A;  1AWB A;  4H67 A;  1NI9 A;  1VDW A;  1GV8 A;  1ZBM A;  4QFK A;  3VLW A;  5FHN A;  2OWZ A;  4YMA A;  3WAF A;  4G8H A;  4O7M A;  3LUZ A;  1I6A A;  1NMU A;  1FBC A;  4QF9 A;  5AA2 B;  3RPW A;  3MWB A;  1A8F A;  4U1O A;  4ZEC A;  4POX A;  3MQ9 A;  1D4N A;  1LB8 A;  4R72 A;  4UAB A;  3K1N A;  1NV4 A;  4DE8 A;  4FAT A;  4FED A;  4GL0 A;  3FBP A;  3TTR A;  3LC8 A;  3HHF A;  4IB2 A;  3O2A A;  5A5X A;  3F11 A;  5ELV A;  3TYH A;  4I3Y A;  4LZ8 A;  3CSG A;  3MVX A;  4GX6 A;  1MY1 A;  2ZZV A;  5I57 B;  4GXA A;  5ITO A;  1LBB A;  2V25 A;  3U94 A;  2ZZW A;  1CNQ A;  4EDP A;  1PB7 A;  4PFI A;  1PB9 A;  2I4C A;  2XXH A;  3IX1 A;  1CE2 A;  2Q88 A;  4EQ9 A;  3K01 A;  5AA4 A;  1F9B A;  4OXV A;  3PUX E;  4K3F A;  5CBS A;  4U22 A;  4QHQ A;  2P3N A;  3SES A;  4G68 B;  2I3V A;  2Q89 A;  1Q9D A;  3L6H A;  1B7H A;  3CI8 A;  5FHM A;  4IO4 A;  3OEK A;  3RTF B;  4RY1 A;  4FOR A;  5I2K A;  1FBP A;  3DP4 A;  3V8X B;  3FJG A;  5F24 A;  2Q8J A;  4PTK A;  2HXR A;  3VLU A;  3KFM A;  4QBA A;  1YXI A;  2ZYN A;  3PD9 A;  2ZNU A;  4H8I A;  2ZYK A;  4QFO A;  4P1L A;  3KBZ A;  3A09 A;  2ANJ A;  1O7T A;  4OVQ A;  2CZH A;  4RK2 A;  2F78 A;  2QL3 A;  1P1N A;  3S9L C;  2ONS A;  3H03 A;  5FHO A;  4ZE9 A;  1POY 1;  4NF8 A;  2QFL A;  3UOR A;  5H8H A;  4C0R A;  3SEY A;  4IO7 A;  4OVR A;  4F19 A;  1Y1Z A;  3CSB A;  2DVC A;  5BUU A;  1SI0 A;  3D4C A;  1ZTY A;  3BKI B;  4H8J A;  1B7Z A;  3FUZ A;  2XWI A;  3FGS A;  4ELO A;  2XXI A;  5H8F B;  4X1D A;  5FTI A;  1RKM A;  1Y3P A;  1NL5 A;  4BDR A;  4MBP A;  1MQJ A;  3THI A;  3DP8 A;  4PFB A;  1JW4 A; 
#chains in the Genus database with same CATH homology
 3CIJ A;  4G4P A;  3ODB A;  1YAE A;  3T22 A;  2R71 A;  4H5G A;  1AL3 A;  3QAX A;  2UVH A;  2REJ A;  3KSJ A;  3IL1 B;  5DEX A;  3N6T A;  4H65 A;  1LAG E;  3V89 B;  4NF5 B;  3T9U A;  3G3F A;  1JW1 A;  4HCY A;  2THI A;  1QUK A;  2G29 A;  1A99 A;  3RN8 A;  4LQ2 A;  1NNK A;  1VFE A;  2YJP A;  2F36 A;  4RA1 A;  4NF4 B;  3MZ1 A;  1PBQ A;  3PU5 A;  3DM0 A;  1S50 A;  3C36 A;  1ZIU A;  3MPL A;  2DE2 A;  3QUF A;  2A5T B;  3RUM A;  3K6U A;  1N04 A;  4FJP A;  1SYI A;  3LSF B;  3T96 B;  4ZE8 A;  3TZA A;  4EF2 A;  4Q5T A;  1SD3 A;  4U23 A;  4GWO A;  1D9V A;  2OK2 A;  3B6Q A;  1B58 A;  4DXC A;  4ZED A;  4Q0C A;  2XD2 A;  1L5T A;  1H3D A;  1POT A;  2G93 A;  3H6T A;  3S4U A;  2DP8 A;  3Q29 A;  1J1N A;  4ESW A;  2GHA A;  3G3I A;  2M8C A;  3PPR A;  2XD3 A;  3K00 A;  4LAT A;  2OLB A;  2QMX A;  3N6U A;  2DXR A;  1R9Q A;  1B3H A;  3Q25 A;  4M1V A;  2V3U A;  3K1P A;  1UTH B;  3O66 A;  1Z7N E;  1XT8 A;  3MVZ A;  4RNS A;  4R75 A;  2QS2 A;  3Q27 A;  2F35 A;  4M4G A;  3M3F A;  3MP1 A;  3N5L A;  4WKM A;  4YB5 A;  3VXB A;  4JXI A;  1SW4 A;  3CG1 A;  4PFT A;  4EXL A;  5I59 A;  2R9J A;  3I6V A;  1B5H A;  3CR9 A;  3IJO B;  4MFI A;  1QW0 A;  5H8S A;  1MQI A;  2WKY A;  3S9E A;  4F2O A;  2DOJ A;  4QRZ A;  3E9X A;  4F31 B;  2Q2C A;  4IY6 A;  4RPN A;  4G8M A;  3JYR A;  4G68 C;  1MPD A;  3KJT A;  3O6I A;  4ZEB A;  4MF3 A;  2O1M A;  2Y84 A;  3RY3 A;  3R7X A;  1VE4 A;  2O84 X;  3UN6 A;  2NVU B;  3KOS A;  3CRB A;  4GQO A;  2NWJ A;  4LA9 A;  4F29 A;  5B7D A;  3E3K A;  1LGB C;  1LFG A;  5K2X A;  3HN0 A;  4OHN A;  2ZYM A;  2H9B A;  3FV2 A;  4OET A;  1Z7M E;  3TTM A;  1AOV A;  4ONY A;  3JZJ A;  3TFL A;  1GVC A;  1SVX B;  1MQH A;  5DYH A;  1XOC A;  3TEL A;  3H06 B;  3HO7 A;  5H8N A;  1MXV A;  3FIR A;  2B3F A;  4BDO A;  1IIT A;  2I4B A;  2OZZ A;  1MY0 A;  4X9T A;  1ANF A;  4QFN A;  1B5J A;  3U92 A;  2O6A A;  3LBS A;  4NTL A;  2ESN A;  5EHS A;  4XKN A;  3I3V A;  1DMB A;  4N07 A;  3OSQ A;  4Q8R A;  2XXU A;  4FE8 A;  3RT6 B;  2RCB A;  1HSL A;  4I8C A;  2HAV A;  4WEP A;  4JWY A;  4ISU A;  4ZEI A;  4F39 A;  2I6E A;  2FYI A;  3B6T A;  1OLC A;  4ZDM A;  3B7D A;  4O3C A;  4U21 A;  1AIV A;  1ELJ A;  1EU8 A;  2ONR A;  2YPN A;  1FQF A;  3DLN A;  1Y1M A;  4G8N A;  1AMF A;  4RK9 A;  3EQ1 A;  3UK4 A;  1Y4T A;  4JDF A;  4EF1 A;  1URD A;  1JEV A;  1UTB B;  2P1S A;  3OEM A;  1URG A;  3IK6 B;  3FVO A;  4GVO A;  4GD5 A;  4G2Z A;  1S7Y A;  2NXO A;  4IY5 A;  3OO9 A;  1MH3 A;  5KDT B;  4LQ5 A;  5KZT A;  3SDF A;  1MPB A;  1N84 A;  5M2V A;  3FJM A;  4WXJ A;  1H44 A;  3N94 A;  3PPO A;  3QK6 A;  4E0X A;  3RNN A;  1MRP A;  1VSO A;  3TEP A;  2O51 A;  3TCG A;  2B3B A;  1ATG A;  1H76 A;  5KCJ B;  2PVU A;  5I56 A;  4IO5 A;  4OER A;  1PEB A;  2RKM A;  5EYF A;  3W9V A;  3MAM A;  3PPN A;  2YLN A;  3PUZ E;  1MDQ A;  2REG A;  3KZG A;  4NF6 A;  4BDN A;  3A3C A;  4JB7 A;  3C34 A;  2Z8E A;  2I0B A;  4IO6 A;  3K2D A;  3PMV A;  5I58 B;  2NUV A;  3USD A;  2ZNS A;  2ONK E;  4RXL A;  1Y4C A;  3KN7 A;  1M5D A;  1B46 A;  4X1B A;  5H8Q B;  2AL4 A;  4DXU A;  5TPA B;  5CC2 A;  3PUV E;  1EH3 A;  3KGC A;  1I6Q A;  4P11 A;  1MG1 A;  2F6P A;  1OMP A;  4GLI A;  4N6P A;  3SEV A;  2PMS A;  4U2R A;  4DIG A;  2VOZ A;  5JK4 A;  2X7Q A;  3QUJ A;  3B6W A;  4ZEF A;  3MJN A;  5ICQ A;  5EHM A;  3OOA A;  3O9P A;  1JET A;  4POW A;  1B1X A;  1GGG A;  2F8D A;  3IOV A;  2I3W A;  5JTY B;  1LLS A;  1B1H A;  4R9F A;  2E1S A;  4DZ1 A;  5F7V A;  3S9M C;  3EHU A;  3VLV A;  3EPE A;  3VFJ A;  1TFD A;  1N3X A;  3IOR A;  4F2Q A;  3HPI A;  2O69 A;  4XKQ A;  3MVY A;  2RIN A;  3FXR A;  2V3T A;  4N13 A;  3RT8 A;  4OEU A;  1NFT A;  1B3F A;  1QUL A;  1SYH A;  3O97 A;  3FV1 A;  5TP9 A;  1MY2 A;  3W9W A;  3DEL B;  3MPK A;  4MLV A;  4NMY A;  2OWT A;  4NWD A;  4KI0 E;  4AQ4 A;  1H43 A;  3ZKK A;  1SDX A;  3EHT A;  2XXY A;  3UA8 A;  5AE4 A;  1IQ7 A;  4DCY A;  1OQG A;  4YAH X;  2D21 A;  4KPT A;  3V5A A;  1Y3Q A;  2D5W A;  3OEN A;  3G3G A;  1QJM A;  2V3Q A;  1QVS A;  4C1U A;  3TAJ A;  1ZU0 A;  1O64 A;  4OTE A;  3T9V A;  2HCA A;  3MP8 A;  1B9J A;  4R74 A;  4F1V A;  1IIW A;  1MY4 A;  3ILU B;  2Z8F A;  4TQU Q;  5J1D A;  1JNF A;  3SKP A;  4KD5 A;  2HQ0 A;  4YZZ A;  1FCK A;  4ECF A;  5AA2 A;  2H25 A;  2V84 A;  2XXW A;  2UVG A;  2OBG A;  4O3B A;  1PDA A;  5IAI A;  2VP1 A;  3OO6 A;  2AYS A;  1DTG A;  3FAT A;  4BDL A;  4YKP A;  4P0I A;  1BTJ A;  1MQD A;  2Z23 A;  4G77 A;  4R2F A;  2XHD A;  4OFO A;  3TOD A;  1LB9 A;  3OSR A;  4MLQ A;  1Y20 A;  2XX8 A;  4ND9 A;  3KBR A;  5I57 A;  3D4G A;  2CMO A;  3CVG A;  1R6Z A;  1MPC A;  3K1M A;  4IO3 A;  1NNP A;  2Q9T A;  3PMW A;  4IGT A;  4F1Y A;  1SQY A;  4FEB A;  5DVJ A;  1YCJ A;  3RQT A;  3TUS A;  4O3A A;  3Q26 A;  3PGF A;  1CB6 A;  1UQW A;  3TCH A;  4KCC A;  4G68 A;  4KHZ E;  4NED A;  4KYD A;  4PFU A;  4R6K A;  1RYX A;  3FVN A;  4C1T A;  2ZNT A;  3RLF E;  2LAO A;  2RC9 A;  3WAE A;  5I2N B;  3GBB A;  2XXQ A;  3TMG A;  3C32 A;  3H4Z A;  1Q35 A;  1JVX A;  1NH8 A;  3IJX B;  3SET A;  3VDF A;  3SEX A;  1XVX A;  2HAU A;  1URS A;  4FAJ A;  3LSW A;  4OVJ A;  1US4 A;  3EHS A;  1UIV A;  2DVZ A;  1P1U A;  4KYE A;  4YB7 A;  3TTN A;  1A8E A;  1LBC A;  3K02 A;  1M5B A;  4I9D A;  1B05 A;  4L17 A;  2DYX A;  4NWC A;  3UP9 A;  2E0S A;  3KSX A;  2QMW A;  3BFU A;  1A40 A;  2VD3 A;  3EF7 A;  2QPQ A;  5H8F A;  2UVJ A;  1OLA A;  5DVI A;  4F3P A;  3O28 A;  2UYE A;  1N76 A;  3CFX A;  3VE1 B;  1IUD A;  2UYF A;  3K6X A;  3H6U A;  1D9Y A;  3GZG A;  1SI1 A;  5JEI A;  3AXF A;  3IR1 A;  2DE3 A;  4H6D A;  2XXP A;  3MBP A;  4RJZ A;  1WVJ A;  3M3K A;  4IGR A;  4Q30 B;  4AB5 A;  3PUW E;  3TDJ A;  2O1L A;  4LZ7 A;  3OO7 A;  3P7I A;  1GTK A;  3V83 A;  4U1Z A;  4NF5 A;  1TFA A;  3E4R A;  4RPO A;  5HBC A;  1LAX A;  2P0S A;  3U72 A;  2O68 A;  5A5X B;  1MXW A;  1US5 A;  3KJ7 A;  4HW8 A;  2VD2 A;  3RTW B;  1FTL A;  3C31 A;  5IKB A;  3G3H A;  4NF4 A;  3R6U A;  3H7M A;  2AIX A;  3MC2 A;  1P1O A;  2W7Y A;  4KR5 A;  4PP0 A;  3VVD A;  2RC7 A;  2P2A A;  4KCD A;  1WDN A;  2GH9 A;  2A5T A;  3OEL A;  1NKX A;  2DQV A;  1LFI A;  1R9L A;  5AA4 B;  1I6B A;  3QYT A;  2Y7I A;  3W15 C;  2F6G A;  2VHA A;  4MH5 A;  2X26 A;  3MW0 A;  3HST A;  4XKR A;  2XXT A;  3TTL A;  5FTH A;  5I2K B;  3ECR A;  2OWS A;  1MXX A;  1OQH A;  2XX9 A;  3UGW A;  4P0G A;  3ONM A;  1FQC A;  5ICT A;  4KFQ A;  3O6H A;  4BLA A;  3S9N C;  1LAF E;  3IO6 A;  1M5F A;  5L9O A;  3G3J A;  4ZEK A;  5DTB A;  1MXZ A;  1RYO A;  4BDQ A;  4FIM A;  2I48 A;  4NF8 B;  3U8Q A;  1UTH A;  5H8H B;  3IB0 A;  3IAZ A;  4IO2 A;  4TOZ A;  1XHY A;  4EUO A;  4LON B;  3PPQ A;  5CRY A;  1SW1 A;  4EQB A;  4YKJ A;  1UIU A;  1Y9U A;  3VV5 A;  4LZ5 A;  4TLM B;  1FQA A;  5I84 A;  1LCT A;  5DEX B;  1FQD A;  2ABH A;  3MVW A;  1N7W A;  5CMM A;  4GOT A;  3TQL A;  4R2B A;  1VR5 A;  2Z8D A;  5AA2 D;  3M8U A;  4LUB A;  4PFW A;  1XVY A;  2Y7P A;  4F18 A;  3K6W A;  3PUY E;  3TKD A;  3A3U A;  2HXW A;  1B0H A;  4XIG Q;  2D3I A;  4F1U A;  1B3G A;  2XXX A;  2DXY A;  1YPN A;  1B0L A;  1KWH A;  3FZV A;  4FEC A;  4GXS B;  3VXC A;  4XTC Q;  5HPQ A;  1DSN A;  4XKP A;  1TXF A;  2DE4 A;  2BJJ X;  4OQO A;  1B2H A;  3T66 A;  2H98 A;  4OWD A;  5L9M A;  3IOW A;  3SEW A;  5LOM A;  3FVK A;  4DCX A;  4E0W A;  1MH4 A;  4QSE A;  3KEI A;  4R6Y A;  1B3E A;  3FXQ A;  3R26 A;  3TTK A;  2DWI A;  3QXM A;  1AH5 A;  3G7W A;  1JW5 A;  1D3K A;  1R1N A;  2Q2A A;  1LCF A;  1N7X A;  2UVI A;  3CFZ A;  1M5C A;  4LP2 B;  4OMB A;  5I59 B;  2VGQ A;  4PET A;  1FW0 A;  4U4X A;  4TLL B;  4OYV A;  4H1X A;  2XXR A;  3BBR A;  1MS7 A;  1DOT A;  1SW2 A;  4ELP A;  3FJ7 A;  2CZL A;  4R6H A;  4QSD A;  1FTJ A;  2B65 A;  4X48 A;  3DP6 A;  1USY E;  1FTK A;  1H45 A;  1IXG A;  3KG2 A;  3GXA A;  3IOT A;  5F1Q A;  4UAC A;  2DS9 A;  1UTB A;  3ILT B;  3IO4 A;  1SW5 A;  2O7U A;  1NNF A;  3OMB A;  1II5 A;  4XXU A;  4OFL A;  1M5E A;  5AA3 A;  1N0T A;  2I49 A;  2QS4 A;  3M3L A;  5KDT A;  1JVY A;  2PT2 A;  4I1D A;  3FXU A;  4YU0 A;  2XX7 A;  1USY H;  4H5F A;  3OXN A;  1IXC A;  1I69 A;  1MXU A;  2F34 A;  4GFR A;  1LFH A;  4ELR A;  4F22 A;  2AL5 A;  1YTV A;  2Y7W A;  1MM7 A;  1BP5 A;  2F7B A;  2Y7K A;  5KCJ A;  3CG3 A;  3IOU A;  1XS5 A;  3IB1 A;  3C4M A;  1EZ9 A;  5BWJ A;  5L9S A;  3RGY A;  3K6V A;  4QSC A;  2X7P A;  4F3G A;  4AB6 A;  2O7I A;  4DDD A;  1XC1 A;  2I58 A;  2H99 A;  1PC3 A;  2UXA A;  2HFB A;  2IA4 A;  2OJT A;  1B32 A;  1A54 A;  5HM4 B;  2H5Y A;  5H8N B;  4HS7 A;  3PV0 E;  1DTZ A;  1MDP 1;  5CMK A;  3QSL A;  2I0C A;  1LAH E;  2KLF A;  5I58 A;  1EZO A;  3O29 A;  4PE5 B;  1T0K A;  4YB6 A;  4KQP A;  2FA7 A;  2A5S A;  4YIC A;  2PBW A;  5ITP A;  1HSJ A;  5H8Q A;  1HSE A;  5TPA A;  4YMB A;  4LVQ A;  3GLB A;  3L6G A;  2Y7R A;  1P1Q A;  4KYS A;  4UA8 A;  2QS1 A;  4ZZE A;  1FTO A;  3ZSF A;  5DVF A;  1MQG A;  5CM6 A;  3VVE A;  1QUJ A;  3KN3 A;  1EZP A;  3G3K A;  3UIF A;  4OZ9 A;  4OEN A;  3H6V A;  3MZB A;  3C33 A;  3LSL A;  3U93 A;  2DSF A;  2F5X A;  3HV1 A;  5JTY A;  4JSD A;  3ZKL A;  4JWO A;  2HEU A;  1OVT A;  4EXK A;  2DWJ A;  1BLF A;  1BKA A;  1B6H A;  2RCA A;  1QKA A;  3KN8 A;  3U1O A;  1SBP A;  2RF1 A;  2ZYO A;  4RYA A;  4JWX A;  1TT1 A;  1NNT A;  3TCF A;  2OCU A;  4R73 A;  2QS3 A;  3BFT A;  1TWY A;  5ISU A;  2ZMB A;  1IZ1 A;  2QSX A;  3LR1 A;  4R9G A;  3H6W A;  3E13 X;  2GFE A;  1FQE A;  3CFL A;  3TPA A;  2XXV A;  3PMX A;  3C35 A;  3FVG A;  4DXB A;  2QJE A;  4F3B A;  1B5I A;  3GBA A;  4U4S A;  4Z0I A;  5I56 B;  4OFJ A;  1A55 A;  2HZK A;  1WOD A;  1ZKB A;  2RC8 A;  2QRY A;  1OVB A;  3SER A;  1DPE A;  3H3G A;  3FAS A;  5DT6 A;  3LSX A;  5CMC A;  4NF6 B;  4GIZ A;  4QFP A;  3MP6 A;  4ZS9 A;  5K2Y A;  3OD7 A;  3T9X B;  3PPP A;  2GRV A;  4EQ7 A;  4ELQ A;  4HTG A;  1DPP A;  3ZS6 A;  3JV9 A;  2DWA A;  4JBZ A;  1A7L A;  3I5O A;  5AA1 A;  4F3S A;  2H4I A;  3HCQ A;  3N26 A;  2PX1 A;  2PYY A;  4JSO A;  4PQJ A;  1Y3N A;  2F7A A;  1IXI A;  4I62 A;  3K0V A;  4HCW A;  4YKI A;  4H0W A;  2IEE A;  5CI5 A;  3S2V A;  2Z22 A;  1MXY A;  1MM6 A;  4GF8 A;  1QKB A;  4ESX A;  4GL8 A;  2FNC A;  1ZJL A;  5B70 A;  3T93 B;  1B51 A;  5CMB A;  3Q28 A;  1B7U A;  2ALU A;  4DLD A;  1ZLQ A;  1P1W A;  2GHB A;  2DWH A;  2F7C A;  2F97 A;  4GRK A;  3IB2 A;  3MUQ A;  4OEV A;  4Z7E A;  1Q1K A;  3KOT A;  4BDM A;  2PT1 A;  4YKK A;  1B40 A;  1LST A;  1PBP A;  5CBR A;  4PFY A;  1IXH A;  3QIM A;  1BIY A;  1O63 A;  3FD3 A;  3HHG A;  3LUY A;  3SEU A;  5L8D A;  3T9H B;  1NH7 A;  1FTM A;  5TP9 B;  2ZXT A;  5I2N A;  3C9H A;  2NOO A;  4THI A;  1PB8 A;  1B52 A;  1JEU A;  4OES A;  3PD8 A;  4ZZA A;  1B4Z A;  3VVF A;  3TQW A;  2V93 A;  4NE4 A;  1IEJ A;  1P99 A;  1OIB A;  1B3L A;  3OO8 A;  1B4H A;  5TU0 A;  1ZMG A;  1VFD A;  1JQF A;  1S9T A;  1FQB A;  3MZ9 A;  3K4U A;  3EN3 A;  4WED A;  2R6G E;  1N3W A;  1GR2 A;  3O6G A;  2HZL A;  4QFL A;  1MY3 A;  1QUI A;  4H67 A;  1GV8 A;  1ZBM A;  4QFK A;  3VLW A;  5FHN A;  4YMA A;  3WAF A;  4G8H A;  1I6A A;  1NMU A;  4QF9 A;  5AA2 B;  3RPW A;  3MWB A;  1A8F A;  4U1O A;  4ZEC A;  4POX A;  3MQ9 A;  1D4N A;  1LB8 A;  4R72 A;  3K1N A;  4DE8 A;  4FAT A;  4FED A;  4GL0 A;  3TTR A;  3LC8 A;  3HHF A;  4IB2 A;  3O2A A;  5A5X A;  3F11 A;  5ELV A;  3TYH A;  4LZ8 A;  3CSG A;  3MVX A;  1MY1 A;  5I57 B;  4GXA A;  5ITO A;  1LBB A;  2V25 A;  3U94 A;  4EDP A;  1PB7 A;  1PB9 A;  2I4C A;  2XXH A;  3IX1 A;  1CE2 A;  2Q88 A;  4EQ9 A;  3K01 A;  5AA4 A;  1F9B A;  4OXV A;  3PUX E;  4K3F A;  5CBS A;  4QHQ A;  4U22 A;  3SES A;  4G68 B;  2I3V A;  2Q89 A;  3L6H A;  1B7H A;  3CI8 A;  5FHM A;  4IO4 A;  3OEK A;  3RTF B;  4RY1 A;  4FOR A;  5I2K A;  3DP4 A;  3V8X B;  3FJG A;  2Q8J A;  3VLU A;  3KFM A;  2ZYN A;  3PD9 A;  2ZNU A;  4H8I A;  2ZYK A;  4QFO A;  3A09 A;  2ANJ A;  1O7T A;  4RK2 A;  2F78 A;  2QL3 A;  1P1N A;  3S9L C;  2ONS A;  3H03 A;  5FHO A;  4ZE9 A;  1POY 1;  4NF8 A;  3UOR A;  5H8H A;  4C0R A;  3SEY A;  4IO7 A;  4F19 A;  1Y1Z A;  3CSB A;  2DVC A;  5BUU A;  1SI0 A;  3D4C A;  1ZTY A;  3BKI B;  4H8J A;  1B7Z A;  3FUZ A;  3FGS A;  4ELO A;  2XXI A;  5H8F B;  4X1D A;  5FTI A;  1RKM A;  1Y3P A;  1NL5 A;  4BDR A;  4MBP A;  1MQJ A;  3THI A;  3DP8 A;  1JW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...