3D4CA

Zp-n domain of mammalian sperm receptor zp3 (crystal form i)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
470
structure length
470
Chain Sequence
EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Cell adhesion
molecule keywords Maltose-binding periplasmic protein, LINKER, Zona pellucida
total genus 136
structure length 470
sequence length 470
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d4cA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4cA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4cA01
5CMMA 3OO8A 2UVJA 2ANJA 1Z7ME 4OETA 5DVFA 2O68A 1L5TA 2OWTA 4NF4B 4MLVA 1PBQA 1Y4CA 5I56A 4ZE9A 4Z0IA 5ICQA 4ONYA 3VE1B 3PV0E 2B3BA 5IAIA 3FATA 4JWYA 3UORA 1UTHA 4NMYA 3TCGA 3PU5A 3N26A 1B7ZA 4EF1A 4G2ZA 1B4HA 3FASA 1IITA 1IQ7A 1B40A 4ISUA 1ZKBA 4P0IA 2KLFA 3Q25A 2V3QA 1SBPA 2W7YA 3O2AA 3EN3A 2DSFA 2Q2AA 2RF1A 2VD2A 3MBPA 3OO7A 4OESA 3BFUA 4F19A 5CBSA 3FV2A 1UTBA 1SYHA 1OQHA 2IA4A 3FVGA 2H25A 3K6WA 2QMXA 1VE4A 1Y3PA 4RPNA 3C36A 2F8DA 3VLUA 4DIGA 2HXWA 1SI0A 3H7MA 4WEPA 5DTBA 2THIA 3VXCA 3K1PA 4LZ7A 2QL3A 1Y1ZA 2NOOA 1MPDA 3OEKA 1D4NA 1B46A 2D3IA 1KWHA 1B4ZA 1M5EA 3B6WA 3KN8A 3ECRA 3KJTA 4RNSA 4QFKA 2UYEA 3UP9A 3VLVA 1LAXA 4F29A 5BUUA 3TCFA 3IO6A 1B3HA 4Z7EA 5KDTB 3SESA 3JV9A 3ODBA 2VP1A 1FQBA 3OOAA 3OMBA 4QHQA 4F31B 1FTOA 2PMSA 1FTLA 1JQFA 3NK4A 5CBRA 3K0VA 3TAJA 1Y4TA 2XHDA 3H6UA 2DVZA 3PMVA 1ZU0A 4YAHX 4BDMA 2DOJA 3TYHA 3VXBA 2QPQA 3MC2A 4L17A 4IGTA 3MW0A 3PPPA 3QUFA 4GRKA 1LAHE 1Q1KA 4LATA 3M3FA 1USYH 1LBCA 4WKMA 1URSA 1MY3A 3C32A 5DT6A 2V3TA 1PB8A 4OTEA 4F22A 5TU0A 4OXVA 1MXUA 5AA4A 2ONRA 4IO6A 1UIVA 4NF5B 5H8FB 4HW8A 5JTYA 4QFOA 5AE4A 1EU8A 4GIZA 1BKAA 4R6KA 1S9TA 1A40A 1JW4A 4HCYA 4RJZA 4U4XA 1DOTA 4PETA 4BDLA 1NFTA 4R73A 3PPRA 4JBZA 1I69A 4O3AA 4RY1A 3T9VA 3C35A 3K6XA 3TCHA 5CI5A 3E4RA 1MH3A 2CZLA 3IR1A 4G8NA 4QFLA 4KQPA 5FTIA 4FATA 5B7DA 3JZJA 4OEUA 2ZNSA 3PUVE 3SEUA 4NWCA 3LC8A 3IOUA 3U1OA 2Z8DA 3KSJA 4KYSA 4PFUA 4C0RA 5JEIA 2DXYA 1NNKA 3PPQA 4X9TA 4BLAA 3IAZA 4DLDA 5ITPA 3I3VA 4DCXA 3PMWA 1VFDA 2VOZA 3HPIA 1PEBA 1TFDA 3U92A 4BDQA 1I6BA 4ZEIA 2VD3A 4OEVA 2HEUA 2V93A 4EXKA 2Y84A 4R9GA 1H44A 1FTKA 1MH4A 1XVXA 1M5BA 4I9DA 1QKAA 3PPNA 4NTLA 5HM4B 4I1DA 3HCQA 3S9MC 1R9QA 4GWOA 1ZBMA 2F34A 5H8FA 5FHMA 4GOTA 3LUYA 2GFEA 4NWDA 4JWXA 4LQ2A 2DYXA 1EZOA 3CSGA 1GGGA 3N6TA 1JNFA 3T66A 5KCJA 1VR5A 1ATGA 3ZSFA 2GHAA 1D3KA 4ND9A 1XHYA 3KSXA 1CB6A 2RCBA 3VVFA 3O6GA 3TTKA 4BDNA 1A8FA 1HSEA 1SD3A 1LGBC 2I3WA 2XXWA 2DWAA 1GTKA 3C34A 4H1XA 4N13A 4PFWA 1FQCA 1P1NA 2PVUA 3QYTA 3T22A 2ZYMA 3KN3A 4ELQA 1J1NA 1UTBB 3DP6A 3EHUA 3K02A 1ZJLA 1B7UA 4NF8A 3THIA 3PMXA 3MZ9A 3IK6B 3O6IA 3EHSA 1XS5A 3IOTA 4I8CA 4K3FA 3MZBA 4YICA 4I62A 3FD3A 3T93B 4G4PA 3K01A 1EZ9A 3PPOA 1TWYA 4ELOA 3RT8A 1N3WA 3RQTA 4R2FA 4YMBA 3PUXE 2X7QA 2PT2A 1SW5A 2P2AA 5K2YA 4JXIA 1N04A 4GQOA 4XIGQ 3VVEA 4YB7A 1POTA 1Y9UA 5H8HB 3I5OA 3N94A 5L9OA 3CIJA 3C31A 2DWJA 3FGSA 3QUJA 4JSOA 5H8NB 3H03A 1DPPA 3PUZE 3K6VA 5AA3A 3LBSA 4RK2A 2ZYKA 1I6QA 3TELA 1O64A 3QK6A 2O84X 3T96B 3OO6A 1M5DA 3CR9A 2H99A 1Z7NE 1MS7A 1OLCA 1FQFA 1P99A 2HCAA 2I3VA 3IB0A 4O3CA 4QFPA 3TQWA 3TTRA 3WAFA 3ZKKA 3R7XA 4DCYA 4F1UA 3O28A 1MDQA 2HAVA 2R6GE 3TDJA 3OSRA 2OBGA 3SDFA 2B3FA 4FECA 5CRYA 3T9UA 3I6VA 4HTGA 4GLIA 4ELPA 1LAGE 2F5XA 4M1VA 2XD2A 4YKIA 2O7IA 3W9VA 4NE4A 1PB9A 3B6QA 2Z8EA 3KFMA 3LR1A 4WEDA 3G3GA 4IY5A 2QMWA 2R71A 2Z8FA 4GVOA 1MQIA 1O7TA 1IIWA 2XXQA 3ILUB 3L6GA 3O9PA 4JDFA 1FTJA 3UA8A 1XVYA 1MXVA 2NWJA 4AB6A 3KEIA 2YLNA 4LA9A 5I58B 1UQWA 3OELA 1AL3A 1N84A 1D9YA 2FYIA 4U1ZA 5DEXA 3SEVA 5I2NB 1OQGA 2A5SA 4NEDA 1XT8A 3W15C 2DXRA 1P1UA 5AA1A 5ELVA 3TEPA 1ANFA 4PFTA 2REGA 5IKBA 2NVUB 2V25A 2QRYA 3IJOB 1SDXA 3HV1A 3BBRA 3FZVA 3RPWA 4LUBA 2HZLA 3USDA 1IZ1A 1NNPA 1F9BA 1NL5A 3CI8A 1B5JA 4KFQA 1ZLQA 1QUIA 3LSWA 3FXQA 3CVGA 2QSXA 3OENA 3ONMA 1B58A 3MWBA 2P1SA 3KOSA 2F6GA 3R6UA 4YZZA 2I4CA 1B32A 3IB2A 3HO7A 3LSFB 1B7HA 4XKQA 5EHMA 3G3HA 4ZEKA 3E9XA 3ZKLA 2HAUA 2O1LA 4XKNA 4R9FA 4UACA 3KZGA 4G68C 3QXMA 1XOCA 3T9HB 1GR2A 1JW1A 1PC3A 4OHNA 3SEYA 5KDTA 4POWA 5HPQA 3PD8A 2Z22A 3M8UA 4QSEA 4X1DA 1B1HA 2DE4A 3P7IA 5A5XB 4TLLB 3TODA 2RCAA 4ELRA 5M2VA 2XXYA 3Q28A 1O63A 3H06B 4IO4A 1Y20A 2QS3A 4NF8B 3TTMA 3V89B 3SETA 3S2VA 1PDAA 4DDDA 4DXUA 5KZTA 4H0WA 2XX9A 4QRZA 2DS9A 2F97A 4DE8A 5LOMA 4TLMB 1BIYA 4KCCA 4LZ5A 4GL8A 5CM6A 4GD5A 1AMFA 2F7CA 2I48A 2XX8A 4G8MA 2AIXA 1B9JA 3K1MA 2XXVA 2ONKE 3FXUA 2H4IA 3H6WA 3H6TA 3O66A 4FIMA 1VFEA 1H3DA 4G77A 4N6PA 1SI1A 4WXJA 5AA4B 2DWHA 4ZZEA 2B65A 3MP8A 4U21A 4DZ1A 5JTYB 1R1NA 4QF9A 1SW4A 2RC7A 1JEUA 3OXNA 4QSCA 1P1OA 1AOVA 1EH3A 3UGWA 2Q2CA 1MG1A 4ZEBA 1FCKA 4QFNA 1MY0A 1QJMA 1MM7A 1A54A 1POY1 4KHZE 5ICTA 2E0SA 3M3LA 1DSNA 2R9JA 2DE3A 3MP1A 4FE8A 1BLFA 4NF6A 2A5TA 1S50A 3MPLA 1QVSA 1CE2A 2H9BA 3IX1A 5ITOA 3TFLA 5EHSA 1T0KA 2O1MA 3FIRA 2AL4A 3OD7A 2XXRA 3PUWE 2HZKA 2QS4A 4OFLA 3UK4A 4U2RA 4XTCQ 1LFIA 3MVYA 3QAXA 4RK9A 4U1OA 4BDRA 5AA2D 1VSOA 2RKMA 3BFTA 3MPKA 3U8QA 1I6AA 2UXAA 2Q9TA 4R2BA 1YAEA 5TPAB 1GVCA 4P11A 4HS7A 1MM6A 2I49A 5I84A 2Y7IA 3KGCA 1M5CA 2XD3A 2UYFA 3TZAA 2LAOA 1Q35A 5EYFA 3D4GA 5DVIA 4MF3A 1DMBA 1MY1A 2Q89A 5J1DA 2V3UA 5I58A 2OJTA 4KYDA 1MXXA 4YKPA 1LBBA 1OVBA 2RC8A 5F1QA 3UIFA 3N6UA 4GL0A 2GRVA 1H45A 1QUKA 3QSLA 3G3KA 3K2DA 5DVJA 4FAJA 2PX1A 4OENA 4EDPA 5KCJB 4FORA 1II5A 4IY6A 1IXHA 1URDA 1DTGA 1MDP1 1A7LA 2F36A 3G3IA 3G3JA 5I57A 1NH8A 2IEEA 2VGQA 5JK4A 5CC2A 3RLFE 2DP8A 3VFJA 1DTZA 4MBPA 1B51A 1TXFA 1MPCA 2O7UA 3GBBA 3TQLA 2FNCA 2AL5A 4OQOA 4H6DA 4PE5B 4FEDA 4LQ5A 1NNFA 2D5WA 1Y3NA 1SW2A 1B3GA 1RYXA 1YPNA 2XXUA 1M5FA 3DLNA 3FXRA 3G7WA 1B0LA 5B70A 2UVHA 3CSBA 3IO4A 3O29A 4RXLA 1Y1MA 4YB5A 2ZNUA 4F18A 4Q8RA 3FJ7A 3A3CA 2NUVA 2DVCA 4YKKA 4JB7A 3ZS6A 4XKPA 1AH5A 1H43A 2OLBA 3DELB 5A5XA 5BWJA 4FJPA 3O97A 3D4CA 1D9VA 2NXOA 4MH5A 3GLBA 4XKRA 3ILTB 5AA2B 1IEJA 1ELJA 5H8HA 3TTLA 2UVGA 1B05A 3PGFA 4GXSB 5H8NA 3KBRA 4RA1A 2QS1A 4G68B 3W9WA 4C1TA 5L9MA 1A55A 3KN7A 4LVQA 4R6YA 4YU0A 4GF8A 1MRPA 5H8QA 4F3GA 4OERA 1WVJA 4XXUA 3K00A 4NF4A 3A3UA 2F7BA 2O6AA 3GZGA 3MJNA 4BDOA 4F3BA 1MXWA 1YTVA 5I59B 3U93A 5I56B 5ISUA 1WODA 1IXGA 3SKPA 2GHBA 3E13X 4IO2A 1UTHB 2V84A 1US5A 1P1WA 2PBWA 3IOVA 1XC1A 1P1QA 4F2QA 4TQUQ 1B0HA 2ZYOA 1MY4A 1SVXB 3VV5A 5L8DA 4N07A 5CMBA 3N5LA 4KD5A 1S7YA 4KPTA 3MVZA 1N76A 3EF7A 1LCFA 3KOTA 4FEBA 3GBAA 3LSLA 4IO3A 3VLWA 1HSLA 1NKXA 1AIVA 2ZYNA 3Q29A 3T9XB 2XXPA 3IOWA 2I0BA 1TFAA 4IO5A 4QSDA 2O69A 1FQEA 3H3GA 4AQ4A 5AA2A 2DWIA 3OO9A 4POXA 1HSJA 4U4SA 4UA8A 3FVOA 4X1BA 4EUOA 1R9LA 5DEXB 3PD9A 3MUQA 3K4UA 3V5AA 5I2NA 1OIBA 2G93A 4H65A 4ZE8A 2I0CA 1B5IA 1ZTYA 2F78A 3SERA 4C1UA 1USYE 1MPBA 3SEXA 2BJJX 2ABHA 2E1SA 2Q88A 2X26A 3FJGA 5CMKA 1FQAA 1DPEA 1LAFE 1LB8A 3HSTA 2ONSA 5F7VA 5I2KB 1ZMGA 1LLSA 4EF2A 2XXXA 3DP4A 1N3XA 3CRBA 1H76A 2FA7A 4ZZAA 3CFLA 2WKYA 2REJA 1PBPA 4R75A 4O3BA 3MVXA 5H8QB 3KJ7A 1MXZA 4H5GA 1OMPA 3IB1A 2RC9A 1QKBA 2Y7KA 2F35A 4PP0A 4Q30B 1RYOA 2M8CA 4R74A 3KG2A 1RKMA 4OWDA 1LCTA 2XX7A 3VDFA 3OSQA 2Q8JA 3B7DA 2ESNA 1NNTA 3F11A 4GXAA 3RTFB 2HQ0A 2QS2A 4F1VA 1OLAA 2RINA 3AXFA 4DXCA 2YJPA 1QULA 5TP9B 3C9HA 4AB5A 4H5FA 3K6UA 3O6HA 2PT1A 1LFHA 4ZECA 4M4GA 4OFJA 3CG1A 3HN0A 5K2XA 1MQJA 4Q5TA 2ALUA 1SQYA 2VHAA 1JVXA 4ZS9A 2QJEA 4OYVA 1FW0A 4YB6A 1B3EA 3FJMA 3MP6A 1EZPA 2XXHA 3MQ9A 2OWSA 4IO7A 3E3KA 4R6HA 1NH7A 3A09A 4EQ7A 1FQDA 3RUMA 4U23A 3UN6A 5L9SA 1FTMA 2AYSA 4E0XA 4KR5A 3DP8A 2H5YA 1GV8A 3MZ1A 3S4UA 1SYIA 2F6PA 4F3SA 5FHOA 1B52A 2F7AA 4OMBA 4E0WA 1B6HA 3CG3A 4LP2B 3MAMA 3FVKA 4GFRA 1MY2A 3FUZA 4ZDMA 3RN8A 3U72A 4LONB 4HCWA 4ECFA 3R26A 4H8JA 1B1XA 4NF6B 3JYRA 4DXBA 2A5TB 3M3KA 3RT6B 2OZZA 1UIUA 1MQHA 1A8EA 3CFXA 4F1YA 5I59A 2GH9A 3IORA 3IJXB 2G29A 3G3FA 4F39A 1TT1A 1MQDA 1JW5A 2ZMBA 1JETA 2HFBA 2DQVA 3NK3A 4JSDA 1IUDA 3FV1A 4RPOA 5TPAA 3DM0A 3S9EA 3EPEA 4IB2A 3BKIB 1IXCA 2Y7PA 3H6VA 4OZ9A 4TOZA 5H8SA 1LSTA 2X7PA 4RYAA 5HBCA 4H67A 1US4A 2CMOA 4YMAA 3PUYE 3TPAA 3TTNA 2I4BA 3MVWA 3TKDA 1ZIUA 2YPNA 3HHGA 3L6HA 1N7XA 2ZXTA 4PQJA 3U94A 3Q27A 1N0TA 1JVYA 1NMUA 5FTHA 4YKJA 3V8XB 5FHNA 2Y7WA 2XXIA 4OFOA 3RNNA 3WAEA 4IGRA 3S9NC 3GXAA 4H8IA 3EHTA 3LSXA 3FVNA 2D21A 3S9LC 2Z23A 2OCUA 3CFZA 3RTWB 3TUSA 1Y3QA 2PYYA 3VVDA 3H4ZA 4EQ9A 4LZ8A 3RY3A 4ZEFA 3V83A 3C4MA 5I2KA 4NF5A 4OVJA 3RGYA 5I57B 1A99A 1LB9A 4R72A 1MQGA 3EQ1A 5DYHA 2Y7RA 3TMGA 4KYEA 3B6TA 2XXTA 4KCDA 4F2OA 2I6EA 3QIMA 4KI0E 4EQBA 4P0GA 1PB7A 1QW0A 2P0SA 2DE2A 3OEMA 4G8HA 4MFIA 1BP5A 4ESXA 1B2HA 1N7WA 4F3PA 1IXIA 1BTJA 1JEVA 2I58A 1MXYA 4EXLA 1LFGA 1OVTA 4THIA 3Q26A 3SEWA 4ESWA 3IL1B 2ZNTA 4MLQA 5TP9A 1B5HA 2O51A 4JWOA 1QUJA 5CMCA 1URGA 1B3FA 1B3LA 4PFYA 1YCJA 1R6ZA 2UVIA 2OK2A 3HHFA 4Q0CA 4ZEDA 4X48A 3C33A 3K1NA 1WDNA 2H98A 4G68A 4U22A 1SW1A
chains in the Genus database with same CATH superfamily
5DVMA 4JO4H 3OO8A 4GKSA 1BM7A 2NY4D 4PR5A 1Z7ME 4Z3JA 4K3DH 4QOKD 4U1MB 5EORL 2RHEA 1AACA 4LSVL 3VI4F 3FHAA 1YCSA 3W38A 3EKCA 4WNQB 4H2CA 2F7RA 1S7RB 2XI9A 1K3IA 3GBDA 3QXTA 1B4HA 3MRBA 4P0IA 2BWQA 4PF8A 1CD1B 3OPZL 3QUYB 1EEQA 1MNUL 3LVEA 1QSFA 4K7PH 4F19A 3LXCA 5EQ8A 1FORH 1OQHA 2WWKO 3FL7A 4XCCL 4FADA 1OGAA 2Y07L 2IDCA 3SE8H 1HXYA 5I1EL 3O8XC 2I85A 2QL3A 2I7SA 2OI9C 1QR4A 5CEYA 3LPGA 1P0SE 4GKNB 3U30B 4ZX4A 4XWOD 1AKPA 4F29A 3TCLA 3E2HC 3PWJA 4K3EH 4ZPVA 1R5WA 1OD9A 4JLRB 4YL9A 2J5LC 5CFAA 2GUOA 1RDYA 2WKLA 3ZHKA 4PGPA 3W2DH 5ET6A 4XBPA 3G5WA 4H8WH 4C58B 2FEDC 2NSXA 5CEXB 2BSDA 1AGBB 2Y23A 3PXHA 1JP5A 4GRKA 3NJVA 2PR4L 5FKPA 3AREA 2ZX8A 3E1ZA 5ESAB 2AQ2A 2EYSB 2VLLB 4WKMA 1B4TA 3ZTJG 3HHSB 4MEVA 3V0DA 4ZUUA 4F33A 4HH8A 5E23A 2AJXH 1RUML 1IUZA 5KJRH 1UH3A 2JI1A 3TZVB 4TQ8A 4PP1C 1KC5L 4EF3A 4KQ0A 3JVGC 2C3HA 2ID5A 3BWUF 1HKFA 3MPCA 4WHCA 4ERSH 5CN3A 1HEJC 1G9MC 1PX8A 1XXDC 3IDIA 4MWFA 4NQCE 4PTTB 5L8JB 1R3KB 3D1RA 4ETYA 5IUCA 3HC0A 4HHAB 5C0CD 4WWKB 2AK4B 4JDEA 4QXTB 5I16A 1MH3A 3IR1A 2ZSVB 2VC2H 1TO4A 1S5IH 4IYKA 1CZ8L 5AW1B 3BUYA 2AQTA 5AUMA 4KJQC 1MFNA 1JRHI 3VFGH 2DXYA 1TZIB 1QZ1A 3CH1B 2VDNL 5EUKA 3I3VA 4XPHL 1VFDA 2KZKA 2WXPA 2YD6A 5IQ7L 3NCJH 4OEVA 4DVBB 4BINA 2YFOA 3KD4A 2ZUQC 2D9QB 1YEGL 3RB7A 4CC0A 2E6QA 1CJYA 4DN3L 3VQ1C 4L5FL 5H8FA 4MAYC 2F54A 3IMVA 5HYQA 4GOTA 1CDGA 4LCCA 5HVGB 4BGDA 1VLXA 4XC3L 4LQ2A 2CDFB 4PRIE 2CDEA 4LB8A 2DEYX 2YSTA 4H1LA 3CZUB 4MB4A 1J8HB 4QRPA 5T3ZE 4FFYH 3U6XS 4OIFA 4PRBB 3BGMA 3VA6A 3MRFB 5E2JA 1CB6A 1Q94A 3LSOB 5J1AB 2PWEA 4NRYA 4KXCA 3RGVD 1YA5A 3UEZA 1I7ZA 3VFVB 4JREC 3WD5L 3VFSB 2JELL 3J27A 5TK4A 3K02A 1V5JA 1FIEA 1SUHA 1HVXA 4M48L 1GCYA 1FL5B 4YICA 4W4OC 4MAUL 4ZO8A 1ETA1 5DWUH 3MJ7B 2YEQA 1EZ9A 3PPOA 4AL8H 3CH8A 1Z9SB 1DQMH 4PBVC 5KYYA 5FM5O 4HJJL 4PJFB 1BZOA 1EHAA 2XN9A 4RQQB 1F58H 3KGRA 3KR3L 4UTBL 5IJCC 5IHZB 4DESA 4JFVA 4K94L 4X6CB 3SBRA 5EQ9A 3C6SB 4JG5A 1SFHA 4BD4A 3C31A 4P2QB 1NFDB 1T1XB 3FO0L 4QIRA 3T0JA 4R2GB 5HGHA 1VPOL 4OZHA 2GTWA 1N59B 4ZFGH 1I6QA 2AK1L 4S1RL 4YGVB 1AP2A 1LK3L 2P8MB 1NANI 3BPLB 12E8H 2RFXB 2VLKB 1B4JH 2OCJA 4N2BA 2ZZWA 1WFTA 3SGDI 3VDCA 2CDGA 3C5XA 4LFHD 1WBXA 1YZ0A 4Y5VA 1RIVH 2WCPA 4JM2D 5JOPD 4NN7B 3TWCH 1OAQL 3S8GB 5E4EC 3QZMA 1IQWH 4IRZL 1MRFL 3AADB 4TVPE 1I3GH 3DGGB 4PVLA 5CJ5A 3AG2B 4YKIA 2BSSA 4KY1L 4Y1TA 5I1IH 3TO2B 3SD2A 3OXSA 4PREA 3II2A 4G83A 1ED3B 3QIWC 4FHKA 4PVBA 5EEVA 1BF2A 1BXUA 4PJBE 1KT2A 1RUMH 1DQJB 1ITBB 4L4VE 5E8EA 1LEKB 2KBGA 1I4FB 1KGCE 2EYTA 2ITCA 2PLTA 4IBZA 4D0BA 1R3JA 1OARL 2GI7A 4Z3GA 2A7BA 3I50L 2REGA 4X5XB 5DJYA 3IDJB 3OSVA 3FFOA 2A9ML 3QUYA 2HPTA 4CJ1A 1FO0L 3D25A 2M26A 2IEPA 3HBGA 1NTDA 1T21A 4H0GA 3DPBB 4NS0A 1J05A 1NINA 2YRBA 4N85A 1NCIA 2BVQB 1U42A 3HRZC 3IB2A 1DVUA 3T0XA 4ZEKA 2DKMA 3BN3B 32C2A 5CILH 1NCDL 3ABMB 2ERJC 2VERN 4K5MA 4FJ6A 4H13C 4XMKL 5H94B 3ZUCA 3KZGA 1ZGLB 5CR1A 1PC3A 2XQBL 3DYOA 1T5XA 3GMMB 4AM0B 3SE3C 3TA3A 2XWXA 2DE4A 1QR1A 1IM3D 2EVFA 5BZWA 3RHWK 1GGIH 2WINA 2R56L 1KCLA 4Z77A 1FVDA 2VO5A 4GS7B 4ZRGA 5A16B 4DN3H 4GYBA 4IO4A 3S2VA 2PXYC 5IFAL 2PCXA 2VDPL 2A4EA 1E42A 1OAYH 1QVOA 3GBEA 5T1LB 4L9LA 3MXWL 3VRLF 2QQLL 1IC4H 3QQ4A 3MTXA 3ULVE 3TIDB 4FIMA 1VFEA 2V17H 1PAZA 4MNGB 3ZSSA 5ELIA 2B65A 2DWHA 1RZ8A 4KO5A 1H6TA 2K4WA 3SDXB 1ANUA 3W82A 3HI5H 3SJVE 1CDUA 2Q2CA 4N6QA 4G6FD 1Z6JT 4H1LG 4FLHA 3MSPA 1M3JA 3QFJE 2GG1A 4P3CL 2H2PD 4UBDD 4BRVA 1H3PL 1BQUA 4JRFA 5EHSA 1BYOA 3U1SL 2DW5A 3IS1X 4ZYKB 2F58L 3IMTA 1H9VA 4TUOB 5FUOH 2GEQA 3TA3D 5D1XA 2HG5B 1KJVB 2XY1A 3C5ZA 3TJEH 5CBAB 5TPAB 5I1CH 4UM9A 2W60B 2HVBA 5ISZE 1CI5A 5CJOL 4OZIE 2C9UA 1EHKB 2VL4A 4WAFA 2ZPKL 4DP4X 1FBIL 5DQJA 2OJTA 3WG7B 4B9IA 4MAUH 1N19A 2H1PL 3RWGA 3GBNL 2RC8A 4TSBL 5IEHB 4XCEA 4TQPA 5I1EH 1YECL 1QUKA 3BH9B 4FAJA 5GSRB 3ROOA 3VSUA 4H1LB 5I76A 5F7EH 3THMH 4R4NC 1JZ4A 3B7YA 4F9LC 1GCFA 1A7OL 2I07B 3C09C 5DHXB 3TPUA 4LLUB 4JGMA 1QSEE 4OLXH 1J8HE 5KSBF 5F0MB 5FS5A 5IV2B 4K2UH 1O9WA 2VABB 1DJZA 1DFBL 3ARFB 1YZZA 4KMQA 5CP3A 2AL5A 1CO1A 4HS6B 4HP5A 3EF4A 4JVUA 2XXUA 4HHWA 4KUCF 2GT9B 1N0LB 1S5HA 1MQ8A 3BZFB 5IB4A 4MJHA 3KBZA 1MI5B 1S7VB 4KBPA 5KJRL 1AH5A 2OLBA 5KSUB 3FQ2A 1IEJA 4N8YA 3QCTH 2BSCA 3RL1A 2UVGA 1YMMA 3B8BA 2EXYD 3KBRA 3O2VH 5L9MA 4JFQB 1Q0YH 4F24A 1OGTA 3KN7A 2NY3D 4JRXA 4OERA 1NFDE 1LQSR 5I1LA 3MA9H 4W9EC 2CK0H 4N8PA 4DZBB 4HJ0C 4Y8AA 1DBML 1P1WA 3A4FA 1WA1X 2VDOB 3NFSH 2E7CA 2EDWA 4FQHB 4MA1C 5D7LD 4ODUA 2YS4A 4LLDB 3RWEA 1S7YA 4KPTA 5B7EA 1ZT4A 1JHLH 3MVZA 4H20L 2XC8A 3F84A 4UYPA 2IMNA 2JCCB 3SE9H 3ZZSA 1FC1A 3DIVA 5FEBA 1WCQA 4AG4L 2W0PA 4WVRA 4ZAKB 4NRXB 4X1BA 3A29A 1WWWX 2G2RB 4N0UA 1W0VB 4B9GA 1U21A 1C5CL 2O61B 3CLFH 1TO5A 4JVIA 5BZDA 3MCKA 2QV4A 3EFDH 3MV7D 3MFGB 2EEXA 3VE0A 1MFAL 4XE5B 1XCQB 2K4AA 2JCWA 4P23D 2ESVB 4CSSA 4WGKA 3HZMB 4NQUA 4HSCX 4L4VB 4Y4FA 2XWEA 3S5ZA 3DP4A 5I8KH 3DDFA 4JDTH 4JZNA 4MMXB 1E3FA 3S35H 2PW1A 5E00B 3IGUA 3SGDH 5LDUA 3O8XB 2J1XA 3HA0A 2IDFA 3KNBA 1LE9A 4DW2H 1FPJA 4ZQKB 2F35A 1PX3A 1SLXA 3KG2A 3VGAC 1GAFH 3UP1A 4I8DA 3F11A 1JL8A 3O3BA 4G1MB 3DGDA 3UTSD 1MPAL 3MBED 3SD5A 2FR4A 3PL6D 3ARBD 4HJ1A 4XOCA 5BZWB 1DLFH 5IF0B 4EE2A 2FYYB 3VMNA 2F54E 2LHAA 3ULUD 1SMOA 7PCYA 4NN3A 3LNEA 5I73C 1AD0B 2NW3B 4N90D 5DRNB 2IALB 1PD0A 4NKDA 3MQ9A 4LOUD 1QUNB 1RMFL 4R4FL 4NNPH 5FK9A 5L9SA 4NQED 2K8QA 3ELQA 2RMNA 3FQUB 1MCNA 4MA1B 1EHXA 1IAOB 1Z3GL 3LKOB 4NO2B 5C9JB 1G0YR 3BZEA 4GSUA 1NPJA 1MH5A 4K2UL 1UXSB 3S35X 3M86A 3UIZA 1B52A 4BWWA 1BECA 1M42A 2ESVD 4F7CB 2FX8H 4LONB 5JOFA 3RX5A 2AABL 4H8JA 1CL7L 2WYIA 4HUNB 4XC1H 2A5TB 3PJLA 1CIUA 3L95A 4I4WB 4RFOH 5C07A 3W9EA 4S0HA 4TTDC 1FSAA 2VN7A 2GH9A 5C0DB 2FBOJ 2QGEA 2MCPH 4H0IA 4IU2B 5A1AA 4IKNA 3ZMNA 5B3JF 5I28A 1WBZB 3IE4A 3KYNA 4MBOA 3LN4B 4QCIB 3RKPA 3EOTL 3FV1A 5DT1H 5TPAA 4IBLT 2DS4A 5C0RL 4IB2A 1IXCA 4TNVF 5AOZA 5AOIA 1A6VH 3KEDA 3IPBA 1B88A 3KL0A 1FZJA 1P84K 3ZOAA 5KSAC 4H67A 2VLRD 2NQ3A 4NO5B 1N7XA 4O2FB 3N6YA 1R1CA 2TRHA 1N0TA 3K3QA 4DOHB 3GSNA 3OJ2C 4N9GB 1PY9A 4OFOA 4QTIH 5D4JA 5T1MB 3BH9A 2GQ1A 5HDOA 4ZUUB 5AFAA 3QDJB 4CGUB 3C12A 3GXPA 3ENEA 4KNSA 5CM1A 3DO4A 2QKIC 1P4IH 1YAIA 1BVLA 1LNUB 2EYRA 4Y4FC 3QIBD 4KK5C 3NIGE 4KKBC 2AXWA 2IH9A 3NCWA 2HLAB 5GGRY 1ET7A 4EQBA 4P0GA 5T5FL 4PRIB 5E8PB 4HS6A 2P0SA 4OV5B 1XGQA 1GYVA 3IBOA 4C83A 3OEMA 4HE0A 4FQXC 3PCYA 3HZ3A 2ATAA 5E56A 3VRIA 1DBAL 4Z78A 5CLZA 3G08A 4PJIB 1QSEA 3TH2T 3D06A 1UM6L 4U6VL 4XN9A 5B1AB 5FA3B 3RUGE 5TGBA 3RWJB 4XCNA 1F13A 1Q9WB 4XNZB 5CMCA 5JNYA 4HDIA 4PFYA 2UVIA 3ZTNH 4X8XA 4AYBA 3GJEB 3QRLA 3S35L 2ORBH 2WAHA 3H9ZA 5I5IA 3WIIH 3HE6C 3BPLC 2OWTA 3SDCC 2CJTA 4KZ0A 5CAYB 2Z92A 4LNVA 5IQNA 2YEZB 4C4KT 4LCCB 4U0QB 1HJCA 3KBPA 5CUSL 4LSUH 1F8TH 2ZD0A 4DFHA 4I88A 3WFCH 1U36A 4WFHD 4X7CC 4FF9A 4X5WB 4B27A 3A21A 2HSIA 4APQB 5CBSA 2AEIT 2Y36L 3WKQA 2JCCA 4HT1H 4DCQB 4ENEC 3MNZB 4JPIB 2VXVH 4Q6IC 4NCDA 2R2CA 4PJXF 4RAUB 4KKZA 4WEPA 2Y7QA 3K1PA 3OWRA 3PWNB 1Y1ZA 2WVSA 2WUCL 4GG8B 4KDTC 3V9CA 5CMAA 3RFZB 5IMOB 2D7MA 2I9TA 2Z64C 2BJIA 2ZKMX 2IDTA 4XP9H 4GMTH 3UP9A 2CHDA 2VXQL 3RVXC 4Y4FB 1I3RB 5DMIH 4L8BA 3GPEA 1AFVH 1UWXH 1A6AA 4B41A 4PGCB 3TAJA 3PMVA 1XCTB 3MR9B 4PGDA 1F6LL 2VDQB 3GMNA 1TCRA 3ZT5A 2Y5TA 3MNMA 2O6PA 5FOBB 3IMBA 5DGRA 3L45A 5JPNC 1UQSB 2AK4E 2CK0L 1DVSA 4I0PD 1USYH 2GHZA 1B2YA 3L3IA 2E6JA 2B77A 3F7VA 3TXAA 3B9VA 4AIZB 1MXUA 3VXMA 5TF1H 1WBXB 4TVUA 2WXOA 2XJKA 2VZVA 3FDWA 4NFDA 5GS1C 3NP4A 1J5OH 5KTEH 1YXIA 4QFOA 4HIEB 4U4XA 3QIBC 3BRGC 1QA9A 4FFVC 1PG7X 5I0VA 2BSSB 2YXVA 3UMTA 1JDAA 2X1PA 4RY1A 3VVWA 1VFBB 3HE6B 3LZFH 2CNYA 1U8LB 3KYOB 1SBSH 4P07A 4PU2A 2WVTA 4KJYA 2ZNSA 1YHPA 4M7LH 2CXGA 1KTBA 2EE2A 3QNZB 3UTSB 1A1MB 4I2XB 1U8HB 1YEKL 4XOEA 1N64L 4ELKB 3F6IA 3E3QC 2HRPH 4M62L 1E6JL 5IGAA 1JWSA 5AB1A 1R46A 4FL4B 3KL5A 1F4XL 5GZNA 1WAEA 1AY1L 1EAQA 2GAZB 4PRAA 4Q6IB 4NTLA 1Y1DA 4OB5H 5AOJA 2R8SH 2ADIA 1ZBMA 2HCZX 3VWKD 2W59A 3A4DA 5FHMA 2EABA 4YE0A 2F74B 5J6GB 2AERT 3TV3L 3F5WB 8PAZA 3REVA 2VZ1A 4LDLB 3VD2A 1QBML 3NVQA 3N42B 1KN4L 4IIZA 1R34A 2YA2A 2PP8A 4XVSH 4ZW5A 4HV8A 4XMPH 1MW1A 5I2IA 5SWQB 4X6CE 3RWHB 1BQLH 5E2TL 3OMIB 4JM2B 3ZHFA 1UTBB 5I8KL 3O6FA 2Z93B 4RMBA 2FTAA 5TDOB 2ZZXA 1MEXH 1I9JH 5J13C 4LEEA 4XN8A 2Y06H 4CRPA 3TEWA 3SE6A 3K72B 5EZJA 4AYFB 5JOEA 2ESVE 3C08L 2MCG1 3PUXE 1A7BA 4CVXB 2WKOF 1JVKA 2YKLL 4NG7A 4XNMB 1Y0LA 1BVOA 2FIEA 1AHWC 3S5LG 2Y7OA 4EAEA 5JXEC 3H2WA 1REIA 3ROLB 4ESKA 1X5AA 3QK6A 1CLZH 2O84X 3AQXA 3GRWA 1DYZA 1W6LA 1RXLA 1XTLA 2VOTA 1ACZA 1MS7A 3DWTA 3IB0A 5TE4H 2SEBA 4ODHL 1DQML 1EDYA 1QSEB 5IQOA 2BRRH 3WHE1 3UG3A 4BFKA 4G9DB 4E9YA 2OXHA 3NCFB 4ZDHB 2B3FA 3S3SA 5JHLL 2DWYA 4MNQE 3MREB 4P04A 3GNMH 4G5ZL 3G6AA 3VTMA 2LR4A 5ICXA 4F8PA 1HQRB 2R71A 3KPRA 2PP7A 1FTJA 5DJDA 3WY1A 1OT1A 2ADGA 4OLUH 4FG4A 4HA1A 5KVGH 4C4BA 4LEXL 4OJFL 5TF1L 3BGAA 2DWDB 3T8MA 4XMTA 2V2TA 1JP4A 2PYEB 2N56A 3TT3L 3BW9B 5F21B 3S3CB 2MNWA 1JPTL 2OYLA 3ARSA 3FUEA 3USDA 3ARGA 1L3NA 1LEGA 1E9QB 1NC4B 1SDAB 4UQDA 5HGGS 5EU3B 3ARBA 5EEZA 4DIGA 3X3GL 5LXVA 4EI5A 1K8IB 3K8KA 4ZOCA 3HO7A 4IK6A 2Y7QB 4ZS7H 1NBYA 3O45A 3S97C 3RDJA 1CZ8H 1PJ9A 3PQYD 5E03A 1XXFC 1A3RH 3L9YA 4UMSA 4GWUA 5DZ9A 3RX7A 3P7IA 4XPHH 1JZFA 2IPTH 4DN4L 4PQXA 2OMWA 1FRPA 1O63A 3W9DA 4EI6A 2WUBH 1D7DA 4DKEL 1BBDH 1AG6A 1DQKA 4Y1SA 5ICUA 3JSSA 4H0WA 4JM4L 3MLYH 1A1OA 3QHTC 2XX1A 4UT6L 4FQLL 1WCBA 2MHAB 1AMFA 2OMTB 3F6JA 4J6RH 1F8TL 4F2FA 3B2VL 3TN0C 4U21A 4WLCA 1YEJH 1NJ9B 2RC7A 3NIDE 4M6MH 1D2OA 3KPPA 4OQTH 3OHXC 2GITA 2DQMA 1TJHL 3FFCE 3T2OA 1ORSA 3OB0K 4WI3A 5ICTA 2VAAB 1TQCB 1H5BC 2ORBL 1H5BB 4JHZA 3GLEA 4L4JA 5E4EB 2R9JA 4QT5B 4NF6A 1KIUA 3KJ6H 4OZHF 1IILE 5ANMB 3EXJA 4Z3TA 5F89A 3EYVB 4HIHA 4UCFA 4N6DA 2O1MA 1T0KA 1PL3A 3T4YA 2P80D 2VIRA 3AWEA 1T6VN 1LP9E 1G9NL 2UXAA 4ALAL 3GM8A 3KEHA 5I8CA 4WI9A 1WFOA 1Q35A 1TSHA 3BEVB 3MLSL 2CO6A 5EIQA 2AEQL 1ECZA 2AXGA 3MLRL 2G0LA 5I6XB 2F5AH 2B0SL 4G3YH 3HN8A 4PJ5D 4OCMC 4A68A 3ZDXE 5J8OA 3QSLA 4LSDA 4WGVB 5DVJA 3QS2A 4NQSA 2BRRL 4XI5C 1SF3A 4MA7L 2F58H 5FHAL 2XSKA 3G5XA 4JRYD 1RIVL 3A4AA 3TWCL 3TCXA 4K07A 1UWFA 1T66C 3REWA 2DV6A 3OXRB 4BFEA 4K73A 3ORJA 4K8RC 1TXFA 1E5CA 2VM4A 5DR5L 1OP3K 4I48A 1DUZB 4NC2B 4ZMYA 3DX9A 4FEDA 2JLLA 4V1DD 3D4YA 5IVXE 3MRHB 1X5JA 2BSRA 1TTCA 1XCWA 5HHOD 5I0XA 3CPLA 1E4WL 1CU4L 4B3EA 1TYRA 2OWZA 5DFVC 4P5KB 4KTDH 5E9DD 2KERA 3A3CA 1ICTA 4M62H 4E9XA 1NICA 1M71B 4PN6A 2P8LB 1E4XH 3B2PA 1MH5B 1EFXA 1OY3B 1UXSA 1KENL 3EYOA 3LQAL 4RA1A 4PV8B 5HHMB 1N4XL 3K8MA 2YBRA 5EOQL 3MBXH 2ZUSA 3RWDA 1BWMA 2VR4A 4PBQA 3E9TA 4U1MA 4HMDA 3LIZH 3VGHA 5JPNB 4BDOA 4YIQB 5HHNB 3BWUC 2W65B 1XCXA 5IW3A 3QCUH 5D8JL 5EF1A 1WODA 1MVFA 1ORQA 2DAVA 4TRPL 1XH3A 2D7NA 3UAJA 1SVXB 1WSST 2FX9H 2IAMA 5CMBA 2HRHA 4LAQH 3LIZA 1Z9LA 1CFVH 2I7OA 3TFKC 3BWAA 5SWZA 5DLLA 1QFUH 3O2WH 4PI2A 3ECQA 1OCZB 4NKOB 2VT0A 1E4KC 4PJIE 1N12A 3BKCH 2J6EL 1FNEA 1IBHA 5TDNA 3VGBA 3FNKA 2DWIA 1LWRA 1FBCA 3BVNA 5KYUB 2Q74A 2B4CH 5DUPL 2QLVB 2W0LA 3RG1C 3WSQH 2HG5A 3GMPB 4B95C 2V17L 4HEPA 4MCMA 1ZSDA 2L5VA 4M1CC 4ZPVB 4JPVL 5KS9E 2XXXA 1MJJB 3BVUA 2FD6L 2YSSA 4IOIB 1R24B 2JIXD 1H76A 1N3XA 4HJIA 2X88A 4B5EA 1NFIB 3T3MF 3RB5A 3MZTA 3FXBA 4LGPB 4IIQC 2IH3B 3G9VA 2QJDA 1AQDA 2Y25A 3DTXB 3ZX1A 5GGQH 1QLRA 1BD2A 1CGYA 4GSDL 4C54A 1EZSA 1NGXB 1RYOA 2GBUA 2YD5A 1YEIH 2XQYK 3WJLA 3BESR 2XX7A 5B39B 1QPPA 1YNTB 4MJIB 4O9HH 2HQ0A 2Z4QB 1ZE3C 3AXFA 2VSMB 4HF5H 4XCNB 3L1EA 1NL0L 4MJ6A 3OZKA 1U8OB 3JV6B 1KPVB 3NGBC 5FO8A 4DAGH 1AC0A 1S9VA 3S96B 4HUVB 4UNIA 4AW4A 2YD8A 1JK8A 2E86A 1OAUH 2ZNWA 4WWKA 5JPMC 4P57B 3MNDA 1LXMA 1ZCRA 5EYGA 4RESB 2MHAA 1MHPH 4M4RA 1F45A 4F80A 2YAQA 4X6FA 2A0LC 4QUOA 3B3IA 4NAPA 1MVUA 2RB8A 1G0HA 2DWEB 2Q5BA 4OLZL 4EBQH 4YHPA 4NBZB 4MKTA 1ZT7B 4QBAA 3NCEB 1UKTA 4GBXC 4OZHE 3Q9QA 4FC3E 4MJ4A 4LP2B 4I9WE 2OMXB 3N04A 5CJBA 2HFEB 4HCWA 1H5BA 3H55A 4NF6B 1M9WA 4X5RA 4APXB 5IGXH 3MA9L 2B1HH 5F6IC 5IUSA 2RIKA 5E5MA 1GXEA 2TSAA 1XI6A 3G3FA 1CDBA 3QPKA 4PB0L 4NNPL 4JDZA 1BM3H 4PW9A 1MQDA 4FQHA 2P5WA 4Z7WE 3OB8A 3BLBA 1RUPH 3GZQA 1IEBB 1FN4A 2MPAH 2X3BA 3RFRA 1F4AA 1R9FA 1H15A 3TZVC 2C9XA 1JFQL 3BZ4A 4RYAA 3VACA 3VRLE 3FBKA 3KHQA 3LKNA 4QRAA 2P49B 4WQOA 3NIGB 1G4RA 1NAML 1NQBA 2F7PA 1HHJA 1NDMA 3AG1B 3BAKA 1ZKAA 3MV7E 3SDCA 1BFVL 2QMKA 3NFNB 2XNAA 1RZIA 1JF1A 3NRPA 4NC0B 3MJ6A 3S9NC 3H2PA 3U6RA 3NRQA 3LSXA 4Z7UB 5HVHB 2OCUA 5D5ME 1OQOA 1JGDB 1HU8A 2WO4A 1KSRA 2VR5A 4ZD3H 2UUDK 4I3RH 4OLEA 4FNTA 1F90L 4H0LC 1MQGA 3EQ1A 3MBEC 2FL5A 2W9EL 4K4KA 2NY4B 3W0WA 5G4NA 5I19H 3CJJA 3QISA 3VFTA 1R17A 5GZND 3V0AC 5IK3B 1LK2B 4DPCX 4R90H 1E2ZA 1IXIA 3BSZL 3RL2A 3DHUA 2IFFL 1Q9KB 3DDGA 3OMZA 2NY6B 5IVXB 3FPXA 1YMME 4AITA 3MYJA 1GTFA 2KQZA 2FR4B 3PFQA 5DVPA 1NCAL 4G6JL 4G6KH 1YCJA 2WBJB 4PJ5E 4Y5XB 4TS6A 5AZ2L 4U22A 2C9QA 2V5YA 1OP5K 3SOBL 35C8H 4IBTA 1AD0A 4LSPL 4WV1C 3RDTB 2JJSA 2ROYA 3ZDWA 1SY6H 1F6AB 1PBQA 4MLVA 2XTLA 1MCOH 3SIKA 1KEMH 1CD9B 1TVDA 3GMLB 4MS8D 3SYOA 4U6VH 5T3XH 1CLVA 3QUHA 1B2WH 4LVOC 3O9WD 2XXCB 4I0PA 4P2YA 4H1LH 3FU5A 3EO9H 4P9KA 5C0FB 1MFDL 3KJ4C 5JQHC 1A0QL 3L95B 5C07B 1T0MB 4P5RA 2HYMA 3C36A 1RV6X 2HXWA 5DTBA 2DMBA 1D5BB 4QRSB 2X6MA 1VGEH 4OT1H 1Z0NA 3LN4A 1QWHA 3IXAB 4N20A 4FKKA 1T3FB 2JE8A 1LAXA 1WG3A 4YN3A 3GMMA 3IO6A 1COBA 1KYFA 2V0AA 2N0KA 2XWTA 4NUMA 5KVDH 4FZ8H 3UJIL 1CXIA 2WM0A 4RNRB 4RZCA 5DI8A 3QJTB 2C8NA 4AUYA 3GI9L 5BW7A 4JHAH 4KQ4H 4KRMB 4NAJA 1RZKH 1QLRB 4A2DA 4CU8A 1ZLEA 1DN0A 2I60L 3C6LB 5B38G 1Q72H 5CHNA 1DCLA 2AAVA 4OZIF 1EXGA 2VDQL 2ICEB 5KBLA 4YHNA 1ZHLA 5DK0A 1RK0B 2XCMC 3K6IA 3ABZA 4XVTH 5TH2B 4YQXL 3FF8A 2GB2A 2XBZA 3LIUA 4LNRB 4TSCL 1MREH 5D1ZI 2NNAB 4ZXBD 1NFTA 4R73A 1G9HA 1X6NA 3FQNA 4HAFA 3T9VA 1EMTL 4F9LA 5LGKA 2WC7A 3EJUA 4AY0A 4P9HH 3N91A 1AO7E 3MCLH 5F1SA 4TSAL 4RDQF 4X4XB 4I0CC 1KMGA 4PFUA 3GB7A 2AKRA 4BLAA 4NUGL 5FLVA 4APQC 5PAZA 5BO1L 3U9UA 1QFWL 1TFDA 3FTGB 3V52L 2A9MH 5HHMD 1IBYA 2QHLA 1C5DB 3FZUC 5EWIH 5EBLB 2BS8A 1NSNL 1KTJA 2FGWL 4JB9H 1A6TA 4ZFOL 2NT0A 2BRQA 1HOCB 2X41A 2ZXGA 4HXAH 4YHZH 4GS7C 1LBWA 3RWGB 3FU7B 1PD6A 4UU9A 4FQCL 1V7NL 5H37G 1EEZB 4U4BA 1LO3H 1Z9NA 1OGSA 3S5LB 2EE9A 3BAEL 3V6OE 1GYAA 5D7JC 1S7WB 5DMKA 4LFHG 5GIRB 3BRDA 1RLBA 3O3AB 3T71A 5F3BB 5IJVB 2PPDA 1I9IH 4PJDA 3DIFA 5CJ8A 3WD5H 3K2KA 1FFOB 3MZ9A 1CQYA 2WQVA 2ZOLB 3KPQA 3T93B 4LCIL 1XX9C 3FUDA 3WE1A 2ZXCA 1NLBL 5K9OB 2H2SC 1J1XH 1AIZA 2RD0A 2F5BL 4OGXL 1BYNA 1MJ8L 3TBCA 1MIEL 1LO5B 2FT8A 3UYOD 1BG9A 2WNGA 4HXBL 2LW3A 4G6KL 1U95A 3LUZA 2FL5B 1AOHA 1JAEA 1BF8A 3GTNA 1ZTXL 2N7SA 4LLVB 4JFQA 3VXUA 3LBSA 2F0CA 2NNCA 3KWWB 2HTKD 2VDLH 4P2RD 1VCAA 3F6LA 4RCAA 5DZJA 1OPGL 1E65A 1VCBC 5IK3A 2VLME 1OLCA 3ZTEA 4M93B 2CIKB 5F89B 3UYRL 3O28A 1NKGA 1YDPB 2J4WH 1KYOJ 3APFA 2VLJA 3MYJB 1KELH 4URTB 2VO8A 3U0WL 4PJHB 3O0RL 4S2SA 3I9IA 3PWLA 3A67H 5AOKA 2QVIA 3X1FA 5BS0E 2NR6A 2Q1EA 3BXNA 4Y16C 2X4QB 1PB9A 3WAFA 2Z8EA 4MHFA 4JG9A 5D2NC 2OZNA 4PFBA 3KEIA 1IO4C 3JTBA 3MBEA 5HI5C 1NUZA 3UTSA 5IZ1A 2A5SA 3N06B 4FLOA 2QDVA 2VXUL 4XZ4A 3W15C 3D3VA 1WHPA 1AXTL 5HBBA 5AA1A 4B3VA 5B1CA 4LDCA 4NQCB 3BO8A 2BJMH 5K9KB 1OARH 2V25A 4IRZA 4D9QD 5DXWA 4QF1B 1RJLA 2DIEA 3DSFH 3H1ZA 4AT6B 3KCPB 3VXQA 1NNPA 3D39B 2ADIB 4BDMA 5FYKL 5KUKA 1B58A 5DEFA 3MCLL 4I48B 4UNTA 1FI8C 1HNGA 4K15A 1FNGA 3RTQC 2C9VA 3ZKLA 3FU9A 4XKNA 4QRUA 1NV4A 4RH4A 4Z7QE 3P9LA 2EO7A 2QPDB 2Z1KA 1C5BL 3BKYL 3O3BB 1WDAA 3V8OA 2Z22A 1G6RA 4N8VB 1A64A 1N64H 5EU4B 4XVSL 1MREL 4CU6A 5F3FA 4HJ0D 3B9KD 2GJJA 4P99A 5G2NA 4GLRH 4MDJA 1OSPH 5ENWA 3T0BA 4LL1A 1P53A 4LCUB 4UIKH 4JANA 4EUPH 2ZYRA 4CKQA 1TOXA 2D9CA 4LZ5A 4CA4A 2XACC 4MKMA 5KVEH 2A9BA 3Q5TA 2F7CA 4YLBA 4G8MA 5IZ3B 3HHSA 3H6WA 2OMYB 3MLTA 5I8OH 5K59E 1RK0A 3WMSA 2YGNA 3BFOA 3X14A 5DHVA 3VXUE 2EEFA 2XWIA 2FECL 1KIQB 3S98A 4AEHL 2LU5A 4TOYH 5AL8A 1EAPA 4H20H 1MWAH 4Y5YC 5FM4A 1AZZC 2HPOA 5IHHA 4KKCC 3A6BH 2DE3A 4R5VA 5CBRA 5DS8A 5IJKA 4N1CA 1NCGA 5D93C 5GS3A 4JFHD 5D96B 5ADPL 1W91A 1LO2L 2C7UA 3EIFA 4OFLA 2EC9T 2V5SA 1GRWA 1RL1A 1JGLL 3B9KA 1VGKA 1N0XH 2HTLC 5CSGA 1A02N 4X7TA 2KLSA 4XNQB 3SCMC 3FCUB 5DRXA 2XJLA 5F7MC 4AOFA 3KGCA 1X3DA 2XFXA 1L7IH 3PHQA 1K8DB 1GVIA 5L4IA 4KQ4L 4MF3A 1J10A 5J89A 4FTDA 2ZKHL 1GC1L 3FOLA 5FYKU 3NZ8A 2ZICA 4MVBD 2F54B 3QDMD 1KZ8A 4GQRA 1BZEA 3ZLQC 5EBMA 1H45A 1DVYA 4KKCD 1LEIA 2IVFC 2A83B 2R0ZL 4IY6A 2NUTA 4NPYB 1D9KA 3UZEC 1GOFA 2VGQA 5GIRA 3KLQA 3MRGA 3QJVB 4KO6A 5JK4A 4PJXB 5JW3L 4IEFA 2XV6B 2DRUA 1UACL 3KWXA 3V4PA 4JFEA 1DZ0A 2AJSH 4WW2F 4HK3J 2QVRA 3FSZA 5LBVA 3T6WA 4KO7A 4PRPB 1E9OA 1PG7H 4XP4H 5DZPA 4OIBA 4EI5B 2RR3A 2D5WA 3DV4A 2IQ9H 4DK6A 1FNHA 3LV3A 3QJRB 4NGHH 3KHOA 4PWKA 5LN4A 2ICWJ 3L3DB 3KYMB 4XVJL 4X9GA 3OHXB 1XT5A 4DWHA 5TGBB 3RWJA 3P0YH 4Q2ZB 2MKWA 4MD5B 3WFHA 1QSVA 4D9RE 4PFIA 1BFOA 4QY8B 1WA0X 1SXAA 4XBGB 4KXPA 1G0IA 5D1QB 3IMSA 3LZOA 5DK2A 5HGHB 5ALCH 2H4EA 2WSKA 1DTUA 3KPLA 4RGND 2J21A 5AVZB 1S9KC 5K59F 1HC1A 1G7LB 5ISUA 5BRZE 2XV0A 4I85A 4LVNC 2X70B 5F44A 1L4IA 4FI8A 1N2RB 3DMMA 1J87A 4RVBA 2BP0B 3ETTA 1NUFA 1VACB 4XPTL 3WIHL 5C2UB 1P1QA 4F2QA 4MCNA 4U3XA 2IAAC 5CJXC 2R2EB 5LG6A 5B3NA 4A7SA 4FQJL 1VZHA 5I6XC 3GBAA 5E7BA 4F37K 3BKJL 1QLEL 5DVLA 3OXSB 3SYAA 2CEYA 4X5PA 5GJTL 3K4UA 4XXCA 5GRVK 5HYFA 3U6RB 5I2NA 1EZLA 4JFZH 3RFZA 1AJ7H 5D7IB 1LEKA 4I9XA 4QHUA 4YO0B 4UQ3A 1TZOA 3UPRA 2X26A 4BEIA 3FU6A 1G7PA 5GHWH 4HEPG 1RQ5A 1IMCA 4EZJA 3HC4H 4UINH 3D9AH 3TP4A 5K1NA 1LD9B 5GRXG 3BJLA 4Y2DC 5FOBA 1T7WA 2O1AA 2RC9A 2AI0H 3N42F 4J3SA 4YSEA 2ETWA 2NY2B 4O58L 1M9SA 5BS0D 1FQ9C 4IK7A 2ESNA 3FB5A 2HHMA 4GXAA 5AAWC 4GOSA 1J1XL 4YPGA 3J07A 5C70A 4JO3H 1CFSB 2K6ZA 3CE1A 4KXZH 1WJ3A 2A1WH 2UZYA 5KS9A 2R23A 3GUTB 3HN0A 3KG5A 1S9YB 3U7YL 4ZUTA 4G70B 3UZQA 2H9GA 3NMEA 1LE5A 4JKPL 3ZN6A 1OP3H 4QXVA 2CEXA 3FJMA 1IGFH 1OZTG 1UEMA 1B0IA 2AMUA 5FV1L 5FYJU 3SE8L 1EPFA 4L3CB 4F7EB 3RQ3A 3O41A 4KUCD 4E0XA 3X12B 1GV8A 4P46C 5IQ9B 4WHTA 4CDHA 2XIBA 4M7JH 1UACH 4ANUA 1LMIA 5GXBB 1BMZA 1FUNA 2YO3A 4HLJA 2EXTA 4PRAB 4Y4KC 4LBAA 1KUMA 3DETD 4HIJA 1R47A 2KMWA 4A6YA 5IFHL 3IORA 1R3HB 4X6BB 3WLWD 1N3NA 1D5BA 1R33A 2W95A 3H53A 2FIXA 4ZYKA 5I74B 4LOFA 5BUPA 1MCQA 3L3OA 4GKNA 2X53A 2GUYA 5D7HA 1HKLH 5DD5H 4FI6A 5DD0H 1ZAGA 3L1OL 3OAUL 1KGUA 5EN2B 4QGYA 4KKAC 4MB1A 4L9LC 2AJVH 5HGBB 1BOGB 3DOIA 3QJFB 2CXKA 5M7QA 4RISH 2UWEA 3GHBH 2OTUA 1S7SA 3BT2L 4CVZB 4Z7WA 2D03H 4JPQA 4AGNA 4AQAB 2Q20A 4LCWA 1QNZH 4KX8A 4UAOC 4AWJC 3AREB 3K4DA 3P4OA 1JHTA 3EYUH 1NOAA 4QRPD 1O75A 2HT2C 2VISB 3O9WA 1ROWA 4IOFD 4JVPA 3RWFA 3U79A 1HN1A 2J5WA 3C4MA 1QPXA 1DBJH 4XMWA 2X3AA 4S0SD 3TMGA 1E4HA 1Y0LB 4KYEA 3CXHK 1X7SA 2ATKA 4JDVA 4U6XB 5MEOB 2IFGA 1NCTA 2WNWA 3BDYH 4G8HA 2QTEA 2V3FA 2BNQB 3OKLA 2C5DC 3TBSB 1O6SB 5F96L 3DX4A 1RJYB 2NY1C 3Q8AA 1YQVH 2AJZB 4AXWA 2CJSA 3Q13A 4NO0B 3GS0A 2ZNTA 3MC0A 1MI5A 1S7VA 3UABA 1BVZA 4PGEB 2O51A 1YJDC 3LMJH 3OKEA 3CTTA 3EUDA 5I17B 1RUQL 3PAZA 1WDNA 2YKKA 1E8ZA 3QJQB 2XXFA 3UG5A 1NCWL 1II4E 4DI4B 3MA7A 3TO4D 4N1EA 3SPIA 3WNIA 4P2OD 2FO1A 3TEYA 3AT8A 25C8H 1LO2H 3MXWH 2PNDA 3RPIA 1RU9L 5JHAA 3O6LH 2B3BA 4AZUA 1UTHA 1NDGA 4CMMB 4YHPB 4QRRD 1S7WA 3FASA 1N0XL 3BQUA 3FSWA 3IF1A 4JG0L 2GFBA 1CLYH 4ZX5A 4BUHA 4YK4C 1XGRB 4LASL 4LSTL 1FFNA 2HFEA 3DJ9A 3JUZA 1PZBA 4MS8C 1BA9A 4ABWA 4ABUA 4LSPH 2OXGA 2FK9A 1GC1H 1P4BL 1LK3H 3GZOA 1WWBX 1DVFD 3DUSB 3LEYL 3EH1A 1UJ3C 4LKXA 4PJHE 4DO4A 1HAWA 5DEGA 4I1NB 3D69A 2VDLB 4XMZA 4LIQE 3OHMB 4UQ3B 5KYWB 2ZX9A 2O26U 5E9AA 5F9WC 3TJEL 2P9RA 1AHMA 5D7IE 4F31B 1ET8A 2DKUA 3FQRB 4KMTH 4XO5A 4L3FA 4WUUE 4BQBA 3MODH 4QTFA 4IRJB 3D07A 3K0VA 5F7WC 2DVZA 1FFPA 4GFXA 1ZU0A 4JX0A 3FONA 4K3JL 5I8EB 3EYSH 4JKPH 4F1ZA 1FVCA 1LE9B 3ARXA 4U6HA 2H1PH 1X44A 2WMPB 2NYYD 3S48A 1UASA 4PJ6A 4Z7UA 3U4EA 3QWRD 4HX1B 5I66B 3MXVH 2OULB 3T0EC 5F71A 4JY5L 3ZR6A 1P5UA 3RYMA 3UP6A 4A7TA 2RCSL 4IRSA 1JW4A 1H3GA 3PWLB 4Q9QL 4BDLA 2GITB 4DQOH 3QEGL 1A4JA 3MV11 1BIIB 3ERXA 3K91A 2K8MA 4DKAA 3LZNA 2IXQB 5IESL 2K45A 5LCVH 4DQAA 5K5YA 3MRDB 1NZRA 5JDSA 5FYKE 3WY2A 5EEYA 1S6NA 2YAHA 1OF0A 3PPQA 3EGSA 2X12A 1E4JA 3W39B 3GMQB 4Z0XB 4NO2A 2Q3ZA 4Z3HA 2R0KH 1EXHA 3JXAA 3UROR 4X5XA 5DJYB 1ZT1A 3HLAA 1PZAA 4J3OF 3AMKA 1JD7A 1Q9OA 4QF1A 2J20A 3GHBL 1EANA 5HM4B 1INQA 1XWVA 1M6OB 1QQDB 4GXFA 3TBWB 3DPBA 3MJ9L 1YYZA 1D6EB 4P9HL 5ISZB 1K9ZA 2ZT9C 3ABKB 2EUZA 3CFCH 5CIPA 2Q2LA 1F00I 3QRGL 3RUGB 1TZHB 3ZW3A 4IU2A 4P1EA 4KOBA 2ZF9A 3MMEB 4U7MA 3RKDD 1M7DB 1IEAA 1A4AA 1G6RH 2FJFB 4G6ML 4F7PA 4AK1A 1TZAA 3O4OC 3O4OB 4A37A 3O6GA 4YXKL 1T5KA 4AB5A 3FRUB 3KN3A 4RDBA 5FLUA 1J88A 1NCBL 2QL1A 1CICB 3DP6A 2XZAL 3E8VA 3H7LA 1TU2B 1IGML 4WU7B 5C0BE 1B7UA 2DL2A 3NSXA 4R8WH 4W9JC 4W68A 3IJ9A 2YPKB 1UC6A 2BLFA 4TVPL 1I9JL 5SX4I 2O72A 3VMPA 3E3QE 3CBRA 3FF7A 4O58H 4YMBA 1M05A 2X7QA 3TCLB 2PT2A 3LB6D 3O11A 4MJ5A 2K1MA 1KBVA 4R4ND 1ZGLM 1YEJL 1BP3B 2YPLB 4JZOA 3ZDXF 6PAZA 5HHXH 4GQOA 4QXDA 5IVZA 1LP9B 3HPJA 5F24A 2PFYA 4BSWA 3US1A 2BX5A 1SPDA 4LOVA 4P23B 4FQ1L 5I6OA 2YD2A 4YSOA 1YYLL 3QC5X 5ITFB 1RZPA 3T96B 2ZWYA 2NLJA 3WKMH 3L5HA 4GKOA 4YUEL 3RZCA 5DHEA 3LH9A 4NHCL 5E2WH 4H4NA 2HAVA 4PJXE 2B59A 2J8OA 5LB1A 3EJSA 4PDDA 1IQWL 3VG9C 5BVJA 1I3GL 1DJWA 3T9UA 5E9DA 1I1FB 2E7HA 2QDWA 1KTRL 5GGVY 3RIAF 3VWJA 4OGZA 3WEBA 1HSAA 4LAJH 5IWLC 1D5ZB 4KTEL 4OIIL 4A7UA 4HKBB 1MQIA 1GZPA 4BA0A 3NZ8B 4R97C 3NOHA 1QBBA 1UVQB 3BUYB 1NC2A 1I3VA 4RGMC 4XPFH 4ZS6D 5GSRA 3ROOB 3AGVA 1WE5A 4HUCA 2NUTB 4FG0A 5AYQA 3TEPA 3I6GA 2VKWA 2EADA 4FNPA 4M00A 1ONQA 3O0RH 4DVBA 2BVEA 1EO5A 3HV1A 5HJ3B 5EBLA 3IDMA 2F3BA 4M3KB 3ULUL 5JR1H 1NL5A 1SXNA 1J9RA 2B39A 4JPIA 1MCCA 5JIIA 3CVGA 5H8FB 5ITBL 3R6UA 1Z32X 3IU4L 4POUB 3P9MB 5F1KC 5B7DA 4AYDC 5EFIB 1P7QA 3E9XA 3ZTCC 1QFWM 1MRCH 2OM5A 2PTVA 2NY0B 3MQIA 3CHGA 3WLBB 5AB9A 4KV5F 4OHNA 3IE9A 4LP4A 1MCKA 2CGRL 2Z31C 3ZKSD 5IOPA 1D5MB 4QSEA 3T3PF 1N5AB 5GS1B 4EI0A 4LSRH 4QOKE 1E8WA 4PJGF 1RUQH 4UOZA 4XF5A 2BNRD 3CDYA 1I85C 2V5TA 4IRJA 3TTMA 2VDPH 4XBGA 4WUUB 2CO2A 2PXYB 4N86A 4NNYB 3TGXA 3QYNA 2XX9A 3CVHB 3FQWB 1NWPA 3T65B 3B50A 4HXVA 4R9HA 5HI3C 4Y16A 4K8RH 5CJQH 2R8TA 4MA8H 1ACCA 4JN1H 3Q44A 5FYLL 1B9ZA 3PGCA 3UJTL 2J71A 2XWZA 4LSSL 1G7IA 4XE0A 4RLDA 2NNFA 4RIRA 2A9CA 3JWNG 3H56A 5D7SH 4L8DA 2R2EA 1EH3A 2JJWA 2OL3L 1QA9B 1UCBL 2DJ4A 2NXYB 3GSRA 4FL4C 5DUBA 5BRPA 2D7PA 4QJ5B 2E0SA 5JHDB 5GGRB 1SN5A 1TQTA 2NY1D 2RFXA 2VLKA 4DVRH 3RNQB 3LRGA 5B3JE 4DW2L 2R0LH 5L2KD 1W0VA 4MNGE 4JPSA 4RK9A 1IGTA 1OWWA 2X6BA 2OMUA 3POHA 4PAFA 1AKJA 5HYJE 4J3OC 3U8QA 1G9NH 2CD0A 3GKWL 2QFRA 1P5VA 2WXLA 4OZ4B 1U3YA 4XMUA 5EZIH 4DPBX 3CQQA 5LUMA 1M5CA 2SODB 2HH0L 4N8UA 1P6AB 3QULB 4OJAA 3QSKB 1O6VA 1WHOA 5EF3A 5EYFA 1C08B 1ZSHA 5JUEL 4AQEA 1ECYA 2FHCA 4LLWA 5G5DA 3ZJAA 4DGYL 1WRFA 2PW1B 5I58A 3TBWA 3DECA 3NSDA 1MXXA 3HRZB 2BWIA 1YUHB 4GO6B 4E41D 4QI3A 1TEYA 2A5UA 2F74A 4K7PY 3ARGD 4V1DB 3X1NA 1GGCH 4OF5A 1HYRC 5E8EB 3OTTA 3KPMA 3U36A 5E6IB 3F7YB 5HDBE 3FB5B 5F6HJ 4YR6B 2XXKA 4NFBA 2AJ3B 4X04A 1FRGL 5LCVA 3ZQ9A 3LQAH 1INDH 3H3KA 4KMTL 3L7FB 1S7UB 5KS9B 2VDPB 2R23B 2CLZA 2FECI 4J8RB 4FQ1H 3VM7A 3TQLA 4PCYA 1P9MC 1YNLH 4OQOA 1L9QA 2HJKA 5KBPA 3QAZB 3QAZC 4NWCA 5EQAA 4K7PX 1P2CB 2E5EA 2LU7A 2ZAIA 2UVHA 1IBFA 5K1VA 3HNVH 3SE4C 2BHUA 5A3IC 3DXAD 1FCCA 4XT1C 1IBZA 1OAKH 5BWJA 4PDHA 4M8QB 2NXOA 4WHTB 1VB9A 5TFSH 5CSBA 4XKRA 4F57L 4Y9FA 1PTZA 5B22A 1ZTMA 2PFZA 1ZE3H 4P23A 5ENWB 1RZ7L 4UV4L 1FGNH 1KACB 1SY6A 1MRPA 3K1KC 5F0PB 4NF4A 5T1LA 3FUJA 3BD4A 4G9FD 3RZCB 1J0ZA 2OMYA 1J0HA 3ILPA 3Q8CA 4I1PA 2X4TB 3BZDA 1GJWA 3EJJX 3JV4B 3CZFA 1TVBA 2QVFB 5TF0A 3Q6GH 4OCXH 3CZNA 5BVJB 2A4CA 4NIKB 2MRYA 1SDYA 2FD6H 1SM3H 4KTYA 2XZAH 4OM0L 1EAJA 4A2HA 1NKXA 3L5WA 3T9XB 3L9EA 1OGAB 4KI1A 4RMSA 4QSDA 3ML8A 3RVWC 1EUUA 4ZTPL 4UQ2A 5KBDA 3D0AA 2ADGB 2X38A 3CZLA 5MHSE 4OM1L 4RFNC 4EUPA 5LNDA 3MUQA 2YAMA 3KWTA 1BX2A 1B5IA 4NJ9H 5A2LH 3IN0A 3ARPA 5DMGD 4XNDA 1IC1A 4ELME 2Q88A 5CMKA 4L3AA 4X9YA 4FNSA 3BVDB 1T2XA 4IBSA 3V4VH 4N9OB 3P4NB 1BVLB 1LNUA 2EYRB 2Y1VA 5FWRA 1BAWA 3D85A 4Y9BA 4GMSL 3B8YA 2CPUA 3WFBH 3PV7A 3VXOB 4R75A 1AY1H 5GZOA 2IBGA 3KDPB 1JF6A 3LD8B 5HY9B 2HWZH 2IIJA 4HAKA 1M6UA 3ZKXC 4BYHA 4E9RA 1O7DE 1JZ6A 1MLCA 2BNQA 1HZHH 5CHNB 5IY5B 3LN5B 3HNTL 4L29B 3BHBA 1NBYB 3SZPA 3FCGA 3SHSA 3GMOA 1BIHA 1LCTA 3WLBA 4ES9A 4DNLA 1UWEH 4HJGB 1D9KB 1EJFA 5HJGA 3VXRA 1YY8A 3GIVB 2X1WL 4X0KB 1JSYA 2QVKA 1E90A 1EV2E 4AE1A 2D8KA 4XNUL 4PD4K 4ZMAT 2OYPA 2MPVA 1MQJA 3FU3A 3UO1H 2XZZA 2E0PA 3D0VB 3MP6A 3CFTA 5J5EA 1OK8A 4HD9A 4WF7A 3RY6A 4ONHA 1LDSA 4J3XA 3DP8A 2O5NA 4PJIF 4LEOA 3A3YB 4RGNE 2OI9B 1CK0L 3I75A 4GFRA 1MY2A 3FN0H 2B1AL 3MV9A 4FS0A 3U72A 2DQEH 3BMVA 1B1XA 2APBA 4U1JB 3M3KA 3O8XD 1IQDA 4A2LA 3FUHA 5E6UB 5JQIB 2Y2YA 5DD6B 2B1HL 3IJXB 4WWNA 4N0CD 4F39A 1JI2A 1CN4A 1N2RA 3RU8L 1U2YA 4YBHA 2YPVA 5DT1L 4ZFFA 2WWOA 4ODUB 3HFFA 4QPEA 3S9EA 3EPEA 1JZHA 4GQ9H 4GBXD 1NBQA 5J1AA 4TOZA 3VFWA 4O7IA 1GPOL 1KXTA 4XCFL 4ZNCD 5D5MF 2DI8A 3L3GA 1AZBA 1WAPA 3DYMA 4I0KA 3RGBA 4ZFOA 5J16A 3B3BA 4JN1L 3UJTH 2FHFA 3HAEH 3CMGA 5AD0A 1JNLL 2DEWX 3BP4B 1X7TA 3L3IB 2Z7ZA 4OCYL 2Z23A 3AZUA 5G4OA 1PDKA 1YPZF 3QWQB 4O8MA 3RY3A 1HXMB 4F91B 3KLHD 1YEKH 2VW4A 4ZMWA 3NIFE 3OAUH 3OR6B 4HIEA 1VSCA 4YDKL 3HC4L 1R5VB 5C0BA 1YN7A 3WIFA 2K9FB 3WN5A 3L9RA 2AXHA 1XGPA 5L2KE 4M5TA 1HHKA 4NHUA 3CNKA 4TUJA 2YAFA 2EDOA 2KLTA 2JCCE 3L5XL 4OF3A 3I6KB 3I02B 1JPSL 4PTKA 5I0ZA 1G5AA 3WAKA 5EHFA 1ZLDA 4Q14A 5C6TL 4KWUA 5INDB 2IPUG 4J3OG 4OUOA 4L8CA 4JWOA 4U1HB 1FO0B 4XAWL 4FEMA 3KPSA 1A9EB 1QRNB 4ZEDA 1MFDH 5J3HC 2P3NA 4ZUTB 1AZUA 5FX3A 1JGUH 4L48A 4NKDB 2PETA 1JV2B 5CSZA 5BQ7A 1WUZA 5EC2A 4ZTPH 1HZLA 1MCHA 3ARFD 1YJDL 5K9QG 4Q0XL 4DVRL 5KYNA 4PAZA 3KGTA 4NMYA 2ZYHA 1I1CA 2B08A 4FLSA 2HJFA 2FJHB 4QXUH 2DWXA 1ZKBA 2O5XH 4PRID 3RPLA 4BJLA 1NUNB 1TKWB 3L1GA 4IDJH 4FOMA 4X5LA 3UEQA 4OQTL 3EN3A 2BM3A 3AU0A 3FFDA 4JM2A 3R19A 1UTBA 5KVFH 4HIJB 3OMNB 5CZKA 1M4KA 4ZW3A 5T1JA 2HFFA 1BBJB 4IS6A 3H9SA 3X13B 1K85A 3HIZA 3H3BC 4WHYH 5FUZL 4HS8H 5KVGL 3JTSA 3SDAC 4TM9A 5FC9A 4M02A 3HMWL 3HC3L 4F20A 1KWHA 1A7QL 3TL5A 1HQ4A 4GEIA 4PWIA 1PQZA 4GP8B 1EK3A 3BVXA 2OTWB 5FAAA 2Q86B 3ODBA 1K6QL 3DBSA 4HIXL 1CC3A 2FT6A 4XMXA 3QJFA 1N6QL 5IVZB 1LP9A 3BDXA 3EJYC 3HPJB 3PDOA 4ZUSA 1WD9A 1Y4TA 2YLKA 4EKXA 3H6UA 2VQTA 3ZKMC 1FIGL 4Y2DD 5ILTH 3QQNA 3LS5L 4OGAD 1LAHE 1KOAA 3BVVA 3D2UD 1UEYA 1KGIA 1KPUB 1A7RL 4FQ2H 4ZS7L 4QRQA 5FF6B 3ZGHA 2BZCA 4G7YL 3ZGIA 2C1OB 3T77B 3JV5A 3QE5A 3GMOB 3LEYH 3TH4T 3DOSB 4WW2B 4WW2C 2CK2A 1IVLA 1UIVA 2B59B 1JIBA 3TTSA 1KFAL 4WFFD 4P2OA 2DQ6A 5C3IA 2JTDA 3CZKA 3KLKA 3MREA 3WELA 5TDPB 2B1AH 1BREA 3K6XA 4OV5A 3E4RA 5CI5A 2E56A 1T2QL 1OO2A 3FAWA 3JZJA 3M88A 4M3JA 3IFPA 4K8RD 5C2BH 2PPFA 1M2OA 3UMNA 1MCEA 2BDNL 1CFNA 3EHBB 3MXVL 1XAKA 5DO2C 2V2TB 4GWSA 1AR2A 1SEBB 3QEUA 4U1LB 4PGEA 4Z7NB 3Q5OA 3IJSB 1QRKA 3IDNA 5GRZA 2HEUA 4JVCA 2J1YA 1JDDA 2H0PA 2FQGA 1XVXA 1EHLH 2DQVA 3DI2B 5EWIL 1OOWA 2EXWD 4OVRA 2IPKA 3E7JA 4JS7A 1R9QA 3PL6B 5MEPA 1A2YB 4CKVX 1FH5H 3NACH 2VQUA 2JKJA 3UTSE 2JI2A 3RPIB 4MSWB 1JWMA 1XR9A 2VMCA 5GRVL 1JN6B 2JXMB 3L5JA 1QPKA 1DSWA 4LLUA 4OFIA 4BWUA 4HXBH 5GS1A 4LCWD 3LYRA 5J9PB 3K71B 1T83C 1ZJLA 3W9DB 2OJ1A 2VKXA 1KCBA 3N50A 2OSWA 4PS8A 3MZBA 1U6AH 3AJ7A 3FD3A 4UNUA 1ZHNA 5D2NE 4G4PA 5DQ9B 3IFOA 5EORH 5HYIA 3NIFF 2F7IA 2BK8A 1NCOA 3O6LL 5DHVH 4UQIM 3A5VA 5K2YA 1I3RA 1CDJA 3I85A 3LN9A 1U8QB 1ZVNA 1TVHB 4X7DC 5G4MA 3RL1B 3N94A 2YMOA 3IWVA 5ECGA 4U7SA 4FMFA 4K7PL 4MGXA 2HMIC 2W81C 1HCVA 3W0WB 1TCRB 1E8YA 4BUQA 4DTGL 2AHIA 3CR9A 1UCTA 4W9KC 4TNEA 3ZZQA 2H3NB 2RH0A 1IARB 3COOA 3H9SD 3BZ5A 3U4BH 4AIZA 4YFDB 3UTPD 4DPAX 2XUWA 3L3HB 4F9PA 2OMUB 1H0DA 1BAGA 3G6JB 5DGQA 2NX5D 5CRYA 2IO5A 1DBKH 2QBWA 2F5XA 3HR5B 1INEL 4M1VA 1Y6KR 4NGUA 3A67L 2AP2A 3L08A 3NDYE 5I0WA 2CUIA 4WEDA 3ATAA 4YHMH 1KTLA 4PJHF 2ZIDA 1NBCA 5DR5H 3AMLA 2NTFA 3VD4A 5ISZD 2YLNA 4LA9A 4N0UB 1D9YA 4YFLI 5D7IF 1S3KH 5I2NB 2DPKA 1OQGA 4G5AA 4OU3A 3OL2A 2V7NA 4L37A 4LL9A 2QPFA 2YPVH 3MRBB 4JE0A 4YR6A 4HWZA 4G8GB 1I8UA 5F7DB 2AF2A 4MZRA 5E8NA 2RA1A 3FT2A 3FFDB 1AO7B 1INQB 3WEMA 1P5UC 2XN0A 2AJUH 5H8QA 5T3ZD 2ICWA 3GDCA 4KI5C 3R7QA 4TNFA 5EHMA 2CKBL 1AQHA 3JTSB 2BOBB 4A7VA 1NUYA 4NNXB 5C6TH 4UACA 5L2JA 5CR8A 4KAQH 4AEFA 1T3FA 1W2KT 2ODHA 3V55A 1JVLA 4DSYA 2Q86A 4P4RA 3HAEG 1P4IL 1R3IL 4Z5RA 3GLZA 4PCSA 2LQRA 2W38A 1BPVA 3VFRA 4RNRA 4RZCB 4U3SB 4YFLF 2QS3A 4V33A 4ONGL 3IS0X 4J2QA 3ARZA 3O2DA 5ALCL 2YA0A 2R4RH 4OD3H 2BOLA 4DE8A 2FX7L 3F7PC 4LLQA 1WBYB 4GL8A 4GD5A 1A4KB 3QUZC 3PWUB 2H4IA 2EILB 4G77A 1JVOA 5KSAA 1P1ZB 1TCMA 3A6CH 2WOYA 3JV4A 4DZ1A 2YZ8A 4G7VH 2A74A 3RWIA 3OXNA 4PG2C 1G6RL 4G6MH 4LVOB 3WI9A 4JJ5A 3HI6L 1U3ZA 3QZWG 3UGWA 4GO8A 3IDIB 4MWFB 1MFBH 4KPHH 1DJHA 1POY1 2EUXA 2DZEA 2ZG1A 3ROLA 3VG9B 2EIDA 2NLJB 3MACL 3NJIA 4TYUA 3QCVH 4Z3IA 2YUWA 1NH6A 1N3NB 3FH8A 4X4XA 4Y0GA 4LSSH 1CFNB 4U1OA 3QK0A 4N17A 3CFBA 2P28B 1GKOA 4Q58C 1LGVA 1OP9A 4HS7A 1HH9A 2IG2H 4PJBB 1YNKH 4C47A 1UM4L 4KQ3L 3RE0A 3V0IA 3PHOB 3VXOA 4GRWB 1S7SB 4CVZA 1ASPA 1UFGA 1HOCA 4JHVA 4LLMA 3QORD 4F2EA 3QPXH 4TNWK 1FPBA 3NCMA 3QXAB 4GFTB 4HGWA 4MA7H 4XVJH 5FHAH 4N2OA 1JHTB 1NUWA 1CTOA 1Y6NR 2DQFA 3QPQD 4OZGA 5CC2A 3WNPA 3PWVB 4NP4L 2ZXEB 5HHVL 3O3AA 2WBJC 1I1AA 2NXZD 2VR6A 4C59B 4F27A 2EIMB 3VFJA 3ULUH 5GGSA 4BQCA 1AANA 4BHUA 3B37A 5D71L 1WZ1H 3NPSB 4IMLA 5AW6B 5TE7L 1IGFL 2HX8A 2OR9L 4JE4B 3STLA 3IFOB 2DQTH 3QW9A 1BAFH 4BK4A 4RXLA 2A6DA 1NAKL 2FIKB 3KS0H 3PP4H 4NGHL 4U1GC 4AMWA 5BO1H 1DK4A 2EICA 2TAAA 1BM3L 4FCHA 3I2CH 4NZDA 4O51B 4PJ5A 3SPJA 4AYGA 2ZXWB 4ERSL 1XGUA 3DELB 4BH7A 4R83A 4HDIB 3ILTB 1T7ZA 4ONFL 3N41F 4H88L 1R19A 1AQKH 4NQEE 3ZDZE 4XPGL 4XR8C 2BFVH 3HMXL 3NCYS 4QYAA 3RVVC 5I17A 4C1TA 1FBGA 4JKNA 2DM2A 1F5WA 3T65A 1BEYH 3SQOL 5D8JH 5I59B 2R51A 4ETQA 3QQDB 4NENA 2XVBA 5FO7B 4WWID 1G7IB 1BW8A 2IQAB 5BOZG 4ZFFB 1ACXA 3VXSE 1MY4A 3NYKA 5LO7A 5A2JH 3VG0H 3LQMA 5L8KB 1G7MB 5AZ2H 4APQA 4KJWC 1ETZA 4GRLB 3G3LA 4JFFE 5EZLB 4WDIA 4J39A 1UZ6F 2GPZA 1X5HA 6FABL 3IETA 3VYOA 4OB5L 5AA2A 4MA3B 3RNQA 1ED3A 4GI6A 1DQLH 3K6DA 4I1RA 5HYJD 1IAII 3FUFA 3L3KA 1FC2D 4JZJC 1IEHA 5DO2D 4FFYL 1MRDH 3MOBH 2A6IA 2CU9A 2HJLB 4XZUB 2F78A 2BY3A 5E0QA 1QRNE 4N0RA 2UUDH 4HCRA 3TNNB 2ONSA 4P4KC 1OTSD 2Y7NA 4E5XA 5EIIB 1IM3B 4I87A 4PBDA 1YSOA 5BXFA 4CC4A 2FA7A 3CRBA 5CN2A 2R2HB 3DXAA 3EKIA 1T21B 3H9SE 3HG1B 2X9ZA 3L2NA 1V7MH 1KXHA 3GXDA 5HTSA 3BH8B 1VEPA 4XO8A 2C1PA 2WCSA 1J8HD 4OT1L 1L0YA 3TLRA 4CSPA 2O93L 4OWDA 5I66A 3IFNH 3G5XB 2GJ6B 1E5BA 1CGXA 3QUXA 3QZWB 2MQ0A 3K80A 4ZZFA 4P2OC 3IJHA 3V4VL 5TP9B 3C8KA 4H25A 4U1HA 4H5FA 2PO6D 3LMJL 4TL5A 5E8OA 4ZECA 4LL4A 3IYLW 1UWXK 3HI1A 1QHQA 2A1WL 2VXVL 3GI9H 5CJOH 3QH3B 4Z76A 4MMZA 1VFBA 3HE6A 4AGPA 1NCWH 4L3ED 2QJEA 5FHBL 2LABA 3NAAL 1M7IB 2OWSA 4KTGA 5JIHA 1S3KL 4KZDL 4ZUVB 1A4KA 1BD2E 3UN6A 3RPKA 4FLQA 4G43A 2XWDA 3ILQD 3FQ4A 5F7KC 3W39A 1KB5A 2B9AA 2ROXA 2Z7UA 3DX2A 3HKZA 3IAPA 4YDNA 2P8LA 3ZXAC 5IIEB 2F6PA 1K4DB 1E2VA 3MRLB 4P2QE 3MRPA 1CCZA 1YNKL 1B6HA 2F7AA 3EH2A 1O9ZA 1N8ZB 1F0LA 5DYOA 5FECA 15C8H 3RN8A 3FZUD 4ODXA 3IDGA 1ZPUA 3ZKQD 2DDQH 3M8OH 4HC1L 5IGXL 2OJEB 1NM9A 4DIXA 4F1YA 1A6PA 4NHBA 4QAWA 2FCBA 5CIPB 1ZOXA 1ORQB 4JM2C 2EDFA 4KI5F 1PQZB 4XVTL 1IUDA 5TE6L 1F3JA 4OI9A 4M8UA 2XA3A 1SM3L 1TR7A 3NDZE 4R4BA 3DURB 4AV4A 1NMAH 1U93A 4AX3A 5EV7A 7CGTA 4XN7A 1TU2A 1BEYL 5BRZB 2G75B 5F1IA 4GAJH 5J4MA 3QA3B 2YD9A 4N0UE 4YHLL 3Q27A 2CLVB 1HINL 2X4NA 1SQ2N 4PJ7F 3GBML 3QIUD 2VXUH 1GZQB 3LD8C 3B7UX 2DQFB 3N9GH 2I07A 1ZHBB 4MMYB 1LL1A 3RGYA 4Y8DC 4IEFB 2NSMA 4GMSH 4QKXB 3B6TA 3ZK0A 3VGAB 4JVDA 1OWRM 5ITFA 3T0VA 1ZWIA 3FQTB 4WW1B 4NKMB 2QQLH 1X5LA 4O02H 5E2UH 4GQQA 5MP6H 4F7TA 4OM1H 2OV0A 1LO3L 2RJMA 3U82B 3OHXA 1KWKA 4WHDA 1RK1B 2WQ8A 1CF8L 5IR1B 2Z34A 1OKEA 1YLBB 3UIYA 1URGA 1YC7A 4FAAB 3QNXA 3T0EB 3TN0A 1NGYA 1HCYA 1QHPA 5CZVH 1MJUH 1WT5C 4G68A 3ETBF 4BE5A 5BCAA 3N40F 4CBZA 3EOYG 1A6TB 5IB5B 3JYBA 5LNEA 1PKQA 4OSUH 1NC2D 2DQHL 4JRXB 3B9KC 3K46A 2XWJB 3KPNA 4ZSOA 5AWNH 5T1DH 4XNAA 1RHFA 4M4RB 3VXNB 2J1KA 1Y1UA 2DM4A 1HAUA 3QJOA 3PU5A 3EW3B 5H2BB 4PRBA 1IQ7A 2A4ZA 1A6WL 3O2AA 3B43A 1K9YA 2VRAA 2DSFA 4WU5A 3EFOA 2DQIH 4L18A 3FVGA 1ROCA 1RI8A 3NQKA 4X83A 4ODTH 1CB4A 1JGUL 1X5XA 3GBNH 4XCCH 3HB3D 4ZPTA 3SJVD 4ADGA 1XO8A 1SI0A 3ARDB 3P3SA 4WWKC 1ZLWK 3S0PA 1P7QB 4LZ7A 4KGJA 1DSFH 1PZCA 2WEFA 2J43A 2CIIA 3V5DA 2VDOH 3DUUB 3MLUL 4B7IA 3KN8A 5ICYB 3IFNL 3VGGA 1XCQA 1Z3GH 1M1XA 3WFZA 2VP1A 4GBWA 5IHZA 5IROA 2RCSH 1D2PA 3VDBA 1XB3A 3WN6A 2ZZVA 1ZA6A