3D4CA

Zp-n domain of mammalian sperm receptor zp3 (crystal form i)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
470
structure length
470
Chain Sequence
EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Maltose-binding periplasmic protein, LINKER, Zona pellucida
publication title Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 136
structure length 470
sequence length 470
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d4cA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4cA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4cA01
1BLFA 1IIWA 4I9DA 5I2NB 3IJXB 3TQWA 3CFXA 3FV1A 3DP4A 4GL0A 2RKMA 4DZ1A 5FHMA 2YLNA 1CE2A 1LCFA 4OFOA 3C34A 2GH9A 3EHUA 1N04A 3IOVA 1SYIA 5FHNA 1MXXA 2ZYOA 1OVBA 4QFNA 4F1YA 3HN0A 3L6HA 5ELVA 2Z8EA 3KGCA 5HBCA 3Q28A 3K2DA 3UORA 1EZOA 2I3WA 5K2YA 3KN8A 1MQHA 3FVKA 4MLVA 3SESA 1PBQA 4KCCA 3TYHA 3VVDA 4RPNA 3TCFA 1D3KA 1ZTYA 4KFQA 1IXIA 1ZLQA 3VVFA 3MAMA 1US4A 1UTBA 5ICQA 4MH5A 2XXQA 4LA9A 1B5JA 3K6WA 4O3BA 1H76A 4XKQA 3B6WA 1RYXA 1VFDA 3IO4A 1LB9A 4IO6A 2Y7IA 3VDFA 3HSTA 4BDLA 1UTHA 1EH3A 1LAGE 2PX1A 3PD8A 3PPOA 4TLLB 3E4RA 4DXUA 2P0SA 1VSOA 4G8MA 1JW4A 4YKIA 4KR5A 4R9FA 3SEWA 3B7DA 3KOTA 2ALUA 2GHBA 2QSXA 2V84A 2DYXA 1QKBA 3C36A 2DP8A 1FQEA 1D4NA 1MG1A 1NL5A 4MBPA 5A5XA 1WDNA 1MXYA 3IL1B 4AB6A 4GD5A 2I48A 3GLBA 3TCHA 4TLMB 2DE3A 2XXRA 4QFPA 4U1ZA 3OOAA 3O66A 3PPPA 3VV5A 4EQ7A 3TMGA 1JW1A 3BFTA 5FHOA 4O3AA 1LFHA 4QSEA 2QPQA 1MY2A 1ZBMA 4M1VA 3V8XB 3M3KA 3M3FA 3K1PA 3KEIA 2H4IA 3MP1A 2XXYA 3Q26A 4OENA 1NFTA 3DLNA 2PT2A 1FCKA 3MPLA 5L9OA 2FYIA 3TTLA 3C9HA 2DE4A 4QSCA 3JYRA 1UTBB 2F36A 2FA7A 2O7UA 5DEXA 3O9PA 2FNCA 1DTZA 2NXOA 2F97A 3EF7A 4NF6A 1HSLA 3PMWA 4BDOA 2B65A 3CRBA 5AA3A 1A99A 3HPIA 4KYEA 3UGWA 4JWYA 4KPTA 1B7ZA 4LZ5A 1EZ9A 3TQLA 5AA1A 2UVHA 3CVGA 3VVEA 3GZGA 1XVXA 2G93A 4XKPA 2ABHA 4ONYA 2I0CA 2Q9TA 2X7PA 1NNTA 1UTHB 3C31A 1M5EA 2UXAA 3UP9A 5H8NA 1P1QA 4XKNA 5L9MA 1JNFA 5B7DA 3OEMA 3SETA 1TWYA 1OLCA 1H45A 1SYHA 4DE8A 4YKJA 3EPEA 4MLQA 4H67A 4YMAA 2XXPA 2XXHA 5I56A 2F78A 3TCGA 4OERA 4R6YA 2XHDA 2ZNUA 1T0KA 3OO9A 1I6QA 4I1DA 1PC3A 2Q89A 3FXQA 2O1MA 4PQJA 4YKKA 1EZPA 3LSLA 2RC9A 4E0WA 3NK3A 4GXSB 4X9TA 4WKMA 1LBBA 4WEPA 4QFOA 5IAIA 1QUJA 3FATA 2H25A 3TTNA 4H65A 2QS2A 3LSXA 4QF9A 4EDPA 4JBZA 5H8SA 4U21A 1A40A 1PBPA 4TOZA 4R75A 4ELRA 5DEXB 1QVSA 1POY1 4OFLA 3C32A 3IK6B 4NF6B 1AMFA 4R9GA 4XIGQ 5KCJA 3PUVE 3G7WA 1KWHA 5DT6A 1B4ZA 4F3SA 2YJPA 1B40A 1D9VA 4OYVA 2O68A 3DP6A 4BDMA 1AOVA 5H8NB 3IB1A 4ELQA 3G3HA 2NOOA 3H6VA 2Z8FA 3VLUA 5FTIA 4KYDA 1DPPA 5TP9A 2A5TA 4POXA 3H4ZA 5I56B 3K4UA 2B3BA 2QMXA 4G8HA 4EQ9A 1S7YA 3MC2A 4ZE9A 3OSQA 5CRYA 4Q8RA 3N6TA 2PYYA 1PDAA 1F9BA 4NF8A 4Q0CA 2LAOA 3HHGA 2V3UA 4WEDA 3H6TA 3FV2A 1MM7A 3KFMA 3S9MC 5IKBA 4ZEKA 3I5OA 4H8IA 1JETA 3CFLA 4NF5A 1O7TA 4TQUQ 2ONKE 3OO7A 4EXLA 2DWJA 1USYH 4YU0A 1HSEA 1IXGA 3THIA 4JXIA 2BJJX 3MZBA 4G4PA 1MDP1 2HZLA 4O3CA 3LR1A 4F31B 3N94A 1MY1A 1MXZA 1IQ7A 3SKPA 1N7XA 1Y3NA 1N76A 3W9VA 2QS1A 1PEBA 2GFEA 5JEIA 4G68B 5I2KA 2F7CA 2R9JA 4F3PA 5KCJB 2NWJA 1JVXA 3KSJA 3EQ1A 1D9YA 1RYOA 4GWOA 1R9QA 2UYEA 1MQDA 2QJEA 5BUUA 1SD3A 1UIVA 1ZU0A 2D3IA 4RA1A 4AQ4A 2RC8A 3Q25A 3SEYA 4OETA 2OLBA 3VLWA 3CSGA 4GLIA 1I69A 4DLDA 2XX8A 4HCWA 3MUQA 5TP9B 2A5TB 2P2AA 2DWIA 3MVWA 4RY1A 4GOTA 3MZ1A 2V3QA 2Q88A 1XVYA 4U4SA 4ZEDA 5CI5A 3PUWE 4H6DA 2AL4A 1JEVA 2OZZA 3TTRA 4PE5B 4NF8B 2ANJA 2IA4A 4F19A 3KG2A 1MPDA 1IEJA 3DELB 2VD2A 2W7YA 1R6ZA 5DVFA 3RT8A 3TKDA 5I59A 1VE4A 4NF5B 4K3FA 3G3GA 5H8HB 1A8EA 5AE4A 5FTHA 4LZ7A 4Z7EA 3NK4A 4JWXA 1P1OA 2DE2A 1M5FA 4R72A 1LAXA 3S9EA 4N13A 4KCDA 1P1NA 3G3FA 2DVCA 2REJA 2XXIA 1BTJA 2DOJA 3KSXA 4FE8A 1CB6A 4HCYA 4LQ5A 4IB2A 1SW2A 3QIMA 4GRKA 1FTLA 3KZGA 4DCXA 3QK6A 3OO8A 1MQIA 5I2KB 1MH3A 4IGRA 3H3GA 4NF4A 3VXBA 3K0VA 3CR9A 3UA8A 4C1TA 3OELA 4FATA 2RC7A 2ONSA 2O84X 4L17A 2V3TA 5DYHA 3RLFE 3PUYE 3EN3A 5CMCA 2F34A 3D4CA 1SW4A 1B3EA 2X26A 1Y3QA 4ECFA 1NNPA 1URDA 5AA2B 1B1XA 1Y1MA 2ZXTA 3O6HA 3P7IA 3WAEA 1NKXA 3OXNA 3BKIB 4R2FA 1Y9UA 2PBWA 2VOZA 3TAJA 2I3VA 3U8QA 2F7AA 2Z8DA 5I59B 4DXCA 4N07A 3VFJA 1LB8A 5EHSA 3S9NC 3IJOB 5H8QA 1A54A 3TUSA 1MY0A 4NWCA 4ZS9A 4IO7A 4IO2A 4JSOA 4MF3A 3QUJA 1IITA 5I57A 5K2XA 3RUMA 4EF1A 1BIYA 4OEUA 5JTYA 3DP8A 3MP8A 4NF4B 1IXCA 1VFEA 2XD2A 2NVUB 1B1HA 3MBPA 2F6GA 3SDFA 2DXYA 1HSJA 3FJGA 1ANFA 4YAHX 3R6UA 3T93B 4G8NA 2DXRA 2ZNTA 2ZYMA 1ATGA 4PFTA 2H98A 4F39A 3IORA 4U2RA 4GF8A 3U93A 2AIXA 3LUYA 1TXFA 3IR1A 1ZJLA 3TODA 3VE1B 4ESWA 3TEPA 1YTVA 2XXWA 3MVXA 4FAJA 3EHTA 2XXXA 4OMBA 1MPCA 4BDNA 3QSLA 1Q1KA 2QS4A 4RNSA 4H0WA 1SW5A 1Y4CA 1LAFE 1M5BA 4KI0E 3M3LA 1OQGA 5CMMA 5A5XB 3IAZA 4LVQA 4F29A 1I6BA 3BBRA 5EYFA 3IO6A 1H44A 5F7VA 1XHYA 2ZYNA 1QUIA 4FIMA 4NEDA 3N5LA 5H8QB 3CIJA 3T96B 2F6PA 3OMBA 3EHSA 3MPKA 1JW5A 4EXKA 2RCAA 1FQCA 5I57B 3U92A 4OFJA 2PMSA 3K6VA 2I49A 3RGYA 5TPAA 4ZZAA 3C35A 2YPNA 4H5FA 1QJMA 3PPRA 3O28A 5DVIA 3SEUA 4ZZEA 4NMYA 3H06B 4HW8A 3B6QA 1DPEA 3TPAA 3ZKKA 3N26A 3UIFA 1XOCA 4LZ8A 2DWHA 3U72A 1NNKA 2O1LA 4C1UA 3ECRA 3DM0A 3KBRA 4DIGA 3FD3A 2REGA 4GL8A 2WKYA 4XTCQ 1MXWA 4PFUA 1B7HA 2OBGA 4E0XA 2CZLA 1SW1A 4KYSA 3I3VA 2B3FA 2HZKA 3QUFA 1H43A 1IXHA 1JEUA 3CSBA 3L6GA 4ELOA 3ONMA 2UVGA 2GRVA 3LSWA 2UYFA 5AA4A 3A3CA 2D5WA 3FUZA 1MY4A 1B46A 3T9UA 1B4HA 4DDDA 3I6VA 1MRPA 1GVCA 1MS7A 3HCQA 1B2HA 3KN7A 3RTFB 1YPNA 1URSA 2QMWA 1VR5A 1DOTA 3VLVA 5ISUA 1N84A 3TZAA 1PB7A 2PT1A 1LFGA 1B52A 1P99A 3T9HB 2AYSA 3PUXE 3V83A 1ELJA 2F7BA 1FTOA 4RPOA 2RF1A 2OK2A 1B5IA 4KHZE 3OD7A 1Q35A 1P1UA 5DVJA 4GFRA 4FJPA 4OZ9A 2PVUA 4QRZA 4MFIA 1DTGA 1QUKA 3FVOA 3M8UA 2Y84A 4U23A 1Y20A 3F11A 1LLSA 4YB5A 1WVJA 3MW0A 4I8CA 1SQYA 1USYE 1ZMGA 3IOTA 5I84A 4Q5TA 4F2QA 4ZEFA 3PGFA 3G3JA 2F8DA 3R26A 3HHFA 5L9SA 4RK9A 2I4BA 1TFAA 2OWTA 4U22A 3K01A 2ZYKA 5CC2A 1AIVA 1M5CA 1B6HA 1IUDA 4F1UA 2HEUA 1N7WA 3SEVA 5CMKA 1MH4A 5ITPA 1OQHA 5H8FA 4ELPA 4IGTA 3JV9A 4JB7A 4QHQA 3ZSFA 3W9WA 1TFDA 4AB5A 4FEDA 1AH5A 2O51A 3IB0A 3QAXA 4IO4A 3IX1A 5AA4B 3FXRA 3VXCA 4ZECA 3MJNA 3ODBA 5CMBA 4F22A 1ZIUA 4G77A 1MPBA 3K1MA 4LONB 5KZTA 4H8JA 1B3HA 3IOUA 1B9JA 5KDTA 2Y7KA 2DQVA 3HV1A 1A8FA 2XXTA 3FVNA 2VD3A 3G3IA 1LAHE 1SI0A 1B05A 4JSDA 3ZKLA 3ZS6A 5F1QA 4XKRA 1II5A 2V25A 2UVIA 3KJ7A 2HQ0A 5CM6A 2AL5A 4OWDA 1B0HA 3T9VA 1URGA 5EHMA 2E0SA 3GBBA 1UIUA 3OSRA 4H5GA 3K00A 4Z0IA 1MM6A 2NUVA 3D4GA 2KLFA 4H1XA 4THIA 1LBCA 1R1NA 4M4GA 2D21A 1NH8A 3RPWA 3OO6A 1FW0A 4EUOA 4OEVA 2Q2CA 3W15C 4R6KA 2HCAA 4UA8A 1B32A 4GIZA 5B70A 1M5DA 1N0TA 4OHNA 4XXUA 3R7XA 2Q8JA 5AA2D 3H03A 5H8FB 4F3BA 1FTKA 2RINA 3IOWA 4F1VA 4YICA 1GGGA 2E1SA 1B0LA 1UQWA 4GXAA 1BP5A 1FQBA 3H6WA 3K02A 4ZDMA 3K6UA 2ZNSA 1WODA 2HAUA 4R73A 3A09A 4EQBA 2Y7PA 1A55A 5M2VA 1OVTA 3UK4A 5HM4B 3HO7A 2F35A 2HAVA 5KDTB 3V5AA 5I58A 1DSNA 2XXUA 3RN8A 3KJTA 1IZ1A 2R6GE 4PP0A 3LSFB 4PFWA 3S2VA 5HPQA 3A3UA 2DSFA 4KD5A 3CI8A 3LC8A 1QW0A 3E9XA 2G29A 4QFLA 3RT6B 1S50A 3MWBA 1L5TA 1A7LA 3FIRA 3PU5A 1SBPA 2Z23A 3OEKA 3PV0E 4JWOA 1POTA 3FGSA 2H99A 2RCBA 1US5A 3E13X 3O97A 3U94A 1NMUA 3T22A 3B6TA 2DS9A 3O6IA 4ZEBA 4YB6A 2X7QA 3PMXA 4KQPA 1RKMA 3MVZA 1B3LA 4FORA 3MP6A 2XX7A 3IB2A 2V93A 1J1NA 4YB7A 2OJTA 4IY5A 3O29A 1N3XA 3MQ9A 2Z22A 4G2ZA 4NTLA 2QS3A 4DXBA 1MDQA 3ILTB 1MQJA 2VP1A 1PB9A 5BWJA 3MZ9A 2H9BA 4IO3A 1MXUA 4LUBA 1R9LA 4LATA 2R71A 1FQFA 4QSDA 1FTJA 2OWSA 4F3GA 1Z7ME 1FQDA 3K6XA 4JDFA 3USDA 4LQ2A 5I58B 3QYTA 1NH7A 1Y4TA 1QULA 4RYAA 4ND9A 3G3KA 4R2BA 2Y7WA 4NE4A 4C0RA 2H5YA 1ZKBA 4IY6A 4POWA 3OENA 3C4MA 3KN3A 1O64A 1YAEA 1XT8A 1LCTA 4OTEA 2DVZA 4GQOA 4BDQA 1JVYA 4F18A 4UACA 1JQFA 3PD9A 4N6PA 1OIBA 4ZEIA 1LSTA 2GHAA 4HTGA 5JTYB 4YMBA 3PUZE 2M8CA 2O69A 4FEBA 1B58A 3ILUB 3O6GA 3V89B 1S9TA 2IEEA 4YZZA 1Y3PA 5ICTA 1B7UA 4RJZA 4OQOA 4FECA 3RY3A 3FJ7A 3UN6A 1MY3A 4OVJA 1AL3A 5DTBA 3H7MA 1P1WA 1SI1A 2I58A 3C33A 3PMVA 5L8DA 1SVXB 4G68A 4ISUA 1SDXA 2A5SA 4YKPA 1GV8A 5J1DA 4F2OA 1B3FA 2F5XA 3PPQA 3Q27A 1LGBC 2I0BA 2VHAA 3KOSA 1EU8A 4G68C 4IO5A 2O7IA 3SEXA 2I6EA 3GXAA 3T66A 4WXJA 3QXMA 2THIA 1DMBA 3TDJA 3RQTA 4HS7A 2ONRA 3CFZA 3T9XB 3FZVA 1N3WA 4R6HA 1MXVA 3JZJA 3PPNA 1B5HA 5ITOA 1PB8A 2QL3A 3N6UA 4OXVA 1MQGA 1XS5A 2ZMBA 4ESXA 3RNNA 1Z7NE 5CBSA 1I6AA 1QKAA 4BLAA 4DCYA 4P0GA 4PETA 2Y7RA 3K1NA 2XXVA 1GTKA 5TPAB 4ZE8A 4LP2B 4U1OA 3LBSA 3S4UA 3TTMA 5I2NA 1XC1A 4PFYA 3GBAA 1OLAA 3U1OA 5H8HA 1TT1A 3SERA 4RXLA 2Q2AA 5LOMA 2I4CA 1H3DA 3TELA 4Q30B 2O6AA 1O63A 3FASA 1B3GA 1GR2A 3Q29A 4P0IA 4OESA 1OMPA 3FVGA 4QFKA 2UVJA 2VGQA 3E3KA 4BDRA 5TU0A 3RTWB 3AXFA 1LFIA 3H6UA 3TTKA 2HFBA 1BKAA 1YCJA 2P1SA 2ESNA 3TFLA 1FTMA 2OCUA 1Y1ZA 5CBRA 4R74A 2DWAA 3FJMA 1B51A 2QRYA 2HXWA 4X1BA 1NNFA 5AA2A 4X48A 2XX9A 3S9LC 3CG1A 4NWDA 3BFUA 5JK4A 3CG3A 4U4XA 3FXUA 2CMOA 4P11A 4RK2A 4EF2A 3MVYA 3O2AA 4I62A 4X1DA 4GVOA 2XD3A 3WAFA 1FQAA
chains in the Genus database with same CATH superfamily
2IWKA 3PGCB 2ALAA 4ELKA 1H0DA 3CV5A 1KYOK 1U8QB 4FX5A 4Z7VB 4EUPA 5I8KH 2B9AA 3PWPE 4UNIA 1S3KL 2DH3A 5BOZG 4KKAD 4QXVA 2R0ZL 4OCXL 2HFFA 1G7JB 1K72A 3LIZA 1WFMA 3KJ4C 3QPXH 4O4YL 5CZXC 3RJDA 4XBPA 4PWHA 1GGBH 4XTRD 5JHMA 3IF1B 2D7QA 3DP4A 1UM4H 3OSKA 2VERN 1D5BB 5IHZB 1D7DA 4LQFH 4Y19D 3C8DA 4JFFB 1UZ8A 1JPST 1DBBL 4P05A 1P1ZA 4I3EA 4OFOA 1I1CA 3FCTB 5KAQF 1HIML 1N04A 1PG7X 3HI6L 1KTKE 3DI3B 2P8PA 1AZRA 4HP5A 1MXXA 2ZYOA 1A8ZA 4NNXA 2AQ1A 4F1YA 3HN0A 3I85A 4HLJA 2G75B 2JELH 4IYKA 3UP6A 5ELVA 3LD8C 4WV1A 1IAII 1U3HD 5F97E 5DFTA 1KBGH 5D4JA 2EJ1A 2XKNA 1G7LB 3HNSH 2Z8EA 5HBCA 3D9AH 3EGDB 4FQCL 3K2DA 4PRBA 3S36H 1QSEA 4IBYA 4C4UA 4FQHB 2VE6A 1EZOA 3KR3L 3U9UB 1ET5A 3U2SB 3I6KB 4OR1A 1FFTB 3KM1A 5K2YA 1IAKA 2R69H 2SODB 1HSAB 3KN8A 5F7FA 3BPOB 3MV8A 4XPHH 1LEIB 1NFDE 4OLWL 3FB7B 3SESA 2ZKHL 3X1NA 1J87A 3VGBA 4OM1H 5L4JA 1F4YL 4PJEE 4RPNA 1EXUA 4JB9H 4ZPTB 3B37A 1M7XA 4ZMXA 4KFQA 4KKZA 4CKQA 1IXIA 1ZLQA 4MMXC 5KSAB 1QSVA 4KJQD 1US4A 5FDWA 2VLKA 2QJDA 2M8XA 1UTBA 4LARH 1MJ8L 1WD8A 5DC2A 4H8WC 3FKUS 2XXQA 1PIGA 5DEFB 3MOBH 2A6IA 1MUJA 2C9XA 2N01B 3OGCB 3INUH 1J5CA 1ZLWK 5CJQL 1UATA 1CBJA 3N44F 5T1LA 4Z78A 1KN2H 3JTBA 1XGUA 2HKAA 1C7SA 2Q5BA 4P3CL 4B9ZA 3DX4A 4CN1A 5IJBC 1AG6A 3QHZH 1D6VL 1SEQH 1AGBB 4XVSL 5DQDH 1DVFA 1LO2L 2XYCA 4LCWE 1NCDL 2XA3A 4EIBA 3STZA 1D5IH 4W6YB 4AT6B 1M1XA 3S8GB 1HYSD 3QG7H 4AGQA 3O2DL 1ORSA 5F3HB 4IO6A 1GR7A 4K7FA 3HSTA 3AZUA 4LCIL 3SE8H 2IANB 3TTYA 1SN2A 4ODVH 3NCCB 3VGDA 2VISB 3G9VA 1J1OH 5JW4R 3L5HA 1F86A 1ANUA 3MLZH 4I0PA 2P5WE 3KGRA 4ORZC 1UURA 1M6UA 2PTUA 2XNAB 4QT5B 1PD1A 3O6KL 4MCMA 5ES4B 4G8MA 1GZQA 4NF0A 4NQCE 3W56A 1T0OA 2QPUA 3DMMA 1ZVYA 1AOHA 3AG1B 1QLFA 2GSGB 5DMKB 4KR5A 4NQED 3UADA 3ZL4L 1ZV2A 4R6UA 4B97A 4KKBC 3P3SA 5JHDD 1HE8A 3F85A 2DIAA 5C0EB 1AHKA 3KOTA 3FRPB 2RR3A 2W9EL 4YIQA 1FH5H 3QORD 2D0HA 3L81A 2WLKA 3KJ4B 3Q1SH 1QSFB 3BKJH 2OR9L 4QGYA 2HPOA 3GRWH 1KXVC 4TVUA 2B2XH 4FAAB 1I4FA 3P73A 1OZUA 2OJZH 3MV01 3QRGL 5AAPA 2CH8A 4RX4D 1D4NA 1MG1A 3E8UL 4ZOAA 4WI3A 5A2JH 4WFHE 3MXWL 4ZXBD 3PCYA 4Y8DC 3K5RA 1YLBB 1QWHA 1A7PH 2LTQB 4WO4A 3B1UA 5EU6B 2VPOA 5A5XA 2PW1A 3W0WE 35C8H 1KY7A 1MVFA 3ZMNA 4L3EA 2GB2A 1MXYA 1AD9B 3I6LD 3IL1B 5JORA 5BJTA 1Q1JH 4RGMC 1NCCL 3CFMA 4AB6A 4GD5A 3IE4A 3LD8B 2HMID 3AGVA 4XMXA 3HBPA 4NQSA 4XCNB 4DPRA 1BYNA 2I48A 1QSZA 4HK0A 4N9GA 4B9KC 2CHDA 5DHEA 1ZVSA 2DE3A 1IFRA 3GLZA 1EHNA 3F2LA 1OGPA 4R4BB 3HNVL 4NX0A 3QXAA 3DO7A 4FZ8H 1IMAA 2E75C 5EWIL 3C5ZC 1JW1A 5ACZB 1JZ2A 2G5UA 5TH2B 4GSRA 3RPIB 3QIWD 2O61A 4JVIA 3RWCA 3S5YA 3G6AB 3K6NA 4P9HH 2QKIA 1J1PL 3Q8CA 1ZBMA 1OTSC 4OFDA 3KLDA 1L5GA 2DD8H 2RTTA 1L9TA 4JPWH 2H9GB 3K1PA 1G9NC 4LL4A 4MMXB 4GEIA 1BBJA 3BZ5A 4K5LA 5DLMH 3OB0H 2VDMH 2XTJC 5E1GA 4GT0A 2NY5C 5J0BA 7CGTA 4OENA 1I8MB 2UXTA 3C2AH 3OKOB 2VZOA 4HKJB 1NFTA 5TE7L 5IEHB 4AGMA 5EUKB 5DLLA 3J2PA 4PJHB 4KV5F 4Q6IA 5EC2B 4RGNE 5DR5H 3SYQA 1N70A 3LMJL 4FNTA 4KHTL 4K07A 2JKNA 4D3CH 3V95A 3NFSL 4PGZA 2MNUA 3GSWB 3SGKC 3N0AA 3WCYA 2F7PA 1S7TA 3C9HA 3RDTC 2MOQA 4QSCA 25C8L 3FB6B 5C0CE 2FVNA 2O7UA 1NV1A 5DEXA 3GO1H 3TH2T 3FQTB 3WTWA 3A24A 1WFUA 1D9QA 4PJGA 1MNUL 1U8MA 4FQLH 5CKGA 4MD4A 2NXOA 2F97A 3AXIA 4NF6A 4ZMAT 2NZ9C 1QRNA 3QXDA 4KXCA 2B65A 1MRCL 2OWZA 3CRBA 2E3VA 2JMRA 1NBYB 1R3HB 1FNEA 1CXKA 3CN4A 1E4KC 4UOW0 4X6CB 3JUZA 4M1CC 4KX9A 5I15L 5JHLH 4JWYA 4LZ5A 1KG0A 1UQSA 3FN9A 4AV0A 2FJHA 4GG6F 2R1YB 1FZOB 1RVFH 4QHKJ 3RWDB 3W1ZA 4I3RH 3BFQG 2Q0ZX 3P11L 3MRBB 4JN2B 3D48R 3QIBC 1NKOA 2EYTA 3QEQA 1ZJAA 4FBPA 2I0CA 5E9DD 2K70A 4N1CA 1TETL 1TFPA 3CPUA 1UTHB 2LOEA 3TM6A 4V1DE 5TJWK 3C31A 4IRZL 1VZIA 5FUOH 5T3ZL 3MVSA 1M5EA 1TZIB 3JWDC 4FKKA 1WUNT 4B3VA 3POCA 1CFVL 1GMEA 1J8SA 1XZWA 3B9DA 2FR4B 3M1OA 2AJSH 2D3VA 5L9MA 3ZTEA 2JKSA 4LLWA 1BX2A 5J1AA 4N0YL 1WEJL 4MDIA 1O75A 3SKNA 3NOIA 3TJEL 4WHYG 2VDQL 4YKJA 1N6UA 3ZE1F 1AQ8A 3PNRB 4IOIA 4RGMB 3EPEA 2ZWSA 1IM3B 4U7MA 3S36L 2OSXA 5F1IA 3H3BC 2P5PA 4P5SA 4H67A 5L8LB 4YMAA 2XXPA 2JTDA 1RURL 2BY1A 5KW9H 4XO8A 4Y4HD 3IMSA 4ORGB 5C6PB 1JYVA 5B1AB 1TJHH 1UH3A 4OY9A 5E5LA 4R6YA 2VSDA 5FV1L 1YPZE 2J12B 4WGWB 3RGHA 4CBZA 5I1AB 3W11C 4QXDA 3VXOB 5I66B 5D6CB 4Q0XH 1I6QA 3FNKA 2MCPL 1D7FA 1IAOB 1WWCA 2EIZB 4G7YH 4BJLA 1RK0A 2O1MA 1U8NA 4OCYL 3ZDXF 5AZEL 5ISZB 3MX0B 4YKKA 1XXDC 3KCWA 2CXGA 5FECB 3NK3A 4PHZA 1O6SA 1CL7L 2XTJB 3FO0H 4X9TA 4WKMA 5IESH 1HINL 4TULL 3UZEA 2IWGA 4ERSH 5ESAA 5EZJB 2J72A 5D7LE 3L1FA 5ITBL 3COOA 1E28B 1GIGL 3O3DA 4W9IC 2XQYA 5AW6B 5B3SB 2VABB 5HDQL 4AZ8A 2VH5L 1DQLL 1BIIB 5IAIA 4RGOH 5C0ND 4IDLA 4XO4A 3TA3D 2H25A 1JGDB 2RA1A 1T66C 2KLRA 1F2XK 3RDTB 4IBQA 2Y1YA 1U8IB 5EOTA 3TTNA 2R4SH 3NABH 1A5FL 4K9EL 4AQ8A 2QS2A 1CVRA 4N81A 3LSXA 3SOBL 1MFCL 1OSPL 4LHUA 2ZX5A 3O6LH 1JP5A 3WN5A 2F5BH 1U8PA 2EDFA 3HRZC 4YQXL 5K9JL 5E08L 4F57L 1AC6A 1CU4L 4GBXB 5GRUL 3V6FA 2EADA 3I74A 4NO2A 1SFHA 2O30A 3KLAB 5T3ZD 3LQZA 3D69B 4P56A 1XGTB 3NRPA 4KUZH 5E94B 5IMMB 2HXAA 4R75A 2WBDA 1QHPA 4UQ2A 5FW7A 4D0DA 3FZUD 1QVSA 1POY1 1XH1A 1QLEB 3VFVB 2YXFA 2B08A 3PWUA 3IK6B 4NRZB 2B14A 4L29B 4A7UA 1USZA 2R0ZH 4JM2D 5E8PB 4XIGQ 6FABL 3VWJA 5JA9A 2FX8L 2XQ0A 3L3OC 5HYQB 4IBTA 2JKLA 1U4FA 1EQWA 3G7WA 3KPMB 3KXFD 4UM9A 5AOLA 2VR6A 3B34A 4GB9A 4QTIL 5SWSA 4CVXA 1EFQA 1TTBA 1FJ9A 1KWHA 4IBWA 4GP5B 2YJPA 5B3JF 1DBBH 5FA4B 4MKMA 1FN4B 4F8NA 4YSUA 3BESR 4NBXB 3O45B 3BH8A 1B40A 3MUHL 1X5IA 1BF2A 1QA9A 5KANG 2K9UA 3DNKA 4TQEL 1Z3GL 3N43B 3MNVB 4Y16D 5D1XE 4GW1A 2ZZWA 4N87A 1KB5B 1TUPA 3QP3A 1EWHA 1KLFA 1NL0L 4NJAL 4P2YA 1WDAA 1XTLA 2Z1KA 4M5SA 5DXWA 4M9OA 3H9ZA 3DV6A 1AR1C 4KKLC 5IQNA 5FO7B 2WXFA 4BDMA 1G0IA 3ILEA 4LHUG 3WBDA 4K71B 4O5LL 4ZAKA 4R26L 2O1AA 1S9XA 5H8NB 3ILPB 1T7XA 3ENEA 3U4BH 3KR3H 5EBLA 2OW7A 4M7KH 3R8QA 4C58B 3WUZA 1C12B 4JVWA 4EI6A 3BZEB 2VDRL 4O9HL 3G3HA 2YIHA 3NOHA 4Y2DD 2ZUUA 2D03H 3HHSB 7TAAA 5B1JA 2Z8FA 5D4IA 3O9WC 1SJVA 5T1DH 1L9QA 4PGBA 3ULUL 2XV0A 3PIQA 4KYDA 2ZKHH 3P3UA 4LKCA 3B9KC 5K69A 2ICEC 3ATFA 3S3JA 2J6EA 1F4YH 4UV7L 4BA8A 5F9DC 5I75C 2Q3AA 1NCIA 1PZ3A 2L7UA 2V2WB 2VW4A 2X6AA 2BO0A 2VL5B 4JRXD 4PV9B 1HHKA 1PD0A 3K4AA 5DEZA 5FGBC 1DBZA 3K6FA 4NZRL 4I3SH 3O3AB 4JFVA 2F3DA 4DQOL 1S9KC 1KC5L 4BFKA 1ZHBA 3T09A 5BOJA 1T03H 1IC7H 3F62A 1TZHB 4P07A 2BSRA 2E6QA 3K4UA 4G8HA 4EQ9A 1S7YA 1OANA 2JJSC 1GYVA 2WQAA 4BKLB 4QRPA 3OSQA 1S7SB 4FEMA 4EZLA 1DR9A 3N6TA 2PYYA 1EH9A 4TQIA 3CVBA 5CJQH 2VXVL 1MRFL 5IEKB 2W80C 5C08D 3MMEA 5H35B 1EZVY 1Q4NX 3KVDD 4HJJH 3SDDA 3T0WA 1DUYA 4P3CH 2JKXA 1KIUA 4IU3A 4X7DC 3AG3B 4A68A 4WEDA 1D6VH 5FKAB 5CGMA 1JWMB 4X7FC 1MM7A 3DA0A 3GMOB 2QQKL 2W0FA 2HVJB 4DZBA 4A7SA 3MJGX 5ID1A 4FTVD 1T0PB 1IEAA 1NKGA 4QWWD 3O2DH 3VTAA 3TO2B 4ELDA 3C2SA 3KWTA 2BIHA 3QQ3A 4LCIH 2Y72A 3LS5L 4OI8A 3CDGB 4K3EL 1SBBA 2MQ3A 4TRPH 2L4OA 2BY0A 3MBED 1YEFL 4XVJH 2RFXB 1D5MA 32C2A 3G5VA 1RP9A 4PJIE 2FDBP 4PJDA 5DZJA 3ZU8A 2I5YL 3V0AC 3ZRFC 4WSGA 4AQEB 3VXSE 3MRQB 4YSEA 2YD3A 1IXGA 5GJSH 1HESA 2JTYA 3KWUA 3V8CA 2X6UA 4HWBH 3OMIB 5IQMA 1FO0L 3ZL4H 3VFPA 2DQGL 3RI5F 4PLNC 4FLQA 4G4PA 1NM4A 3DGGA 2BWDA 1IEBB 3KYMA 1G7PA 4QAWA 5EUOA 2F19L 4F9PC 4WRLA 2VXTL 4LVHC 1XF4A 2V3DA 4J1UB 5I6XC 1RSFA 3L3OB 1NBZA 1H3PL 1OSZA 4F31B 4E36A 2DMBA 1UB6B 3N94A 2GJ6B 1MY1A 1O5PA 3CN0A 4NC1E 4NP4H 4NQDA 5D9SA 5GGUB 4HJUA 3QRGH 4I88A 2G0LA 3ARFA 3E8UH 3G7TA 1IQ7A 1R47A 1XZ0B 3MXWH 3ZKNC 1U8LA 5LBSH 1N76A 1MELA 3JV6A 5I1HL 3B6SB 5EO9A 1ZLEA 5C0GA 1E5YA 5JEIA 4G68B 4GAGL 1TTFA 3MBWB 3ULUD 3EJJX 1QUNA 1EGJH 1LP9B 3V6OC 3FF7A 3VFSA 5KSBF 3LZFH 1NCCH 1AR1B 1JVXA 1IMCA 2OV0A 4AC2A 1THCA 4BQ9A 3FCGA 1D9YA 4IBLT 4YC2C 1XSIA 3MRPB 3U4EB 1J0YA 4GWOA 4JFQB 2GSIB 4KTDL 4X6EA 5J13C 4W93A 4TQPA 4RLDA 4TNWK 4EZJA 1MQDA 2MCG1 4HIPA 5BUUA 1UIVA 1IAIL 4JFTA 5EWIH 4LSPL 5KVGL 4YH6A 2D3IA 4L3FA 5JUEL 3TO4D 4RA1A 3GQFA 1J1PH 1E50A 3Q25A 2YRBA 4OETA 5BOPA 2XWBA 3I3EA 3GBDA 4YFEA 1ZS8B 2E7LA 3CSGA 1FZJA 4ICWA 2HG5A 5KYUB 2X4UB 4GAAA 3LYRA 2A6DA 3GSNH 3FTSA 1F4WL 4DLDA 5J8OA 3VGAB 5KEZA 3QG6B 5ANME 2ZXQA 4WFGD 4D8OA 5TE7H 4ZMPA 4N9OB 2XFXA 5KVFL 2Y7MA 4HK3J 2D31A 2HB0A 2XX8A 4Y9FA 5HVHC 2Z8SA 2UWEA 3MUQA 5D5MA 5GGRY 2P2AA 2JCWA 3MUGB 3MNZB 4KGLA 2FYVA 4KHTH 4X6FA 1BD2D 3MJ7A 2EXWD 3PNWA 5BS0B 3VRLE 5IJVA 3EO9L 3PQYE 1YRKA 3Q8EA 5BQ7A 4YK4C 2WLHA 5BW7A 1MHHA 1XVYA 3NEXA 1DJYA 4PRPA 4BSWB 5CI5A 3KPPA 3LNHA 2BOBA 3IFCA 1P84J 1XQ4A 3DROB 3MJWA 1FLRL 4DTGL 5FUZL 1S5IH 2C1OA 1BIHA 2FD6L 2BHUA 5ADPL 1MRCH 1J18A 4N22A 4U1HA 5F72S 2OZZA 2PCRA 2WXRA 1D5XB 1EZSA 3WFHA 4GWZA 2AS5M 4NF8B 3CFJA 4WWNA 2BSBA 2CJSA 3BN3B 2IA4A 4AQ1B 3QUZA 5I15H 3OXRA 4OIBA 5LXGL 2D7TL 3WNPA 3GXIA 2N3JA 2X1WL 3UEQA 5I16B 1MPDA 3RZCC 3UYOD 2H2SD 1IEJA 3P11H 4G8FB 3S88H 2KLTA 2YGVA 2VD2A 1JVKA 2W7YA 4RAVA 2L04A 4JFFD 2BRRL 1JZIA 1EEQA 2XY1A 5EEZA 1E7UA 2AMGA 3RT8A 5TF1L 4CSTA 3O3BA 1MIMH 4MJIE 5JYMA 1VE4A 3OZLA 5LUMA 3G3GA 3SGEH 2Z4QA 4LVHB 5H8HB 4IRZH 4FNSA 5AE4A 3RYMA 5T3ZH 2AP2A 4GUPA 1AD0A 1WTGT 3L3JA 2Y7NA 3KLSA 3KGTA 4AYSA 1CFVH 1P1OA 4XI5C 2IAAC 1M5FA 4ETYA 1YVLA 3BEWB 3N85L 5IMKA 6TAAA 5IB2A 2BOCB 1NKRA 4BBWA 2PPDA 4N0YH 1WEJH 2AJZA 2EE2A 3ARBC 3F7YB 3OQRA 3BXNB 5B39G 1P1NA 1RJZB 3IDIB 3OPZH 3WIIL 1PZBA 1FWXA 4ANXA 1AVAA 8CGTA 4WCYL 3VCLA 2VSMB 1MI5E 5J9PA 2X05A 4GX3A 1C7TA 2AJVH 1QR1A 2DOJA 1IGML 2F5AL 12E8H 4XNUH 4P5KB 4FE8A 4HCYA 2R29L 4IB2A 3PAUA 4Y5VC 4GRKA 5DUPH 4YL4A 4YC2B 1MLBA 1FTLA 1PGRB 1RURH 1TCMA 2BVQB 3BVVA 4DCXA 4I9WE 5J13B 1MQIA 1JDAA 3CFCH 2DQIL 4PLJD 5KSAD 1OOWA 1DK4A 5I2KB 3BP6B 3I3DA 3RE0A 1LEKB 3VYOA 1MH3A 5ICUA 1ZXKA 3VXBA 4HOMA 5DHMC 1T04B 3K0VA 5SV4A 3CFIC 3EO0A 4K5PA 2C3HA 5GGSB 1Z2KA 2FUTA 4R0LC 1FZMA 1E6OH 4RIRA 4OCYH 1D9KA 2VLJE 3OJVC 2BNRE 5AZEH 5IHUL 2XV2A 4B9PA 4MNGB 1CQYA 2ODHA 1N4XL 3D4YA 1CL7H 2MOVA 1G7QB 3NRFA 3BGFB 4PWEA 3DOSB 4MMYB 4TULH 2JCCE 2Y5TB 4ZX4A 5DYFA 2W88A 2D2OA 3QEGL 3ULSA 1GIGH 2XKSA 4P2QB 5DYHA 2ZXBA 4JY6B 3RLFE 2VH5H 5DK0A 5E8OB 4Y5YA 5FYJL 2XV3A 4IM8A 4MASA 2LGNA 2CHZA 1BZEA 3NAAH 5CMCA 2F34A 2FYYB 3NCMA 2NYZA 2IAND 5F70A 4YK4B 1J9QA 2HFEB 4K7PY 3HE6B 1A5FH 2HLEB 4K9EH 3RKDD 2Q7YB 2OMTA 5DVLA 1OM9A 1RIVL 4POZD 3SOBH 1MFCH 1URDA 4XGZA 5DJ2B 1UM5L 2VN3A 3QT2A 2VT5A 3AS0A 1PD6A 3FXBA 4N0UA 3QIUA 5ID0B 4ODUB 5K9JH 1HXMA 4F57H 4YHIB 2EEFA 1CU4H 2YXMA 5EC1A 5GRUH 3V0VB 2PCPB 3DYPA 3H7LA 4Z7UE 2CO6A 1I8LA 1KIQB 3HR5A 3N1MC 4HSCX 2MCMA 1NIAA 4ELMF 1Q9DA 1QYGL 1OCCB 2Q7AA 4NKOB 4PJ9A 4JKKA 2OX5B 1NKXA 3IRZA 1QSFD 2NUPB 3SIKA 4DGWC 1BXXA 1OAQL 2X9WA 4HKXB 5CJXC 4I2XB 2CM6A 3KYOB 2QGEA 1AO7B 4KO6A 2MCAA 4L2YA 4KNQA 1EAQA 1X6NA 4BH7B 2WP3O 1RUQL 2FX8H 5I5IA 2QV2A 4R2FA 4YR6A 3B56A 4LSSL 1RZIA 4PSPA 3BIKA 3RYDA 3RWIB 2JXMA 1GZPB 4XBMA 1N5AA 5EU6D 5FUCC 3X14A 1WS7A 2OMBA 1FFQA 5DMGC 1L7TL 4QRQB 3MJ9A 1DQQB 2IVFC 2H1PL 4MQ7B 1CVSC 3ESOA 5B3NA 2XN9B 1OVZA 4NKIL 1KGUA 2PF6A 1AS6A 2GABA 1Z3GH 3DURB 3HAEA 5I8OH 4NZTL 4FYQA 4GKSA 5CXPA 1J0ZA 5F7YC 3X3GL 5B38A 4NJAH 3SBWA 4PRAA 3RX8A 4UI2A 1UOKA 2NY0D 4DXCA 3BJ91 2DYPA 4HEMA 3WS3B 5DGRA 1X5FA 5EZLA 1LB8A 4O5LH 2HX8A 2J8UE 1CGYA 1JHTA 4R26H 4U1LB 4GWSA 3S9NC 2YA0A 5L2KE 3ZW3A 3QEUB 5DS8A 3NIFE 2PWHA 2YQBA 3FSVA 2WNGA 5MP6L 1PAZA 4O9HH 5GSRA 4CA4A 4PY7B 5DS2A 1NMBL 3T0EC 5C9JA 3DVNA 4L4TA 1N9PA 1E8YA 4ADJA 4JO1L 1CF8L 2IAMC 2DI9A 5I17B 3ULUH 4HFWB 2FVZA 2G5BA 1P53A 1GS6X 4PS7A 2PO6C 2FNBA 1E4XH 1PY9A 3E9UA 4HGWB 4UV7H 4A67A 5I57A 3MUUA 5FYJD 2QL1A 1NGPL 4OFIA 3IMRA 1KGCD 1TIUA 3TH3T 1Y0LA 3WL9A 4NZRH 3WFEL 1X7QB 4R0LB 4ZFZB 1UA3A 4DQOH 1I1AA 3O8XD 1KC5H 3CVHA 2VXQL 4NCC1 4GJTB 4LRNL 1KGWA 4I1PA 4X83A 3KNBA 4YSAA 2PPFA 1XGRA 4QHPA 5E6IA 3DP8A 2FT6A 1GGCL 1K6QL 1UENA 3X3FH 1ONQA 1OP3K 1IGJA 1JPSL 5G5DA 3UG5A 3MCYA 2VXVH 1MRFH 2ZUVA 1VFEA 1N0XL 1R5VA 4YNYA 2LU4A 4OCWH 1SJHA 1RZJC 2DM3A 3CBJB 1NC2D 1B1HA 1YMHA 3MBPA 4CSZA 1A8JH 2VKWA 2ESVB 4GG8A 4UDUA 2YGOA 2E7MA 4IHBA 3SDFA 4GG6A 4XN7A 3DUUA 2H8PA 2PLTA 4L05A 2FIKB 2AQRA 2MPVA 5I76A 3T1WA 3H9SE 1PSKL 3SGJC 2NR6C 2AXGB 3HS9A 3KHOA 3QA3A 2VAJA 4NENA 1AQHA 5JIQA 3FJGA 4WGKA 4TQHA 1KZYA 4DOHB 3OAUL 3R06B 4LFHD 5HPOA 4K3EH 1PPIA 1HEZB 1BWWA 2J8HA 2HVKA 2DXRA 1R33A 4UM8A 1PTZA 1I8KB 3T6WA 3X11B 1YEFH 3PWPA 4DVRL 5CCKL 4HC1L 3CDYA 3SKUD 3QYNA 3DVIA 1ATGA 4KQ3H 2LU3A 1W15A 2K4AA 4XMKL 1RULL 1C5CL 4NN5C 4X99B 5BZZA 1ZTXE 1CN4A 3KS0H 1U6AH 4P1LA 1XGYL 3ZZQA 4F39A 4FP8L 1V10A 3MRCB 4EJ1C 1EVUA 4IKJA 4MS6A 2YRPA 4KQ0A 2E9JA 2DQGH 4URTB 1SXBA 5HHQB 1NUXA 3IORA 3M17B 3UGXA 1VAHA 3UTSE 1NV4A 2KZKA 4U2RA 2CG9X 2V5YA 1V05A 2F19H 4L4VE 1QLEL 2G3MA 2VXTH 2WQWA 2AIXA 3ZQ9A 4MSWA 3DX9B 2HX9A 1H3PH 1CICA 1KNOB 2NXYC 4XPTL 4ESWA 4Z7VE 5IQ7H 1EIBA 4UYPA 3TEPA 1DVSA 1F6LL 5DJ6A 1YTVA 5EOQH 2IPKA 4G6AC 1JL8A 4J2QA 5B8CA 3EHTA 5I5PA 2XXXA 5I1HH 1VEMA 2ZICA 1QEWB 3CZFA 1IM3D 4CW1A 4YL9A 4M29A 4MJ4A 1NMAH 5DRNB 3BD4A 1ZSHA 3SJVD 2C26A 2BINA 3ATAA 3QSLA 5IREA 3F6IA 3QZPA 2WD0A 4WW2B 2NY6B 3TCXA 2X41A 3HKZA 4WKZB 1M5BA 4G59C 5EF0A 5DJ0B 1V5JA 1HNGA 4PJEA 1UJ3C 2WYTA 4JM2F 4KTDH 3WNLA 3SDAD 5FO8B 5CMMA 4JPKL 4J3WA 4WNSA 1XF1A 2QPFA 1FPTL 2J6WA 3DIFB 3O4OC 3T0EB 4LSPH 3N91A 5JUEH 2A7BA 3IO6A 3V0HA 2XTJD 2PO6B 3LNEA 3VRIB 1KTDA 3TBVB 4B50A 1ZT4B 2XIDA 1AFVH 4OZIF 2EDYA 1G84A 2XZZA 2JB6A 1VFOA 1OPOA 4QHLB 2PYEB 3ZRSA 2QVKA 1G9HA 4PLOB 2CMRL 4N2IA 1F4WH 4BCYA 3MJ8A 4EO5A 2DLIA 1N64L 2F6PA 3H55A 2APXA 2X1QA 2EXSA 1OW0A 5KVFH 4MCZA 3EHSA 3RDTD 2IADB 5MHSD 4LCWA 4EXKA 3LSOB 1RFDH 3PJNA 1CK0L 5KVDL 2CXKA 3QDJD 4HS6A 2Y7SA 3UEZA 4Z9KB 1I1FB 3L3KA 1QATA 4DI4B 4NCDA 2PMSA 3REWB 3QJHB 4XNQA 4HPOL 2NZ9D 2XWIA 4WJG3 5TPAA 1Q9WA 4FLRA 4AUJA 4OUOA 4PRID 1S9WB 4GBXD 2PKDA 1QJMA 4RRPG 4FFYH 5I1EL 2V7HA 4E41A 1FLRH 4HUUA 4V2CB 5FUZH 1AS8A 2FQGA 2FD6H 3HUJE 4PLKC 2YUWA 1EFXB 1E65A 2WBJA 3PP3H 1M3JA 2MMXA 5J6SA 3KPSB 3QE5A 1CFTB 4HW8A 4I48B 5IUCA 4U1KA 4HH9A 2D7TH 3IJ8A 5D1ZA 5MEPA 2ZCLL 4LLDB 3WAKA 5KBLA 3N26A 3DTDA 3BQUA 5EN2A 1M57B 3D1MC 3AAZB 2WEFA 3TF7C 1BVOA 1CFBA 3IGKA 3TFKD 4NN5B 2HAZA 1XH3A 2V37A 3EUDA 2FJSA 2CO2A 3O2WL 4X4ZA 5FYKU 4OGZA 3L1GA 3TC9A 2CBTA 3NSCA 4X8GA 5HVFB 2DWHA 3DRTB 3T1FB 2WXHA 3I75B 4XBEL 5JNYA 2FNWA 1U8HB 4N3UA 2JFCA 1N8OE 5TF1H 4LOUD 1EZVX 3DM0A 3KBRA 4HIHB 3VFUA 2WIIB 3MLUL 1PEWA 4FHBD 3W0WA 4W9EC 4P46C 2GFBA 1XWVA 2NXYB 2FZ3B 2X1OA 3RL1B 5B21A 4RWYH 3UTTB 3AU1B 3D5OF 3N85H 3KVPA 4PFUA 4ALAL 1JXDA 2Q3ZA 1CFSB 1B7HA 1A3RL 1FSAA 1C16A 4OLZH 4E0XA 3IWUA 3WIIH 1SW1A 3I3VA 2HPTA 2B3FA 3WNIA 1NOFA 2V8MA 2H6OA 1H43A 2F5AH 4FZEL 4JNXA 2BW4A 2AEWA 2R29H 1F1AA 4I4WB 5BCAA 3IDYC 1S4IA 3GSQA 4P4RA 2I85A 3L3HB 4RNRB 3MYJA 4XAWL 5G2NA 1NUFA 1MCWM 4R7NB 1UJ3B 5E6UB 1ZE3H 4OZHE 2AV7B 2FH8A 2UVGA 1MCHA 1VADA 3QJRB 3VGHA 1W72A 5FO9B 3T6ZA 3MRJA 3TF4A 2O6CA 3O4OB 3CWGA 1U95A 3S8WA 2J25A 2D73A 2X89A 4RVBA 3LNGA 3A3CA 3HE7A 4G6KL 3FUZA 2ZCHL 1MWAL 3ZE0B 1WG3A 2ZYSA 5I8CB 1NTDA 2WLZA 3OM3B 3NFPB 5ALBL 1B46A 3BKCL 5F21B 3RURA 2Q74A 3T0BA 1E5ZA 3WFZA 3ULUF 3VE0A 3QO1A 3GLAA 5J6HA 4DDDA 5EORL 3DJSA 5JIPA 5IB1A 4YDMA 4KZDL 1TSRA 3DVGA 1P7QB 2YPVL 5AUMA 4OZ4B 2NNRA 3FQNB 5C0CA 3RBSA 1NBVH 2ZX7A 1D7CA 3Q5YA 5D4QA 4HE2A 3BYYA 3SYPA 5FYJH 2GC7C 5CJBA 1NCWL 1URSA 4J27A 4UIKL 1EEYB 1CI5A 1LO5A 1M7UA 4PJHE 4OZFB 5DTFB 1OAZL 3NCYP 1CD1A 4NC2B 3IBEA 4U2ZA 3N1FC 1A0QL 5AVTB 1ZHNB 2VLLA 2Z31A 1T1YA 5K39B 3PUXE 4GWYA 4WI0A 1FTOA 2X2JA 2MKWA 4ONGL 2PPCA 4G2AA 4RMVA 2OK2A 1B5IA 5DJAB 4X98B 4PYGA 4R3SB 4L8SC 4HX1A 2VZ1A 4NPYA 1Q35A 4PUBH 2R2EB 2G30A 2LFGA 5C0BB 2X1XR 2EH7L 4PW3A 1QYGH 5T3JA 2W81C 2FSEA 4QRZA 4MFIA 4V1DA 2X3CA 1OAQH 2GJ6D 3E0GA 3OKKA 2H6UA 1QUKA 1UA7A 3ZDZF 3M8UA 3AVEA 1SOSA 1CFQA 5HDBB 1PY0A 4F58L 1KBBA 3P30L 2A0LC 2NX5E 4PIRF 1S9VA 5E0FA 3TX4A 4CC0A 5GZOC 5L88H 2Y84A 1EXGA 2NW2B 5KSBA 2CALA 3DTXA 4W4NA 3WKQA 1WAEA 1AHWA 1S8DB 4PJFE 1WVJA 3AFLA 1A7QL 3RTQD 5C2BL 2G2NA 1NMCC 1ACXA 1ZMGA 1MW0A 2BPBA 2VMFA 4FHJA 4NKIH 1ETJA 1ZK9A 3LKOA 4YS4A 3O2VH 2CZIA 4NN7C 3QNFA 4FQ1H 1T2QL 1T5WA 4Z7VF 3VG0H 3X3GH 2R0LH 3LS4L 4IKKA 2DPKA 4EZMA 3THMH 4P3LA 4RQQB 4Y19A 3GBLA 3HG1D 4WWKD 5HHOB 1DJGA 3PGFA 3AQDA 3WJLC 4MWFA 2MKLC 3IFPA 1F3JB 3BPCB 1YPZA 2ZUSA 4FG2A 1EEUA 4J5VA 2H0EA 3D52A 3W81A 4ZMNA 3IDYB 5LDUA 5MP6H 4F20A 5D7KE 2I4BA 2DYSB 2H32H 4QNPE 5HGBA 1TFAA 1NMBH 3K01A 1NSNL 4JO1H 1CF8H 5CC2A 2Y7OA 1AIVA 1KCBA 1IKFL 3J7HA 1MFDH 2GJPA 4OIAA 4ZS7L 1FHGA 1NGPH 1SBSL 3SEVA 2F7OA 3MRMB 1SFDA 5T8IA 4TPRL 1A3QA 5DHYA 5ITPA 2CUIA 5D7LA 2VXQH 1OQHA 5H8FA 4JVPA 4C56B 5BS0D 4JB7A 2BP5M 1IAMA 1WZ1L 2CLVB 1GGCH 1K6QH 5JIIA 5CILL 2NQ3A 2X70B 3D08A 3RBGA 1ETA1 3F7RA 4I18C 5K9OB 5ISZE 4BEIA 3VXCA 3QDGB 2HX7A 2DYRB 3AWGA 4MGXA 1U9KA 1TZOA 3KC0A 3GNML 3MRGB 3MYZA 4G5ZH 5DVPA 1JZJA 5CJ5A 1NANI 1YEKL 2CIIB 4XWGL 2A6JB 2Y9RT 4F22A 4HH8A 1XL4A 2FX9H 1TTAA 2YEQA 1D6EB 2GI0A 3UX9B 1F6AA 4ZFQA 2C4XA 3K6IA 5IB5B 2AVGA 5I1KL 1K85A 2D7MA 2GITA 1ASQA 2GY7B 3OAUH 4DWHA 2QPEB 4LONB 5IK3A 4L8SB 5CCKH 2DRUA 4HC1H 1RZKL 3MGTB 3AWFA 4UT6H 3IOUA 1R9FA 4NNYA 1B9JA 4A2EA 4MQTB 2LR4A 3N06B 4ZQTA 1YMMB 1XIWC 2O72A 2Y7KA 2PWGA 4QKXB 1XGYH 2ADGB 4FP8H 1KXTB 4P4KC 3V6BR 5AENA 2QSCL 2J3SA 3V0IA 2IV8A 4OT1H 3AS2A 4PJ8A 2VPNA 1UT2A 2PR4L 5EF3A 1QLEH 1B05A 2PWFA 3WFCH 1LEGB 5D1XA 3LVEA 1KACB 1R75A 3ZO0A 3LXCA 2ARWA 2HJKA 2IPUK 2Z0UA 3ALXA 1P9MC 4NQEA 1E4HA 1D2OA 4AYID 4K7PX 4NT6A 3US1A 2MPAL 3P2TA 4FQJH 4WSJA 1II5A 2QPSA 4MQXC 1NMCB 4EXPX 3KJ7A 1JK9A 4ZTPL 1JGEB 4E5XG 3EOBA 1FDLL 4HCRH 2QFLA 4NN7B 3SE4A 5KUKA 2WOBA 3IPBA 4H8QA 3VXNA 4RX4A 3W9DA 3MV9E 3WXVL 2D7PA 1MIEL 4CVZA 4ZXBA 1S6NA 3TIEA 1DTUA 1F18A 4W81A 5K93A 2O6FA 4XRCA 1URGA 3HZMA 4ATTA 3BZFA 4MX7B 3GBBA 5B7FA 1E3XA 4X4KA 5BZWA 4RFEA 3MUZ1 1XAKA 2WNXA 4JPKH 2QQLL 3EFOB 3K00A 4EIUA 1JE6A 3V5DB 1FPTH 1SDYA 4Z0IA 4X6BA 1ZHLB 1QW8A 3FF8A 5KSVB 4F3FB 4PFIA 2ED6A 5GSVA 3IJEA 4M4GA 2IJ0C 5TQ0L 4Z0BL 3TU6A 3ZZ1A 2EDKA 1A4KA 4RCAA 3BUYA 2FBPA 2X09A 4HJGA 3TNNB 4JJ5A 1NA8A 3KCPA 4FQXC 5EH1A 4OFQA 4C57C 3CPLB 4OEVA 3SY0B 1HSBA 3B2VL 1IZJA 4P2QD 1HXYB 3QFJB 2CMRH 1LEVA 3MUY1 4OFPA 1M71B 1N64H 2WP3T 1B32A 1QBAA 2XQYK 5AW2B 2X6MA 1FL3B 3WHE1 4GIZA 2UZPA 5DF0A 3FL7A 3ARXA 1AY1L 4N2OA 5AVRB 1VHPA 2FEEI 3QQ4A 3HE6D 4I18B 4N2MA 3EADA 1PZSA 1XF5B 5KVDH 2P45B 4NQXA 4XNYH 2NQDA 1QP1A 5BQDA 4NO5A 4EI5C 2AI0L 2Q76A 4RWHA 3LRLA 5KS9B 2Q8JA 3CVIL 4HVBA 2Z91A 4XCCL 2MEJB 5FK9B 3IGFA 4UMSA 4AMWA 1OF2A 1YEEL 5E2VH 3DBXA 1F11B 5E51A 1A1OA 4PRDB 1V27A 1NGXA 1B6UA 3MRNA 5SX5K 2ITCB 1X5XA 1A7OH 2JI2A 2R1XA 3WNMA 4PJIA 1AC0A 5AD0B 1EYKA 3PTYA 4KH9A 4LSQL 3O4LB 4F1VA 4HT1L 2IWEA 4HGMA 4U1SA 1GGGA 3T9WA 3JSSA 1WCBA 1B0LA 2ZCKH 4GXAA 2VUKA 1AO7D 3S4SA 1BOGA 1GZHA 3OKDA 4K94C 4LLUB 4X4ME 4MA8L 4Z18A 4H88H 3FQRB 1P7KA 3L8QA 1LGVA 3WNOA 2ZNSA 3KM2A 1HAUA 1XIWB 2K6YA 2IQAB 1R6VA 3PV6A 4ZOEA 1WF5A 1AANA 5AZ2L 4HLEA 1WODA 2GTWA 4L37A 1SJEA 4M00A 4XMZA 2EDXA 4P4KB 4HW6A 4J6RH 4XXDB 2ZZVA 1EX0A 3LQAC 1PCSA 3D07A 3LV0A 4NJ9H 2XN9D 4JMNA 4XI5D 4AV5A 4EIZC 3N1QC 1G6RB 2Y7PA 4X6CF 4JR9L 5DMYA 4BK8A 4K5MA 2IBBA 3MLUH 2P0SA 1IU1A 4JE0A 1XO8A 1RJLA 1QEXA 1VSCA 3ESMA 3SODB 4JQVA 4G82A 3FT2A 4HIJB 5KDTB 3V5AA 1P4UA 2XG5A 1DSNA 2CNZA 4RAUB 4ODBD 3VVVA 1NGWB 4NLHA 1G7IA 5E9DA 3AABA 4ALAH 1ZA3B 1H8LA 4FOMA 4DN4L 5DFWH 2ZNWA 3AS1A 1R5IB 3GUTA 3KJTA 1IZ1A 1Y6KR 1YUHB 4FMVA 1H8OA 4FQQA 4PB9L 1Z9OA 3UTPE 3MFFA 5T1JA 1JXGA 3CD4A 3QJFB 1R34A 1M7DA 3BP5B 2CO3A 3HLAB 4GRLA 4TV3A 3SO3C 4PFWA 3S2VA 3GD1C 1I7UB 4KPHL 2B1HL 3TNMB 2Q8AL 1KULA 1ZT7A 1XF2B 3MRLA 3C6LC 3GIVB 2W60B 2VCOA 3DGDA 1I3RA 1LP9E 3ASNB 4HV8B 4JPIA 1C8QA 4KD5A 2X44D 4U1GB 3JUYA 1FFOA 4PJBE 4OAWB 4JDVB 2G29A 2XWXA 3OC8A 1E9PB 3DOIA 2AJYL 4P04A 3NJHA 1IQWH 4XODA 5ANMA 3MWBA 3P77B 2B3IA 1MWAH 4AVIA 2B15A 1JPTH 4YXHL 4Z5RB 4JVDA 4RMBA 3ULAB 1B4TA 2OSLB 4N2LA 1B4LA 2IH1B 1K5NB 3CHXA 4FQXB 5AVYB 4E0RA 3BVXA 5L7XL 5E1IA 3H9YA 1J10A 4DT2A 2ESVD 3OEKA 3VM7A 4RZKA 4KZDH 5F6IC 4L2LA 2YPVH 3WLBA 5MEQB 2R8TA 5D70H 3ABKB 4R7DB 1BM3L 4UQ9A 2Y23A 3DJ9A 3EDKA 3D05A 1POTA 2H99A 3FGSA 1QFWM 4P8QA 2RCBA 2K1MA 3CSPA 5DUBB 1PX8A 5C0AE 4FQ2L 3ROOB 2XWZA 1TZGL 4MD0A 1NCWH 3QUHA 4YVNA 4JY5H 3SPVA 4EI5B 5J57B 3ZQXA 1WSST 2ZP8A 4G80A 2Y5QA 3TEYA 1MZYA 4XX5A 2FT8A 1E90A 5IM7B 3LN4A 1RZJL 5E5UB 4BRVA 2D9QB 2WBKA 2LT9A 4B95C 3U94A 1P84K 3VH8G 2W07A 1OLZA 4M43H 3TA3A 3B6TA 1DN0A 2QMJA 2YPLD 3O6IA 4ZEBA 4M5ZH 3ZSSA 3Q7JA 1UJTA 1HL5A 3AJ7A 1SJMA 4YB6A 3L1EA 2X7QA 1KJMA 5E0QA 2X4NB 2F2HA 1BVNP 2M1KA 3C60C 2EH7H 1T1WB 3MP6A 3QSKB 4R96A 5AW0B 1FC1A 3KAAA 2I69A 5ANHA 3WUWG 1LE5B 2OJTA 4KX8A 4P9ML 3EJPA 3S2AA 1TT6A 3MBXL 3MXVL 3TEWA 4ONOA 4QRBA 3UAJC 4F58H 4XNZC 3FU3A 4HUVB 4HE1A 1Y6MR 4X2UA 3LQMA 4G2ZA 1HHJB 5J12B 4IK7A 1J0JA 1JWUA 4IRSC 2PXYC 1AKJB 3L5WB 4PC9A 5F1NB 1UKTA 5E8EA 4OSUH 4ISVA 4G9FB 1ZEAL 2CO7B 4GS7B 2DQTH 4BWTA 1NFKA 4DVBB 5C0FB 1G87A 3PDGA 2RQ8A 5L9DL 3MKKA 1FSKC 4UIMA 2NY6D 3TWYA 2DWDA 2BVOA 2AFNA 3AROA 4JZOA 2GJZB 1R9LA 3LS4H 4Z7QB 2R71A 3B3IA 2OMZA 4ODSL 4U0RB 3UBXA 4F3GA 3QYCA 1MCBA 1A47A 2BX5A 3ISRA 2Y6SD 1UUNA 4KVCL 3SO3B 4OZIA 3AM8C 1NAMH 4JDFA 3T0ED 1DVYA 3IKCB 4PBHA 4BK5C 2YAPA 5I58B 1GW0A 2PO6D 3H9HA 2OYLA 3BSGA 4LCCA 3C6LB 3HC3H 3PPSA 4FG6C 4YBQC 5EEVA 1B88A 2MQCA 3N43F 1Y4TA 2QTVA 3QYMA 4KKPA 2VLJA 3G3KA 1R3LB 4HXBH 2PYED 3KL0A 1MF2L 3G6JB 3QAQA 3CZSA 3GXFA 3SYOA 4XO3A 5INCA 1SBSH 2VDNH 1CTNA 1MCKA 3TVMB 4H0IA 5ABAA 3F7QA 4WDIA 1JPFA 1FVCB 4Y2DA 1O64A 4TPRH 1X5MA 2W59A 4Q89A 3D7PA 1G7MB 4XZUB 1WZ1H 1E9QA 3D2TA 3FAXA 3K1DA 4IRJB 4JM4H 4NDMA 3WY2A 3NGBC 2VN6A 4G7QB 4JRXA 1LCTA 2VR5A 5JDSA 4Y4KC 1HN1A 2YEZB 2JI1A 4QY8B 4GQOA 1IARB 2IMMA 4BDQA 4F18A 4MNGE 4UACA 3GJFB 4DFIA 2VT0A 3O41B 5GS0C 1XCXA 1XCTB 2R9HC 4D9RD 3GNMH 4XB3A 1EFXD 1WWWX 2P49B 1YEKH 2B4CC 4QHMB 4HTGA 1NCBL 4F5CA 5JTYB 3F5WB 2BNQB 1DZ0A 4Z7UA 5C08A 4QXUL 1IC0A 1NAKL 1XB3A 1ET7A 5D72L 3TPUA 2CPUA 5AKTA 4FEBA 3H1ZA 3RPLB 2YPKB 3H54A 4OJEH 5I1KH 2ANJA 5GRWA 4CMHC 4BZ2L 3O6GA 5GGTL 3U36B 2G3ZA 4YZZA 4Q9BA 2D8KA 3FTXA 2OMWB 1T83C 3MRIB 4FECA 1CR9H 1D3CA 1RZKH 1YSOA 4HGKC 5B1CA 4DEWA 5JOPD 2JKIS 3FJ7A 1FZKA 3MSPA 5I2IB 5C7XL 4WTQA 3C60B 3FQ4A 1Y1UA 4BSVB 1BAFH 1DBAH 1WAAE 2QSCH 5GRZA 3BMWA 1RSYA 2ZJSL 1J05B 1M6OA 1TU2B 3UTTD 1YEGH 4XNZB 2PR4H 5HHVL 1T22B 4N5EC 5TPWL 4IRSB 2PXYB 5I73C 1OAJA 2WLLB 4I2XE 2I58A 3WDIA 4JFYB 1YCSA 1JGVL 3N42B 1I7ZB 3NJGA 1E8XA 2XXCB 1KPUA 3D39B 4R84A 5DUJA 1FSKB 2JNZA 1T4KA 2J8UA 4IDJL 4XP6L 5DA0B 1I9EA 5L2KA 1FDLH 8FABA 1QFHA 2ZX6A 4PREB 2A5SA 2XWDA 3CXHJ 3SBPA 2ISDA 1FBIL 4XCYA 4YKPA 4PBXA 2WSPA 3WXVH 4G1MB 4UAOC 1G7HB 1GJUA 2X7LB 4KXAA 5K1NA 5FIEA 3A23A 2WINA 4TUKL 1QFUH 1GY1A 1NIBA 1MFNA 2ENPA 2MQGA 4YZFE 5HGDA 5TGBA 2W9DL 4JO4L 4JRYB 1FFNA 1WBXB 2UXFA 3NIGE 4LGRB 2YD4A 2A9BA 2OZ4L 3WS6C 2VHAA 1N6VA 4UQAA 2QQLH 4IO5A 2O7IA 5H37A 1IE4A 1JNJA 1RH8A 3BGMB 3CFTA 2AMUA 2G2RB 4KZ0A 5E7BA 1RZFL 1KYAA 5JW3H 1JPGB 1EYIA 1JV5A 3WFBL 4YZWA 4GKZA 4UBDC 5TQ0H 3V5KA 4OCRL 2J88H 2B9BA 2THIA 2K9FB 3O6ML 1P7QD 3V4PA 4BKTC 4PW9A 5CNHA 1CCZA 1MFUA 3Q43A 3TDJA 1P6AB 5AAWC 1XB8A 43CAB 1WGVA 5DRWA 3B2VH 3E2HB 5AKSA 2AZUA 1OGTA 5GS1C 5D7IB 3C9NA 4N2KA 1X4YA 4PW4A 4MAYC 3S35L 3S3PA 1HHGB 1PZ5B 2XIIA 4DN3L 2R23A 3ECQA 3FZVA 3OAYK 1BJ8A 1KSRA 1ND0B 2JE8A 3H6AA 1AY1H 3ABZA 4Y2OB 3NGBB 3IXTB 3MPCA 4HIIB 3PPNA 3AY4C 4Y4KB 1HVXA 3FU9A 3MLSH 1INPA 3C87A 4LAQL 4Y89A 1VGEL 5ITOA 1PB8A 1O9WA 1U42A 2Y07H 2AI0H 3ILQD 4M48L 1JNNL 2EDMA 5FYLL 4PLKD 1P4BH 3B2UD 3LKSB 4XCCH 3GI8L 1MQGA 3T3PE 5AG9A 3JV5A 3PWJA 3U6XS 5T3XE 3FUJA 5JQHC 3DV4B 2A3TA 2YAFA 4WO0A 1EV2E 5C0BD 2X5PA 5F7DA 3UJJH 1OT2A 4Z1PA 4LSQH 5JOFB 4BLAA 3OKLB 4NGHL 3GGWA 4HT1H 4XVTH 4KRMB 4G6FB 4P0GA 1F13A 3BUBA 4HETA 3JTSB 4UUJA 4OU3A 3W57A 4XP5L 3KYKH 1KLUA 3M7FB 1FO0A 5I26A 3GXPA 3H3PL 3ZKQD 4YSSA 3TL5A 4G8GB 4L4VA 2OFQA 3SKOB 3QI9B 5CCJA 1REIA 3PGCA 4HCIA 3P4MB 4Z7OB 3LBSA 5B1KA 1QI4A 1U8QA 1UWXH 4Z7VA 1SM3L 1HYRC 4E9YA 5I19L 2Y06L 1V7ML 4LB8A 1K3IA 3AB0C 1Q90A 1G7JA 3QH3A 1OK8A 5KANI 4M03A 2ZXEB 4FXKB 3IF1A 3BVUA 3DPBB 1D5BA 1AQKL 2VERA 5I73B 5IHZA 3WIAA 1OALA 1YYLH 4J28A 4JFFA 2N7AA 3CLEH 3QNZA 5IMOB 1OB1B 4NUMA 4DN4H 2Y24A 4AVKA 1T7ZA 2G2PA 2CK0L 5F7UA 3GHEH 3N55A 4BE5A 5FUCE 4AMKL 1AG0A 1E5BA 1KN4L 5FYKL 4Q30B 1LK3H 2VMEA 4JAMB 2G75A 4H8UA 2OLDA 4QRUA 1O63A 3KLQA 4PEEA 2G0KA 5AYQA 2B1HH 1G7LA 4UAOB 1JGUH 4FADA 2EH8L 3EGDA 3EKCA 4MCNA 2Q8AH 4YDZA 3LNFA 1CE6A 3RPKA 5JR1L 3K71B 4H7VA 3Q29A 3U9UA 4OESA 1CXHA 3U2SA 2KQNA 3I6KA 1FYTB 2OL3B 1NJ9B 2AQ2A 2A9ML 2HWZL 3DECA 5MENB 1C1EL 1JPEA 4A1RA 3GS4A 3E3KA 1LEIA 4JX0A 3FB7A 5C8JA 1F3RB 2WBWB 4Z7WB 2AJYH 5E5MB 2E6JA 4HJIA 3APCA 5MEOB 3CFKB 5EU3B 1EHKB 4A55A 4PM1A 3N50A 5LO7A 4ZPTA 5AB1A 3RP1A 1UM6H 3QZWG 5FYLD 5KSAA 2RAMA 4OLYL 3FSZA 3P0VL 1VRSA 3QDGD 1AGEB 5GS1B 4YVUA 4OCNC 2BC4A 1TJGL 4MAYB 3RY6C 1DQDL 4P2CG 5D7EA 2NY3C 2D0GA 1RJCA 2EE6A 2LW3A 3MROB 5DEFA 1GAFL 4UQ3B 1OB0A 2PCYA 3D33A 1BM3H 1GHFH 1T6WA 3HS8A 5DD5L 1CGVA 2FE0A 3ZX1A 3L5JA 1FTMA 5F9OL 1INQB 4E42B 2OCUA 4FQ2H 5CEYB 1A2YB 1ZLSL 3RIFF 2LAGB 3KPOB 3D6GA 2A74C 3K6DA 4DPBX 2PTTA 3ABGA 1QFWI 4MVBD 4OCMC 3GLEA 1WQVT 3Q6FB 4IOSA 3CJJA 4R74A 4B41A 1MN4A 1EDYA 2FEEL 2CAKA 3TPKA 3KS0J 3CHGA 2WYKA 3FJMA 3FPXA 5F3HA 1B51A 2NTSP 5ITFB 1NNFA 1WUZA 4GY4A 5HTSA 3U48A 1HOCB 1YMMD 3OG6B 2CKNA 3ARDC 1LWHA 2VISA 4TTDC 5CEZE 3AADB 2AC0A 3E7JA 3OR7A 4HJ1A 4WQOA 3S34L 2GIMA 4QT5A 1ADWA 3KPNB 3K2UL 2DI7A 5IW3A 3LRSB 4D9RE 4ETQB 5GZOD 5HSFA 5DHVH 1JP4A 2FBRA 5GRJH 3KPSE 4P9MH 2GSGA 3MXVH 5DMKA 4HDIB 3STLB 4RESB 2JKRM 5C0EA 1JJUA 1QO3B 3CE1A 4P11A 3AB0B 4NQQA 4RK2A 4R5XA 3RVUC 3FO1A 4EF2A 4X8XA 4YXKL 3MVYA 4I62A 1U21A 4NKDB 3SDYL 1ZEAH 1PVHA 4M4PA 3FFDB 4GVOA 2VC2L 2VWEE 2XD3A 5L9DH 5E4OA 3RNKB 3KGUA 3WLWC 1JAEA 2VIRA 1FPFA 5GZNC 2XT1B 4LSRH 3P4NB 5EU6A 1WA2X 3DX8B 3HC4H 5IKCB 4ODSH 2ZKWA 4W68A 3OKEB 1JZFA 2EO7A 3V4VH 1TR7A 3CFXA 2BS9A 3DXAE 3IFLH 4OZHA 4UT7H 1TTUA 4KVCH 1OEZW 5EPMB 4GL0A 2OKMA 1A4BA 5FHMA 5GGRB 4UDTB 4UOQA 3FB8B 4CJ1A 4LDEB 1FFRA 3QWOB 3QDMB 2WTOA 4R4BA 2GH9A 2MNWA 3IOVA 2N4IA 4G71B 1BV8A 3S6CA 5IGXL 3REVB 5A7BA 2C3WA 3QFJD 1JGLL 5TH2A 2E9GA 4YHKL 3RPIA 1GPOL 3GHBH 1BXUA 3G6AA 5ALCH 3L6HA 1MHCB 3UTZB 4AYEC 1NDMA 4ZX6A 2OXGA 2AQPA 1T0NB 4GWUA 3FRPG 3UORA 2H9GA 2VMJA 1VFBB 2P46B 3QULB 4MMXA 1ORQB 4NUJB 4GQQA 1I8MA 4HKJA 2VRKA 4YPJA 5IEHA 1MQHA 5JW4M 5EUKA 1GL4B 3L3IB 4PJHA 4GSDH 4FULA 4MKTA 5C07B 4ZX3A 5IZ3B 2NY3B 1KFAL 1SXAA 3FT1A 4J7RA 3SN6N 4G8IB 3VVDA 3TCFA 4HQQL 4DKFL 2H1XA 1DL7H 3DSFH 3O4LD 3AS3A 3FB6A 2A74B 1CBVL 1TMQA 5BV7H 1NCBH 4F33B 2XWEA 1OM3L 4N8YA 1VIWA 3IRCA 3FQTA 4LASL 3LIUA 3SBQA 1MCOL 4CJ0A 2J5LC 4NM8L 4ZRGA 3HG5A 4P2AA 2XBTA 5AWNH 1ID5I 4BZ2H 5ICZA 3AREC 4W9GC 2ED7A 5GGTH 1BG9A 3HKFA 1CF1A 1NBYA 1R3HA 2AGJL 4X6CA 1SXCA 5HGHB 4M6OH 2OJEA 3ARDB 2DQMA 2KZBA 4P4KD 3QISA 4NZDA 4POYA 2X3BA 1FF5A 4LMQE 2Q6WB 3DPDA 3BT2H 3CLFL 3B6WA 2R1YA 1FZOA 1MCPH 3GSUB 3RWDA 4JG1H 4BYHA 1RYXA 3Q8AA 4ZNEE 3IO4A 3GBML 2V2XB 3L4CA 4JN2A 1ZLUH 1AZUA 1MW3A 3U46B 2ZJSH 4H1LH 3VACA 2BS8A 4IR8A 5HHVH 1UTHA 4MQXD 5TPWH 1EH3A 4H40A 4UTBL 3UIZA 3PPOA 2W0PA 4KVNL 1QLRB 2NMSA 1TZIA 2EIJB 4MBOA 3LQAL 4WAFA 1KXVA 4KI1A 4BWUA 1JGVH 1R24B 4DEPC 5B39B 2FR4A 1JW4A 1IBGH 1CT8A 1VSOA 3EGXB 4HUXB 2F53E 4IDJH 4XP6H 1RUAL 3FOLA 1LE9B 5GIRB 1Z7JA 3EW3B 3B7DA 5EOCH 4WUUD 2VLMD 4YDVA 2GHBA 4UNVA 2QSXA 1UT9A 1I3VA 3WY1A 1QKBA 4O2EB 5BO1H 4PJCE 2XWVA 2FL5A 5TD4A 4TUKH 4JKMA 1SQ2N 4PSRA 1IM3A 5FKPA 4JO4H 4K8RC 1N26A 2FWUA 3GS7A 5D2NC 4X6DE 1CURA 4AQOA 3PHOA 5HHOE 4MNQE 4UCFA 2TSBA 5CSZB 4S1QH 5I1AA 5LGHL 1WDNA 4LFHG 3CMOL 3GBNL 1FV1B 3TCTA 3C5ZA 3VXOA 3WFBH 5I66A 4PWIA 5D6CA 2YAQA 2Y7QB 5E23A 3EDDA 1VACB 1A4JB 3ETBF 3O6MH 1IAOA 1LMKA 2EIZA 4WW2F 1TNMA 5E2UL 4YHOL 5DEJA 2DLGA 1X5GA 2OK0L 3D85D 4H13C 3MX0A 5ISZA 1E67A 2A1WL 1P5VB 1D2PA 3QEHB 1EBPA 5CR1A 2PW2A 3S35H 5FOBB 5EZPA 5FECA 1FL5A 5HY9B 2P44B 1GGUA 4DN3H 4YHNB 1WC7B 1Z0NA 3MI6A 4Y9EA 1MREL 3IYLW 5E95B 2H0JA 3KPLB 4GAYB 4EI5D 3TMGA 4LLMB 5EZJA 4U0QB 2CLRB 3M6DA 1KCRL 4C56E 2NZ1A 4LIQL 2OZNA 3QXTA 4PTUB 2XZAH 3E78A 2H3KA 4AENB 1JNNH 5FYLH 3E3QE 3MLXH 3VU1A 4N8VB 5PCYA 3SGKA 1JGDA 3RI5K 1H3VA 1GTNA 3FO2B 3RDTA 1GSMA 3MP1A 1U8IA 3UO1L 2VLRB 3VGGA 3V0WL 3Q26A 3T4AC 2OA9A 5I18H 3QZNA 3FFCE 5FHAH 1G9MH 3ZIYA 1GYAA 3WE6A 3PP4L 2J5LB 1XCQA 2PT2A 5LAPA 2G9HA 3BHBB 2VXUL 3ECUA 3MPLA 3AREB 3WIFB 1GA2A 5L9OA 1NANH 4DZ8B 2BXZA 3QUKB 5ICYB 1E4KA 3MO1A 4FI8A 4HCGA 3GHPA 3ZY7A 3TTLA 4XP5H 4LBEB 4ZW3A 3D69A 5BXFA 1B9KA 1QD0A 1XGTA 4IU2B 3RUGF 5CD3B 1QTYT 3CAFA 5E94A 2X4SB 4GW4B 3SPCA 4CGUB 2O5XH 3O9PA 1AKJD 4P0DA 5IQ9A 2X87A 4LU5L 3NACH 1MCEA 5L6YL 4NRZA 1SM3H 4L29A 4KJYB 2R4RL 3GXNA 3QIBA 1V7MH 1WGOA 3B5HA 3FU6A 3PHSA 5CGYC 2FJGB 2TSAA 5E8PA 4R4FL 4J2XA 1A99A 5HYQA 2E0PA 1I3GL 5AL8A 3KPMA 5DW8A 1HKLL 1B7ZA 3ARSA 4N0CD 1EZ9A 4Z76A 4ZO7A 3X17A 3CVGA 2FWSA 4EN2A 5I0DA 2DIJA 3EJQA 3VVEA 1HKFA 4N2DA 3K3QA 1FN4A 3MV9A 3O45A 4FKHA 1XVXA 3GZGA 5KJRL 1M2VA 4K55A 3EH3B 3MNVA 3KWWA 1KB5A 4J3VA 4APQC 4H4NA 1XVSA 3H4FA 4KJWC 3W39A 4AMKH 1IM9A 2X7PA 1KN4H 3S5LG 3KYNB 2C3GA 5I30L 3D50A 4QRAA 1VPOH 1JIBA 5FO7A 4ZODA 5FYKE 1QNIA 4P8BA 4AYDC 4N24A 4R9HA 1EO7A 2UXAA 1QW9A 5H8NA 4DAGH 5E00B 1TTCA 2DQUL 1MJ7H 3VRJB 1FBHA 5CLXA 2QTEA 1ITBB 1W0WB 1C12A 4HS8L 5B7DA 1U58A 1A21A 5D2NB 3TVMD 1NUWA 4BHUI 2Q1EA 3SETA 4AL8H 1TWYA 2A9MH 3G9AB 3HHSA 1DJWA 4Y7MA 1NV7A 1C1EH 1OLCA 1BREA 3LKRA 3L4VA 9PCYA 3FTYA 4QRRD 4YO0A 4ZSOE 3E1F1 2QHLA 5IVXE 3U2IA 1OF0A 4FXGC 4IRJD 1KEML 1G0YR 2V2WA 2VL5A 3QK0A 4ILDA 4PV9A 2ZZXA 3AXLB 3I2CL 2XA5A 1JZ6A 3ZSTA 1NV3A 2EC9T 1B4JH 1JCKA 3QQDB 3SQBB 1NEZB 4GI9A 4BQ6A 1TZHA 1TJGH 3QUMB 1L9PA 4OB5L 1DQDH 2WVVB 4XCFL 2ZNUA 2L7EA 4H25B 1W91A 4ZUWB 2DMKA 4J3TA 1QTSA 3RFZC 4TUOA 1X5AA 2BNQD 2P3YA 3L95B 5F9OH 5E5RB 2BSED 5IEKA 3CZUB 5H35A 4HBCL 3OO9A 1I7TB 1RUPL 1UYWL 2FEDD 2Q89A 3GTVA 3ZE0F 5E99H 4W9CC 4WK2B 1JNLH 4X9YA 1JWMA 2RC9A 2EC9U 3VI4F 3GMOA 4OV6F 1U41A 2HVJA 3VA6A 1OCZB 3WSQH 2ZOOA 3T4AB 4GIPD 4P2RE 3QXUA 4ZFGL 1LBBA 4UZSA 3TO2A 2Z93A 1QMUA 5KS9E 1S2EA 4ZPVB 3N1PC 2DN7A 3OV6A 2DQEL 3CDGA 3CZEA 2IO5A 4GSQA 3HRZA 4GT7A 3FATA 2KC0A 3UAJD 3T0XA 1S78C 1IGIL 5IZ1A 4OUUB 2LLLA 3K2UH 5DWUL 1KWKA 4AQEA 3MRQA 3PU7A 5H8DA 4IRSD 5DQ9A 2PXYD 3GXUB 4E9XA 3CU7A 1MCRA 4HZLB 4K73A 4OGYL 4QF9A 2GEEA 4EDPA 1TEGA 2V7NB 5HPMB 4JBZA 1SN5A 2D7OA 3MCLL 4G3YH 4PVLA 4AY0A 4N25A 5IROD 3D39D 4B9GA 2C1PB 4PJ5E 4J1UA 4YXKH 3L3OA 4X4XB 3UAAA 1MEXL 2EDEA 3DJTA 1RAMA 1I8IB 1UB6A 1NGZB 2GJ6A 4KXBA 3SDYH 1XFPA 3DO4A 2TAAA 4U6XA 4TOZA 4MNHB 2DQFB 3IU3B 1X9QA 3PAYA 2DIEA 2VC2H 4N4YB 1GRWA 5GGUA 5D1QD 5CIPH 1XZ0A 1XV8A 3OAZK 5CU9A 3FYIB 5IOPB 3B6SA 5H94B 3IPFA 4JRYD 1QI5A 1H6FA 4M62L 1JFHA 3EF4A 5HDBF 3IE9A 1R5WB 2OSWA 4APQB 3VB9A 1LP9A 1OV8A 3ECWA 4GSUA 1AZZC 1UB5B 4FG6D 3I6GB 1IC4L 4M7LL 3MLWL 2P3VA 5EIIB 2VRQA 3MRPA 3N41B 5C9KA 4JFQA 1Q9OB 2GSIA 1D9VA 2WC7A 4OQTL 1A6AA 5HGAB 3UGEA 1RLWA 5FDYA 3TT3L 4W4OC 1AACA 4MXVE 1BQKA 1SDDB 4LHJB 3H4HA 3O9WA 4PH8A 2P8MA 3ZE1B 4YHKH 2DH2A 1VFUA 1YEDB 5IW1B 3B9KA 1CD9B 2ICEA 1WWAX 2LABA 1N3NB 3EDFA 4FXGB 2CBQA 3B8BA 5KJ4A 4AKQA 1ZS8A 5E2WL 1TQSA 2SEBA 2WVUA 5FGBA 5KYUA 2X4UA 2NY7L 3D2UB 3NJJA 3H6VA 2R1WB 4HKZB 2W92A 5C0AA 1I9JL 1JZ5A 1ETZB 4H2CA 4HU2A 4WHTB 2VDOB 2R9HD 3VLUA 4IKIA 4L9LC 2JJSA 4BFJA 3OHXC 4POXA 4D2NA 2HA1A 2ADIB 2NXZC 3MNZA 3MUGA 4DKFH 1SYSA 4ZO9A 5BS0A 2F08A 2GEQA 4NRXA 4U6VH 5BRZB 4R5TA 5L2JB 3OKNB 3QMFA 4N2HA 3EYUH 2VDLL 3H4ZA 1CJYA 4QF1B 4P9HC 4G6FD 2CO4A 4BSWA 1KEGH 1MPAH 4UNTA 3RIAF 4CUCA 5I56B 4LASH 1HL9A 4RDBA 3MC2A 3DROA 3JYCA 4K23L 3ZKMD 4AIOA 1UKSA 4G8GD 3RQ3A 3QI9D 5G4OA 4JFHD 2EEXA 1D5XA 1YEJL 2AGJH 4NFDA 4NF8A 1JD9A 1QFWL 2D2CC 2LAOA 1XB6A 1SY6L 3F65A 3FT3B 3HHGA 1Q8MA 2V3UA 3MV8E 4NO0B 3AMLA 5HDRA 5I16A 3KFMA 2WMPB 1TVHB 4J12A 3HZVB 4OFVA 4A6YH 1BF8A 1NZRA 4WU7B 4I3YA 3QUYC 5IKBA 3GBMH 4G8FA 3I5OA 4ZEKA 1CXFA 2CLZA 1YN7B 1FNGB 1OAKL 3BUTA 2C9AA 2X4RB 3I3BA 3ZPDA 1R17A 4XP9H 3WTXA 4D0BB 4F9PA 1O7TA 1FNLA 3D0LB 3TGXA 4TQUQ 5C6WH 2ONKE 4EXLA 2DWJA 1B2WL 5KYYB 4S1SL 1MVUB 3HB3C 3KPRB 4QMEA 4FA7B 3BEWA 1PJWA 4LRIC 1HI6B 1RUAH 1ERNA 3QZBA 1AGDB 3GWJA 4G42B 1E2VA 2M2DA 1MVYA 1RJZA 3IDIA 4FLHA 4G9FE 5J3HC 1MAKA 1BAGA 1CG9B 2HZLA 3TWCH 3RHWF 1FYTD 1K4CB 3V6OA 4X8CA 1JYNA 3KD4A 4JQIA 3B7SA 2EDQA 4P5KA 3W3BA 2JLPA 1NOLA 1SVZA 3MNDA 1AE6L 4GUOA 2QADC 2AXJA 1Y3NA 1OHQA 2MIZA 4UT9L 4UBDD 3RU8H 1OE3A 4AGOA 2ZYHA 2RJMA 5KZCB 5C97A 2BCKB 5I2KA 4MFHA 2NTFA 5LGHH 2F7CA