3D4CA

Zp-n domain of mammalian sperm receptor zp3 (crystal form i)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
470
structure length
470
Chain Sequence
EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltose-binding periplasmic protein, LINKER, Zona pellucida
publication title Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Cell adhesion
total genus 136
structure length 470
sequence length 470
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d4cA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4cA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4cA01
1B6HA 5AA3A 3BBRA 5JTYB 3IOTA 2RC9A 1NNPA 1BTJA 1MS7A 4U22A 5H8NA 4NWCA 3OEMA 1N3XA 3C9HA 1UIUA 1XVYA 3G3KA 4ZEFA 4LATA 3MP6A 1EZ9A 1I6AA 4F1VA 3K0VA 2X26A 4GWOA 3UK4A 4LVQA 1WDNA 4FE8A 3VLVA 1R1NA 4H1XA 3O28A 4YAHX 3ODBA 2DQVA 3R6UA 4HS7A 5I56A 1URGA 5FHOA 2QJEA 2B3BA 1SQYA 4FIMA 3MP8A 3FZVA 1ANFA 1OVBA 4KI0E 1N84A 3C32A 1ZJLA 5I2NA 5H8HB 3E3KA 3VVEA 4LONB 2RC8A 1PC3A 3FXUA 2UVGA 4R2BA 1A55A 3GBAA 5I57A 1UTHB 4F1YA 3OELA 2Z22A 4YB7A 4ZECA 5AE4A 1FQCA 1QULA 1DPPA 2QMWA 4RJZA 1NH8A 3FD3A 1FTMA 3NK4A 1I69A 3IB2A 1B52A 3EQ1A 4GQOA 3TODA 1BIYA 2XX9A 3I6VA 3LC8A 4U1OA 4KYSA 1LFGA 3OEKA 4C0RA 2AYSA 5CBRA 4I9DA 2OZZA 1XT8A 2F7AA 4F22A 3O29A 3W9VA 2DE2A 3PPOA 3PPQA 3C35A 4NF8B 4ZEBA 3FV1A 3DP8A 3OENA 2OWTA 1JW5A 1FCKA 3VDFA 2Q2AA 1LBCA 1A8EA 2F6PA 4QFPA 2X7QA 5H8NB 3C4MA 3KOSA 3H03A 2B65A 4QSDA 1KWHA 4OXVA 2F34A 4XIGQ 2XHDA 4KYEA 3ECRA 3UGWA 1JEUA 1B7HA 4NF5A 3TDJA 3CFZA 4KPTA 3FXRA 4JBZA 4FATA 3D4GA 2F7CA 1LSTA 4G8NA 4GL0A 3PPRA 2ZYMA 1RKMA 2O69A 1YTVA 5BUUA 3RGYA 1BKAA 4N6PA 3VFJA 4TQUQ 3P7IA 1ZTYA 1B3HA 5DVIA 3SKPA 3MAMA 3SETA 5AA2A 5I56B 2ONRA 3PGFA 3O9PA 2ANJA 1UTBA 2NVUB 3PU5A 3FVGA 1RYXA 3GZGA 2YJPA 2O68A 4F3SA 3PV0E 4BLAA 4I8CA 2B3FA 1PB9A 1MXZA 1MH4A 4OWDA 1LCTA 4QSEA 3I3VA 4OTEA 4QFLA 3TCGA 3HV1A 4FECA 1ZKBA 4QFOA 4LUBA 2XXTA 3FVKA 3E4RA 3MVWA 4P0GA 3MZBA 2UVJA 1B3EA 3OO8A 1EU8A 2QS2A 2OCUA 1B46A 1OMPA 1MM6A 1POY1 2OK2A 5ITOA 2VOZA 1LB8A 2DE3A 5FHMA 3VLUA 2XX8A 4EF2A 2PMSA 3A3CA 4AB5A 1B1XA 1IIWA 4IB2A 2XX7A 3C36A 3PMWA 4JB7A 5H8FA 4IO6A 4MF3A 4OEUA 2ESNA 3VXCA 2OBGA 3V5AA 3U1OA 3CIJA 3MVYA 5DYHA 2HAUA 1MXXA 4LQ2A 3B6WA 2XXIA 4F2OA 4IO4A 5I2KB 2OWSA 3RQTA 4NTLA 1I6BA 4Q5TA 4DLDA 4HW8A 3C33A 1JW1A 3B6TA 3K01A 1LFIA 5KCJA 4ZEIA 2P2AA 1SYIA 3PD9A 3EHTA 3PUXE 1B4HA 2I0CA 1MXWA 3HN0A 2AL5A 3B7DA 2DP8A 1B2HA 2ZMBA 2ONSA 1NNTA 5LOMA 4TOZA 3RT8A 3KJ7A 3LSLA 4LZ5A 3LSFB 3S9EA 2F8DA 3T66A 5AA2B 3QIMA 1PB8A 2P0SA 3N26A 1QUJA 2DWJA 3FJGA 1SBPA 3RN8A 4MLQA 2RC7A 1UTBB 3FJ7A 4C1TA 3EN3A 1OLCA 2H4IA 5ISUA 3FVOA 3MUQA 4NEDA 2XD2A 4TLMB 1B7UA 2ZNSA 4F31B 3N5LA 3GLBA 2XXPA 1B5HA 1B3LA 4IO3A 4RPOA 4EQ9A 3G3IA 4QRZA 3H06B 4QF9A 1T0KA 2LAOA 2ZYOA 1Y20A 5L8DA 5H8QB 2REJA 5ITPA 1D4NA 3F11A 3NK3A 5AA4B 2UYEA 1B51A 3DP6A 1BP5A 4H65A 1TXFA 1Y1MA 4G77A 3ILTB 4DCXA 1XC1A 3A3UA 3N6UA 5B7DA 1XHYA 2RF1A 3K00A 4F39A 3UN6A 4F3BA 1NFTA 3H7MA 2O51A 1VFEA 5I58B 2Y7WA 1MXVA 1QUIA 3A09A 1MPDA 4GRKA 4F3GA 3H6TA 4LZ8A 4POXA 1MPCA 5CMCA 3TEPA 2XD3A 1NNKA 3USDA 3ZSFA 2R9JA 3MPKA 4KD5A 3MBPA 3TELA 2ZYNA 5JEIA 4R75A 3FJMA 1O63A 5L9SA 2O84X 2W7YA 1A8FA 4MFIA 3S9NC 1MQJA 4XKRA 4ZE9A 1Y1ZA 2Q8JA 3IORA 3OXNA 2F7BA 2Q9TA 3DP4A 4U23A 3DM0A 1USYE 2V3QA 2O1MA 2IEEA 1XVXA 3HHGA 3DLNA 4EF1A 3RTFB 3OO7A 1H76A 2QPQA 3BKIB 4Z0IA 3HO7A 5K2XA 2H5YA 2H9BA 4DIGA 4X48A 3RT6B 2V3UA 3TTLA 5DEXA 3IB1A 2HFBA 5L9MA 3VVFA 4GOTA 2QS4A 4DXCA 2V93A 4YB5A 2ZNUA 5HPQA 3T9XB 1AIVA 2OJTA 2GHAA 4U21A 5FTHA 4KHZE 1FQFA 1OVTA 2RKMA 3TMGA 1SI0A 1ZLQA 2DE4A 1TFDA 4R73A 3H3GA 4JXIA 3SEUA 1B3GA 3BFUA 1M5BA 3SDFA 2F5XA 3O6IA 2XXVA 2A5TB 3FASA 4HTGA 4WXJA 4H8JA 3MVZA 1EZPA 2DVCA 1JW4A 1Z7ME 3TFLA 3QSLA 4OENA 4ND9A 3H4ZA 1YCJA 1S9TA 4JSOA 1Q35A 4BDRA 1P1WA 4E0WA 3S2VA 1ATGA 1UQWA 3EHUA 2DVZA 4UACA 1FTJA 2G93A 5I59A 1H45A 4ZDMA 2V84A 3OOAA 3Q29A 2I49A 4UA8A 2CMOA 2X7PA 1YPNA 3K6XA 3K1MA 3D4CA 3Q26A 1LFHA 4O3CA 3LSWA 2VGQA 4GFRA 2RCAA 2UVIA 3U93A 3TKDA 2PYYA 4MBPA 1B3FA 5JK4A 2I6EA 3THIA 3C31A 1EZOA 2DXRA 3RNNA 1Y4CA 4IO7A 4YB6A 2HZKA 4F18A 1MY2A 4Q8RA 1QW0A 4RA1A 5DTBA 3N6TA 2QMXA 2XXYA 1LGBC 1MRPA 1MXYA 2WKYA 5CM6A 1GGGA 4PP0A 3MJNA 1ELJA 2UVHA 4R6KA 1QKAA 4R9FA 2I4BA 2DS9A 3G3JA 5CRYA 4XXUA 2DXYA 5FTIA 3VLWA 1B1HA 1WODA 4G2ZA 4OFOA 1M5DA 1A99A 2Q89A 4QFKA 3PUZE 5TU0A 2QS1A 1SW1A 1M5FA 3M3KA 1VSOA 3LR1A 5ICQA 4NF6A 4EUOA 3Q27A 2O6AA 5I2NB 4X1DA 4EQ7A 4F19A 5AA2D 2VP1A 4F3PA 2QS3A 4JWYA 2F35A 3UA8A 1A7LA 1B4ZA 3PUYE 3S4UA 5I57B 3CG1A 1XOCA 1DSNA 3FUZA 4P0IA 5B70A 4O3BA 3KGCA 3T9UA 3H6UA 4F1UA 4ZZAA 1OQHA 2OLBA 1P99A 4HCYA 4R72A 2PBWA 4Z7EA 5F1QA 2I0BA 3IL1B 1SDXA 4JWOA 3M8UA 2DWAA 3QAXA 5I59B 1MG1A 2A5SA 4NE4A 4OQOA 1NMUA 1H43A 1SW4A 2DYXA 4OYVA 2PT2A 4GD5A 1XS5A 3WAEA 2FA7A 4AQ4A 2O7UA 4MLVA 5H8SA 2RINA 4NF4A 1R6ZA 1SI1A 3V89B 4M1VA 1HSJA 2XXRA 5ICTA 3HHFA 4U4XA 3VE1B 1B9JA 4RK2A 2DOJA 1Z7NE 3TPAA 4PQJA 4FJPA 1B7ZA 3CSBA 1YAEA 2R71A 3PMXA 2DSFA 2D3IA 2YPNA 3UIFA 3T22A 3R26A 1Q1KA 4NF5B 3EPEA 3CVGA 1Y9UA 3CRBA 3PMVA 3CI8A 4K3FA 2Q2CA 2R6GE 4PE5B 1MPBA 3MVXA 1Y3QA 1F9BA 1US4A 3K1PA 2KLFA 2NXOA 1B5IA 1MY0A 4JDFA 4RYAA 4XKQA 3PUVE 3RUMA 4XKNA 4JWXA 1TWYA 4XKPA 2QL3A 1JEVA 2FNCA 1LLSA 3K1NA 1USYH 4WEDA 1MM7A 4R2FA 1N76A 1PBPA 3TZAA 5KDTA 3IX1A 4PFYA 3KOTA 4IO5A 3ZKKA 2Z8FA 2HEUA 3KJTA 3TQWA 5CBSA 3U8QA 5F7VA 3SERA 4YKJA 3O6HA 1LAXA 3QXMA 4OMBA 4H67A 1B0LA 4KCDA 4KQPA 3LBSA 2Z8DA 4Q0CA 2PT1A 1S7YA 3KG2A 5M2VA 4R6HA 1UTHA 3H6WA 4R6YA 3CR9A 3VV5A 3G3FA 1NKXA 5AA1A 5IKBA 4LP2B 3TAJA 4RXLA 3IR1A 4GXAA 3IK6B 3JV9A 2HAVA 4DE8A 3VXBA 3PUWE 2ONKE 4LQ5A 1TT1A 1SVXB 2D21A 4DDDA 2G29A 5H8FB 5TP9A 4M4GA 4GVOA 1I6QA 1JQFA 1MXUA 3OO9A 3FV2A 3FGSA 3IB0A 2O1LA 4NF4B 4G8HA 3OSQA 2F97A 1A40A 5DT6A 4ESXA 1LAGE 4QHQA 4U4SA 2ALUA 2HXWA 4G8MA 4G68A 4H8IA 4ELRA 4U2RA 5EYFA 1US5A 2D5WA 1JVYA 4N13A 4MH5A 3O6GA 4NF8A 3RTWB 5KCJB 1VFDA 4ONYA 3C34A 1PDAA 5CC2A 3QYTA 1QJMA 4YKIA 3JYRA 4JSDA 2CZLA 2Y7RA 3K02A 2PVUA 1P1UA 4RNSA 1WVJA 4YICA 2GHBA 4ZZEA 4FEDA 3UORA 2RCBA 4WEPA 1H44A 4ZE8A 3EF7A 1MQHA 4GXSB 4KFQA 1B5JA 2REGA 1SW5A 1N0TA 5HBCA 3SEVA 1FTKA 4IY5A 1POTA 2VHAA 3CG3A 3FXQA 2YLNA 1M5CA 2GFEA 1AMFA 3MZ1A 4ZEDA 3PPNA 5KDTB 3TTNA 1A54A 5ELVA 4DCYA 1FQDA 3KSXA 2XXHA 4RK9A 1H3DA 1O64A 3L6HA 5J1DA 2I3WA 3KBRA 3SEXA 1FQAA 1R9LA 1DPEA 3W15C 4H6DA 2Y7IA 3V8XB 3G3HA 2AL4A 1B0HA 1P1NA 1AL3A 2XXXA 4QSCA 4TLLB 4IY6A 3BFTA 2FYIA 3UP9A 1IXCA 3KN3A 3KEIA 5FHNA 1UIVA 1QKBA 1GTKA 2NWJA 4G68C 5TP9B 3T9HB 1D3KA 1B05A 3Q28A 1MY4A 4H5GA 1HSEA 2HZLA 1RYOA 1PB7A 3HPIA 1FTOA 3IOWA 3AXFA 5CI5A 4OETA 3CSGA 4L17A 1SYHA 4R9GA 5EHSA 3M3FA 1Y3PA 1MQIA 4FAJA 2Z23A 3IOUA 1ZBMA 4G68B 1ZU0A 1HSLA 4FEBA 4O3AA 1IXHA 1ZIUA 1LCFA 3GXAA 4EXLA 2ZYKA 4EQBA 1URSA 3ONMA 5I2KA 5L9OA 1L5TA 2P1SA 4NWDA 1OLAA 1FQEA 2F36A 3IJOB 5EHMA 1SW2A 4BDLA 4RPNA 2HQ0A 4H5FA 1S50A 3U94A 2V3TA 4DXUA 1LB9A 5DEXB 4Q30B 1Y3NA 4IO2A 4ZEKA 3U92A 4XTCQ 3IAZA 4F29A 4POWA 3HSTA 2I58A 1IXGA 3K2DA 3RPWA 2Y84A 3PPPA 3K6WA 2NOOA 1FW0A 2O7IA 3FATA 1BLFA 3G3GA 1LBBA 3LSXA 2H99A 2H25A 4BDMA 1URDA 4YU0A 1SD3A 2HCAA 4OESA 3TYHA 2DWIA 2QRYA 2Q88A 1VR5A 2QSXA 1DTZA 4ELOA 1ZMGA 1PEBA 4N07A 2VD3A 4GL8A 1MQDA 3IO4A 4EDPA 3ZS6A 2XXUA 1IXIA 3K6UA 3S9LC 5A5XA 1GR2A 4G4PA 2I48A 3QUJA 4ISUA 4GIZA 4OHNA 3HCQA 3B6QA 2I3VA 1GVCA 4YMAA 2GH9A 1JNFA 1GV8A 3KN8A 3ILUB 3MP1A 4P11A 5DVJA 5DVFA 3CFLA 4KCCA 3JZJA 1JVXA 3TTKA 3TTRA 1B58A 1N7WA 5H8QA 3KFMA 1MDQA 1NH7A 4BDOA 1JETA 4DXBA 4X9TA 5AA4A 4EXKA 4ECFA 4LZ7A 2M8CA 3VVDA 3W9WA 3FIRA 3N94A 1VE4A 1D9VA 3TTMA 3TUSA 3KSJA 3T96B 3ZKLA 2V25A 3L6GA 1B32A 4HCWA 3I5OA 5TPAA 5CMBA 3SESA 4GF8A 4OEVA 1FTLA 3U72A 3S9MC 5I58A 1N7XA 1AOVA 2DWHA 2ZXTA 4OFJA 4H0WA 1LAFE 3E13X 1QUKA 4LA9A 3MZ9A 1MH3A 3O66A 4IGRA 4YKPA 5BWJA 3R7XA 4DZ1A 3Q25A 2Z8EA 3KN7A 4F2QA 3RLFE 1NL5A 4GLIA 1B40A 5JTYA 2ABHA 3QUFA 3T9VA 4BDNA 2E1SA 4YZZA 3MC2A 2UYFA 3CFXA 3K4UA 4C1UA 1D9YA 4YKKA 4QFNA 1FQBA 2UXAA 3T93B 3MPLA 3DELB 3PD8A 3OSRA 1TFAA 3H6VA 2THIA 3OO6A 4PFWA 1DOTA 2H98A 5I84A 4ESWA 2GRVA 4OERA 1PBQA 3TCFA 4OZ9A 5HM4B 4FORA 3QK6A 1OQGA 3MQ9A 1IUDA 1IEJA 4NF6B 2F78A 4E0XA 1O7TA 2Y7PA 3IJXB 3E9XA 3O97A 1EH3A 3O2AA 3IOVA 1MQGA 1CE2A 2PX1A 4AB6A 3WAFA 1J1NA 3G7WA 5H8HA 5A5XB 1IITA 2AIXA 4PFUA 3LUYA 1IZ1A 4BDQA 2A5TA 1LAHE 1AH5A 2NUVA 1II5A 1DTGA 4X1BA 3OMBA 3TQLA 1MY1A 1NNFA 4RY1A 2IA4A 3SEYA 4ELQA 2ZNTA 4YMBA 1IQ7A 1N04A 1CB6A 4R74A 2XXQA 5CMKA 1MY3A 1MDP1 4U1ZA 2Y7KA 4WKMA 5K2YA 4THIA 3V83A 1P1QA 4ELPA 2XXWA 2I4CA 4OVJA 5TPAB 1R9QA 4PETA 4NMYA 3FVNA 3IO6A 4ZS9A 1Y4TA 2VD2A 5IAIA 4PFTA 4KYDA 1M5EA 4I1DA 4I62A 4KR5A 3RY3A 3TCHA 2F6GA 3KZGA 4IGTA 5CMMA 5KZTA 1QVSA 1DMBA 3K6VA 3MWBA 3OD7A 3EHSA 1N3WA 4OFLA 3SEWA 3GBBA 2E0SA 2BJJX 3MW0A 1OIBA 1P1OA 3M3LA
chains in the Genus database with same CATH superfamily
5D7IF 4WGKA 3K5SA 4FHJA 2RCSL 2UZYB 3IETA 1CXIA 2J1ZA 2WM0A 1BQHG 4XMLH 5AVUB 3W3BA 5LGKA 1B6HA 2QSCL 1U6AH 2IBGA 5I3SA 4LCUB 1XGUA 2GAZB 2XN9E 3C8KB 3QDMD 5DSCA 3IOTA 2B5IB 2XFGB 4NC1C 1CDGA 1TCRB 1T2QH 3B7SA 1KTJA 3I6GB 4FZ8H 4HHAA 3WIFA 3IFOA 3TWCL 4DH2A 4AIEA 4IR8A 1EVUA 4QO1B 3GO1H 1P84K 1XGRA 4HULB 2X4RA 1PFOA 2O6DA 1CO1A 1JXFA 3HUJA 4PTKA 2YGPA 3QK0A 3MLUH 3L95B 3ZW3A 1XGZA 4QXWA 4N81A 3K2UL 4IOIB 3WKMH 2B4CH 1J0KA 4JKKA 5HGAA 3CC5B 4LN5A 1MIEL 2Q1EA 1PQZA 4EMZA 1KTKE 3BQVA 4JFVA 1FFNB 4KK8D 5AAMC 5FECA 3LEYH 5CINL 4ZEFA 4LATA 5KS9F 3UIZA 4PJ6A 3MP6A 2EKSA 3FU7B 3LOWA 5AW5B 4MDIB 2R0ZL 4PDDA 2BY2A 1BYNA 3VU1A 1H9VA 5EZIH 5FDWB 2ZNXA 3ZTDC 4E41A 1I6AA 2V4CA 3HBGA 4X98B 4DKTA 3D7PA 4GAGH 5DRXA 1Q4NX 2XQYG 4D8PA 5T1MA 1ZT7B 3GRWL 1MFCH 2XFXA 1XF5A 3QE5A 3FUDA 4AM0B 2X26A 3TJEL 4Y1AA 3B2PA 3B3IA 5K9OB 2BNQA 3ABKB 4ONOA 2BOCA 1UCBL 4PJIF 1G84A 2BJIA 1DCEA 5ITFB 5AUMB 1UM5H 5AW6B 2J1YA 4QTIL 2PO6C 4JG9A 4WHCA 2VXSH 4J2QA 2F3BA 4OM1H 3HE7B 4XMUA 3ODBA 3IGAB 1DSYA 4HPYH 3NPSB 4PY8I 4QI3A 4RWYL 5I56A 1W6WA 1CFVH 5E1QA 3W82A 3KPQB 3PUUA 3TA4D 1EEZA 1AHKA 1S7VB 5HSFA 1G43A 1V7NH 2A4ZA 3C9NB 2YUZA 1TQSA 1S9VA 1KBKA 3GUTA 3AY2A 4KITB 4G1EB 4DGYL 3FF7A 5CSGA 1NFDE 2P5WB 2GBAA 1N84A 1G9ML 1FNGA 1CWVA 1ZJLA 3L54A 4UB0H 4X0NA 2ATPB 4YDKL 2XWOA 2WQVA 2VM3A 4Z0XA 3SO3B 3MV9E 2I9LB 3G5ZA 1T89A 3OKOA 4GG6A 2I9TA 2EDKA 3WNNA 1CZ8H 4WHTB 5CJBA 1W6LA 3PHOA 2OZ4H 4ZNEE 1P5UC 3DX4A 1TJHH 2B20A 1A8ZA 2EYTA 3FCBA 3KLLA 4N5UA 2APXA 4XNXL 1PC3A 2WZ0A 3DOSA 4ATWA 3FXUA 4NCDA 1AGCB 4R2BA 25C8L 3RBGA 3D52A 2AXGB 1A55A 5I57A 2JJWA 4L37A 4TULH 1OAUL 4JRXA 3BHBB 2CR0A 4TNWF 3TZVC 5EDSA 2G4EA 1UTHB 4F1YA 3TGXA 4QOKB 4YB7A 4JFXA 4N0UE 2KH2B 2SEBB 4TNGA 1WT5C 4QXUL 4ZECA 2L3BA 1TJMA 3D2UA 4B95C 4Y89A 3BYYA 2OMVB 3FRPA 2Y2WA 3PAZA 1JXDA 1ML0A 5DD3L 5FKPB 2YAHA 3RNQA 5A3ID 4HEMA 5T3XE 3MLVH 3LZOA 3RY5A 2GK0B 1K6QL 4WU5A 5AB0A 4CMHC 1GYAA 4U1GC 4NZ8A 4PJ7A 2CDGB 1GSKA 3SGKC 3VDCA 3OB8A 3AB0C 4AMWA 4CU7A 4YOKA 1HH9A 1SXNA 1JD9A 3JWNC 1NDMB 1MAMH 3NABH 3NSCA 1ED3B 2MPVA 1ZLUK 1XSIA 2JKWA 4LPUA 2WXHA 2JKNA 3FUNA 3MJ9H 2BIMA 1VFAA 4J6RL 5CKGA 1D9QA 1I69A 1QO3B 3IB2A 4W9FC 4DZ8A 1B52A 5EUOE 1BZDA 4NQED 5DJ6B 5E9DB 3T0XA 4BK8A 5ILTH 3ZDXB 3PV6B 3EQ1A 4GQOA 1V5JA 3TNNB 4UT6H 1BIYA 4Z7QF 1FNAA 1JZ2A 1ESOA 3D51A 2EUZA 5GRXG 2XX9A 5DUMH 2UZIH 4N2LA 2GIMA 2EIZB 1OM3L 3TA3A 1I8KB 3O45A 3TN0D 2EDFA 4PJHE 4U1OA 4Z76B 1S5IL 4FNPA 1DE4A 5TDOA 4DFIA 4BFKA 2A77H 3OEKA 1TZIB 5GSRA 5J1AA 2YBRB 4AJWA 4FMFA 1BFOB 4PRBB 4XVSH 1F1DA 5IG7A 1A3QA 1H8NA 2N3JA 5CBRA 3FN3A 4RAVA 3QIBB 2FH8A 1FZMA 4O00A 4HKJB 5EU6A 4CBPA 2I69A 2NW3A 3EJTA 4FABL 4URKA 5IT2L 3D0AA 3O29A 4UOQA 4OCXL 1JPFB 2I24N 2VR6A 4FQIL 4L8SA 4OVUA 5F8QC 5FK9A 1MHHB 5C9KA 4IIZA 5HI5C 2DE2A 1DVFD 3DMMD 3E9TA 1ODUA 3KG5A 4H7VA 1WAPA 3SZKC 3ULUE 4XO5A 3OXSB 3V4PB 1ZV2A 2DYPB 4NHCL 1ZKAA 5C9JB 2OWTA 1NM4A 2IMNA 3BKML 4EZLA 5EOTB 4MQ7A 2VZVA 5BO1L 5CGYD 5IF0B 4NB7A 3F7PC 4FE9A 4GOSA 3U9UA 4KXPA 4XT1C 2WO2B 4UQ3B 2H1PH 1OAKH 1RZJL 4CVWA 1KN4L 3HMWL 4KHXL 2VZTA 3N42B 2CEXA 1S7QB 4LSSL 2LABA 4NXKA 2CLZA 3ARVA 3T6WA 3IDYB 2EQDA 5KSBA 4C59B 3TESA 3QO1A 4KI1A 5TPWH 4QSDA 3CVHB 1LEGA 1TTCA 4YFLF 2F34A 2IAMD 3SBQA 1ZK5A 4DP5X 3NCMA 4X9HA 1DJGA 1ODAA 5T1KA 2VW6A 4HXAL 2V2XB 4O02B 5J7CC 3OHXA 2IANA 3I3EA 4JQIL 2BWIA 3PUCA 4XBMA 5EH1A 4F2MA 4ZZFA 2EVFA 4G7RB 4OGQC 1RZIA 3VXUB 4KYEA 2BNRA 4NM4H 1FHGA 1MWOA 4XAKD 1EO8L 2O30A 3RVXC 1RZ7L 4XVUD 5IW6A 4UILL 5J57B 4XTRC 5GZNA 3MRLB 2YQBA 4RGOH 3TDJA 4NO5B 4K71C 5E03A 3CFZA 4MX7A 1SOKA 2NY1D 2Y7NA 2XJLA 3NEOA 1GOHA 1I7RB 4FATA 1X9RA 3WJMB 2F6AA 1EHLH 3WFCL 3JWOH 3PF2A 1HK6A 3MV8A 4LVHC 5A2IH 4RGNB 1L9QA 4JFFD 1XCTA 5LQBH 4G9FB 3PPRA 2H32A 4BKLB 5AB9A 2OPCA 2G2RB 4W4OA 3HB3D 2XTJB 4JKWA 4MSWB 5H94A 5C0RL 4GRWB 4AK1A 1YTVA 1RUML 5IHUL 5KVGE 4L1SA 4Y1SA 5BRQA 3WLBB 2WBDA 4A6YB 4TQUQ 4ICXA 3JWDL 3UPCA 4JJ5B 2D3JA 4YE4L 3FRUA 3VXRA 5AA2A 3R19A 4JKNA 1QRNE 4M5SA 4ZX3A 3JBG7 1GS7A 3PGFA 3W9DA 4NGUA 2DJUA 5D7KD 1GW0A 3DIFB 3U0PA 5GS1C 1BECA 1YNTA 4F93B 2XQBH 2ZKHL 1E0OB 3SOBH 4WUKL 2Q8AL 2HH0H 2ZSWA 3FQTA 2ANJA 1KWKA 5ITBH 1G1KA 3LS4L 1K8IA 3FT2B 3T4AC 4ALAC 3O9WC 2E4FA 5AYUL 4DK5A 9CGTA 4IU3A 3FVGA 1L6PA 3GI9H 4CSZA 5KYWB 1OB1B 3EUUA 5F1IB 5FGSA 3GZGA 4U31A 2YJPA 2OMWA 5J13C 3QGVA 1BJMA 2CALA 1Q0XH 4IOFD 5I1JH 3ARGB 1KJMA 4HKZB 3MGTB 9PCYA 4Z3GA 3L3JA 4BSJA 3QZWA 3LV0A 4RAHA 2B3RA 1H5BB 1S3RA 1I1FB 3SDXF 5D96C 4ENZA 1R75A 1FAIL 4PB0L 3BAWA 3KYOB 2B3FA 3F3HA 3KPMA 2X0WA 4QNPE 3SPHA 4OTEA 2A6DB 4QFLA 2WHVA 4NZFA 4EAEA 5DURD 1I8MA 4PRDB 1MI5E 1OCOB 1XGPB 5H37G 2Y1YA 3HV1A 5JZ7C 4N0YH 3P2BA 4NKMB 4OVTA 4QFOA 4Z7WA 1O6SA 3QDGE 2YKLH 2NZIA 4LUBA 5IGAA 1TOXA 3MBEB 4JHVA 3OX8B 1Z9SA 3AG3B 3MACL 1TO4A 5DJ2A 3MVWA 4P0GA 4OVQA 3MZBA 3PWVB 4OI9A 3WEAA 4JFYA 4IMLA 5DUPH 1HT6A 1BXVA 1YQVL 5FGCB 4LASL 3D48R 2VN7A 3U6XA 5IFJA 1HHHB 1VGKA 3GBEA 2LLLA 4CC4A 3NZUA 4RSVA 2BRQA 4FKKA 5ITOA 1Q9LA 2QVKA 1A25A 2F3DA 3C08H 1IAOA 2WANA 2VLRD 3QZNA 4X4ZA 3G9VA 1BD2E 4EF2A 5LUMA 5DJYA 5CLXA 3A3CA 5GGSA 3SO5A 3GSWA 1MFAL 1IIWA 4IB2A 1O75A 3SYQA 5C0DB 1E27B 2G5BB 3U48A 3R7RA 5JDSB 4HUWA 1U8KB 2BPBA 4OEUA 2ESNA 2VLLB 4AMKL 3VXCA 4R0LB 1RU9L 3V5AA 3QMFA 1VKXA 4OVPA 5I17A 2N0KA 1J11A 2HRPL 3U1OA 1IFGA 1JOIA 1XO8A 1PD1A 2COQA 2HAUA 3FYIB 1RZKL 5CZVH 4FP8L 2DQIH 5JMOC 3PWJB 3T77B 3SJVE 1MLCB 4UTAL 3GMLA 2BHUA 4WUUE 3ARDB 5KSVB 3CFEA 4XMKL 1BVLA 1XXFC 1KIQA 2C9VA 5I1LB 5TE4L 4JK0D 3P30L 5F6IB 5IVZA 4HSCX 3VXPB 1ACZA 2QSTA 4OAWB 2OJZL 2BCKB 4Y2DA 1IGCL 2YKKA 4HKXB 3KS0H 5JXEC 1XGTB 1DBMH 1TKWB 5JIHA 3VFTB 1ACYL 1ONQB 4NRXA 1HEZA 3Q6FA 3ZO9A 3GJFK 4X5WA 4AEIH 3IJHB 3C33A 3VI3A 4YDNA 2A6KB 2MQ3A 3BE1H 4HUUA 3EHBD 3NCXA 5DHVA 4MXQD 3S3PA 4YSUA 1FVCB 4ANXA 5KJRL 4RRPG 4D0BA 2P26A 2VNCA 4K4KA 1D9KA 1I7TB 5KBLA 4R4NC 4LVNC 4WFGD 4PGPA 2FWOB 4QHLA 1FYTE 3KPNB 2J88H 2P2AA 1SYIA 4HIEA 4UQDA 5HHOB 1W8OA 2DQFB 1A6VH 4G6JH 5HD8C 1B4HA 4ZG1A 4U05A 2I0CA 4N9GB 1LWRA 5D1XC 3V52L 3WIAA 2F53E 2HVJB 1NGZB 2EIBA 1CF1A 1CE6A 2WWMD 3IJYA 2WXNA 4GUPB 2KDGA 1J1OH 2BINA 1G7PB 1U36A 3U1SH 3MCLH 3IRPX 15C8L 1URLA 1Y1UA 1XH1A 5AW8B 2HVBA 5D7LE 3FB8A 4GSXA 5CLYA 5DR5H 1WK0A 2ED9A 3QDJB 4OBRA 4MMXB 4XNMB 2CLVB 4HK0B 3IF1A 2OXGA 1UB5B 1IC7L 5EN2A 3VFOB 5CD3A 4PRID 4KO9A 4GKOA 2VQTA 2J1XA 1W72L 1EQWA 5CN2A 1AYRA 1KNOA 2APBA 2OW6A 4JREC 4X4MA 2NXYD 4M4RA 3KPRB 3QEQA 4KX8A 4JR9L 3KBEA 5TQ0H 1NBZB 3D39E 3NCWA 4YC2C 4Y19A 4Y7MA 4GQRA 4XXWA 5I1HL 4PB9H 5EULV 1U95A 2DWJA 3FJGA 1NEUA 3ELQA 2WUCH 3LIUA 3KPOA 2ADGA 2PPCA 1MDTA 3QXDB 5KS9B 5IQLA 1T7ZA 1HE7A 2X3CA 4P2RE 1A2YB 4KRPC 1DVYA 3ZE1E 4ZPTB 1VADB 4JMXA 5D72L 2R51A 1HHJA 2OX5B 1DCLA 4J12A 4NQVB 1BZ8A 1EV2E 1HJCA 5ISUA 2P5EA 1U3HD 4CDHA 4EE2A 4Y2OA 1WA1X 3QULB 3DV6A 1I9RL 4WO4D 4KMTH 4NEDA 1SY6L 2GITA 4AEFA 2VN4A 2XD2A 5F7DA 1TXKA 5E08H 1U8MB 4NYLB 4PJIB 4AC2A 5I15H 4F31B 4L4VD 3NSYA 2XXPA 1EDHA 3E7JA 4YBLC 3KXFA 1B5HA 1B3LA 4LXFA 2VXVH 2XPZA 5AQ0A 4YSEA 1G6RA 1MCFA 2IG2H 2X7LB 2ZCLH 3LQZB 2NYYC 1TQTA 4YK4B 1OSPL 4EJ1C 4MHHG 3BAEH 3HC4H 1HNGA 1MCPL 3L5XL 3PPEA 4LEOA 1HXMB 3ULVC 2X4QA 3UAJA 1A5FL 4R7NB 1FAKT 3QIUC 2XZQH 3LB6C 3FW6A 1S7XA 4JPVH 2REJA 1B2WH 2WXRA 2ESVB 4ZUTA 1D4NA 1E4HA 1KTDA 3AQZA 1OAQL 4XP5L 3F11A 1OPOA 4H20H 1ZA3B 4FL4C 2R39A 1TTRA 2IDQA 3PDOA 4XBPB 1NJ9A 3NK3A 4R7XA 3MA9H 4ZUUA 4AKPA 4BSWB 1P6WA 2H3KA 3BQUA 1BP5A 4PRAB 5DK2B 2J1KA 1Y1MA 5ICYB 3IGFA 3L4ZA 4HC1H 4DP7X 1U8HA 4M6MH 1P7QA 2A9NH 2WNGA 5FO7B 2I5YL 4DCXA 3V6FB 3A3UA 1UUSA 3QJTB 5D2NB 3V5DA 4AW7A 1GGBL 1YJDH 1MCNA 4L3ED 1U21A 4X7TA 3N6UA 3LMJL 4QXGL 4KI5D 2ICEA 4ADJA 3Q8AA 1XHYA 3WDJA 2DQJL 5IB1A 2EP6A 3NEEA 4FTVA 1R24B 4JFPA 3O2WL 2A0LC 1W91A 1S7UB 3DNKA 3C60D 2QQNL 2GFBA 3L4UA 2PXYB 5C3TA 3D05A 4PP2B 5A40E 1QUIA 2DQUH 1M71A 3VFGL 4GRKA 4U1LB 1U8OA 2V9UA 2ARJQ 2NZ9C 1NUDA 2Y6SD 3NA9H 1C5CH 4XNQA 1PCXA 1MHPL 1XXDC 3H2WA 1R3HA 1SHMA 4J3OD 5T3ZE 2IH9A 2XD3A 4KPHH 5CP3H 4PJAF 1B0WA 2F54B 2VXTH 3LEVH 2ATAA 1KIRB 1WEJH 3DXAA 5DZNA 1S9YB 2R9JA 1A47A 3FMGL 2V5TA 5T3XH 3MPKA 4TKWA 1FJ6A 5JHMA 1LD9B 3E6FA 2ZYNA 4PD4J 5G4OA 3U46A 2KZWA 2HYMA 5FDYA 3EFFB 2Y5TB 3VXMD 5LHDA 1VA9A 3UTSE 3QO0B 5LXGL 2UY7A 3P0VL 3TURA 3VQLA 3H0TB 5AFAA 4Z7QB 3QAZC 1E8YA 1ZY9A 5JQIB 2YMXL 3KDPB 4CJ0A 4P5TC 1YO4A 3FJMA 4BUHA 5BOJA 1BX2A 5DJDB 1YEEL 5BOZG 3MV7D 5L9SA 4UT7H 5JW4Q 2O84X 1AQ8A 2KI6A 1HKLH 3QFJA 5I0WA 1MQJA 3ARTA 1Y1ZA 4ZE9A 1C7SA 1YECL 1MW0A 2F7BA 2JELH 4JFEE 2IDCA 4FFWC 2C3WA 1HI6B 3FFCB 5LDUA 2WY3B 4DKEH 4FQXC 4MCYA 3DP4A 5DZ9A 3W0WE 2ZOOA 1J8SA 6PCYA 1OCWH 2FZ3B 4U23A 4ODTH 3UTTE 5EIIB 3EFOA 1G4MA 2CPUA 1USYE 3AVEA 4ELKA 3SE4C 3M8OL 3NYKA 4HXBL 3UACA 4LCWB 4EF1A 3EFDH 2C7UB 3RIFF 1FG9C 1H76A 4LIQE 3C6LC 2VZOA 4PRPE 1I8IA 4H25A 4EN3B 1D5MB 1G0IA 3IXTB 3HO7A 5K2XA 3JWNE 5IR1A 3MCYA 4PRNA 3UTZB 2J3SA 4DIGA 3QDME 1AHWC 4JANA 4OB5L 3WYRA 5T5FA 4Q8BA 5DEXA 1A64A 3QR2A 3ZHDA 1CE1L 2QS4A 3BP7A 3N9GL 1EVTC 1BPVA 3E8UL 1R4XA 4D9LL 2HX7A 2NXZC 1EZLA 2B9BA 3HFUA 1KB9K 2XV2A 4ANVA 4EF3A 1M2VB 5BS0E 1RUPH 1DHKA 4XNYH 2YMTA 1ZT4A 5ET5A 4N4YB 5ANME 2GHAA 3PNWB 1MAKA 3MRJB 5FO9B 3WFBH 3S34H 1A4KB 3WE6B 3C8HA 5FTHA 5E6IA 1AGFA 4NP9A 2RKMA 4YR6B 5E2JA 1IFHH 4TYUA 3LSOA 5LWYH 5AOKA 1SI0A 5I1AB 1RUQH 3AQXA 4F37F 4X7SL 4E41D 2VO5A 3EOAB 3UJTH 2UWEF 3D0VB 2K78A 2DTML 3NFSL 4I4WA 3LKRA 4BZYA 4Y4KB 4Y1AD 1YMMB 3BSGA 5SWZE 1J9QA 1RAMA 4XCNB 3NJIA 2IPTH 2AZAA 4JPIA 4MNQB 3TEUA 3X12A 2D7TH 3MNWB 4MJOA 4R5VA 5IBLC 3GSQA 4PWIA 1EH9A 1EFQA 1B3GA 3A6BL 4IOSA 3SDFA 4FI6A 2CBOA 2OYMA 1Q9KA 5EO0A 3VCLA 1USZA 5ERWB 5AKVA 5GS0C 2XXVA 4HTGA 1AE6H 3KJ4C 5ICXA 4LCCB 1R0AH 4F9PA 1QOKA 2J6WA 2TSBA 4YS4A 3KLHD 4ABUA 4NRYA 3WXWH 2DVCA 1JN6A 4GMSH 1J7VR 1MVFA 1F4YL 3KS0J 2P80A 4OCRH 1UYWH 3BKJL 3BGAA 5E94B 3QWNA 1QWUA 5DMIH 5HDOA 5F2FA 4TTDD 3OWRA 5CM1A 3JTSB 1PG7L 3S48A 4FEIA 4ND9A 3RVTC 5KVGH 4MB3A 3SE9H 3L4CA 1RURH 4XN8A 3WHXB 1S9TA 4JSOA 4MAGA 4MMZB 3DETD 5DT1H 4BDRA 1IQWL 2ALWA 2P46B 3NJVA 3ZL4L 1NBCA 4IMKC 2BSDA 3WL9A 1P53A 1QPXA 2H8PB 5IMLB 3WFDL 1WJ3A 1ZHNA 1RIVH 4XCCH 3UZVA 3FQYA 1PSKL 2QPEB 1DUZB 1UQWA 2D7QA 4JRXD 1PIGA 2VAJA 3GMPB 5EWIH 3D25A 5D1QA 3WEXB 2KQZA 4K94L 1SYVB 4Q4EA 3AAZA 3KL3A 5HP5A 4EI5C 1NEPA 4EZKA 5CFHA 4HKBA 4IDJH 4X8JB 4MBOA 5I8EB 4DQOL 1ZLSH 3SDXB 3FQWB 1F1AA 3GM8A 5HDQL 2VMFA 3D2UD 4GUOA 2NR6A 2IMMA 4KK6D 1L0QA 1FZKA 3GPEA 4TQ8A 4UM8A 1ECZA 4AYBA 4ERSH 4U3HA 1IUZA 3NGBC 4GRLC 1YSOA 1YPNA 3RTQA 1DZBA 2GC7C 4TUKH 1PL3A 3LQAH 3WTVA 4XPAH 3C5JB 2YRZA 5PCYA 5F9WB 3K6XA 4HJEA 1VDWA 3UBGA 2HJFB 4OM0H 1A7RH 4XX1E 4OD3H 3KHOA 3GHEL 3MV01 4XCFL 5IKCB 2VC2L 1I9JL 1EO5A 4UTBH 4A66A 4O3CA 3OGOE 2E9BA 4APXB 1SDDA 3ZGIA 5EF0A 1ZA6B 2OR9H 4OZ4B 3IMVA 4PJ5A 2RCAA 4GX3A 4OFVA 5B39G 3T08A 2UVIA 1HHGA 1FDLL 1FZOA 1RY7B 1FFOB 2JIXD 2VABA 4CN6A 2LU3A 1CPUA 1E8ZA 5GJTL 2EE0A 5C71A 1FVEA 3D3VA 3T6VA 1TVHB 2YFOA 4Y1TA 1L7IL 5HTSA 1D5RA 5ICZA 1P4LB 4HMDA 2FHYA 2NTFA 4HJSA 4NO0D 2PYEB 1ZWIA 2XZCH 2ZPKH 4LLAA 4Z7UE 2I6EA 2Y2TA 3TBWB 4EEEA 3DJSA 1CT8B 4PREB 3SOTA 2FIXA 1BK4A 5IIEB 3DX9A 5EU6D 2WTRB 2HZKA 3S2AA 4I2XB 3RPKA 3OJDA 4DK6A 4X0KB 3L08A 4GKNB 3UBFA 3WXVH 3T1WA 4JEGB 4K8RC 1FGNL 1QHQA 5K9JH 3JQOB 5ID1A 3KCPB 2MWCA 4LARL 1AMXA 3VD5A 4V2BA 4A2LA 3SBPA 3VQ1C 3VRJB 2PWFA 5FCUL 1GGGA 1A6UL 2DICA 3RWEA 3PGCA 5KW9L 1Z2KA 2J8OA 1EJOL 4YL9A 1KXTA 4R6KA 1QKAA 4KZ0A 4R9FA 3WIHA 3ARZA 5BVPH 5JPNA 4WTZA 4GEIA 2R69A 3FCTB 1LGVA 4FNUA 4IKNA 2NY4C 1AQKL 2WWKT 4GW5A 4M5TA 4YSSA 2DLFL 1BBJB 2Q86B 3MLSL 4PFBA 5AVXB 5CIPA 6FABH 4YXHL 1NWOA 1MXGA 5GS3A 2VDQH 1K4DA 2P48B 3OZLA 3CX5K 3PHQA 4JPKH 1WODA 4K94C 4DK3A 2QADB 3AM8A 4U6YB 1MNNA 1ZLWH 3LH8A 2C4XA 3IS0X 3ZUCA 4BE5A 3CV5A 5JIPA 4F9LA 1SXBA 1M5DA 1A99A 1IE4A 2XXKA 3B7TA 3DUSA 1CICA 5GZND 1EXGA 2GY7B 5KBDA 2CO6B 3IVKB 4U1MB 3UABA 2UZXB 3TJHC 1G0HA 2AEQL 2EC9T 3ILQD 5HHMD 4QXTA 5CZRA 3PUZE 2CJSA 4KWUA 3WCYA 3QUZB 1P1ZB 2QS1A 4GAYB 3KH3A 3V9EA 2HZHA 3KDMB 5JO5B 4N5EC 4N2EA 4QT5A 4FDWA 1CGUA 4PJFA 2XWIA 2Z4QA 4YXKH 2DQCL 2V9RA 2Y7SA 3A22A 5F7LB 1A22B 3RPIB 3R8BB 5HYSG 2O6AA 2ODHA 4PBQA 3S37L 4M1GH 1XF4A 4KOCA 1IGIL 1LVEA 1EYJA 4X1DA 4JCMA 5I5IA 1PLGH 2ZP9A 4WSJA 2Z9TA 5GGTL 4F20A 3ROJA 1XF2A 4RVBA 3WJJA 4F19A 3MNVA 4U1IA 3MFFB 5AA2D 3BP5B 4I3EA 2GSIB 4S1QH 2FATH 4IEFB 3EO9H 1J12A 5DO8A 3TCLB 3QSKB 4L48A 4DN4H 3ZIYA 4JWYA 4JZNB 3GTNA 3CD4A 3HRZB 4HJ1A 3DVNB 1HYSC 2MQCA 5IVXE 1B4ZA 2OJEA 3QUXA 3PUYE 3CG1A 1U9KA 4K15A 3W1ZA 5E4AA 4A68A 5J12C 3FUZA 5B70A 3WFHB 2X4UA 4LEXL 5HYIA 3PGFL 1QMUA 1QKZH 1YYLL 5JIMA 1NBVL 3QUKB 2PPDA 2J5WA 3R06A 3U4EB 3T9UA 3BZFA 1G7QB 4ODWB 4QHMA 2CDFA 4ZZAA 1XIWC 1NCWL 4IKLA 1V7ML 1P99A 1D6VL 3QCTL 2JKRM 3K1KC 3OR6B 4HCYA 3GSNB 4JFZH 4OIBA 1IM9A 5LB1A 4GAAA 4OZHB 1J8HB 4OD1L 1R3KA 4LMQE 3UYPA 4ICWA 2XCMC 1GH7A 1RUAH 2BDNL 5D1XE 1IIKA 3IXAA 2OMXB 3WY2A 1AXSB 3BLKA 4D0CA 1SLWA 3EW3B 4RQQA 4PJBF 2WSDA 3HLAA 1ZLVH 1B6DA 4M7JH 5I6OA 1HSBB 1SOQA 2JTDA 3MCKB 3IU4H 4XP1H 2QPSA 3L4VA 5HHVL 4G7QB 5I59B 5SV3A 3QEGH 3K72A 3W5NA 2HT4C 4JO1L 2XZAH 4OCSL 4YVNA 4LO9A 2BFVH 4U4IA 3BP6B 3PJSA 5B1JC 5F24A 1FCCA 3F01A 4HIQA 5JHDD 4WY7H 5J56B 2DWEA 5EBLB 4NE4A 4H88L 2NX5A 4A2FA 1DEEA 2COVD 5HPMA 2G75A 3KC1A 1LLAA 2ORBH 1H43A 1SW4A 2DYXA 1S7TB 1NIEA 5DQ9A 2XWVA 2FX9L 4GD5A 3NBNA 3JV6B 4KJQD 5C7ZA 4B53A 5CF3A 5I59A 3WAEA 5A16B 3QUYA 3AADB 4FOMA 4Q2ZB 4YH6A 1PDKA 4IKJA 4GLRH 3HBZA 3PWPE 5DUBB 2HJKA 5ACMA 3TT3L 5IOKA 3BUIA 1BZ9A 5EEYA 2ALAA 3OLDA 4NCC1 1GOFA 2FL5A 2F74A 2J1WA 2Z91A 3CSYA 3HZYB 5JR1L 5HHPA 2WSKA 2WINB 1W8NA 1MCQA 4GBXB 4YSPA 2A74B 3MOQA 2AERT 4LSRH 3BCFA 3MUZ1 4Y8AA 1OP5H 3FFOA 2MHAB 4G80B 3FXBA 3BGFC 2XG4B 3V89B 1XZWA 2YR3A 3GIVA 4X83A 2B0SH 2O61B 1A9BB 1MEXL 5E2UH 3HHFA 1YA5A 4H46A 5B3SB 3CJJA 3RUGF 3O4LA 1B9JA 2GYSA 5C0GA 3BAYA 3NESA 5BUAA 1G7JA 1BZQK 3NCJL 3VSQA 2AJYH 3AS2A 1Z7NE 3IE4A 2R0KL 3X14A 1PD0A 1QSEE 2Q2LA 3IAPA 3NACL 5C09D 2VISB 2W0PA 5C0FB 3D07A 4WSKA 3L2MA 1SHWA 4HEPA 5DTFA 1DANT 5DHMC 4XWOD 5I5RA 1K5WA 2L0DA 2IPUK 1UOWA 3IM1A 4XPBL 5KSAA 5AOZA 3ULVE 4FF9A 1HSAB 4ODHL 1YAEA 2Z92A 1QSFA 1ZS2A 4PJAB 3Q5TA 4KTDH 1NIDA 3B9KC 3PCYA 1C08B 2UZYA 4N8CL 4Y2DD 5LBSH 4Z78B 2DSFA 5KUKA 3UBXG 3UIFA 2QT6A 3C8KA 2GAZA 3C09C 3BI9X 3GTTA 1T7YA 2WN3A 1WG3A 3ZPDA 4OCWL 2HFFB 4B9FA 3CVGA 1PNCA 3VD3A 4FCHA 1C16A 3OSKA 1BXXA 4KY1H 1SDAB 1D9KD 4KHTL 1JG9A 3CLEH 3HN5A 5C0CD 4GKZB 1P5VA 3MRQB 5H4ZA 2ZYSA 3C5XA 4QCIB 2FK9A 3GZQA 4WFEE 4EUPG 2Y1AA 1IAIM 1CK0H 1BIHA 2BOBB 4IOIA 5B38G 1REIA 2CCLA 2RFXB 3CC5A 3OKLA 1ZE3C 1TO5A 1N19A 1T5WB 1T7VA 4BZ2A 2WLKA 5TK2A 3MVXA 1KLFB 4MMYA 4KBPA 5F3BB 4XPFL 3FU7A 1AG6A 2C7FA 1X5GA 4W6XB 3CX2A 3BSZH 3BUQA 4RYAA 1THAA 5FDWA 3ZKXB 4XKNA 2DM3A 2B8OT 2QJDA 5D70L 5JLZB 5J11B 1ZT7A 4JWXA 4ES9A 2VDMH 2XYBA 1Q8MA 4XN9A 3UTQA 5K9OA 2FNCA 2E0PA 4N8VB 1NC2A 4PHZA 5FOBB 2IOIA 3VD0A 4JM2A 1SPIA 1USYH 5DJCB 1FRGL 3SDCC 4EOWH 2NY3C 1NMBH 2WP3O 4WEDA 3HE7A 4XX5A 3IGAA 3MRCA 4LIQH 4R2FA 2JQMA 4M6AA 1UD4A 3QEQD 1IRAY 1TQBB 3JWNH 5C0AA 1F8TH 5E4EC 3GJFB 3CDGB 4NBYB 3UGXA 4B41A 1S7VA 2ZP0T 1P7KA 4Y19D 2F2HA 2DLHA 5KDTA 3C9NA 1XGQB 1XTMA 3IX1A 4PFYA 2FQDA 3NT0A 1G5AA 5CEZD 4K23L 5FXCH 4AGQA 2Z8FA 2OL3B 2P5WA 4QHUB 3BMVA 1N64L 3KJTA 4O2EB 4U3CA 3V10A 2YLKA 5CBSA 1DZ0A 5BMFL 2IGFH 3EOBA 4O9HL 4WDIB 2ATPA 4KTGA 2J25A 1DVXA 2I9LA 2UWEB 3I6KA 3SERA 4IGBB 4U0RC 2P5ED 4OH2A 2O5ZL 3FULA 4WHTA 2WMPA 3QXMA 5CEZL 5KN5B 4QF1B 3HC2A 4WZ9A 3F85A 3MODL 3T8XB 4WV1B 1FN4B 2GB2A 2Z8DA 1FNFA 2AXGA 5M2VA 3ZXAC 2YEQA 1JJUA 3DX8B 3ARFB 3BHBA 1UTHA 3S35X 1UCBH 3KXFD 3H6WA 2WXJA 1EHKB 5JOPD 3MV11 2HG5B 1NDTA 1MJ7L 1YVLA 3QA3B 1M2OA 4JO3L 4GI8A 5L6YL 2O6FA 4BE6A 4GBVA 4YDLB 3ES6B 4WW1A 4S1SH 5KVDL 5M7QA 4LP2B 1Q1JH 4RXLA 3K4DA 3IR1A 4GXAA 1BXAA 3OJVC 2GK0A 3IK6B 3JV9A 4R26H 2MOQA 2V5MA 1SXCA 1G6RL 2ZP8A 1G0XA 4OZFH 4YE0A 5C2BH 3VXBA 4BYHA 2ONKE 2R7EA 1NDMA 1IMCA 2KPWA 4B9ZA 3B7UX 1ED3A 5I1GH 2D21A 5B4MC 4DDDA 3FBKA 1D5IL 3UO1L 2DEYX 5H8FB 4FFVC 4NZUL 2PTTA 4YDKH 4GVOA 5EPMB 3BQUD 4OSUL 1JQFA 1QO3A 5ALBH 1UACL 2F15A 3T0AA 5DJ6A 4PM1A 5E9DA 4PJEF 5IY5B 3PV6A 5J4MA 1R47A 1MXUA 5I7IA 3RA7H 3L6FB 4NZJA 4BWUA 3TNNA 1S3KH 2W0FA 4JM0A 5FS5A 2WVTA 2JFCA 3IB0A 4MJID 5SWSD 3MI6A 4O5LL 1A7NL 2EIZA 4KRLB 4M1CC 1K3IA 4WIQA 4JN2B 4KI5E 4TM9A 4NBZB 6PAZA 1PZUB 4FTVD 4Z76A 3WMPA 3B7YA 3VFRB 3TYGL 3GMNA 1T7WA 1TZIA 3QZMA 5BZXA 3PGDB 2YBRA 4X6CE 3VA6A 4DT2A 2BJMH 4ELME 1FBPA 3NJXA 1FFPA 1BF8A 3HFML 2FIEA 4G8MA 2VR8A 4CRPA 4DGIH 5HVHB 1GAFH 3QIBA 1EA9C 4GRLA 1T4WA 1XWVA 1X5AA 4H8IA 4WTXA 2XKNB 3F7RA 4BFBD 1Q0EA 4M62H 5KSUA 1JPFA 2GK2A 1GGYA 4U2RA 4ONHB 4RNRB 4O4YL 3F6JA 1NGWA 3R0NA 4LCIH 2WZ5A 3DXAD 2DYPA 3T09A 4GI6A 1AQDB 5D2LF 1RD6A 4EBQL 4GAJH 5EOTA 1A21A 4H26B 4FMVA 1PIFA 4XHQA 4GW4A 1IBZA 3OKEB 4YHYB 4JS7A 4PGCA 1QJMA 4DI4B 1TQVA 1WBXB 2EC8A 5AW4B 1L5GB 2CKBH 2XA8H 4LSTL 1OTUC 4KXCA 3H8NA 1XQ4A 1GL4B 1SOSA 1S7QA 5ISZB 2OMYB 3EO1B 3ZHFA 1TZHB 3VFPA 2QGEA 3HG2A 5GJSH 4WVRA 2UX6A 4LRIC 1N0XL 2LV4A 1INEH 3AS1A 4MCZA 5DK3A 4PGNA 3ZGHA 2QSVA 2PVUA 3PFQA 5TF1H 4EI6B 2WLLA 4XF5A 1KCUH 2V2XA 4HDIB 4O02A 4WWPA 1KFAL 4ALAH 1LO2L 2GHBA 2FSEA 4YICA 2YPVA 3BDYL 3MLZL 3VGFA 3TEWA 4HAKA 5I9QC 2F1EA 4HIPA 4ZMAT 5GGRA 5KTEH 1E4JA 1UEMA 2OK0L 1IQDB 1F2XK 4GXUM 4Y5VC 2YC1B 1U92B 5TD4A 1O7DC 4CVXB 2DQTL 4WEPA 5CCKH 5CCGE 3D30A 5LAXB 4H45A 1IBGH 1QVOA 1ILSA 1RJYB 3AS0A 1LMKA 4KKAD 3MRLA 3QISA 4QRRE 4BH8A 4LU5H 1EFXB 4YZWA 1A7PL 2PCRA 1BM7A 4DZBB 3QUGA 3OWEA 3S36X 4FI8A 5IHHA 2OAAA 1I7RA 1TJIL 4ZAKC 1B0IA 2JLPA 3TX4A 1AJ7H 5KOVC 2XLLA 2PKDA 1Q38A 3LZFL 4G9FA 3QJRB 4DO4A 1KIUA 3RIAK 2REGA 1OSZB 2CO2A 4HWNA 4JFDE 3CVCA 4CKVX 1IX2A 5IM7A 4MSWA 3ZR6A 3MSTA 3HUJE 4XNAA 4P2AA 5T5FL 2O6CA 4A6YA 2XIDA 2NY6C 1UZ8B 3C87A 4JJ5A 5D7JC 5CUSH 4Q89A 2Y36L 2IXQB 5HDBF 1T5KA 1QFWL 2BP5M 3RGHA 4ZFQA 5K9KA 4ZEDA 1TYRA 3F64A 2YXVA 3MRDB 1KCRL 1G9NC 1MRDL 2D0HA 3QHZH 3MRGB 3GMQB 1CDYA 1GYWA 1JVOA 3RVXD 1MIML 3DSNA 1JPST 2DI7A 4RK9A 3KMDA 4DGWC 1OD9A 3L1OH 1KGYE 1H3DA 3I75A 1AZNA 4Y1AE 5J1DA 5KYWA 1OB1A 2BNQE 5F1IA 2PWEA 4UV7L 1NOFA 1UT9A 2I60H 3SKMB 3C12A 3ARGA 1IZJA 4IOSD 1VLXA 2WBJC 43CAB 1QR4A 2EEFA 2C9SA 3VSUA 4H6DA 5FOJA 1E28A 1I1FA 5CZXC 3ZSSA 2FR4B 1NFAA 2AL4A 3U0TB 5GGUB 2Y0SA 3LPWA 3VFUB 1AL3A 4OF6A 4OLWL 2P80D 4TQEL 2NQ3A 1LBYA 3S4SG 3K46A 2FHFA 4X80L 4UM9B 3MAWA 4UCFA 4YHIA 4YQXH 4PP1D 2JCCE 2NSQA 2Y06H 4PTTB 1RJCA 2XWTA 1G1YA 4GKLA 1F45A 4N2FA 4NKMA 2NNAA 1JNLL 1JGEB 4P5RA 5JW3H 4GG6E 2W38A 3MBEA 1PEWA 1W2KT 5FHNA 1AR1B 3VWKC 2GG1A 4K0OA 3MZTA 2BP0B 4IYKA 3ZE0F 1GTKA 1WZ1L 3PWVA 3D6GA 1FH5L 1FP5A 3KL5A 4K5LA 5DFVC 5DGQA 5FHBL 2NCMA 1DJHA 1PF3A 2NY5C 3VFMB 4KKRA 5TP9B 3BSHA 1Y6KR 1EDQA 4FG6D 2HCZX 2A9BA 4RA3A 1RZ8A 1HHHA 2BIOA 3CFMA 5CD5D 4JG1L 3QG7L 3UP6A 3Q28A 5D1QD 5E2WL 5A7BA 1V3JA 3GHBL 4X2UA 3GYRA 5DHYA 1COBA 1TLMA 3QQDB 3V0IA 2Q8BL 3QI9B 4MDJB 5HHXL 1M3IA 4PJBB 2NR6D 2GQHA 1OGSA 2R1WA 3LXCA 3MOBL 2O6EA 4XCYA 3CVIH 5EBGA 3SE3A 3VM7A 8FABB 5LNGA 2E9IA 4IBLT 5K1JA 3EGDB 4NOFA 1W15A 4R9GA 1BFVL 1E27A 2G5BA 4LPTA 5DW8A 5JDSA 5KBNC 1U8KA 1MQIA 5IZZA 4PLOB 2Q10A 3OSVA 3ZKMD 1ADQA 3IOUA 4R0LA 2QKIC 1ZBMA 4G68B 2AEWA 3LH9A 5ESQB 1ZU0A 4NKOB 3BAXA 3ZK0A 4P59H 3OAZK 4GKSB 1BOYA 3QCVL 5DQJB 4APQA 4Q6IC 4JM4L 3H3PL 1M05B 2MNWA 4XBGB 3T77A 4QY8B 2DIEA 2VRKA 2QGBA 3QRFM 3ARDA 2QFRA 5ID0B 4UZSA 1I1CA 3SDYL 4CC0A 4NKQB 3ONMA 1T1WB 4R2GD 2PYFA 4HS6B 1KJVB 3VXPA 1L5TA 2EE9A 4NWDA 3D3VD 4K7PL 2BCKA 4HKXA 3RDTB 1M56B 1BP3B 4M6OH 2X2YA 2EADA 2CPCA 1SW2A 1IT9H 1ZOXA 3QW9A 2ZZWA 1OAXL 3OLEA 3DVIA 4BCXA 2IFFH 4J8RA 3ESNA 1Y0LA 2YZ8A 3UC0L 2A6KA 4IK6A 5E8NA 5HY9B 5D1ZB 4XNZB 1FVCA 4OZIE 1I7TA 5E5RB 2C34A 1LB9A 1F4AA 1WZAA 1FIGL 3IDIA 3RUGB 4UDTB 4WW2F 5CJQL 3WJLA 1JF6A 1AI1L 4RMTA 1DBJH 3M1BA 4HOWA 2FWOA 1Y3NA 4LK4A 2DV6A 2QL1A 3KPNA 1PGRB 5AAWC 2P9RA 2HUEA 1IKFL 5EU3B 4WJKB 4IO2A 4YSDA 5EFIA 2A38A 2OS7A 3U92A 4F5CE 4XTCQ 3P9LB 1XH2A 4W1TA 3Q8EA 3IAZA 5DHXB 3O3DB 3AFLA 2WQWA 3N50A 4KK9C 2CXKA 4J3WA 4UQ2A 4MQSB 4B7IA 2LOEA 4ZS7L 5J89A 4MQTB 4DEPB 4JO2L 1PJ9A 4X8CA 3WEBA 3K2DA 4GUPA 5D7IA 2ZOLA 4AXWA 5TK4A 5MEQB 5DMGC 4A04A 1HHIA 1IFRA 2NOOA 2O7IA 3DSFH 3QC5X 2WLHA 3DOHA 1SVBA 1GGTA 2AABH 1JPTH 1S46A 1BLFA 1K9TA 4ZYKB 3QDJA 2QVFB 1CFNB 4XNMA 2CLVA 1OZUA 4G8GB 1KXVC 4HK0A 3ULVH 1VEMA 5GHWH 1UB5A 1FQ9C 2QQLH 3WIHL 3KD4A 5FHAH 1XAUA 2IANE 2UXFA 2R69L 1L3WA 4HZAA 4HD5A 1L7TL 3H3BC 1NLDL 4JKMA 2XA5A 1MFEL 3QG6B 2FQFA 1EX0A 4HAFA 3KPRA 3DHJA 2BNRE 4M7LL 4AEEA 1IGFL 5DEFB 5TGBB 5GZOC 1DTZA 2QSXA 1CICD 4BBWA 1T6WA 3MLYL 5EYGA 1E2WA 4D3CL 4F8QA 4Y16C 3OJ2C 1Z6JT 4WCYL 2VD3A 3QXDA 5AOJA 5KS9A 2HPGA 2ZXWB 1MQDA 4Z0BL 4IBUA 4JB9H 2A73A 4UTCA 3MV8E 5DYFA 4ZPTA 2E6PA 1CYWA 2J55A 3HZ3A 4LLVA 4UQBA 4M7KL 2VDPL 2OX5A 3TEXA 3F7KA 4M8UA 4X9GA 1Z66A 2VT0A 4UZUA 4FZEH 3CXHJ 4YHML 4PFRA 1I8UA 1NLBL 1OM9A 3QULA 4EIBA 2OI9C 4D9RE 5FV1L 5A5XA 3EDFA 4D9QE 2KLSA 1NGYB 2HPOA 3Q1SH 1RJZA 2AJSH 2MCMA 5GGVH 4I1RA 2EDHA 4XP6L 5HGBB 3EH4B 1U8MA 3OB0H 3FB7B 4NYLA 4PJIA 3VXRE 2P1YA 4UMSA 3I2CH 5FB8B 2R4SH 1DLHA 1S9XB 4YMAA 5G5DB 3ZN6A 1AC6A 4AIXA 1I1AA 5FCSH 4N2HA 1FWXA 4LGSB 3KN8A 4M29A 4IIQA 3T2PA 3UPRB 3QUXD 3FHAA 5I2IB 3LQZA 5FW8A 4LCVA 4KKNA 1LJMA 5DVJA 1OGAE 1GY1A 4NQEB 3VSTA 3J7HA 3MNMA 1HXMA 5I30H 2Z8RA 1JZ6A 4KCCA 2ZCKH 1JVXA 5DMYA 3TTRA 3IMTA 4TQIA 5IFAH 2V6HA 1NPUA 5J6SA 4F8TA 4LPVA 3TN0B 5EC2B 1VAHA 3S0PA 2BHFA 2WB7A 4KKCD 4CADA 1HIML 1WITA 3D69B 2XDHA 4ZXBB 1ZA3A 1DVQA 1H3PL 2B2XL 4DXBA 3FUHA 2OTPA 4DP9X 3GXNA 3B56A 4X9TA 4CNIB 1P4UA 4BFOA 4EXKA 5JQ6H 1AANA 3DX6A 4RZKA 4Z3TA 2GHZA 4DOHE 1N26A 1M7UA 3BVVA 3FU9A 1CFQB 5ICYA 4XH2A 1D9VA 4JMNA 3SPJA 5FO7A 3V6FA 4S1RH 4R90L 2ADJB 5D2NA 4Z7NF 5HI4D 2J5LC 1LE9B 1DVFB 3EYFB 3L9RA 3TO2B 3GKWH 3MLWL 3T96B 3ZKLA 5L7XH 1KB5A 4G8IB 4HCWA 2NYYD 2FGWL 3K4AA 5BV7L 4OEVA 1Z9LA 3H9SA 1VIWA 3DTXB 4MXWH 4XO4A 3BRDA 1S7UA 4TXVB 3U72A 3MUHL 1AD0B 3PXJA 4JG5A 4YHNA 5AKSA 5ESVA 3RZWA 2WYKA 4E5XG 1CFSB 3Q3GA 2DWHA 5IWLA 1RK7A 2NX5D 4L1BA 1HQRB 1HE8A 2AEIT 4P04A 1UWEH 2DL9A 3OTTA 3P0GB 1GPOL 5E8OB 4H0WA 4OJFL 3MRRB 3VXNB 1OT1A 3QUYD 2F18A 3C6SB 3TJPA 4KROC 3BUPA 3SYAA 2WAQA 5L88L 5T33L 5AA1A 2WBWB 3FH8A 2F54A 1CXFA 3FU5A 1KIRA 4LSVL 3FO0L 1NMCC 4X6DE 4MS8C 2IAMB 5BZZA 1MVUB 4G6KL 4RSYA 1LO4L 4QR7A 4YHKH 5I73C 1G6VK 2YSSA 3O66A 3TLRA 4RA0C 5IMKA 3Q6GH 4JHWL 3VXSB 1KPRB 4PJEB 1FORH 1O6TA 2VDNH 4L4TA 3R7XA 3P77A 4C4BA 1GS8A 3V6BR 3ZTCC 1I7ZA 3Q25A 4OJDH 3H0TA 3DGDA 3KN7A 5D7SH 4OLXH 4RZCB 2CXGA 3NSDA 4MEVA 1JGVL 4KQ4L 5BUPA 1KZYA 3NRPA 3HC3H 4PJGE 3ZHNA 5JTYA 1CFTB 2K6WA 1MFBH 2BSRB 4G6MH 2NY1B 3QUFA 2CR6A 4JRLA 4MNHA 4MRBA 1KLUB 5AKTA 3S5LA 3T9VA 4IQHA 3HA0A 3O2WH 3UAFA 3V0JA 4Y5XC 4AIOA 1HI6A 3FFCA 4F15B 4C1UA 3T04D 2FZ3A 2NZ9D 1YN6B 1OTSC 5KSAD 2UXAA 3TV3H 3V9FA 3HB3B 4H4NA 1OY3B 1U8IB 4AE0A 5KZCB 3DELB 1QSFD 1DLFH 3DI2B 3M1CA 2C1PB 1BIIB 1FO0H 4LCWA 3NTCL 4H1LH 4OGYL 1YDPB 4U7SA 2VWEC 4KV5E 2IAAC 1RP8A 3QCUL 1AY1H 4ZFZB 3H6VA 3IXTA 5D2LB 4PFWA 5GS0H 1KYFA 3UTZA 2GHWB 3T0EA 1R9FA 5KYUA 4NM8H 3HI6L 4JRYE 4Q9QL 4AENA 4ESWA 3DBXA 3KM2A 5IJKA 3QT2A 3NOHA 2RMNA 4JO5A 5C0NC 3V5HB 1UXWA 1QFWI 4P5TD 3FFDB 2I7OA 1FPJA 3W39A 5IB5B 3BKCL 4KQ3L 4FORA 1FBDA 3X3GL 4AZ8A 3MQ9A 3KJ6L 1IUDA 1GZPB 1DSFH 3QK6A 1Z3RA 4FYTA 2RH0A 1KENL 3O6LH 3VFWA 4NAPA 1M2VA 4HSQA 4LFHG 1UJTA 4X4YB 3APCA 4FQXD 2V7HB 1O7TA 3PNWA 1AIZA 3JUYA 3MRJA 4D7BA 1BVZA 2DQDH 4EZMA 1A4KA 3A47A 2VMEA 3NJGA 4U1KA 1KBGH 4LF3B 4DUVA 2DIAA 2IGTA 3STBA 2Y7PA 2YD4A 5A6MA 4P23C 3T2LA 3QJFB 3B9DA 1XB6A 4TLSA 1XR9B 3F7VB 4U1HA 3E9XA 1NBQA 2J71A 1R46A 3EOAA 3MNDA 4M8QB 3KBFA 3O97A 3D0VA 1E30A 4OKVB 4LZKA 4X4KA 4BZ2L 5J0BA 2H2PD 3IOVA 3O2AA 4XMPL 3MJ7B 2ICCA 3VMOA 1BBDL 2AJVL 2R9HC 4Y4KA 3MMEB 2VW4A 2AJ3B 4AB6A 3WAFA 1J1NA 5DURB 1DCUA 2VXUL 5F1SA 5F1OB 5HDLA 3OKNA 3H42H 5A2BA 3U6RB 4D0DB 1NC2D 1CLVA 1LXMA 2FVNA 4JM2D 5LBVA 3Q05A 3KPLB 1LP9E 1HHKB 4NJAH 4Z7VB 3MRNA 3BIGA 4PGBA 5ERWA 5FIEA 1LK3H 3F12B 1T7XA 3RI5K 4X4ME 4PJXF 2AGJL 2EACA 4LCCA 5C0AD 2EDOA 2FEDD 1QFOA 1DTGA 4OLYH 2P3YA 5I1KH 3NFPB 4N6QA 5E94A 1PY9A 2P5WD 2IA4A 1SHXA 2Q2EB 5MEPA 1WFUA 2PABA 4ZMWA 3UEZA 3UYRH 1NPJA 1WFNA 4ZMNA 1T1XB 2VLRB 3DRTB 3SD5A 1U58B 2K4AA 1N04A 3BD3A 3I3BA 1AO7A 1FE8L 5I6XC 3WHXA 1KTCA 1UXMA 4MMZA 4C55A 1GHFH 2XXQA 5DD6B 1NGPH 1BCIA 3B2UC 4TRPH 5FM5M 5J3HC 4E9VA 5F7KC 2GJ6E 1MDP1 1NCHA 2BWQA 3VYPA 4LE8A 2H8PA 5IMLA 2C3XA 2I25N 3VGAB 3VH8G 4GSQA 3NSFA 3MXWH 3V5KB 3MROB 4GQQA 4WKMA 5C08B 3S8WA 2I07A 4THIA 1J5OL 4PG9B 4X5PA 1SEBA 1FLRH 3OR7B 3SDXA 3FQWA 3LS5L 4ZFOB 3DGCR 1NSNL 2FDBP 4GH7B 3DBSA 1INQA 1UGNA 2JWYA 1SBSL 3N55A 4K8RH 1NAMH 5TPAB 3PAUA 5F89B 3NPZB 1DP0A 5JHLA 5F3HB 4FX5A 4WF7A 3VRIA 4HP5A 1B4JL 3LV3B 1GZHC 4ZMVA 3GKZA 5AZEH 4P2OA 1EZSA 4XXCC 2X28A 4JPWL 3C5JA 1OP5K 3IO6A 5KSBF 1SUHA 4RLDA 4R3SB 1SN5A 5E1GA 1E7UA 1XF3B 2HJFA 2YN5A 1HX0A 43C9B 3CIAA 5IAIA 3HAEG 5HYQA 5F88A 5FKAA 2O5XL 5E9DD 2L5VA 3FAXA 4APXA 4OZ4A 1FPGA 1BAGA 3PFUA 1JYXA 2BIIA 4ODBD 1FFOA 2GJZB 2ZONA 1D7FA 1M7DB 2B59B 3WFDH 3N04A 1NCIA 3HI1A 4DCQB 1J10A 4EI5D 2YGVA 3EHSA 3SEWA 1WHPA 3F00A 3GBBA 3RAJL 3U25A 3MW0A 1P4LA 1VGEL 2BSBA 4KMLB 2MPAH 4NRZB 1KCKA 2ENYA 5KJ4A 1BZOA 5E8PB 2KUTA 4M5ZH 5AA3A 3DRQB 1CT8A 2WOBA 4GRLD 4M3KB 2RC9A 2Y1ZA 3K8KA 2WTRA 5CP7A 1NNPA 3WY3A 3FTXA 4PN6A 4QNPF 3IDMB 2VDKL 1UA6L 1E8XA 4I2XA 1KLGB 1EERB 1FRPA 3EXJA 4X0KA 5IQ9B 4NERA 1JZEA 4L9LC 2O6PA 3H9ZA 4JY5L 1JK8B 4FQLL 1OAYL 3HNVH 4Q9RL 3C9HA 2F0CA 1YZZA 3DDFA 2VLME 4MB5A 4FFZA 3RVVC 2X5PA 4ETYA 2Q3XA 2AS5M 4G8EA 3KCPA 4NWTL 5CJXC 4RMSA 4QLWA 3WIIL 1ETZB 3NJMA 3VRJA 1MJJB 1NCUA 1YYML 2EYRA 2P8MA 5GIRB 4YJZL 4IHBA 2EZ0C 1YNTF 4NQDE 3UTPE 3ECBB 4H0GA 3LDBB 5AVQB 1M42A 3GT6A 2Q20A 1A0QH 4A7GF 1NCOA 1KEML 1IBBA 4X9IA 3FCTA 4LOUC 4FN0A 4F7TA 3QFJE 2W91A 3AG1B 3ARQA 5E23A 4W9CC 4R7DB 4G8AC 3K0VA 5TTRA 1ZHBB 4J2XA 4Y4HA 5DWUH 1OCZB 2PW1B 3IFLL 4FLSA 3SO3C 1IMEA 4NSKA 2D8KA 4ODSH 4P2CG 3UK4A 1IAIH 2IH8A 4MA8L 3DYPA 3CQPA 2C9AA 3FYEB 4X6EB 1WDNA 1J1PH 2RQEA 1U3HB 5LVEA 4U6YA 3ZTJH 2ZJSL 2AV1B 5F7MC 2XYCA 3CVHL 4ZOBA 5T5NF 4WO4B 5D55A 2OSXA 1NV5A 3R6UA 2MRYA 3UP9A 2VQ4A 4O02L 3IJSB 2CO6A 3IVKA 3V2AR 4N1HB 3CHSA 2UZXA 3DGGB 4L4VB 4RAUA 4Y5YA 1QWNA 1WGOA 3I84A 3V0DA 3QORB 3QUZA 3SQRA 4ZPVB 3KDMA 4NO2B 2KZKA 5FCUH 4JN1H 2W07B 4G9FD 5IGXH 2W9DH 1XH0A 3RPIA 4AKQA 1L9OA 1XB8A 2F8IA 3EJYC 4AOFA 2F1AA 5AG8A 1NL0H 3MRHB 2NY4D 4M48H 1VACB 3G5VB 3O11B 2VJ0A 3LKOA 3ZRCC 1T6BX 3PQYE 4YXLH 4LONB 2VDOH 3MFFA 2QR0A 4F7MB 1VFBA 3Q2LA 1FVDA 2EC9U 3GRBA 3B2VH 2K7PA 5FWRA 2PWHA 2WLIB 4LPYA 4JZNA 5TQ2L 3HZKB 4L29A 4WI0A 4MCMA 4OLEA 4A6YL 4N8GA 1Q72H 4RRPM 3SDDC 3COOA 4XX1G 3CWGA 5GGVY 1KCWA 4HGWA 3VD1A 2OLDA 2YJLA 1X5MA 1GZQA 4MRCA 2Z22A 3ESUF 2YD2A 2ZX6A 3OKKB 3WFHA 2OP4L 4X9BA 3LIZL 5J1SC 1KGUA 3QUKA 1T6VN 4M5YL 5B3JE 1KPUB 1MLBB 1PBYA 3OHMB 5HGDB 4OI7A 4CW1B 5AE4A 4N5ED 1QULA 1XSJA 4ODWA 1MCIA 4PJCE 4PS4H 2A1WH 1ZGLM 2IWKA 2LQRA 4NUGH 1WCQA 3V0VB 3ARGD 4Z3HA 4QRPA 3FO9B 2F5BL 2WYTA 4P2QE 4B9PA 3HEIB 1NH8A 5TDNB 3R1GH 4B50A 2VLJA 3IGKA 3VE0B 1YEJH 1WZKA 2OMXA 1AXSA 4L8BA 3WSQL 4ZO9A 4UT9H 5DRNA 2BO0A 2XXFA 2XTLA 2L7QA 4U2ZA 3CZSA 4GSDH 3UJIH 1HSBA 5GGTH 2BIQA 4QUOA 3CXDH 3CK0L 4U49A 3C5ZC 3CFCL 4TQPA 3RI5F 2JK5A 4DIXA 4WKZB 4IBWA 1HCFX 2P4AB 2VMDA 1OO2A 2HXAA 1U4FA 1MW2A 4PG2C 2VDRH 2OMTA 4OLVL 3BPLB 2K6YA 3VXMB 3BVNB 4KYSA 4GYBA 4P57B 4P4KB 3VI3F 3RYDA 4YO0A 2BVPA 5DI8A 4HHWA 1XIWD 4GT7A 2DLGA 5EZJB 1S7TA 4I9DA 3JV6A 1SYSB 4YSCA 4A39A 2OZZA 3HG1A 3MV7B 3MX0B 3OXRB 1YLBB 5HYEA 4Y4FA 2O26U 3DOIA 3ATBA 2JMRA 5EU4B 1T0NB 3CSTA 4P3DA 1TIUA 4H8PA 5E6RB 2O1AA 4NN5B 3ASNB 1PVHA 4MKMA 2E74C 4GBXA 4GX6A 4J4PA 2KR0A 2X9YA 3PPOA 2Q87A 3NVQA 2BRRH 1Z9MA 4N2GA 1L9RA 1KCSH 2B3IA 2MHAA 4DKFH 4G80A 3FV1A 4TUJA 3L3OB 1D5XB 4Z7NB 3OPZH 1ZE3H 1NGQH 2EH7H 4LHUA 2O61A 1A9BA 2Q2AA 3IETB 1BWWA 1WD8A 3FSAA 3NA4A 3CFUA 1A8EA 4KKPA 4Z3FA 3PIQB 4QFPA 1XGUB 1EBAA 2JE8A 2VMCA 3EGXA 1NCBL 3NZSA 2UVEA 3ME0A 5E2VH 5C2UB 2BMKB 1JS4A 2VKWA 4RGNC 3MOAH 4APQD 2YWZA 3C4MA 5C0FA 2VISA 1TJGL 4KUCF 3IFOB 4HXVA 3KYKH 3DPBA 2X4RB 1OTTC 1ADQL 4PJ5E 3UZEC 2Z7WA 1E5BA 1HSAA 4I9XA 2BZ7A 4PV1C 4PJAA 3RVUC 5D71H 2FX9H 4GO8A 3VACA 5EORH 5D6DC 4BQ8A 4ANWA 2I7SA 4JDVB 4ODUA 4XIGQ 1PQZB 2XHDA 3SQBB 3UGWA 4HCRH 3QWOA 3ARSA 1JTOA 4OTXL 2OW7A 5DO2D 3GSVA 1ZJAA 5E56A 4G6AC 1XVSA 3D08A 3QJXA 2HFFA 4DJMA 1JNNH 2AFNA 4KPTA 4E41B 3V0AC 4HS8H 3D4GA 1DANU 4P9HC 4PHXA 4GKZA 4NG7A 1HC1A 1ZTXL 3MRQA 1AZRA 4QCIA 1OSEA 3P4MB 1XF5B 4N0UB 4OVVA 1KDIA 3RX9A 5LXVA 4DAGH 3UGEA 2RFXA 1WO2A 4UBDC 1HZHL 3GZPA 3ZMNA 1RZFL 3RWHB 2X70B 4YEFA 1B3HA 1OCCB 1ZVHA 3EJJX 1H5BC 3FQUB 5F3BA 1JERA 1OWWA 2G5UA 3G5WA 4TPRL 5E4IA 5JHBA 5I56B 5HI3C 4AVHA 2XICA 3RGVA 2I26N 4HQQL 2KPNA 1SLVA 5C7XH 3MKGA 3LNEA 3MNZB 4UNVA 2OMZA 5JLZA 3IWVA 3B8BA 5EEXA 3O9PA 1S9VB 3FSWA 3GUTB 4I0CC 5I0XA 3ESMA 4XN7A 1ZV5A 4LAQH 1HKFA 2YAPA 4GIAA 4GI9A 1KA1A 1UTBA 1H8SA 4OGXH 4N8VA 4RIRB 1SXAA 3MDJA 3B50A 4KDTC 1XEDA 4G1MA 2CU9A 4OT1L 3TVMC 2V5RA 1X9QA 4MZ2A 3S98A 5JPMC 2PCYA 1L4IA 2MTPA 3KPRD 1ORSA 2BP8A 2KBGA 1HQ4A 2HRGA 4KXZI 1HNFA 3GJFA 3A67L 4LPWA 4PV8B 2C9RA 4TVUA 1XGQA 4HWZA 2FLRT 5IROC 1P6AB 3PV0E 4L37B 4F3SA 5AOLA 3SPVA 4LDLB 4BLAA 3GMMB 4N28A 4QHUA 4JFXB 2CO4A 2GUYA 4WDIA 5FR3A 1NEZG 3Q06A 4HHGA 1RUKL 1OIOA 3D2UB 3TCGA 1DJWA 3T2QA 2W94A 1NINA 3FRPB 3SGJC 3WS6A 4M9OA 3RNQB 1ZKBA 3N85H 3IMBA 3DURB 3GLDA 4TS6A 4M93B 4QF1A 1HH9B 4N15A 1AZVA 2VWEE 4YHZH 3SDCD 1B3EA 3OO8A 5HHNB 1EU8A 1I1AD 4ZW5A 4E0RA 2A9MH 4P3CL 4JPQA 5L9DL 4JVWA 1F41A 3IGLA 5DJZA 1OT4A 2HG5A 5IP4A 1OMPA 4PJXB 2Z35B 4DZ8B 4GIPD 3EJQA 4RESB 4N2DA 1XFPA 5DQDL 3I85A 1POY1 1XAKA 2OK2A 5K9QI 3ES6A 2CNZA 2VOZA 4I8DA 5F6IC 4YHLH 5BO0D 3BISA 2JIXB 1YEFH 3FU3A 5FHMA 2WVVB 1LBZA 2EUWA 1VENA 4K3JH 2JB6B 4MZRA 4TOYH 1DE4B 1QUNB 2N56A 1H3GA 2XX7A 1KTRL 4FLHA 4NO0B 1LILA 2VITB 4P4RB 1JFQL 1J86A 3C36A 4JB7A 5H8FA 4WEBL 1MFVA 1NWPA 2A7BA 4IO6A 3MU3A 4N2AA 1IZKA 4Z1PA 3VW3H 2DLEA 3QJQB 2NNRA 5EU6B 4EDWH 2NW3B 5CXPA 3O4OB 1CDBA 1QP1A 3L6FA 3QNZA 3QQ3A 4L8SB 3FTVA 5FK9B 1S6NA 3B6WA 1J1XH 3LUZA 1IC5L 2VERN 2DQGH 3CE1A 3GIZH 2Z64C 1K9ZA 5DD1H 4IO4A 4JN2A 5I8OH 5I71B 2X6VA 5F1NB 3H9SD 1DQLL 5JUEH 4M6NL 4I3SH 3VFRA 3RQTA 4NQCA 3PGDA 3TCXA 4KFMA 2QMKA 2ZE0A 3DKHA 2R23A 3U9UB 1X5XA 4DLDA 2E76C 1T66D 1KB5L 2BWDA 1TJXA 2HFEB 1FSKB 3RKDC 2XKNA 4WRLA 4QRAA 3MBXH 1X4ZA 4ONHA 5I5MA 1JW1A 3VTAA 2EEAA 5KSBB 5EIQA 4ZMPA 3QO1B 1LEGB 4FC3E 4MMXC 4U2YA 5IBTH 4DP8X 5FF6A 1LFIA 4XWGL 2ENSA 1J0HA 3HC0B 2EUVA 5C0JA 2WO4A 3H2QA 2AXHA 3OHXB 4FRWA 4L4TD 4ZEIA 1WQVT 2FB4H 3BFOA 3OKEA 3WS3A 1NPNA 2X2IA 3EJZD 4LESA 1Z0NA 4F2MB 2YWYA 2P44B 2RALA 3L16A 1WBXA 5IB3B 3EHTA 1B0GB 4A7SA 5K39B 1J9SA 1Z1WA 4Z9KB 3L1EA 3CH8A 1SF3A 1LL1A 4JDEA 4P5KB 1MXWA 2OWZA 4KK5C 4F33A 5ISZA 4AYSA 3RHWF 3EO1A 2B1AH 3I9AA 1GMEA 4B27A 3O4LE 1XV8A 4UOW0 4MX7B 1G9NH 3BWAB 5HHMB 3G3LA 1B2HA 2YD1A 2BZCA 2W60B 3ZUNC 3N06B 2ONSA 1DBKH 1U4EA 2FYYA 3U30B 4EI6A 5BVJA 3RT8A 4IKIA 2FUQA 1P1OA 2H32B 1Q9WA 2E8ZA 4Y9EA 5FGBC 5F7YC 4DPAX 1BQLL 3CHPA 3VDAA 4PLJC 4QRSA 1U92A 2B1HH 3WN5A 3LSFB 4LCWD 4CVXA 4Q97A 2FHCA 3WO3B 1AKJB 4HGKC 5FUZL 1G1OA 5LAXA 3O6KH 3EJCA 1IO4C 3K6IA 5AA2B 4FXKA 4NO3B 4H0IA 4PVMA 4AV0A 1PB8A 4LKXB 3T0ED 2VR4A 1BV8A 4JKPH 3UIYA 3W9DB 4DZBA 1N18A 2ZWNA 3MCG1 1RQ5A 1ASQA 3U0PB 4M43H 3ML8A 1YNTB 1NMAH 3OAWA 1ES0A 1BAFL 5DFAA 2XV6B 1OSZA 2X6MA 4A37A 4MLQA 1TETL 3MFGB 1K8IB 1NV2A 3FJ7A 4C1TA 1OLCA 1ZHKB 1WIOA 2QV4A 1MCSA 1UUNA 3ZDYF 3ZRFC 4LLDB 1UZ8A 1QATA 3FVOA 1EJFA 1GYCA 4MTMA 4X4XA 5EZPA 1ICTA 4DVRH 4Z7UF 4C4UA 1AQHA 3L3JB 3QZWB 1FPIA 4A63A 1LK2B 1N8ZB 4UYPA 3CN0A 2LTQC 5K59E 2NY5H 3OQ3B 3H4FA 3GLBA 2A3TA 3EDJA 2AF2A 2X1QA 1FNSL 4AYMC 2F19L 4KJWC 2DQTH 2KLRA 4Y4KD 4QRZA 3H06B 1KPVA 3JT0A 1I8MB 1JMXA 2VZ3A 4GSUA 3AMKA 2DQHH 3H6AA 1A4BA 1JPSH 1UURA 3CUPA 4NX1A 4WUUB 5A43C 4Z7WB 4JVDA 2DM4A 4L05A 1QNZL 2PXYC 3FQRA 3F7YB 4X7FC 4MA1C 43CAA 1Z9SB 4TL4A 3O41B 5JHDB 4LP5A 5I19H 3WHE1 4IMLB 5AW7B 4LOFA 2CGYA 2FR4A 1UWXH 2G5RA 2N7AA 4PWKA 1ZEAL 3SKOA 5I16B 5AA4B 2MNJB 1E4XL 3W11C 3P3UA 4OUUA 1ECYA 1VGKB 4H40A 3P4OB 4R84A 2V17H 3NIFF 4N85A 4J3OG 2DLTA 1Q9LB 4E9WA 2CSPA 1E9QB 3ILTB 2IJ0C 1XC1A 3SGEI 3UPAA 1JGEA 2WBXA 2CUHA 2DDQH 1AO7D 5DFWH 1BQKA 4D2NA 3K00A 4MMPA 5DXWA 3RURA 4F39A