3D4CA

Zp-n domain of mammalian sperm receptor zp3 (crystal form i)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
470
structure length
470
Chain Sequence
EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Cell adhesion
molecule keywords Maltose-binding periplasmic protein, LINKER, Zona pellucida
total genus 136
structure length 470
sequence length 470
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d4cA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4cA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4cA01
1LCFA 4GF8A 1UTBB 4RPNA 4N6PA 3MVWA 1YAEA 1GV8A 2O68A 4EUOA 2XX9A 3TTRA 4XTCQ 3MJNA 4RPOA 4DIGA 3GBBA 4JBZA 4EF2A 2OBGA 4LQ2A 1VSOA 3RT6B 5AA2B 3UGWA 4HCYA 3MZ9A 1B0LA 3LSLA 3MPKA 3T22A 4QSEA 3OSRA 2GRVA 4PQJA 3O2AA 5DTBA 5CMMA 4YU0A 1MRPA 3MUQA 2A5SA 1LGBC 2XXHA 3RTWB 5ICTA 4EQBA 4UA8A 1Y4TA 2VHAA 3PPPA 3MBPA 3THIA 3LC8A 3B6TA 3H6TA 1R6ZA 1MS7A 4XKNA 3U72A 1ZJLA 2OWSA 2V25A 3OMBA 3IORA 1URDA 5AE4A 2X7QA 1MY1A 1QKAA 5H8FA 2XXUA 3I6VA 4GL8A 1CB6A 3FXQA 1ZU0A 2I0BA 1PDAA 4R75A 1MPCA 3RTFB 2D3IA 3C34A 1J1NA 1D9YA 2DSFA 3G3KA 3N26A 4K3FA 5DEXA 4E0WA 3V8XB 4EXLA 1DTZA 4F2OA 5I84A 1B4HA 3O6GA 5CRYA 1H3DA 1H76A 2UYFA 4EQ9A 1UTBA 4IO4A 4ELPA 4ZZAA 3W9VA 2F97A 2Q2CA 1UIVA 1FCKA 3LSXA 4LZ7A 4OFOA 5IAIA 2PYYA 2Y7KA 2O7IA 4O3BA 5I56A 3LSFB 1EU8A 3CG3A 1SQYA 1Y1MA 2E1SA 5B70A 2HCAA 3PGFA 4NF6A 2GH9A 4PFUA 5KCJA 4Q0CA 3WAEA 4BDQA 1UTHB 1OLCA 1MPBA 3EHUA 1ZTYA 4RA1A 4ZE8A 1SDXA 4OEUA 1P99A 3PD8A 1NMUA 3TAJA 2P1SA 1O7TA 4GLIA 2Q2AA 4JWOA 3OD7A 1URSA 1JW1A 4M4GA 3RNNA 5JEIA 1T0KA 2QMWA 1EZOA 1GVCA 4R72A 3TODA 3OENA 3HV1A 3QIMA 3QUJA 3RUMA 2HEUA 3FASA 3QUFA 1IQ7A 4KPTA 4NF4B 4TLLB 1IXGA 4YB7A 2UVGA 3Q27A 2F36A 4I1DA 3MQ9A 5M2VA 3ZKLA 3TTNA 2X26A 3GZGA 3MAMA 2ZMBA 3PUZE 1MM7A 4GVOA 1Y3PA 3B7DA 1H44A 2ESNA 3H3GA 4OHNA 4OEVA 1PB8A 2DE3A 4YAHX 4GD5A 4IO3A 4YICA 4BDLA 4X9TA 3S9LC 3PUYE 2ZYKA 1AL3A 1IXIA 3Q28A 4H67A 1XVYA 4PE5B 1SW1A 4R9GA 5TPAB 3TELA 3PD9A 3V89B 2Y7PA 3IB2A 1N76A 3FZVA 5DEXB 3T9UA 3RGYA 1JW5A 3VLUA 4BDOA 1B3GA 4XIGQ 2RKMA 3S4UA 1FTLA 3CG1A 5H8FB 1CE2A 4WXJA 1FTJA 3USDA 5H8SA 3ECRA 1GGGA 4POXA 1JEUA 5I57B 4L17A 2QS1A 5CBRA 3VDFA 3R7XA 2I6EA 4F1VA 1N04A 3NK4A 4WEPA 4GL0A 2XXYA 3M3LA 1Y3NA 1FQDA 1SVXB 3M8UA 1M5DA 1MH4A 5JK4A 3EN3A 3PMWA 3MPLA 3O97A 4OYVA 4H0WA 1MQIA 1NH8A 1URGA 4P0IA 2NXOA 1R9QA 2P0SA 4NF6B 5I2KA 1JNFA 3DP8A 3EQ1A 3H6VA 2NVUB 1H45A 1IITA 3OO8A 1ELJA 3C36A 3KN3A 1PB7A 4YMBA 1SYHA 2W7YA 3CR9A 4EXKA 1JEVA 4AB6A 3H03A 4H5FA 1I6QA 3RQTA 4PFYA 5DVJA 4H65A 1N0TA 1N3XA 2F35A 5CC2A 3FIRA 4RY1A 3PUVE 4G8MA 1N7WA 1SI1A 2FNCA 2PMSA 1BLFA 3KJTA 1Y9UA 5FHOA 3KBRA 5TP9A 3K2DA 2RCAA 2DE2A 4R2BA 5TP9B 3RLFE 3G3FA 5I58A 1FQAA 3SKPA 4DCXA 3FJ7A 1MQDA 4KD5A 3PPOA 1LBCA 3EHSA 2ABHA 2HZLA 2V3UA 2OZZA 2THIA 4H8IA 4NWDA 1QUKA 3DELB 4BDRA 4ESWA 4MF3A 3SDFA 3MVXA 4ZEKA 1ZMGA 2F8DA 4KFQA 1YCJA 2RINA 4IO7A 4NEDA 2I0CA 3H06B 1MPDA 3EHTA 1MQHA 2B3BA 1MY3A 1OMPA 1XS5A 3S9EA 1M5FA 1B0HA 4KYEA 3K6WA 2G29A 4TOZA 1ZLQA 3HHGA 1JQFA 3VXBA 4NMYA 2ZNSA 4ND9A 2V3QA 2DXRA 3VVEA 3I3VA 3O6IA 1LAGE 3TQWA 3U1OA 4YMAA 5LOMA 4NF4A 4U1OA 3SEYA 1DPEA 1Q1KA 1NKXA 4NE4A 4YKKA 4OETA 1PC3A 3QK6A 4H1XA 2R6GE 4RNSA 4WKMA 4QFLA 3SETA 3T9HB 3TKDA 2XXPA 2BJJX 2VGQA 4GFRA 4U21A 4ZE9A 2QL3A 5I58B 2HAVA 2QS3A 1A54A 2Y84A 2AL4A 4ZS9A 1N3WA 3A09A 4ZECA 3QSLA 3PU5A 4H6DA 1B52A 3IJOB 3TUSA 1B3FA 1PB9A 1XC1A 4U2RA 3PPRA 2DWIA 4JSOA 1B5IA 4KI0E 4TLMB 4YKIA 5CI5A 2ANJA 1FW0A 3LSWA 1B51A 1R1NA 3U93A 2I4BA 3KOTA 3W15C 3S9NC 4RK2A 3TYHA 2ZNUA 3OO9A 1ANFA 1JVXA 2RCBA 4KCCA 1QKBA 4N07A 2NUVA 4ZEBA 3IAZA 1SYIA 3PMXA 1MXVA 4FATA 3GBAA 1B05A 1MXWA 3IK6B 4IGRA 4R6YA 4X48A 1USYH 3FATA 4LATA 4LZ8A 5JTYB 4QFNA 2LAOA 3FVGA 5HPQA 4KHZE 5L8DA 1MDQA 1MXXA 3VVDA 3E4RA 3GXAA 4G68C 3TCHA 3U94A 3PUXE 1MQGA 2I4CA 4MH5A 1US4A 4G68A 2F7BA 2OCUA 2G93A 2ZYMA 3DLNA 1B6HA 4G68B 3HPIA 3MW0A 3T9VA 5IKBA 4E0XA 4EDPA 5H8HA 4U4XA 3UA8A 3VV5A 4HCWA 5HM4B 1SW4A 2Z8DA 4R9FA 1UTHA 4QFPA 1B7UA 1FQCA 4FJPA 3A3UA 3EPEA 3NK3A 1M5EA 4F31B 1POY1 3KFMA 4ONYA 3UP9A 1OQGA 4F2QA 1DMBA 1FTOA 1QVSA 1Q35A 2B65A 3E3KA 4KYDA 4O3AA 3R26A 4POWA 1O64A 4DXCA 3VFJA 1MY4A 2ONSA 3M3FA 4HW8A 2XXTA 1NNKA 4WEDA 3KSJA 2PT1A 3IR1A 1WVJA 3PUWE 4MLVA 4P11A 4QSCA 3JYRA 5I59B 3H6UA 2CZLA 3QYTA 3U8QA 3CI8A 1OIBA 3FVNA 2XXXA 2VD3A 4KQPA 1L5TA 1DSNA 1BP5A 1VFEA 2Q88A 4F3BA 2I49A 1YPNA 3N94A 1H43A 1B3LA 1QJMA 1TXFA 2F7CA 2F5XA 2GHAA 1SBPA 2OLBA 2Z8FA 4IY5A 4QFOA 3VLWA 3OEMA 1TFDA 2XD2A 3UN6A 3FXUA 1I6AA 2DOJA 5H8NA 5CMCA 4JWXA 1EH3A 4IO2A 5B7DA 1POTA 3B6QA 4XXUA 3FXRA 1HSJA 1DTGA 2GFEA 1LAXA 5H8HB 5BUUA 4GXSB 3F11A 1II5A 4BDMA 1LBBA 4LONB 3IOWA 1BKAA 4YB6A 4QSDA 3MZBA 3SEWA 2WKYA 5DVFA 5ITPA 2OJTA 1S7YA 3FJMA 4LQ5A 4F39A 4EF1A 4G77A 1UQWA 1LCTA 4IY6A 1AMFA 1LAHE 3HO7A 5KCJB 4ELOA 5AA3A 2O1MA 3FGSA 3K02A 3DP6A 1A99A 1FQBA 2ONRA 3FV2A 2PX1A 2Q89A 1IUDA 4JDFA 1Y4CA 2HQ0A 1Z7ME 2I48A 4XKRA 5BWJA 2Z8EA 1RYOA 2HAUA 4KR5A 4F3SA 4OFJA 4G4PA 5AA1A 3KN7A 1B1XA 4YZZA 3N6UA 4DXBA 4FEDA 2PVUA 3SEVA 3K4UA 4QF9A 1XVXA 3C9HA 1JVYA 1HSEA 1QUJA 1KWHA 1MDP1 1MY0A 3Q26A 3H6WA 3TCFA 4M1VA 4NF8B 5I2NA 2UXAA 3DP4A 3R6UA 3N6TA 1A40A 3TZAA 3Q29A 2Q9TA 4RXLA 3BFTA 1FQEA 4R6HA 1SI0A 2R9JA 5ISUA 1XHYA 3O66A 1D4NA 1I6BA 4FEBA 4I62A 4EQ7A 1PBQA 2H9BA 2ZYOA 4KYSA 1P1QA 4MLQA 5EHMA 3TDJA 3SERA 1B7HA 2H4IA 1P1WA 1VE4A 4R6KA 4PFTA 1PEBA 5EYFA 4ZEFA 1ZIUA 4KCDA 1JW4A 1FTKA 1MXYA 3VE1B 5FHNA 3TTMA 1AH5A 3IB1A 3LR1A 4H8JA 2QMXA 3JV9A 3E13X 3GLBA 1QULA 4GWOA 3S2VA 1B2HA 3VXCA 1LB8A 1S9TA 3CFLA 4ISUA 5F7VA 4O3CA 2NOOA 2Y7IA 3V5AA 2QJEA 4ELQA 2NWJA 4Q8RA 1MM6A 5K2XA 4U4SA 1ATGA 2QSXA 4ECFA 3MP8A 4LP2B 4RK9A 1B4ZA 2P2AA 4ZDMA 1S50A 4LZ5A 1D9VA 2I3VA 3CSBA 4LUBA 1GTKA 2UYEA 3ILUB 1SW2A 3K1PA 3RT8A 5EHSA 3IOTA 3FD3A 5AA4A 1AOVA 3K1MA 1P1NA 4C1TA 1D3KA 5CBSA 2ONKE 3KG2A 5I59A 5JTYA 1GR2A 3CRBA 2HXWA 3CVGA 3ILTB 4IO5A 4GOTA 3TCGA 3TEPA 2R71A 3PPNA 2ZXTA 3RN8A 3ONMA 3FVOA 2YLNA 2OWTA 4OFLA 1ZBMA 3P7IA 4IGTA 3TPAA 4FIMA 1AIVA 1N7XA 3K6XA 3ODBA 4GXAA 1P1UA 3KJ7A 3G3IA 4F18A 1LFHA 1LLSA 1F9BA 2DP8A 2REGA 4YKPA 1VR5A 4BDNA 1TWYA 2A5TB 2O51A 2I58A 2V3TA 3JZJA 2B3FA 3K00A 4H5GA 4HS7A 2XD3A 2YPNA 3W9WA 4DCYA 4XKPA 5J1DA 5ELVA 1MH3A 3CIJA 4DLDA 3DM0A 5CMBA 5H8QB 5CM6A 1OLAA 1RKMA 2QPQA 1Z7NE 2HFBA 3KN8A 3BKIB 4G2ZA 4MFIA 3VLVA 2VP1A 4C1UA 5FHMA 3AXFA 1B58A 1IZ1A 5KZTA 5HBCA 3G3GA 3HHFA 2M8CA 3IL1B 3HSTA 3ZKKA 3OO7A 1B9JA 1WODA 2E0SA 1B7ZA 1MG1A 3L6GA 3CFXA 3SEUA 1LAFE 3K6VA 2Y7RA 3V83A 2VOZA 2AYSA 3I5OA 1JETA 4OQOA 1IEJA 3K1NA 3M3KA 1SW5A 1A55A 5H8NB 2DVZA 2GHBA 1XOCA 3G7WA 2REJA 3OEKA 3KGCA 3SEXA 3IOUA 4AB5A 1M5BA 1MY2A 3IO6A 4JXIA 4U1ZA 1USYE 3OELA 5DVIA 2Q8JA 3EF7A 2HZKA 5L9SA 2X7PA 4DZ1A 1P1OA 4ESXA 4FE8A 1NH7A 5I2KB 2D5WA 1NNPA 2DYXA 3CFZA 3TTLA 3K01A 3O9PA 3Q25A 1OVTA 3QXMA 3C33A 4BLAA 2Z22A 2O69A 3C32A 1O63A 2QS4A 2O1LA 3QAXA 3BBRA 5F1QA 5ICQA 2F6PA 5KDTA 2ZNTA 4GQOA 3UIFA 1IIWA 4OERA 3C4MA 2UVHA 1BIYA 2H99A 4G8HA 2XX7A 1DPPA 1EZ9A 1B5JA 2XXIA 2H98A 2QS2A 4OZ9A 4ZZEA 3TFLA 3UK4A 2Z23A 4AQ4A 1B32A 1DOTA 2RC7A 4DE8A 4RJZA 4OVJA 3D4GA 1B3EA 4F1UA 2FYIA 3WAFA 4G8NA 2AIXA 5K2YA 4X1DA 2DVCA 1MXUA 1A8FA 3KEIA 3LUYA 3BFUA 4GRKA 3A3CA 4OWDA 3T66A 2XX8A 4OXVA 4Q5TA 3ZSFA 3MC2A 2CMOA 4F22A 4QHQA 1IXCA 1OVBA 4F29A 1MQJA 1MXZA 3OXNA 5TU0A 1Y20A 2XXQA 2F6GA 5FTIA 3MZ1A 4FECA 2V93A 2RC8A 2F78A 3FVKA 3S9MC 2QRYA 2ALUA 4JWYA 4QRZA 3RPWA 3SESA 4PETA 5KDTB 5I56B 1LSTA 2OK2A 3TMGA 3IX1A 2AL5A 3PMVA 1B40A 1NNTA 5FTHA 4DDDA 2PBWA 3IOVA 3TQLA 1TT1A 2FA7A 3FJGA 4I8CA 1UIUA 2XXWA 4OESA 4RYAA 4IB2A 4ELRA 4UACA 3H7MA 2O84X 5CMKA 3LBSA 3IB0A 1A7LA 1BTJA 4YKJA 4X1BA 2H5YA 2H25A 4NF5B 4LA9A 4FORA 3D4CA 4THIA 5AA4B 1RYXA 2RF1A 4XKQA 2XHDA 1OQHA 1NFTA 1LB9A 1QUIA 4MBPA 3OSQA 5I57A 3B6WA 4JB7A 2UVIA 4Z0IA 2DWHA 1R9LA 4I9DA 4Z7EA 4U23A 1HSLA 1IXHA 3G3HA 4U22A 4R2FA 1QW0A 4F3GA 1B3HA 4ZEIA 1ZKBA 2DWAA 4NF8A 1B1HA 3O28A 5DYHA 3C31A 1A8EA 4TQUQ 3HCQA 4NTLA 1US5A 4P0GA 2XXRA 1M5CA 2DS9A 3HN0A 1Y3QA 1LFGA 3K0VA 3OOAA 5DT6A 3MWBA 4R73A 5A5XB 4Q30B 5AA2A 3N5LA 5H8QA 4C0RA 4OMBA 1WDNA 4QFKA 5ITOA 5TPAA 4F19A 4GIZA 2UVJA 2V84A 2D21A 1VFDA 2A5TA 2PT2A 2XXVA 3MVZA 2DWJA 3E9XA 3T9XB 3VVFA 4F3PA 5A5XA 2F34A 3IJXB 2Y7WA 2DXYA 4N13A 3K6UA 3MVYA 2O7UA 3T93B 3MP6A 3O29A 4HTGA 4YB5A 3IO4A 3MP1A 2IEEA 4PP0A 3H4ZA 4LVQA 2ZYNA 5I2NB 2RC9A 1EZPA 1NNFA 2I3WA 3L6HA 1B5HA 3KOSA 3RY3A 2F7AA 1FTMA 1Y1ZA 2O6AA 3G3JA 3KSXA 3OO6A 2VD2A 5L9MA 2DE4A 3TTKA 5AA2D 1TFAA 4PFWA 1NL5A 1I69A 3KZGA 4R74A 3O6HA 3C35A 3CSGA 4NF5A 1SD3A 3UORA 1LFIA 4JSDA 2IA4A 2KLFA 3FV1A 4NWCA 4F1YA 4FAJA 4ZEDA 4OENA 2YJPA 3PV0E 4IO6A 4OTEA 3T96B 1B46A 3U92A 1FQFA 1N84A 5L9OA 1YTVA 2DQVA 3PPQA 3ZS6A 1PBPA 3FUZA 4DXUA 1XT8A
chains in the Genus database with same CATH superfamily
2ZD0A 1ACXA 3OR7A 3S4SB 2OKMA 3R7QA 2XX9A 1PKQE 3KPQB 1IJNA 3LPOA 2HUHA 3IFOB 1BFTA 1FL5A 3ATEA 5DA4A 1SDYA 1DK4A 3VI4A 1AG6A 3NJVA 2BC4B 4Z7VB 5I26A 3IDIA 4CN1A 1QSEA 3QUYB 4K9JA 1WZLA 3REWA 4YU0A 3GIZH 4D9RE 1FYTD 3U1QA 3NFNB 4OCSH 1SFHA 2BFVL 4D0BB 5HJ3B 3DIVA 5LQBL 2B4MA 3QJOA 4XX5A 3FQTB 4OJYA 3CX2A 2D4FA 1MVYA 1UA3A 3IJ8A 4EZJA 1DANU 2GJ6B 2KQZA 3F12A 1X9RA 4R75A 2FX9L 2KLTA 3BP5A 5E8EB 1EO8L 3S3BB 3MJWA 4MMZB 1HXYA 5C0BD 3U82B 4AWJC 1ZK5A 1YEJL 1HSAB 2R56H 2WW8A 1EUUA 2WJ5A 1BIIA 5BZXA 4Q9RH 2Y7KA 5IZ1A 2NY6D 2QR0B 3ZTDC 2I07B 4AV4A 4AQ1B 3JWOH 1MCEA 3MRBA 2X4SA 2JJKA 1VFBA 3CSFA 1U8LB 3VQ2C 3L3IB 1J48A 1OXYA 1X7QB 3FN9A 2HJLA 2P1SA 2D8KA 1QFWM 1NFDB 4JQIL 4YJZL 4OZGF 3TT3L 3OD7A 3LMJH 5ADPH 1EHNA 3OD3A 1KYDA 2VSKB 4IRSA 1Q9LB 5H8DA 3VSTA 2Q5BA 5GPRA 2XFXB 2I24N 4AVKA 3QUFA 4QRRD 1IXGA 5H35B 2VN6A 4YB7A 3QORA 4HH9B 2I85A 2VR8A 3ZKLA 4NP4L 3G08B 4H5SA 4UOJA 2R83A 1F2XK 1I8KA 3T1WA 2OXHB 4NN5B 4TYUA 1FNGA 3EYSL 4EUPA 4ZX3A 4HWEL 4UTAH 4PAFA 4P2OA 3C5SA 5CBEA 1XVYA 3EOAB 4FFYA 4OD3L 3FK3A 3X13B 5DEXB 1E6OL 1MCCA 4FYQA 3RGYA 3V4PB 2GT9A 3ESNA 3ZL1A 4H88H 3GIVB 3VDBA 3IXTA 3KC0A 4N9GB 4BCXA 4OM1L 2BSDA 2F7PA 2YA2A 4GSXA 1QBML 5CBRA 2KC0A 3R7XA 2DBLL 5KS9A 3CFIC 4NZFA 5E9DD 3VXTA 1T1ZA 2E4FA 2NNFA 4AYGA 4A67A 1IBGH 2FR4B 2P24A 5JK4A 4DK6A 4ZUVA 3QEQB 3H2PA 3ECUA 3TCXA 2YO3A 4YHOL 5SWSD 1CD0A 1WVZA 2R27A 4M1DH 2K6YA 5I59A 3T6WA 3AREC 5SWQB 3TL5A 3X3GH 4P46C 3TVMC 4ZOAA 5D7LA 2QV4A 3FOMB 1QX1A 4H65A 5DVJA 1AGFB 3QZPA 5C2UB 1IIIA 4I3SH 3KPRE 3FIRA 1USZA 2JKNA 4M43H 2ODIA 3HI6L 2EDKA 4XNUL 1Z7JA 3QDMB 1BLFA 1BK4A 5F88A 2RCAA 1KXTB 1L9SA 1O6VA 4LAQH 3UAJD 3RDTB 3WTYA 5H8FA 4P23B 4F57H 2E7DA 3HN3A 3V5HB 4AEIL 3QDJB 4XCFH 3IDNB 43CAA 2V3UA 3WJMB 1EMTH 5IW1A 1KWKA 2V3DA 4LU5L 3INUL 5AW8B 2MKLC 1QYGL 4NHUA 4PY7B 4YZFF 5FUOH 1YCJA 3QUYD 4R2GC 4HK0B 2G75A 4TPRH 1CURA 1MY3A 1XS5A 2XKNB 3IDMB 4MXQD 4QY8B 3UC2A 1F8TL 3JQOB 3UTTB 3BQUD 3UP1A 5EO0B 4U6HA 4U4IA 5SWSA 2ZNSA 1GZPB 4EI5D 3L7EB 4L4VB 2FNWA 4QDGA 4QWWC 3DX6A 4RMBA 5D7KD 1ESOA 3HS8A 3SSGA 5FYKU 1L9RA 3H42L 2O6CA 5A2FA 4M6AA 4PJ9B 3SETA 4QFLA 1NAMA 3BJLA 5IW6B 4HF5L 3HI1A 5AZ2L 2Q8BH 2EUVA 3UABA 2N0KA 4L48A 1A3LL 3U6XS 2EADA 4OFDA 5JHLA 1AJ7H 4PQXA 1N3WA 4XPBL 4I13B 2Z92B 4H6DA 3QNZB 3EDDA 3GMMB 3IKCB 5TDNB 1PB9A 3LV3B 4HXBH 3NH7L 1CT8B 1T83A 4N85A 4U1JB 3TO2B 3U1SH 1SXSA 1MUJB 2OJZH 4M29A 4OCYH 1KCUH 3VG9C 3ZTNL 4NKOB 1P5UA 3T2QA 2ZXWB 5KANG 4BHUI 4D8OA 1T7XA 2MQ3A 2UZYA 4J23A 4TM9A 5LDZA 4AL8H 2VB5A 1OLLA 3ZTCC 2HWZL 4GG6A 2FTAA 3O4OC 3AADB 1ZIBA 5GRZA 3NZ8B 3X1EA 1JP4A 2I4CA 4MAGA 4AYFA 2FT6A 4ODUB 1AGCB 1VGEL 4Q4EA 5BXFA 5E1AA 1NEZG 2C9VA 3TWCL 3QRGL 4Q4IA 2Z8DA 2MPVA 4F7KA 3O6KL 2DIEA 4DW2L 3U4BL 1FO0H 3NK3A 4OCLC 4FQXC 3CIQA 5TH2B 4ONYA 2EKSA 3KYAA 1M42A 1CI3M 4YWGH 4JE0A 5KUKA 4TULH 1SJEA 4N0UB 1UD5A 4NZTH 3BAYA 3H3PL 3BXNA 3MJ8B 1YY9C 1BP5A 1JXJA 1QSZA 1ACYH 3UZEA 1CLYL 1ZANH 3G3LA 4EO5A 5I76A 3I9IA 5FM5M 3T0EC 1BG9A 4XAKD 3EDEA 1A1OA 4HAGA 3HMXL 4JM2F 3I9AA 4TQPA 3PJLA 3NIGF 4W70A 4P06A 3UTSE 4OV5A 5CMCA 4IO2A 2LLLA 3P4MA 1NUDA 4J3OH 4MMXA 3BHBB 3T0ED 4XCYB 2KZ1B 2XX1A 5IVZA 4ZFFB 1LAXA 5HHOA 5I0YA 3VFSA 3WUWG 1LBBA 4R97B 4QSDA 1TZIA 2YQGA 1HHKB 4UIMA 4RGNE 2OJTA 1S7YA 2CWRA 3UTTA 1T1XB 1Z9SB 4E9VA 1PX4A 1A4JB 2I60H 4K3JL 5TQ2L 5BV7L 4P2RD 4J12A 1C8PA 4O2FA 1XGRB 4AMXA 4W6XB 2H1XA 2X2UA 4IDJH 4P4KB 4OVVA 4TUOA 1IFRA 1B4JH 4ZODA 1FNLA 2PPFA 4L8DA 5LO7A 1A7PH 3MXVH 5I17B 1KGJA 3ZK0A 3RWDB 3T6ZA 4G4PA 3QDGA 4NHCH 4PAKA 5AFAA 3NUKA 2YPVA 4XN7A 1S9VB 2AEPH 2XZCH 3VD7A 3ETBJ 2BCKA 5L4MA 3VI3B 3ILPA 4AEHL 1MIMH 4I1RA 1NCUA 2PCYA 2CZIA 5HHOB 3WAKA 5I2NA 1JNNL 1S78D 3GB7B 3P4MB 5IQ9B 5BUAA 2Q9TA 5AL8A 3BFTA 2HKHL 3DUHA 4PRBA 2JIXD 1P7KA 1TU2B 1F4AA 2ZYOA 4BFGA 5SWQA 5FGRA 2YA0A 3NJNA 3M17A 3VD9A 3BUYA 2DEXX 4GWWA 3HI5L 3VA2C 4ZX4A 4Z7VE 2JWYA 4FA6A 2GJ6E 2W80C 4OD2B 2KLSA 1UATA 3CVHB 1IBYA 3BKJH 3DIDA 1HFUA 4Z77B 1AQKL 2VAAA 1G7JA 2CR3A 1IGCL 5DRZA 2J72A 4JX0A 1YN6A 1SPIA 5EQ7A 5BRZA 1U95B 1XQ4A 4KK8D 3SJVE 5LCVH 5HHPA 4IR8A 1JE6A 4TSCH 4HT1L 1D2PA 3VYOA 3SE8H 4E9QA 1LWHA 5I0VA 5IVXB 3M1CA 3T4YB 1FBDA 3C5ZB 3GMLA 3H1ZA 2HFFB 2BS71 3FT1A 1SJVA 3WIHH 1ZLSH 2R71A 3DMMC 3ONMA 1FNGB 4GKNA 4GBXA 3ZIYA 3CFCL 4A7TA 4L4VE 2YPVL 3GC3A 3FQXB 3N42B 2ALAA 4KI5F 3CXHK 2BJMH 5AA3A 2QQLL 5DD0L 1KEMH 3LUZA 1MUJA 3OQRA 3FFCB 2UZPA 1MH3A 2QEJA 5H8QB 5L88L 2FH8A 3C5ZA 3GMLB 4P23D 5J9PA 3HG1E 3BKIB 1C08A 3AS0A 3C08H 1VADA 3BWUC 5L2KD 5I0ZA 3G3GA 2XDHA 2E7BA 5H4ZA 1JGVH 3K2IA 3JTSB 2CDFB 3DJZA 3MLTA 4U3HA 3U0WL 3HSTA 2DH2A 4EN2A 2VMCA 4I9WE 5HHPB 2R1YA 1FIEA 2XBTA 2K7PA 4OM0L 5C7ZA 3ECQA 3RQ3A 3GJFA 3HB3C 5HYEA 1RURL 1S7QB 4WWKB 3UBXI 3UZVA 2EZ0D 2REJA 3KCWA 1DP0A 1MWAB 5LBGA 3GSQB 3HC3H 2A6KA 4XPGH 1IGTB 2ZKWA 4RGOL 1BVKA 1QUNA 3KPRB 3DRTB 1USYE 3OELA 1OCOB 1BD2E 1OAKL 5IB3B 3OR6B 4QPEA 1CTOA 1H8SA 4ZW5A 4PYHA 2V2WA 4H8VA 4ZYKB 5DZJA 1WFUA 2MMXA 3O2DL 2O69A 2ICCA 1QRNB 2I9LA 2ZOOA 5ESQB 5IMMA 1OM3H 3MRNA 4X4XA 2XTSA 1B32A 1CICA 5D2LB 3BWSA 1UJ3B 3B2VH 2NZ9D 3H2QA 4KXBA 1Z5HA 3K46A 5K2YA 3OB0K 2ZSVB 5LXGH 3FO1A 1A8FA 4P1LA 2VRAA 3CN2A 2FYYB 4NLAA 2LLGA 5C6PB 1AR1B 1WTLA 4F22A 1KELH 3ESOA 5F97E 4OFQA 2D2OA 2ZAGA 3G6JE 3VRJA 3KWXA 4AGLA 4DO5A 4TQEH 5BJTA 4O5LL 4ZUWB 3WIIL 5E8OB 3ISYA 4YHIA 3S9MC 1IBZA 1TTRA 4YEEA 1L9MA 3F7VB 43C9A 1NNTA 3PV7A 1UEYA 1KBKA 1MAMH 3N40P 4OESA 1JFHA 2O84X 1MF2L 1WSST 2PPCA 1E5YA 1BJMA 4UNUA 5C0FB 2AI0L 3EGDA 3L3DB 2WLMA 3S8GB 2QHRL 1VDWA 1F0LA 4THIA 2Z35A 3UYPB 3VM5A 5D1QC 3ZN6A 2GW5A 1U3HA 2OX5A 4KZDH 1YYLL 5DS8A 4JB7A 1X4ZA 3CQPA 5KS9B 2XA5A 4PLKC 1G9MC 5BRZD 2KZKA 2GTZA 3C87A 4U1MB 4Q9BA 3WS6C 2DKSA 1RZKH 5MEPA 5C0NC 4FQ1L 3VFGH 1G7HB 3C31A 4LLWB 5MI0C 1OP4A 1MCBA 4W9DC 5D7IE 5DT6A 2R4SL 1HH6B 3EF4A 4AMWA 4Y4HC 4R96A 3WE1A 2HG5B 4FADA 1LD9A 3ILEA 5FFOA 4G6FB 2ZCKH 4LDCA 4M8QA 4XCCL 4BA0A 1TMQA 4F19A 1WD8A 1AANA 4F3PA 3VB9A 1BZQK 1U8HA 1RHHB 2BVQB 4EQ2A 4JFXB 4KUCF 5I30H 2IAMC 3MBWA 1OGTB 4HC1L 5AOLA 4OIBA 3EO0A 3MVYA 3C9NA 3UIYA 3PGCB 5I0WA 5F0PB 4DUXA 3S3DB 2CH8A 4LLDA 2E8ZA 2P8LA 4K3DH 3WL9B 2I3WA 1JAEA 3B1UA 4QTFA 1O5PA 1MSPA 4U2ZA 2DE4A 4ZMAT 3X14B 2X38A 4YC2C 1HE8A 1QBBA 1JWMA 3V4PH 4HE1A 2FJGA 3QFJD 3HOGA 5AB1A 3TEYA 4TSAL 4JFEA 4JFFE 5IF0B 1FPIA 4BWTA 1NM9A 1NBYA 2XPGA 1JXFA 2X9YA 35C8L 1RZKC 3BIBX 3ZE2B 1ZT7A 1UXMA 5I18H 5T1MB 5HI4C 3KPSE 3V9CA 4E5XB 3DO7A 4CSTA 1AHWC 4MQXC 3QIBB 3N55A 5SWZD 2IQAA 3TN0C 2EC9U 1A4AA 2B5IC 2D3JA 3WHE1 1PSKL 4PQJA 1FORL 4M1CC 2J8UB 2QHLA 3I02B 5IW6A 5ICTA 4UA8A 5C0CE 4F20A 3DSFH 2P8LB 4OZGA 4N28A 3FB8A 3OMZA 3QUGA 1NSNL 1ACYL 4JVPA 4KMLB 1FPFA 3AS1A 1EYKA 3U72A 2Y6SD 1DUYA 5BQDA 1PEZA 4LDEB 3U7WL 5AE4A 1OO2A 4QCIB 4Q9RL 3I6VA 4GL8A 3KLLA 1OOAA 1PDAA 4R8WH 1SYSB 2XY2A 7FABL 3VXSD 3US1A 5GGUB 4EQ3A 5D5MA 4XMUA 1B4HA 4GFTB 2R59A 2GK2A 4JY6B 1QATA 1QO3B 1QRNE 2ARJB 4ZZAA 1O5DT 4NHUB 3SKNA 4FXGC 4OZFB 1TTFA 4TTDD 1GCYA 2ESVA 3GPEA 5A2IH 3PGFA 4ZAKD 4QYOA 4TKWA 1LJMA 1MPBA 1OLCA 3EHUA 3AXIA 2C3WA 3DO4A 4XE5B 4Y19A 1RZGB 3UTTE 2J3SA 4H26A 1DDHA 1B0WA 2DQTL 2X0WA 3FFOA 4L18A 1HI6B 1LE5A 5F8RC 4JZNB 4KKAD 1PZ5A 4PGCA 2YC1A 4NAQA 4XMPH 1JW1A 1JHTB 2QMWA 3WMQA 1BQHG 4ZO6A 3V10A 4O02L 4Z3IA 4QYOB 3UTSB 4HH8A 3BRGC 4GRLD 4AE0A 3LOWA 1DN0A 3OGCB 3MAMA 4ADGA 2NY7H 5IB4B 2ESNA 4L3CB 3MLYH 4B50A 1NV7A 5EORH 3QDAA 4OUOA 4BRJA 3AVEA 3UTZA 1UT9A 4QLWA 1QEWA 1XR8B 4XC3L 2HT4C 4HPYH 2AHIA 5CS7A 1UYWH 4HIPA 4LHQB 3O0LA 4WNJA 5EPMB 2WO2B 5F8QC 1RZJC 3I3BA 5KVFH 5I1LB 4I9WD 2DDKA 1LP9B 5G55A 1N04A 4KROC 5IBUG 1JV2B 3FN0L 5GS0C 4HHGA 3FPYA 3N41B 2BFGA 2X2YA 2W88A 3V0IA 4PJEA 1CDYA 3RB7A 1MQIA 3A29A 2EH7L 4QXDA 3GXNA 4JM2C 3CFEB 2FBPA 5ET5A 1CF8H 2IQAB 4QJ4B 1WGOA 1KDJA 1KIQB 3SQBB 2OM5A 3OO8A 3EYOA 4ENED 3MAWA 5T5FL 4HLEA 5D1ZA 2Y5TB 2APSA 3BOVA 2DZEA 2WXOA 4EBQH 5AUMB 4P1EA 3P11H 4HWBA 2LU4A 1ZDQA 3PS6A 3SPJA 3VRIB 4JFEB 4OF8A 5IF0A 4ZD3H 1URIA 3ARVA 5DC4B 5E94B 1Q9KB 4NKQB 2YQ2A 2VLRD 3R19A 4RRPA 3QJXA 4XPTL 1Y0LA 3R1GH 4OW6A 4U1GC 1D2OA 3EFFA 2Y07H 3FC8A 5DZ9A 3U9UB 1ID2A 3CXDL 3FJ7A 4DCXA 1IAKA 3OXRB 4L23A 2IH3A 1X44A 3PPOA 2QGEA 4PS3A 4Z5RB 2HZLA 2OZZA 5IFHH 4N25A 5A6IA 1YMMB 2BVYA 2HTLC 4PG9A 4CSSA 2PF6A 5EHFA 5HYSA 4YHOH 1Z5LA 3EHTA 1J12A 5BO1H 5GS0H 2NSXA 1IGFH 4EI6A 1U8HB 1WAAA 2BVQA 2VN3A 2H32B 2VN4A 4C8XA 4M6ML 1ROWA 1F41A 3IAPA 5CJ5A 1K5WA 3OM3B 4NMYA 4FG0A 1MFBL 3HNVH 1MW0A 2V3QA 1IMFA 3OGOE 4ZS7L 4GW1B 4P4RB 3SOBH 3Q6FA 3HG3A 4M6MH 3I3VA 3S8WA 1LAGE 3ZMNA 5C0BA 4G2AA 4JR9L 5E51A 1OAQH 5HJ3A 4YKKA 2AVGA 4NZRL 5J5EA 1E4XI 1N8ZA 3FO2A 3SCMC 4ZAKA 1DSFL 1MQKH 4PJBE 5TDPB 3WXWL 2DD8L 4DZ8A 5D71L 3KLAA 3RPKA 4HG4K 1TJIL 1NGYA 3QG7H 2OYLA 3KWUA 4C4KT 2IDTA 4ISVB 4NO5B 2EE2A 4HKXB 2F1EA 5ID0A 5K69A 3PPRA 3UJJH 1KIRB 3LSWA 4PC9A 3KM2A 5EC2B 5IVNA 5JUEH 3MLRL 3DROB 5JOFA 1QHOA 2NUVA 3IAZA 4DF9A 4QYAA 1Q9WA 2VDOH 1UJTA 4FQ1H 4MCYA 2QKIC 3VFGL 5E2WL 5HGAA 5DZNA 5HHNB 3RX8A 5GS1B 5JTYB 5FAAA 4RAUB 1H3VA 1C5DB 3NGBC 4KWUA 1H6TA 1PG7H 3OKNA 4ELMA 4YXHL 2WOBA 3STBA 4YO0B 1CF8L 3D12B 4R4ND 1IEAA 5FUZH 4IBWA 2FATH 2WWOA 1SYVA 2Z3FA 1NINA 2ZCZA 1SW4A 3FQUB 3KPNA 4WWPA 1S9VA 3C60C 3VAEA 1RDYA 1RK7A 1CWVA 4JFDB 2HFEA 1L6ZA 1WRFA 3REVA 3S36H 5H4YA 1POY1 3KFMA 3KS0J 2WKLA 2B65A 4MRCA 4NCC1 5ESYA 4AK2A 4QOKD 4JY6A 1YYCA 1MRCH 2I9LB 5D96B 1JNHA 2Q2EB 5JO5B 1ZWIB 1WVJA 1BZEA 5E9DA 4JGUA 3H6UA 2HPGA 5GGUA 5GGRA 3S5LA 4FRWA 5DQ9B 1T7VA 1VFEA 1S4IA 4TTDC 2DS4A 1AQ8A 1WBYA 4G1MA 3T3PE 3N94A 1I7UB 2FBOJ 2V5TA 1DR9A 1A9BA 5CUSH 2F68X 4FTDA 3WN6A 3F83A 2BY3A 2FCBA 2PWHA 4ODHH 4Y1AA 1I1YB 3GZOA 3KGRA 3VI3F 3WOVA 2VERN 1TVBA 1ZT1B 3BP4A 1WZ1H 3CFDA 3IM1A 4XXUA 1A47A 3MSTA 1EWHA 2VLRA 2YGNA 4Y4HA 1T21B 2LAGB 2Z4QA 5GRJH 2G3ZA 2C9QA 4U33A 2O6FA 2Y22A 4YE4H 1EHAA 4HUUA 4AV0A 1DVFD 4K3HA 4E5XA 1D6EB 2CNYA 5DD6B 2AV7B 4K94H 3AAZA 3K02A 5AVZB 3VX0A 4ZSOA 1JIBA 4OCNC 3BIKA 2PX1A 4XVSH 5F7YC 4P4KC 5AALA 4QI3A 3VWJD 1HJBC 3QAZC 1UENA 4KHXL 4OUUA 1Z1WA 1F00I 4HEPA 1ES0B 4Y88A 4DXBA 4BRVA 3SEVA 4O8MA 1UT2A 3I6LD 1EFXA 4C56A 3C6SB 2BRQA 1E2WA 2A0LC 2B39A 4FFTA 4LKXA 3DMMB 1NCCH 3DP4A 4N3UA 4U6YB 4MB1A 4AS5A 1A40A 3Q29A 4P2RA 4E9TA 4LEEA 3F58L 1GSMA 1RUAH 5DD0H 3T1BA 5LTCA 5BRZB 2WLZA 5FKPA 1P1QA 5C6TH 1HHHA 1L5TA 4X6DF 3FTVA 1V05A 5F7DA 3PQYA 3NAAL 5DD6A 4XVUD 1A4BA 5KBPA 5E24E 3CVHA 3WGVB 3KHQA 3LR1A 3ULUF 3JV9A 4A7SA 3BUYB 1S9TA 2NNCA 4O3CA 5LUMA 1DQQB 4L1SA 3FQWB 3I85A 3LS5L 4IHOB 5D7LD 1JPGA 1JG9A 1DQLH 3UPRB 4WFHD 2VUYA 1BOYA 3QZWB 1U92A 4XH2B 1G7LA 4HCRA 4AQ1C 4ZDMA 4X5QA 1JPEA 5F1KC 3SESA 3IYLW 2WYKA 5FGBC 3ILUB 3EHBD 3V4VA 1QBAA 2PW1A 3LN9A 3WLBA 2Z35B 2Z91A 2R2EB 3LVEA 5C0ND 3CRBA 3TCGA 1L6PA 2OI9B 1T0PB 3B4NA 4KZ0A 4UABA 4Q9CA 4NNPH 3D07A 3SD5A 3CZFB 4Z7WE 5JHMA 5I17A 3BD4A 1NKOA 4Z76B 1CIUA 2J25A 1WV7T 2Y2TA 4PJDE 1DBBH 4MX6A 3ZDZB 4DCYA 2ZUQB 3R0NA 4GH7B 3V7AE 4MFIA 3QDJA 1EO5A 2JXMA 2L8AA 5KSAD 1UWGH 3KL5A 5AG9A 4JGNA 4Y5XA 4YSOA 1XT5A 2DLHA 4G6JH 1JDCA 3IGLA 3OHXC 2ATPB 1A3RL 4I3RL 4ELMB 5JPMB 1E8ZA 1J8SA 2GY7B 3FMGL 2ZSWB 4QGTA 3MRNB 3OAZK 4HDIB 2KHAA 1FFPB 3ZR5A 3ZYIA 1IKOP 4UQEA 2BDNL 1Q9WB 1JZ8A 2FIEA 3KPTA 15C8H 2YZ8A 5DVOA 5DJ0A 5B1JC 3B5TA 5I8EA 5L2KA 3LS4H 3HZMA 4WI3A 4ZQKB 4EBQL 1UM6H 2A6KB 4JL2A 3R06A 4N3TA 3ARQA 3QEQA 2EILB 4R5VA 2PTUA 5DHDA 5KDTA 3AREB 4GWYA 3VXTB 4WEEA 4G8HA 1FO0A 2BRRL 2H98A 3Q8BA 5DJAB 1NDGA 1NCNA 1TKWB 3NIGB 3CCHB 4OVJA 3PHAA 4B9IA 2FYIA 3IXTB 4MD4A 2ZTBA 4IKIA 3JVGA 1D7DA 2FB4H 5HHVL 1N3NA 1MXUA 3DNKA 4APXA 3BFUA 2AEOA 5GGVY 4OWDA 1NFAA 1WBXB 2JV6A 3O8XC 2GAZA 3A5VA 4XOEA 2UUDH 2JKJA 2OSWA 5FTIA 1QR1B 4ODTL 4XHJD 2C9UA 1DO6A 2VN5A 3FRPG 2DM7A 2UZYB 4I0PC 3UTPD 3DIFB 2O5XH 1NCDL 1K2DA 1NGQH 4JO3H 4S1DD 4WGWB 3IOVA 3TQLA 1MCJA 1WC7B 2DQDH 5K59E 1EO7A 1JZEA 2J12B 4KVNL 4DP7X 1J0YA 4KITB 3MRRA 3PAYA 4NERA 4UZUA 1G84A 4W9LC 1TUPA 5AWNH 3M1BA 2LOEA 1V3LA 4V2BA 1QUIA 4D2NA 4M00A 1M1SA 1A7QH 4YX2L 2YGVA 3LB6C 4S1QH 1TVHA 4Z0IA 4F7TB 4P9MH 1RSYA 2VDKH 4XBEL 1FYTE 3ULSB 5FV2A 3O28A 4UBDC 5DJYB 2P8MA 2DQTH 1D5MB 5IY5B 4N6DA 4Q58C 1ND0B 2WBDA 4OCYL 1RIUL 1LFGA 3VRLE 4OD2A 2VZ3A 3EYOB 1C8QA 5F7NC 3RKDC 4C0RA 2AJYH 1MCPH 4Z3EA 3Q9QA 3O81A 3QCTL 1MG2C 4FNUA 1I1FB 1RURH 3OMNB 3IDMA 4JO2L 2NXZB 3MV8D 2D31A 2FJFA 4GX3A 4PJAE 1PFCA 2KR0A 5I16B 2APTA 2OV0A 1PZDA 2JMRA 1UZ6E 2NLJA 4HDIA 4F1SA 5D4HA 3S97C 4M9PA 4R7LA 3FUDA 3GXIA 5JXED 2F0CA 4CVXA 4P9HC 3AB0C 4P23A 2OCJA 5B39B 3MLPA 1ZSHA 3C35A 3EDFA 1I9EA 1R5VB 4JSDA 2IA4A 1SVZA 3FV1A 2ALWA 2HG0A 4GINA 1IZJA 2WY3B 1IIKA 2QPUA 3OXSB 4MNGA 3U92A 1B46A 4I1PA 1YTVA 5DSCB 3HN5A 3CJJA 2PPEA 1SDDA 3BMVA 4D8PA 2JIXA 3BAXA 3LHPL 3PREA 5JDJA 3DVFA 1HZLA 4H46A 4MAUL 5J7CC 1M7UA 4G7RB 1NBCA 3VXSE 4JL1A 1TZIB 1WIPA 4R26L 4XCFL 5E00B 1U4FA 4PJAF 2ICEA 4L5FE 4MS8D 3DARA 3VGFA 1QLFB 4IRZH 3ALXA 2WBKA 2OQJA 4JO8A 2CK0H 3RU8L 1W8OA 3V4VB 1MRPA 2APXA 2Z8RA 5IROC 5FW6A 2Q7YB 3FXIC 2WXNA 2CO7B 5I6OA 4FLOA 4KY1L 3IJSA 4IOSA 3WD5L 2HT3D 4GXVL 1BXAA 1GZHC 1RVFL 4JG5A 1BEYL 2DLFH 2EINB 3WAJA 3ARYA 3W82A 2ARJA 5CKGA 1KCBA 5F7HA 5EC1B 5DEXA 2WQ8A 3QCUL 4L1LA 3U6XA 4DKFL 3W9EA 2Q2CA 3LSXA 4LZ7A 1N26A 5TF0A 1NEZB 4O3BA 2Q74A 3CHXA 3V4UH 2GH9A 4BDQA 2F54A 4U6YA 4FKEA 4ZE8A 2ZNXA 3N42F 2D7QA 2FLMA 4KPHL 1DSNA 4U1SA 3TO4A 1E65A 1NMUA 3C5ZD 2V4CA 3TAJA 1XBDA 3HE6D 4PJHA 2XWTA 2ARWA 2P5PA 2QPDB 3CLFH 2BNQA 2BHYA 4JWOA 2NYZA 2CLRA 1URSA 3RNKB 3QH3B 3CH8A 4M4GA 3M8OL 1G43A 3GSRB 3QHFH 5JMRA 3T1FA 4GAYA 3B9KA 4PJCB 5JW4R 1NUXA 3WO4C 4TLLB 1FJ1B 3HAEH 4QHMB 1JCVA 1TTCA 4NP4H 4NJAL 4JKNA 5C09B 2QR0A 1OKEA 2ROXA 2X26A 1GGYA 1OAJA 3H7BA 3PUZE 4J2QA 3PHSA 1D7FA 4G6ML 4ZNEE 4R9GA 2EXSA 1E4WH 3KJ4B 1E9QB 3BQUB 5FYLL 5HHXL 5HYSG 1S3KL 2VLRB 3ME0B 3ZKMC 1QSFA 4AM0A 1TVBB 4FEMA 3UOAB 4A2FA 5AG8A 4NNYB 3F65A 1SUHA 2NY1D 4XGZA 2EXYD 4JFEE 4JFFA 3VDFA 1KIPB 4H1LG 3ZTJG 3ALPA 2F54D 1MW2A 2W59A 3TBTA 1J1OH 3D39B 3O6KH 1OGTA 1CGWA 4NWTL 2QVTA 2AMUA 4YDNA 4NZUH 3BPLC 2Q76B 3MX0B 1NH8A 3WJJC 3WEXA 2XJLA 4NBXB 4PBDA 3SDAA 4D7BA 2E9JA 4W9EC 3H6VA 1HNYA 2XV3A 2V2TA 2VXVL 4Y7OC 3QGVA 4EXKA 4WKZA 5AVQB 4K7FB 3L08A 2X4UB 5BVJA 2JELL 4URTB 1ZCRA 4R5XA 4LESA 5AYTA 1QPPA 1LBZA 4ESKA 2Y7QB 4U4BA 5EZLA 2NYYD 3WMPA 1SYVB 3NJKA 1MFEH 4G8MA 4P2OC 5GZOC 4Z7WF 3K2DA 2CRIA 5F88B 3KYOB 4KDTA 3OB8A 4IKNA 1MLCA 3KWWB 1I82A 4IU2A 1CDJA 1LBCA 4XPBH 3EGDB 3UC0L 3V52L 1E0OB 3K4AA 4XOCA 4HXBL 4XO5A 5IOKA 1BLIA 3QIWA 4IOSD 2F9BT 3I74A 2J71A 1IEBB 4LASL 5CJXA 1GC1L 3H42H 3GS7A 4MVBD 4M8VA 2P1YA 3TTYA 5I1GL 4E9WA 1LWRA 4EDXB 4RIRB 6PAZA 2ZYRA 2KUTA 1IVLA 4DNLA 4H8WH 3QZNA 4NNXA 5F9DC 1ONQA 3J07A 3PWJA 4GUQA 1XH2A 4NO5A 3VRJB 4HZLB 1IFHL 5ES4B 2GFBA 2PNDA 4YDZA 4AX3A 1A3QA 1YNLH 4EVNB 4QXGH 3BEWB 2W1NA 2WCGA 4X5LA 1NKXA 3LH8A 4DK3A 1CU4L 2IAMA 1L9OA 1ZSDA 4DZBB 5DJ8A 3WIHL 4PW4A 5LG6A 4WKMA 3RLSA 4X8JA 1JJUA 4PJXA 3HFML 3RL1B 4QRRA 2UYLB 4PM1A 2QS3A 5ESQA 3H56A 1DVSA 4XNMB 4MMYA 5G2NA 4GBWA 1XGTB 4N15A 3HC0A 3ZW3A 3IJOB 1B3FA 3WN5A 1R19A 2CRZA 4TLMB 1B51A 3HHMA 3FB7A 1MXDA 2UXGA 1THCA 3GHBL 4NO2A 3UXFA 4L4TD 4OIFA 4HD5A 1I3RB 5JDSA 5K9OA 4WTXA 1EMTL 2YSSA 2B3IA 4LPVA 1M1XB 5AYUH 3KPOA 3C8KB 4GKLA 3PP3H 3QFDB 3RKPA 1NFDF 4X6FB 5HYQA 3MRIB 2ZXQA 5I1EH 3IJ9A 1BEXA 2TSBA 2BMKB 3BUIA 3P9MA 2OMVA 3L4VA 2QBWA 2W9EH 4XI5D 3UYOD 4XNZC 3B7RL 2ZKXA 5IKBA 5SWZB 4U4XA 1X5AA 2PPAA 3IJYA 4KROD 4QFPA 2X10A 3W11C 4GSQA 1TJIH 1K9ZA 2E74C 2X87A 4Z7WA 9PCYA 4LSQL 4M8UA 1DMBA 3E3KA 3U1OA 1H3XA 4GBVA 5H37A 3ZE2E 1MVUA 5PAZA 1B3JA 4PYGA 1IBGL 1JRHH 4JKWA 2FQDA 3BI9X 3F7PC 4FG6D 5EIIB 3VJ6A 2NR6A 5FDWB 4ZAKC 5JOEA 2EVGA 1WCBA 1YPNA 2Q8AL 4XCNB 3QUMB 3EYSH 4IY5A 5HGHA 3CHGA 5TDOA 5EPMA 3DUSB 1MCIA 3U36A 4P47A 5F3BA 5CJQH 3AQDA 5T8IA 2ZYIA 3ZGIA 1QSEB 4RBPH 3P4OB 4HPOH 4B7IA 3AMKA 5KBLA 2QGCA 1K8IA 3IXAB 2WXKA 4G6FD 4AXWA 3HLAB 2R0WL 3TT3H 4Z7QB 4LQ5A 4ZMQA 1J0IA 4P2CG 3VNYA 5D7JB 5HDWA 4PDHA 4BELD 5E56A 3P3UA 1KYAA 2I9TA 3PGFL 1NWOA 3QIWB 4P2RE 3HRZB 1Z7ME 4XKRA 3CBRA 4OFJA 5ITBL 4WGVB 4LOUD 1NGWA 2ZKHL 2E27L 4PJ8B 3C9HA 4PGCB 3BGMB 4DP4X 1GL4B 3KEHA 3QUZB 3TIDA 1KCVH 1A2YB 2XRAH 3L4TA 3LZQA 1KY6A 3B3BA 4C54A 3FSZA 2BCKB 1HQRA 3NDZE 1YEJH 1TQSA 2AAAA 5H2BB 1N2RA 3SJVB 3IDGB 3P0GB 4HHWA 1OTTC 4K7FA 1PDKB 1SXNA 4APQB 2YMXH 5I0DA 3FO9A 4MLQA 5CGMA 1JSYA 5EHMA 3TYFA 4R6KA 3BVDB 4WHYH 3VD3A 4CA4A 1M53A 2BIIA 1N8OE 4XC3H 3WE6B 4XP1L 1L5GA 4AITA 4XVSL 1CE1L 3KGUA 3GLBA 4OLZH 2Y7IA 3U1SL 2OMBA 2NNAA 5D1ZD 3NPSC 5IVZB 5IVOA 2ZXEB 3BPCB 4JQXC 3IN2A 5GGQL 4PRDA 3MP8A 4NFDA 4PGNA 2X7LB 1AGEB 2Z4TA 1KLGA 3KL3A 4LZ5A 4PV8B 1DJGA 2FWOA 2DWEA 5AB9A 3UROR 1M71B 3PQYD 5MENE 3TJPA 2UX6A 3LIZH 3HCVA 2JJSA 5IGXL 4LRIA 4MXVE 2Y1YA 4JFZL 5T5FA 1I3VA 5FIEA 3VFTA 2FWSA 2WXHA 2VIRA 1MRDH 3IMUA 5E4AA 1D5RA 1RH8A 3BVXA 4AMKH 4GXAA 2WVVB 1OP3K 1Q72H 5B22A 3VDCA 3JZJA 2I58A 1BQUA 1HIML 1DCEA 5CSZB 4B41A 2B3FA 4HS7A 2GB2A 4PJIA 4ZFZA 4MJ6A 1U42A 2R4RH 3NJLA 2LW3A 3QO0A 1GW6A 5E1AB 3GXMA 3S96A 1JBJA 4LCUB 4LL1A 4UCFA 4U1LB 3DA0A 2ZAIA 3K74B 3FFCD 2Y7RA 4Q6IC 5HYFA 4XC1L 1FYTB 3HHSB 3CX5K 3D9AL 4JHVA 1JPFB 3FQ1A 3HB3D 4HXAL 4U1ZA 5DVIA 5T3XH 3QDGD 1CUOA 2K3TA 2O72A 2X7PA 4IRJD 2W60B 3M46A 3GBML 5D7IB 4WY7L 3TBYB 5I8KH 3EADA 2HG5A 5EC1A 1UA7A 3QHTC 1DVFA 1NLBH 3FONA 5ICQA 4H1LH 5A43C 1KJVB 4PP2A 2ZNTA 4C59B 2G2RA 3TA4D 3BD5A 3SZKC 2Q6WB 2V17H 2YA1A 5FK9A 5AZEH 2XYCA 3VWJA 1G0DA 2P3NA 2YAPA 4ZOBA 5EOTB 2VDNH 3HEIB 2OX5B 1Q1PA 2ADJB 3W39A 5EDSA 2GSGB 3ZSFA 2XBDA 2DBLH 3BFOA 3ARBA 5F6IC 1EFXD 2F53E 4OCWH 3BFWA 5FWRA 4AC2A 4C56D 1N6QL 1FNEB 1MXZA 1DSFH 3PLYA 3N9GH 2V93A 3LEVH 1S3RA 4H88L 4X99B 2FO4B 5E6ZA 2ZUTA 4XBMA 4B5ZA 5C1MB 1MEXH 2F7IA 2SEBB 3PWUA 4ZS7H 2ATAA 4QOKA 1R0AH 4Z7OF 4J3OC 4MAYB 1MG3C 4WO4D 3HR5B 3IK2A 1KB5A 1WD9A 4DAGL 2W0FB 4JN2A 4WCYL 1OQHA 2XHDA 4YQXH 3H9HB 1LB9A 2OMYA 4NQQA 3B6WA 4KH2A 4EDWH 1FLRH 4U22A 3L3HA 3QUXC 4F3GA 4P9KA 2IV9A 4YDIL 5LLIC 1ZKBA 5DYHA 4X98A 1ILUA 4XPFH 1ETJA 5TPWH 2E7MA 4AGPA 5FWQA 4YDLB 3MOQA 3LKQA 1M5CA 2DS9A 1Y3QA 2DLGA 3D2TA 2FECL 2VM4A 4ORGB 3L1OL 4QFKA 3PFUA 1FRGL 1D5BB 1KGWA 4AIOA 1K8DA 4DJMA 2J1ZA 1BVKB 3KPRA 4E9LA 3CDGA 3WY4A 3SPVB 2VABA 2LABA 1KCLA 5SX5K 5A40E 2WQUA 3WU1A 2VXUH 1VGKA 3V6FA 2HN7B 2IF7A 4N13A 2YD1A 3K6UA 3QW9A 3DTXA 4CVUA 4Z3TA 3V2AR 4I18C 4WW1B 5FHBH 4JXIA 1CL7H 1PZ2A 4OI9A 2GYSA 2WQRA 3T2OA 3EFOB 3KLKA 1S3KH 4IMKC 2VD2A 1JWSA 1YY8B 2APVA 1O7DC 3AB0B 1T89A 1LFIA 1FPBA 2FBJL 1MCDA 3U9PL 4FNTA 2WAQA 4NRZA 2R0KH 2OYPA 3LSOB 4OENA 3U4KA 1IM9B 2FUTA 3MV8A 5SV4A 1PZAA 1EXHA 4A2DA 1U8PA 1MFCH 5DUBB 3SDCD 3PYCA 4ZTOL 4F1ZA 1M6OB 4PW3A 2EDXA 2J56A 5FW7A 4W9GC 4MB5A 2GBUA 3AACA 3DPBB 1KJ2H 4MASA 4LLUA 3VGAC 2XACC 3MJ9H 3X3FL 1FJ6A 3UGWA 2DL9A 3Q5TA 2SODB 2WCSA 2V33A 3T4YA 4M48L 4PV1C 4Y4FC 1N0LA 1MCLA 1CLZH 4HAKA 4PJHF 3S0PA 3BRFA 1QTPA 3PG2A 2CCWA 2VC2H 3CUPA 4UOQA 4BGLA 5JXEC 5HI3C 4M1CD 1FO0B 5T3XE 4MD5B 2WHVA 4AQ1A 4KUZL 2R8SL 1URDA 4JPVL 1ODAA 5I3SA 1J1PL 4NZDA 3RI5K 4HUWA 2H6OA 3UBXA 1GIGH 4G3YH 3FTWA 1K9YA 3HZMB 2X1PA 3H2WA 4EI5B 4F2OA 1KZQA 4B60A 3E0GA 3O3EA 4TNWK 5CRYA 1SF5A 4PVLA 1HYSC 2F5AH 4RRPG 4IO4A 1F1GA 2B3RA 1EAOA 5E5RB 1UIVA 4Y9CA 3VXRE 2H3NA 1YAZA 1QG3A 3BWAA 5I56A 1Y1MA 1F4WL 1TQBB 3DV6B 4HCRL 5KCJA 4H7VA 2KQNA 4PVNA 4KRPD 3VA6A 4K9EH 5AW0B 2PCXA 4WO4A 4AIEA 2ATPA 2UZXA 3FQ2A 4PJCF 4RFNC 4Z7QE 3QQ9C 5G4OA 5DRXA 1A4KB 3IGKA 2D3NA 4HWZB 4RFEA 4Z0XB 2YKLL 3WS3A 1EZOA 2BSSA 1W0WA 1FBFA 4IKLA 2WLLB 3BH8B 4B9PA 5B8CC 1IQ7A 4NF4B 1HDMA 1A0QL 1KGCE 1EBPA 1LK2B 2UVGA 4I1DA 5M2VA 3MQ9A 3WDJA 5E5LA 1PY0A 3GZGA 2ZMBA 3OKKA 1Y3PA 3NQIA 4X99A 1MXGA 2FRGP 3Q06A 3QAQA 1LO0H 4PV9A 4WI9A 5C08E 4EIGB 1DL7L 1T6VN 1A64A 3HE6A 4E0RB 5TPAB 1IILE 4ZFOA 5HGDB 4X4KA 2EDYA 4ZFFA 4PWKA 2BZDA 3QEQD 2V9RA 3S4UA 4MX7A 1Z9LA 3BSZH 2OMZB 3FFDA 4QRPD 4ZMLA 3T0DA 5H8FB 1MIEL 4HE2A 3CDYA 1WITA 2IFGA 4JZJA 4PDDA 5LAPA 5LNGA 1IC4H 4LSVL 4K3EH 2CUMA 4F1VA 2YEZB 1HKLL 2NUPA 3ABKB 3PWVB 3OZLA 1S2EA 1IE4A 3BE1H 3KDMA 3RKDD 4KOCA 4R4FH 5ALBH 4G7YH 4Z3FA 3DTXB 2EIZA 2NX5A 1Z9NA 4H2CA 4AEHH 2P0SA 4NF6B 5I2KA 1L7IL 5DJDA 3BT2L 3D4YA 3H03A 3NZUA 1K8DB 4KKBD 4AZUA 1MAJA 5LHDA 3QIUC 1N0TA 3NSJA 1N3XA 3S88H 1ZLDA 3MRDA 4FNRA 4H2AA 3EO9L 3VFRB 4LKXB 1NANI 1BW8A 2PYED 5KN5A 2EEFA 1KJMA 3FUNA 3I75B 3QUMH 1XDTT 4QRUA 3G5YA 1E50A 1TJHL 4NWDA 1MHEA 2B7DT 5B7MA 3PDDA 3R18A 4WTZG 3BUQA 2VE6B 3VQMA 4YDKH 1ZHBA 2I25N 5EZJB 1R4XA 1KB5B 4NEDA 3LTVA 2JJSC 1T20B 2QHRH 1DQVA 4JPKH 5GGSB 4PB9H 3RFZB 1ZLWK 4KYEA 2V5MA 2NY0B 4NUJB 1OCRB 2BSTA 1D6VH 4JHAL 2FD6H 3D2UA 4ACTA 4DQAA 2CEYA 2Y7SA 1FPGA 1JHLL 2YHGA 4P46D 3SEYA 5F96L 3U2SA 4FMVA 4CBPA 4NX0A 4O5LH 1CL7L 4U3CA 4NENA 4Z7VF 5EA0L 5FHBL 4H1XA 2XWDA 1T0NB 3QIWD 3MO1B 4QTIL 4PS8A 5EIVA 1CICD 1RPUA 4ZE9A 2RCSH 2J7LA 3QG6B 3RUGF 1RAMA 2G2NA 4E42A 1EDYA 4GQ9L 2PYEA 3W0WE 3KAAA 1KYOK 1VGEH 2BNQD 3ARDB 3QO1A 4MCMA 3TASA 2Q7AA 1P4LA 4KJQD 4UB0L 4KU1A 2I7OA 3RWGB 2IADB 1N0XL 4HK0A 4EI0A 1XX9C 3T09A 4WFED 7PCYA 2IH9A 1WPCA 4Q74A 2J6EL 4Y2DB 4XN8A 2AS5M 1F6AB 2XZAH 3RIFF 2ED7A 3QZMA 1SNRA 5EO9B 3WJMA 4QFNA 2WLJA 3AXLB 1ASOA 3NJHA 5F9WC 2DIBA 1RHFA 5AVYB 3VVDA 2PO6A 4LF3A 4RGOH 4YXLL 3W5MA 3TCHA 3PWLB 3TH2T 3ZE1B 1OT2A 5CGBA 1Q90A 1MCSA 4EF3A 1QA9A 3F6LA 2FJUB 2ENJA 2FIKA 2R0ZL 4ABQA 5DFWH 3IS1X 1YEKH 3ILQD 1AQDA 3QYMA 2G4EA 5HD8D 4J3XA 4MJIA 4FFZA 4G7QB 1N70A 3ES6A 1Z0NA 4LNRA 4XO3A 4POWA 4M61A 4E9RA 1EA9C 2PCFA 4WJ5B 3QRBA 4PRHE 5E9AA 5I6LA 3MJGX 2AC0A 5I59B 4FTVE 3BSZL 2Q0ZX 3NIGE 5IMKA 5KVMC 4GXVH 3DJTA 1W6WA 3KYKL 4ES9A 1J1XH 3N9GL 4M7KL 4OFVA 4AXWB 2GHAA 4QFOA 5JIIA 5L4FA 2YPVH 2PWGA 1QD0A 2CRYA 4R5TA 3TXAA 1OP5H 2VL5A 2X4TA 2ZNWA 4Y9GA 1IGIH 1IVTA 3X12A 2AXGA 2ROYA 4JFDD 1NC4D 2XN1A 5L8LB 1BECA 3TONA 4ZZKA 3LZLA 2DWEB 1II5A 4U1NB 5BPPA 1BKAA 2EDQA 4MNQB 2JVUA 2VW4A 1TFPA 3PDOA 3ZX1A 5LCVL 2R1XB 4UOW1 3QFJA 4AG4H 4PI2A 4YUEL 3FUIA 1AO7A 1IX2A 2MRYA 3MFFA 5DW8A 3IAGC 1WIOA 2VMFA 1DBML 1OVZA 2CUHA 4MD0A 5HYSB 1ZVSB 3GKWL 4CU7A 3ZDZF 4KKCC 4X0KB 2YQ3A 5DLLA 3WTVA 5L4IA 4L3EA 5IBTH 3P9LA 3HHRB 1ZLVK 4YZZA 1JN6B 4P5TC 5IQNA 5HHME 3WJLA 3FO9B 3GNML 2F5AL 5DJCB 5SWZA 5F0JB 2BZ7A 4CADB 4E41E 3IDGA 4H25B 1NC2B 3IRCA 2QZ5A 1S5HB 4M1VA 5AB2A 4RDQG 1N4XL 2OA9A 2Q3AA 2Y9RT 3CHPA 3L5XH 4JPVH 3GRWL 5FOJA 5KANI 4L3EB 2R9JA 5ACLA 5ILTH 1U9KA 1L3NA 3DBXB 1VFUA 1OY3B 4PLJD 4GEIA 4DUWA 3TDJA 5EUKB 3K71A 1ZRUA 1MFNA 1PLBA 1CG9A 1ZS8A 2OZ4H 3BQUC 3ESPA 4FNLH 1UXWA 1A7NL 5JHDE 2VAJA 2WQVA 4TVPH 3VXSA 5HHOE 3T9WA 3APCA 5D7SL 1EFQA 1ET5A 4U1NA 4JQXA 1RZ7H 3BJ91 5DMIL 3B83A 2B4CH 3BIAX 4L8BB 1U36A 3AQXA 3HLAA 3UYRH 5ANHA 3F6JA 1GTKA 2D7TH 3K8KA 2EAEA 2YPLE 3L3GB 1BD2B 5IESL 4TVPD 5DEZA 3WTTA 1B88A 2RQEA 3T8XA 3SYOA 1QEWB 4OLZL 3WTWA 3OKDA 3WSQH 1MFCL 5KYXA 1JYWA 1HU8A 3BZFB 3EYUL 4HWBL 4MZIA 4IBUA 5BNXD 3FVOA 1KFGA 4YHPA 5AOMA 4JN1L 1OGPA 4MJID 3KD4A 3S4SA 1A14H 4XP6H 1WH0A 3DUUB 1BGXH 3RUGE 4F18A 4YKPA 3U9PH 3WO4B 1DUZB 4MFHA 1TWYA 3Q2CA 1DVQA 5ICUA 1R1CA 2APWA 4HHAB 5IQ7H 3X11A 4F8OA 1XH3B 4MDRA 1SQMA 4ZPTB 3CZKA 4NO3A 3AQYA 1NOLA 2AJSL 5DLML 5KW9H 1L9NA 2VRQA 3E80A 1HQ4A 4FZEH 4F3FA 5KZTA 3VGHA 2D4DA 4YAQA 1XCQA 2IDSA 1HI6A 4QT5A 1BM3H 4LLAA 1KBBA 3NIFE 3PXJA 2BIPA 3SIKA 5IQOA 3PWLA 2E0SA 1CFMA 3LQAH 1LAFE 1PBYA 2MTPA 3TV3H 4U49A 1CZ8H 3L8QA 3N85H 4DEPC 1FRGH 2QLYA 2W95A 2Y5EA 3KGCA 3SKNB 3P0VH 4JHWL 3EO9H 1VIWA 2HWZH 3ZQWA 1H9DA 2HZKA 1LBVA 5FOBA 2HTKD 4C55A 1LK3H 1BZ8A 3HNSH 1K4CB 1XO8A 1AFVL 1LLAA 4HWNA 4LZKA 4UWQB 3IETA 4WO0A 5KZCB 4BKLA 1ZVSA 2CLZB 1R5WA 3RWJA 3N0PB 1O63A 4Y9FA 4BZ2H 4DERA 3RPLA 5DUMH 5KJRL 4YDJB 4Y4FD 2DTML 1ZGLB 1MCWW 3MC0A 5IMOA 4YSPA 3A4FA 3B6SA 4YHZH 5AVUB 2Q87A 3U9WA 1K5NB 3ZHDA 4EOWL 2AIXA 2G5RA 3NRPA 3RNQA 1MLBA 4GRKA 4E5XG 3CFMA 5B1KA 1OVBA 3L3KA 1ZEAL 5DYOA 3KXFE 3H9ZA 4LBAA 4U2YA 3E8VA 3LNIA 3MZ1A 2Y1ZA 4FBPA 1AXSA 4JHBA 4HUVB 3EBGA 3D0VB 1KXHA 2VLKB 4N8PA 3ZMRA 2NY6C 3C6EA 4N2CA 1YEFH 3M45A 1GC1C 2D9QB 4HKJA 5F93C 2AL5A 1S7XB 1F3JB 1UXSA 1XZ0A 4WJKB 1WTGT 2QADD 3LRKA 3KR3L 4RIRA 2PTVA 4DESA 2A5UA 1P4BH 1IEBA 4WFFD 1KXVC 4MWFB 3S5LG 4P2OD 2NR6D 1HC1A 1D5ZA 1BJ8A 4PG2A 4Y4KC 2C9XA 4FXLA 1WEJL 3Q8AA 4PJFB 5HPOA 1MJJB 1R9LA 1MW1A 2FIXA 2NY4D 1HSLA 2YJLA 4JVIA 3Q1EA 5D2NA 5DVNA 3LCYA 4Y4FA 9CGTA 3MLVH 2DJ4A 2EO9A 4X6EB 1FA4A 3N40F 1A8EA 1WA0X 3ESUF 3K2UH 2WP3T 1A6ZA 5DHMC 1NBZB 2V5YA 1QI3A 4YHLL 2CKBB 5HDOA 4LP5A 2VT0A 5EO9A 2H32H 1L0QA 1SY6L 4BD4A 4BSVB 2EIZB 3QIBD 1QLRB 1T3FA 2D2CC 5CGTA 4U0RC 1F2QA 4PMEA 2Z7UA 4FCAA 4PJCE 1ORQA 2AKRB 4KKBC 2D7NA 4BHUA 4K8RL 1XD0A 4TUJA 5DD3L 1PZUB 1CBVH 4ODXB 3IO4A 3LN4B 5KYWB 2IEEA 4ABUA 3R8QA 2COVD 4HUNB 3RY3A 4W93A 3KSXA 1LBYA 1MCRA 5DTFB 2OI9C 1XMEB 2RHEA 3LQMA 1VHPA 4Z9KB 1JF1B 3MQIA 4K7PL 3MGOA 3OLEA 4R97C 4ADIA 4AQEA 2QMKA 1AE6L 4H8WL 2YJPA 2VXSL 5AVSB 5D2NC 3RUGA 2DQVA 1GGBH 2X89D 3ESMA 2EVIA 1NBQA 5TK4A 3MVWA 2DTMH 4HJUA 4XR8C 1MHHB 1J9RA 1YECH 5L6YL 3GSUB 4NG7A 5JIMA 1HHGA 2EH8L 2X44D 4EF2A 2P7TB 1WZ1L 2Q9OA 4NKIL 5K9KB 2X1OA 3MPKA 3AWEA 5HPMA 1DJHA 4QHMA 1QZNA 1NA8A 2QKIA 5EF0A 4N1HB 5CMMA 1E4JA 3B9KB 4HIHB 4GS7C 3MI6A 1I85C 2OJEB 2DJSA 1MS7A 2XWIA 3J27A 5IZZA 1SY6A 3DV6A 4NO0A 4Q9QL 3MKKA 3VFRA 1V3MA 2CK2A 4AY0A 1HZHL 4B3EA 3F62A 5DK2A 1E8XA 1SEBA 4CBZA 3V8XB 5HJDA 4M56A 1G94A 3O6GA 1N68A 1RZ8B 5GSRA 3ULVC 3GBNH 3O9WA 4LDOB 1C5CL 1CYGA 3L7FA 1EXUB 4I88A 5F6HJ 5KVEL 1AGBA 2EC8A 3ZO0A 4OFOA 1D5MA 2NW2B 4OAWB 5DJYA 4BCYA 3CG3A 4M7ZC 4PTUB 1SQ2N 3ZKSD 4NF6A 3EW3B 2OR9H 3BH4A 4Q0CA 3PGFH 5KBKA 5B38A 2NY0D 1LEKA 1DVUA 2GABA 4OZHE 1NGPL 3CC5A 4IMLA 4KRMB 3P40A 4OVTA 5A1AA 4X6CB 1OCWH 5FV1L 2YBGA 1NAMH 1K3IA 1D5XB 2K4WA 1PSKH 4PUBH 4GLIA 4NQDE 3V4LA 5I23A 5G5DA 4ZTEA 4XRCB 1ECYA 2XQBL 3ETBF 3NTCH 4KXZH 4M5ZH 4GNKB 3QULA 1ULVA 2XVBA 3NABH 3GEFA 3FFCA 2DW5A 5C0GB 2HEUA 3FFDB 3TBBA 1OSPL 4ONFL 3B2DC 3FASA 1MZZA 3Q27A 1M6OA 2JKLA 5IV2B 1TO4A 3AU1B 3NSYA 2PABA 3N06B 4APQC 1J9SA 3NT0A 1H44A 1WA2X 4CKQA 3KNBA 4ALAH 3H0TB 3QG7L 5IJCC 2MPAH 1OM9A 1QR1A 5EN2A 4IRJA 3IMWA 3LSOA 5L6YH 1T2QL 2ZXDA 4CL7A 4JO1H 1KMGA 3RDTC 2Y7PA 2IALB 5I75B 5KSBA 4ZMYA 2E8YA 2WOYA 3MTRA 1MW3A 5EBMB 3C6LB 4PE3A 2VXSH 1R17A 3I6GB 1FTJA 2AW2A 2EE9A 2XXMB 4FQXD 1GGGA 3IF1A 2K9FB 4PRAA 1NCAH 5JQHC 2YUWA 2I5YL 2O26U 3V4UL 3SYQA 2KZBA 3ZHFA 4CVXB 2HN7A 4GYBA 3P3RA 3T0EA 2UZIH 3QJQB 4PJGA 3WHXA 1VCAA 4JM2A 4AGOA 3ARBD 3ARWA 3CBJB 4LOFA 4H0WA 1GOHA 4PBHA 2CBPA 1ZA6B 2FWUA 4PRHA 5DD3H 4ANKA 4CW1A 4CN4A 1JNFA 2YAEA 4NBZB 5I16A 3BP6B 4JPWL 2H3NB 5TTRA 3T0XA 5JOPD 2PWFA 5CZVH 2RMNA 3QE5A 3OPZL 5LNEA 2Z7WA 4OFIA 4HVBA 1TJGH 3MRJB 3MLXH 3GBMH 4GT7A 3SDCA 4AT6B 2HHMA 1ZA3A 3PUVE 2FX8L 3FT3B 4YHLH 2PMSA 3D25A 2V8MA 3GHBH 4ZO7A 3PPSA 3WYRA 1A3ZA 2F7OA 3H55A 5D9SA 5E8NB 5FCUL 3UERA 3VFVB 2FNBA 5E7BA 1G5AA 3FOLA 4JFOA 3VI3A 3IF1B 2JKIS 1NV2A 2THIA 3EDJA 3D85B 3FTGB 4NAMA 1PIGA 2KMWA 5MHSD 4F9PA 1R3HA 3CLEL 1RIHH 1RZJH 4I9XA 1KIUB 1OD7A 4RAVB 2WTRB 2IALA 2CZKA 3FRUB 4OCRL 4AIXA 4KFQA 4NO0D 4XHJC 3IFNH 4TTGA 5F7BA 3MMEA 1WT5A 1ACZA 2DQCH 3FNKA 2VCOA 4MJJA 4PY8I 4UDTB 1JTOA 2A6JB 3W0WB 1J88A 1UH2A 4ZMXA 3K6WA 1QFUH 2IIJA 3SY0B 2H2SD 5I1DA 3DIFA 2CM5A 1IAIM 5KVDH 4U0QB 1RZIB 3B9DA 3CDZA 3TQWA 5LOMA 3GTNA 3QUXB 1JYVA 3EOTH 3B2VL 3BSGA 1QKZH 1YN7A 3E6HB 3G04B 3PP4H 3B9KD 4UQDA 1RU9L 1A1OB 2BJJX 1FP5A 1W80A 2DICA 5G5DB 4U21A 2CNZA 5I76B 4MXWL 5FYJD 3MLYL 2A83A 3PHQA 2A7BA 2IQ9L 2TSAA 4L8SA 4BV1A 1P7HL 4WDIB 2X9ZA 1DQMH 1MH5A 3IPFA 4L1TA 4J8RA 4X4ZA 1WHPA 4UNIA 3HG0A 2HTLD 4ZS6D 4PJGF 3K91A 1U91B 4FQQB 2BP5M 4JFFD 4JG0L 2XI9A 2Y7MA 2K7QA 1EHLL 5K59F 2BS8A 1CXEA 3B37A 3GXAA 5IBLD 1US4A 4LCUA 3DLNA 4DEWA 4ZZFA 4W9CC 3E6FB 1T1WA 4UYPA 5ACMA 1J18A 3L3HB 2VH5L 4UILL 1FQCA 1VZHA 3JVGC 1HXMA 4KJYA 4V33A 1CK0L 1MFUA 1WE5A 4U1KA 2AQRA 4NKOA 1O64A 1KCSH 2VTFA 1LO5A 4DXCA 1DTUA 2G5BA 1UFGA 3LN5A 1WUZA 4Y16D 4IS6B 1FH2A 3GBLA 4JM2D 4M93B 4LRNL 3VMNA 2PO6D 3WKQA 1OIBA 4RRPM 2HLAA 4Q14A 2G3NA 3FKUS 3GMMA 1QACA 1BAFH 4O2CB 1QJMA 2F7CA 1C12B 1OZUA 1SLXA 3TFKC 3DHPA 4HT1H 5EMYA 2BNRE 5HXMA 3UN6A 1U21A 4QHLB 3ZHNA 4AW7A 5DEFA 2RJMA 4GXFA 3ZKNC 1IKNC 1MCWM 4TXVB 3VXQB 3WFBH 2VDKB 1VPOL 1Z9MA 5LBVA 1KF9B 2DQGL 2GSGA 2P9RA 5B3NA 3LH2H 1N59A 3Q7JA 2R9HD 5MEOB 2VR7A 4G8IB 4PGBA 3BKJL 4HKBA 3CDFA 4JE4B 1B6UA 3QZWA 2HRPL 1NCTA 1LCTA 2PP9A 3SBWC 1CYWA 1HCFX 2AANA 3SQRA 2QFLA 1FQBA 1CFVH 2Q8AH 4JDFA 1IUDA 4QRSB 5JR1L 2XWVA 1UHVA 4PY7A 2OMXA 4Z78A 1KC5L 4JFQA 1E40A 1A7NH 2BVOA 4WSKA 5F7DB 4BSVA 4F3SA 3DGCR 3TU6A 4JFDA 5L9DH 2JJTC 1NC4A 1PZCA 4QF9A 1S5IH 1UA6L 2ZF8A 4N6KA 1YNKL 4DSYA 1MY0A 1UASA 5BS0A 4Y4FB 1NGZB 2UXAA 2BY2A 5GS3A 1IE5A 3TZAA 1JTTA 4L4TA 3O4LB 1MJJA 4JO4L 1YPZA 5CZKA 5JR1H 3S9DB 4EQ7A 3D33A 3WIFB 4DGVL 4BFJA 2PFYA 5DVKA 4NPKA 1QNIA 5KVEE 3PXLA 2H4IA 4K3JH 3VWKB 4IEFA 3H6AA 4WJG3 2CK0L 2RH0A 3KBPA 3POCA 5I1EL 4ZFOL 5F1NB 2ZOLA 4ZSOB 3L2MA 2WVVA 1A9VA 4GWOA 2P24B 1AIFB 1A02N 3MGTB 2NOOA 4U3SB 5DZVA 5IHUH 3T3PB 1FTAA 4ECFA 3RU8H 3E1F1 1MWAH 1DE4A 1E9PA 4R7DB 1H5BC 4FE9A 5HJBA 1TQBC 2ED9A 3FO2B 4JRWA 1YEEL 1FAIH 1PTZA 4NRXA 3ARFB 3ZY7A 5IOPB 5INDA 2BSRA 4MAUH 3TO4D 1I8MA 1T1YA 3X13A 2ONKE 1KLGB 3QXVA 1VACA 1BQ5A 4LVHB 1WZMA 3O6FB 3ZLQC 2HXWA 4P8BA 3CMOH 3KCPA 1NMBL 4YIQB 4JY5H 4ZTPL 3MR9B 4EI6B 4KVCH 3B7SA 2N1TE 3K6XA 3KH4A 5F1IB 1R46A 1Z9PA 1OF2A 4W4OA 1Z5LB 3FU8A 5T3ZL 1F9BA 2B4LA 1LFHA 4BDNA 4KKCD 2DN7A 3DX4A 4M7KH 5EBWA 1F18A 5EUOB 3F3HA 2YPNA 3BW9A 3U4BH 4AI7A 3CSPA 5GRYA 5I1GH 3GINA 1OLAA 2HFBA 1NCCL 3MBXL 2ORBH 2KL6A 1KFAH 4G2ZA 3P69A 2IAAC 1N5AB 1KTLA 1ITCA 2AJYL 1NFDA 3ZKKA 1UH3A 3ULVH 3LEXA 1HOEA 4WI5A 1G1CA 3D2UD 5I71C 2EYTA 4LLYB 4XN2A 4P46A 2G0LA 4UQ3B 2VWEE 3SD2A 1QSFD 1UURA 1M7IA 2ICWB 5GJTH 3RTLA 1BXUA 2N01B 3WFDH 1H3PH 3DHJA 4ZUTA 4AKOA 4X5PA 4PJDB 7PAZA 5A7EA 1EEZA 1SEQL 1SLVA 5D1ZB 1M5BA 1H15B 2OJZL 3RFZC 1T2XA 2YSSB 5K93A 3KPMB 3MJ7B 3EF7A 5K9QG 3GZQA 4NQDB 3B8YA 3QUYC 1RUQH 4UT9A 4NQCA 5JLZB 3CI8A 1YY9D 3K01A 2IWEA 1XR9A 2Z64C 4MKTA 3C32A 1OP9A 3CZSA 3ZHLA 4R84A 3PTYA 3C60B 1KJ2L 1ZE3H 2FT8A 4E2OA 3SKJL 1H19A 2DQIH 2OTUB 5I24A 4NC1E 3AG4B 4ZRGA 4HIIB 4A7GA 4OZ9A 3UAJC 3WFCL 1CDIA 1JERA 3OJDB 3OKMB 1G1OA 5AEAA 2VWEC 4O2EB 3BVVA 4YHYB 1YDPA 2WXLA 4P5RA 1F11A 1I1RA 3JSSA 1FZMB 4OLXH 2H26B 4K55A 5KVDL 3U36B 3ARSA 2BJML 3ZHKA 4KKNA 2F3DA 4P05A 3NCJH 4AK1A 2JFCA 2F6GA 3Q01A 2F78A 1RP9A 4B9KC 3ABGA 2HB0A 2GTWB 1R5IA 2FD6L 4D3CH 4JHAH 5SX4I 2BRRH 3MYJA 2QKSA 2PBWA 2BY0A 3DK0A 4G6MH 5JLZA 2DQMA 2MIZA 1N18A 3D4CA 2XVLA 5E1HB 5JIQA 2QVUA 3BT0A 2DWDA 5AA4B 3NJMA 4PG9B 1R3IL 3IMRA 4XXCC 1ZPLA 3VFOA 1A7RL 4JVCA 15C8L 4L9LC 4PJAB 3EJYD 3Q8CA 5IEKB 4F7CB 1OOWA 4XAKE 3BCFA 4QD2E 5IHHA 4DTGH 3MPCA 2JSFA 4G8AC 4EKJA 1S7WB 2LFGA 4OZFA 2FGWL 2L5VA 2XXRA 2B9AA 4LDLB 5A5XB 4JPWH 4EDWL 4UT6A 1KJ2A 3UBFA 2BJIA 3ARBC 4GAJH 5I15L 3VYNA 3O45A 3CK0L 4NM8L 4TV3A 1AQHA 4X0KA 4R90L 3OKEA 3ULVE 3AWFA 1W72B 2UZIL 3LXAA 3VVFA 5CCKH 4A6YL 2MNWA 3WXVL 2W9DL 3IJXB 1SMAA 4A6YB 2VZSA 3T3ME 3VUAA 4P2QD 2WNGA 3QFJB 4OSUH 5TE7H 3KH3A 2GK0B 1MEXL 4G9FA 4U6XB 1AIZA 1YEHH 4RDBA 2WIIA 4LARH 3OAZH 1HINH 1EAJA 4PJGE 4HUKB 1NH6A 3G5ZB 4G8GA 1NL5A 5LCVA 4GWUA 1PL3A 2ENQA 4K3EL 4FHJA 5BRPA 1UGKA 1E9QA 4MJ5B 5H37H 2NQCA 4OZFH 2VLMD 1COBA 4NS0A 4HOWA 1Y6MR 2BLFA 4UDUB 1U8QA 5F71A 5TQ2H 3T0BA 2P5EB 4XB8A 4BKTC 4EIBA 1J8RA 5F7WC 1UTBB 1JHKL 2DRUA 4G6AC 1YAEA 3UTZB 1O9VA 5KSBE 4NNXB 3TTRA 4P5TB 5HTSA 4CMHC 4BDVA 3NSXA 1CR9H 3VVVA 5AVXB 1B0LA 5CD3B 5FF6A 4LCCB 4RA0C 3X14A 4KOBA 4X4YB 4ZMZA 2C3XA 2NY2D 4PJHB 2FECI 4EQBA 3MBPA 1HN1A 2CPCA 1CLYH 1ZANL 5DT1H 2H8PA 4I40A 1TIUA 1BZ9A 1KB5L 4NXSA 2FIKB 3OKYA 5JW3H 1F97A 3BKCH 1QSVA 5B4MD 2WJ7A 2GQHA 1KN2H 2ZT9C 4N20A 2X7QA 2XFGB 4G9FD 2ZKMX 5EIQA 3FHAA 3NCCB 3NEEA 4BM7A 5EOCJ 3QJRB 2WANA 2DSFA 1CDGA 1EO8H 4PH8A 3F05A 2OSLA 4XB7A 2GUYA 2NQDA 5KWYC 5L2JB 2PYYA 5DO8A 3HPJA 3UBXG 3DJSA 1U58B 2E1SA 4FXGB 3STZB 3MRKA 3Q44A 5ESVB 4DGYH 1Q94B 3HE7C 4HJJL 2A9AA 4ODWA 4AL8L 4MB4A 2MFNA 4KUZH 1DBJL 5C0AB 2R8SH 1A1MB 1I7ZA 3FYEB 2QPFA 4N2IA 5JEIA 2VDKL 1A9EB 3N50A 3O9WD 4P49A 1CE6B 4HFWB 3KPRD 3TZVC 1J8KA 3VRLF 1QSFB 2PWEA 2N56A 3OKOA 4AM0B 5DS2A 4KPTA 4A68A 3UDWC 3QJFA 4LCCA 5KSVA 2PW2A 1E3FA 3LPWA 4GVOA 4N2KA 3H3GA 1U3HC 1MCHA 4BUHA 4MQSB 3RX9A 4YFLF 4JVUA 2AJ3A 4JB9H 1DQDL 4ETYA 2EDMA 1XSJA 1HJCA 4NIKB 4H67A 1VKXB 1UWYA 1ZT7B 3DTUB 4F9LC 2A0LD 2K70A 3L54A 5GQBA 2N1KA 4KX8A 2K3HA 5F7LB 5C0EB 2CDEB 3QA3B