4XFEA

Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d-glucuronate
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
306
structure length
306
Chain Sequence
LDIKFAEIHPAGYPTVVAEQNMGKKLEQASNGDITFKMFAGGVLGSEKEVIEQAQIGAVQMTRVSLGIVGPVVPDVNVFNMPFVFRDHDHMRKIIDGEIGQEILDKITNSDFNLVALAWMDGGSRSIYTKKPVRSLEDLKGMKIRVQGNPLFIDMMNAMGGNGIAMDTGEIFSALQTGVIDGAENNPPTLLEHNHFQSAKYYTLTGHLILPEPVVMSKTTWNKLTPEQQVLVKKVAREAQMEERALWDAKSAASEEKLKAAGVEFITVDKKPFYDATASVREKYGAQYADLMKRIDAVQAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a TRAP periplasmic solute binding protein from Pseudomonas putida F1 (Pput_1203), Target EFI-500184, with bound D-glucuronate
rcsb
source organism Pseudomonas putida nd6
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter subunit DctP
total genus 100
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4xfeA00
4NQ8A 3FXBA 4OANA 4MAGA 3U65A 4X8RA 4DI4B 5CM6A 2VPOA 4PDHA 2HZLA 4OVPA 4N91A 4P3LA 4YICA 4PC9A 2VPNA 4N6KA 4PETA 2HZKA 4PCDA 4P56A 2XWKA 4PBQA 4PFIA 4MMPA 4NGUA 4PBHA 4MHFA 4YZZA 5I5PA 4NX1A 2ZZWA 5I7IA 4OVTA 2PFZA 2ZZXA 4PF6A 2XA5A 3B50A 5IM2A 4NAPA 4PFBA 2XWOA 5LTCA 4P8BA 4P47A 4MCOA 4PE3A 4PDDA 2HPGA 4N8GA 4OVRA 4N4UA 2CEYA 2V4CA 2XWVA 4PF8A 2ZZVA 4NF0A 4O8MA 4MIJA 4XEQA 4P1EA 2WX9A 4XF5A 4MEVA 4PAIA 4PGPA 4DI3D 4N15A 4X04A 4NHBA 2WYKA 4OVSA 4N8YA 5IZZA 4O7MA 4PFRA 4UABA 4XFEA 4MNPA 4PGNA 5IGAA 4PAFA 2WYPA 4NN3A 4N17A 4OVQA 3GYYA 4NG7A 2CEXA 4N6DA 4P1LA 2PFYA 4MX6A 4MNCA 2XWIA 4LN5A 4OA4A 4O94A 4P9KA 2XXKA 4MNIA 4PAKA
chains in the Genus database with same CATH superfamily
2I3WA 2QS1A 2OBGA 3W9VA 3IR1A 4F31B 1TWYA 3LUYA 2YLNA 4OVPA 3KC0A 1EYIA 4GQOA 3V89B 3EN3A 3G3JA 1BTJA 3KBZA 1IXHA 1EZPA 2ZNUA 2IEEA 3IX1A 1NV2A 2UVIA 1B6HA 2DWHA 1NV1A 2G93A 4ELQA 3NOHA 4F2OA 1US5A 4RA1A 2ZZXA 1VFEA 4PF6A 1LBBA 3OO9A 3CG3A 3HV1A 2H4IA 1BP5A 5AA1A 5F7VA 1Q9DA 2REJA 3CSGA 3OOAA 1JEUA 3K2DA 1JEVA 1FPLA 4R2FA 2B3FA 2R9JA 3K6VA 4R9GA 3FXQA 1LAHE 1MDP1 3H06B 4YB7A 4F3SA 3FV2A 5HBCA 2QS2A 4F39A 2YPNA 1TFAA 3K4UA 4JDFA 1B7UA 4JWXA 1LBVA 4GIZA 5I57A 3RT6B 5IGAA 3IORA 5DYHA 4OTEA 1B5HA 1I69A 1NUXA 1UTHA 2V3TA 1SW5A 5I3SA 3TPAA 2PFYA 4MX6A 4OZ9A 3BIGA 4EF1A 4GVOA 2O1MA 2OX3A 4F18A 3A29A 5A5LA 5H8FA 2O7IA 2XXPA 4ECFA 1BIYA 4DZ1A 4NQ8A 4QF9A 1LAFE 2HZLA 4R6YA 2JJKA 2F34A 5ET7A 5EQAA 5KDTA 1VSOA 4I1DA 4BLAA 1D9YA 3VXCA 3CSBA 4Q8RA 5T3JA 3TTRA 3B7DA 5DVFA 3N6UA 2P0SA 1MRPA 1KWHA 3M3LA 1LBXA 1MQJA 5H8SA 4AS5A 3D4GA 4JWOA 1B4HA 1MQGA 4RXLA 4F1VA 4R6HA 1NL5A 2ZYNA 3MP8A 3B50A 4O3BA 4G2ZA 4N81A 5AA4B 3EF7A 2I4CA 1MQIA 1CE2A 5HM4B 3CFZA 3OENA 1O64A 3G3IA 4LUBA 2FYIA 2QRYA 1TT1A 2O6AA 5BWJA 3SEXA 4AS4A 4KFQA 4MIJA 4ESXA 2QVUA 1MPCA 3LSXA 1EZOA 3H6VA 4MLQA 1MXZA 1UIVA 2VD2A 3O6GA 4PQJA 4BDQA 3ILUB 2HXWA 2DDKA 2ZXTA 2PCRA 3Q27A 5CMKA 2PT1A 4NF5A 3E9XA 3QIMA 5H8QB 1IMEA 4LZ5A 4BDOA 1H43A 4YMAA 1RYXA 1FBEA 1LGBC 2OWTA 1IEJA 5H8FB 2XX7A 5CM6A 1F9BA 4BDNA 4GL0A 1DTZA 4H8JA 2X26A 3GBBA 5CMBA 3EHTA 3U93A 1HSEA 1Y3NA 1FRPA 1D3KA 3EHSA 4ZEKA 2DE3A 5FTHA 2B4LA 1LCFA 4I9DA 2WBBA 3RTWB 1I6QA 3IL1B 4RY1A 3PMVA 2B65A 1HSLA 2THIA 1PB7A 1CB6A 3R26A 2VOZA 1N7WA 3DP6A 3FBPA 1DPEA 4OFJA 1P1NA 4QSDA 2FVZA 5I2NA 1O63A 4MBPA 3K02A 1B5JA 1LB8A 4FATA 1MXYA 4ND9A 2F3DA 3FIRA 4F2QA 4PAIA 5FHMA 4G8MA 1OQHA 3EKIA 4NHBA 4NWDA 2V25A 3T93B 4HTGA 5F1QA 5IZZA 1FJ6A 3FASA 4LONB 4GD5A 4ZS9A 4OENA 4XFEA 2F78A 4FJPA 4PGNA 5ITOA 2R8TA 5KDTB 4Q0CA 1GV8A 4NF4B 1XT8A 5LDZA 2A5TA 2QPQA 2DXRA 4OQOA 3B6QA 2XWIA 2XXQA 4ZZAA 5JTYB 3TMGA 2F97A 4E0WA 3QUJA 4QXDA 4MAGA 4X8RA 3KJTA 4GX6A 3O6IA 2HQ0A 1MDQA 1LBCA 3RT8A 5AA4A 3CRBA 4PCDA 3A3UA 2F6PA 4X1BA 1XI6A 2AL5A 1FQCA 3RN8A 2RC7A 1IXIA 3ROJA 1SDXA 4H45A 4H46A 1FSAA 4G61A 3RTFB 1LBWA 2Q8MA 5I57B 4JB7A 4NF6B 1B32A 4GX4A 5ESYA 3VLWA 4KI0E 1MXWA 1Y3PA 5I59A 1IZ1A 5AA3A 5KZTA 3Q25A 4ZE9A 4IGTA 4M1VA 5DVJA 2HHMA 3SEVA 3QUFA 1AWBA 2CEYA 2PX1A 4AB6A 1EZ9A 1IMBA 1II5A 3FATA 1MQHA 3E13X 3S4UA 1WVJA 1VFDA 4LVQA 4XKRA 3D4CA 3RQTA 4IB2A 1D4NA 1EU8A 4IY6A 4KCDA 1Q1KA 2ZMBA 4Q30B 1J1NA 3VLVA 5F24A 1P1UA 2DS9A 3I5OA 1POY1 2DWIA 3SETA 5ICTA 2CMOA 2UYEA 2I4BA 3O6HA 5EQ9A 3OEKA 1MXVA 2UXAA 1R6ZA 2ALUA 4TQUQ 1G0IA 5I84A 1LLSA 1PB8A 3VFJA 2VPNA 2GHBA 1G0HA 2R6GE 1Y1MA 3FVKA 2ONSA 2Q9TA 1R9QA 1P1WA 1SBPA 1PBQA 3PUVE 3IFAA 4YKKA 3VVDA 4ZE8A 1AL3A 1IUDA 3TTMA 2O1LA 3VDFA 3ILTB 3PUXE 3Q28A 1MH3A 1UTBA 3U92A 3TUSA 1OQGA 1QUJA 3PU5A 3JZJA 4G4PA 4BDLA 4RK9A 2OJTA 2O51A 2ONKE 1A99A 1WODA 3IOWA 3MUQA 4DI3D 1NH8A 2ESNA 4KQPA 1XVXA 1I6AA 1N3XA 2PBWA 1AOVA 3PUZE 4X1DA 4UABA 1PEBA 3BFTA 3S9NC 1USYH 3ZSFA 3TCGA 4OVQA 1M5DA 3CVGA 3VVFA 1NV3A 2CEXA 1P1OA 4POWA 4R6KA 4F3PA 2I0CA 4G8HA 2A5SA 4ZEFA 5AA2D 3RPWA 2A5TB 4MLVA 1OLAA 2QJEA 2FA7A 3FJGA 3S9EA 3HHFA 5I56B 2E0SA 4YICA 3O28A 4PETA 5TP9A 2HZKA 4MJOA 3PD9A 2I6EA 1SYHA 3HHGA 3ISPA 1A8EA 3UA8A 4PBQA 3HCQA 3SEWA 3IFCA 4NX1A 2AIXA 5A5XB 4QSEA 1R1NA 3HO7A 4H6DA 4FE8A 1Y4TA 3MZ1A 1FCKA 1SW2A 3TEPA 4PFBA 3U72A 3LSFB 2F35A 1QVSA 2QS4A 1SI1A 3WAFA 3MQ9A 4PE3A 5JTYA 3G3FA 1ZU0A 4YKPA 4N4UA 1S7YA 1PBPA 1H45A 2XXRA 3EQ1A 1SYIA 2UYFA 3TQWA 4GWUA 3MPKA 3IOUA 4IO3A 4P0GA 4FORA 3KBRA 4PFRA 2F7CA 3K1PA 2DYXA 1B2HA 3HPIA 4WEPA 2WYPA 5FHNA 4N17A 3FD3A 3VXBA 2V93A 2FNCA 1DCUA 2QFLA 4JBZA 3K1NA 4NF5B 1B52A 3RNNA 5H8QA 4YKJA 4U23A 2DWJA 4PAKA 4IO4A 3GBAA 1Q35A 5AE4A 1NI9A 1NV4A 2XXVA 1OLCA 2NUVA 3FXBA 4RPOA 4P11A 3SDFA 3U65A 4DI4B 3K6XA 1FPGA 4P3LA 1B3EA 3TELA 2PVUA 5H8NB 1FBCA 4L17A 1B7ZA 3MVZA 1A54A 3RLFE 1T0KA 4EQ7A 2Y5KA 4ZZEA 4PFIA 4Z0IA 4I3EA 3SESA 1MXUA 3C4MA 4MHFA 1ANFA 2FIEA 2HAVA 1YCJA 1FPBA 1AH5A 1MY0A 4XKQA 1FTMA 2Z23A 2CZIA 4QBAA 3BKIB 1B7HA 2DQVA 3ZS6A 4YMBA 2XXUA 4P8BA 4YAHX 1H76A 2HEUA 3LSWA 1SPIA 3A09A 4KCCA 1Y20A 4FECA 4PF8A 2CZHA 3MP1A 4DXBA 4P1EA 3FXUA 1FQBA 4GWZA 2WYKA 4I3YA 2DVCA 4QHQA 3GZGA 1YYZA 3OSRA 4R75A 5I56A 1QW0A 3H4ZA 3OD7A 4FBPA 2HCAA 4LQ2A 4ONYA 4P1LA 3TTNA 3UORA 1DK4A 3S9LC 4OA4A 2VGQA 1KA1A 3FXRA 4GXSB 2E1SA 4OESA 4EXKA 2VPOA 1RDYA 5EQ7A 1Y9UA 1QJMA 3T0JA 5FBPA 4JSDA 2H5YA 2B3BA 3IJXB 1GGGA 4X9TA 2RC8A 1ZLQA 3KC1A 3QAXA 3TZAA 4ZEDA 2GFEA 4PE5B 1RYOA 3MP6A 1FW0A 1GVCA 1B4ZA 1JNFA 1NFTA 3W15C 4GWYA 4H8IA 3LV0A 1DTGA 5IAIA 4GXAA 4ZDMA 2VD3A 5A5XA 4HE1A 3K01A 3UN6A 5CBSA 1B3LA 4IY5A 3E4RA 2LAOA 4LATA 1TXFA 5TU0A 1YPNA 2I49A 2HPGA 2AL4A 4DXUA 4XKNA 3LSLA 1FPIA 4KYSA 2F7BA 2H9BA 3MJNA 4NF0A 3H3GA 3IB0A 4TOZA 3USDA 3T9VA 1INPA 4OETA 2DE2A 4OVSA 3M8UA 1NNPA 3E3KA 1OMPA 4ZECA 3DLNA 3ZKKA 4RK2A 4WEDA 1RDZA 3MVXA 4RNSA 1M5FA 1IIWA 4KYEA 3MSTA 1QGXA 4GL8A 3R7XA 2XXWA 4NF6A 4YB5A 4E0XA 3O97A 4HE2A 3UGWA 3H03A 1M5CA 1MXXA 4PFTA 1NNFA 4N6KA 1S9TA 2G29A 4N07A 3PTYA 1MM7A 3FVOA 1SD3A 1B1XA 4DCXA 1M5BA 2F5XA 3MC2A 2OWSA 3K00A 3SEUA 2DVZA 2VT5A 4NGUA 1NNTA 4YZZA 3LBSA 4NF8A 5TPAB 4JVDA 2O68A 1JW5A 3KSXA 5DTBA 2RF1A 5EYFA 4AQ4A 3BIHA 2XD3A 4HE0A 2ZNTA 4ELPA 2OZZA 4PDDA 3CFXA 1NV7A 5I59B 3LC8A 4MEVA 4XIGQ 3VV5A 4U2RA 1KZ8A 3L6GA 3TCHA 3UK4A 1FPEA 3TKDA 1MY4A 3H6UA 5TP9B 3T66A 5EYHA 2RCBA 1R9LA 4EF2A 3OELA 4JVIA 2Q2CA 3CR9A 4KR5A 1LBYA 2GH9A 4U21A 3R6UA 3C33A 4JXIA 5JEIA 2BJJX 3PMXA 4QFNA 5HPQA 1NV6A 3RGYA 3FJMA 3PPOA 4G77A 4MNIA 4FAJA 3IB2A 3T9HB 1VDWA 1FTLA 3K0VA 1EYJA 4OANA 1N3WA 1S50A 2ZYKA 3VE1B 5CRYA 3QXMA 3CIJA 4OERA 2ANJA 2GQ1A 3PUWE 1JQFA 2NOOA 5I58B 1HSJA 5CMMA 2Q2AA 1NKXA 5ICQA 3MAMA 4EDPA 1MY3A 4R74A 3C31A 3Q29A 4HCYA 1N0TA 5DT6A 4KHZE 1A7LA 2F8DA 3MYUA 2Y7IA 4G68C 5M2VA 3PPRA 4WKMA 4HXVA 4UACA 1H44A 2H25A 3H7MA 3K6WA 2QS3A 4PFWA 3RYDA 4QFLA 2ZNSA 4OVRA 1AIVA 4JWYA 2WEFA 3RY3A 2WX9A 3QYTA 2I0BA 2M8CA 1LAXA 5IZ1A 1B9JA 2BJIA 3HN0A 3O66A 3TQLA 4F1YA 1URGA 1POTA 1ZJLA 4GBWA 1B05A 2ABHA 3C34A 3KEIA 2RKMA 1B3HA 2Q74A 2DSFA 3CFLA 3KJ7A 2IA4A 1GR2A 2H98A 3SKPA 1SVXB 2H99A 3OO8A 2ZYMA 3S2VA 4GWOA 3D1RA 4G8NA 3MZBA 3DELB 2XXKA 4NEDA 1BK4A 2DE4A 1JVXA 3DP4A 2QL3A 1NUZA 3ODBA 4OMBA 4NE4A 4PTKA 2YJPA 4N6PA 3KZGA 4N91A 1BLFA 4O7IA 4RPNA 4IO2A 5CI5A 2V3UA 4ELRA 4U4SA 1KA0A 4XTCQ 3PPNA 4DE8A 2ZYOA 3MZ9A 3W9WA 4ISUA 4IR8A 4OYVA 1FQDA 5L8DA 2Z8DA 5L9SA 4KD5A 1MPDA 5B70A 2D21A 3T9UA 5I7IA 2DOJA 3TYHA 2XA5A 3KN7A 4ELOA 1B1HA 3HSTA 1BKAA 2D5WA 2RINA 1FPKA 3C32A 3IO4A 2VP1A 2HFBA 3KOTA 5AA2B 3K6UA 3N94A 3FUZA 3FVNA 2R71A 1DBZA 1IMFA 2FBPA 2ZZVA 4O8MA 2OCUA 3HFUA 3AXFA 4ZEIA 3FJ7A 1B58A 1QUIA 1JW1A 3G7WA 1LAGE 3C9HA 3S9MC 1N76A 1LFIA 1FBHA 4K3FA 1B0HA 5L9OA 2Q89A 4NN3A 3IAZA 3KN3A 5KCJA 4OXVA 2QSXA 5DEXA 4MH5A 1FPDA 2X7QA 3SEYA 4F19A 4O94A 4NTLA 1YXIA 3F11A 3MWBA 3KSJA 4GF8A 4PC9A 3IO6A 2Z22A 1FTKA 1B3GA 3THIA 3IB1A 4NMYA 5DW8A 5IKBA 3K1MA 1SI0A 2I3VA 1IMAA 1JW4A 1FBDA 4KXPA 2Z8FA 4C0RA 3MW0A 3BFUA 5LOMA 3UP9A 1N7XA 2QMWA 1IITA 4IO6A 2XXXA 2QVRA 4MFIA 2GHAA 2XXYA 5EHSA 2OWZA 4PP0A 4H5GA 4KPTA 4YB6A 1A8FA 1FQAA 3PPPA 4H65A 1Z7ME 4O7MA 3IOVA 4DLDA 1H3DA 2F36A 3U94A 4GBVA 4MNPA 3LR1A 1FQEA 4PAFA 4M4GA 4GX3A 5I2KB 1DSNA 2HXRA 4TLMB 5EQ8A 4F3BA 1ZTYA 3DP8A 1MY2A 1DOTA 3M3FA 4Q5TA 4O3AA 2NVUB 4NF8B 4HCWA 1NH7A 1FBFA 5BUUA 1XHYA 3V5AA 3V83A 1YZ0A 1D9QA 1A40A 1QKBA 4PDHA 1IQ7A 3G3GA 1MQDA 5FTIA 1FTOA 4U4XA 1O7TA 5AA2A 2GRVA 3B6TA 2CZLA 3I6VA 3U1OA 1Y4CA 4GFRA 5H8NA 3Q26A 1M5EA 1UQWA 5DVIA 1LBZA 1WDNA 4R9FA 3KGCA 1ELJA 1URSA 1XOCA 4IGRA 4YKIA 4FEDA 2Y7RA 3TODA 1VR5A 2XWOA 5LTCA 2P2AA 4P47A 5ET5A 4BDMA 1VE4A 1ZBMA 3IOTA 3MVWA 4MCOA 4UA8A 2W7YA 3PV0E 2PYYA 5CMCA 2Y7PA 2RC9A 1USYE 3QSLA 3N5LA 1K9YA 4RJZA 4RYAA 1GTKA 4G68B 2Y84A 4NF4A 3G3HA 4GWWA 3T96B 3A3CA 1AMFA 5CBRA 4EXLA 5JK4A 2PT2A 4X48A 3IJOB 1RKMA 1ZIUA 2CZKA 3EHUA 4QRZA 2XD2A 3GXAA 3MPLA 3WAEA 2FIXA 1IMDA 1FPJA 5ET8A 4THIA 4ESWA 3GYYA 3EPEA 4NG7A 2UVHA 1Y3QA 2P3NA 3RPLA 1SW4A 5ET6A 2KLFA 4F22A 3H6TA 4FIMA 4H0WA 4OFLA 4HW8A 3L6HA 4FEBA 4H1XA 4LA9A 4IO7A 1DPPA 2QMXA 3ECRA 4GOTA 3SERA 4O3CA 1FPFA 3JV9A 1B40A 3QMFA 2WKYA 1YAEA 3G3KA 3PUYE 3KN8A 1FTJA 4P56A 4OEVA 1Z7NE 2P3VA 4U22A 3C36A 4DCYA 2X7PA 3TDJA 2Y7WA 1UTHB 2HAUA 4MMPA 1IXCA 1US4A 5I5PA 2XXIA 1L5TA 5ITPA 1FQFA 1B3FA 2REGA 2PFZA 1URDA 1QUKA 2I58A 4NAPA 3OSQA 3SZPA 3H6WA 4WXJA 1PDAA 4P0IA 1XVYA 1FBGA 4GRKA 4I8CA 5K2YA 3TTLA 2OK2A 2V4CA 4OEUA 4OVJA 3GLBA 3O9PA 4EQ9A 2NWJA 4XF5A 1LFHA 3OO7A 3PGFA 4IO5A 4LZ8A 3C35A 1CNQA 4F29A 1OIBA 2V84A 4DDDA 2D3IA 1MH4A 4F3GA 4H67A 3DM0A 1NV0A 5J1DA 3CHGA 1NMUA 3B8BA 4EQBA 1P1QA 4OWDA 4POXA 2OLBA 1NV5A 1P99A 4MNCA 4U1OA 4OHNA 4BDRA 1ZKBA 4PFUA 3TCFA 3RPLB 1B46A 3BBRA 2O69A 4HS7A 3ZKLA 5IZ3B 3M3KA 4QFOA 3OXNA 3N26A 1LB9A 1MY1A 2XWKA 4GLIA 4R73A 4GWXA 1N84A 2L5VA 5H8HB 4I40A 4AB5A 2VHAA 4DXCA 4U1ZA 1OVBA 1EYKA 1SW1A 3MVYA 3OMBA 2PMSA 3RUMA 2DWAA 5EHMA 5I58A 2DP8A 4DIGA 5L9MA 2I48A 2XXHA 2ONRA 2FHYA 3I3VA 5B7DA 5IM2A 5ISUA 2Y5LA 2XX8A 3O2AA 2F7AA 4JSOA 1RDXA 4N8GA 3T1BA 3FVGA 3CG1A 1JETA 1JVYA 4LP2B 2XWVA 1ATGA 3PD8A 3OEMA 3T22A 4QSCA 2O7UA 4PGPA 4QFPA 4N15A 4XXUA 4R2BA 2XXTA 4X04A 5IZ3A 1QKAA 4LQ5A 2Q8JA 2UVJA 1FTAA 3MBPA 4N8YA 1N04A 1DMBA 1I6BA 2DXYA 2RCAA 3TTKA 3CI8A 4F1UA 2Z8EA 3LUZA 3U8QA 1B51A 1UIUA 4GWSA 3FGSA 5K2XA 4N6DA 4C1TA 3TAJA 1UTBB 5ELVA 5J16A 5I2NB 4EUOA 4MF3A 5KCJB 1NUWA 4TLLB 3B6WA 5DEXB 5TPAA 1D9VA 3PMWA 1A55A 1IXGA 2F3BA 1LEVA 2MKZA 5CC2A 1MS7A 1LFGA 1ZMGA 4G68A 3FZVA 4Z7EA 3OO6A 1B5IA 1FBPA 4PBHA 1QULA 1PB9A 4OFOA 1XC1A 1MM6A 2UVGA 2ZZWA 1B0LA 4C1UA 2NXOA 4OVTA 2B4MA 2KQZA 1K9ZA 5I2KA 1LCTA 3E79A 1MPBA 1NUYA 4H5FA 3KOSA 1XS5A 1NNKA 1TFDA 2V3QA 3UIFA 3VVEA 2Y7KA 1JP4A 2F6GA 1FJ9A 4ZEBA 3KFMA 3QK6A 3PPQA 2QVVA 3IK6B 1Y1ZA 3TFLA 4YU0A 2XHDA 3KG2A 4XEQA 1OVTA 1SQYA 3FV1A 1MG1A 1YTVA 1EH3A 2WBDA 3JYRA 3V8XB 2XX9A 3E78A 4XKPA 3VLUA 2P1SA 3N6TA 4JVCA 4NWCA 3O29A 4QFKA 4N13A 3ONMA 2O84X 5EYGA 1PC3A 1IMCA 3P7IA 4PFYA 2KR0A 4KYDA 5H8HA 4LZ7A 2Q88A 4R72A 4LN5A 1LSTA 5FHOA 3T9XB 4P9KA 4I62A 2AYSA
chains in the Genus database with same CATH topology
3MSTA 1QGXA 1VDWA 5EQ9A 3RPLB 1NI9A 1NUZA 1NV4A 1YZ0A 4NQ8A 1D9QA 1EYJA 3FXBA 4QXDA 4OANA 3W9VA 4MAGA 3U65A 4HE2A 4X8RA 4DI4B 4PTKA 2VPOA 4PDHA 5CM6A 2HZLA 1RDYA 1FPFA 4OVPA 3KC0A 5IZ3B 4N91A 5EQ7A 1FPGA 4P3LA 4GX6A 4YICA 1G0IA 3QMFA 2JJKA 4O7IA 4PC9A 5ET7A 2VPNA 4N6KA 4PETA 2HZKA 5EQAA 4MJOA 4AS4A 4PCDA 3T0JA 4P56A 5FBPA 1G0HA 1FBCA 3PTYA 2F3BA 1EYIA 1LEVA 1XI6A 2P3VA 4PAKA 1KA0A 2GQ1A 2XWKA 2MKZA 5T3JA 3KBZA 4GWXA 3ISPA 2L5VA 3W9WA 2F5XA 1NV2A 4I40A 3ROJA 4X9TA 4PBQA 4MNIA 1FRPA 2DVZA 1EYKA 2Q9TA 2VT5A 1FSAA 2Y5KA 3KC1A 4G61A 4H45A 1FBPA 4H46A 4I3EA 1LBWA 1LBXA 4MMPA 4NGUA 4PBHA 3IFCA 4MHFA 4YZZA 4AS5A 5I5PA 1NV1A 4NX1A 2FIEA 2DE3A 2Q8MA 2B4LA 2ZZWA 3NOHA 5DW8A 4F1VA 3IFAA 1FPBA 1LBZA 5I7IA 2WBBA 4OVTA 2B4MA 4HCYA 2PFZA 2ZZXA 2CZIA 2KQZA 4PF6A 2FHYA 4QBAA 2XA5A 1IMAA 3B50A 3LV0A 4GWYA 1FBDA 4JVDA 4P9KA 5IM2A 1K9ZA 2Y5LA 3MYUA 4GX4A 4NAPA 1Q9DA 4KXPA 4N81A 4HE1A 3E79A 4PFBA 2XWOA 5ESYA 5LTCA 1NUYA 3BIHA 3SZPA 4P8BA 4P47A 4HE0A 5ET5A 2V3QA 1FPLA 5IGAA 4HXVA 1FPKA 4PFIA 1JP4A 4MCOA 1FJ9A 1RDXA 1FBGA 3FBPA 4PE3A 4M1VA 2HPGA 4PDDA 4N8GA 1SPIA 3RYDA 3T1BA 2FVZA 2HHMA 2QVRA 4OVRA 2QVVA 4N4UA 1AWBA 1NV7A 1FPIA 2CEYA 1DBZA 2V4CA 2XWVA 4PF8A 1IMBA 1IMFA 2CZHA 2FBPA 2WEFA 1K9YA 2ZZVA 4IR8A 4MIJA 2QVUA 4NF0A 3HFUA 4O8MA 4XEQA 4P1EA 2WX9A 4XF5A 2F3DA 4MEVA 4PAIA 1KZ8A 4PGPA 2OWZA 4DI3D 4GWUA 4GWZA 4N15A 1FPEA 1CNQA 3EKIA 4GWWA 4NHBA 4X04A 5IZ3A 2WYKA 4I3YA 5IZ1A 2BJIA 1INPA 1FTAA 2DE2A 4N8YA 1YYZA 1LBVA 4OVSA 5EYHA 5IZZA 5JK4A 2WBDA 1FJ6A 4O7MA 4PFRA 4UABA 4XFEA 3E78A 4GBVA 2CZKA 2DDKA 4MNPA 4F1UA 4PGNA 2DE4A 2PCRA 3LUZA 4GBWA 1FBHA 4JVCA 1NV0A 2FIXA 2R8TA 4JVIA 4GX3A 1YXIA 5J1DA 5EYGA 1IMDA 1FPJA 2HXRA 2WYPA 2Q74A 3CHGA 4GWSA 5ET8A 5EQ8A 1LBYA 3B8BA 4FBPA 1NUXA 1IMCA 4N17A 4NN3A 4OVQA 3GYYA 4NG7A 4PAFA 5F24A 4F18A 1NV3A 2KR0A 2CEXA 4N6DA 2QPQA 4P1LA 5A5LA 5LDZA 1NV5A 5I3SA 2PFYA 4MX6A 3BIGA 2P3NA 5J16A 4MNCA 1DCUA 2QFLA 1DK4A 2XWIA 1RDZA 3RPLA 1FPDA 3D1RA 4LN5A 5ET6A 1IMEA 2OX3A 1NUWA 3A29A 4HCWA 1FBFA 4O94A 1NV6A 4OA4A 2XXKA 1KA1A 4F19A 1FBEA 1BK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQ8 A;  3FXB A;  4OAN A;  4MAG A;  3U65 A;  4X8R A;  4DI4 B;  5CM6 A;  2VPO A;  4PDH A;  2HZL A;  4OVP A;  4N91 A;  4P3L A;  4YIC A;  4PC9 A;  2VPN A;  4N6K A;  4PET A;  2HZK A;  4PCD A;  4P56 A;  2XWK A;  4PBQ A;  4PFI A;  4MMP A;  4NGU A;  4PBH A;  4MHF A;  4YZZ A;  5I5P A;  4NX1 A;  2ZZW A;  5I7I A;  4OVT A;  2PFZ A;  2ZZX A;  4PF6 A;  2XA5 A;  3B50 A;  5IM2 A;  4NAP A;  4PFB A;  2XWO A;  5LTC A;  4P8B A;  4P47 A;  4MCO A;  4PE3 A;  4PDD A;  2HPG A;  4N8G A;  4OVR A;  4N4U A;  2CEY A;  2V4C A;  2XWV A;  4PF8 A;  2ZZV A;  4NF0 A;  4O8M A;  4MIJ A;  4XEQ A;  4P1E A;  2WX9 A;  4XF5 A;  4MEV A;  4PAI A;  4PGP A;  4DI3 D;  4N15 A;  4X04 A;  4NHB A;  2WYK A;  4OVS A;  4N8Y A;  5IZZ A;  4O7M A;  4PFR A;  4UAB A;  4XFE A;  4MNP A;  4PGN A;  5IGA A;  4PAF A;  2WYP A;  4NN3 A;  4N17 A;  4OVQ A;  3GYY A;  4NG7 A;  2CEX A;  4N6D A;  4P1L A;  2PFY A;  4MX6 A;  4MNC A;  2XWI A;  4LN5 A;  4OA4 A;  4O94 A;  4P9K A;  2XXK A;  4MNI A;  4PAK A; 
#chains in the Genus database with same CATH topology
 2I3W A;  2QS1 A;  2OBG A;  3W9V A;  3IR1 A;  4F31 B;  1TWY A;  3LUY A;  2YLN A;  4OVP A;  3KC0 A;  1EYI A;  4GQO A;  3V89 B;  3EN3 A;  3G3J A;  1BTJ A;  3KBZ A;  1IXH A;  1EZP A;  2ZNU A;  2IEE A;  3IX1 A;  1NV2 A;  2UVI A;  1B6H A;  2DWH A;  1NV1 A;  2G93 A;  4ELQ A;  3NOH A;  4F2O A;  1US5 A;  4RA1 A;  2ZZX A;  1VFE A;  4PF6 A;  1LBB A;  3OO9 A;  3CG3 A;  3HV1 A;  2H4I A;  1BP5 A;  5AA1 A;  5F7V A;  1Q9D A;  2REJ A;  3CSG A;  3OOA A;  1JEU A;  3K2D A;  1JEV A;  1FPL A;  4R2F A;  2B3F A;  2R9J A;  3K6V A;  4R9G A;  3FXQ A;  1LAH E;  1MDP 1;  3H06 B;  4YB7 A;  4F3S A;  3FV2 A;  5HBC A;  2QS2 A;  4F39 A;  2YPN A;  1TFA A;  3K4U A;  4JDF A;  1B7U A;  4JWX A;  1LBV A;  4GIZ A;  5I57 A;  3RT6 B;  5IGA A;  3IOR A;  5DYH A;  4OTE A;  1B5H A;  1I69 A;  1NUX A;  1UTH A;  2V3T A;  1SW5 A;  5I3S A;  3TPA A;  2PFY A;  4MX6 A;  4OZ9 A;  3BIG A;  4EF1 A;  4GVO A;  2O1M A;  2OX3 A;  4F18 A;  3A29 A;  5A5L A;  5H8F A;  2O7I A;  2XXP A;  4ECF A;  1BIY A;  4DZ1 A;  4NQ8 A;  4QF9 A;  1LAF E;  2HZL A;  4R6Y A;  2JJK A;  2F34 A;  5ET7 A;  5EQA A;  5KDT A;  1VSO A;  4I1D A;  4BLA A;  1D9Y A;  3VXC A;  3CSB A;  4Q8R A;  5T3J A;  3TTR A;  3B7D A;  5DVF A;  3N6U A;  2P0S A;  1MRP A;  1KWH A;  3M3L A;  1LBX A;  1MQJ A;  5H8S A;  4AS5 A;  3D4G A;  4JWO A;  1B4H A;  1MQG A;  4RXL A;  4F1V A;  4R6H A;  1NL5 A;  2ZYN A;  3MP8 A;  3B50 A;  4O3B A;  4G2Z A;  4N81 A;  5AA4 B;  3EF7 A;  2I4C A;  1MQI A;  1CE2 A;  5HM4 B;  3CFZ A;  3OEN A;  1O64 A;  3G3I A;  4LUB A;  2FYI A;  2QRY A;  1TT1 A;  2O6A A;  5BWJ A;  3SEX A;  4AS4 A;  4KFQ A;  4MIJ A;  4ESX A;  2QVU A;  1MPC A;  3LSX A;  1EZO A;  3H6V A;  4MLQ A;  1MXZ A;  1UIV A;  2VD2 A;  3O6G A;  4PQJ A;  4BDQ A;  3ILU B;  2HXW A;  2DDK A;  2ZXT A;  2PCR A;  3Q27 A;  5CMK A;  2PT1 A;  4NF5 A;  3E9X A;  3QIM A;  5H8Q B;  1IME A;  4LZ5 A;  4BDO A;  1H43 A;  4YMA A;  1RYX A;  1FBE A;  1LGB C;  2OWT A;  1IEJ A;  5H8F B;  2XX7 A;  5CM6 A;  1F9B A;  4BDN A;  4GL0 A;  1DTZ A;  4H8J A;  2X26 A;  3GBB A;  5CMB A;  3EHT A;  3U93 A;  1HSE A;  1Y3N A;  1FRP A;  1D3K A;  3EHS A;  4ZEK A;  2DE3 A;  5FTH A;  2B4L A;  1LCF A;  4I9D A;  2WBB A;  3RTW B;  1I6Q A;  3IL1 B;  4RY1 A;  3PMV A;  2B65 A;  1HSL A;  2THI A;  1PB7 A;  1CB6 A;  3R26 A;  2VOZ A;  1N7W A;  3DP6 A;  3FBP A;  1DPE A;  4OFJ A;  1P1N A;  4QSD A;  2FVZ A;  5I2N A;  1O63 A;  4MBP A;  3K02 A;  1B5J A;  1LB8 A;  4FAT A;  1MXY A;  4ND9 A;  2F3D A;  3FIR A;  4F2Q A;  4PAI A;  5FHM A;  4G8M A;  1OQH A;  3EKI A;  4NHB A;  4NWD A;  2V25 A;  3T93 B;  4HTG A;  5F1Q A;  5IZZ A;  1FJ6 A;  3FAS A;  4LON B;  4GD5 A;  4ZS9 A;  4OEN A;  4XFE A;  2F78 A;  4FJP A;  4PGN A;  5ITO A;  2R8T A;  5KDT B;  4Q0C A;  1GV8 A;  4NF4 B;  1XT8 A;  5LDZ A;  2A5T A;  2QPQ A;  2DXR A;  4OQO A;  3B6Q A;  2XWI A;  2XXQ A;  4ZZA A;  5JTY B;  3TMG A;  2F97 A;  4E0W A;  3QUJ A;  4QXD A;  4MAG A;  4X8R A;  3KJT A;  4GX6 A;  3O6I A;  2HQ0 A;  1MDQ A;  1LBC A;  3RT8 A;  5AA4 A;  3CRB A;  4PCD A;  3A3U A;  2F6P A;  4X1B A;  1XI6 A;  2AL5 A;  1FQC A;  3RN8 A;  2RC7 A;  1IXI A;  3ROJ A;  1SDX A;  4H45 A;  4H46 A;  1FSA A;  4G61 A;  3RTF B;  1LBW A;  2Q8M A;  5I57 B;  4JB7 A;  4NF6 B;  1B32 A;  4GX4 A;  5ESY A;  3VLW A;  4KI0 E;  1MXW A;  1Y3P A;  5I59 A;  1IZ1 A;  5AA3 A;  5KZT A;  3Q25 A;  4ZE9 A;  4IGT A;  4M1V A;  5DVJ A;  2HHM A;  3SEV A;  3QUF A;  1AWB A;  2CEY A;  2PX1 A;  4AB6 A;  1EZ9 A;  1IMB A;  1II5 A;  3FAT A;  1MQH A;  3E13 X;  3S4U A;  1WVJ A;  1VFD A;  4LVQ A;  4XKR A;  3D4C A;  3RQT A;  4IB2 A;  1D4N A;  1EU8 A;  4IY6 A;  4KCD A;  1Q1K A;  2ZMB A;  4Q30 B;  1J1N A;  3VLV A;  5F24 A;  1P1U A;  2DS9 A;  3I5O A;  1POY 1;  2DWI A;  3SET A;  5ICT A;  2CMO A;  2UYE A;  2I4B A;  3O6H A;  5EQ9 A;  3OEK A;  1MXV A;  2UXA A;  1R6Z A;  2ALU A;  4TQU Q;  1G0I A;  5I84 A;  1LLS A;  1PB8 A;  3VFJ A;  2VPN A;  2GHB A;  1G0H A;  2R6G E;  1Y1M A;  3FVK A;  2ONS A;  2Q9T A;  1R9Q A;  1P1W A;  1SBP A;  1PBQ A;  3PUV E;  3IFA A;  4YKK A;  3VVD A;  4ZE8 A;  1AL3 A;  1IUD A;  3TTM A;  2O1L A;  3VDF A;  3ILT B;  3PUX E;  3Q28 A;  1MH3 A;  1UTB A;  3U92 A;  3TUS A;  1OQG A;  1QUJ A;  3PU5 A;  3JZJ A;  4G4P A;  4BDL A;  4RK9 A;  2OJT A;  2O51 A;  2ONK E;  1A99 A;  1WOD A;  3IOW A;  3MUQ A;  4DI3 D;  1NH8 A;  2ESN A;  4KQP A;  1XVX A;  1I6A A;  1N3X A;  2PBW A;  1AOV A;  3PUZ E;  4X1D A;  4UAB A;  1PEB A;  3BFT A;  3S9N C;  1USY H;  3ZSF A;  3TCG A;  4OVQ A;  1M5D A;  3CVG A;  3VVF A;  1NV3 A;  2CEX A;  1P1O A;  4POW A;  4R6K A;  4F3P A;  2I0C A;  4G8H A;  2A5S A;  4ZEF A;  5AA2 D;  3RPW A;  2A5T B;  4MLV A;  1OLA A;  2QJE A;  2FA7 A;  3FJG A;  3S9E A;  3HHF A;  5I56 B;  2E0S A;  4YIC A;  3O28 A;  4PET A;  5TP9 A;  2HZK A;  4MJO A;  3PD9 A;  2I6E A;  1SYH A;  3HHG A;  3ISP A;  1A8E A;  3UA8 A;  4PBQ A;  3HCQ A;  3SEW A;  3IFC A;  4NX1 A;  2AIX A;  5A5X B;  4QSE A;  1R1N A;  3HO7 A;  4H6D A;  4FE8 A;  1Y4T A;  3MZ1 A;  1FCK A;  1SW2 A;  3TEP A;  4PFB A;  3U72 A;  3LSF B;  2F35 A;  1QVS A;  2QS4 A;  1SI1 A;  3WAF A;  3MQ9 A;  4PE3 A;  5JTY A;  3G3F A;  1ZU0 A;  4YKP A;  4N4U A;  1S7Y A;  1PBP A;  1H45 A;  2XXR A;  3EQ1 A;  1SYI A;  2UYF A;  3TQW A;  4GWU A;  3MPK A;  3IOU A;  4IO3 A;  4P0G A;  4FOR A;  3KBR A;  4PFR A;  2F7C A;  3K1P A;  2DYX A;  1B2H A;  3HPI A;  4WEP A;  2WYP A;  5FHN A;  4N17 A;  3FD3 A;  3VXB A;  2V93 A;  2FNC A;  1DCU A;  2QFL A;  4JBZ A;  3K1N A;  4NF5 B;  1B52 A;  3RNN A;  5H8Q A;  4YKJ A;  4U23 A;  2DWJ A;  4PAK A;  4IO4 A;  3GBA A;  1Q35 A;  5AE4 A;  1NI9 A;  1NV4 A;  2XXV A;  1OLC A;  2NUV A;  3FXB A;  4RPO A;  4P11 A;  3SDF A;  3U65 A;  4DI4 B;  3K6X A;  1FPG A;  4P3L A;  1B3E A;  3TEL A;  2PVU A;  5H8N B;  1FBC A;  4L17 A;  1B7Z A;  3MVZ A;  1A54 A;  3RLF E;  1T0K A;  4EQ7 A;  2Y5K A;  4ZZE A;  4PFI A;  4Z0I A;  4I3E A;  3SES A;  1MXU A;  3C4M A;  4MHF A;  1ANF A;  2FIE A;  2HAV A;  1YCJ A;  1FPB A;  1AH5 A;  1MY0 A;  4XKQ A;  1FTM A;  2Z23 A;  2CZI A;  4QBA A;  3BKI B;  1B7H A;  2DQV A;  3ZS6 A;  4YMB A;  2XXU A;  4P8B A;  4YAH X;  1H76 A;  2HEU A;  3LSW A;  1SPI A;  3A09 A;  4KCC A;  1Y20 A;  4FEC A;  4PF8 A;  2CZH A;  3MP1 A;  4DXB A;  4P1E A;  3FXU A;  1FQB A;  4GWZ A;  2WYK A;  4I3Y A;  2DVC A;  4QHQ A;  3GZG A;  1YYZ A;  3OSR A;  4R75 A;  5I56 A;  1QW0 A;  3H4Z A;  3OD7 A;  4FBP A;  2HCA A;  4LQ2 A;  4ONY A;  4P1L A;  3TTN A;  3UOR A;  1DK4 A;  3S9L C;  4OA4 A;  2VGQ A;  1KA1 A;  3FXR A;  4GXS B;  2E1S A;  4OES A;  4EXK A;  2VPO A;  1RDY A;  5EQ7 A;  1Y9U A;  1QJM A;  3T0J A;  5FBP A;  4JSD A;  2H5Y A;  2B3B A;  3IJX B;  1GGG A;  4X9T A;  2RC8 A;  1ZLQ A;  3KC1 A;  3QAX A;  3TZA A;  4ZED A;  2GFE A;  4PE5 B;  1RYO A;  3MP6 A;  1FW0 A;  1GVC A;  1B4Z A;  1JNF A;  1NFT A;  3W15 C;  4GWY A;  4H8I A;  3LV0 A;  1DTG A;  5IAI A;  4GXA A;  4ZDM A;  2VD3 A;  5A5X A;  4HE1 A;  3K01 A;  3UN6 A;  5CBS A;  1B3L A;  4IY5 A;  3E4R A;  2LAO A;  4LAT A;  1TXF A;  5TU0 A;  1YPN A;  2I49 A;  2HPG A;  2AL4 A;  4DXU A;  4XKN A;  3LSL A;  1FPI A;  4KYS A;  2F7B A;  2H9B A;  3MJN A;  4NF0 A;  3H3G A;  3IB0 A;  4TOZ A;  3USD A;  3T9V A;  1INP A;  4OET A;  2DE2 A;  4OVS A;  3M8U A;  1NNP A;  3E3K A;  1OMP A;  4ZEC A;  3DLN A;  3ZKK A;  4RK2 A;  4WED A;  1RDZ A;  3MVX A;  4RNS A;  1M5F A;  1IIW A;  4KYE A;  3MST A;  1QGX A;  4GL8 A;  3R7X A;  2XXW A;  4NF6 A;  4YB5 A;  4E0X A;  3O97 A;  4HE2 A;  3UGW A;  3H03 A;  1M5C A;  1MXX A;  4PFT A;  1NNF A;  4N6K A;  1S9T A;  2G29 A;  4N07 A;  3PTY A;  1MM7 A;  3FVO A;  1SD3 A;  1B1X A;  4DCX A;  1M5B A;  2F5X A;  3MC2 A;  2OWS A;  3K00 A;  3SEU A;  2DVZ A;  2VT5 A;  4NGU A;  1NNT A;  4YZZ A;  3LBS A;  4NF8 A;  5TPA B;  4JVD A;  2O68 A;  1JW5 A;  3KSX A;  5DTB A;  2RF1 A;  5EYF A;  4AQ4 A;  3BIH A;  2XD3 A;  4HE0 A;  2ZNT A;  4ELP A;  2OZZ A;  4PDD A;  3CFX A;  1NV7 A;  5I59 B;  3LC8 A;  4MEV A;  4XIG Q;  3VV5 A;  4U2R A;  1KZ8 A;  3L6G A;  3TCH A;  3UK4 A;  1FPE A;  3TKD A;  1MY4 A;  3H6U A;  5TP9 B;  3T66 A;  5EYH A;  2RCB A;  1R9L A;  4EF2 A;  3OEL A;  4JVI A;  2Q2C A;  3CR9 A;  4KR5 A;  1LBY A;  2GH9 A;  4U21 A;  3R6U A;  3C33 A;  4JXI A;  5JEI A;  2BJJ X;  3PMX A;  4QFN A;  5HPQ A;  1NV6 A;  3RGY A;  3FJM A;  3PPO A;  4G77 A;  4MNI A;  4FAJ A;  3IB2 A;  3T9H B;  1VDW A;  1FTL A;  3K0V A;  1EYJ A;  4OAN A;  1N3W A;  1S50 A;  2ZYK A;  3VE1 B;  5CRY A;  3QXM A;  3CIJ A;  4OER A;  2ANJ A;  2GQ1 A;  3PUW E;  1JQF A;  2NOO A;  5I58 B;  1HSJ A;  5CMM A;  2Q2A A;  1NKX A;  5ICQ A;  3MAM A;  4EDP A;  1MY3 A;  4R74 A;  3C31 A;  3Q29 A;  4HCY A;  1N0T A;  5DT6 A;  4KHZ E;  1A7L A;  2F8D A;  3MYU A;  2Y7I A;  4G68 C;  5M2V A;  3PPR A;  4WKM A;  4HXV A;  4UAC A;  1H44 A;  2H25 A;  3H7M A;  3K6W A;  2QS3 A;  4PFW A;  3RYD A;  4QFL A;  2ZNS A;  4OVR A;  1AIV A;  4JWY A;  2WEF A;  3RY3 A;  2WX9 A;  3QYT A;  2I0B A;  2M8C A;  1LAX A;  5IZ1 A;  1B9J A;  2BJI A;  3HN0 A;  3O66 A;  3TQL A;  4F1Y A;  1URG A;  1POT A;  1ZJL A;  4GBW A;  1B05 A;  2ABH A;  3C34 A;  3KEI A;  2RKM A;  1B3H A;  2Q74 A;  2DSF A;  3CFL A;  3KJ7 A;  2IA4 A;  1GR2 A;  2H98 A;  3SKP A;  1SVX B;  2H99 A;  3OO8 A;  2ZYM A;  3S2V A;  4GWO A;  3D1R A;  4G8N A;  3MZB A;  3DEL B;  2XXK A;  4NED A;  1BK4 A;  2DE4 A;  1JVX A;  3DP4 A;  2QL3 A;  1NUZ A;  3ODB A;  4OMB A;  4NE4 A;  4PTK A;  2YJP A;  4N6P A;  3KZG A;  4N91 A;  1BLF A;  4O7I A;  4RPN A;  4IO2 A;  5CI5 A;  2V3U A;  4ELR A;  4U4S A;  1KA0 A;  4XTC Q;  3PPN A;  4DE8 A;  2ZYO A;  3MZ9 A;  3W9W A;  4ISU A;  4IR8 A;  4OYV A;  1FQD A;  5L8D A;  2Z8D A;  5L9S A;  4KD5 A;  1MPD A;  5B70 A;  2D21 A;  3T9U A;  5I7I A;  2DOJ A;  3TYH A;  2XA5 A;  3KN7 A;  4ELO A;  1B1H A;  3HST A;  1BKA A;  2D5W A;  2RIN A;  1FPK A;  3C32 A;  3IO4 A;  2VP1 A;  2HFB A;  3KOT A;  5AA2 B;  3K6U A;  3N94 A;  3FUZ A;  3FVN A;  2R71 A;  1DBZ A;  1IMF A;  2FBP A;  2ZZV A;  4O8M A;  2OCU A;  3HFU A;  3AXF A;  4ZEI A;  3FJ7 A;  1B58 A;  1QUI A;  1JW1 A;  3G7W A;  1LAG E;  3C9H A;  3S9M C;  1N76 A;  1LFI A;  1FBH A;  4K3F A;  1B0H A;  5L9O A;  2Q89 A;  4NN3 A;  3IAZ A;  3KN3 A;  5KCJ A;  4OXV A;  2QSX A;  5DEX A;  4MH5 A;  1FPD A;  2X7Q A;  3SEY A;  4F19 A;  4O94 A;  4NTL A;  1YXI A;  3F11 A;  3MWB A;  3KSJ A;  4GF8 A;  4PC9 A;  3IO6 A;  2Z22 A;  1FTK A;  1B3G A;  3THI A;  3IB1 A;  4NMY A;  5DW8 A;  5IKB A;  3K1M A;  1SI0 A;  2I3V A;  1IMA A;  1JW4 A;  1FBD A;  4KXP A;  2Z8F A;  4C0R A;  3MW0 A;  3BFU A;  5LOM A;  3UP9 A;  1N7X A;  2QMW A;  1IIT A;  4IO6 A;  2XXX A;  2QVR A;  4MFI A;  2GHA A;  2XXY A;  5EHS A;  2OWZ A;  4PP0 A;  4H5G A;  4KPT A;  4YB6 A;  1A8F A;  1FQA A;  3PPP A;  4H65 A;  1Z7M E;  4O7M A;  3IOV A;  4DLD A;  1H3D A;  2F36 A;  3U94 A;  4GBV A;  4MNP A;  3LR1 A;  1FQE A;  4PAF A;  4M4G A;  4GX3 A;  5I2K B;  1DSN A;  2HXR A;  4TLM B;  5EQ8 A;  4F3B A;  1ZTY A;  3DP8 A;  1MY2 A;  1DOT A;  3M3F A;  4Q5T A;  4O3A A;  2NVU B;  4NF8 B;  4HCW A;  1NH7 A;  1FBF A;  5BUU A;  1XHY A;  3V5A A;  3V83 A;  1YZ0 A;  1D9Q A;  1A40 A;  1QKB A;  4PDH A;  1IQ7 A;  3G3G A;  1MQD A;  5FTI A;  1FTO A;  4U4X A;  1O7T A;  5AA2 A;  2GRV A;  3B6T A;  2CZL A;  3I6V A;  3U1O A;  1Y4C A;  4GFR A;  5H8N A;  3Q26 A;  1M5E A;  1UQW A;  5DVI A;  1LBZ A;  1WDN A;  4R9F A;  3KGC A;  1ELJ A;  1URS A;  1XOC A;  4IGR A;  4YKI A;  4FED A;  2Y7R A;  3TOD A;  1VR5 A;  2XWO A;  5LTC A;  2P2A A;  4P47 A;  5ET5 A;  4BDM A;  1VE4 A;  1ZBM A;  3IOT A;  3MVW A;  4MCO A;  4UA8 A;  2W7Y A;  3PV0 E;  2PYY A;  5CMC A;  2Y7P A;  2RC9 A;  1USY E;  3QSL A;  3N5L A;  1K9Y A;  4RJZ A;  4RYA A;  1GTK A;  4G68 B;  2Y84 A;  4NF4 A;  3G3H A;  4GWW A;  3T96 B;  3A3C A;  1AMF A;  5CBR A;  4EXL A;  5JK4 A;  2PT2 A;  4X48 A;  3IJO B;  1RKM A;  1ZIU A;  2CZK A;  3EHU A;  4QRZ A;  2XD2 A;  3GXA A;  3MPL A;  3WAE A;  2FIX A;  1IMD A;  1FPJ A;  5ET8 A;  4THI A;  4ESW A;  3GYY A;  3EPE A;  4NG7 A;  2UVH A;  1Y3Q A;  2P3N A;  3RPL A;  1SW4 A;  5ET6 A;  2KLF A;  4F22 A;  3H6T A;  4FIM A;  4H0W A;  4OFL A;  4HW8 A;  3L6H A;  4FEB A;  4H1X A;  4LA9 A;  4IO7 A;  1DPP A;  2QMX A;  3ECR A;  4GOT A;  3SER A;  4O3C A;  1FPF A;  3JV9 A;  1B40 A;  3QMF A;  2WKY A;  1YAE A;  3G3K A;  3PUY E;  3KN8 A;  1FTJ A;  4P56 A;  4OEV A;  1Z7N E;  2P3V A;  4U22 A;  3C36 A;  4DCY A;  2X7P A;  3TDJ A;  2Y7W A;  1UTH B;  2HAU A;  4MMP A;  1IXC A;  1US4 A;  5I5P A;  2XXI A;  1L5T A;  5ITP A;  1FQF A;  1B3F A;  2REG A;  2PFZ A;  1URD A;  1QUK A;  2I58 A;  4NAP A;  3OSQ A;  3SZP A;  3H6W A;  4WXJ A;  1PDA A;  4P0I A;  1XVY A;  1FBG A;  4GRK A;  4I8C A;  5K2Y A;  3TTL A;  2OK2 A;  2V4C A;  4OEU A;  4OVJ A;  3GLB A;  3O9P A;  4EQ9 A;  2NWJ A;  4XF5 A;  1LFH A;  3OO7 A;  3PGF A;  4IO5 A;  4LZ8 A;  3C35 A;  1CNQ A;  4F29 A;  1OIB A;  2V84 A;  4DDD A;  2D3I A;  1MH4 A;  4F3G A;  4H67 A;  3DM0 A;  1NV0 A;  5J1D A;  3CHG A;  1NMU A;  3B8B A;  4EQB A;  1P1Q A;  4OWD A;  4POX A;  2OLB A;  1NV5 A;  1P99 A;  4MNC A;  4U1O A;  4OHN A;  4BDR A;  1ZKB A;  4PFU A;  3TCF A;  3RPL B;  1B46 A;  3BBR A;  2O69 A;  4HS7 A;  3ZKL A;  5IZ3 B;  3M3K A;  4QFO A;  3OXN A;  3N26 A;  1LB9 A;  1MY1 A;  2XWK A;  4GLI A;  4R73 A;  4GWX A;  1N84 A;  2L5V A;  5H8H B;  4I40 A;  4AB5 A;  2VHA A;  4DXC A;  4U1Z A;  1OVB A;  1EYK A;  1SW1 A;  3MVY A;  3OMB A;  2PMS A;  3RUM A;  2DWA A;  5EHM A;  5I58 A;  2DP8 A;  4DIG A;  5L9M A;  2I48 A;  2XXH A;  2ONR A;  2FHY A;  3I3V A;  5B7D A;  5IM2 A;  5ISU A;  2Y5L A;  2XX8 A;  3O2A A;  2F7A A;  4JSO A;  1RDX A;  4N8G A;  3T1B A;  3FVG A;  3CG1 A;  1JET A;  1JVY A;  4LP2 B;  2XWV A;  1ATG A;  3PD8 A;  3OEM A;  3T22 A;  4QSC A;  2O7U A;  4PGP A;  4QFP A;  4N15 A;  4XXU A;  4R2B A;  2XXT A;  4X04 A;  5IZ3 A;  1QKA A;  4LQ5 A;  2Q8J A;  2UVJ A;  1FTA A;  3MBP A;  4N8Y A;  1N04 A;  1DMB A;  1I6B A;  2DXY A;  2RCA A;  3TTK A;  3CI8 A;  4F1U A;  2Z8E A;  3LUZ A;  3U8Q A;  1B51 A;  1UIU A;  4GWS A;  3FGS A;  5K2X A;  4N6D A;  4C1T A;  3TAJ A;  1UTB B;  5ELV A;  5J16 A;  5I2N B;  4EUO A;  4MF3 A;  5KCJ B;  1NUW A;  4TLL B;  3B6W A;  5DEX B;  5TPA A;  1D9V A;  3PMW A;  1A55 A;  1IXG A;  2F3B A;  1LEV A;  2MKZ A;  5CC2 A;  1MS7 A;  1LFG A;  1ZMG A;  4G68 A;  3FZV A;  4Z7E A;  3OO6 A;  1B5I A;  1FBP A;  4PBH A;  1QUL A;  1PB9 A;  4OFO A;  1XC1 A;  1MM6 A;  2UVG A;  2ZZW A;  1B0L A;  4C1U A;  2NXO A;  4OVT A;  2B4M A;  2KQZ A;  1K9Z A;  5I2K A;  1LCT A;  3E79 A;  1MPB A;  1NUY A;  4H5F A;  3KOS A;  1XS5 A;  1NNK A;  1TFD A;  2V3Q A;  3UIF A;  3VVE A;  2Y7K A;  1JP4 A;  2F6G A;  1FJ9 A;  4ZEB A;  3KFM A;  3QK6 A;  3PPQ A;  2QVV A;  3IK6 B;  1Y1Z A;  3TFL A;  4YU0 A;  2XHD A;  3KG2 A;  4XEQ A;  1OVT A;  1SQY A;  3FV1 A;  1MG1 A;  1YTV A;  1EH3 A;  2WBD A;  3JYR A;  3V8X B;  2XX9 A;  3E78 A;  4XKP A;  3VLU A;  2P1S A;  3N6T A;  4JVC A;  4NWC A;  3O29 A;  4QFK A;  4N13 A;  3ONM A;  2O84 X;  5EYG A;  1PC3 A;  1IMC A;  3P7I A;  4PFY A;  2KR0 A;  4KYD A;  5H8H A;  4LZ7 A;  2Q88 A;  4R72 A;  4LN5 A;  1LST A;  5FHO A;  3T9X B;  4P9K A;  4I62 A;  2AYS A; 
#chains in the Genus database with same CATH homology
 3MST A;  1QGX A;  1VDW A;  5EQ9 A;  3RPL B;  1NI9 A;  1NUZ A;  1NV4 A;  1YZ0 A;  4NQ8 A;  1D9Q A;  1EYJ A;  3FXB A;  4QXD A;  4OAN A;  3W9V A;  4MAG A;  3U65 A;  4HE2 A;  4X8R A;  4DI4 B;  4PTK A;  2VPO A;  4PDH A;  5CM6 A;  2HZL A;  1RDY A;  1FPF A;  4OVP A;  3KC0 A;  5IZ3 B;  4N91 A;  5EQ7 A;  1FPG A;  4P3L A;  4GX6 A;  4YIC A;  1G0I A;  3QMF A;  2JJK A;  4O7I A;  4PC9 A;  5ET7 A;  2VPN A;  4N6K A;  4PET A;  2HZK A;  5EQA A;  4MJO A;  4AS4 A;  4PCD A;  3T0J A;  4P56 A;  5FBP A;  1G0H A;  1FBC A;  3PTY A;  2F3B A;  1EYI A;  1LEV A;  1XI6 A;  2P3V A;  4PAK A;  1KA0 A;  2GQ1 A;  2XWK A;  2MKZ A;  5T3J A;  3KBZ A;  4GWX A;  3ISP A;  2L5V A;  3W9W A;  2F5X A;  1NV2 A;  4I40 A;  3ROJ A;  4X9T A;  4PBQ A;  4MNI A;  1FRP A;  2DVZ A;  1EYK A;  2Q9T A;  2VT5 A;  1FSA A;  2Y5K A;  3KC1 A;  4G61 A;  4H45 A;  1FBP A;  4H46 A;  4I3E A;  1LBW A;  1LBX A;  4MMP A;  4NGU A;  4PBH A;  3IFC A;  4MHF A;  4YZZ A;  4AS5 A;  5I5P A;  1NV1 A;  4NX1 A;  2FIE A;  2DE3 A;  2Q8M A;  2B4L A;  2ZZW A;  3NOH A;  5DW8 A;  4F1V A;  3IFA A;  1FPB A;  1LBZ A;  5I7I A;  2WBB A;  4OVT A;  2B4M A;  4HCY A;  2PFZ A;  2ZZX A;  2CZI A;  2KQZ A;  4PF6 A;  2FHY A;  4QBA A;  2XA5 A;  1IMA A;  3B50 A;  3LV0 A;  4GWY A;  1FBD A;  4JVD A;  4P9K A;  5IM2 A;  1K9Z A;  2Y5L A;  3MYU A;  4GX4 A;  4NAP A;  1Q9D A;  4KXP A;  4N81 A;  4HE1 A;  3E79 A;  4PFB A;  2XWO A;  5ESY A;  5LTC A;  1NUY A;  3BIH A;  3SZP A;  4P8B A;  4P47 A;  4HE0 A;  5ET5 A;  2V3Q A;  1FPL A;  5IGA A;  4HXV A;  1FPK A;  4PFI A;  1JP4 A;  4MCO A;  1FJ9 A;  1RDX A;  1FBG A;  3FBP A;  4PE3 A;  4M1V A;  2HPG A;  4PDD A;  4N8G A;  1SPI A;  3RYD A;  3T1B A;  2FVZ A;  2HHM A;  2QVR A;  4OVR A;  2QVV A;  4N4U A;  1AWB A;  1NV7 A;  1FPI A;  2CEY A;  1DBZ A;  2V4C A;  2XWV A;  4PF8 A;  1IMB A;  1IMF A;  2CZH A;  2FBP A;  2WEF A;  1K9Y A;  2ZZV A;  4IR8 A;  4MIJ A;  2QVU A;  4NF0 A;  3HFU A;  4O8M A;  4XEQ A;  4P1E A;  2WX9 A;  4XF5 A;  2F3D A;  4MEV A;  4PAI A;  1KZ8 A;  4PGP A;  2OWZ A;  4DI3 D;  4GWU A;  4GWZ A;  4N15 A;  1FPE A;  1CNQ A;  3EKI A;  4GWW A;  4NHB A;  4X04 A;  5IZ3 A;  2WYK A;  4I3Y A;  5IZ1 A;  2BJI A;  1INP A;  1FTA A;  2DE2 A;  4N8Y A;  1YYZ A;  1LBV A;  4OVS A;  5EYH A;  5IZZ A;  5JK4 A;  2WBD A;  1FJ6 A;  4O7M A;  4PFR A;  4UAB A;  4XFE A;  3E78 A;  4GBV A;  2CZK A;  2DDK A;  4MNP A;  4F1U A;  4PGN A;  2DE4 A;  2PCR A;  3LUZ A;  4GBW A;  1FBH A;  4JVC A;  1NV0 A;  2FIX A;  2R8T A;  4JVI A;  4GX3 A;  1YXI A;  5J1D A;  5EYG A;  1IMD A;  1FPJ A;  2HXR A;  2WYP A;  2Q74 A;  3CHG A;  4GWS A;  5ET8 A;  5EQ8 A;  1LBY A;  3B8B A;  4FBP A;  1NUX A;  1IMC A;  4N17 A;  4NN3 A;  4OVQ A;  3GYY A;  4NG7 A;  4PAF A;  5F24 A;  4F18 A;  1NV3 A;  2KR0 A;  2CEX A;  4N6D A;  2QPQ A;  4P1L A;  5A5L A;  5LDZ A;  1NV5 A;  5I3S A;  2PFY A;  4MX6 A;  3BIG A;  2P3N A;  5J16 A;  4MNC A;  1DCU A;  2QFL A;  1DK4 A;  2XWI A;  1RDZ A;  3RPL A;  1FPD A;  3D1R A;  4LN5 A;  5ET6 A;  1IME A;  2OX3 A;  1NUW A;  3A29 A;  4HCW A;  1FBF A;  4O94 A;  1NV6 A;  4OA4 A;  2XXK A;  1KA1 A;  4F19 A;  1FBE A;  1BK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...