3FD3A

Structure of the c-terminal domains of a lysr family protein from agrobacterium tumefaciens str. c58.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
207
structure length
207
Chain Sequence
RVTLNIATNADSLGTWFLDAVSKFTGGSDYLVNIAVDDQDHTVEWLRGGRVLAAVTAHDKPVQGCRVTPLGVLRYHATASPDFMARHFADGVTPAALARAPGLTFNQKDRLQASWIRTALGEDVSYPTHWLPSTDGFVKASLAGMGWGLNPVQLVAEHLAAGRLVELMPGTPLDIPLYWQVNRLAAERLAGLTANMVGTARVVLMPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chromosome replication initiation inhibitor protein
publication title Structure of the C-terminal domains of a LysR family protein from Agrobacterium tumefaciens str. C58.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Transcription regulator
total genus 61
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2008-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fd3A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fd3A02
3HHGA 4NF5A 3N26A 2DOJA 2YLNA 2RKMA 3V89B 5BUUA 4Z0IA 4U1ZA 1LCTA 3IJOB 1B2HA 3SEYA 1JW4A 1J1NA 1N04A 3K6UA 3LR1A 5A5XA 4DZ1A 1FQFA 2H25A 4NF5B 1A40A 1POTA 3L6GA 5EYFA 2GHBA 4BDNA 1FCKA 1AL3A 4OHNA 5JK4A 5DVJA 1MXWA 3QUFA 4OFJA 3KN7A 3MP1A 4GQOA 4N07A 1IXGA 3H7MA 2PVUA 1SI1A 2OJTA 2O7IA 5A5XB 4OFOA 3FV1A 1QUKA 1AOVA 4PP0A 1MY2A 3FZVA 3H6UA 2AL5A 2Q9TA 4IB2A 4U22A 2Y7IA 2F7BA 4NTLA 4JXIA 1LAHE 4DXBA 3PD9A 3MBPA 4I9DA 2QS1A 2P1SA 4RXLA 3OO9A 5M2VA 4DXUA 2V3QA 5ICTA 4FATA 2ZNSA 1Y4TA 1N0TA 4XKPA 1B52A 4XKNA 3SKPA 5FTHA 2I4BA 4GLIA 1QULA 5L9SA 4EXLA 4JBZA 4NF4B 1SBPA 4R75A 4WKMA 3B6TA 3U93A 3ONMA 2DQVA 1B05A 4OFLA 2QS2A 1TFDA 3EHTA 4DXCA 3KOTA 5TPAA 4HCWA 3IOWA 1T0KA 4KYSA 1SD3A 1XHYA 1ZIUA 4DDDA 4ELPA 2D21A 4LZ8A 3N5LA 1EU8A 3M3KA 2I0CA 3VLWA 1MQGA 2ZYOA 4G77A 3C9HA 4FIMA 2VP1A 2ZNUA 1NMUA 5TPAB 4U4SA 3PUVE 3UORA 1RKMA 3OD7A 3RUMA 4NWCA 1YTVA 2GFEA 1UQWA 1SW5A 3E3KA 4RPNA 4I1DA 3TCHA 5KCJA 4PFTA 1URGA 5ITPA 3PMXA 2XXRA 1DTGA 1O64A 3KBRA 4ZEDA 2Z8EA 3OMBA 1JW1A 4IO5A 4DE8A 4IO7A 3OO6A 3MPLA 5CMCA 1Y9UA 3OELA 4G8MA 1LAXA 1KWHA 1H3DA 1S7YA 3CVGA 4DCYA 5KCJB 2B65A 3TTKA 5K2YA 4UA8A 4R9FA 3TTNA 4R2FA 1B1HA 1FTKA 3TFLA 1Z7ME 2RC9A 3T9UA 4F3PA 5AA3A 3F11A 3PUZE 3RGYA 3HHFA 3FXUA 1IXCA 4YB7A 2XXWA 1POY1 3EN3A 2F36A 1II5A 1LAFE 4EDPA 5CBRA 3TQLA 4GXAA 1B40A 3O6IA 3R6UA 2Q88A 1QW0A 3MJNA 1EZPA 4IGTA 3I3VA 3H6TA 1Y4CA 1B5HA 3FVOA 4PQJA 1BIYA 4KYEA 1MPBA 3BFTA 3N94A 2I4CA 2WKYA 5I57A 3KSJA 3R26A 4M1VA 4QSDA 1S50A 2THIA 1Q1KA 4O3AA 1WDNA 3VXBA 1MXZA 1PB7A 1XS5A 4IO3A 1D9VA 4FJPA 2I48A 4PE5B 2RCAA 1M5CA 2UYEA 2VHAA 4EQ7A 1I6BA 4UACA 4P11A 4H5FA 3G3GA 2DWAA 2G29A 1JEVA 2Y84A 4QHQA 1BP5A 3KEIA 3T66A 1UIUA 5ELVA 3FUZA 3O28A 4IY6A 2Z23A 2AIXA 3PMVA 3MC2A 4JWOA 1MY4A 1DOTA 1MDP1 3G3FA 4RJZA 5B70A 3JV9A 3TCFA 1B58A 1QJMA 2ZYMA 1TFAA 4N13A 4ELRA 4YB5A 1JVYA 2H98A 5JTYA 4LP2B 1ZBMA 4LQ5A 4QRZA 4BDLA 2W7YA 4OEUA 3MVWA 3BBRA 1DPEA 1A8EA 2F6GA 1IXHA 2F78A 4I62A 3R7XA 3Q25A 3V5AA 2E0SA 4HS7A 1MY1A 4ZEKA 4OEVA 3C32A 4MF3A 5EHMA 3E9XA 5JTYB 4ELQA 1TXFA 4IY5A 2O7UA 3K1PA 1MS7A 4RNSA 1B32A 2HFBA 3CFZA 3EHSA 1BKAA 4HW8A 1QVSA 1PBQA 3GXAA 4GIZA 2O84X 5I84A 3BKIB 3UA8A 4R73A 2RINA 1GVCA 2XXIA 5CMMA 3FIRA 1B51A 4GOTA 4O3BA 3SETA 4N6PA 4EF2A 1FW0A 2OLBA 2DS9A 2FYIA 2UYFA 3QSLA 2X7PA 1B3HA 3OSRA 3S4UA 2HZKA 3FXRA 1Q35A 3N6UA 4YB6A 4OMBA 4F3GA 1MXUA 1OVTA 3V8XB 1N7XA 3QK6A 2YJPA 3CRBA 3OEMA 3PUWE 2DE2A 1CB6A 3PPRA 5AA2A 3MZ9A 1LFHA 3O6HA 4YU0A 2QJEA 4EXKA 3K2DA 4ISUA 1NKXA 2VGQA 4LUBA 3IORA 3HN0A 3K6VA 3LBSA 3U1OA 1FQAA 2P2AA 1XT8A 3RNNA 3OO8A 1GR2A 1USYH 5DEXA 4Q30B 2V25A 2XXUA 3U8QA 1B4HA 5AA2B 1SW4A 3A09A 5FHOA 4DCXA 2Y7KA 4KR5A 1UIVA 3VVFA 5L8DA 3VE1B 1P1NA 2REJA 5DT6A 5AA2D 1A55A 2GH9A 5I58A 2VD3A 3T96B 5I2NA 3BFUA 1FTMA 3K1MA 1US5A 5DEXB 1IZ1A 1MY3A 1PB8A 2QL3A 2PYYA 2OWSA 1NNPA 3TMGA 1SQYA 3AXFA 2DWIA 2QMXA 3IO4A 4KYDA 3HO7A 4F39A 2QSXA 4PFWA 2V3UA 1MDQA 5I58B 1M5EA 2UVJA 1MRPA 4MH5A 4I8CA 5HBCA 5I2NB 3PPNA 3CFXA 4THIA 4ND9A 1IITA 1B4ZA 3ILUB 4R6YA 4H6DA 3D4CA 5CC2A 1OMPA 4OWDA 2XXHA 3K4UA 4ESXA 3HV1A 2OBGA 3KG2A 3FVKA 4H65A 3O2AA 3PPPA 3LSWA 1I6AA 4F19A 4KQPA 1NNFA 2RCBA 2OZZA 1UTHA 1B6HA 1I6QA 4Q8RA 1PDAA 2Q2AA 4NF8A 3ZS6A 3SESA 4R74A 2UVIA 1SW2A 2RF1A 4JSOA 5AA4A 1ZLQA 1RYOA 3RLFE 2XXTA 1MH4A 1R6ZA 3ECRA 2Y7PA 4OENA 3VDFA 4QFNA 3PD8A 2XD2A 2ONKE 3B6QA 3MW0A 3OENA 2RC8A 4TQUQ 4YZZA 4RPOA 3RTFB 1Y3NA 4OERA 4F22A 3FGSA 4NF8B 2DXYA 2HZLA 5AA4B 2O1LA 4G68A 5J1DA 1MG1A 1Y3PA 3UK4A 2I49A 2HXWA 3MP6A 1RYXA 1SYIA 1JNFA 2GRVA 4R9GA 2HAUA 3O29A 2P0SA 2XXYA 1MY0A 4ZZAA 1MM6A 3GBAA 1JETA 4G68B 3K1NA 4BDRA 4EUOA 4QSCA 5FHNA 1B7UA 4RYAA 1GTKA 1B7HA 1QKAA 2F6PA 3G7WA 5AA1A 4LONB 3MZ1A 1NH8A 3PGFA 5CI5A 3CI8A 1LSTA 3EQ1A 4GL8A 2O68A 2D5WA 4NE4A 2H9BA 2F8DA 2ABHA 3SEXA 3H6VA 2ESNA 3T9HB 3Q26A 4GD5A 3VXCA 4WXJA 3TPAA 3TEPA 1MH3A 2Z8DA 4X1BA 2PT2A 3DP4A 4KFQA 1TWYA 3UIFA 1XVYA 3USDA 3B6WA 4GVOA 3CG1A 4U21A 4HCYA 1N76A 3LC8A 3KN3A 1IQ7A 4ZDMA 3GBBA 2XX8A 3HCQA 3Q29A 3CG3A 2FNCA 4OTEA 4F1UA 1BTJA 1Y20A 4POXA 5CM6A 3IK6B 3A3CA 5CRYA 3TYHA 2DWHA 1Z7NE 1M5DA 3N6TA 1IEJA 2QPQA 4YKPA 3QXMA 2O6AA 3PUYE 3ZSFA 2H4IA 3SEWA 4RA1A 3VVEA 2GHAA 1TT1A 3HSTA 4HTGA 2PBWA 1ZTYA 2R9JA 2Q2CA 4X1DA 4O3CA 2DE3A 1PBPA 4G8NA 3T9XB 4GL0A 4DLDA 5IKBA 1NH7A 3SEUA 2UXAA 1LB9A 5IAIA 3TZAA 3MAMA 3UP9A 4C1TA 5H8FA 4L17A 3B7DA 3MWBA 3T93B 4KI0E 3U94A 1AIVA 3FATA 2UVGA 1S9TA 1P99A 4KHZE 4FORA 1LCFA 1B5JA 2NUVA 3P7IA 4YICA 1A8FA 2XXXA 2OK2A 5H8HA 4M4GA 2B3FA 1ZJLA 2UVHA 1SYHA 5H8FB 3S9MC 2IEEA 1Y1ZA 2QS3A 4NF6A 3K6WA 3WAFA 5I57B 3IOUA 2A5TA 3W9VA 2I3WA 4NEDA 5H8HB 2Y7RA 2DE4A 3FJMA 3G3IA 2YPNA 3A3UA 4JWYA 3TKDA 5KDTA 1VFDA 4YKKA 2DWJA 2AL4A 4YAHX 3HPIA 3IOTA 1PEBA 4U23A 1OVBA 4ZE9A 2DYXA 2A5TB 4E0WA 4GXSB 3S9NC 3C36A 3DP8A 3IL1B 1B3EA 3GLBA 4OYVA 3PV0E 3C33A 4YMBA 5KDTB 1XOCA 3O9PA 2H99A 3TQWA 4P0GA 4LQ2A 2ZNTA 1O63A 5DVFA 4PETA 4FECA 2ANJA 3DP6A 5I59A 3WAEA 4RY1A 2X7QA 3E4RA 1XVXA 4E0XA 1YPNA 1FTJA 3MP8A 5HPQA 2QS4A 2NWJA 2F5XA 3I5OA 3MVYA 4JWXA 4AB5A 4FEBA 1D3KA 1HSJA 4R6KA 5I59B 2VOZA 3RN8A 4YMAA 4PFUA 3H6WA 2NXOA 1H44A 5LOMA 2XXPA 1JVXA 4G4PA 3KGCA 1B7ZA 1QKBA 3VLVA 1IXIA 2XX7A 4OZ9A 2O69A 2REGA 4WEDA 4F31B 5KZTA 2FA7A 1JEUA 4F3BA 3PPOA 1MM7A 4MBPA 3TAJA 1A99A 3K01A 4H8JA 1ZKBA 3KOSA 3UN6A 1D9YA 3KZGA 2X26A 5I2KA 1AMFA 3OSQA 4OQOA 3Q27A 5H8QA 5JEIA 2G93A 4QF9A 1F9BA 3K02A 2XXQA 1N3XA 1HSEA 4EF1A 2PT1A 2DXRA 1B5IA 2HQ0A 3H3GA 3LSFB 2ALUA 5H8NA 1N7WA 2OWTA 1OIBA 4C1UA 3MZBA 4GWOA 3QAXA 3G3KA 4H5GA 5H8QB 4POWA 1P1WA 2H5YA 4OESA 5L9OA 4PFYA 2F7AA 4XIGQ 3JZJA 3OOAA 4FAJA 3IB1A 1DPPA 2IA4A 5H8NB 5TP9A 1GV8A 2F97A 3SEVA 2ZYNA 4H1XA 4H8IA 4KPTA 2XHDA 1SI0A 1UTBA 4LA9A 2HEUA 3OEKA 4BDOA 3FV2A 3FVNA 3LSLA 3IB0A 3RT6B 5TP9B 2ZMBA 1VE4A 4X9TA 1B0LA 1B3LA 1UTBB 3MVZA 3RQTA 2DVCA 1H76A 2PX1A 2NVUB 4KD5A 4IO2A 1JW5A 3FJGA 2NOOA 1VSOA 1B46A 3JYRA 3C34A 5DVIA 1NNTA 3QUJA 4U1OA 2Q8JA 1B3FA 4XKRA 1FQEA 3TODA 4YKIA 3T22A 3GZGA 4P0IA 3DLNA 3V83A 1MQDA 1O7TA 4G2ZA 1SW1A 3L6HA 1GGGA 4Q0CA 4DIGA 3THIA 3IR1A 3EPEA 1UTHB 4R2BA 1ATGA 3TELA 1US4A 3MVXA 1ANFA 4NF4A 4QFPA 1A7LA 3QIMA 4MFIA 4GRKA 1ZMGA 3QYTA 2Y7WA 1N3WA 4G68C 4BDQA 4G8HA 1LBBA 1URSA 1Y1MA 1MPDA 4ZZEA 2ZYKA 4TOZA 1N84A 3PUXE 4ONYA 1LBCA 5BWJA 1L5TA 4U2RA 4NMYA 1M5FA 5B7DA 1P1OA 4ZEIA 3TTLA 1LAGE 3IO6A 2I0BA 3RT8A 1XC1A 3E13X 1EH3A 1B3GA 2F7CA 2V84A 4FEDA 1LB8A 1H43A 4EQBA 2R6GE 1OQGA 2VD2A 3LSXA 3H03A 3RTWB 3TDJA 2LAOA 3S2VA 3DM0A 4IGRA 3CFLA 4KCCA 1SVXB 1H45A 5ICQA 3W15C 2O1MA 1R1NA 3EF7A 4JSDA 3IX1A 1WVJA 1NFTA 1B0HA 3O66A 4ESWA 5I56A 3DELB 1R9QA 3CSGA 5H8SA 1DSNA 4JDFA 5DTBA 5F7VA 4EQ9A 1FQCA 3VFJA 5F1QA 3O6GA 3S9EA 1IUDA 3LUYA 4FE8A 1LGBC 1P1UA 3TTRA 2M8CA 4RK2A 5FHMA 1SDXA 5DYHA 1FTOA 2DP8A 3ZKKA 4LATA 5TU0A 4WEPA 3SDFA 5CBSA 5I56B 1P1QA 1MQHA 3ODBA 1LFIA 5ITOA 1M5BA 2ONSA 1MXXA 4F1YA 5K2XA 5CMBA 1CE2A 4H0WA 4XTCQ 2AYSA 2F35A 3U92A 2DSFA 2CMOA 1NL5A 4ZEFA 1DMBA 4QFOA 3TTMA 4F29A 4QFKA 2RC7A 3H06B 3I6VA 5L9MA 1MXVA 1AH5A 2V93A 4JB7A 2CZLA 3MPKA 4LZ5A 3KJ7A 2HAVA 2XX9A 3IJXB 4GF8A 1EZ9A 4RK9A 3Q28A 1IIWA 3IOVA 2B3BA 3M3LA 4QSEA 3KN8A 3RY3A 3CR9A 1OLCA 3W9WA 5ISUA 1OLAA 2QRYA 4R72A 2ZXTA 3IB2A 3UGWA 1DTZA 4BDMA 3MQ9A 4MLQA 1LLSA 2BJJX 3VVDA 3K0VA 4Z7EA 4IO4A 1D4NA 4XXUA 3FD3A 2Q89A 1VFEA 1YAEA 4MLVA 4YKJA 1JQFA 1MQJA 4NF6B 2Z8FA 1YCJA 3G3JA 3PU5A 1ELJA 1I69A 4QFLA 1PB9A 3FXQA 3D4GA 1OQHA 2D3IA 4R6HA 4TLLB 3K00A 4NWDA 1QUJA 1WODA 1VR5A 4F2OA 1URDA 4ZEBA 2HCAA 4OETA 4XKQA 4ZS9A 4GFRA 3OXNA 4OVJA 3SERA 2ONRA 2PMSA 1B9JA 3S9LC 1FQBA 2R71A 1ZU0A 3C35A 4F3SA 1HSLA 1FTLA 3FVGA 1EZOA 4H67A 2A5SA 5HM4B 4F1VA 2KLFA 1NNKA 4ZECA 2I58A 3U72A 1PC3A 3K6XA 3VV5A 2QMWA 5FTIA 3EHUA 2F34A 1Y3QA 2V3TA 4ZE8A 3TCGA 1BLFA 4KCDA 3C31A 3T9VA 3KJTA 1QUIA 5AE4A 4LZ7A 2DVZA 3PMWA 2O51A 4AQ4A 3TUSA 3ZKLA 4OXVA 1USYE 1MXYA 2XD3A 4IO6A 3ILTB 4K3FA 4F18A 3M3FA 4X48A 4Q5TA 5EHSA 4ECFA 2I3VA 3KFMA 3VLUA 3PPQA 2Z22A 1R9LA 3IAZA 3FJ7A 3FASA 4TLMB 3C4MA 4U4XA 3KSXA 1FQDA 1MQIA 1B1XA 5I2KB 1LFGA 3RPWA 1A54A 2E1SA 5CMKA 4ELOA 3CIJA 3H4ZA 3OO7A 3M8UA 4F2QA 4AB6A 3MUQA 3CSBA 3O97A 2OCUA 2I6EA 1MPCA 4C0RA 4LVQA 2XXVA 4BLAA 3G3HA
chains in the Genus database with same CATH superfamily
3HHGA 2PCRA 4NF5A 3N26A 2DOJA 2YLNA 2RKMA 3V89B 4O94A 5BUUA 4Z0IA 4U1ZA 1LCTA 3IJOB 1B2HA 3SEYA 1JW4A 1J1NA 1N04A 3B50A 4GX4A 3K6UA 3LR1A 2VPOA 5A5XA 4DZ1A 1FQFA 2H25A 4NF5B 1IMEA 1A40A 1POTA 3L6GA 5EYFA 2GHBA 4BDNA 1FCKA 1AL3A 4OHNA 5JK4A 5DVJA 1MXWA 3QUFA 4OFJA 3KN7A 3MP1A 4GQOA 4N07A 1IXGA 3H7MA 2PVUA 1SI1A 2OJTA 2O7IA 5A5XB 2XWVA 4OFOA 3FV1A 1QUKA 1AOVA 4PP0A 4NG7A 1NV1A 1MY2A 3FZVA 2CEYA 3H6UA 2AL5A 2Q9TA 4IB2A 4U22A 2Y7IA 2F7BA 4NTLA 4JXIA 1LAHE 4DXBA 3PD9A 3IFAA 3MBPA 4I9DA 2QS1A 2P1SA 4RXLA 3OO9A 5M2VA 4DXUA 2V3QA 5ICTA 4FATA 2ZNSA 1Y4TA 1FPEA 2QVUA 1N0TA 4XKPA 1B52A 4XKNA 3EKIA 2Y5LA 3SKPA 4XFEA 5FTHA 4MX6A 2I4BA 4GLIA 4GWYA 2MKZA 1QULA 5L9SA 4EXLA 4JBZA 4NF4B 1SBPA 4R75A 4WKMA 3B6TA 3U93A 3ONMA 2DQVA 1B05A 4OFLA 2QS2A 1TFDA 5I3SA 3EHTA 4DXCA 3KOTA 2VT5A 2QFLA 5TPAA 4HCWA 2FVZA 3IOWA 1T0KA 1LBZA 4HE0A 4KYSA 1SD3A 1XHYA 1ZIUA 4DDDA 4ELPA 2D21A 4LZ8A 3N5LA 4MEVA 1EU8A 3M3KA 2I0CA 3VLWA 1MQGA 2ZYOA 4G77A 3C9HA 4FIMA 2VP1A 2ZNUA 1NMUA 4NF0A 4MJOA 5TPAB 1LBYA 1KZ8A 4U4SA 3PUVE 4O8MA 3UORA 1RKMA 5A5LA 3OD7A 2FIEA 3RUMA 4NWCA 1YTVA 2GFEA 1UQWA 1SW5A 3E3KA 4RPNA 1DBZA 4I1DA 3TCHA 5KCJA 4PFTA 1URGA 5ITPA 3PMXA 2XXRA 2PFZA 1DTGA 1O64A 3KBRA 4ZEDA 1EYIA 2Z8EA 3OMBA 5FBPA 1JW1A 4MNPA 4IO5A 4DE8A 4IO7A 3OO6A 3MPLA 4NQ8A 5CMCA 1Y9UA 3OELA 4G8MA 1LAXA 1KWHA 1H3DA 1S7YA 3CVGA 4DCYA 5KCJB 2B65A 3TTKA 5K2YA 1D9QA 4UA8A 4R9FA 3TTNA 4R2FA 1B1HA 1FTKA 4AS5A 2FBPA 3TFLA 5IM2A 2XA5A 1Z7ME 2RC9A 3T9UA 4F3PA 2KQZA 5AA3A 1NV0A 3F11A 4I40A 3PUZE 3RGYA 3HHFA 4LN5A 3FXUA 1IXCA 4N8GA 4YB7A 1KA1A 2XXWA 1POY1 3EN3A 2F36A 1II5A 1LAFE 4EDPA 5CBRA 3TQLA 4GXAA 1B40A 3O6IA 3R6UA 2Q88A 1QW0A 3MJNA 1EZPA 4IGTA 3I3VA 3H6TA 1Y4CA 5EYHA 1B5HA 3FVOA 4PQJA 1BIYA 4KYEA 1MPBA 3BFTA 3N94A 1FJ9A 2I4CA 2WKYA 5I57A 3KSJA 3R26A 4M1VA 4QSDA 1S50A 1NV6A 2THIA 1Q1KA 4O3AA 2P3NA 1WDNA 3VXBA 1MXZA 1PB7A 1XS5A 4IO3A 1D9VA 4FJPA 1FPBA 3HFUA 2I48A 4PE5B 2RCAA 1M5CA 2UYEA 2VHAA 4EQ7A 1I6BA 4UACA 4P11A 4H5FA 3G3GA 2DWAA 2G29A 1JEVA 2Y84A 3NOHA 4QHQA 1BP5A 3KEIA 3T66A 1UIUA 5ELVA 3FUZA 3O28A 3A29A 4IY6A 2Z23A 2AIXA 3PMVA 3MC2A 4JWOA 1MY4A 1DOTA 1MDP1 3G3FA 4RJZA 5B70A 2CZKA 3JV9A 3TCFA 1B58A 1QJMA 2ZYMA 2WEFA 1TFAA 4N13A 2F3DA 4ELRA 4YB5A 1JVYA 5ET8A 2H98A 5JTYA 4LP2B 1ZBMA 4LQ5A 2ZZWA 4QRZA 4BDLA 2W7YA 4OEUA 3MVWA 3BBRA 1DPEA 1A8EA 2F6GA 1IXHA 4P8BA 2F78A 4I62A 3R7XA 3Q25A 3V5AA 2E0SA 4HS7A 1MY1A 4ZEKA 4PDHA 4OEVA 3C32A 2WBBA 4MF3A 5EHMA 3E9XA 5JTYB 4ELQA 1TXFA 4IY5A 2O7UA 3K1PA 1MS7A 4RNSA 1KA0A 1B32A 2HFBA 3CFZA 3EHSA 1BKAA 3KC1A 4HW8A 3MYUA 1QVSA 1PBQA 3GXAA 4GIZA 2O84X 5I84A 1FPKA 3BKIB 3UA8A 4R73A 2RINA 1GVCA 2XXIA 5CMMA 3KC0A 3FIRA 1B51A 4P1LA 4GOTA 2VPNA 4O3BA 3SETA 4I3EA 4N6PA 4EF2A 1FW0A 2OLBA 2DS9A 2FYIA 2UYFA 3QSLA 2X7PA 1B3HA 3OSRA 3S4UA 2HZKA 3FXRA 5IGAA 1Q35A 3N6UA 4YB6A 4OMBA 3E78A 4F3GA 1MXUA 1OVTA 3V8XB 1N7XA 3QK6A 2YJPA 3CRBA 3OEMA 3PUWE 2DE2A 1CB6A 3PPRA 5AA2A 3MZ9A 1LFHA 3O6HA 4YU0A 2QJEA 4EXKA 3K2DA 4ISUA 1NKXA 2VGQA 4LUBA 3IORA 1NV4A 3HN0A 3K6VA 3LBSA 3U1OA 1FQAA 2P2AA 1XT8A 3RNNA 3OO8A 2Y5KA 1GR2A 1USYH 5DEXA 4Q30B 2V25A 2XXUA 3U8QA 1B4HA 5AA2B 1SW4A 3A09A 5FHOA 4DCXA 2Y7KA 4KR5A 1UIVA 3VVFA 5L8DA 3VE1B 1P1NA 2REJA 5DT6A 5AA2D 1A55A 2KR0A 2GH9A 2Q8MA 5I58A 2VD3A 3T96B 5I2NA 3BFUA 1FTMA 1NV2A 3K1MA 1SPIA 1US5A 5DEXB 1IZ1A 1MY3A 1PB8A 2QL3A 5LDZA 1YYZA 2PYYA 2OWSA 1NNPA 3TMGA 4GWZA 1SQYA 3AXFA 4NN3A 2DWIA 2QMXA 3IO4A 4KYDA 3HO7A 4PAKA 4F39A 2QSXA 4PFWA 2V3UA 1MDQA 5I58B 1M5EA 2UVJA 4MH5A 1MRPA 4I8CA 5HBCA 5I2NB 3PPNA 3CFXA 4THIA 4ND9A 1IITA 1B4ZA 3ILUB 4R6YA 1G0HA 4H6DA 3D4CA 5CC2A 4MNCA 1OMPA 4OWDA 2R8TA 2XXHA 3K4UA 4ESXA 3HV1A 2OBGA 3KG2A 5ET7A 3FVKA 4H65A 3O2AA 3PPPA 3LSWA 3GYYA 1I6AA 4F19A 4KQPA 1NNFA 2RCBA 2OZZA 1UTHA 1B6HA 5ET5A 1I6QA 1PDAA 4Q8RA 2Q2AA 4NF8A 3ZS6A 1RDYA 3SESA 4R74A 2UVIA 1SW2A 4OA4A 2RF1A 4JSOA 5AA4A 1ZLQA 1RYOA 3RLFE 2XXTA 1IMCA 1DCUA 1MH4A 1R6ZA 3ECRA 2Y7PA 4OENA 3VDFA 4QFNA 4JVCA 3PD8A 2XD2A 4DI4B 2ONKE 3B6QA 2F3BA 3MW0A 2ZZXA 3OENA 4TQUQ 2RC8A 4YZZA 4RPOA 3RTFB 1Y3NA 4OERA 4F22A 3FGSA 1AWBA 4HXVA 4NF8B 2DXYA 2GQ1A 2HZLA 5AA4B 2O1LA 4G68A 5J1DA 1MG1A 5I7IA 1Y3PA 1LBXA 3UK4A 3MP6A 2HXWA 2I49A 1RYXA 1SYIA 1JNFA 2GRVA 3BIGA 4R9GA 2HAUA 3O29A 5EQ7A 2P0SA 2XXYA 1MY0A 4ZZAA 1MM6A 3GBAA 1JETA 4G68B 4I3YA 3K1NA 4BDRA 4EUOA 1FPIA 2Q74A 4QSCA 5FHNA 1B7UA 4RYAA 1GTKA 1B7HA 1QKAA 2F6PA 3G7WA 5AA1A 4PE3A 4LONB 3MZ1A 1NH8A 1QGXA 3PGFA 5EQAA 5CI5A 3CI8A 1LSTA 3EQ1A 4GL8A 2O68A 2D5WA 4NE4A 2H9BA 2F8DA 2ABHA 3SEXA 3H6VA 2ESNA 2OWZA 3T9HB 3Q26A 4GD5A 3VXCA 4WXJA 3TPAA 3TEPA 1MH3A 2Z8DA 4X1BA 2PT2A 3DP4A 4KFQA 4PCDA 1TWYA 3UIFA 1XVYA 3USDA 3B6WA 4GVOA 3CG1A 4U21A 4HCYA 1N76A 3LC8A 3KN3A 1IQ7A 3RYDA 4ZDMA 3GBBA 2XX8A 3HCQA 2HXRA 3Q29A 2QVRA 3CG3A 2FNCA 4PAIA 4OTEA 4F1UA 1BTJA 1Y20A 4POXA 5CM6A 4NHBA 4MAGA 3IK6B 3A3CA 4NGUA 5CRYA 3TYHA 2DWHA 1Z7NE 1M5DA 4PFBA 3N6TA 1IEJA 5J16A 2QPQA 4YKPA 4GWUA 1FBDA 3QXMA 2O6AA 3PUYE 3ZSFA 2H4IA 3SEWA 4RA1A 3VVEA 4N15A 4H45A 2GHAA 1TT1A 2FHYA 3HSTA 4PDDA 4HTGA 2PBWA 1ZTYA 2R9JA 2Q2CA 4X1DA 4O3CA 2DE3A 1PBPA 1VDWA 4G8NA 2CEXA 4N8YA 3T9XB 4GL0A 2L5VA 4DLDA 5IKBA 4GX3A 1NH7A 3SEUA 2UXAA 1LB9A 4GX6A 2PFYA 5IAIA 3FXBA 3TZAA 3MAMA 3UP9A 4C1TA 5H8FA 4L17A 3B7DA 3MWBA 3T93B 4KI0E 3MSTA 3U94A 1AIVA 3FATA 2UVGA 2CZIA 1S9TA 1P99A 4KHZE 4X04A 4FORA 1LCFA 1B5JA 2NUVA 3P7IA 4YICA 4P1EA 1A8FA 2XXXA 2OK2A 5H8HA 4M4GA 2B3FA 1RDZA 1ZJLA 3LUZA 2UVHA 1SYHA 5H8FB 3S9MC 2IEEA 1Y1ZA 2QS3A 4NF6A 3K6WA 5LTCA 3WAFA 5I57B 3QMFA 3IOUA 2WYKA 2A5TA 3W9VA 2I3WA 4NEDA 5H8HB 2Y7RA 2DE4A 3FJMA 3G3IA 2YPNA 3A3UA 4JWYA 3TKDA 4PFRA 4HE2A 5KDTA 1VFDA 4YKKA 2DWJA 2AL4A 4PBHA 4YAHX 3HPIA 3IOTA 1PEBA 4U23A 1OVBA 4ZE9A 2DYXA 1FBFA 1FPDA 2A5TB 4P9KA 4E0WA 4GXSB 3S9NC 3C36A 3DP8A 3IL1B 1LEVA 1B3EA 2FIXA 3GLBA 4O7MA 4OYVA 3PV0E 3C33A 4YMBA 1NUYA 5KDTB 1XOCA 3O9PA 2H99A 4OVPA 3TQWA 3KBZA 4P0GA 4LQ2A 1DK4A 2ZNTA 1FPJA 1O63A 5DVFA 4PETA 4FECA 2ANJA 3DP6A 4PFIA 1FPLA 5I59A 3WAEA 4RY1A 2X7QA 3E4RA 1FTAA 1XVXA 3LV0A 4E0XA 1YPNA 4HE1A 1FTJA 3MP8A 5HPQA 2QS4A 4MCOA 2NWJA 2F5XA 2OX3A 3I5OA 3MVYA 4PF6A 4JWXA 4AB5A 4FEBA 1D3KA 1HSJA 4R6KA 5I59B 2VOZA 4MIJA 3RN8A 2B4LA 4YMAA 4PFUA 4MNIA 3H6WA 2NXOA 4GWXA 1H44A 5LOMA 2XXPA 1JVXA 4G4PA 3KGCA 1B7ZA 1QKBA 3VLVA 1IXIA 4P47A 4UABA 5EYGA 2XX7A 4OZ9A 2O69A 2REGA 4WEDA 4X8RA 4F31B 5KZTA 2FA7A 1JEUA 3PPOA 4F3BA 1MM7A 4MBPA 3TAJA 1A99A 1NV5A 3K01A 4H8JA 1ZKBA 3KOSA 3UN6A 1D9YA 3KZGA 2X26A 5I2KA 3T1BA 1AMFA 3OSQA 4OQOA 3Q27A 5H8QA 5JEIA 2G93A 4NX1A 5IZZA 4QF9A 1F9BA 3K02A 1LBVA 2XXQA 1FSAA 1N3XA 1HSEA 4EF1A 2PT1A 2DXRA 1B5IA 2HQ0A 3H3GA 4N81A 2CZHA 3LSFB 2ALUA 5H8NA 1N7WA 4H46A 2OWTA 1OIBA 4C1UA 3MZBA 4GWOA 3QAXA 3G3KA 4H5GA 4PC9A 5H8QB 4POWA 2QVVA 1NI9A 1LBWA 1P1WA 2H5YA 4OESA 5L9OA 4PFYA 2F7AA 4XIGQ 3JZJA 3OOAA 4FAJA 3IB1A 1DPPA 4XF5A 2IA4A 5H8NB 5TP9A 1GV8A 2F97A 1BK4A 3SEVA 2ZYNA 4H1XA 4H8IA 4KPTA 2XHDA 1SI0A 1UTBA 1FBEA 1NUXA 4LA9A 4IR8A 1NUWA 2HEUA 3OEKA 4PF8A 4BDOA 3FV2A 4JVIA 4OVSA 3FVNA 4OANA 3LSLA 3IB0A 3RT6B 5TP9B 2ZMBA 3B8BA 1VE4A 1K9ZA 4X9TA 1B0LA 1B3LA 1UTBB 3MVZA 3RQTA 2DVCA 1H76A 2PX1A 2NVUB 2XXKA 2V4CA 4KD5A 1IMDA 4IO2A 1JW5A 1NUZA 3FJGA 2NOOA 1VSOA 4MHFA 3PTYA 1B46A 3JYRA 3C34A 5DVIA 1NNTA 3QUJA 4N4UA 4U1OA 2Q8JA 1B3FA 4XKRA 1FQEA 4N17A 3TODA 4YKIA 3T22A 3T0JA 3GZGA 4P0IA 3DLNA 1IMFA 3V83A 1MQDA 1O7TA 4G2ZA 1SW1A 3L6HA 4G61A 1GGGA 5ET6A 4Q0CA 4DIGA 3THIA 3IR1A 3EPEA 1UTHB 4R2BA 1ATGA 3TELA 1US4A 3MVXA 1ANFA 1RDXA 4NF4A 4N6KA 4QFPA 1FBHA 1A7LA 3QIMA 4MFIA 4GRKA 1ZMGA 3QYTA 2Y7WA 4OVRA 1N3WA 4G68C 4BDQA 4G8HA 1FBGA 1LBBA 1URSA 1Y1MA 4GBWA 1MPDA 4ZZEA 2ZYKA 4TOZA 1N84A 3PUXE 4ONYA 1LBCA 4N91A 5BWJA 1L5TA 4U2RA 4NMYA 1M5FA 5B7DA 1P1OA 4ZEIA 3TTLA 1LAGE 3IO6A 2I0BA 3E79A 4GWSA 5IZ3A 1FRPA 3RT8A 1YXIA 1XC1A 3E13X 1EH3A 1B3GA 2F7CA 2V84A 4FEDA 1LB8A 1H43A 4EQBA 2R6GE 1INPA 1OQGA 2VD2A 3LSXA 3RPLA 3H03A 3RTWB 1EYKA 3TDJA 5IZ3B 2LAOA 3S2VA 3DM0A 4IGRA 3CFLA 4KCCA 4P3LA 1SVXB 3ISPA 1H45A 5ICQA 3W15C 2O1MA 2WYPA 1R1NA 3EF7A 5ESYA 4JSDA 3IX1A 1WVJA 1NFTA 1B0HA 3CHGA 4P56A 3O66A 4ESWA 5I56A 3DELB 1R9QA 3CSGA 3RPLB 5H8SA 1DSNA 4JDFA 5DTBA 5F7VA 4EQ9A 1FQCA 3VFJA 5F1QA 4KXPA 3D1RA 3O6GA 3S9EA 1IUDA 3LUYA 2HPGA 4FE8A 1LGBC 1P1UA 3TTRA 2M8CA 4RK2A 5FHMA 1SDXA 5DYHA 1FTOA 2DP8A 3ZKKA 4LATA 5TU0A 1NV3A 4WEPA 3SDFA 5CBSA 3SZPA 5IZ1A 5I56B 4DI3D 1P1QA 1XI6A 1Q9DA 4FBPA 1FPGA 1MQHA 5EQ9A 3ODBA 1LFIA 5ITOA 2P3VA 1M5BA 2DDKA 4GWWA 1FBCA 2ONSA 1MXXA 4F1YA 5K2XA 5CMBA 2BJIA 1CE2A 2XWIA 4H0WA 4XTCQ 2AYSA 2F35A 3U92A 2DSFA 1YZ0A 4NAPA 2CMOA 1NL5A 4PBQA 4ZEFA 1DMBA 4PTKA 3BIHA 4QFOA 4QXDA 3TTMA 4F29A 4QFKA 1IMBA 2RC7A 3H06B 3I6VA 5L9MA 1MXVA 1AH5A 2V93A 4JB7A 2CZLA 3MPKA 4LZ5A 1G0IA 2XWKA 3KJ7A 2HAVA 2XX9A 3IJXB 4GF8A 1EZ9A 4RK9A 3Q28A 1IIWA 3IOVA 2B3BA 3M3LA 4QSEA 3KN8A 3RY3A 3CR9A 1OLCA 3W9WA 5ISUA 1OLAA 2QRYA 4R72A 2ZXTA 3IB2A 3UGWA 1DTZA 5F24A 3FBPA 4BDMA 3MQ9A 4MLQA 4XEQA 1LLSA 2BJJX 3VVDA 3K0VA 4Z7EA 4IO4A 1D4NA 1JP4A 4XXUA 3FD3A 2Q89A 1VFEA 1YAEA 4MLVA 4YKJA 1JQFA 1MQJA 2XWOA 4NF6B 1K9YA 2Z8FA 4PGNA 5EQ8A 1YCJA 3G3JA 3PU5A 1ELJA 1I69A 4QFLA 2JJKA 1PB9A 3FXQA 3D4GA 1OQHA 2D3IA 4O7IA 4R6HA 4TLLB 3K00A 4NWDA 1QUJA 4OVTA 1WODA 1VR5A 4F2OA 1URDA 4ZEBA 2HCAA 4OETA 4XKQA 4ZS9A 4GFRA 4PGPA 3OXNA 2WBDA 4OVJA 3SERA 1FJ6A 2ONRA 2PMSA 1B9JA 3S9LC 1FQBA 2R71A 2ZZVA 1ZU0A 3C35A 1HSLA 4F3SA 1FTLA 4PAFA 2B4MA 5T3JA 3FVGA 1EZOA 4H67A 2A5SA 1FPFA 5HM4B 4F1VA 2KLFA 1NNKA 4ZECA 2I58A 3U72A 4GBVA 4JVDA 1PC3A 3K6XA 3VV5A 2QMWA 5FTIA 3EHUA 2F34A 2WX9A 1Y3QA 2V3TA 4ZE8A 3TCGA 1BLFA 4AS4A 4KCDA 3C31A 3T9VA 3KJTA 1QUIA 1EYJA 4QBAA 5AE4A 4LZ7A 2DVZA 3PMWA 1IMAA 2O51A 4AQ4A 3TUSA 3ZKLA 4OXVA 1USYE 1MXYA 2XD3A 4IO6A 3ILTB 4K3FA 4F18A 3M3FA 4X48A 4Q5TA 1FBPA 4MMPA 5EHSA 4ECFA 2I3VA 5I5PA 3KFMA 3VLUA 3PPQA 2Z22A 1R9LA 3IAZA 3FJ7A 4OVQA 3FASA 4TLMB 4N6DA 3C4MA 3ROJA 3IFCA 5DW8A 4U4XA 3KSXA 1FQDA 3U65A 1MQIA 1B1XA 5I2KB 1LFGA 3RPWA 1A54A 2E1SA 5CMKA 4ELOA 3CIJA 3H4ZA 3OO7A 3M8UA 4F2QA 2HHMA 4AB6A 3MUQA 3CSBA 3O97A 2OCUA 2I6EA 1NV7A 1MPCA 1CNQA 4C0RA 4LVQA 2XXVA 4BLAA 3G3HA
chains in the Genus database with same CATH topology
3HHGA 4NF5A 3N26A 2DOJA 2YLNA 2RKMA 3V89B 5BUUA 4Z0IA 4U1ZA 1LCTA 3IJOB 1B2HA 3SEYA 1JW4A 1J1NA 1N04A 3K6UA 3LR1A 5A5XA 4DZ1A 1FQFA 2H25A 4NF5B 1A40A 1POTA 3L6GA 5EYFA 2GHBA 4BDNA 1FCKA 1AL3A 4OHNA 5JK4A 5DVJA 1MXWA 3QUFA 4OFJA 3KN7A 3MP1A 4GQOA 4N07A 1IXGA 3H7MA 2PVUA 1SI1A 2OJTA 2O7IA 5A5XB 4OFOA 3FV1A 1QUKA 1AOVA 4PP0A 1MY2A 3FZVA 3H6UA 2AL5A 2Q9TA 4IB2A 4U22A 2Y7IA 2F7BA 4NTLA 4JXIA 1LAHE 4DXBA 3PD9A 3MBPA 4I9DA 2QS1A 2P1SA 4RXLA 3OO9A 5M2VA 4DXUA 2V3QA 5ICTA 4FATA 2ZNSA 1Y4TA 1N0TA 4XKPA 1B52A 4XKNA 3SKPA 5FTHA 2I4BA 4GLIA 1QULA 5L9SA 4EXLA 4JBZA 4NF4B 1SBPA 4R75A 4WKMA 3B6TA 3U93A 3ONMA 2DQVA 1B05A 4OFLA 2QS2A 1TFDA 3EHTA 4DXCA 3KOTA 5TPAA 4HCWA 3IOWA 1T0KA 4KYSA 1SD3A 1XHYA 1ZIUA 4DDDA 4ELPA 2D21A 4LZ8A 3N5LA 1EU8A 3M3KA 2I0CA 3VLWA 1MQGA 2ZYOA 4G77A 3C9HA 4FIMA 2VP1A 2ZNUA 1NMUA 5TPAB 4U4SA 3PUVE 3UORA 1RKMA 3OD7A 3RUMA 4NWCA 1YTVA 2GFEA 1UQWA 1SW5A 3E3KA 4RPNA 4I1DA 3TCHA 5KCJA 4PFTA 1URGA 5ITPA 3PMXA 2XXRA 1DTGA 1O64A 3KBRA 4ZEDA 2Z8EA 3OMBA 1JW1A 4IO5A 4DE8A 4IO7A 3OO6A 3MPLA 5CMCA 1Y9UA 3OELA 4G8MA 1LAXA 1KWHA 1H3DA 1S7YA 3CVGA 4DCYA 5KCJB 2B65A 3TTKA 5K2YA 4UA8A 4R9FA 3TTNA 4R2FA 1B1HA 1FTKA 3TFLA 1Z7ME 2RC9A 3T9UA 4F3PA 5AA3A 3F11A 3PUZE 3RGYA 3HHFA 3FXUA 1IXCA 4YB7A 2XXWA 1POY1 3EN3A 2F36A 1II5A 1LAFE 4EDPA 5CBRA 3TQLA 4GXAA 1B40A 3O6IA 3R6UA 2Q88A 1QW0A 3MJNA 1EZPA 4IGTA 3I3VA 3H6TA 1Y4CA 1B5HA 3FVOA 4PQJA 1BIYA 4KYEA 1MPBA 3BFTA 3N94A 2I4CA 2WKYA 5I57A 3KSJA 3R26A 4M1VA 4QSDA 1S50A 2THIA 1Q1KA 4O3AA 1WDNA 3VXBA 1MXZA 1PB7A 1XS5A 4IO3A 1D9VA 4FJPA 2I48A 4PE5B 2RCAA 1M5CA 2UYEA 2VHAA 4EQ7A 1I6BA 4UACA 4P11A 4H5FA 3G3GA 2DWAA 2G29A 1JEVA 2Y84A 4QHQA 1BP5A 3KEIA 3T66A 1UIUA 5ELVA 3FUZA 3O28A 4IY6A 2Z23A 2AIXA 3PMVA 3MC2A 4JWOA 1MY4A 1DOTA 1MDP1 3G3FA 4RJZA 5B70A 3JV9A 3TCFA 1B58A 1QJMA 2ZYMA 1TFAA 4N13A 4ELRA 4YB5A 1JVYA 2H98A 5JTYA 4LP2B 1ZBMA 4LQ5A 4QRZA 4BDLA 2W7YA 4OEUA 3MVWA 3BBRA 1DPEA 1A8EA 2F6GA 1IXHA 2F78A 4I62A 3R7XA 3Q25A 3V5AA 2E0SA 4HS7A 1MY1A 4ZEKA 4OEVA 3C32A 4MF3A 5EHMA 3E9XA 5JTYB 4ELQA 1TXFA 4IY5A 2O7UA 3K1PA 1MS7A 4RNSA 1B32A 2HFBA 3CFZA 3EHSA 1BKAA 4HW8A 1QVSA 1PBQA 3GXAA 4GIZA 2O84X 5I84A 3BKIB 3UA8A 4R73A 2RINA 1GVCA 2XXIA 5CMMA 3FIRA 1B51A 4GOTA 4O3BA 3SETA 4N6PA 4EF2A 1FW0A 2OLBA 2DS9A 2FYIA 2UYFA 3QSLA 2X7PA 1B3HA 3OSRA 3S4UA 2HZKA 3FXRA 1Q35A 3N6UA 4YB6A 4OMBA 4F3GA 1MXUA 1OVTA 3V8XB 1N7XA 3QK6A 2YJPA 3CRBA 3OEMA 3PUWE 2DE2A 1CB6A 3PPRA 5AA2A 3MZ9A 1LFHA 3O6HA 4YU0A 2QJEA 4EXKA 3K2DA 4ISUA 1NKXA 2VGQA 4LUBA 3IORA 3HN0A 3K6VA 3LBSA 3U1OA 1FQAA 2P2AA 1XT8A 3RNNA 3OO8A 1GR2A 1USYH 5DEXA 4Q30B 2V25A 2XXUA 3U8QA 1B4HA 5AA2B 1SW4A 3A09A 5FHOA 4DCXA 2Y7KA 4KR5A 1UIVA 3VVFA 5L8DA 3VE1B 1P1NA 2REJA 5DT6A 5AA2D 1A55A 2GH9A 5I58A 2VD3A 3T96B 5I2NA 3BFUA 1FTMA 3K1MA 1US5A 5DEXB 1IZ1A 1MY3A 1PB8A 2QL3A 2PYYA 2OWSA 1NNPA 3TMGA 1SQYA 3AXFA 2DWIA 2QMXA 3IO4A 4KYDA 3HO7A 4F39A 2QSXA 4PFWA 2V3UA 1MDQA 5I58B 1M5EA 2UVJA 1MRPA 4MH5A 4I8CA 5HBCA 5I2NB 3PPNA 3CFXA 4THIA 4ND9A 1IITA 1B4ZA 3ILUB 4R6YA 4H6DA 3D4CA 5CC2A 1OMPA 4OWDA 2XXHA 3K4UA 4ESXA 3HV1A 2OBGA 3KG2A 3FVKA 4H65A 3O2AA 3PPPA 3LSWA 1I6AA 4F19A 4KQPA 1NNFA 2RCBA 2OZZA 1UTHA 1B6HA 1I6QA 4Q8RA 1PDAA 2Q2AA 4NF8A 3ZS6A 3SESA 4R74A 2UVIA 1SW2A 2RF1A 4JSOA 5AA4A 1ZLQA 1RYOA 3RLFE 2XXTA 1MH4A 1R6ZA 3ECRA 2Y7PA 4OENA 3VDFA 4QFNA 3PD8A 2XD2A 2ONKE 3B6QA 3MW0A 3OENA 2RC8A 4TQUQ 4YZZA 4RPOA 3RTFB 1Y3NA 4OERA 4F22A 3FGSA 4NF8B 2DXYA 2HZLA 5AA4B 2O1LA 4G68A 5J1DA 1MG1A 1Y3PA 3UK4A 2I49A 2HXWA 3MP6A 1RYXA 1SYIA 1JNFA 2GRVA 4R9GA 2HAUA 3O29A 2P0SA 2XXYA 1MY0A 4ZZAA 1MM6A 3GBAA 1JETA 4G68B 3K1NA 4BDRA 4EUOA 4QSCA 5FHNA 1B7UA 4RYAA 1GTKA 1B7HA 1QKAA 2F6PA 3G7WA 5AA1A 4LONB 3MZ1A 1NH8A 3PGFA 5CI5A 3CI8A 1LSTA 3EQ1A 4GL8A 2O68A 2D5WA 4NE4A 2H9BA 2F8DA 2ABHA 3SEXA 3H6VA 2ESNA 3T9HB 3Q26A 4GD5A 3VXCA 4WXJA 3TPAA 3TEPA 1MH3A 2Z8DA 4X1BA 2PT2A 3DP4A 4KFQA 1TWYA 3UIFA 1XVYA 3USDA 3B6WA 4GVOA 3CG1A 4U21A 4HCYA 1N76A 3LC8A 3KN3A 1IQ7A 4ZDMA 3GBBA 2XX8A 3HCQA 3Q29A 3CG3A 2FNCA 4OTEA 4F1UA 1BTJA 1Y20A 4POXA 5CM6A 3IK6B 3A3CA 5CRYA 3TYHA 2DWHA 1Z7NE 1M5DA 3N6TA 1IEJA 2QPQA 4YKPA 3QXMA 2O6AA 3PUYE 3ZSFA 2H4IA 3SEWA 4RA1A 3VVEA 2GHAA 1TT1A 3HSTA 4HTGA 2PBWA 1ZTYA 2R9JA 2Q2CA 4X1DA 4O3CA 2DE3A 1PBPA 4G8NA 3T9XB 4GL0A 4DLDA 5IKBA 1NH7A 3SEUA 2UXAA 1LB9A 5IAIA 3TZAA 3MAMA 3UP9A 4C1TA 5H8FA 4L17A 3B7DA 3MWBA 3T93B 4KI0E 3U94A 1AIVA 3FATA 2UVGA 1S9TA 1P99A 4KHZE 4FORA 1LCFA 1B5JA 2NUVA 3P7IA 4YICA 1A8FA 2XXXA 2OK2A 5H8HA 4M4GA 2B3FA 1ZJLA 2UVHA 1SYHA 5H8FB 3S9MC 2IEEA 1Y1ZA 2QS3A 4NF6A 3K6WA 3WAFA 5I57B 3IOUA 2A5TA 3W9VA 2I3WA 4NEDA 5H8HB 2Y7RA 2DE4A 3FJMA 3G3IA 2YPNA 3A3UA 4JWYA 3TKDA 5KDTA 1VFDA 4YKKA 2DWJA 2AL4A 4YAHX 3HPIA 3IOTA 1PEBA 4U23A 1OVBA 4ZE9A 2DYXA 2A5TB 4E0WA 4GXSB 3S9NC 3C36A 3DP8A 3IL1B 1B3EA 3GLBA 4OYVA 3PV0E 3C33A 4YMBA 5KDTB 1XOCA 3O9PA 2H99A 3TQWA 4P0GA 4LQ2A 2ZNTA 1O63A 5DVFA 4PETA 4FECA 2ANJA 3DP6A 5I59A 3WAEA 4RY1A 2X7QA 3E4RA 1XVXA 4E0XA 1YPNA 1FTJA 3MP8A 5HPQA 2QS4A 2NWJA 2F5XA 3I5OA 3MVYA 4JWXA 4AB5A 4FEBA 1D3KA 1HSJA 4R6KA 5I59B 2VOZA 3RN8A 4YMAA 4PFUA 3H6WA 2NXOA 1H44A 5LOMA 2XXPA 1JVXA 4G4PA 3KGCA 1B7ZA 1QKBA 3VLVA 1IXIA 2XX7A 4OZ9A 2O69A 2REGA 4WEDA 4F31B 5KZTA 2FA7A 1JEUA 4F3BA 3PPOA 1MM7A 4MBPA 3TAJA 1A99A 3K01A 4H8JA 1ZKBA 3KOSA 3UN6A 1D9YA 3KZGA 2X26A 5I2KA 1AMFA 3OSQA 4OQOA 3Q27A 5H8QA 5JEIA 2G93A 4QF9A 1F9BA 3K02A 2XXQA 1N3XA 1HSEA 4EF1A 2PT1A 2DXRA 1B5IA 2HQ0A 3H3GA 3LSFB 2ALUA 5H8NA 1N7WA 2OWTA 1OIBA 4C1UA 3MZBA 4GWOA 3QAXA 3G3KA 4H5GA 5H8QB 4POWA 1P1WA 2H5YA 4OESA 5L9OA 4PFYA 2F7AA 4XIGQ 3JZJA 3OOAA 4FAJA 3IB1A 1DPPA 2IA4A 5H8NB 5TP9A 1GV8A 2F97A 3SEVA 2ZYNA 4H1XA 4H8IA 4KPTA 2XHDA 1SI0A 1UTBA 4LA9A 2HEUA 3OEKA 4BDOA 3FV2A 3FVNA 3LSLA 3IB0A 3RT6B 5TP9B 2ZMBA 1VE4A 4X9TA 1B0LA 1B3LA 1UTBB 3MVZA 3RQTA 2DVCA 1H76A 2PX1A 2NVUB 4KD5A 4IO2A 1JW5A 3FJGA 2NOOA 1VSOA 1B46A 3JYRA 3C34A 5DVIA 1NNTA 3QUJA 4U1OA 2Q8JA 1B3FA 4XKRA 1FQEA 3TODA 4YKIA 3T22A 3GZGA 4P0IA 3DLNA 3V83A 1MQDA 1O7TA 4G2ZA 1SW1A 3L6HA 1GGGA 4Q0CA 4DIGA 3THIA 3IR1A 3EPEA 1UTHB 4R2BA 1ATGA 3TELA 1US4A 3MVXA 1ANFA 4NF4A 4QFPA 1A7LA 3QIMA 4MFIA 4GRKA 1ZMGA 3QYTA 2Y7WA 1N3WA 4G68C 4BDQA 4G8HA 1LBBA 1URSA 1Y1MA 1MPDA 4ZZEA 2ZYKA 4TOZA 1N84A 3PUXE 4ONYA 1LBCA 5BWJA 1L5TA 4U2RA 4NMYA 1M5FA 5B7DA 1P1OA 4ZEIA 3TTLA 1LAGE 3IO6A 2I0BA 3RT8A 1XC1A 3E13X 1EH3A 1B3GA 2F7CA 2V84A 4FEDA 1LB8A 1H43A 4EQBA 2R6GE 1OQGA 2VD2A 3LSXA 3H03A 3RTWB 3TDJA 2LAOA 3S2VA 3DM0A 4IGRA 3CFLA 4KCCA 1SVXB 1H45A 5ICQA 3W15C 2O1MA 1R1NA 3EF7A 4JSDA 3IX1A 1WVJA 1NFTA 1B0HA 3O66A 4ESWA 5I56A 3DELB 1R9QA 3CSGA 5H8SA 1DSNA 4JDFA 5DTBA 5F7VA 4EQ9A 1FQCA 3VFJA 5F1QA 3O6GA 3S9EA 1IUDA 3LUYA 4FE8A 1LGBC 1P1UA 3TTRA 2M8CA 4RK2A 5FHMA 1SDXA 5DYHA 1FTOA 2DP8A 3ZKKA 4LATA 5TU0A 4WEPA 3SDFA 5CBSA 5I56B 1P1QA 1MQHA 3ODBA 1LFIA 5ITOA 1M5BA 2ONSA 1MXXA 4F1YA 5K2XA 5CMBA 1CE2A 4H0WA 4XTCQ 2AYSA 2F35A 3U92A 2DSFA 2CMOA 1NL5A 4ZEFA 1DMBA 4QFOA 3TTMA 4F29A 4QFKA 2RC7A 3H06B 3I6VA 5L9MA 1MXVA 1AH5A 2V93A 4JB7A 2CZLA 3MPKA 4LZ5A 3KJ7A 2HAVA 2XX9A 3IJXB 4GF8A 1EZ9A 4RK9A 3Q28A 1IIWA 3IOVA 2B3BA 3M3LA 4QSEA 3KN8A 3RY3A 3CR9A 1OLCA 3W9WA 5ISUA 1OLAA 2QRYA 4R72A 2ZXTA 3IB2A 3UGWA 1DTZA 4BDMA 3MQ9A 4MLQA 1LLSA 2BJJX 3VVDA 3K0VA 4Z7EA 4IO4A 1D4NA 4XXUA 3FD3A 2Q89A 1VFEA 1YAEA 4MLVA 4YKJA 1JQFA 1MQJA 4NF6B 2Z8FA 1YCJA 3G3JA 3PU5A 1ELJA 1I69A 4QFLA 1PB9A 3FXQA 3D4GA 1OQHA 2D3IA 4R6HA 4TLLB 3K00A 4NWDA 1QUJA 1WODA 1VR5A 4F2OA 1URDA 4ZEBA 2HCAA 4OETA 4XKQA 4ZS9A 4GFRA 3OXNA 4OVJA 3SERA 2ONRA 2PMSA 1B9JA 3S9LC 1FQBA 2R71A 1ZU0A 3C35A 4F3SA 1HSLA 1FTLA 3FVGA 1EZOA 4H67A 2A5SA 5HM4B 4F1VA 2KLFA 1NNKA 4ZECA 2I58A 3U72A 1PC3A 3K6XA 3VV5A 2QMWA 5FTIA 3EHUA 2F34A 1Y3QA 2V3TA 4ZE8A 3TCGA 1BLFA 4KCDA 3C31A 3T9VA 3KJTA 1QUIA 5AE4A 4LZ7A 2DVZA 3PMWA 2O51A 4AQ4A 3TUSA 3ZKLA 4OXVA 1USYE 1MXYA 2XD3A 4IO6A 3ILTB 4K3FA 4F18A 3M3FA 4X48A 4Q5TA 5EHSA 4ECFA 2I3VA 3KFMA 3VLUA 3PPQA 2Z22A 1R9LA 3IAZA 3FJ7A 3FASA 4TLMB 3C4MA 4U4XA 3KSXA 1FQDA 1MQIA 1B1XA 5I2KB 1LFGA 3RPWA 1A54A 2E1SA 5CMKA 4ELOA 3CIJA 3H4ZA 3OO7A 3M8UA 4F2QA 4AB6A 3MUQA 3CSBA 3O97A 2OCUA 2I6EA 1MPCA 4C0RA 4LVQA 2XXVA 4BLAA 3G3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHG A;  4NF5 A;  3N26 A;  2DOJ A;  2YLN A;  2RKM A;  3V89 B;  5BUU A;  4Z0I A;  4U1Z A;  1LCT A;  3IJO B;  1B2H A;  3SEY A;  1JW4 A;  1J1N A;  1N04 A;  3K6U A;  3LR1 A;  5A5X A;  4DZ1 A;  1FQF A;  2H25 A;  4NF5 B;  1A40 A;  1POT A;  3L6G A;  5EYF A;  2GHB A;  4BDN A;  1FCK A;  1AL3 A;  4OHN A;  5JK4 A;  5DVJ A;  1MXW A;  3QUF A;  4OFJ A;  3KN7 A;  3MP1 A;  4GQO A;  4N07 A;  1IXG A;  3H7M A;  2PVU A;  1SI1 A;  2OJT A;  2O7I A;  5A5X B;  4OFO A;  3FV1 A;  1QUK A;  1AOV A;  4PP0 A;  1MY2 A;  3FZV A;  3H6U A;  2AL5 A;  2Q9T A;  4IB2 A;  4U22 A;  2Y7I A;  2F7B A;  4NTL A;  4JXI A;  1LAH E;  4DXB A;  3PD9 A;  3MBP A;  4I9D A;  2QS1 A;  2P1S A;  4RXL A;  3OO9 A;  5M2V A;  4DXU A;  2V3Q A;  5ICT A;  4FAT A;  2ZNS A;  1Y4T A;  1N0T A;  4XKP A;  1B52 A;  4XKN A;  3SKP A;  5FTH A;  2I4B A;  4GLI A;  1QUL A;  5L9S A;  4EXL A;  4JBZ A;  4NF4 B;  1SBP A;  4R75 A;  4WKM A;  3B6T A;  3U93 A;  3ONM A;  2DQV A;  1B05 A;  4OFL A;  2QS2 A;  1TFD A;  3EHT A;  4DXC A;  3KOT A;  5TPA A;  4HCW A;  3IOW A;  1T0K A;  4KYS A;  1SD3 A;  1XHY A;  1ZIU A;  4DDD A;  4ELP A;  2D21 A;  4LZ8 A;  3N5L A;  1EU8 A;  3M3K A;  2I0C A;  3VLW A;  1MQG A;  2ZYO A;  4G77 A;  3C9H A;  4FIM A;  2VP1 A;  2ZNU A;  1NMU A;  5TPA B;  4U4S A;  3PUV E;  3UOR A;  1RKM A;  3OD7 A;  3RUM A;  4NWC A;  1YTV A;  2GFE A;  1UQW A;  1SW5 A;  3E3K A;  4RPN A;  4I1D A;  3TCH A;  5KCJ A;  4PFT A;  1URG A;  5ITP A;  3PMX A;  2XXR A;  1DTG A;  1O64 A;  3KBR A;  4ZED A;  2Z8E A;  3OMB A;  1JW1 A;  4IO5 A;  4DE8 A;  4IO7 A;  3OO6 A;  3MPL A;  5CMC A;  1Y9U A;  3OEL A;  4G8M A;  1LAX A;  1KWH A;  1H3D A;  1S7Y A;  3CVG A;  4DCY A;  5KCJ B;  2B65 A;  3TTK A;  5K2Y A;  4UA8 A;  4R9F A;  3TTN A;  4R2F A;  1B1H A;  1FTK A;  3TFL A;  1Z7M E;  2RC9 A;  3T9U A;  4F3P A;  5AA3 A;  3F11 A;  3PUZ E;  3RGY A;  3HHF A;  3FXU A;  1IXC A;  4YB7 A;  2XXW A;  1POY 1;  3EN3 A;  2F36 A;  1II5 A;  1LAF E;  4EDP A;  5CBR A;  3TQL A;  4GXA A;  1B40 A;  3O6I A;  3R6U A;  2Q88 A;  1QW0 A;  3MJN A;  1EZP A;  4IGT A;  3I3V A;  3H6T A;  1Y4C A;  1B5H A;  3FVO A;  4PQJ A;  1BIY A;  4KYE A;  1MPB A;  3BFT A;  3N94 A;  2I4C A;  2WKY A;  5I57 A;  3KSJ A;  3R26 A;  4M1V A;  4QSD A;  1S50 A;  2THI A;  1Q1K A;  4O3A A;  1WDN A;  3VXB A;  1MXZ A;  1PB7 A;  1XS5 A;  4IO3 A;  1D9V A;  4FJP A;  2I48 A;  4PE5 B;  2RCA A;  1M5C A;  2UYE A;  2VHA A;  4EQ7 A;  1I6B A;  4UAC A;  4P11 A;  4H5F A;  3G3G A;  2DWA A;  2G29 A;  1JEV A;  2Y84 A;  4QHQ A;  1BP5 A;  3KEI A;  3T66 A;  1UIU A;  5ELV A;  3FUZ A;  3O28 A;  4IY6 A;  2Z23 A;  2AIX A;  3PMV A;  3MC2 A;  4JWO A;  1MY4 A;  1DOT A;  1MDP 1;  3G3F A;  4RJZ A;  5B70 A;  3JV9 A;  3TCF A;  1B58 A;  1QJM A;  2ZYM A;  1TFA A;  4N13 A;  4ELR A;  4YB5 A;  1JVY A;  2H98 A;  5JTY A;  4LP2 B;  1ZBM A;  4LQ5 A;  4QRZ A;  4BDL A;  2W7Y A;  4OEU A;  3MVW A;  3BBR A;  1DPE A;  1A8E A;  2F6G A;  1IXH A;  2F78 A;  4I62 A;  3R7X A;  3Q25 A;  3V5A A;  2E0S A;  4HS7 A;  1MY1 A;  4ZEK A;  4OEV A;  3C32 A;  4MF3 A;  5EHM A;  3E9X A;  5JTY B;  4ELQ A;  1TXF A;  4IY5 A;  2O7U A;  3K1P A;  1MS7 A;  4RNS A;  1B32 A;  2HFB A;  3CFZ A;  3EHS A;  1BKA A;  4HW8 A;  1QVS A;  1PBQ A;  3GXA A;  4GIZ A;  2O84 X;  5I84 A;  3BKI B;  3UA8 A;  4R73 A;  2RIN A;  1GVC A;  2XXI A;  5CMM A;  3FIR A;  1B51 A;  4GOT A;  4O3B A;  3SET A;  4N6P A;  4EF2 A;  1FW0 A;  2OLB A;  2DS9 A;  2FYI A;  2UYF A;  3QSL A;  2X7P A;  1B3H A;  3OSR A;  3S4U A;  2HZK A;  3FXR A;  1Q35 A;  3N6U A;  4YB6 A;  4OMB A;  4F3G A;  1MXU A;  1OVT A;  3V8X B;  1N7X A;  3QK6 A;  2YJP A;  3CRB A;  3OEM A;  3PUW E;  2DE2 A;  1CB6 A;  3PPR A;  5AA2 A;  3MZ9 A;  1LFH A;  3O6H A;  4YU0 A;  2QJE A;  4EXK A;  3K2D A;  4ISU A;  1NKX A;  2VGQ A;  4LUB A;  3IOR A;  3HN0 A;  3K6V A;  3LBS A;  3U1O A;  1FQA A;  2P2A A;  1XT8 A;  3RNN A;  3OO8 A;  1GR2 A;  1USY H;  5DEX A;  4Q30 B;  2V25 A;  2XXU A;  3U8Q A;  1B4H A;  5AA2 B;  1SW4 A;  3A09 A;  5FHO A;  4DCX A;  2Y7K A;  4KR5 A;  1UIV A;  3VVF A;  5L8D A;  3VE1 B;  1P1N A;  2REJ A;  5DT6 A;  5AA2 D;  1A55 A;  2GH9 A;  5I58 A;  2VD3 A;  3T96 B;  5I2N A;  3BFU A;  1FTM A;  3K1M A;  1US5 A;  5DEX B;  1IZ1 A;  1MY3 A;  1PB8 A;  2QL3 A;  2PYY A;  2OWS A;  1NNP A;  3TMG A;  1SQY A;  3AXF A;  2DWI A;  2QMX A;  3IO4 A;  4KYD A;  3HO7 A;  4F39 A;  2QSX A;  4PFW A;  2V3U A;  1MDQ A;  5I58 B;  1M5E A;  2UVJ A;  1MRP A;  4MH5 A;  4I8C A;  5HBC A;  5I2N B;  3PPN A;  3CFX A;  4THI A;  4ND9 A;  1IIT A;  1B4Z A;  3ILU B;  4R6Y A;  4H6D A;  3D4C A;  5CC2 A;  1OMP A;  4OWD A;  2XXH A;  3K4U A;  4ESX A;  3HV1 A;  2OBG A;  3KG2 A;  3FVK A;  4H65 A;  3O2A A;  3PPP A;  3LSW A;  1I6A A;  4F19 A;  4KQP A;  1NNF A;  2RCB A;  2OZZ A;  1UTH A;  1B6H A;  1I6Q A;  4Q8R A;  1PDA A;  2Q2A A;  4NF8 A;  3ZS6 A;  3SES A;  4R74 A;  2UVI A;  1SW2 A;  2RF1 A;  4JSO A;  5AA4 A;  1ZLQ A;  1RYO A;  3RLF E;  2XXT A;  1MH4 A;  1R6Z A;  3ECR A;  2Y7P A;  4OEN A;  3VDF A;  4QFN A;  3PD8 A;  2XD2 A;  2ONK E;  3B6Q A;  3MW0 A;  3OEN A;  2RC8 A;  4TQU Q;  4YZZ A;  4RPO A;  3RTF B;  1Y3N A;  4OER A;  4F22 A;  3FGS A;  4NF8 B;  2DXY A;  2HZL A;  5AA4 B;  2O1L A;  4G68 A;  5J1D A;  1MG1 A;  1Y3P A;  3UK4 A;  2I49 A;  2HXW A;  3MP6 A;  1RYX A;  1SYI A;  1JNF A;  2GRV A;  4R9G A;  2HAU A;  3O29 A;  2P0S A;  2XXY A;  1MY0 A;  4ZZA A;  1MM6 A;  3GBA A;  1JET A;  4G68 B;  3K1N A;  4BDR A;  4EUO A;  4QSC A;  5FHN A;  1B7U A;  4RYA A;  1GTK A;  1B7H A;  1QKA A;  2F6P A;  3G7W A;  5AA1 A;  4LON B;  3MZ1 A;  1NH8 A;  3PGF A;  5CI5 A;  3CI8 A;  1LST A;  3EQ1 A;  4GL8 A;  2O68 A;  2D5W A;  4NE4 A;  2H9B A;  2F8D A;  2ABH A;  3SEX A;  3H6V A;  2ESN A;  3T9H B;  3Q26 A;  4GD5 A;  3VXC A;  4WXJ A;  3TPA A;  3TEP A;  1MH3 A;  2Z8D A;  4X1B A;  2PT2 A;  3DP4 A;  4KFQ A;  1TWY A;  3UIF A;  1XVY A;  3USD A;  3B6W A;  4GVO A;  3CG1 A;  4U21 A;  4HCY A;  1N76 A;  3LC8 A;  3KN3 A;  1IQ7 A;  4ZDM A;  3GBB A;  2XX8 A;  3HCQ A;  3Q29 A;  3CG3 A;  2FNC A;  4OTE A;  4F1U A;  1BTJ A;  1Y20 A;  4POX A;  5CM6 A;  3IK6 B;  3A3C A;  5CRY A;  3TYH A;  2DWH A;  1Z7N E;  1M5D A;  3N6T A;  1IEJ A;  2QPQ A;  4YKP A;  3QXM A;  2O6A A;  3PUY E;  3ZSF A;  2H4I A;  3SEW A;  4RA1 A;  3VVE A;  2GHA A;  1TT1 A;  3HST A;  4HTG A;  2PBW A;  1ZTY A;  2R9J A;  2Q2C A;  4X1D A;  4O3C A;  2DE3 A;  1PBP A;  4G8N A;  3T9X B;  4GL0 A;  4DLD A;  5IKB A;  1NH7 A;  3SEU A;  2UXA A;  1LB9 A;  5IAI A;  3TZA A;  3MAM A;  3UP9 A;  4C1T A;  5H8F A;  4L17 A;  3B7D A;  3MWB A;  3T93 B;  4KI0 E;  3U94 A;  1AIV A;  3FAT A;  2UVG A;  1S9T A;  1P99 A;  4KHZ E;  4FOR A;  1LCF A;  1B5J A;  2NUV A;  3P7I A;  4YIC A;  1A8F A;  2XXX A;  2OK2 A;  5H8H A;  4M4G A;  2B3F A;  1ZJL A;  2UVH A;  1SYH A;  5H8F B;  3S9M C;  2IEE A;  1Y1Z A;  2QS3 A;  4NF6 A;  3K6W A;  3WAF A;  5I57 B;  3IOU A;  2A5T A;  3W9V A;  2I3W A;  4NED A;  5H8H B;  2Y7R A;  2DE4 A;  3FJM A;  3G3I A;  2YPN A;  3A3U A;  4JWY A;  3TKD A;  5KDT A;  1VFD A;  4YKK A;  2DWJ A;  2AL4 A;  4YAH X;  3HPI A;  3IOT A;  1PEB A;  4U23 A;  1OVB A;  4ZE9 A;  2DYX A;  2A5T B;  4E0W A;  4GXS B;  3S9N C;  3C36 A;  3DP8 A;  3IL1 B;  1B3E A;  3GLB A;  4OYV A;  3PV0 E;  3C33 A;  4YMB A;  5KDT B;  1XOC A;  3O9P A;  2H99 A;  3TQW A;  4P0G A;  4LQ2 A;  2ZNT A;  1O63 A;  5DVF A;  4PET A;  4FEC A;  2ANJ A;  3DP6 A;  5I59 A;  3WAE A;  4RY1 A;  2X7Q A;  3E4R A;  1XVX A;  4E0X A;  1YPN A;  1FTJ A;  3MP8 A;  5HPQ A;  2QS4 A;  2NWJ A;  2F5X A;  3I5O A;  3MVY A;  4JWX A;  4AB5 A;  4FEB A;  1D3K A;  1HSJ A;  4R6K A;  5I59 B;  2VOZ A;  3RN8 A;  4YMA A;  4PFU A;  3H6W A;  2NXO A;  1H44 A;  5LOM A;  2XXP A;  1JVX A;  4G4P A;  3KGC A;  1B7Z A;  1QKB A;  3VLV A;  1IXI A;  2XX7 A;  4OZ9 A;  2O69 A;  2REG A;  4WED A;  4F31 B;  5KZT A;  2FA7 A;  1JEU A;  4F3B A;  3PPO A;  1MM7 A;  4MBP A;  3TAJ A;  1A99 A;  3K01 A;  4H8J A;  1ZKB A;  3KOS A;  3UN6 A;  1D9Y A;  3KZG A;  2X26 A;  5I2K A;  1AMF A;  3OSQ A;  4OQO A;  3Q27 A;  5H8Q A;  5JEI A;  2G93 A;  4QF9 A;  1F9B A;  3K02 A;  2XXQ A;  1N3X A;  1HSE A;  4EF1 A;  2PT1 A;  2DXR A;  1B5I A;  2HQ0 A;  3H3G A;  3LSF B;  2ALU A;  5H8N A;  1N7W A;  2OWT A;  1OIB A;  4C1U A;  3MZB A;  4GWO A;  3QAX A;  3G3K A;  4H5G A;  5H8Q B;  4POW A;  1P1W A;  2H5Y A;  4OES A;  5L9O A;  4PFY A;  2F7A A;  4XIG Q;  3JZJ A;  3OOA A;  4FAJ A;  3IB1 A;  1DPP A;  2IA4 A;  5H8N B;  5TP9 A;  1GV8 A;  2F97 A;  3SEV A;  2ZYN A;  4H1X A;  4H8I A;  4KPT A;  2XHD A;  1SI0 A;  1UTB A;  4LA9 A;  2HEU A;  3OEK A;  4BDO A;  3FV2 A;  3FVN A;  3LSL A;  3IB0 A;  3RT6 B;  5TP9 B;  2ZMB A;  1VE4 A;  4X9T A;  1B0L A;  1B3L A;  1UTB B;  3MVZ A;  3RQT A;  2DVC A;  1H76 A;  2PX1 A;  2NVU B;  4KD5 A;  4IO2 A;  1JW5 A;  3FJG A;  2NOO A;  1VSO A;  1B46 A;  3JYR A;  3C34 A;  5DVI A;  1NNT A;  3QUJ A;  4U1O A;  2Q8J A;  1B3F A;  4XKR A;  1FQE A;  3TOD A;  4YKI A;  3T22 A;  3GZG A;  4P0I A;  3DLN A;  3V83 A;  1MQD A;  1O7T A;  4G2Z A;  1SW1 A;  3L6H A;  1GGG A;  4Q0C A;  4DIG A;  3THI A;  3IR1 A;  3EPE A;  1UTH B;  4R2B A;  1ATG A;  3TEL A;  1US4 A;  3MVX A;  1ANF A;  4NF4 A;  4QFP A;  1A7L A;  3QIM A;  4MFI A;  4GRK A;  1ZMG A;  3QYT A;  2Y7W A;  1N3W A;  4G68 C;  4BDQ A;  4G8H A;  1LBB A;  1URS A;  1Y1M A;  1MPD A;  4ZZE A;  2ZYK A;  4TOZ A;  1N84 A;  3PUX E;  4ONY A;  1LBC A;  5BWJ A;  1L5T A;  4U2R A;  4NMY A;  1M5F A;  5B7D A;  1P1O A;  4ZEI A;  3TTL A;  1LAG E;  3IO6 A;  2I0B A;  3RT8 A;  1XC1 A;  3E13 X;  1EH3 A;  1B3G A;  2F7C A;  2V84 A;  4FED A;  1LB8 A;  1H43 A;  4EQB A;  2R6G E;  1OQG A;  2VD2 A;  3LSX A;  3H03 A;  3RTW B;  3TDJ A;  2LAO A;  3S2V A;  3DM0 A;  4IGR A;  3CFL A;  4KCC A;  1SVX B;  1H45 A;  5ICQ A;  3W15 C;  2O1M A;  1R1N A;  3EF7 A;  4JSD A;  3IX1 A;  1WVJ A;  1NFT A;  1B0H A;  3O66 A;  4ESW A;  5I56 A;  3DEL B;  1R9Q A;  3CSG A;  5H8S A;  1DSN A;  4JDF A;  5DTB A;  5F7V A;  4EQ9 A;  1FQC A;  3VFJ A;  5F1Q A;  3O6G A;  3S9E A;  1IUD A;  3LUY A;  4FE8 A;  1LGB C;  1P1U A;  3TTR A;  2M8C A;  4RK2 A;  5FHM A;  1SDX A;  5DYH A;  1FTO A;  2DP8 A;  3ZKK A;  4LAT A;  5TU0 A;  4WEP A;  3SDF A;  5CBS A;  5I56 B;  1P1Q A;  1MQH A;  3ODB A;  1LFI A;  5ITO A;  1M5B A;  2ONS A;  1MXX A;  4F1Y A;  5K2X A;  5CMB A;  1CE2 A;  4H0W A;  4XTC Q;  2AYS A;  2F35 A;  3U92 A;  2DSF A;  2CMO A;  1NL5 A;  4ZEF A;  1DMB A;  4QFO A;  3TTM A;  4F29 A;  4QFK A;  2RC7 A;  3H06 B;  3I6V A;  5L9M A;  1MXV A;  1AH5 A;  2V93 A;  4JB7 A;  2CZL A;  3MPK A;  4LZ5 A;  3KJ7 A;  2HAV A;  2XX9 A;  3IJX B;  4GF8 A;  1EZ9 A;  4RK9 A;  3Q28 A;  1IIW A;  3IOV A;  2B3B A;  3M3L A;  4QSE A;  3KN8 A;  3RY3 A;  3CR9 A;  1OLC A;  3W9W A;  5ISU A;  1OLA A;  2QRY A;  4R72 A;  2ZXT A;  3IB2 A;  3UGW A;  1DTZ A;  4BDM A;  3MQ9 A;  4MLQ A;  1LLS A;  2BJJ X;  3VVD A;  3K0V A;  4Z7E A;  4IO4 A;  1D4N A;  4XXU A;  3FD3 A;  2Q89 A;  1VFE A;  1YAE A;  4MLV A;  4YKJ A;  1JQF A;  1MQJ A;  4NF6 B;  2Z8F A;  1YCJ A;  3G3J A;  3PU5 A;  1ELJ A;  1I69 A;  4QFL A;  1PB9 A;  3FXQ A;  3D4G A;  1OQH A;  2D3I A;  4R6H A;  4TLL B;  3K00 A;  4NWD A;  1QUJ A;  1WOD A;  1VR5 A;  4F2O A;  1URD A;  4ZEB A;  2HCA A;  4OET A;  4XKQ A;  4ZS9 A;  4GFR A;  3OXN A;  4OVJ A;  3SER A;  2ONR A;  2PMS A;  1B9J A;  3S9L C;  1FQB A;  2R71 A;  1ZU0 A;  3C35 A;  4F3S A;  1HSL A;  1FTL A;  3FVG A;  1EZO A;  4H67 A;  2A5S A;  5HM4 B;  4F1V A;  2KLF A;  1NNK A;  4ZEC A;  2I58 A;  3U72 A;  1PC3 A;  3K6X A;  3VV5 A;  2QMW A;  5FTI A;  3EHU A;  2F34 A;  1Y3Q A;  2V3T A;  4ZE8 A;  3TCG A;  1BLF A;  4KCD A;  3C31 A;  3T9V A;  3KJT A;  1QUI A;  5AE4 A;  4LZ7 A;  2DVZ A;  3PMW A;  2O51 A;  4AQ4 A;  3TUS A;  3ZKL A;  4OXV A;  1USY E;  1MXY A;  2XD3 A;  4IO6 A;  3ILT B;  4K3F A;  4F18 A;  3M3F A;  4X48 A;  4Q5T A;  5EHS A;  4ECF A;  2I3V A;  3KFM A;  3VLU A;  3PPQ A;  2Z22 A;  1R9L A;  3IAZ A;  3FJ7 A;  3FAS A;  4TLM B;  3C4M A;  4U4X A;  3KSX A;  1FQD A;  1MQI A;  1B1X A;  5I2K B;  1LFG A;  3RPW A;  1A54 A;  2E1S A;  5CMK A;  4ELO A;  3CIJ A;  3H4Z A;  3OO7 A;  3M8U A;  4F2Q A;  4AB6 A;  3MUQ A;  3CSB A;  3O97 A;  2OCU A;  2I6E A;  1MPC A;  4C0R A;  4LVQ A;  2XXV A;  4BLA A;  3G3H A; 
#chains in the Genus database with same CATH topology
 3HHG A;  2PCR A;  4NF5 A;  3N26 A;  2DOJ A;  2YLN A;  2RKM A;  3V89 B;  4O94 A;  5BUU A;  4Z0I A;  4U1Z A;  1LCT A;  3IJO B;  1B2H A;  3SEY A;  1JW4 A;  1J1N A;  1N04 A;  3B50 A;  4GX4 A;  3K6U A;  3LR1 A;  2VPO A;  5A5X A;  4DZ1 A;  1FQF A;  2H25 A;  4NF5 B;  1IME A;  1A40 A;  1POT A;  3L6G A;  5EYF A;  2GHB A;  4BDN A;  1FCK A;  1AL3 A;  4OHN A;  5JK4 A;  5DVJ A;  1MXW A;  3QUF A;  4OFJ A;  3KN7 A;  3MP1 A;  4GQO A;  4N07 A;  1IXG A;  3H7M A;  2PVU A;  1SI1 A;  2OJT A;  2O7I A;  5A5X B;  2XWV A;  4OFO A;  3FV1 A;  1QUK A;  1AOV A;  4PP0 A;  4NG7 A;  1NV1 A;  1MY2 A;  3FZV A;  2CEY A;  3H6U A;  2AL5 A;  2Q9T A;  4IB2 A;  4U22 A;  2Y7I A;  2F7B A;  4NTL A;  4JXI A;  1LAH E;  4DXB A;  3PD9 A;  3IFA A;  3MBP A;  4I9D A;  2QS1 A;  2P1S A;  4RXL A;  3OO9 A;  5M2V A;  4DXU A;  2V3Q A;  5ICT A;  4FAT A;  2ZNS A;  1Y4T A;  1FPE A;  2QVU A;  1N0T A;  4XKP A;  1B52 A;  4XKN A;  3EKI A;  2Y5L A;  3SKP A;  4XFE A;  5FTH A;  4MX6 A;  2I4B A;  4GLI A;  4GWY A;  2MKZ A;  1QUL A;  5L9S A;  4EXL A;  4JBZ A;  4NF4 B;  1SBP A;  4R75 A;  4WKM A;  3B6T A;  3U93 A;  3ONM A;  2DQV A;  1B05 A;  4OFL A;  2QS2 A;  1TFD A;  5I3S A;  3EHT A;  4DXC A;  3KOT A;  2VT5 A;  2QFL A;  5TPA A;  4HCW A;  2FVZ A;  3IOW A;  1T0K A;  1LBZ A;  4HE0 A;  4KYS A;  1SD3 A;  1XHY A;  1ZIU A;  4DDD A;  4ELP A;  2D21 A;  4LZ8 A;  3N5L A;  4MEV A;  1EU8 A;  3M3K A;  2I0C A;  3VLW A;  1MQG A;  2ZYO A;  4G77 A;  3C9H A;  4FIM A;  2VP1 A;  2ZNU A;  1NMU A;  4NF0 A;  4MJO A;  5TPA B;  1LBY A;  1KZ8 A;  4U4S A;  3PUV E;  4O8M A;  3UOR A;  1RKM A;  5A5L A;  3OD7 A;  2FIE A;  3RUM A;  4NWC A;  1YTV A;  2GFE A;  1UQW A;  1SW5 A;  3E3K A;  4RPN A;  1DBZ A;  4I1D A;  3TCH A;  5KCJ A;  4PFT A;  1URG A;  5ITP A;  3PMX A;  2XXR A;  2PFZ A;  1DTG A;  1O64 A;  3KBR A;  4ZED A;  1EYI A;  2Z8E A;  3OMB A;  5FBP A;  1JW1 A;  4MNP A;  4IO5 A;  4DE8 A;  4IO7 A;  3OO6 A;  3MPL A;  4NQ8 A;  5CMC A;  1Y9U A;  3OEL A;  4G8M A;  1LAX A;  1KWH A;  1H3D A;  1S7Y A;  3CVG A;  4DCY A;  5KCJ B;  2B65 A;  3TTK A;  5K2Y A;  1D9Q A;  4UA8 A;  4R9F A;  3TTN A;  4R2F A;  1B1H A;  1FTK A;  4AS5 A;  2FBP A;  3TFL A;  5IM2 A;  2XA5 A;  1Z7M E;  2RC9 A;  3T9U A;  4F3P A;  2KQZ A;  5AA3 A;  1NV0 A;  3F11 A;  4I40 A;  3PUZ E;  3RGY A;  3HHF A;  4LN5 A;  3FXU A;  1IXC A;  4N8G A;  4YB7 A;  1KA1 A;  2XXW A;  1POY 1;  3EN3 A;  2F36 A;  1II5 A;  1LAF E;  4EDP A;  5CBR A;  3TQL A;  4GXA A;  1B40 A;  3O6I A;  3R6U A;  2Q88 A;  1QW0 A;  3MJN A;  1EZP A;  4IGT A;  3I3V A;  3H6T A;  1Y4C A;  5EYH A;  1B5H A;  3FVO A;  4PQJ A;  1BIY A;  4KYE A;  1MPB A;  3BFT A;  3N94 A;  1FJ9 A;  2I4C A;  2WKY A;  5I57 A;  3KSJ A;  3R26 A;  4M1V A;  4QSD A;  1S50 A;  1NV6 A;  2THI A;  1Q1K A;  4O3A A;  2P3N A;  1WDN A;  3VXB A;  1MXZ A;  1PB7 A;  1XS5 A;  4IO3 A;  1D9V A;  4FJP A;  1FPB A;  3HFU A;  2I48 A;  4PE5 B;  2RCA A;  1M5C A;  2UYE A;  2VHA A;  4EQ7 A;  1I6B A;  4UAC A;  4P11 A;  4H5F A;  3G3G A;  2DWA A;  2G29 A;  1JEV A;  2Y84 A;  3NOH A;  4QHQ A;  1BP5 A;  3KEI A;  3T66 A;  1UIU A;  5ELV A;  3FUZ A;  3O28 A;  3A29 A;  4IY6 A;  2Z23 A;  2AIX A;  3PMV A;  3MC2 A;  4JWO A;  1MY4 A;  1DOT A;  1MDP 1;  3G3F A;  4RJZ A;  5B70 A;  2CZK A;  3JV9 A;  3TCF A;  1B58 A;  1QJM A;  2ZYM A;  2WEF A;  1TFA A;  4N13 A;  2F3D A;  4ELR A;  4YB5 A;  1JVY A;  5ET8 A;  2H98 A;  5JTY A;  4LP2 B;  1ZBM A;  4LQ5 A;  2ZZW A;  4QRZ A;  4BDL A;  2W7Y A;  4OEU A;  3MVW A;  3BBR A;  1DPE A;  1A8E A;  2F6G A;  1IXH A;  4P8B A;  2F78 A;  4I62 A;  3R7X A;  3Q25 A;  3V5A A;  2E0S A;  4HS7 A;  1MY1 A;  4ZEK A;  4PDH A;  4OEV A;  3C32 A;  2WBB A;  4MF3 A;  5EHM A;  3E9X A;  5JTY B;  4ELQ A;  1TXF A;  4IY5 A;  2O7U A;  3K1P A;  1MS7 A;  4RNS A;  1KA0 A;  1B32 A;  2HFB A;  3CFZ A;  3EHS A;  1BKA A;  3KC1 A;  4HW8 A;  3MYU A;  1QVS A;  1PBQ A;  3GXA A;  4GIZ A;  2O84 X;  5I84 A;  1FPK A;  3BKI B;  3UA8 A;  4R73 A;  2RIN A;  1GVC A;  2XXI A;  5CMM A;  3KC0 A;  3FIR A;  1B51 A;  4P1L A;  4GOT A;  2VPN A;  4O3B A;  3SET A;  4I3E A;  4N6P A;  4EF2 A;  1FW0 A;  2OLB A;  2DS9 A;  2FYI A;  2UYF A;  3QSL A;  2X7P A;  1B3H A;  3OSR A;  3S4U A;  2HZK A;  3FXR A;  5IGA A;  1Q35 A;  3N6U A;  4YB6 A;  4OMB A;  3E78 A;  4F3G A;  1MXU A;  1OVT A;  3V8X B;  1N7X A;  3QK6 A;  2YJP A;  3CRB A;  3OEM A;  3PUW E;  2DE2 A;  1CB6 A;  3PPR A;  5AA2 A;  3MZ9 A;  1LFH A;  3O6H A;  4YU0 A;  2QJE A;  4EXK A;  3K2D A;  4ISU A;  1NKX A;  2VGQ A;  4LUB A;  3IOR A;  1NV4 A;  3HN0 A;  3K6V A;  3LBS A;  3U1O A;  1FQA A;  2P2A A;  1XT8 A;  3RNN A;  3OO8 A;  2Y5K A;  1GR2 A;  1USY H;  5DEX A;  4Q30 B;  2V25 A;  2XXU A;  3U8Q A;  1B4H A;  5AA2 B;  1SW4 A;  3A09 A;  5FHO A;  4DCX A;  2Y7K A;  4KR5 A;  1UIV A;  3VVF A;  5L8D A;  3VE1 B;  1P1N A;  2REJ A;  5DT6 A;  5AA2 D;  1A55 A;  2KR0 A;  2GH9 A;  2Q8M A;  5I58 A;  2VD3 A;  3T96 B;  5I2N A;  3BFU A;  1FTM A;  1NV2 A;  3K1M A;  1SPI A;  1US5 A;  5DEX B;  1IZ1 A;  1MY3 A;  1PB8 A;  2QL3 A;  5LDZ A;  1YYZ A;  2PYY A;  2OWS A;  1NNP A;  3TMG A;  4GWZ A;  1SQY A;  3AXF A;  4NN3 A;  2DWI A;  2QMX A;  3IO4 A;  4KYD A;  3HO7 A;  4PAK A;  4F39 A;  2QSX A;  4PFW A;  2V3U A;  1MDQ A;  5I58 B;  1M5E A;  2UVJ A;  4MH5 A;  1MRP A;  4I8C A;  5HBC A;  5I2N B;  3PPN A;  3CFX A;  4THI A;  4ND9 A;  1IIT A;  1B4Z A;  3ILU B;  4R6Y A;  1G0H A;  4H6D A;  3D4C A;  5CC2 A;  4MNC A;  1OMP A;  4OWD A;  2R8T A;  2XXH A;  3K4U A;  4ESX A;  3HV1 A;  2OBG A;  3KG2 A;  5ET7 A;  3FVK A;  4H65 A;  3O2A A;  3PPP A;  3LSW A;  3GYY A;  1I6A A;  4F19 A;  4KQP A;  1NNF A;  2RCB A;  2OZZ A;  1UTH A;  1B6H A;  5ET5 A;  1I6Q A;  1PDA A;  4Q8R A;  2Q2A A;  4NF8 A;  3ZS6 A;  1RDY A;  3SES A;  4R74 A;  2UVI A;  1SW2 A;  4OA4 A;  2RF1 A;  4JSO A;  5AA4 A;  1ZLQ A;  1RYO A;  3RLF E;  2XXT A;  1IMC A;  1DCU A;  1MH4 A;  1R6Z A;  3ECR A;  2Y7P A;  4OEN A;  3VDF A;  4QFN A;  4JVC A;  3PD8 A;  2XD2 A;  4DI4 B;  2ONK E;  3B6Q A;  2F3B A;  3MW0 A;  2ZZX A;  3OEN A;  4TQU Q;  2RC8 A;  4YZZ A;  4RPO A;  3RTF B;  1Y3N A;  4OER A;  4F22 A;  3FGS A;  1AWB A;  4HXV A;  4NF8 B;  2DXY A;  2GQ1 A;  2HZL A;  5AA4 B;  2O1L A;  4G68 A;  5J1D A;  1MG1 A;  5I7I A;  1Y3P A;  1LBX A;  3UK4 A;  3MP6 A;  2HXW A;  2I49 A;  1RYX A;  1SYI A;  1JNF A;  2GRV A;  3BIG A;  4R9G A;  2HAU A;  3O29 A;  5EQ7 A;  2P0S A;  2XXY A;  1MY0 A;  4ZZA A;  1MM6 A;  3GBA A;  1JET A;  4G68 B;  4I3Y A;  3K1N A;  4BDR A;  4EUO A;  1FPI A;  2Q74 A;  4QSC A;  5FHN A;  1B7U A;  4RYA A;  1GTK A;  1B7H A;  1QKA A;  2F6P A;  3G7W A;  5AA1 A;  4PE3 A;  4LON B;  3MZ1 A;  1NH8 A;  1QGX A;  3PGF A;  5EQA A;  5CI5 A;  3CI8 A;  1LST A;  3EQ1 A;  4GL8 A;  2O68 A;  2D5W A;  4NE4 A;  2H9B A;  2F8D A;  2ABH A;  3SEX A;  3H6V A;  2ESN A;  2OWZ A;  3T9H B;  3Q26 A;  4GD5 A;  3VXC A;  4WXJ A;  3TPA A;  3TEP A;  1MH3 A;  2Z8D A;  4X1B A;  2PT2 A;  3DP4 A;  4KFQ A;  4PCD A;  1TWY A;  3UIF A;  1XVY A;  3USD A;  3B6W A;  4GVO A;  3CG1 A;  4U21 A;  4HCY A;  1N76 A;  3LC8 A;  3KN3 A;  1IQ7 A;  3RYD A;  4ZDM A;  3GBB A;  2XX8 A;  3HCQ A;  2HXR A;  3Q29 A;  2QVR A;  3CG3 A;  2FNC A;  4PAI A;  4OTE A;  4F1U A;  1BTJ A;  1Y20 A;  4POX A;  5CM6 A;  4NHB A;  4MAG A;  3IK6 B;  3A3C A;  4NGU A;  5CRY A;  3TYH A;  2DWH A;  1Z7N E;  1M5D A;  4PFB A;  3N6T A;  1IEJ A;  5J16 A;  2QPQ A;  4YKP A;  4GWU A;  1FBD A;  3QXM A;  2O6A A;  3PUY E;  3ZSF A;  2H4I A;  3SEW A;  4RA1 A;  3VVE A;  4N15 A;  4H45 A;  2GHA A;  1TT1 A;  2FHY A;  3HST A;  4PDD A;  4HTG A;  2PBW A;  1ZTY A;  2R9J A;  2Q2C A;  4X1D A;  4O3C A;  2DE3 A;  1PBP A;  1VDW A;  4G8N A;  2CEX A;  4N8Y A;  3T9X B;  4GL0 A;  2L5V A;  4DLD A;  5IKB A;  4GX3 A;  1NH7 A;  3SEU A;  2UXA A;  1LB9 A;  4GX6 A;  2PFY A;  5IAI A;  3FXB A;  3TZA A;  3MAM A;  3UP9 A;  4C1T A;  5H8F A;  4L17 A;  3B7D A;  3MWB A;  3T93 B;  4KI0 E;  3MST A;  3U94 A;  1AIV A;  3FAT A;  2UVG A;  2CZI A;  1S9T A;  1P99 A;  4KHZ E;  4X04 A;  4FOR A;  1LCF A;  1B5J A;  2NUV A;  3P7I A;  4YIC A;  4P1E A;  1A8F A;  2XXX A;  2OK2 A;  5H8H A;  4M4G A;  2B3F A;  1RDZ A;  1ZJL A;  3LUZ A;  2UVH A;  1SYH A;  5H8F B;  3S9M C;  2IEE A;  1Y1Z A;  2QS3 A;  4NF6 A;  3K6W A;  5LTC A;  3WAF A;  5I57 B;  3QMF A;  3IOU A;  2WYK A;  2A5T A;  3W9V A;  2I3W A;  4NED A;  5H8H B;  2Y7R A;  2DE4 A;  3FJM A;  3G3I A;  2YPN A;  3A3U A;  4JWY A;  3TKD A;  4PFR A;  4HE2 A;  5KDT A;  1VFD A;  4YKK A;  2DWJ A;  2AL4 A;  4PBH A;  4YAH X;  3HPI A;  3IOT A;  1PEB A;  4U23 A;  1OVB A;  4ZE9 A;  2DYX A;  1FBF A;  1FPD A;  2A5T B;  4P9K A;  4E0W A;  4GXS B;  3S9N C;  3C36 A;  3DP8 A;  3IL1 B;  1LEV A;  1B3E A;  2FIX A;  3GLB A;  4O7M A;  4OYV A;  3PV0 E;  3C33 A;  4YMB A;  1NUY A;  5KDT B;  1XOC A;  3O9P A;  2H99 A;  4OVP A;  3TQW A;  3KBZ A;  4P0G A;  4LQ2 A;  1DK4 A;  2ZNT A;  1FPJ A;  1O63 A;  5DVF A;  4PET A;  4FEC A;  2ANJ A;  3DP6 A;  4PFI A;  1FPL A;  5I59 A;  3WAE A;  4RY1 A;  2X7Q A;  3E4R A;  1FTA A;  1XVX A;  3LV0 A;  4E0X A;  1YPN A;  4HE1 A;  1FTJ A;  3MP8 A;  5HPQ A;  2QS4 A;  4MCO A;  2NWJ A;  2F5X A;  2OX3 A;  3I5O A;  3MVY A;  4PF6 A;  4JWX A;  4AB5 A;  4FEB A;  1D3K A;  1HSJ A;  4R6K A;  5I59 B;  2VOZ A;  4MIJ A;  3RN8 A;  2B4L A;  4YMA A;  4PFU A;  4MNI A;  3H6W A;  2NXO A;  4GWX A;  1H44 A;  5LOM A;  2XXP A;  1JVX A;  4G4P A;  3KGC A;  1B7Z A;  1QKB A;  3VLV A;  1IXI A;  4P47 A;  4UAB A;  5EYG A;  2XX7 A;  4OZ9 A;  2O69 A;  2REG A;  4WED A;  4X8R A;  4F31 B;  5KZT A;  2FA7 A;  1JEU A;  3PPO A;  4F3B A;  1MM7 A;  4MBP A;  3TAJ A;  1A99 A;  1NV5 A;  3K01 A;  4H8J A;  1ZKB A;  3KOS A;  3UN6 A;  1D9Y A;  3KZG A;  2X26 A;  5I2K A;  3T1B A;  1AMF A;  3OSQ A;  4OQO A;  3Q27 A;  5H8Q A;  5JEI A;  2G93 A;  4NX1 A;  5IZZ A;  4QF9 A;  1F9B A;  3K02 A;  1LBV A;  2XXQ A;  1FSA A;  1N3X A;  1HSE A;  4EF1 A;  2PT1 A;  2DXR A;  1B5I A;  2HQ0 A;  3H3G A;  4N81 A;  2CZH A;  3LSF B;  2ALU A;  5H8N A;  1N7W A;  4H46 A;  2OWT A;  1OIB A;  4C1U A;  3MZB A;  4GWO A;  3QAX A;  3G3K A;  4H5G A;  4PC9 A;  5H8Q B;  4POW A;  2QVV A;  1NI9 A;  1LBW A;  1P1W A;  2H5Y A;  4OES A;  5L9O A;  4PFY A;  2F7A A;  4XIG Q;  3JZJ A;  3OOA A;  4FAJ A;  3IB1 A;  1DPP A;  4XF5 A;  2IA4 A;  5H8N B;  5TP9 A;  1GV8 A;  2F97 A;  1BK4 A;  3SEV A;  2ZYN A;  4H1X A;  4H8I A;  4KPT A;  2XHD A;  1SI0 A;  1UTB A;  1FBE A;  1NUX A;  4LA9 A;  4IR8 A;  1NUW A;  2HEU A;  3OEK A;  4PF8 A;  4BDO A;  3FV2 A;  4JVI A;  4OVS A;  3FVN A;  4OAN A;  3LSL A;  3IB0 A;  3RT6 B;  5TP9 B;  2ZMB A;  3B8B A;  1VE4 A;  1K9Z A;  4X9T A;  1B0L A;  1B3L A;  1UTB B;  3MVZ A;  3RQT A;  2DVC A;  1H76 A;  2PX1 A;  2NVU B;  2XXK A;  2V4C A;  4KD5 A;  1IMD A;  4IO2 A;  1JW5 A;  1NUZ A;  3FJG A;  2NOO A;  1VSO A;  4MHF A;  3PTY A;  1B46 A;  3JYR A;  3C34 A;  5DVI A;  1NNT A;  3QUJ A;  4N4U A;  4U1O A;  2Q8J A;  1B3F A;  4XKR A;  1FQE A;  4N17 A;  3TOD A;  4YKI A;  3T22 A;  3T0J A;  3GZG A;  4P0I A;  3DLN A;  1IMF A;  3V83 A;  1MQD A;  1O7T A;  4G2Z A;  1SW1 A;  3L6H A;  4G61 A;  1GGG A;  5ET6 A;  4Q0C A;  4DIG A;  3THI A;  3IR1 A;  3EPE A;  1UTH B;  4R2B A;  1ATG A;  3TEL A;  1US4 A;  3MVX A;  1ANF A;  1RDX A;  4NF4 A;  4N6K A;  4QFP A;  1FBH A;  1A7L A;  3QIM A;  4MFI A;  4GRK A;  1ZMG A;  3QYT A;  2Y7W A;  4OVR A;  1N3W A;  4G68 C;  4BDQ A;  4G8H A;  1FBG A;  1LBB A;  1URS A;  1Y1M A;  4GBW A;  1MPD A;  4ZZE A;  2ZYK A;  4TOZ A;  1N84 A;  3PUX E;  4ONY A;  1LBC A;  4N91 A;  5BWJ A;  1L5T A;  4U2R A;  4NMY A;  1M5F A;  5B7D A;  1P1O A;  4ZEI A;  3TTL A;  1LAG E;  3IO6 A;  2I0B A;  3E79 A;  4GWS A;  5IZ3 A;  1FRP A;  3RT8 A;  1YXI A;  1XC1 A;  3E13 X;  1EH3 A;  1B3G A;  2F7C A;  2V84 A;  4FED A;  1LB8 A;  1H43 A;  4EQB A;  2R6G E;  1INP A;  1OQG A;  2VD2 A;  3LSX A;  3RPL A;  3H03 A;  3RTW B;  1EYK A;  3TDJ A;  5IZ3 B;  2LAO A;  3S2V A;  3DM0 A;  4IGR A;  3CFL A;  4KCC A;  4P3L A;  1SVX B;  3ISP A;  1H45 A;  5ICQ A;  3W15 C;  2O1M A;  2WYP A;  1R1N A;  3EF7 A;  5ESY A;  4JSD A;  3IX1 A;  1WVJ A;  1NFT A;  1B0H A;  3CHG A;  4P56 A;  3O66 A;  4ESW A;  5I56 A;  3DEL B;  1R9Q A;  3CSG A;  3RPL B;  5H8S A;  1DSN A;  4JDF A;  5DTB A;  5F7V A;  4EQ9 A;  1FQC A;  3VFJ A;  5F1Q A;  4KXP A;  3D1R A;  3O6G A;  3S9E A;  1IUD A;  3LUY A;  2HPG A;  4FE8 A;  1LGB C;  1P1U A;  3TTR A;  2M8C A;  4RK2 A;  5FHM A;  1SDX A;  5DYH A;  1FTO A;  2DP8 A;  3ZKK A;  4LAT A;  5TU0 A;  1NV3 A;  4WEP A;  3SDF A;  5CBS A;  3SZP A;  5IZ1 A;  5I56 B;  4DI3 D;  1P1Q A;  1XI6 A;  1Q9D A;  4FBP A;  1FPG A;  1MQH A;  5EQ9 A;  3ODB A;  1LFI A;  5ITO A;  2P3V A;  1M5B A;  2DDK A;  4GWW A;  1FBC A;  2ONS A;  1MXX A;  4F1Y A;  5K2X A;  5CMB A;  2BJI A;  1CE2 A;  2XWI A;  4H0W A;  4XTC Q;  2AYS A;  2F35 A;  3U92 A;  2DSF A;  1YZ0 A;  4NAP A;  2CMO A;  1NL5 A;  4PBQ A;  4ZEF A;  1DMB A;  4PTK A;  3BIH A;  4QFO A;  4QXD A;  3TTM A;  4F29 A;  4QFK A;  1IMB A;  2RC7 A;  3H06 B;  3I6V A;  5L9M A;  1MXV A;  1AH5 A;  2V93 A;  4JB7 A;  2CZL A;  3MPK A;  4LZ5 A;  1G0I A;  2XWK A;  3KJ7 A;  2HAV A;  2XX9 A;  3IJX B;  4GF8 A;  1EZ9 A;  4RK9 A;  3Q28 A;  1IIW A;  3IOV A;  2B3B A;  3M3L A;  4QSE A;  3KN8 A;  3RY3 A;  3CR9 A;  1OLC A;  3W9W A;  5ISU A;  1OLA A;  2QRY A;  4R72 A;  2ZXT A;  3IB2 A;  3UGW A;  1DTZ A;  5F24 A;  3FBP A;  4BDM A;  3MQ9 A;  4MLQ A;  4XEQ A;  1LLS A;  2BJJ X;  3VVD A;  3K0V A;  4Z7E A;  4IO4 A;  1D4N A;  1JP4 A;  4XXU A;  3FD3 A;  2Q89 A;  1VFE A;  1YAE A;  4MLV A;  4YKJ A;  1JQF A;  1MQJ A;  2XWO A;  4NF6 B;  1K9Y A;  2Z8F A;  4PGN A;  5EQ8 A;  1YCJ A;  3G3J A;  3PU5 A;  1ELJ A;  1I69 A;  4QFL A;  2JJK A;  1PB9 A;  3FXQ A;  3D4G A;  1OQH A;  2D3I A;  4O7I A;  4R6H A;  4TLL B;  3K00 A;  4NWD A;  1QUJ A;  4OVT A;  1WOD A;  1VR5 A;  4F2O A;  1URD A;  4ZEB A;  2HCA A;  4OET A;  4XKQ A;  4ZS9 A;  4GFR A;  4PGP A;  3OXN A;  2WBD A;  4OVJ A;  3SER A;  1FJ6 A;  2ONR A;  2PMS A;  1B9J A;  3S9L C;  1FQB A;  2R71 A;  2ZZV A;  1ZU0 A;  3C35 A;  1HSL A;  4F3S A;  1FTL A;  4PAF A;  2B4M A;  5T3J A;  3FVG A;  1EZO A;  4H67 A;  2A5S A;  1FPF A;  5HM4 B;  4F1V A;  2KLF A;  1NNK A;  4ZEC A;  2I58 A;  3U72 A;  4GBV A;  4JVD A;  1PC3 A;  3K6X A;  3VV5 A;  2QMW A;  5FTI A;  3EHU A;  2F34 A;  2WX9 A;  1Y3Q A;  2V3T A;  4ZE8 A;  3TCG A;  1BLF A;  4AS4 A;  4KCD A;  3C31 A;  3T9V A;  3KJT A;  1QUI A;  1EYJ A;  4QBA A;  5AE4 A;  4LZ7 A;  2DVZ A;  3PMW A;  1IMA A;  2O51 A;  4AQ4 A;  3TUS A;  3ZKL A;  4OXV A;  1USY E;  1MXY A;  2XD3 A;  4IO6 A;  3ILT B;  4K3F A;  4F18 A;  3M3F A;  4X48 A;  4Q5T A;  1FBP A;  4MMP A;  5EHS A;  4ECF A;  2I3V A;  5I5P A;  3KFM A;  3VLU A;  3PPQ A;  2Z22 A;  1R9L A;  3IAZ A;  3FJ7 A;  4OVQ A;  3FAS A;  4TLM B;  4N6D A;  3C4M A;  3ROJ A;  3IFC A;  5DW8 A;  4U4X A;  3KSX A;  1FQD A;  3U65 A;  1MQI A;  1B1X A;  5I2K B;  1LFG A;  3RPW A;  1A54 A;  2E1S A;  5CMK A;  4ELO A;  3CIJ A;  3H4Z A;  3OO7 A;  3M8U A;  4F2Q A;  2HHM A;  4AB6 A;  3MUQ A;  3CSB A;  3O97 A;  2OCU A;  2I6E A;  1NV7 A;  1MPC A;  1CNQ A;  4C0R A;  4LVQ A;  2XXV A;  4BLA A;  3G3H A; 
#chains in the Genus database with same CATH homology
 3HHG A;  4NF5 A;  3N26 A;  2DOJ A;  2YLN A;  2RKM A;  3V89 B;  5BUU A;  4Z0I A;  4U1Z A;  1LCT A;  3IJO B;  1B2H A;  3SEY A;  1JW4 A;  1J1N A;  1N04 A;  3K6U A;  3LR1 A;  5A5X A;  4DZ1 A;  1FQF A;  2H25 A;  4NF5 B;  1A40 A;  1POT A;  3L6G A;  5EYF A;  2GHB A;  4BDN A;  1FCK A;  1AL3 A;  4OHN A;  5JK4 A;  5DVJ A;  1MXW A;  3QUF A;  4OFJ A;  3KN7 A;  3MP1 A;  4GQO A;  4N07 A;  1IXG A;  3H7M A;  2PVU A;  1SI1 A;  2OJT A;  2O7I A;  5A5X B;  4OFO A;  3FV1 A;  1QUK A;  1AOV A;  4PP0 A;  1MY2 A;  3FZV A;  3H6U A;  2AL5 A;  2Q9T A;  4IB2 A;  4U22 A;  2Y7I A;  2F7B A;  4NTL A;  4JXI A;  1LAH E;  4DXB A;  3PD9 A;  3MBP A;  4I9D A;  2QS1 A;  2P1S A;  4RXL A;  3OO9 A;  5M2V A;  4DXU A;  2V3Q A;  5ICT A;  4FAT A;  2ZNS A;  1Y4T A;  1N0T A;  4XKP A;  1B52 A;  4XKN A;  3SKP A;  5FTH A;  2I4B A;  4GLI A;  1QUL A;  5L9S A;  4EXL A;  4JBZ A;  4NF4 B;  1SBP A;  4R75 A;  4WKM A;  3B6T A;  3U93 A;  3ONM A;  2DQV A;  1B05 A;  4OFL A;  2QS2 A;  1TFD A;  3EHT A;  4DXC A;  3KOT A;  5TPA A;  4HCW A;  3IOW A;  1T0K A;  4KYS A;  1SD3 A;  1XHY A;  1ZIU A;  4DDD A;  4ELP A;  2D21 A;  4LZ8 A;  3N5L A;  1EU8 A;  3M3K A;  2I0C A;  3VLW A;  1MQG A;  2ZYO A;  4G77 A;  3C9H A;  4FIM A;  2VP1 A;  2ZNU A;  1NMU A;  5TPA B;  4U4S A;  3PUV E;  3UOR A;  1RKM A;  3OD7 A;  3RUM A;  4NWC A;  1YTV A;  2GFE A;  1UQW A;  1SW5 A;  3E3K A;  4RPN A;  4I1D A;  3TCH A;  5KCJ A;  4PFT A;  1URG A;  5ITP A;  3PMX A;  2XXR A;  1DTG A;  1O64 A;  3KBR A;  4ZED A;  2Z8E A;  3OMB A;  1JW1 A;  4IO5 A;  4DE8 A;  4IO7 A;  3OO6 A;  3MPL A;  5CMC A;  1Y9U A;  3OEL A;  4G8M A;  1LAX A;  1KWH A;  1H3D A;  1S7Y A;  3CVG A;  4DCY A;  5KCJ B;  2B65 A;  3TTK A;  5K2Y A;  4UA8 A;  4R9F A;  3TTN A;  4R2F A;  1B1H A;  1FTK A;  3TFL A;  1Z7M E;  2RC9 A;  3T9U A;  4F3P A;  5AA3 A;  3F11 A;  3PUZ E;  3RGY A;  3HHF A;  3FXU A;  1IXC A;  4YB7 A;  2XXW A;  1POY 1;  3EN3 A;  2F36 A;  1II5 A;  1LAF E;  4EDP A;  5CBR A;  3TQL A;  4GXA A;  1B40 A;  3O6I A;  3R6U A;  2Q88 A;  1QW0 A;  3MJN A;  1EZP A;  4IGT A;  3I3V A;  3H6T A;  1Y4C A;  1B5H A;  3FVO A;  4PQJ A;  1BIY A;  4KYE A;  1MPB A;  3BFT A;  3N94 A;  2I4C A;  2WKY A;  5I57 A;  3KSJ A;  3R26 A;  4M1V A;  4QSD A;  1S50 A;  2THI A;  1Q1K A;  4O3A A;  1WDN A;  3VXB A;  1MXZ A;  1PB7 A;  1XS5 A;  4IO3 A;  1D9V A;  4FJP A;  2I48 A;  4PE5 B;  2RCA A;  1M5C A;  2UYE A;  2VHA A;  4EQ7 A;  1I6B A;  4UAC A;  4P11 A;  4H5F A;  3G3G A;  2DWA A;  2G29 A;  1JEV A;  2Y84 A;  4QHQ A;  1BP5 A;  3KEI A;  3T66 A;  1UIU A;  5ELV A;  3FUZ A;  3O28 A;  4IY6 A;  2Z23 A;  2AIX A;  3PMV A;  3MC2 A;  4JWO A;  1MY4 A;  1DOT A;  1MDP 1;  3G3F A;  4RJZ A;  5B70 A;  3JV9 A;  3TCF A;  1B58 A;  1QJM A;  2ZYM A;  1TFA A;  4N13 A;  4ELR A;  4YB5 A;  1JVY A;  2H98 A;  5JTY A;  4LP2 B;  1ZBM A;  4LQ5 A;  4QRZ A;  4BDL A;  2W7Y A;  4OEU A;  3MVW A;  3BBR A;  1DPE A;  1A8E A;  2F6G A;  1IXH A;  2F78 A;  4I62 A;  3R7X A;  3Q25 A;  3V5A A;  2E0S A;  4HS7 A;  1MY1 A;  4ZEK A;  4OEV A;  3C32 A;  4MF3 A;  5EHM A;  3E9X A;  5JTY B;  4ELQ A;  1TXF A;  4IY5 A;  2O7U A;  3K1P A;  1MS7 A;  4RNS A;  1B32 A;  2HFB A;  3CFZ A;  3EHS A;  1BKA A;  4HW8 A;  1QVS A;  1PBQ A;  3GXA A;  4GIZ A;  2O84 X;  5I84 A;  3BKI B;  3UA8 A;  4R73 A;  2RIN A;  1GVC A;  2XXI A;  5CMM A;  3FIR A;  1B51 A;  4GOT A;  4O3B A;  3SET A;  4N6P A;  4EF2 A;  1FW0 A;  2OLB A;  2DS9 A;  2FYI A;  2UYF A;  3QSL A;  2X7P A;  1B3H A;  3OSR A;  3S4U A;  2HZK A;  3FXR A;  1Q35 A;  3N6U A;  4YB6 A;  4OMB A;  4F3G A;  1MXU A;  1OVT A;  3V8X B;  1N7X A;  3QK6 A;  2YJP A;  3CRB A;  3OEM A;  3PUW E;  2DE2 A;  1CB6 A;  3PPR A;  5AA2 A;  3MZ9 A;  1LFH A;  3O6H A;  4YU0 A;  2QJE A;  4EXK A;  3K2D A;  4ISU A;  1NKX A;  2VGQ A;  4LUB A;  3IOR A;  3HN0 A;  3K6V A;  3LBS A;  3U1O A;  1FQA A;  2P2A A;  1XT8 A;  3RNN A;  3OO8 A;  1GR2 A;  1USY H;  5DEX A;  4Q30 B;  2V25 A;  2XXU A;  3U8Q A;  1B4H A;  5AA2 B;  1SW4 A;  3A09 A;  5FHO A;  4DCX A;  2Y7K A;  4KR5 A;  1UIV A;  3VVF A;  5L8D A;  3VE1 B;  1P1N A;  2REJ A;  5DT6 A;  5AA2 D;  1A55 A;  2GH9 A;  5I58 A;  2VD3 A;  3T96 B;  5I2N A;  3BFU A;  1FTM A;  3K1M A;  1US5 A;  5DEX B;  1IZ1 A;  1MY3 A;  1PB8 A;  2QL3 A;  2PYY A;  2OWS A;  1NNP A;  3TMG A;  1SQY A;  3AXF A;  2DWI A;  2QMX A;  3IO4 A;  4KYD A;  3HO7 A;  4F39 A;  2QSX A;  4PFW A;  2V3U A;  1MDQ A;  5I58 B;  1M5E A;  2UVJ A;  1MRP A;  4MH5 A;  4I8C A;  5HBC A;  5I2N B;  3PPN A;  3CFX A;  4THI A;  4ND9 A;  1IIT A;  1B4Z A;  3ILU B;  4R6Y A;  4H6D A;  3D4C A;  5CC2 A;  1OMP A;  4OWD A;  2XXH A;  3K4U A;  4ESX A;  3HV1 A;  2OBG A;  3KG2 A;  3FVK A;  4H65 A;  3O2A A;  3PPP A;  3LSW A;  1I6A A;  4F19 A;  4KQP A;  1NNF A;  2RCB A;  2OZZ A;  1UTH A;  1B6H A;  1I6Q A;  4Q8R A;  1PDA A;  2Q2A A;  4NF8 A;  3ZS6 A;  3SES A;  4R74 A;  2UVI A;  1SW2 A;  2RF1 A;  4JSO A;  5AA4 A;  1ZLQ A;  1RYO A;  3RLF E;  2XXT A;  1MH4 A;  1R6Z A;  3ECR A;  2Y7P A;  4OEN A;  3VDF A;  4QFN A;  3PD8 A;  2XD2 A;  2ONK E;  3B6Q A;  3MW0 A;  3OEN A;  2RC8 A;  4TQU Q;  4YZZ A;  4RPO A;  3RTF B;  1Y3N A;  4OER A;  4F22 A;  3FGS A;  4NF8 B;  2DXY A;  2HZL A;  5AA4 B;  2O1L A;  4G68 A;  5J1D A;  1MG1 A;  1Y3P A;  3UK4 A;  2I49 A;  2HXW A;  3MP6 A;  1RYX A;  1SYI A;  1JNF A;  2GRV A;  4R9G A;  2HAU A;  3O29 A;  2P0S A;  2XXY A;  1MY0 A;  4ZZA A;  1MM6 A;  3GBA A;  1JET A;  4G68 B;  3K1N A;  4BDR A;  4EUO A;  4QSC A;  5FHN A;  1B7U A;  4RYA A;  1GTK A;  1B7H A;  1QKA A;  2F6P A;  3G7W A;  5AA1 A;  4LON B;  3MZ1 A;  1NH8 A;  3PGF A;  5CI5 A;  3CI8 A;  1LST A;  3EQ1 A;  4GL8 A;  2O68 A;  2D5W A;  4NE4 A;  2H9B A;  2F8D A;  2ABH A;  3SEX A;  3H6V A;  2ESN A;  3T9H B;  3Q26 A;  4GD5 A;  3VXC A;  4WXJ A;  3TPA A;  3TEP A;  1MH3 A;  2Z8D A;  4X1B A;  2PT2 A;  3DP4 A;  4KFQ A;  1TWY A;  3UIF A;  1XVY A;  3USD A;  3B6W A;  4GVO A;  3CG1 A;  4U21 A;  4HCY A;  1N76 A;  3LC8 A;  3KN3 A;  1IQ7 A;  4ZDM A;  3GBB A;  2XX8 A;  3HCQ A;  3Q29 A;  3CG3 A;  2FNC A;  4OTE A;  4F1U A;  1BTJ A;  1Y20 A;  4POX A;  5CM6 A;  3IK6 B;  3A3C A;  5CRY A;  3TYH A;  2DWH A;  1Z7N E;  1M5D A;  3N6T A;  1IEJ A;  2QPQ A;  4YKP A;  3QXM A;  2O6A A;  3PUY E;  3ZSF A;  2H4I A;  3SEW A;  4RA1 A;  3VVE A;  2GHA A;  1TT1 A;  3HST A;  4HTG A;  2PBW A;  1ZTY A;  2R9J A;  2Q2C A;  4X1D A;  4O3C A;  2DE3 A;  1PBP A;  4G8N A;  3T9X B;  4GL0 A;  4DLD A;  5IKB A;  1NH7 A;  3SEU A;  2UXA A;  1LB9 A;  5IAI A;  3TZA A;  3MAM A;  3UP9 A;  4C1T A;  5H8F A;  4L17 A;  3B7D A;  3MWB A;  3T93 B;  4KI0 E;  3U94 A;  1AIV A;  3FAT A;  2UVG A;  1S9T A;  1P99 A;  4KHZ E;  4FOR A;  1LCF A;  1B5J A;  2NUV A;  3P7I A;  4YIC A;  1A8F A;  2XXX A;  2OK2 A;  5H8H A;  4M4G A;  2B3F A;  1ZJL A;  2UVH A;  1SYH A;  5H8F B;  3S9M C;  2IEE A;  1Y1Z A;  2QS3 A;  4NF6 A;  3K6W A;  3WAF A;  5I57 B;  3IOU A;  2A5T A;  3W9V A;  2I3W A;  4NED A;  5H8H B;  2Y7R A;  2DE4 A;  3FJM A;  3G3I A;  2YPN A;  3A3U A;  4JWY A;  3TKD A;  5KDT A;  1VFD A;  4YKK A;  2DWJ A;  2AL4 A;  4YAH X;  3HPI A;  3IOT A;  1PEB A;  4U23 A;  1OVB A;  4ZE9 A;  2DYX A;  2A5T B;  4E0W A;  4GXS B;  3S9N C;  3C36 A;  3DP8 A;  3IL1 B;  1B3E A;  3GLB A;  4OYV A;  3PV0 E;  3C33 A;  4YMB A;  5KDT B;  1XOC A;  3O9P A;  2H99 A;  3TQW A;  4P0G A;  4LQ2 A;  2ZNT A;  1O63 A;  5DVF A;  4PET A;  4FEC A;  2ANJ A;  3DP6 A;  5I59 A;  3WAE A;  4RY1 A;  2X7Q A;  3E4R A;  1XVX A;  4E0X A;  1YPN A;  1FTJ A;  3MP8 A;  5HPQ A;  2QS4 A;  2NWJ A;  2F5X A;  3I5O A;  3MVY A;  4JWX A;  4AB5 A;  4FEB A;  1D3K A;  1HSJ A;  4R6K A;  5I59 B;  2VOZ A;  3RN8 A;  4YMA A;  4PFU A;  3H6W A;  2NXO A;  1H44 A;  5LOM A;  2XXP A;  1JVX A;  4G4P A;  3KGC A;  1B7Z A;  1QKB A;  3VLV A;  1IXI A;  2XX7 A;  4OZ9 A;  2O69 A;  2REG A;  4WED A;  4F31 B;  5KZT A;  2FA7 A;  1JEU A;  4F3B A;  3PPO A;  1MM7 A;  4MBP A;  3TAJ A;  1A99 A;  3K01 A;  4H8J A;  1ZKB A;  3KOS A;  3UN6 A;  1D9Y A;  3KZG A;  2X26 A;  5I2K A;  1AMF A;  3OSQ A;  4OQO A;  3Q27 A;  5H8Q A;  5JEI A;  2G93 A;  4QF9 A;  1F9B A;  3K02 A;  2XXQ A;  1N3X A;  1HSE A;  4EF1 A;  2PT1 A;  2DXR A;  1B5I A;  2HQ0 A;  3H3G A;  3LSF B;  2ALU A;  5H8N A;  1N7W A;  2OWT A;  1OIB A;  4C1U A;  3MZB A;  4GWO A;  3QAX A;  3G3K A;  4H5G A;  5H8Q B;  4POW A;  1P1W A;  2H5Y A;  4OES A;  5L9O A;  4PFY A;  2F7A A;  4XIG Q;  3JZJ A;  3OOA A;  4FAJ A;  3IB1 A;  1DPP A;  2IA4 A;  5H8N B;  5TP9 A;  1GV8 A;  2F97 A;  3SEV A;  2ZYN A;  4H1X A;  4H8I A;  4KPT A;  2XHD A;  1SI0 A;  1UTB A;  4LA9 A;  2HEU A;  3OEK A;  4BDO A;  3FV2 A;  3FVN A;  3LSL A;  3IB0 A;  3RT6 B;  5TP9 B;  2ZMB A;  1VE4 A;  4X9T A;  1B0L A;  1B3L A;  1UTB B;  3MVZ A;  3RQT A;  2DVC A;  1H76 A;  2PX1 A;  2NVU B;  4KD5 A;  4IO2 A;  1JW5 A;  3FJG A;  2NOO A;  1VSO A;  1B46 A;  3JYR A;  3C34 A;  5DVI A;  1NNT A;  3QUJ A;  4U1O A;  2Q8J A;  1B3F A;  4XKR A;  1FQE A;  3TOD A;  4YKI A;  3T22 A;  3GZG A;  4P0I A;  3DLN A;  3V83 A;  1MQD A;  1O7T A;  4G2Z A;  1SW1 A;  3L6H A;  1GGG A;  4Q0C A;  4DIG A;  3THI A;  3IR1 A;  3EPE A;  1UTH B;  4R2B A;  1ATG A;  3TEL A;  1US4 A;  3MVX A;  1ANF A;  4NF4 A;  4QFP A;  1A7L A;  3QIM A;  4MFI A;  4GRK A;  1ZMG A;  3QYT A;  2Y7W A;  1N3W A;  4G68 C;  4BDQ A;  4G8H A;  1LBB A;  1URS A;  1Y1M A;  1MPD A;  4ZZE A;  2ZYK A;  4TOZ A;  1N84 A;  3PUX E;  4ONY A;  1LBC A;  5BWJ A;  1L5T A;  4U2R A;  4NMY A;  1M5F A;  5B7D A;  1P1O A;  4ZEI A;  3TTL A;  1LAG E;  3IO6 A;  2I0B A;  3RT8 A;  1XC1 A;  3E13 X;  1EH3 A;  1B3G A;  2F7C A;  2V84 A;  4FED A;  1LB8 A;  1H43 A;  4EQB A;  2R6G E;  1OQG A;  2VD2 A;  3LSX A;  3H03 A;  3RTW B;  3TDJ A;  2LAO A;  3S2V A;  3DM0 A;  4IGR A;  3CFL A;  4KCC A;  1SVX B;  1H45 A;  5ICQ A;  3W15 C;  2O1M A;  1R1N A;  3EF7 A;  4JSD A;  3IX1 A;  1WVJ A;  1NFT A;  1B0H A;  3O66 A;  4ESW A;  5I56 A;  3DEL B;  1R9Q A;  3CSG A;  5H8S A;  1DSN A;  4JDF A;  5DTB A;  5F7V A;  4EQ9 A;  1FQC A;  3VFJ A;  5F1Q A;  3O6G A;  3S9E A;  1IUD A;  3LUY A;  4FE8 A;  1LGB C;  1P1U A;  3TTR A;  2M8C A;  4RK2 A;  5FHM A;  1SDX A;  5DYH A;  1FTO A;  2DP8 A;  3ZKK A;  4LAT A;  5TU0 A;  4WEP A;  3SDF A;  5CBS A;  5I56 B;  1P1Q A;  1MQH A;  3ODB A;  1LFI A;  5ITO A;  1M5B A;  2ONS A;  1MXX A;  4F1Y A;  5K2X A;  5CMB A;  1CE2 A;  4H0W A;  4XTC Q;  2AYS A;  2F35 A;  3U92 A;  2DSF A;  2CMO A;  1NL5 A;  4ZEF A;  1DMB A;  4QFO A;  3TTM A;  4F29 A;  4QFK A;  2RC7 A;  3H06 B;  3I6V A;  5L9M A;  1MXV A;  1AH5 A;  2V93 A;  4JB7 A;  2CZL A;  3MPK A;  4LZ5 A;  3KJ7 A;  2HAV A;  2XX9 A;  3IJX B;  4GF8 A;  1EZ9 A;  4RK9 A;  3Q28 A;  1IIW A;  3IOV A;  2B3B A;  3M3L A;  4QSE A;  3KN8 A;  3RY3 A;  3CR9 A;  1OLC A;  3W9W A;  5ISU A;  1OLA A;  2QRY A;  4R72 A;  2ZXT A;  3IB2 A;  3UGW A;  1DTZ A;  4BDM A;  3MQ9 A;  4MLQ A;  1LLS A;  2BJJ X;  3VVD A;  3K0V A;  4Z7E A;  4IO4 A;  1D4N A;  4XXU A;  3FD3 A;  2Q89 A;  1VFE A;  1YAE A;  4MLV A;  4YKJ A;  1JQF A;  1MQJ A;  4NF6 B;  2Z8F A;  1YCJ A;  3G3J A;  3PU5 A;  1ELJ A;  1I69 A;  4QFL A;  1PB9 A;  3FXQ A;  3D4G A;  1OQH A;  2D3I A;  4R6H A;  4TLL B;  3K00 A;  4NWD A;  1QUJ A;  1WOD A;  1VR5 A;  4F2O A;  1URD A;  4ZEB A;  2HCA A;  4OET A;  4XKQ A;  4ZS9 A;  4GFR A;  3OXN A;  4OVJ A;  3SER A;  2ONR A;  2PMS A;  1B9J A;  3S9L C;  1FQB A;  2R71 A;  1ZU0 A;  3C35 A;  4F3S A;  1HSL A;  1FTL A;  3FVG A;  1EZO A;  4H67 A;  2A5S A;  5HM4 B;  4F1V A;  2KLF A;  1NNK A;  4ZEC A;  2I58 A;  3U72 A;  1PC3 A;  3K6X A;  3VV5 A;  2QMW A;  5FTI A;  3EHU A;  2F34 A;  1Y3Q A;  2V3T A;  4ZE8 A;  3TCG A;  1BLF A;  4KCD A;  3C31 A;  3T9V A;  3KJT A;  1QUI A;  5AE4 A;  4LZ7 A;  2DVZ A;  3PMW A;  2O51 A;  4AQ4 A;  3TUS A;  3ZKL A;  4OXV A;  1USY E;  1MXY A;  2XD3 A;  4IO6 A;  3ILT B;  4K3F A;  4F18 A;  3M3F A;  4X48 A;  4Q5T A;  5EHS A;  4ECF A;  2I3V A;  3KFM A;  3VLU A;  3PPQ A;  2Z22 A;  1R9L A;  3IAZ A;  3FJ7 A;  3FAS A;  4TLM B;  3C4M A;  4U4X A;  3KSX A;  1FQD A;  1MQI A;  1B1X A;  5I2K B;  1LFG A;  3RPW A;  1A54 A;  2E1S A;  5CMK A;  4ELO A;  3CIJ A;  3H4Z A;  3OO7 A;  3M8U A;  4F2Q A;  4AB6 A;  3MUQ A;  3CSB A;  3O97 A;  2OCU A;  2I6E A;  1MPC A;  4C0R A;  4LVQ A;  2XXV A;  4BLA A;  3G3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...