3FD3A

Structure of the c-terminal domains of a lysr family protein from agrobacterium tumefaciens str. c58.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
207
structure length
207
Chain Sequence
RVTLNIATNADSLGTWFLDAVSKFTGGSDYLVNIAVDDQDHTVEWLRGGRVLAAVTAHDKPVQGCRVTPLGVLRYHATASPDFMARHFADGVTPAALARAPGLTFNQKDRLQASWIRTALGEDVSYPTHWLPSTDGFVKASLAGMGWGLNPVQLVAEHLAAGRLVELMPGTPLDIPLYWQVNRLAAERLAGLTANMVGTARVVLMPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chromosome replication initiation inhibitor protein
publication title Structure of the C-terminal domains of a LysR family protein from Agrobacterium tumefaciens str. C58.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Transcription regulator
total genus 61
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2008-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fd3A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fd3A02
3USDA 3H6UA 2Q88A 2ZXTA 1AIVA 4DCXA 1LAFE 5KZTA 5H8HB 2HZKA 1LGBC 2O1LA 5H8SA 3A3UA 2DWHA 1YTVA 3IJOB 4PP0A 2THIA 2DP8A 4HW8A 1N3XA 4GD5A 1MDQA 1N7WA 4LP2B 1ANFA 3PPPA 3G3KA 2BJJX 1O63A 1P1NA 1OLCA 1QW0A 1LAXA 2RINA 5FTIA 2ZYKA 2XXHA 4G77A 2XD2A 1B58A 4R75A 2ZNTA 1II5A 3O66A 3MUQA 5M2VA 3CG3A 4OYVA 1VR5A 2VP1A 4YKJA 4POXA 2O7IA 1H76A 2ZYNA 2F35A 2H98A 1TWYA 1VFDA 3MW0A 2F7CA 1L5TA 5I59B 2Y7WA 3GXAA 2D5WA 3FV2A 1MM6A 4F39A 1GVCA 5H8NA 1IXIA 1B3LA 3FUZA 1B1HA 4MH5A 4OZ9A 4KD5A 3C32A 1P1UA 3U92A 4U4XA 3TTLA 2RF1A 2XXYA 1LAGE 2I58A 2Z8FA 2QS4A 3ZKLA 4OTEA 1OIBA 5CI5A 1HSLA 4XKRA 5A5XB 2NWJA 4XKNA 4YMAA 5CBSA 3D4GA 4HCYA 5ITPA 2QS3A 2QSXA 3OO8A 1M5BA 2PX1A 3FJMA 5HM4B 5H8HA 4G68A 4OMBA 4TQUQ 1LFGA 3FZVA 1B51A 3ZSFA 3IOUA 3RUMA 4EQ7A 1D4NA 1LSTA 1JQFA 3O6HA 4KYSA 1A8EA 2I4CA 4F2OA 1H44A 1NH8A 5H8FB 1EZ9A 2D21A 1Q1KA 1GGGA 4IB2A 5CMKA 3OEMA 2Q9TA 4N13A 4DXUA 4GVOA 5HBCA 4X9TA 1US4A 1URSA 5DYHA 5AA3A 3M3KA 2GH9A 3TAJA 5I58B 4GIZA 4L17A 3O2AA 3O28A 5KDTB 2DWIA 1EZOA 5H8QB 4U22A 2FNCA 1SYHA 4QFLA 2A5TA 3SETA 3JZJA 4NF8B 2KLFA 3HHFA 3Q26A 4U23A 2NXOA 3PMXA 3B6WA 2F8DA 3MP1A 5FHOA 4G8HA 1ZJLA 3Q29A 3ILUB 2RC7A 2OJTA 4I9DA 2R71A 4QSDA 3CFZA 5B70A 2I3VA 1MQJA 3ODBA 2NVUB 5I2KA 1QKAA 5CBRA 4IO3A 1TFDA 4TLMB 3VE1B 4KQPA 4ZE9A 1N0TA 1DOTA 2V3TA 1M5EA 4QRZA 4E0WA 3UN6A 3BFUA 3B6TA 4N07A 5JTYA 4DCYA 1FQEA 3HSTA 1D9YA 3C9HA 2F36A 1TT1A 3MPKA 4K3FA 4YKKA 1I69A 3RT6B 3H6TA 3Q27A 1XVYA 3FJ7A 1SBPA 1P1QA 2V84A 1M5FA 3HCQA 1PB9A 2O7UA 2E0SA 1D9VA 1QULA 2OZZA 3TKDA 4FE8A 4E0XA 3KN8A 3OO9A 1DPEA 2UYEA 1Y1ZA 1ELJA 4BDLA 3FD3A 4U2RA 1B3GA 4G8NA 1LBBA 2UVGA 5L8DA 5TPAB 2XD3A 3G3HA 2ONKE 1MPBA 3B7DA 3CRBA 3GZGA 1JEVA 3CI8A 3QUFA 1Z7NE 4GLIA 1R9QA 5I57A 3PPOA 3FVOA 3LSLA 4NWDA 1B5JA 1B05A 4BDMA 1FTMA 2RKMA 1ZU0A 3MZ9A 4H8IA 2DVCA 3O97A 1FQCA 1DPPA 2O69A 4DXBA 3MPLA 3E9XA 1UTHA 2R6GE 2W7YA 3K2DA 3H6VA 3N26A 1O7TA 3L6GA 1YCJA 4RK2A 4DLDA 2DXRA 2ZYOA 4AQ4A 1NNPA 4BDQA 2XXTA 1N3WA 2REJA 1I6QA 3I5OA 3H6WA 1N76A 1SYIA 2DSFA 4U1OA 4LUBA 1T0KA 3QSLA 1D3KA 1PDAA 2QRYA 3ZS6A 3H06B 3FXQA 1MDP1 1TXFA 2Z23A 4NF6B 3IB0A 5F1QA 4PETA 4Q0CA 2QPQA 1URGA 4FEBA 5ISUA 3VLUA 1IXGA 3K1PA 4IY6A 4ISUA 3IX1A 4ZZAA 3VVEA 1PC3A 1BP5A 2H99A 2RC9A 1B6HA 3EHUA 3BFTA 1NNFA 1JEUA 5TPAA 3TCGA 1LBCA 2XHDA 4AB6A 4UA8A 1RYXA 3DELB 1Y1MA 4I1DA 1WODA 4X48A 4IGRA 1A40A 3EPEA 3G3IA 2XX9A 4HTGA 1A54A 1POTA 2X7QA 5CC2A 1BKAA 4GXSB 2F78A 4N6PA 3PUYE 1QUIA 1B2HA 5I2NA 4IO4A 1PBQA 2YLNA 3RTWB 2PBWA 4DE8A 2XXRA 1JVYA 3TFLA 5H8NB 4F3GA 5I56A 3DP4A 4IY5A 1B4ZA 4F3BA 3SESA 5FHMA 5I84A 3O9PA 4JB7A 3TTKA 3SEYA 2X7PA 1P1OA 5DVJA 4EQ9A 4F19A 3FV1A 4H67A 4NTLA 4XKQA 2UYFA 3CR9A 4O3BA 1SW1A 3S4UA 2Q2CA 4EUOA 1I6AA 5B7DA 1LB8A 5L9SA 1B5IA 1ZLQA 1MH4A 4C1UA 2DWJA 4G68B 1N84A 4OFLA 1B46A 4H8JA 5K2YA 3U72A 1GR2A 1IIWA 1B1XA 3M8UA 2Y7PA 1A8FA 2NOOA 4YICA 1PEBA 4R72A 5DT6A 3V8XB 4XTCQ 4EF1A 1CE2A 1JW1A 1JETA 2I0CA 3FXUA 4HCWA 1IXCA 3FVNA 3MP8A 5CM6A 3MVZA 3VXBA 1OVBA 5DEXA 1CB6A 3QK6A 4OESA 2M8CA 5ICQA 4OHNA 4RA1A 2H9BA 3OELA 3PPRA 2D3IA 1ZBMA 2A5TB 1WDNA 3CIJA 4U4SA 2DE2A 4R6HA 5K2XA 2B3BA 2DWAA 3OXNA 3MZBA 4RK9A 4DXCA 2P0SA 3V83A 1SW2A 1ATGA 4BLAA 4JDFA 2XXPA 1M5DA 4NWCA 3PU5A 1B52A 1B3EA 5DVIA 3SKPA 3L6HA 3G3GA 3CSBA 4EF2A 5I2KB 3W15C 5L9MA 2ZMBA 1USYH 1MY1A 1BTJA 4P11A 3SEUA 2CMOA 3H03A 2P2AA 2Z8DA 4IO7A 1Y3QA 4ZDMA 4R73A 1MH3A 3SEVA 3UORA 4LA9A 2XXQA 4THIA 3C31A 4GWOA 1WVJA 2QMXA 5JTYB 1URDA 2VD3A 4YAHX 3PUWE 2XX7A 5AA4A 3WAFA 3TCHA 1AMFA 5DVFA 1FQDA 3K1MA 1MPDA 3K01A 3TZAA 1UIUA 2HZLA 4F2QA 1QUJA 3Q28A 1DTZA 2AIXA 4ELQA 4OETA 3I6VA 3IB1A 3U94A 1XOCA 3E4RA 3O6GA 3KOSA 3IO4A 1NMUA 4F3PA 1A7LA 3TYHA 3V5AA 4QHQA 4EXKA 3TDJA 4WXJA 1XHYA 3CVGA 5CMBA 1NFTA 1LCTA 1P1WA 4ELOA 2Z8EA 3IR1A 3W9VA 3U8QA 3MAMA 1NNTA 4R74A 4JSDA 3DM0A 5ELVA 3G3FA 3KEIA 4YKPA 3MVYA 4BDRA 3R6UA 1MQDA 2YPNA 1S7YA 5I57B 1B32A 1XVXA 2QMWA 2UVIA 1J1NA 4IO5A 3R7XA 1Y9UA 2RCBA 3C4MA 1SW4A 2PVUA 2A5SA 3RT8A 4QFKA 3T66A 2E1SA 1UTHB 3N5LA 1FW0A 4R9GA 1Z7ME 2QS1A 4P0IA 4WEPA 3VLVA 4F1UA 5ICTA 5FTHA 3JYRA 1H45A 1NNKA 3MWBA 3U93A 2AYSA 4FIMA 3W9WA 4ONYA 3T22A 3KN7A 4PFWA 5CMCA 3K00A 1SW5A 3MQ9A 1MS7A 4I62A 3OD7A 1MXYA 2I3WA 1FTLA 2O84X 3H4ZA 4ZEIA 4NF4A 2ZYMA 1YAEA 4OEVA 4JBZA 2HAVA 1Q35A 4PFYA 2RC8A 4MLQA 1MM7A 2REGA 3FVGA 4GRKA 4F18A 3S9MC 1Y20A 3PUXE 3HO7A 1ZIUA 4NF5B 4KCDA 1S9TA 2ONSA 1PB8A 3RNNA 3KG2A 3OSQA 4QSCA 3TTNA 4C0RA 3GBBA 3C34A 4M1VA 4M4GA 5ITOA 3OENA 2V3QA 5TP9A 3QAXA 3THIA 3PGFA 1MXXA 1XT8A 3CFXA 4UACA 4JXIA 4OFJA 1AL3A 3LSFB 3FGSA 3OOAA 5I2NB 4Q8RA 2ESNA 4ND9A 3IB2A 1MY0A 2QS2A 4YU0A 2DYXA 3H3GA 1ZTYA 3LC8A 4RY1A 5KCJA 4H65A 3FXRA 3T9XB 3DLNA 5I56B 3KGCA 3T93B 1NH7A 4MFIA 4HS7A 4WKMA 3ZKKA 2VOZA 1H3DA 3RGYA 2F34A 3TEPA 3BBRA 3SDFA 1EH3A 1EZPA 4ELPA 3UA8A 3K02A 4GL8A 3S9EA 4ZEBA 4XKPA 3MVXA 4RXLA 2O51A 4NF5A 5L9OA 3PPNA 3EHTA 3TPAA 3K0VA 4KCCA 2DOJA 4F29A 4ZEFA 3A09A 3V89B 3FVKA 3TQLA 2ZNUA 3IK6B 1SQYA 4R6KA 4PE5B 4KR5A 4F31B 1AOVA 3S9NC 3RLFE 3PMVA 3UP9A 2DVZA 4OXVA 4NE4A 4EXLA 3SEWA 1UTBA 1GTKA 3T96B 4MBPA 1SI0A 3KZGA 4KFQA 3K1NA 5DEXB 1SVXB 4GQOA 2HXWA 4DDDA 3K6VA 3TQWA 2HCAA 2G29A 3EQ1A 1MPCA 4FJPA 4H1XA 1M5CA 1FQFA 3IO6A 4YZZA 1KWHA 2UVHA 1R6ZA 3OO7A 1FTKA 4R2FA 1OLAA 4IO2A 2VD2A 4H0WA 3E13X 4FORA 3QXMA 4H5GA 2ANJA 3LSXA 2RCAA 4JSOA 4I8CA 3EF7A 3RTFB 3KJTA 2O68A 3F11A 3VV5A 3CFLA 3RPWA 5TU0A 4X1BA 1MXUA 4G2ZA 3VFJA 4MF3A 3WAEA 2XXWA 2GHAA 4FEDA 4XXUA 3QUJA 1UIVA 1DMBA 2OBGA 4R6YA 3C35A 3TELA 4LATA 2Y7KA 1HSEA 4AB5A 4H5FA 1MRPA 5BUUA 5LOMA 3C33A 5AA4B 3IJXB 1R9LA 1GV8A 3FASA 1TFAA 1IZ1A 1SI1A 2AL4A 1S50A 1MY2A 3IORA 4Q30B 2OCUA 3G3JA 1DTGA 2FYIA 3H7MA 1ZMGA 3VVDA 3TTRA 2QJEA 2Z22A 4GOTA 1XS5A 3VDFA 1BIYA 3PMWA 4LQ2A 3E3KA 2FA7A 1Y4CA 4NEDA 3LR1A 2UXAA 2GHBA 5HPQA 3IOWA 3DP6A 3T9UA 1QJMA 4GFRA 1OVTA 4DZ1A 5AA2A 2I48A 2I4BA 3KBRA 1MQGA 4U1ZA 2F6GA 2LAOA 2Y7RA 4Q5TA 3K6UA 1LAHE 1MXZA 2YJPA 1YPNA 4OFOA 3I3VA 2H4IA 1MQHA 1MXVA 4Z7EA 3OEKA 4QF9A 3N94A 4QFPA 4LZ5A 3C36A 2Q2AA 3TMGA 1QKBA 5IKBA 3KJ7A 3G7WA 4PFUA 3FIRA 1R1NA 1OMPA 3ONMA 3PUZE 2WKYA 2Y84A 1P99A 4LQ5A 2UVJA 2XXIA 3ECRA 3HPIA 1US5A 1VE4A 4GL0A 3TODA 3MJNA 4ZECA 4ZS9A 4ZEDA 3HV1A 3CSGA 2GFEA 1LLSA 1PB7A 3GBAA 1OQGA 1RKMA 3R26A 4NF4B 2V93A 2PT2A 3TTMA 4YB7A 5I59A 3MZ1A 4O3CA 3K6WA 5JEIA 5AA2D 3KSJA 1QVSA 1IQ7A 2F6PA 4X1DA 4OEUA 1RYOA 4R2BA 4BDNA 3T9VA 3KFMA 4YB6A 3IOVA 2F5XA 5AA1A 3PUVE 4LZ7A 3FATA 3CG1A 5TP9B 4ESWA 4F1VA 5A5XA 4OENA 1JW5A 1Y4TA 4POWA 2OK2A 4DIGA 1A55A 1MG1A 4LONB 1HSJA 1NKXA 2IA4A 4YKIA 2H5YA 2DS9A 1B7ZA 5AE4A 1B7UA 4RYAA 1USYE 2R9JA 5F7VA 3UGWA 2F7AA 2IEEA 3SERA 4OVJA 2AL5A 2VGQA 1LFHA 4JWYA 4ESXA 1ZKBA 3ILTB 1MQIA 3P7IA 4OERA 4G8MA 3KN3A 4GF8A 3PV0E 5KCJB 3O29A 1B0LA 1Y3PA 1UQWA 3KOTA 3D4CA 5H8FA 3N6UA 3QYTA 4ZE8A 1I6BA 4KI0E 4RJZA 4ECFA 2I49A 3PPQA 3LSWA 1FQBA 2XXXA 4QSEA 3PD9A 5I58A 3JV9A 1JVXA 4ZEKA 4C1TA 1QUKA 3FJGA 2V25A 5KDTA 1IUDA 3IAZA 2B65A 4MLVA 4KHZE 4TOZA 5H8QA 3S9LC 2Q89A 1LFIA 4YB5A 4ELRA 1H43A 2HFBA 2Q8JA 3OMBA 1JNFA 2DXYA 3K4UA 1FTJA 4JWOA 4NF8A 3S2VA 2ZNSA 3HHGA 2QL3A 2DQVA 2O1MA 1IITA 4RPOA 3OO6A 3OSRA 4P0GA 3MBPA 1F9BA 3KSXA 1MXWA 2G93A 1B0HA 1B40A 1B4HA 2OWSA 2F7BA 5CMMA 4R9FA 3EN3A 3M3LA 4XIGQ 1UTBB 4F22A 3IOTA 2Y7IA 3Q25A 4LZ8A 5JK4A 3RN8A 1VSOA 2ABHA 1OQHA 4KYDA 4TLLB 3K6XA 4O3AA 4EDPA 4FECA 1B3HA 2H25A 1LB9A 3IL1B 3VLWA 4H6DA 3O6IA 1B7HA 1B5HA 3TCFA 3PD8A 4FAJA 3BKIB 1JW4A 3VXCA 5FHNA 4IO6A 2DE3A 4RNSA 3RY3A 4QFOA 1FTOA 4QFNA 4PFTA 3UIFA 1FQAA 2NUVA 1MY4A 4G68C 4Z0IA 4JWXA 4KYEA 2V3UA 2P1SA 1AH5A 4OQOA 2O6AA 5BWJA 1N04A 3DP8A 4WEDA 3MVWA 2GRVA 3A3CA 3M3FA 2HQ0A 4OWDA 3LUYA 1BLFA 4NMYA 4PQJA 1EU8A 3UK4A 5EHMA 2XXVA 5DTBA 1Y3NA 3VVFA 3LBSA 3MP6A 2PMSA 1B3FA 4ZZEA 4LVQA 4F1YA 2OWTA 2XX8A 3GLBA 4F3SA 4KPTA 5EYFA 4G4PA 2X26A 5J1DA 1A99A 2DE4A 2HEUA 1B9JA 2XXUA 2HAUA 3HN0A 4U21A 1N7XA 2I0BA 4YMBA 2OLBA 1IXHA 2F97A 3EHSA 3B6QA 2PYYA 1POY1 3U1OA 3RQTA 4BDOA 2ALUA 4IGTA 1PBPA 3SEXA 5IAIA 1O64A 3T9HB 3MC2A 4FATA 4EQBA 3AXFA 1XC1A 2PT1A 1VFEA 4GXAA 2CZLA 5CRYA 2ONRA 1SDXA 1IEJA 5AA2B 2B3FA 1SD3A 4RPNA 1MY3A 3QIMA 1DSNA 4NF6A 3TUSA 2I6EA 3N6TA 1FCKA 2VHAA 5EHSA 1NL5A 1LCFA
chains in the Genus database with same CATH superfamily
3USDA 4PTKA 4OVTA 3H6UA 2Q88A 2ZXTA 1AIVA 4DCXA 2PFYA 1LAFE 5KZTA 5H8HB 2HZKA 1LGBC 2O1LA 5H8SA 3A3UA 2DWHA 4QBAA 1YTVA 3IJOB 4PP0A 2THIA 2DP8A 4HW8A 1N3XA 4PDHA 2FBPA 4MAGA 4GD5A 1MDQA 1N7WA 4LP2B 1ANFA 3PPPA 4UABA 2F3BA 2BJJX 1O63A 1P1NA 1OLCA 1QW0A 3G3KA 1LAXA 2RINA 5FTIA 2ZYKA 2XXHA 4G77A 2XD2A 1B58A 4R75A 1RDZA 3PTYA 2ZNTA 1II5A 3O66A 3MUQA 5M2VA 3CG3A 4OYVA 1VR5A 2VP1A 5ESYA 4YKJA 4POXA 2O7IA 1H76A 2ZYNA 2F35A 2H98A 1TWYA 1VFDA 3MW0A 2F7CA 1L5TA 5I59B 2Y7WA 3GXAA 2D5WA 3FV2A 1MM6A 4F39A 1KA0A 2QVRA 1GVCA 5H8NA 1IXIA 1B3LA 3FUZA 1B1HA 4MH5A 4OZ9A 4KD5A 3C32A 1P1UA 5IGAA 3U92A 3RPLA 4U4XA 3TTLA 2RF1A 2XXYA 4PFBA 1LAGE 2I58A 2Z8FA 2QS4A 3ZKLA 4JVIA 4OTEA 1OIBA 4P56A 4GWUA 5CI5A 1HSLA 4XKRA 5A5XB 2NWJA 4XKNA 4YMAA 5CBSA 2XWKA 3D4GA 1IMBA 4HCYA 4PAIA 5ITPA 1NV7A 2QS3A 2QSXA 3OO8A 1M5BA 2PX1A 3FJMA 5HM4B 5H8HA 4G68A 1FPFA 4OMBA 4TQUQ 1LFGA 3FZVA 1B51A 3ZSFA 3IOUA 3RUMA 4EQ7A 1D4NA 1LSTA 1JQFA 1LBVA 3O6HA 4KYSA 1A8EA 2I4CA 4OVQA 4F2OA 1H44A 5LDZA 1XI6A 1NH8A 5H8FB 1EZ9A 2D21A 1Q1KA 1GGGA 4IB2A 5CMKA 3OEMA 2Q9TA 1FTAA 4N13A 4DXUA 4GVOA 5HBCA 4X9TA 1US4A 3ISPA 1FBFA 1FPBA 1DK4A 1URSA 5DYHA 5AA3A 3M3KA 2GH9A 3TAJA 5I58B 4GIZA 4L17A 3O2AA 3O28A 5KDTB 2DWIA 1EZOA 5H8QB 4X8RA 4U22A 4G61A 1JP4A 2FNCA 1SYHA 4OVRA 3BIHA 5IZZA 4QFLA 2A5TA 3SETA 3JZJA 4NF8B 2KLFA 3HHFA 3Q26A 4U23A 2NXOA 3PMXA 4O94A 3B6WA 1SPIA 2F8DA 3MP1A 5FHOA 4G8HA 5I3SA 1ZJLA 3Q29A 3ILUB 2RC7A 2OJTA 4I9DA 2R71A 4N15A 2XXKA 4QSDA 3CFZA 4NGUA 4P1EA 4X04A 5B70A 2I3VA 1MQJA 3ODBA 2NVUB 5I2KA 1QKAA 4AS4A 5CBRA 4IO3A 1TFDA 4TLMB 2HHMA 3VE1B 4KQPA 4ZE9A 1N0TA 1DOTA 1LBWA 2V3TA 1M5EA 4QRZA 4E0WA 3UN6A 3BFUA 1FBHA 2HXRA 3B6TA 4N07A 3SZPA 5JTYA 4DCYA 1FQEA 3HSTA 1D9YA 3C9HA 2F36A 3KBZA 1TT1A 3MPKA 1FBCA 4K3FA 4YKKA 1I69A 3RT6B 4QXDA 3H6TA 3Q27A 1XVYA 3FJ7A 1SBPA 1P1QA 2V84A 1M5FA 4N8GA 3HCQA 1PB9A 2O7UA 2E0SA 1D9VA 1QULA 1QGXA 2OZZA 3TKDA 4FE8A 2Q8MA 2WYKA 4E0XA 3KN8A 4IR8A 3OO9A 1DPEA 2UYEA 1Y1ZA 1ELJA 4BDLA 3FD3A 4U2RA 1G0HA 1B3GA 1LBZA 1DBZA 4G8NA 1LBBA 4MMPA 2UVGA 5L8DA 1DCUA 4N6KA 2XD3A 3G3HA 3GZGA 2ONKE 1MPBA 3B7DA 3CRBA 5TPAB 4HXVA 1JEVA 3CI8A 3QUFA 1Z7NE 4GLIA 3T0JA 1R9QA 5I57A 1FPEA 3PPOA 3FVOA 3LSLA 4NWDA 1B5JA 1B05A 4BDMA 1FTMA 2RKMA 1ZU0A 3MZ9A 4H8IA 2DVCA 3O97A 1FQCA 1DPPA 2O69A 2ZZWA 4DXBA 1FBPA 3MPLA 3E9XA 1UTHA 3LV0A 2R6GE 2W7YA 3K2DA 5IZ3B 3H6VA 3N26A 1O7TA 3L6GA 1YCJA 4RK2A 4DLDA 2DXRA 2ZYOA 4AQ4A 1NNPA 4BDQA 2XXTA 1N3WA 2REJA 1I6QA 3I5OA 3H6WA 1N76A 1SYIA 2DSFA 4U1OA 4LUBA 1T0KA 3QSLA 1D3KA 4NN3A 1PDAA 2QRYA 3ZS6A 3H06B 3EKIA 3FXQA 1MDP1 3RYDA 1TXFA 2Z23A 1NV4A 4NF6B 3IB0A 5F1QA 4PETA 4Q0CA 2QPQA 1URGA 4FEBA 5ISUA 3VLUA 1IXGA 3K1PA 4PCDA 4IY6A 4ISUA 3IX1A 4ZZAA 3VVEA 1PC3A 1BP5A 1KZ8A 2H99A 2RC9A 1B6HA 3EHUA 3BFTA 1NNFA 1JEUA 5TPAA 3TCGA 1LBCA 2XHDA 5ET5A 4AB6A 4UA8A 1RYXA 3DELB 1Y1MA 4I1DA 1WODA 4X48A 4IGRA 5I7IA 1A40A 3EPEA 2CZKA 3G3IA 3E78A 2XX9A 4HE1A 4HTGA 1A54A 1POTA 2X7QA 5CC2A 3A29A 1BKAA 4GXSB 2F78A 4N6PA 3PUYE 1QUIA 1B2HA 5I2NA 4IO4A 1PBQA 2YLNA 5EQ9A 3RTWB 2PBWA 4DE8A 2XXRA 1JVYA 3TFLA 5H8NB 4F3GA 5I56A 3DP4A 4IY5A 1B4ZA 4F3BA 1RDXA 3SESA 5FHMA 5I84A 3RPLB 2XWIA 3O9PA 4JB7A 3TTKA 1Q9DA 2X7PA 3SEYA 1P1OA 5DVJA 4EQ9A 4F19A 3FV1A 4H67A 1LEVA 4NTLA 4XKQA 2UYFA 1FPKA 3CR9A 1SW1A 3KC0A 4O3BA 3S4UA 2Q2CA 3MSTA 2VPNA 4EUOA 1I6AA 1K9ZA 5B7DA 1LB8A 5L9SA 1B5IA 4MNPA 1ZLQA 1MH4A 4C1UA 2DWJA 4XF5A 4G68B 1FJ6A 1N84A 3D1RA 3E79A 4OFLA 4GWXA 1B46A 4H8JA 5K2YA 4MX6A 3U72A 1GR2A 4GWZA 1IIWA 1B1XA 3M8UA 2WYPA 2Y7PA 1A8FA 1FBGA 2NOOA 1IMDA 4YICA 1PEBA 4R72A 5DT6A 3V8XB 4XTCQ 4EF1A 1EYKA 1CE2A 1JW1A 1JETA 2I0CA 3FXUA 4HCWA 4MNIA 2B4LA 1IXCA 3FVNA 3MP8A 5CM6A 3MVZA 3VXBA 1OVBA 5DEXA 1CB6A 3QK6A 4OESA 2M8CA 5ICQA 4OHNA 4RA1A 4N81A 2H9BA 1NV6A 3OELA 3PPRA 2D3IA 1ZBMA 2A5TB 2QFLA 4NG7A 1WDNA 3CIJA 1IMAA 4U4SA 2DE2A 3BIGA 4R6HA 5K2XA 2B3BA 2DWAA 3OXNA 3MZBA 4RK9A 1FPLA 2JJKA 2CZIA 4DXCA 2P0SA 3V83A 1SW2A 2FHYA 1ATGA 4GWSA 4BLAA 4JDFA 2XXPA 1M5DA 4NWCA 1NV2A 3PU5A 1B52A 1B3EA 5DVIA 2PFZA 3SKPA 3L6HA 4GWWA 3G3GA 3CSBA 4EF2A 4PAFA 5I2KB 3W15C 5L9MA 2ZMBA 1VDWA 1USYH 1MY1A 1BTJA 4OANA 1BK4A 4P11A 3SEUA 2CMOA 2Y5LA 3H03A 2P2AA 2Z8DA 4IO7A 1Y3QA 4R73A 4ZDMA 1MH3A 3SEVA 4MIJA 3UORA 4LA9A 2XXQA 4THIA 2WX9A 3C31A 4GWOA 4PAKA 1WVJA 2QMXA 5JTYB 4NAPA 4P47A 1URDA 2VD3A 4YAHX 3PUWE 2XX7A 1EYJA 4DI4B 5AA4A 3WAFA 3TCHA 1AMFA 5DVFA 1FQDA 2WBBA 3K1MA 5IZ1A 1MPDA 3K01A 3TZAA 1UIUA 2HZLA 4F2QA 4DI3D 1QUJA 4PBHA 3Q28A 1DTZA 2AIXA 4ELQA 4OETA 2DDKA 3I6VA 3IB1A 3U94A 1XOCA 4HE2A 3E4RA 3O6GA 3KOSA 3IO4A 1NMUA 4PGPA 1A7LA 5EYHA 3TYHA 4F3PA 3V5AA 4QHQA 4EXKA 3TDJA 4WXJA 1G0IA 1IMFA 1XHYA 3CVGA 5CMBA 1NFTA 1LCTA 1P1WA 4ELOA 2Z8EA 3IR1A 1FBEA 3W9VA 3U8QA 2B4MA 3MAMA 1NNTA 4R74A 2XWOA 4JSDA 3DM0A 2VPOA 5ELVA 3G3FA 3KEIA 4YKPA 4LN5A 3MVYA 4OVSA 4BDRA 3R6UA 1MQDA 2YPNA 1S7YA 5I57B 1B32A 1XVXA 2QMWA 5IM2A 2UVIA 1J1NA 4IO5A 3R7XA 1Y9UA 4P9KA 4O7MA 2RCBA 3C4MA 1SW4A 2PVUA 2A5SA 3RT8A 4QFKA 3T66A 2E1SA 1UTHB 3N5LA 1FW0A 4R9GA 1Z7ME 2QS1A 4P0IA 4WEPA 3VLVA 4F1UA 4HE0A 5ICTA 5FTHA 1NV3A 3JYRA 1H45A 1NNKA 3MWBA 3U93A 2AYSA 5EQAA 4FIMA 3W9WA 4ONYA 3T22A 3KN7A 4PFWA 5CMCA 3K00A 1SW5A 1YYZA 3MQ9A 3QMFA 3HFUA 1MS7A 4I62A 3OD7A 1MXYA 2I3WA 1FTLA 2O84X 3H4ZA 4ZEIA 4NF4A 2ZYMA 1FRPA 1YAEA 4OEVA 4JBZA 4GX4A 2HAVA 1Q35A 4PFYA 2RC8A 4MLQA 1MM7A 2REGA 3FVGA 4GRKA 4F18A 3S9MC 1Y20A 3PUXE 3HO7A 1ZIUA 4NF5B 4KCDA 1S9TA 2ONSA 1PB8A 3RNNA 3KG2A 3OSQA 4QSCA 5I5PA 3TTNA 4C0RA 3GBBA 3C34A 4M1VA 4M4GA 1NI9A 5ITOA 3OENA 2V3QA 2KQZA 5TP9A 3QAXA 3THIA 3PGFA 1MXXA 1XT8A 3CFXA 4UACA 4JXIA 4OFJA 1AL3A 3B8BA 2XA5A 3LSFB 3FGSA 3LUZA 3OOAA 5I2NB 4Q8RA 2ESNA 4ND9A 3IB2A 1KA1A 1MY0A 2QS2A 4YU0A 2DYXA 3H3GA 1ZTYA 3LC8A 4RY1A 5KCJA 4H65A 3FXRA 3T9XB 3DLNA 5I56B 1NUYA 5J16A 3KGCA 3U65A 3T93B 1NH7A 2XWVA 4GX6A 2L5VA 4MHFA 4MFIA 4HS7A 4WKMA 3ZKKA 2WBDA 2VOZA 3T1BA 1H3DA 3RGYA 2F34A 3TEPA 1AWBA 5F24A 1FPIA 3BBRA 3SDFA 1EH3A 1EZPA 4ELPA 3UA8A 3ROJA 2P3NA 3K02A 4GL8A 3S9EA 4ZEBA 4XKPA 3MVXA 4RXLA 2O51A 4NF5A 5L9OA 3PPNA 3EHTA 3TPAA 3K0VA 4KCCA 2DOJA 4F29A 2V4CA 2CZHA 4ZEFA 5A5LA 3A09A 3V89B 3FVKA 3TQLA 2ZNUA 4N17A 3IK6B 1SQYA 4R6KA 4NHBA 4PE5B 4KR5A 4F31B 1AOVA 3S9NC 3RLFE 3PMVA 3UP9A 2DVZA 4OXVA 4NE4A 4EXLA 3SEWA 1UTBA 1GTKA 4MCOA 3T96B 4MBPA 2ZZXA 1SI0A 3KZGA 4KFQA 3K1NA 5DEXB 1SVXB 2BJIA 4GQOA 2HXWA 4DDDA 3K6VA 3TQWA 5DW8A 4PF6A 2HCAA 2G29A 3EQ1A 1MPCA 4FJPA 4H1XA 1M5CA 1FQFA 3IO6A 4GBVA 4XEQA 4YZZA 1KWHA 4FBPA 2UVHA 1R6ZA 3OO7A 1FTKA 4R2FA 1OLAA 4IO2A 2VD2A 4H0WA 3E13X 3KC1A 4FORA 3QXMA 4H5GA 2Q74A 2ANJA 3LSXA 2FIXA 5LTCA 2RCAA 4JSOA 4MNCA 4N6DA 4I8CA 3EF7A 3RTFB 3KJTA 1D9QA 2O68A 3F11A 3VV5A 3CFLA 5EQ7A 4OA4A 5TU0A 3RPWA 4X1BA 1MXUA 4G2ZA 3VFJA 4MF3A 3WAEA 2XXWA 4FEDA 2GHAA 4XXUA 3QUJA 1YXIA 5ET7A 1NUZA 1UIVA 1DMBA 2OBGA 4N4UA 4R6YA 3C35A 3TELA 1FSAA 4LATA 2Y7KA 1HSEA 4AB5A 4H5FA 1MRPA 5BUUA 5LOMA 3C33A 5AA4B 3IJXB 1R9LA 1GV8A 3FASA 1TFAA 4PFRA 1IZ1A 4P8BA 1SI1A 2AL4A 1S50A 3B50A 1MY2A 3IORA 4Q30B 2OCUA 3G3JA 1DTGA 2MKZA 2FYIA 3H7MA 1ZMGA 3VVDA 3TTRA 2QJEA 2Z22A 4GOTA 1XS5A 3VDFA 1BIYA 1RDYA 3PMWA 4LQ2A 3E3KA 2FA7A 1Y4CA 4NEDA 3LR1A 2UXAA 2GHBA 4NQ8A 4GX3A 4PGNA 5HPQA 3IOWA 3DP6A 3T9UA 1QJMA 4GFRA 1OVTA 4DZ1A 5AA2A 2I48A 2I4BA 3KBRA 1MQGA 4U1ZA 1FJ9A 2F6GA 2LAOA 2Y5KA 2Y7RA 4Q5TA 3K6UA 1LAHE 1MXZA 2YJPA 1YPNA 4OFOA 3I3VA 2H4IA 1MQHA 1MXVA 4Z7EA 3OEKA 4QF9A 3N94A 4QFPA 4LZ5A 4GWYA 3C36A 2Q2AA 3TMGA 1QKBA 5IKBA 3KJ7A 3G7WA 2FIEA 4PFUA 3CHGA 3FIRA 1R1NA 1OMPA 4PFIA 3ONMA 3PUZE 2WKYA 2Y84A 4I40A 1P99A 1CNQA 4LQ5A 2UVJA 2XXIA 3ECRA 3HPIA 1US5A 1VE4A 4GL0A 3TODA 3MJNA 4ZECA 4ZS9A 4ZEDA 3HV1A 3CSGA 2GFEA 1LLSA 1NV0A 1PB7A 3GBAA 4PDDA 1OQGA 1RKMA 3R26A 4NF4B 2V93A 2PT2A 3TTMA 4YB7A 5I59A 3MZ1A 4O3CA 3K6WA 5JEIA 5AA2D 4GBWA 3KSJA 1QVSA 1IQ7A 2F6PA 4X1DA 4OEUA 4PF8A 1FBDA 1RYOA 4MEVA 4H45A 4R2BA 4BDNA 3T9VA 3KFMA 4YB6A 3IOVA 2F5XA 5AA1A 4NX1A 5EQ8A 3PUVE 1LBXA 4LZ7A 3FATA 3CG1A 5TP9B 4ESWA 4F1VA 5A5XA 4OENA 5EYGA 1JW5A 1Y4TA 4POWA 2OK2A 4DIGA 1A55A 1MG1A 4LONB 4JVCA 4KXPA 1NUXA 1HSJA 1NKXA 2IA4A 4YKIA 2F3DA 2R8TA 2H5YA 2DS9A 1B7ZA 5AE4A 1B7UA 4RYAA 1USYE 2R9JA 5F7VA 3UGWA 2F7AA 2IEEA 3SERA 4OVJA 2AL5A 2VGQA 5T3JA 1LFHA 4JWYA 1K9YA 4ESXA 1ZKBA 3ILTB 1MQIA 3GYYA 3P7IA 4OERA 4G8MA 3KN3A 4GF8A 3PV0E 5KCJB 3O29A 1B0LA 3FXBA 1Y3PA 1UQWA 3KOTA 3D4CA 4O8MA 5H8FA 3N6UA 1IMCA 3QYTA 4ZE8A 1I6BA 4KI0E 4RJZA 4ECFA 2I49A 3PPQA 3LSWA 1FQBA 2XXXA 4QSEA 3PD9A 5I58A 5ET6A 3JV9A 1JVXA 4ZEKA 4C1TA 1QUKA 3FJGA 2V25A 5KDTA 1IUDA 1IMEA 1FPGA 3IAZA 2B65A 4MLVA 4KHZE 4TOZA 5H8QA 3S9LC 2Q89A 1LFIA 3FBPA 2QVVA 4YB5A 4ELRA 1H43A 2HFBA 2Q8JA 3OMBA 1JNFA 2DXYA 3K4UA 5FBPA 1FTJA 4JWOA 4MJOA 4NF8A 3S2VA 2ZNSA 3HHGA 2QL3A 2DQVA 2FVZA 2O1MA 1IITA 4RPOA 3OO6A 3OSRA 4P0GA 3MBPA 1F9BA 3KSXA 1MXWA 2G93A 1B0HA 1B40A 1B4HA 4NF0A 2OWSA 2F7BA 2VT5A 2PCRA 5CMMA 2ZZVA 4R9FA 3EN3A 2OX3A 2HPGA 4OVPA 4JVDA 3M3LA 4XIGQ 1UTBB 4F22A 3IOTA 2Y7IA 4N8YA 3Q25A 4LZ8A 5JK4A 3RN8A 1VSOA 2ABHA 1OQHA 4KYDA 4TLLB 4P3LA 3K6XA 3IFCA 4O3AA 4P1LA 4FECA 4EDPA 1B3HA 2H25A 4PBQA 1LB9A 3IL1B 4N91A 3VLWA 4H6DA 3O6IA 1B7HA 1B5HA 3TCFA 3PD8A 4FAJA 2OWZA 3BKIB 1JW4A 4AS5A 3VXCA 5FHNA 4IO6A 2DE3A 2P3VA 4RNSA 2QVUA 3RY3A 1LBYA 4QFOA 1FTOA 4QFNA 4PFTA 3UIFA 1FQAA 1YZ0A 2NUVA 1MY4A 2CEXA 4G68C 4Z0IA 4JWXA 4KYEA 2V3UA 2P1SA 1AH5A 4OQOA 3NOHA 2O6AA 5BWJA 5ET8A 1N04A 2GQ1A 3DP8A 4WEDA 1NUWA 1INPA 3MVWA 2GRVA 2WEFA 3A3CA 2KR0A 3M3FA 2HQ0A 4OWDA 3MYUA 3LUYA 1BLFA 4NMYA 4PQJA 1EU8A 2CEYA 4O7IA 3UK4A 5EHMA 2XXVA 5DTBA 1Y3NA 3VVFA 1NV5A 3LBSA 3MP6A 2PMSA 4I3YA 1B3FA 4ZZEA 4LVQA 4H46A 4F1YA 2OWTA 3IFAA 1EYIA 2XX8A 3GLBA 4KPTA 5EYFA 4F3SA 4G4PA 2X26A 5J1DA 1A99A 2DE4A 2HEUA 1B9JA 2XXUA 2HAUA 3HN0A 4U21A 1N7XA 2I0BA 4YMBA 2OLBA 1IXHA 5IZ3A 2F97A 3EHSA 3B6QA 2PYYA 4PE3A 1POY1 3U1OA 3RQTA 4BDOA 2ALUA 4IGTA 1PBPA 3SEXA 5IAIA 1O64A 3T9HB 3MC2A 4FATA 4EQBA 3AXFA 1XC1A 2PT1A 4XFEA 1VFEA 1FPJA 4GXAA 2CZLA 5CRYA 1NV1A 2ONRA 4PC9A 1SDXA 1IEJA 5AA2B 2B3FA 1SD3A 4RPNA 1MY3A 3QIMA 1DSNA 4NF6A 3TUSA 2I6EA 1FPDA 3N6TA 1FCKA 4I3EA 2VHAA 5EHSA 1NL5A 1LCFA
chains in the Genus database with same CATH topology
3USDA 3H6UA 2Q88A 2ZXTA 1AIVA 4DCXA 1LAFE 5KZTA 5H8HB 2HZKA 1LGBC 2O1LA 5H8SA 3A3UA 2DWHA 1YTVA 3IJOB 4PP0A 2THIA 2DP8A 4HW8A 1N3XA 4GD5A 1MDQA 1N7WA 4LP2B 1ANFA 3PPPA 3G3KA 2BJJX 1O63A 1P1NA 1OLCA 1QW0A 1LAXA 2RINA 5FTIA 2ZYKA 2XXHA 4G77A 2XD2A 1B58A 4R75A 2ZNTA 1II5A 3O66A 3MUQA 5M2VA 3CG3A 4OYVA 1VR5A 2VP1A 4YKJA 4POXA 2O7IA 1H76A 2ZYNA 2F35A 2H98A 1TWYA 1VFDA 3MW0A 2F7CA 1L5TA 5I59B 2Y7WA 3GXAA 2D5WA 3FV2A 1MM6A 4F39A 1GVCA 5H8NA 1IXIA 1B3LA 3FUZA 1B1HA 4MH5A 4OZ9A 4KD5A 3C32A 1P1UA 3U92A 4U4XA 3TTLA 2RF1A 2XXYA 1LAGE 2I58A 2Z8FA 2QS4A 3ZKLA 4OTEA 1OIBA 5CI5A 1HSLA 4XKRA 5A5XB 2NWJA 4XKNA 4YMAA 5CBSA 3D4GA 4HCYA 5ITPA 2QS3A 2QSXA 3OO8A 1M5BA 2PX1A 3FJMA 5HM4B 5H8HA 4G68A 4OMBA 4TQUQ 1LFGA 3FZVA 1B51A 3ZSFA 3IOUA 3RUMA 4EQ7A 1D4NA 1LSTA 1JQFA 3O6HA 4KYSA 1A8EA 2I4CA 4F2OA 1H44A 1NH8A 5H8FB 1EZ9A 2D21A 1Q1KA 1GGGA 4IB2A 5CMKA 3OEMA 2Q9TA 4N13A 4DXUA 4GVOA 5HBCA 4X9TA 1US4A 1URSA 5DYHA 5AA3A 3M3KA 2GH9A 3TAJA 5I58B 4GIZA 4L17A 3O2AA 3O28A 5KDTB 2DWIA 1EZOA 5H8QB 4U22A 2FNCA 1SYHA 4QFLA 2A5TA 3SETA 3JZJA 4NF8B 2KLFA 3HHFA 3Q26A 4U23A 2NXOA 3PMXA 3B6WA 2F8DA 3MP1A 5FHOA 4G8HA 1ZJLA 3Q29A 3ILUB 2RC7A 2OJTA 4I9DA 2R71A 4QSDA 3CFZA 5B70A 2I3VA 1MQJA 3ODBA 2NVUB 5I2KA 1QKAA 5CBRA 4IO3A 1TFDA 4TLMB 3VE1B 4KQPA 4ZE9A 1N0TA 1DOTA 2V3TA 1M5EA 4QRZA 4E0WA 3UN6A 3BFUA 3B6TA 4N07A 5JTYA 4DCYA 1FQEA 3HSTA 1D9YA 3C9HA 2F36A 1TT1A 3MPKA 4K3FA 4YKKA 1I69A 3RT6B 3H6TA 3Q27A 1XVYA 3FJ7A 1SBPA 1P1QA 2V84A 1M5FA 3HCQA 1PB9A 2O7UA 2E0SA 1D9VA 1QULA 2OZZA 3TKDA 4FE8A 4E0XA 3KN8A 3OO9A 1DPEA 2UYEA 1Y1ZA 1ELJA 4BDLA 3FD3A 4U2RA 1B3GA 4G8NA 1LBBA 2UVGA 5L8DA 5TPAB 2XD3A 3G3HA 2ONKE 1MPBA 3B7DA 3CRBA 3GZGA 1JEVA 3CI8A 3QUFA 1Z7NE 4GLIA 1R9QA 5I57A 3PPOA 3FVOA 3LSLA 4NWDA 1B5JA 1B05A 4BDMA 1FTMA 2RKMA 1ZU0A 3MZ9A 4H8IA 2DVCA 3O97A 1FQCA 1DPPA 2O69A 4DXBA 3MPLA 3E9XA 1UTHA 2R6GE 2W7YA 3K2DA 3H6VA 3N26A 1O7TA 3L6GA 1YCJA 4RK2A 4DLDA 2DXRA 2ZYOA 4AQ4A 1NNPA 4BDQA 2XXTA 1N3WA 2REJA 1I6QA 3I5OA 3H6WA 1N76A 1SYIA 2DSFA 4U1OA 4LUBA 1T0KA 3QSLA 1D3KA 1PDAA 2QRYA 3ZS6A 3H06B 3FXQA 1MDP1 1TXFA 2Z23A 4NF6B 3IB0A 5F1QA 4PETA 4Q0CA 2QPQA 1URGA 4FEBA 5ISUA 3VLUA 1IXGA 3K1PA 4IY6A 4ISUA 3IX1A 4ZZAA 3VVEA 1PC3A 1BP5A 2H99A 2RC9A 1B6HA 3EHUA 3BFTA 1NNFA 1JEUA 5TPAA 3TCGA 1LBCA 2XHDA 4AB6A 4UA8A 1RYXA 3DELB 1Y1MA 4I1DA 1WODA 4X48A 4IGRA 1A40A 3EPEA 3G3IA 2XX9A 4HTGA 1A54A 1POTA 2X7QA 5CC2A 1BKAA 4GXSB 2F78A 4N6PA 3PUYE 1QUIA 1B2HA 5I2NA 4IO4A 1PBQA 2YLNA 3RTWB 2PBWA 4DE8A 2XXRA 1JVYA 3TFLA 5H8NB 4F3GA 5I56A 3DP4A 4IY5A 1B4ZA 4F3BA 3SESA 5FHMA 5I84A 3O9PA 4JB7A 3TTKA 3SEYA 2X7PA 1P1OA 5DVJA 4EQ9A 4F19A 3FV1A 4H67A 4NTLA 4XKQA 2UYFA 3CR9A 4O3BA 1SW1A 3S4UA 2Q2CA 4EUOA 1I6AA 5B7DA 1LB8A 5L9SA 1B5IA 1ZLQA 1MH4A 4C1UA 2DWJA 4G68B 1N84A 4OFLA 1B46A 4H8JA 5K2YA 3U72A 1GR2A 1IIWA 1B1XA 3M8UA 2Y7PA 1A8FA 2NOOA 4YICA 1PEBA 4R72A 5DT6A 3V8XB 4XTCQ 4EF1A 1CE2A 1JW1A 1JETA 2I0CA 3FXUA 4HCWA 1IXCA 3FVNA 3MP8A 5CM6A 3MVZA 3VXBA 1OVBA 5DEXA 1CB6A 3QK6A 4OESA 2M8CA 5ICQA 4OHNA 4RA1A 2H9BA 3OELA 3PPRA 2D3IA 1ZBMA 2A5TB 1WDNA 3CIJA 4U4SA 2DE2A 4R6HA 5K2XA 2B3BA 2DWAA 3OXNA 3MZBA 4RK9A 4DXCA 2P0SA 3V83A 1SW2A 1ATGA 4BLAA 4JDFA 2XXPA 1M5DA 4NWCA 3PU5A 1B52A 1B3EA 5DVIA 3SKPA 3L6HA 3G3GA 3CSBA 4EF2A 5I2KB 3W15C 5L9MA 2ZMBA 1USYH 1MY1A 1BTJA 4P11A 3SEUA 2CMOA 3H03A 2P2AA 2Z8DA 4IO7A 1Y3QA 4ZDMA 4R73A 1MH3A 3SEVA 3UORA 4LA9A 2XXQA 4THIA 3C31A 4GWOA 1WVJA 2QMXA 5JTYB 1URDA 2VD3A 4YAHX 3PUWE 2XX7A 5AA4A 3WAFA 3TCHA 1AMFA 5DVFA 1FQDA 3K1MA 1MPDA 3K01A 3TZAA 1UIUA 2HZLA 4F2QA 1QUJA 3Q28A 1DTZA 2AIXA 4ELQA 4OETA 3I6VA 3IB1A 3U94A 1XOCA 3E4RA 3O6GA 3KOSA 3IO4A 1NMUA 4F3PA 1A7LA 3TYHA 3V5AA 4QHQA 4EXKA 3TDJA 4WXJA 1XHYA 3CVGA 5CMBA 1NFTA 1LCTA 1P1WA 4ELOA 2Z8EA 3IR1A 3W9VA 3U8QA 3MAMA 1NNTA 4R74A 4JSDA 3DM0A 5ELVA 3G3FA 3KEIA 4YKPA 3MVYA 4BDRA 3R6UA 1MQDA 2YPNA 1S7YA 5I57B 1B32A 1XVXA 2QMWA 2UVIA 1J1NA 4IO5A 3R7XA 1Y9UA 2RCBA 3C4MA 1SW4A 2PVUA 2A5SA 3RT8A 4QFKA 3T66A 2E1SA 1UTHB 3N5LA 1FW0A 4R9GA 1Z7ME 2QS1A 4P0IA 4WEPA 3VLVA 4F1UA 5ICTA 5FTHA 3JYRA 1H45A 1NNKA 3MWBA 3U93A 2AYSA 4FIMA 3W9WA 4ONYA 3T22A 3KN7A 4PFWA 5CMCA 3K00A 1SW5A 3MQ9A 1MS7A 4I62A 3OD7A 1MXYA 2I3WA 1FTLA 2O84X 3H4ZA 4ZEIA 4NF4A 2ZYMA 1YAEA 4OEVA 4JBZA 2HAVA 1Q35A 4PFYA 2RC8A 4MLQA 1MM7A 2REGA 3FVGA 4GRKA 4F18A 3S9MC 1Y20A 3PUXE 3HO7A 1ZIUA 4NF5B 4KCDA 1S9TA 2ONSA 1PB8A 3RNNA 3KG2A 3OSQA 4QSCA 3TTNA 4C0RA 3GBBA 3C34A 4M1VA 4M4GA 5ITOA 3OENA 2V3QA 5TP9A 3QAXA 3THIA 3PGFA 1MXXA 1XT8A 3CFXA 4UACA 4JXIA 4OFJA 1AL3A 3LSFB 3FGSA 3OOAA 5I2NB 4Q8RA 2ESNA 4ND9A 3IB2A 1MY0A 2QS2A 4YU0A 2DYXA 3H3GA 1ZTYA 3LC8A 4RY1A 5KCJA 4H65A 3FXRA 3T9XB 3DLNA 5I56B 3KGCA 3T93B 1NH7A 4MFIA 4HS7A 4WKMA 3ZKKA 2VOZA 1H3DA 3RGYA 2F34A 3TEPA 3BBRA 3SDFA 1EH3A 1EZPA 4ELPA 3UA8A 3K02A 4GL8A 3S9EA 4ZEBA 4XKPA 3MVXA 4RXLA 2O51A 4NF5A 5L9OA 3PPNA 3EHTA 3TPAA 3K0VA 4KCCA 2DOJA 4F29A 4ZEFA 3A09A 3V89B 3FVKA 3TQLA 2ZNUA 3IK6B 1SQYA 4R6KA 4PE5B 4KR5A 4F31B 1AOVA 3S9NC 3RLFE 3PMVA 3UP9A 2DVZA 4OXVA 4NE4A 4EXLA 3SEWA 1UTBA 1GTKA 3T96B 4MBPA 1SI0A 3KZGA 4KFQA 3K1NA 5DEXB 1SVXB 4GQOA 2HXWA 4DDDA 3K6VA 3TQWA 2HCAA 2G29A 3EQ1A 1MPCA 4FJPA 4H1XA 1M5CA 1FQFA 3IO6A 4YZZA 1KWHA 2UVHA 1R6ZA 3OO7A 1FTKA 4R2FA 1OLAA 4IO2A 2VD2A 4H0WA 3E13X 4FORA 3QXMA 4H5GA 2ANJA 3LSXA 2RCAA 4JSOA 4I8CA 3EF7A 3RTFB 3KJTA 2O68A 3F11A 3VV5A 3CFLA 3RPWA 5TU0A 4X1BA 1MXUA 4G2ZA 3VFJA 4MF3A 3WAEA 2XXWA 2GHAA 4FEDA 4XXUA 3QUJA 1UIVA 1DMBA 2OBGA 4R6YA 3C35A 3TELA 4LATA 2Y7KA 1HSEA 4AB5A 4H5FA 1MRPA 5BUUA 5LOMA 3C33A 5AA4B 3IJXB 1R9LA 1GV8A 3FASA 1TFAA 1IZ1A 1SI1A 2AL4A 1S50A 1MY2A 3IORA 4Q30B 2OCUA 3G3JA 1DTGA 2FYIA 3H7MA 1ZMGA 3VVDA 3TTRA 2QJEA 2Z22A 4GOTA 1XS5A 3VDFA 1BIYA 3PMWA 4LQ2A 3E3KA 2FA7A 1Y4CA 4NEDA 3LR1A 2UXAA 2GHBA 5HPQA 3IOWA 3DP6A 3T9UA 1QJMA 4GFRA 1OVTA 4DZ1A 5AA2A 2I48A 2I4BA 3KBRA 1MQGA 4U1ZA 2F6GA 2LAOA 2Y7RA 4Q5TA 3K6UA 1LAHE 1MXZA 2YJPA 1YPNA 4OFOA 3I3VA 2H4IA 1MQHA 1MXVA 4Z7EA 3OEKA 4QF9A 3N94A 4QFPA 4LZ5A 3C36A 2Q2AA 3TMGA 1QKBA 5IKBA 3KJ7A 3G7WA 4PFUA 3FIRA 1R1NA 1OMPA 3ONMA 3PUZE 2WKYA 2Y84A 1P99A 4LQ5A 2UVJA 2XXIA 3ECRA 3HPIA 1US5A 1VE4A 4GL0A 3TODA 3MJNA 4ZECA 4ZS9A 4ZEDA 3HV1A 3CSGA 2GFEA 1LLSA 1PB7A 3GBAA 1OQGA 1RKMA 3R26A 4NF4B 2V93A 2PT2A 3TTMA 4YB7A 5I59A 3MZ1A 4O3CA 3K6WA 5JEIA 5AA2D 3KSJA 1QVSA 1IQ7A 2F6PA 4X1DA 4OEUA 1RYOA 4R2BA 4BDNA 3T9VA 3KFMA 4YB6A 3IOVA 2F5XA 5AA1A 3PUVE 4LZ7A 3FATA 3CG1A 5TP9B 4ESWA 4F1VA 5A5XA 4OENA 1JW5A 1Y4TA 4POWA 2OK2A 4DIGA 1A55A 1MG1A 4LONB 1HSJA 1NKXA 2IA4A 4YKIA 2H5YA 2DS9A 1B7ZA 5AE4A 1B7UA 4RYAA 1USYE 2R9JA 5F7VA 3UGWA 2F7AA 2IEEA 3SERA 4OVJA 2AL5A 2VGQA 1LFHA 4JWYA 4ESXA 1ZKBA 3ILTB 1MQIA 3P7IA 4OERA 4G8MA 3KN3A 4GF8A 3PV0E 5KCJB 3O29A 1B0LA 1Y3PA 1UQWA 3KOTA 3D4CA 5H8FA 3N6UA 3QYTA 4ZE8A 1I6BA 4KI0E 4RJZA 4ECFA 2I49A 3PPQA 3LSWA 1FQBA 2XXXA 4QSEA 3PD9A 5I58A 3JV9A 1JVXA 4ZEKA 4C1TA 1QUKA 3FJGA 2V25A 5KDTA 1IUDA 3IAZA 2B65A 4MLVA 4KHZE 4TOZA 5H8QA 3S9LC 2Q89A 1LFIA 4YB5A 4ELRA 1H43A 2HFBA 2Q8JA 3OMBA 1JNFA 2DXYA 3K4UA 1FTJA 4JWOA 4NF8A 3S2VA 2ZNSA 3HHGA 2QL3A 2DQVA 2O1MA 1IITA 4RPOA 3OO6A 3OSRA 4P0GA 3MBPA 1F9BA 3KSXA 1MXWA 2G93A 1B0HA 1B40A 1B4HA 2OWSA 2F7BA 5CMMA 4R9FA 3EN3A 3M3LA 4XIGQ 1UTBB 4F22A 3IOTA 2Y7IA 3Q25A 4LZ8A 5JK4A 3RN8A 1VSOA 2ABHA 1OQHA 4KYDA 4TLLB 3K6XA 4O3AA 4EDPA 4FECA 1B3HA 2H25A 1LB9A 3IL1B 3VLWA 4H6DA 3O6IA 1B7HA 1B5HA 3TCFA 3PD8A 4FAJA 3BKIB 1JW4A 3VXCA 5FHNA 4IO6A 2DE3A 4RNSA 3RY3A 4QFOA 1FTOA 4QFNA 4PFTA 3UIFA 1FQAA 2NUVA 1MY4A 4G68C 4Z0IA 4JWXA 4KYEA 2V3UA 2P1SA 1AH5A 4OQOA 2O6AA 5BWJA 1N04A 3DP8A 4WEDA 3MVWA 2GRVA 3A3CA 3M3FA 2HQ0A 4OWDA 3LUYA 1BLFA 4NMYA 4PQJA 1EU8A 3UK4A 5EHMA 2XXVA 5DTBA 1Y3NA 3VVFA 3LBSA 3MP6A 2PMSA 1B3FA 4ZZEA 4LVQA 4F1YA 2OWTA 2XX8A 3GLBA 4F3SA 4KPTA 5EYFA 4G4PA 2X26A 5J1DA 1A99A 2DE4A 2HEUA 1B9JA 2XXUA 2HAUA 3HN0A 4U21A 1N7XA 2I0BA 4YMBA 2OLBA 1IXHA 2F97A 3EHSA 3B6QA 2PYYA 1POY1 3U1OA 3RQTA 4BDOA 2ALUA 4IGTA 1PBPA 3SEXA 5IAIA 1O64A 3T9HB 3MC2A 4FATA 4EQBA 3AXFA 1XC1A 2PT1A 1VFEA 4GXAA 2CZLA 5CRYA 2ONRA 1SDXA 1IEJA 5AA2B 2B3FA 1SD3A 4RPNA 1MY3A 3QIMA 1DSNA 4NF6A 3TUSA 2I6EA 3N6TA 1FCKA 2VHAA 5EHSA 1NL5A 1LCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3USD A;  3H6U A;  2Q88 A;  2ZXT A;  1AIV A;  4DCX A;  1LAF E;  5KZT A;  5H8H B;  2HZK A;  1LGB C;  2O1L A;  5H8S A;  3A3U A;  2DWH A;  1YTV A;  3IJO B;  4PP0 A;  2THI A;  2DP8 A;  4HW8 A;  1N3X A;  4GD5 A;  1MDQ A;  1N7W A;  4LP2 B;  1ANF A;  3PPP A;  3G3K A;  2BJJ X;  1O63 A;  1P1N A;  1OLC A;  1QW0 A;  1LAX A;  2RIN A;  5FTI A;  2ZYK A;  2XXH A;  4G77 A;  2XD2 A;  1B58 A;  4R75 A;  2ZNT A;  1II5 A;  3O66 A;  3MUQ A;  5M2V A;  3CG3 A;  4OYV A;  1VR5 A;  2VP1 A;  4YKJ A;  4POX A;  2O7I A;  1H76 A;  2ZYN A;  2F35 A;  2H98 A;  1TWY A;  1VFD A;  3MW0 A;  2F7C A;  1L5T A;  5I59 B;  2Y7W A;  3GXA A;  2D5W A;  3FV2 A;  1MM6 A;  4F39 A;  1GVC A;  5H8N A;  1IXI A;  1B3L A;  3FUZ A;  1B1H A;  4MH5 A;  4OZ9 A;  4KD5 A;  3C32 A;  1P1U A;  3U92 A;  4U4X A;  3TTL A;  2RF1 A;  2XXY A;  1LAG E;  2I58 A;  2Z8F A;  2QS4 A;  3ZKL A;  4OTE A;  1OIB A;  5CI5 A;  1HSL A;  4XKR A;  5A5X B;  2NWJ A;  4XKN A;  4YMA A;  5CBS A;  3D4G A;  4HCY A;  5ITP A;  2QS3 A;  2QSX A;  3OO8 A;  1M5B A;  2PX1 A;  3FJM A;  5HM4 B;  5H8H A;  4G68 A;  4OMB A;  4TQU Q;  1LFG A;  3FZV A;  1B51 A;  3ZSF A;  3IOU A;  3RUM A;  4EQ7 A;  1D4N A;  1LST A;  1JQF A;  3O6H A;  4KYS A;  1A8E A;  2I4C A;  4F2O A;  1H44 A;  1NH8 A;  5H8F B;  1EZ9 A;  2D21 A;  1Q1K A;  1GGG A;  4IB2 A;  5CMK A;  3OEM A;  2Q9T A;  4N13 A;  4DXU A;  4GVO A;  5HBC A;  4X9T A;  1US4 A;  1URS A;  5DYH A;  5AA3 A;  3M3K A;  2GH9 A;  3TAJ A;  5I58 B;  4GIZ A;  4L17 A;  3O2A A;  3O28 A;  5KDT B;  2DWI A;  1EZO A;  5H8Q B;  4U22 A;  2FNC A;  1SYH A;  4QFL A;  2A5T A;  3SET A;  3JZJ A;  4NF8 B;  2KLF A;  3HHF A;  3Q26 A;  4U23 A;  2NXO A;  3PMX A;  3B6W A;  2F8D A;  3MP1 A;  5FHO A;  4G8H A;  1ZJL A;  3Q29 A;  3ILU B;  2RC7 A;  2OJT A;  4I9D A;  2R71 A;  4QSD A;  3CFZ A;  5B70 A;  2I3V A;  1MQJ A;  3ODB A;  2NVU B;  5I2K A;  1QKA A;  5CBR A;  4IO3 A;  1TFD A;  4TLM B;  3VE1 B;  4KQP A;  4ZE9 A;  1N0T A;  1DOT A;  2V3T A;  1M5E A;  4QRZ A;  4E0W A;  3UN6 A;  3BFU A;  3B6T A;  4N07 A;  5JTY A;  4DCY A;  1FQE A;  3HST A;  1D9Y A;  3C9H A;  2F36 A;  1TT1 A;  3MPK A;  4K3F A;  4YKK A;  1I69 A;  3RT6 B;  3H6T A;  3Q27 A;  1XVY A;  3FJ7 A;  1SBP A;  1P1Q A;  2V84 A;  1M5F A;  3HCQ A;  1PB9 A;  2O7U A;  2E0S A;  1D9V A;  1QUL A;  2OZZ A;  3TKD A;  4FE8 A;  4E0X A;  3KN8 A;  3OO9 A;  1DPE A;  2UYE A;  1Y1Z A;  1ELJ A;  4BDL A;  3FD3 A;  4U2R A;  1B3G A;  4G8N A;  1LBB A;  2UVG A;  5L8D A;  5TPA B;  2XD3 A;  3G3H A;  2ONK E;  1MPB A;  3B7D A;  3CRB A;  3GZG A;  1JEV A;  3CI8 A;  3QUF A;  1Z7N E;  4GLI A;  1R9Q A;  5I57 A;  3PPO A;  3FVO A;  3LSL A;  4NWD A;  1B5J A;  1B05 A;  4BDM A;  1FTM A;  2RKM A;  1ZU0 A;  3MZ9 A;  4H8I A;  2DVC A;  3O97 A;  1FQC A;  1DPP A;  2O69 A;  4DXB A;  3MPL A;  3E9X A;  1UTH A;  2R6G E;  2W7Y A;  3K2D A;  3H6V A;  3N26 A;  1O7T A;  3L6G A;  1YCJ A;  4RK2 A;  4DLD A;  2DXR A;  2ZYO A;  4AQ4 A;  1NNP A;  4BDQ A;  2XXT A;  1N3W A;  2REJ A;  1I6Q A;  3I5O A;  3H6W A;  1N76 A;  1SYI A;  2DSF A;  4U1O A;  4LUB A;  1T0K A;  3QSL A;  1D3K A;  1PDA A;  2QRY A;  3ZS6 A;  3H06 B;  3FXQ A;  1MDP 1;  1TXF A;  2Z23 A;  4NF6 B;  3IB0 A;  5F1Q A;  4PET A;  4Q0C A;  2QPQ A;  1URG A;  4FEB A;  5ISU A;  3VLU A;  1IXG A;  3K1P A;  4IY6 A;  4ISU A;  3IX1 A;  4ZZA A;  3VVE A;  1PC3 A;  1BP5 A;  2H99 A;  2RC9 A;  1B6H A;  3EHU A;  3BFT A;  1NNF A;  1JEU A;  5TPA A;  3TCG A;  1LBC A;  2XHD A;  4AB6 A;  4UA8 A;  1RYX A;  3DEL B;  1Y1M A;  4I1D A;  1WOD A;  4X48 A;  4IGR A;  1A40 A;  3EPE A;  3G3I A;  2XX9 A;  4HTG A;  1A54 A;  1POT A;  2X7Q A;  5CC2 A;  1BKA A;  4GXS B;  2F78 A;  4N6P A;  3PUY E;  1QUI A;  1B2H A;  5I2N A;  4IO4 A;  1PBQ A;  2YLN A;  3RTW B;  2PBW A;  4DE8 A;  2XXR A;  1JVY A;  3TFL A;  5H8N B;  4F3G A;  5I56 A;  3DP4 A;  4IY5 A;  1B4Z A;  4F3B A;  3SES A;  5FHM A;  5I84 A;  3O9P A;  4JB7 A;  3TTK A;  3SEY A;  2X7P A;  1P1O A;  5DVJ A;  4EQ9 A;  4F19 A;  3FV1 A;  4H67 A;  4NTL A;  4XKQ A;  2UYF A;  3CR9 A;  4O3B A;  1SW1 A;  3S4U A;  2Q2C A;  4EUO A;  1I6A A;  5B7D A;  1LB8 A;  5L9S A;  1B5I A;  1ZLQ A;  1MH4 A;  4C1U A;  2DWJ A;  4G68 B;  1N84 A;  4OFL A;  1B46 A;  4H8J A;  5K2Y A;  3U72 A;  1GR2 A;  1IIW A;  1B1X A;  3M8U A;  2Y7P A;  1A8F A;  2NOO A;  4YIC A;  1PEB A;  4R72 A;  5DT6 A;  3V8X B;  4XTC Q;  4EF1 A;  1CE2 A;  1JW1 A;  1JET A;  2I0C A;  3FXU A;  4HCW A;  1IXC A;  3FVN A;  3MP8 A;  5CM6 A;  3MVZ A;  3VXB A;  1OVB A;  5DEX A;  1CB6 A;  3QK6 A;  4OES A;  2M8C A;  5ICQ A;  4OHN A;  4RA1 A;  2H9B A;  3OEL A;  3PPR A;  2D3I A;  1ZBM A;  2A5T B;  1WDN A;  3CIJ A;  4U4S A;  2DE2 A;  4R6H A;  5K2X A;  2B3B A;  2DWA A;  3OXN A;  3MZB A;  4RK9 A;  4DXC A;  2P0S A;  3V83 A;  1SW2 A;  1ATG A;  4BLA A;  4JDF A;  2XXP A;  1M5D A;  4NWC A;  3PU5 A;  1B52 A;  1B3E A;  5DVI A;  3SKP A;  3L6H A;  3G3G A;  3CSB A;  4EF2 A;  5I2K B;  3W15 C;  5L9M A;  2ZMB A;  1USY H;  1MY1 A;  1BTJ A;  4P11 A;  3SEU A;  2CMO A;  3H03 A;  2P2A A;  2Z8D A;  4IO7 A;  1Y3Q A;  4ZDM A;  4R73 A;  1MH3 A;  3SEV A;  3UOR A;  4LA9 A;  2XXQ A;  4THI A;  3C31 A;  4GWO A;  1WVJ A;  2QMX A;  5JTY B;  1URD A;  2VD3 A;  4YAH X;  3PUW E;  2XX7 A;  5AA4 A;  3WAF A;  3TCH A;  1AMF A;  5DVF A;  1FQD A;  3K1M A;  1MPD A;  3K01 A;  3TZA A;  1UIU A;  2HZL A;  4F2Q A;  1QUJ A;  3Q28 A;  1DTZ A;  2AIX A;  4ELQ A;  4OET A;  3I6V A;  3IB1 A;  3U94 A;  1XOC A;  3E4R A;  3O6G A;  3KOS A;  3IO4 A;  1NMU A;  4F3P A;  1A7L A;  3TYH A;  3V5A A;  4QHQ A;  4EXK A;  3TDJ A;  4WXJ A;  1XHY A;  3CVG A;  5CMB A;  1NFT A;  1LCT A;  1P1W A;  4ELO A;  2Z8E A;  3IR1 A;  3W9V A;  3U8Q A;  3MAM A;  1NNT A;  4R74 A;  4JSD A;  3DM0 A;  5ELV A;  3G3F A;  3KEI A;  4YKP A;  3MVY A;  4BDR A;  3R6U A;  1MQD A;  2YPN A;  1S7Y A;  5I57 B;  1B32 A;  1XVX A;  2QMW A;  2UVI A;  1J1N A;  4IO5 A;  3R7X A;  1Y9U A;  2RCB A;  3C4M A;  1SW4 A;  2PVU A;  2A5S A;  3RT8 A;  4QFK A;  3T66 A;  2E1S A;  1UTH B;  3N5L A;  1FW0 A;  4R9G A;  1Z7M E;  2QS1 A;  4P0I A;  4WEP A;  3VLV A;  4F1U A;  5ICT A;  5FTH A;  3JYR A;  1H45 A;  1NNK A;  3MWB A;  3U93 A;  2AYS A;  4FIM A;  3W9W A;  4ONY A;  3T22 A;  3KN7 A;  4PFW A;  5CMC A;  3K00 A;  1SW5 A;  3MQ9 A;  1MS7 A;  4I62 A;  3OD7 A;  1MXY A;  2I3W A;  1FTL A;  2O84 X;  3H4Z A;  4ZEI A;  4NF4 A;  2ZYM A;  1YAE A;  4OEV A;  4JBZ A;  2HAV A;  1Q35 A;  4PFY A;  2RC8 A;  4MLQ A;  1MM7 A;  2REG A;  3FVG A;  4GRK A;  4F18 A;  3S9M C;  1Y20 A;  3PUX E;  3HO7 A;  1ZIU A;  4NF5 B;  4KCD A;  1S9T A;  2ONS A;  1PB8 A;  3RNN A;  3KG2 A;  3OSQ A;  4QSC A;  3TTN A;  4C0R A;  3GBB A;  3C34 A;  4M1V A;  4M4G A;  5ITO A;  3OEN A;  2V3Q A;  5TP9 A;  3QAX A;  3THI A;  3PGF A;  1MXX A;  1XT8 A;  3CFX A;  4UAC A;  4JXI A;  4OFJ A;  1AL3 A;  3LSF B;  3FGS A;  3OOA A;  5I2N B;  4Q8R A;  2ESN A;  4ND9 A;  3IB2 A;  1MY0 A;  2QS2 A;  4YU0 A;  2DYX A;  3H3G A;  1ZTY A;  3LC8 A;  4RY1 A;  5KCJ A;  4H65 A;  3FXR A;  3T9X B;  3DLN A;  5I56 B;  3KGC A;  3T93 B;  1NH7 A;  4MFI A;  4HS7 A;  4WKM A;  3ZKK A;  2VOZ A;  1H3D A;  3RGY A;  2F34 A;  3TEP A;  3BBR A;  3SDF A;  1EH3 A;  1EZP A;  4ELP A;  3UA8 A;  3K02 A;  4GL8 A;  3S9E A;  4ZEB A;  4XKP A;  3MVX A;  4RXL A;  2O51 A;  4NF5 A;  5L9O A;  3PPN A;  3EHT A;  3TPA A;  3K0V A;  4KCC A;  2DOJ A;  4F29 A;  4ZEF A;  3A09 A;  3V89 B;  3FVK A;  3TQL A;  2ZNU A;  3IK6 B;  1SQY A;  4R6K A;  4PE5 B;  4KR5 A;  4F31 B;  1AOV A;  3S9N C;  3RLF E;  3PMV A;  3UP9 A;  2DVZ A;  4OXV A;  4NE4 A;  4EXL A;  3SEW A;  1UTB A;  1GTK A;  3T96 B;  4MBP A;  1SI0 A;  3KZG A;  4KFQ A;  3K1N A;  5DEX B;  1SVX B;  4GQO A;  2HXW A;  4DDD A;  3K6V A;  3TQW A;  2HCA A;  2G29 A;  3EQ1 A;  1MPC A;  4FJP A;  4H1X A;  1M5C A;  1FQF A;  3IO6 A;  4YZZ A;  1KWH A;  2UVH A;  1R6Z A;  3OO7 A;  1FTK A;  4R2F A;  1OLA A;  4IO2 A;  2VD2 A;  4H0W A;  3E13 X;  4FOR A;  3QXM A;  4H5G A;  2ANJ A;  3LSX A;  2RCA A;  4JSO A;  4I8C A;  3EF7 A;  3RTF B;  3KJT A;  2O68 A;  3F11 A;  3VV5 A;  3CFL A;  3RPW A;  5TU0 A;  4X1B A;  1MXU A;  4G2Z A;  3VFJ A;  4MF3 A;  3WAE A;  2XXW A;  2GHA A;  4FED A;  4XXU A;  3QUJ A;  1UIV A;  1DMB A;  2OBG A;  4R6Y A;  3C35 A;  3TEL A;  4LAT A;  2Y7K A;  1HSE A;  4AB5 A;  4H5F A;  1MRP A;  5BUU A;  5LOM A;  3C33 A;  5AA4 B;  3IJX B;  1R9L A;  1GV8 A;  3FAS A;  1TFA A;  1IZ1 A;  1SI1 A;  2AL4 A;  1S50 A;  1MY2 A;  3IOR A;  4Q30 B;  2OCU A;  3G3J A;  1DTG A;  2FYI A;  3H7M A;  1ZMG A;  3VVD A;  3TTR A;  2QJE A;  2Z22 A;  4GOT A;  1XS5 A;  3VDF A;  1BIY A;  3PMW A;  4LQ2 A;  3E3K A;  2FA7 A;  1Y4C A;  4NED A;  3LR1 A;  2UXA A;  2GHB A;  5HPQ A;  3IOW A;  3DP6 A;  3T9U A;  1QJM A;  4GFR A;  1OVT A;  4DZ1 A;  5AA2 A;  2I48 A;  2I4B A;  3KBR A;  1MQG A;  4U1Z A;  2F6G A;  2LAO A;  2Y7R A;  4Q5T A;  3K6U A;  1LAH E;  1MXZ A;  2YJP A;  1YPN A;  4OFO A;  3I3V A;  2H4I A;  1MQH A;  1MXV A;  4Z7E A;  3OEK A;  4QF9 A;  3N94 A;  4QFP A;  4LZ5 A;  3C36 A;  2Q2A A;  3TMG A;  1QKB A;  5IKB A;  3KJ7 A;  3G7W A;  4PFU A;  3FIR A;  1R1N A;  1OMP A;  3ONM A;  3PUZ E;  2WKY A;  2Y84 A;  1P99 A;  4LQ5 A;  2UVJ A;  2XXI A;  3ECR A;  3HPI A;  1US5 A;  1VE4 A;  4GL0 A;  3TOD A;  3MJN A;  4ZEC A;  4ZS9 A;  4ZED A;  3HV1 A;  3CSG A;  2GFE A;  1LLS A;  1PB7 A;  3GBA A;  1OQG A;  1RKM A;  3R26 A;  4NF4 B;  2V93 A;  2PT2 A;  3TTM A;  4YB7 A;  5I59 A;  3MZ1 A;  4O3C A;  3K6W A;  5JEI A;  5AA2 D;  3KSJ A;  1QVS A;  1IQ7 A;  2F6P A;  4X1D A;  4OEU A;  1RYO A;  4R2B A;  4BDN A;  3T9V A;  3KFM A;  4YB6 A;  3IOV A;  2F5X A;  5AA1 A;  3PUV E;  4LZ7 A;  3FAT A;  3CG1 A;  5TP9 B;  4ESW A;  4F1V A;  5A5X A;  4OEN A;  1JW5 A;  1Y4T A;  4POW A;  2OK2 A;  4DIG A;  1A55 A;  1MG1 A;  4LON B;  1HSJ A;  1NKX A;  2IA4 A;  4YKI A;  2H5Y A;  2DS9 A;  1B7Z A;  5AE4 A;  1B7U A;  4RYA A;  1USY E;  2R9J A;  5F7V A;  3UGW A;  2F7A A;  2IEE A;  3SER A;  4OVJ A;  2AL5 A;  2VGQ A;  1LFH A;  4JWY A;  4ESX A;  1ZKB A;  3ILT B;  1MQI A;  3P7I A;  4OER A;  4G8M A;  3KN3 A;  4GF8 A;  3PV0 E;  5KCJ B;  3O29 A;  1B0L A;  1Y3P A;  1UQW A;  3KOT A;  3D4C A;  5H8F A;  3N6U A;  3QYT A;  4ZE8 A;  1I6B A;  4KI0 E;  4RJZ A;  4ECF A;  2I49 A;  3PPQ A;  3LSW A;  1FQB A;  2XXX A;  4QSE A;  3PD9 A;  5I58 A;  3JV9 A;  1JVX A;  4ZEK A;  4C1T A;  1QUK A;  3FJG A;  2V25 A;  5KDT A;  1IUD A;  3IAZ A;  2B65 A;  4MLV A;  4KHZ E;  4TOZ A;  5H8Q A;  3S9L C;  2Q89 A;  1LFI A;  4YB5 A;  4ELR A;  1H43 A;  2HFB A;  2Q8J A;  3OMB A;  1JNF A;  2DXY A;  3K4U A;  1FTJ A;  4JWO A;  4NF8 A;  3S2V A;  2ZNS A;  3HHG A;  2QL3 A;  2DQV A;  2O1M A;  1IIT A;  4RPO A;  3OO6 A;  3OSR A;  4P0G A;  3MBP A;  1F9B A;  3KSX A;  1MXW A;  2G93 A;  1B0H A;  1B40 A;  1B4H A;  2OWS A;  2F7B A;  5CMM A;  4R9F A;  3EN3 A;  3M3L A;  4XIG Q;  1UTB B;  4F22 A;  3IOT A;  2Y7I A;  3Q25 A;  4LZ8 A;  5JK4 A;  3RN8 A;  1VSO A;  2ABH A;  1OQH A;  4KYD A;  4TLL B;  3K6X A;  4O3A A;  4EDP A;  4FEC A;  1B3H A;  2H25 A;  1LB9 A;  3IL1 B;  3VLW A;  4H6D A;  3O6I A;  1B7H A;  1B5H A;  3TCF A;  3PD8 A;  4FAJ A;  3BKI B;  1JW4 A;  3VXC A;  5FHN A;  4IO6 A;  2DE3 A;  4RNS A;  3RY3 A;  4QFO A;  1FTO A;  4QFN A;  4PFT A;  3UIF A;  1FQA A;  2NUV A;  1MY4 A;  4G68 C;  4Z0I A;  4JWX A;  4KYE A;  2V3U A;  2P1S A;  1AH5 A;  4OQO A;  2O6A A;  5BWJ A;  1N04 A;  3DP8 A;  4WED A;  3MVW A;  2GRV A;  3A3C A;  3M3F A;  2HQ0 A;  4OWD A;  3LUY A;  1BLF A;  4NMY A;  4PQJ A;  1EU8 A;  3UK4 A;  5EHM A;  2XXV A;  5DTB A;  1Y3N A;  3VVF A;  3LBS A;  3MP6 A;  2PMS A;  1B3F A;  4ZZE A;  4LVQ A;  4F1Y A;  2OWT A;  2XX8 A;  3GLB A;  4F3S A;  4KPT A;  5EYF A;  4G4P A;  2X26 A;  5J1D A;  1A99 A;  2DE4 A;  2HEU A;  1B9J A;  2XXU A;  2HAU A;  3HN0 A;  4U21 A;  1N7X A;  2I0B A;  4YMB A;  2OLB A;  1IXH A;  2F97 A;  3EHS A;  3B6Q A;  2PYY A;  1POY 1;  3U1O A;  3RQT A;  4BDO A;  2ALU A;  4IGT A;  1PBP A;  3SEX A;  5IAI A;  1O64 A;  3T9H B;  3MC2 A;  4FAT A;  4EQB A;  3AXF A;  1XC1 A;  2PT1 A;  1VFE A;  4GXA A;  2CZL A;  5CRY A;  2ONR A;  1SDX A;  1IEJ A;  5AA2 B;  2B3F A;  1SD3 A;  4RPN A;  1MY3 A;  3QIM A;  1DSN A;  4NF6 A;  3TUS A;  2I6E A;  3N6T A;  1FCK A;  2VHA A;  5EHS A;  1NL5 A;  1LCF A; 
#chains in the Genus database with same CATH topology
 3USD A;  4PTK A;  4OVT A;  3H6U A;  2Q88 A;  2ZXT A;  1AIV A;  4DCX A;  2PFY A;  1LAF E;  5KZT A;  5H8H B;  2HZK A;  1LGB C;  2O1L A;  5H8S A;  3A3U A;  2DWH A;  4QBA A;  1YTV A;  3IJO B;  4PP0 A;  2THI A;  2DP8 A;  4HW8 A;  1N3X A;  4PDH A;  2FBP A;  4MAG A;  4GD5 A;  1MDQ A;  1N7W A;  4LP2 B;  1ANF A;  3PPP A;  4UAB A;  2F3B A;  2BJJ X;  1O63 A;  1P1N A;  1OLC A;  1QW0 A;  3G3K A;  1LAX A;  2RIN A;  5FTI A;  2ZYK A;  2XXH A;  4G77 A;  2XD2 A;  1B58 A;  4R75 A;  1RDZ A;  3PTY A;  2ZNT A;  1II5 A;  3O66 A;  3MUQ A;  5M2V A;  3CG3 A;  4OYV A;  1VR5 A;  2VP1 A;  5ESY A;  4YKJ A;  4POX A;  2O7I A;  1H76 A;  2ZYN A;  2F35 A;  2H98 A;  1TWY A;  1VFD A;  3MW0 A;  2F7C A;  1L5T A;  5I59 B;  2Y7W A;  3GXA A;  2D5W A;  3FV2 A;  1MM6 A;  4F39 A;  1KA0 A;  2QVR A;  1GVC A;  5H8N A;  1IXI A;  1B3L A;  3FUZ A;  1B1H A;  4MH5 A;  4OZ9 A;  4KD5 A;  3C32 A;  1P1U A;  5IGA A;  3U92 A;  3RPL A;  4U4X A;  3TTL A;  2RF1 A;  2XXY A;  4PFB A;  1LAG E;  2I58 A;  2Z8F A;  2QS4 A;  3ZKL A;  4JVI A;  4OTE A;  1OIB A;  4P56 A;  4GWU A;  5CI5 A;  1HSL A;  4XKR A;  5A5X B;  2NWJ A;  4XKN A;  4YMA A;  5CBS A;  2XWK A;  3D4G A;  1IMB A;  4HCY A;  4PAI A;  5ITP A;  1NV7 A;  2QS3 A;  2QSX A;  3OO8 A;  1M5B A;  2PX1 A;  3FJM A;  5HM4 B;  5H8H A;  4G68 A;  1FPF A;  4OMB A;  4TQU Q;  1LFG A;  3FZV A;  1B51 A;  3ZSF A;  3IOU A;  3RUM A;  4EQ7 A;  1D4N A;  1LST A;  1JQF A;  1LBV A;  3O6H A;  4KYS A;  1A8E A;  2I4C A;  4OVQ A;  4F2O A;  1H44 A;  5LDZ A;  1XI6 A;  1NH8 A;  5H8F B;  1EZ9 A;  2D21 A;  1Q1K A;  1GGG A;  4IB2 A;  5CMK A;  3OEM A;  2Q9T A;  1FTA A;  4N13 A;  4DXU A;  4GVO A;  5HBC A;  4X9T A;  1US4 A;  3ISP A;  1FBF A;  1FPB A;  1DK4 A;  1URS A;  5DYH A;  5AA3 A;  3M3K A;  2GH9 A;  3TAJ A;  5I58 B;  4GIZ A;  4L17 A;  3O2A A;  3O28 A;  5KDT B;  2DWI A;  1EZO A;  5H8Q B;  4X8R A;  4U22 A;  4G61 A;  1JP4 A;  2FNC A;  1SYH A;  4OVR A;  3BIH A;  5IZZ A;  4QFL A;  2A5T A;  3SET A;  3JZJ A;  4NF8 B;  2KLF A;  3HHF A;  3Q26 A;  4U23 A;  2NXO A;  3PMX A;  4O94 A;  3B6W A;  1SPI A;  2F8D A;  3MP1 A;  5FHO A;  4G8H A;  5I3S A;  1ZJL A;  3Q29 A;  3ILU B;  2RC7 A;  2OJT A;  4I9D A;  2R71 A;  4N15 A;  2XXK A;  4QSD A;  3CFZ A;  4NGU A;  4P1E A;  4X04 A;  5B70 A;  2I3V A;  1MQJ A;  3ODB A;  2NVU B;  5I2K A;  1QKA A;  4AS4 A;  5CBR A;  4IO3 A;  1TFD A;  4TLM B;  2HHM A;  3VE1 B;  4KQP A;  4ZE9 A;  1N0T A;  1DOT A;  1LBW A;  2V3T A;  1M5E A;  4QRZ A;  4E0W A;  3UN6 A;  3BFU A;  1FBH A;  2HXR A;  3B6T A;  4N07 A;  3SZP A;  5JTY A;  4DCY A;  1FQE A;  3HST A;  1D9Y A;  3C9H A;  2F36 A;  3KBZ A;  1TT1 A;  3MPK A;  1FBC A;  4K3F A;  4YKK A;  1I69 A;  3RT6 B;  4QXD A;  3H6T A;  3Q27 A;  1XVY A;  3FJ7 A;  1SBP A;  1P1Q A;  2V84 A;  1M5F A;  4N8G A;  3HCQ A;  1PB9 A;  2O7U A;  2E0S A;  1D9V A;  1QUL A;  1QGX A;  2OZZ A;  3TKD A;  4FE8 A;  2Q8M A;  2WYK A;  4E0X A;  3KN8 A;  4IR8 A;  3OO9 A;  1DPE A;  2UYE A;  1Y1Z A;  1ELJ A;  4BDL A;  3FD3 A;  4U2R A;  1G0H A;  1B3G A;  1LBZ A;  1DBZ A;  4G8N A;  1LBB A;  4MMP A;  2UVG A;  5L8D A;  1DCU A;  4N6K A;  2XD3 A;  3G3H A;  3GZG A;  2ONK E;  1MPB A;  3B7D A;  3CRB A;  5TPA B;  4HXV A;  1JEV A;  3CI8 A;  3QUF A;  1Z7N E;  4GLI A;  3T0J A;  1R9Q A;  5I57 A;  1FPE A;  3PPO A;  3FVO A;  3LSL A;  4NWD A;  1B5J A;  1B05 A;  4BDM A;  1FTM A;  2RKM A;  1ZU0 A;  3MZ9 A;  4H8I A;  2DVC A;  3O97 A;  1FQC A;  1DPP A;  2O69 A;  2ZZW A;  4DXB A;  1FBP A;  3MPL A;  3E9X A;  1UTH A;  3LV0 A;  2R6G E;  2W7Y A;  3K2D A;  5IZ3 B;  3H6V A;  3N26 A;  1O7T A;  3L6G A;  1YCJ A;  4RK2 A;  4DLD A;  2DXR A;  2ZYO A;  4AQ4 A;  1NNP A;  4BDQ A;  2XXT A;  1N3W A;  2REJ A;  1I6Q A;  3I5O A;  3H6W A;  1N76 A;  1SYI A;  2DSF A;  4U1O A;  4LUB A;  1T0K A;  3QSL A;  1D3K A;  4NN3 A;  1PDA A;  2QRY A;  3ZS6 A;  3H06 B;  3EKI A;  3FXQ A;  1MDP 1;  3RYD A;  1TXF A;  2Z23 A;  1NV4 A;  4NF6 B;  3IB0 A;  5F1Q A;  4PET A;  4Q0C A;  2QPQ A;  1URG A;  4FEB A;  5ISU A;  3VLU A;  1IXG A;  3K1P A;  4PCD A;  4IY6 A;  4ISU A;  3IX1 A;  4ZZA A;  3VVE A;  1PC3 A;  1BP5 A;  1KZ8 A;  2H99 A;  2RC9 A;  1B6H A;  3EHU A;  3BFT A;  1NNF A;  1JEU A;  5TPA A;  3TCG A;  1LBC A;  2XHD A;  5ET5 A;  4AB6 A;  4UA8 A;  1RYX A;  3DEL B;  1Y1M A;  4I1D A;  1WOD A;  4X48 A;  4IGR A;  5I7I A;  1A40 A;  3EPE A;  2CZK A;  3G3I A;  3E78 A;  2XX9 A;  4HE1 A;  4HTG A;  1A54 A;  1POT A;  2X7Q A;  5CC2 A;  3A29 A;  1BKA A;  4GXS B;  2F78 A;  4N6P A;  3PUY E;  1QUI A;  1B2H A;  5I2N A;  4IO4 A;  1PBQ A;  2YLN A;  5EQ9 A;  3RTW B;  2PBW A;  4DE8 A;  2XXR A;  1JVY A;  3TFL A;  5H8N B;  4F3G A;  5I56 A;  3DP4 A;  4IY5 A;  1B4Z A;  4F3B A;  1RDX A;  3SES A;  5FHM A;  5I84 A;  3RPL B;  2XWI A;  3O9P A;  4JB7 A;  3TTK A;  1Q9D A;  2X7P A;  3SEY A;  1P1O A;  5DVJ A;  4EQ9 A;  4F19 A;  3FV1 A;  4H67 A;  1LEV A;  4NTL A;  4XKQ A;  2UYF A;  1FPK A;  3CR9 A;  1SW1 A;  3KC0 A;  4O3B A;  3S4U A;  2Q2C A;  3MST A;  2VPN A;  4EUO A;  1I6A A;  1K9Z A;  5B7D A;  1LB8 A;  5L9S A;  1B5I A;  4MNP A;  1ZLQ A;  1MH4 A;  4C1U A;  2DWJ A;  4XF5 A;  4G68 B;  1FJ6 A;  1N84 A;  3D1R A;  3E79 A;  4OFL A;  4GWX A;  1B46 A;  4H8J A;  5K2Y A;  4MX6 A;  3U72 A;  1GR2 A;  4GWZ A;  1IIW A;  1B1X A;  3M8U A;  2WYP A;  2Y7P A;  1A8F A;  1FBG A;  2NOO A;  1IMD A;  4YIC A;  1PEB A;  4R72 A;  5DT6 A;  3V8X B;  4XTC Q;  4EF1 A;  1EYK A;  1CE2 A;  1JW1 A;  1JET A;  2I0C A;  3FXU A;  4HCW A;  4MNI A;  2B4L A;  1IXC A;  3FVN A;  3MP8 A;  5CM6 A;  3MVZ A;  3VXB A;  1OVB A;  5DEX A;  1CB6 A;  3QK6 A;  4OES A;  2M8C A;  5ICQ A;  4OHN A;  4RA1 A;  4N81 A;  2H9B A;  1NV6 A;  3OEL A;  3PPR A;  2D3I A;  1ZBM A;  2A5T B;  2QFL A;  4NG7 A;  1WDN A;  3CIJ A;  1IMA A;  4U4S A;  2DE2 A;  3BIG A;  4R6H A;  5K2X A;  2B3B A;  2DWA A;  3OXN A;  3MZB A;  4RK9 A;  1FPL A;  2JJK A;  2CZI A;  4DXC A;  2P0S A;  3V83 A;  1SW2 A;  2FHY A;  1ATG A;  4GWS A;  4BLA A;  4JDF A;  2XXP A;  1M5D A;  4NWC A;  1NV2 A;  3PU5 A;  1B52 A;  1B3E A;  5DVI A;  2PFZ A;  3SKP A;  3L6H A;  4GWW A;  3G3G A;  3CSB A;  4EF2 A;  4PAF A;  5I2K B;  3W15 C;  5L9M A;  2ZMB A;  1VDW A;  1USY H;  1MY1 A;  1BTJ A;  4OAN A;  1BK4 A;  4P11 A;  3SEU A;  2CMO A;  2Y5L A;  3H03 A;  2P2A A;  2Z8D A;  4IO7 A;  1Y3Q A;  4R73 A;  4ZDM A;  1MH3 A;  3SEV A;  4MIJ A;  3UOR A;  4LA9 A;  2XXQ A;  4THI A;  2WX9 A;  3C31 A;  4GWO A;  4PAK A;  1WVJ A;  2QMX A;  5JTY B;  4NAP A;  4P47 A;  1URD A;  2VD3 A;  4YAH X;  3PUW E;  2XX7 A;  1EYJ A;  4DI4 B;  5AA4 A;  3WAF A;  3TCH A;  1AMF A;  5DVF A;  1FQD A;  2WBB A;  3K1M A;  5IZ1 A;  1MPD A;  3K01 A;  3TZA A;  1UIU A;  2HZL A;  4F2Q A;  4DI3 D;  1QUJ A;  4PBH A;  3Q28 A;  1DTZ A;  2AIX A;  4ELQ A;  4OET A;  2DDK A;  3I6V A;  3IB1 A;  3U94 A;  1XOC A;  4HE2 A;  3E4R A;  3O6G A;  3KOS A;  3IO4 A;  1NMU A;  4PGP A;  1A7L A;  5EYH A;  3TYH A;  4F3P A;  3V5A A;  4QHQ A;  4EXK A;  3TDJ A;  4WXJ A;  1G0I A;  1IMF A;  1XHY A;  3CVG A;  5CMB A;  1NFT A;  1LCT A;  1P1W A;  4ELO A;  2Z8E A;  3IR1 A;  1FBE A;  3W9V A;  3U8Q A;  2B4M A;  3MAM A;  1NNT A;  4R74 A;  2XWO A;  4JSD A;  3DM0 A;  2VPO A;  5ELV A;  3G3F A;  3KEI A;  4YKP A;  4LN5 A;  3MVY A;  4OVS A;  4BDR A;  3R6U A;  1MQD A;  2YPN A;  1S7Y A;  5I57 B;  1B32 A;  1XVX A;  2QMW A;  5IM2 A;  2UVI A;  1J1N A;  4IO5 A;  3R7X A;  1Y9U A;  4P9K A;  4O7M A;  2RCB A;  3C4M A;  1SW4 A;  2PVU A;  2A5S A;  3RT8 A;  4QFK A;  3T66 A;  2E1S A;  1UTH B;  3N5L A;  1FW0 A;  4R9G A;  1Z7M E;  2QS1 A;  4P0I A;  4WEP A;  3VLV A;  4F1U A;  4HE0 A;  5ICT A;  5FTH A;  1NV3 A;  3JYR A;  1H45 A;  1NNK A;  3MWB A;  3U93 A;  2AYS A;  5EQA A;  4FIM A;  3W9W A;  4ONY A;  3T22 A;  3KN7 A;  4PFW A;  5CMC A;  3K00 A;  1SW5 A;  1YYZ A;  3MQ9 A;  3QMF A;  3HFU A;  1MS7 A;  4I62 A;  3OD7 A;  1MXY A;  2I3W A;  1FTL A;  2O84 X;  3H4Z A;  4ZEI A;  4NF4 A;  2ZYM A;  1FRP A;  1YAE A;  4OEV A;  4JBZ A;  4GX4 A;  2HAV A;  1Q35 A;  4PFY A;  2RC8 A;  4MLQ A;  1MM7 A;  2REG A;  3FVG A;  4GRK A;  4F18 A;  3S9M C;  1Y20 A;  3PUX E;  3HO7 A;  1ZIU A;  4NF5 B;  4KCD A;  1S9T A;  2ONS A;  1PB8 A;  3RNN A;  3KG2 A;  3OSQ A;  4QSC A;  5I5P A;  3TTN A;  4C0R A;  3GBB A;  3C34 A;  4M1V A;  4M4G A;  1NI9 A;  5ITO A;  3OEN A;  2V3Q A;  2KQZ A;  5TP9 A;  3QAX A;  3THI A;  3PGF A;  1MXX A;  1XT8 A;  3CFX A;  4UAC A;  4JXI A;  4OFJ A;  1AL3 A;  3B8B A;  2XA5 A;  3LSF B;  3FGS A;  3LUZ A;  3OOA A;  5I2N B;  4Q8R A;  2ESN A;  4ND9 A;  3IB2 A;  1KA1 A;  1MY0 A;  2QS2 A;  4YU0 A;  2DYX A;  3H3G A;  1ZTY A;  3LC8 A;  4RY1 A;  5KCJ A;  4H65 A;  3FXR A;  3T9X B;  3DLN A;  5I56 B;  1NUY A;  5J16 A;  3KGC A;  3U65 A;  3T93 B;  1NH7 A;  2XWV A;  4GX6 A;  2L5V A;  4MHF A;  4MFI A;  4HS7 A;  4WKM A;  3ZKK A;  2WBD A;  2VOZ A;  3T1B A;  1H3D A;  3RGY A;  2F34 A;  3TEP A;  1AWB A;  5F24 A;  1FPI A;  3BBR A;  3SDF A;  1EH3 A;  1EZP A;  4ELP A;  3UA8 A;  3ROJ A;  2P3N A;  3K02 A;  4GL8 A;  3S9E A;  4ZEB A;  4XKP A;  3MVX A;  4RXL A;  2O51 A;  4NF5 A;  5L9O A;  3PPN A;  3EHT A;  3TPA A;  3K0V A;  4KCC A;  2DOJ A;  4F29 A;  2V4C A;  2CZH A;  4ZEF A;  5A5L A;  3A09 A;  3V89 B;  3FVK A;  3TQL A;  2ZNU A;  4N17 A;  3IK6 B;  1SQY A;  4R6K A;  4NHB A;  4PE5 B;  4KR5 A;  4F31 B;  1AOV A;  3S9N C;  3RLF E;  3PMV A;  3UP9 A;  2DVZ A;  4OXV A;  4NE4 A;  4EXL A;  3SEW A;  1UTB A;  1GTK A;  4MCO A;  3T96 B;  4MBP A;  2ZZX A;  1SI0 A;  3KZG A;  4KFQ A;  3K1N A;  5DEX B;  1SVX B;  2BJI A;  4GQO A;  2HXW A;  4DDD A;  3K6V A;  3TQW A;  5DW8 A;  4PF6 A;  2HCA A;  2G29 A;  3EQ1 A;  1MPC A;  4FJP A;  4H1X A;  1M5C A;  1FQF A;  3IO6 A;  4GBV A;  4XEQ A;  4YZZ A;  1KWH A;  4FBP A;  2UVH A;  1R6Z A;  3OO7 A;  1FTK A;  4R2F A;  1OLA A;  4IO2 A;  2VD2 A;  4H0W A;  3E13 X;  3KC1 A;  4FOR A;  3QXM A;  4H5G A;  2Q74 A;  2ANJ A;  3LSX A;  2FIX A;  5LTC A;  2RCA A;  4JSO A;  4MNC A;  4N6D A;  4I8C A;  3EF7 A;  3RTF B;  3KJT A;  1D9Q A;  2O68 A;  3F11 A;  3VV5 A;  3CFL A;  5EQ7 A;  4OA4 A;  5TU0 A;  3RPW A;  4X1B A;  1MXU A;  4G2Z A;  3VFJ A;  4MF3 A;  3WAE A;  2XXW A;  4FED A;  2GHA A;  4XXU A;  3QUJ A;  1YXI A;  5ET7 A;  1NUZ A;  1UIV A;  1DMB A;  2OBG A;  4N4U A;  4R6Y A;  3C35 A;  3TEL A;  1FSA A;  4LAT A;  2Y7K A;  1HSE A;  4AB5 A;  4H5F A;  1MRP A;  5BUU A;  5LOM A;  3C33 A;  5AA4 B;  3IJX B;  1R9L A;  1GV8 A;  3FAS A;  1TFA A;  4PFR A;  1IZ1 A;  4P8B A;  1SI1 A;  2AL4 A;  1S50 A;  3B50 A;  1MY2 A;  3IOR A;  4Q30 B;  2OCU A;  3G3J A;  1DTG A;  2MKZ A;  2FYI A;  3H7M A;  1ZMG A;  3VVD A;  3TTR A;  2QJE A;  2Z22 A;  4GOT A;  1XS5 A;  3VDF A;  1BIY A;  1RDY A;  3PMW A;  4LQ2 A;  3E3K A;  2FA7 A;  1Y4C A;  4NED A;  3LR1 A;  2UXA A;  2GHB A;  4NQ8 A;  4GX3 A;  4PGN A;  5HPQ A;  3IOW A;  3DP6 A;  3T9U A;  1QJM A;  4GFR A;  1OVT A;  4DZ1 A;  5AA2 A;  2I48 A;  2I4B A;  3KBR A;  1MQG A;  4U1Z A;  1FJ9 A;  2F6G A;  2LAO A;  2Y5K A;  2Y7R A;  4Q5T A;  3K6U A;  1LAH E;  1MXZ A;  2YJP A;  1YPN A;  4OFO A;  3I3V A;  2H4I A;  1MQH A;  1MXV A;  4Z7E A;  3OEK A;  4QF9 A;  3N94 A;  4QFP A;  4LZ5 A;  4GWY A;  3C36 A;  2Q2A A;  3TMG A;  1QKB A;  5IKB A;  3KJ7 A;  3G7W A;  2FIE A;  4PFU A;  3CHG A;  3FIR A;  1R1N A;  1OMP A;  4PFI A;  3ONM A;  3PUZ E;  2WKY A;  2Y84 A;  4I40 A;  1P99 A;  1CNQ A;  4LQ5 A;  2UVJ A;  2XXI A;  3ECR A;  3HPI A;  1US5 A;  1VE4 A;  4GL0 A;  3TOD A;  3MJN A;  4ZEC A;  4ZS9 A;  4ZED A;  3HV1 A;  3CSG A;  2GFE A;  1LLS A;  1NV0 A;  1PB7 A;  3GBA A;  4PDD A;  1OQG A;  1RKM A;  3R26 A;  4NF4 B;  2V93 A;  2PT2 A;  3TTM A;  4YB7 A;  5I59 A;  3MZ1 A;  4O3C A;  3K6W A;  5JEI A;  5AA2 D;  4GBW A;  3KSJ A;  1QVS A;  1IQ7 A;  2F6P A;  4X1D A;  4OEU A;  4PF8 A;  1FBD A;  1RYO A;  4MEV A;  4H45 A;  4R2B A;  4BDN A;  3T9V A;  3KFM A;  4YB6 A;  3IOV A;  2F5X A;  5AA1 A;  4NX1 A;  5EQ8 A;  3PUV E;  1LBX A;  4LZ7 A;  3FAT A;  3CG1 A;  5TP9 B;  4ESW A;  4F1V A;  5A5X A;  4OEN A;  5EYG A;  1JW5 A;  1Y4T A;  4POW A;  2OK2 A;  4DIG A;  1A55 A;  1MG1 A;  4LON B;  4JVC A;  4KXP A;  1NUX A;  1HSJ A;  1NKX A;  2IA4 A;  4YKI A;  2F3D A;  2R8T A;  2H5Y A;  2DS9 A;  1B7Z A;  5AE4 A;  1B7U A;  4RYA A;  1USY E;  2R9J A;  5F7V A;  3UGW A;  2F7A A;  2IEE A;  3SER A;  4OVJ A;  2AL5 A;  2VGQ A;  5T3J A;  1LFH A;  4JWY A;  1K9Y A;  4ESX A;  1ZKB A;  3ILT B;  1MQI A;  3GYY A;  3P7I A;  4OER A;  4G8M A;  3KN3 A;  4GF8 A;  3PV0 E;  5KCJ B;  3O29 A;  1B0L A;  3FXB A;  1Y3P A;  1UQW A;  3KOT A;  3D4C A;  4O8M A;  5H8F A;  3N6U A;  1IMC A;  3QYT A;  4ZE8 A;  1I6B A;  4KI0 E;  4RJZ A;  4ECF A;  2I49 A;  3PPQ A;  3LSW A;  1FQB A;  2XXX A;  4QSE A;  3PD9 A;  5I58 A;  5ET6 A;  3JV9 A;  1JVX A;  4ZEK A;  4C1T A;  1QUK A;  3FJG A;  2V25 A;  5KDT A;  1IUD A;  1IME A;  1FPG A;  3IAZ A;  2B65 A;  4MLV A;  4KHZ E;  4TOZ A;  5H8Q A;  3S9L C;  2Q89 A;  1LFI A;  3FBP A;  2QVV A;  4YB5 A;  4ELR A;  1H43 A;  2HFB A;  2Q8J A;  3OMB A;  1JNF A;  2DXY A;  3K4U A;  5FBP A;  1FTJ A;  4JWO A;  4MJO A;  4NF8 A;  3S2V A;  2ZNS A;  3HHG A;  2QL3 A;  2DQV A;  2FVZ A;  2O1M A;  1IIT A;  4RPO A;  3OO6 A;  3OSR A;  4P0G A;  3MBP A;  1F9B A;  3KSX A;  1MXW A;  2G93 A;  1B0H A;  1B40 A;  1B4H A;  4NF0 A;  2OWS A;  2F7B A;  2VT5 A;  2PCR A;  5CMM A;  2ZZV A;  4R9F A;  3EN3 A;  2OX3 A;  2HPG A;  4OVP A;  4JVD A;  3M3L A;  4XIG Q;  1UTB B;  4F22 A;  3IOT A;  2Y7I A;  4N8Y A;  3Q25 A;  4LZ8 A;  5JK4 A;  3RN8 A;  1VSO A;  2ABH A;  1OQH A;  4KYD A;  4TLL B;  4P3L A;  3K6X A;  3IFC A;  4O3A A;  4P1L A;  4FEC A;  4EDP A;  1B3H A;  2H25 A;  4PBQ A;  1LB9 A;  3IL1 B;  4N91 A;  3VLW A;  4H6D A;  3O6I A;  1B7H A;  1B5H A;  3TCF A;  3PD8 A;  4FAJ A;  2OWZ A;  3BKI B;  1JW4 A;  4AS5 A;  3VXC A;  5FHN A;  4IO6 A;  2DE3 A;  2P3V A;  4RNS A;  2QVU A;  3RY3 A;  1LBY A;  4QFO A;  1FTO A;  4QFN A;  4PFT A;  3UIF A;  1FQA A;  1YZ0 A;  2NUV A;  1MY4 A;  2CEX A;  4G68 C;  4Z0I A;  4JWX A;  4KYE A;  2V3U A;  2P1S A;  1AH5 A;  4OQO A;  3NOH A;  2O6A A;  5BWJ A;  5ET8 A;  1N04 A;  2GQ1 A;  3DP8 A;  4WED A;  1NUW A;  1INP A;  3MVW A;  2GRV A;  2WEF A;  3A3C A;  2KR0 A;  3M3F A;  2HQ0 A;  4OWD A;  3MYU A;  3LUY A;  1BLF A;  4NMY A;  4PQJ A;  1EU8 A;  2CEY A;  4O7I A;  3UK4 A;  5EHM A;  2XXV A;  5DTB A;  1Y3N A;  3VVF A;  1NV5 A;  3LBS A;  3MP6 A;  2PMS A;  4I3Y A;  1B3F A;  4ZZE A;  4LVQ A;  4H46 A;  4F1Y A;  2OWT A;  3IFA A;  1EYI A;  2XX8 A;  3GLB A;  4KPT A;  5EYF A;  4F3S A;  4G4P A;  2X26 A;  5J1D A;  1A99 A;  2DE4 A;  2HEU A;  1B9J A;  2XXU A;  2HAU A;  3HN0 A;  4U21 A;  1N7X A;  2I0B A;  4YMB A;  2OLB A;  1IXH A;  5IZ3 A;  2F97 A;  3EHS A;  3B6Q A;  2PYY A;  4PE3 A;  1POY 1;  3U1O A;  3RQT A;  4BDO A;  2ALU A;  4IGT A;  1PBP A;  3SEX A;  5IAI A;  1O64 A;  3T9H B;  3MC2 A;  4FAT A;  4EQB A;  3AXF A;  1XC1 A;  2PT1 A;  4XFE A;  1VFE A;  1FPJ A;  4GXA A;  2CZL A;  5CRY A;  1NV1 A;  2ONR A;  4PC9 A;  1SDX A;  1IEJ A;  5AA2 B;  2B3F A;  1SD3 A;  4RPN A;  1MY3 A;  3QIM A;  1DSN A;  4NF6 A;  3TUS A;  2I6E A;  1FPD A;  3N6T A;  1FCK A;  4I3E A;  2VHA A;  5EHS A;  1NL5 A;  1LCF A; 
#chains in the Genus database with same CATH homology
 3USD A;  3H6U A;  2Q88 A;  2ZXT A;  1AIV A;  4DCX A;  1LAF E;  5KZT A;  5H8H B;  2HZK A;  1LGB C;  2O1L A;  5H8S A;  3A3U A;  2DWH A;  1YTV A;  3IJO B;  4PP0 A;  2THI A;  2DP8 A;  4HW8 A;  1N3X A;  4GD5 A;  1MDQ A;  1N7W A;  4LP2 B;  1ANF A;  3PPP A;  3G3K A;  2BJJ X;  1O63 A;  1P1N A;  1OLC A;  1QW0 A;  1LAX A;  2RIN A;  5FTI A;  2ZYK A;  2XXH A;  4G77 A;  2XD2 A;  1B58 A;  4R75 A;  2ZNT A;  1II5 A;  3O66 A;  3MUQ A;  5M2V A;  3CG3 A;  4OYV A;  1VR5 A;  2VP1 A;  4YKJ A;  4POX A;  2O7I A;  1H76 A;  2ZYN A;  2F35 A;  2H98 A;  1TWY A;  1VFD A;  3MW0 A;  2F7C A;  1L5T A;  5I59 B;  2Y7W A;  3GXA A;  2D5W A;  3FV2 A;  1MM6 A;  4F39 A;  1GVC A;  5H8N A;  1IXI A;  1B3L A;  3FUZ A;  1B1H A;  4MH5 A;  4OZ9 A;  4KD5 A;  3C32 A;  1P1U A;  3U92 A;  4U4X A;  3TTL A;  2RF1 A;  2XXY A;  1LAG E;  2I58 A;  2Z8F A;  2QS4 A;  3ZKL A;  4OTE A;  1OIB A;  5CI5 A;  1HSL A;  4XKR A;  5A5X B;  2NWJ A;  4XKN A;  4YMA A;  5CBS A;  3D4G A;  4HCY A;  5ITP A;  2QS3 A;  2QSX A;  3OO8 A;  1M5B A;  2PX1 A;  3FJM A;  5HM4 B;  5H8H A;  4G68 A;  4OMB A;  4TQU Q;  1LFG A;  3FZV A;  1B51 A;  3ZSF A;  3IOU A;  3RUM A;  4EQ7 A;  1D4N A;  1LST A;  1JQF A;  3O6H A;  4KYS A;  1A8E A;  2I4C A;  4F2O A;  1H44 A;  1NH8 A;  5H8F B;  1EZ9 A;  2D21 A;  1Q1K A;  1GGG A;  4IB2 A;  5CMK A;  3OEM A;  2Q9T A;  4N13 A;  4DXU A;  4GVO A;  5HBC A;  4X9T A;  1US4 A;  1URS A;  5DYH A;  5AA3 A;  3M3K A;  2GH9 A;  3TAJ A;  5I58 B;  4GIZ A;  4L17 A;  3O2A A;  3O28 A;  5KDT B;  2DWI A;  1EZO A;  5H8Q B;  4U22 A;  2FNC A;  1SYH A;  4QFL A;  2A5T A;  3SET A;  3JZJ A;  4NF8 B;  2KLF A;  3HHF A;  3Q26 A;  4U23 A;  2NXO A;  3PMX A;  3B6W A;  2F8D A;  3MP1 A;  5FHO A;  4G8H A;  1ZJL A;  3Q29 A;  3ILU B;  2RC7 A;  2OJT A;  4I9D A;  2R71 A;  4QSD A;  3CFZ A;  5B70 A;  2I3V A;  1MQJ A;  3ODB A;  2NVU B;  5I2K A;  1QKA A;  5CBR A;  4IO3 A;  1TFD A;  4TLM B;  3VE1 B;  4KQP A;  4ZE9 A;  1N0T A;  1DOT A;  2V3T A;  1M5E A;  4QRZ A;  4E0W A;  3UN6 A;  3BFU A;  3B6T A;  4N07 A;  5JTY A;  4DCY A;  1FQE A;  3HST A;  1D9Y A;  3C9H A;  2F36 A;  1TT1 A;  3MPK A;  4K3F A;  4YKK A;  1I69 A;  3RT6 B;  3H6T A;  3Q27 A;  1XVY A;  3FJ7 A;  1SBP A;  1P1Q A;  2V84 A;  1M5F A;  3HCQ A;  1PB9 A;  2O7U A;  2E0S A;  1D9V A;  1QUL A;  2OZZ A;  3TKD A;  4FE8 A;  4E0X A;  3KN8 A;  3OO9 A;  1DPE A;  2UYE A;  1Y1Z A;  1ELJ A;  4BDL A;  3FD3 A;  4U2R A;  1B3G A;  4G8N A;  1LBB A;  2UVG A;  5L8D A;  5TPA B;  2XD3 A;  3G3H A;  2ONK E;  1MPB A;  3B7D A;  3CRB A;  3GZG A;  1JEV A;  3CI8 A;  3QUF A;  1Z7N E;  4GLI A;  1R9Q A;  5I57 A;  3PPO A;  3FVO A;  3LSL A;  4NWD A;  1B5J A;  1B05 A;  4BDM A;  1FTM A;  2RKM A;  1ZU0 A;  3MZ9 A;  4H8I A;  2DVC A;  3O97 A;  1FQC A;  1DPP A;  2O69 A;  4DXB A;  3MPL A;  3E9X A;  1UTH A;  2R6G E;  2W7Y A;  3K2D A;  3H6V A;  3N26 A;  1O7T A;  3L6G A;  1YCJ A;  4RK2 A;  4DLD A;  2DXR A;  2ZYO A;  4AQ4 A;  1NNP A;  4BDQ A;  2XXT A;  1N3W A;  2REJ A;  1I6Q A;  3I5O A;  3H6W A;  1N76 A;  1SYI A;  2DSF A;  4U1O A;  4LUB A;  1T0K A;  3QSL A;  1D3K A;  1PDA A;  2QRY A;  3ZS6 A;  3H06 B;  3FXQ A;  1MDP 1;  1TXF A;  2Z23 A;  4NF6 B;  3IB0 A;  5F1Q A;  4PET A;  4Q0C A;  2QPQ A;  1URG A;  4FEB A;  5ISU A;  3VLU A;  1IXG A;  3K1P A;  4IY6 A;  4ISU A;  3IX1 A;  4ZZA A;  3VVE A;  1PC3 A;  1BP5 A;  2H99 A;  2RC9 A;  1B6H A;  3EHU A;  3BFT A;  1NNF A;  1JEU A;  5TPA A;  3TCG A;  1LBC A;  2XHD A;  4AB6 A;  4UA8 A;  1RYX A;  3DEL B;  1Y1M A;  4I1D A;  1WOD A;  4X48 A;  4IGR A;  1A40 A;  3EPE A;  3G3I A;  2XX9 A;  4HTG A;  1A54 A;  1POT A;  2X7Q A;  5CC2 A;  1BKA A;  4GXS B;  2F78 A;  4N6P A;  3PUY E;  1QUI A;  1B2H A;  5I2N A;  4IO4 A;  1PBQ A;  2YLN A;  3RTW B;  2PBW A;  4DE8 A;  2XXR A;  1JVY A;  3TFL A;  5H8N B;  4F3G A;  5I56 A;  3DP4 A;  4IY5 A;  1B4Z A;  4F3B A;  3SES A;  5FHM A;  5I84 A;  3O9P A;  4JB7 A;  3TTK A;  3SEY A;  2X7P A;  1P1O A;  5DVJ A;  4EQ9 A;  4F19 A;  3FV1 A;  4H67 A;  4NTL A;  4XKQ A;  2UYF A;  3CR9 A;  4O3B A;  1SW1 A;  3S4U A;  2Q2C A;  4EUO A;  1I6A A;  5B7D A;  1LB8 A;  5L9S A;  1B5I A;  1ZLQ A;  1MH4 A;  4C1U A;  2DWJ A;  4G68 B;  1N84 A;  4OFL A;  1B46 A;  4H8J A;  5K2Y A;  3U72 A;  1GR2 A;  1IIW A;  1B1X A;  3M8U A;  2Y7P A;  1A8F A;  2NOO A;  4YIC A;  1PEB A;  4R72 A;  5DT6 A;  3V8X B;  4XTC Q;  4EF1 A;  1CE2 A;  1JW1 A;  1JET A;  2I0C A;  3FXU A;  4HCW A;  1IXC A;  3FVN A;  3MP8 A;  5CM6 A;  3MVZ A;  3VXB A;  1OVB A;  5DEX A;  1CB6 A;  3QK6 A;  4OES A;  2M8C A;  5ICQ A;  4OHN A;  4RA1 A;  2H9B A;  3OEL A;  3PPR A;  2D3I A;  1ZBM A;  2A5T B;  1WDN A;  3CIJ A;  4U4S A;  2DE2 A;  4R6H A;  5K2X A;  2B3B A;  2DWA A;  3OXN A;  3MZB A;  4RK9 A;  4DXC A;  2P0S A;  3V83 A;  1SW2 A;  1ATG A;  4BLA A;  4JDF A;  2XXP A;  1M5D A;  4NWC A;  3PU5 A;  1B52 A;  1B3E A;  5DVI A;  3SKP A;  3L6H A;  3G3G A;  3CSB A;  4EF2 A;  5I2K B;  3W15 C;  5L9M A;  2ZMB A;  1USY H;  1MY1 A;  1BTJ A;  4P11 A;  3SEU A;  2CMO A;  3H03 A;  2P2A A;  2Z8D A;  4IO7 A;  1Y3Q A;  4ZDM A;  4R73 A;  1MH3 A;  3SEV A;  3UOR A;  4LA9 A;  2XXQ A;  4THI A;  3C31 A;  4GWO A;  1WVJ A;  2QMX A;  5JTY B;  1URD A;  2VD3 A;  4YAH X;  3PUW E;  2XX7 A;  5AA4 A;  3WAF A;  3TCH A;  1AMF A;  5DVF A;  1FQD A;  3K1M A;  1MPD A;  3K01 A;  3TZA A;  1UIU A;  2HZL A;  4F2Q A;  1QUJ A;  3Q28 A;  1DTZ A;  2AIX A;  4ELQ A;  4OET A;  3I6V A;  3IB1 A;  3U94 A;  1XOC A;  3E4R A;  3O6G A;  3KOS A;  3IO4 A;  1NMU A;  4F3P A;  1A7L A;  3TYH A;  3V5A A;  4QHQ A;  4EXK A;  3TDJ A;  4WXJ A;  1XHY A;  3CVG A;  5CMB A;  1NFT A;  1LCT A;  1P1W A;  4ELO A;  2Z8E A;  3IR1 A;  3W9V A;  3U8Q A;  3MAM A;  1NNT A;  4R74 A;  4JSD A;  3DM0 A;  5ELV A;  3G3F A;  3KEI A;  4YKP A;  3MVY A;  4BDR A;  3R6U A;  1MQD A;  2YPN A;  1S7Y A;  5I57 B;  1B32 A;  1XVX A;  2QMW A;  2UVI A;  1J1N A;  4IO5 A;  3R7X A;  1Y9U A;  2RCB A;  3C4M A;  1SW4 A;  2PVU A;  2A5S A;  3RT8 A;  4QFK A;  3T66 A;  2E1S A;  1UTH B;  3N5L A;  1FW0 A;  4R9G A;  1Z7M E;  2QS1 A;  4P0I A;  4WEP A;  3VLV A;  4F1U A;  5ICT A;  5FTH A;  3JYR A;  1H45 A;  1NNK A;  3MWB A;  3U93 A;  2AYS A;  4FIM A;  3W9W A;  4ONY A;  3T22 A;  3KN7 A;  4PFW A;  5CMC A;  3K00 A;  1SW5 A;  3MQ9 A;  1MS7 A;  4I62 A;  3OD7 A;  1MXY A;  2I3W A;  1FTL A;  2O84 X;  3H4Z A;  4ZEI A;  4NF4 A;  2ZYM A;  1YAE A;  4OEV A;  4JBZ A;  2HAV A;  1Q35 A;  4PFY A;  2RC8 A;  4MLQ A;  1MM7 A;  2REG A;  3FVG A;  4GRK A;  4F18 A;  3S9M C;  1Y20 A;  3PUX E;  3HO7 A;  1ZIU A;  4NF5 B;  4KCD A;  1S9T A;  2ONS A;  1PB8 A;  3RNN A;  3KG2 A;  3OSQ A;  4QSC A;  3TTN A;  4C0R A;  3GBB A;  3C34 A;  4M1V A;  4M4G A;  5ITO A;  3OEN A;  2V3Q A;  5TP9 A;  3QAX A;  3THI A;  3PGF A;  1MXX A;  1XT8 A;  3CFX A;  4UAC A;  4JXI A;  4OFJ A;  1AL3 A;  3LSF B;  3FGS A;  3OOA A;  5I2N B;  4Q8R A;  2ESN A;  4ND9 A;  3IB2 A;  1MY0 A;  2QS2 A;  4YU0 A;  2DYX A;  3H3G A;  1ZTY A;  3LC8 A;  4RY1 A;  5KCJ A;  4H65 A;  3FXR A;  3T9X B;  3DLN A;  5I56 B;  3KGC A;  3T93 B;  1NH7 A;  4MFI A;  4HS7 A;  4WKM A;  3ZKK A;  2VOZ A;  1H3D A;  3RGY A;  2F34 A;  3TEP A;  3BBR A;  3SDF A;  1EH3 A;  1EZP A;  4ELP A;  3UA8 A;  3K02 A;  4GL8 A;  3S9E A;  4ZEB A;  4XKP A;  3MVX A;  4RXL A;  2O51 A;  4NF5 A;  5L9O A;  3PPN A;  3EHT A;  3TPA A;  3K0V A;  4KCC A;  2DOJ A;  4F29 A;  4ZEF A;  3A09 A;  3V89 B;  3FVK A;  3TQL A;  2ZNU A;  3IK6 B;  1SQY A;  4R6K A;  4PE5 B;  4KR5 A;  4F31 B;  1AOV A;  3S9N C;  3RLF E;  3PMV A;  3UP9 A;  2DVZ A;  4OXV A;  4NE4 A;  4EXL A;  3SEW A;  1UTB A;  1GTK A;  3T96 B;  4MBP A;  1SI0 A;  3KZG A;  4KFQ A;  3K1N A;  5DEX B;  1SVX B;  4GQO A;  2HXW A;  4DDD A;  3K6V A;  3TQW A;  2HCA A;  2G29 A;  3EQ1 A;  1MPC A;  4FJP A;  4H1X A;  1M5C A;  1FQF A;  3IO6 A;  4YZZ A;  1KWH A;  2UVH A;  1R6Z A;  3OO7 A;  1FTK A;  4R2F A;  1OLA A;  4IO2 A;  2VD2 A;  4H0W A;  3E13 X;  4FOR A;  3QXM A;  4H5G A;  2ANJ A;  3LSX A;  2RCA A;  4JSO A;  4I8C A;  3EF7 A;  3RTF B;  3KJT A;  2O68 A;  3F11 A;  3VV5 A;  3CFL A;  3RPW A;  5TU0 A;  4X1B A;  1MXU A;  4G2Z A;  3VFJ A;  4MF3 A;  3WAE A;  2XXW A;  2GHA A;  4FED A;  4XXU A;  3QUJ A;  1UIV A;  1DMB A;  2OBG A;  4R6Y A;  3C35 A;  3TEL A;  4LAT A;  2Y7K A;  1HSE A;  4AB5 A;  4H5F A;  1MRP A;  5BUU A;  5LOM A;  3C33 A;  5AA4 B;  3IJX B;  1R9L A;  1GV8 A;  3FAS A;  1TFA A;  1IZ1 A;  1SI1 A;  2AL4 A;  1S50 A;  1MY2 A;  3IOR A;  4Q30 B;  2OCU A;  3G3J A;  1DTG A;  2FYI A;  3H7M A;  1ZMG A;  3VVD A;  3TTR A;  2QJE A;  2Z22 A;  4GOT A;  1XS5 A;  3VDF A;  1BIY A;  3PMW A;  4LQ2 A;  3E3K A;  2FA7 A;  1Y4C A;  4NED A;  3LR1 A;  2UXA A;  2GHB A;  5HPQ A;  3IOW A;  3DP6 A;  3T9U A;  1QJM A;  4GFR A;  1OVT A;  4DZ1 A;  5AA2 A;  2I48 A;  2I4B A;  3KBR A;  1MQG A;  4U1Z A;  2F6G A;  2LAO A;  2Y7R A;  4Q5T A;  3K6U A;  1LAH E;  1MXZ A;  2YJP A;  1YPN A;  4OFO A;  3I3V A;  2H4I A;  1MQH A;  1MXV A;  4Z7E A;  3OEK A;  4QF9 A;  3N94 A;  4QFP A;  4LZ5 A;  3C36 A;  2Q2A A;  3TMG A;  1QKB A;  5IKB A;  3KJ7 A;  3G7W A;  4PFU A;  3FIR A;  1R1N A;  1OMP A;  3ONM A;  3PUZ E;  2WKY A;  2Y84 A;  1P99 A;  4LQ5 A;  2UVJ A;  2XXI A;  3ECR A;  3HPI A;  1US5 A;  1VE4 A;  4GL0 A;  3TOD A;  3MJN A;  4ZEC A;  4ZS9 A;  4ZED A;  3HV1 A;  3CSG A;  2GFE A;  1LLS A;  1PB7 A;  3GBA A;  1OQG A;  1RKM A;  3R26 A;  4NF4 B;  2V93 A;  2PT2 A;  3TTM A;  4YB7 A;  5I59 A;  3MZ1 A;  4O3C A;  3K6W A;  5JEI A;  5AA2 D;  3KSJ A;  1QVS A;  1IQ7 A;  2F6P A;  4X1D A;  4OEU A;  1RYO A;  4R2B A;  4BDN A;  3T9V A;  3KFM A;  4YB6 A;  3IOV A;  2F5X A;  5AA1 A;  3PUV E;  4LZ7 A;  3FAT A;  3CG1 A;  5TP9 B;  4ESW A;  4F1V A;  5A5X A;  4OEN A;  1JW5 A;  1Y4T A;  4POW A;  2OK2 A;  4DIG A;  1A55 A;  1MG1 A;  4LON B;  1HSJ A;  1NKX A;  2IA4 A;  4YKI A;  2H5Y A;  2DS9 A;  1B7Z A;  5AE4 A;  1B7U A;  4RYA A;  1USY E;  2R9J A;  5F7V A;  3UGW A;  2F7A A;  2IEE A;  3SER A;  4OVJ A;  2AL5 A;  2VGQ A;  1LFH A;  4JWY A;  4ESX A;  1ZKB A;  3ILT B;  1MQI A;  3P7I A;  4OER A;  4G8M A;  3KN3 A;  4GF8 A;  3PV0 E;  5KCJ B;  3O29 A;  1B0L A;  1Y3P A;  1UQW A;  3KOT A;  3D4C A;  5H8F A;  3N6U A;  3QYT A;  4ZE8 A;  1I6B A;  4KI0 E;  4RJZ A;  4ECF A;  2I49 A;  3PPQ A;  3LSW A;  1FQB A;  2XXX A;  4QSE A;  3PD9 A;  5I58 A;  3JV9 A;  1JVX A;  4ZEK A;  4C1T A;  1QUK A;  3FJG A;  2V25 A;  5KDT A;  1IUD A;  3IAZ A;  2B65 A;  4MLV A;  4KHZ E;  4TOZ A;  5H8Q A;  3S9L C;  2Q89 A;  1LFI A;  4YB5 A;  4ELR A;  1H43 A;  2HFB A;  2Q8J A;  3OMB A;  1JNF A;  2DXY A;  3K4U A;  1FTJ A;  4JWO A;  4NF8 A;  3S2V A;  2ZNS A;  3HHG A;  2QL3 A;  2DQV A;  2O1M A;  1IIT A;  4RPO A;  3OO6 A;  3OSR A;  4P0G A;  3MBP A;  1F9B A;  3KSX A;  1MXW A;  2G93 A;  1B0H A;  1B40 A;  1B4H A;  2OWS A;  2F7B A;  5CMM A;  4R9F A;  3EN3 A;  3M3L A;  4XIG Q;  1UTB B;  4F22 A;  3IOT A;  2Y7I A;  3Q25 A;  4LZ8 A;  5JK4 A;  3RN8 A;  1VSO A;  2ABH A;  1OQH A;  4KYD A;  4TLL B;  3K6X A;  4O3A A;  4EDP A;  4FEC A;  1B3H A;  2H25 A;  1LB9 A;  3IL1 B;  3VLW A;  4H6D A;  3O6I A;  1B7H A;  1B5H A;  3TCF A;  3PD8 A;  4FAJ A;  3BKI B;  1JW4 A;  3VXC A;  5FHN A;  4IO6 A;  2DE3 A;  4RNS A;  3RY3 A;  4QFO A;  1FTO A;  4QFN A;  4PFT A;  3UIF A;  1FQA A;  2NUV A;  1MY4 A;  4G68 C;  4Z0I A;  4JWX A;  4KYE A;  2V3U A;  2P1S A;  1AH5 A;  4OQO A;  2O6A A;  5BWJ A;  1N04 A;  3DP8 A;  4WED A;  3MVW A;  2GRV A;  3A3C A;  3M3F A;  2HQ0 A;  4OWD A;  3LUY A;  1BLF A;  4NMY A;  4PQJ A;  1EU8 A;  3UK4 A;  5EHM A;  2XXV A;  5DTB A;  1Y3N A;  3VVF A;  3LBS A;  3MP6 A;  2PMS A;  1B3F A;  4ZZE A;  4LVQ A;  4F1Y A;  2OWT A;  2XX8 A;  3GLB A;  4F3S A;  4KPT A;  5EYF A;  4G4P A;  2X26 A;  5J1D A;  1A99 A;  2DE4 A;  2HEU A;  1B9J A;  2XXU A;  2HAU A;  3HN0 A;  4U21 A;  1N7X A;  2I0B A;  4YMB A;  2OLB A;  1IXH A;  2F97 A;  3EHS A;  3B6Q A;  2PYY A;  1POY 1;  3U1O A;  3RQT A;  4BDO A;  2ALU A;  4IGT A;  1PBP A;  3SEX A;  5IAI A;  1O64 A;  3T9H B;  3MC2 A;  4FAT A;  4EQB A;  3AXF A;  1XC1 A;  2PT1 A;  1VFE A;  4GXA A;  2CZL A;  5CRY A;  2ONR A;  1SDX A;  1IEJ A;  5AA2 B;  2B3F A;  1SD3 A;  4RPN A;  1MY3 A;  3QIM A;  1DSN A;  4NF6 A;  3TUS A;  2I6E A;  3N6T A;  1FCK A;  2VHA A;  5EHS A;  1NL5 A;  1LCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...