3FD3A

Structure of the c-terminal domains of a lysr family protein from agrobacterium tumefaciens str. c58.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
207
structure length
207
Chain Sequence
RVTLNIATNADSLGTWFLDAVSKFTGGSDYLVNIAVDDQDHTVEWLRGGRVLAAVTAHDKPVQGCRVTPLGVLRYHATASPDFMARHFADGVTPAALARAPGLTFNQKDRLQASWIRTALGEDVSYPTHWLPSTDGFVKASLAGMGWGLNPVQLVAEHLAAGRLVELMPGTPLDIPLYWQVNRLAAERLAGLTANMVGTARVVLMPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords chromosome replication initiation inhibitor protein
publication title Structure of the C-terminal domains of a LysR family protein from Agrobacterium tumefaciens str. C58.
rcsb
source organism Agrobacterium tumefaciens str.
total genus 61
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2008-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fd3A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fd3A02
4OWDA 4POXA 3Q25A 2Q2AA 4KD5A 1P99A 4H5GA 3TTRA 1MY0A 3MW0A 3U72A 3FXUA 2O7UA 1OVBA 2WKYA 1B05A 3TKDA 2GFEA 3MP1A 3PV0E 1NNPA 2V3UA 4OZ9A 3IOUA 5AA2D 3H4ZA 4WEPA 3HSTA 1PBQA 1FQDA 1UTBA 5DEXA 2O1MA 1Z7ME 2ANJA 3HHGA 4I8CA 4X9TA 1CE2A 3B6TA 2XD2A 1LAGE 2HCAA 4R2BA 3RUMA 1VFEA 2F6GA 1JEVA 3E3KA 4Q30B 1VSOA 4ZEIA 1DPEA 1FQBA 4QF9A 1PC3A 4RJZA 3IL1B 1BIYA 3TAJA 1TXFA 3OMBA 4QFLA 4U4XA 1RKMA 3TYHA 2I4CA 2REJA 4NE4A 4THIA 3K1PA 3IK6B 1B52A 4H8JA 3SESA 4JB7A 3FXQA 2PVUA 5H8FA 4EUOA 1TWYA 4RA1A 2OWTA 3FGSA 3K0VA 3K01A 4UA8A 5CMBA 1MH4A 1PB9A 3SEWA 1SYHA 1JW1A 4HS7A 1ZJLA 4BDLA 4RPNA 4PE5B 4NF5A 3RLFE 1B1XA 3OXNA 4HW8A 3SEYA 1LBBA 1B6HA 5HM4B 1EZ9A 1LCFA 1P1NA 1MXWA 2F35A 1P1WA 2DXRA 4NMYA 3SEXA 4PFWA 5K2XA 3M3FA 4EF2A 3TMGA 2O51A 4M4GA 5DEXB 5KZTA 4O3BA 4R9GA 2HQ0A 2RCBA 2QS4A 3T22A 4C0RA 3U92A 1JETA 3PGFA 1MDP1 5AA2A 3LSLA 2P0SA 4Z0IA 5I84A 2P2AA 1M5CA 1ZTYA 1B7UA 5H8NB 3IB1A 3H03A 5DTBA 4GXSB 1DTZA 2ZXTA 4BDMA 3MVZA 1Q1KA 2VHAA 3FVGA 5I2NB 2I48A 3CFXA 3TTKA 5CI5A 3OSQA 3MAMA 3MVXA 4ELPA 5M2VA 5B70A 3C36A 4MH5A 2I3WA 3ZSFA 4JBZA 3TCHA 3LBSA 4LATA 3N26A 1A99A 3TQWA 3FIRA 3T66A 1Y3QA 4F39A 1SI1A 2HZKA 3CSBA 1B51A 3RPWA 2DVZA 4O3AA 4YMBA 4OFJA 5ELVA 4H65A 4GXAA 4ELQA 1OIBA 4F2OA 4H67A 3IOWA 1FTOA 3H7MA 3H3GA 3G3JA 4XTCQ 4YKKA 3WAFA 1T0KA 4F18A 4DXUA 3O6HA 4N07A 2HFBA 4MLQA 3C32A 2E1SA 2Q89A 5FHNA 4QFKA 2HZLA 4GVOA 1B58A 1SQYA 4FATA 3B6WA 4G68C 5I2KA 1B5HA 3FVNA 3KOTA 1S9TA 1YAEA 3FV2A 3MQ9A 4NF4B 2Y84A 1FCKA 4ISUA 4YMAA 3H6WA 3ODBA 2H5YA 3GXAA 5A5XB 3GLBA 3RT8A 4YB5A 1FTKA 3C33A 3UN6A 3N6TA 2RC9A 3TTMA 1OLCA 3EHUA 3HCQA 2O1LA 2UXAA 2P1SA 1JEUA 3CRBA 1MXXA 5H8HB 3ECRA 4EF1A 3D4GA 2VP1A 4IGTA 3EN3A 4G2ZA 2PMSA 1QKBA 1N04A 1P1QA 4LZ5A 3CG3A 1B3FA 5TU0A 3OO9A 1ZIUA 4YZZA 1MXVA 3ILUB 1NH7A 4KI0E 1Y20A 3IB0A 3MVWA 2D21A 1DPPA 4LZ7A 1M5DA 3H06B 4OFLA 3LUYA 1FQFA 3OOAA 5I56B 3IOVA 2XXPA 1S7YA 3TCGA 3G3KA 3CR9A 1AH5A 3HPIA 3UORA 3AXFA 1GR2A 1JQFA 1GTKA 1P1UA 3EQ1A 1OQHA 3HHFA 1MY2A 2DWHA 3S9MC 2F34A 1B5IA 3KFMA 5I59A 4RY1A 4DIGA 5F1QA 2HEUA 3TQLA 4G68B 4TLLB 5ITPA 1A8FA 3T9XB 3KJ7A 3O28A 1N7XA 3OENA 4GQOA 3FV1A 4JWOA 4NF6B 3EPEA 2ZMBA 3EHTA 5IKBA 4OHNA 3BKIB 2F6PA 1FQEA 3PUVE 3Q29A 3QUJA 5J1DA 3U93A 3B6QA 4QSEA 5L9OA 3FASA 1LBCA 5DVJA 5TPAA 1Y1MA 4G77A 1QULA 4F3SA 4L17A 3KJTA 4XKPA 1Y4CA 4KYSA 1ELJA 4IO4A 3A3CA 2V3TA 1ZKBA 5F7VA 2A5TA 3IX1A 2Q88A 2DE2A 2RKMA 2RC7A 1B3HA 2FYIA 5DVFA 3MZBA 4G8NA 2XXQA 1XVYA 4JXIA 1PDAA 2XX9A 4KHZE 5JTYB 3PD9A 1TFAA 4JWXA 4OVJA 4DXBA 4U21A 2XX8A 3QUFA 3RQTA 4GOTA 3QXMA 4IO2A 4YICA 3KSJA 3C31A 3TZAA 3DP4A 4I9DA 1IXGA 3G3HA 4H0WA 1FQAA 3M8UA 3KZGA 2XXTA 3JYRA 2Y7WA 4XXUA 3U1OA 2UYFA 4U22A 2B65A 1WDNA 1B40A 2OBGA 1O63A 1EH3A 4QHQA 4YKPA 1N3XA 4U23A 5AA4A 2Z8FA 3FVKA 3W9VA 3U94A 3DP8A 3IJOB 4R6KA 4PFTA 1TT1A 4NF8A 3R6UA 1A54A 3T9VA 1PEBA 3V8XB 5AA1A 1B2HA 4F29A 3W15C 1URGA 3I5OA 3E9XA 2Z22A 4FE8A 5JK4A 4X1DA 4G8HA 1ATGA 4DDDA 1KWHA 3FJGA 2X7PA 3RNNA 3IOTA 4PP0A 3TPAA 4FJPA 2F7BA 3TTNA 1LSTA 4GL8A 3ZKKA 2RC8A 1LAHE 1XS5A 2XXYA 4JSDA 2H25A 3S9EA 2ONKE 4EXKA 1ZLQA 2G93A 1A7LA 3SEVA 4U2RA 4R6HA 3A3UA 3MJNA 5L8DA 5H8SA 1QKAA 3C4MA 1H76A 3K4UA 3C9HA 1D9YA 1I6QA 3TDJA 5CMCA 2B3BA 1B0HA 4DCXA 1POTA 3C34A 4X48A 1MPBA 4FEDA 4YKJA 3ONMA 4F1UA 3MVYA 5KCJA 2PBWA 4F31B 2GHBA 5HPQA 3Q26A 3RY3A 2CZLA 2Z23A 3E4RA 1YCJA 1BKAA 4YB7A 3QK6A 1B5JA 1FQCA 3UK4A 3L6HA 1Y3PA 2FNCA 1B7ZA 1I6AA 4F3GA 1UTBB 4P0GA 3S2VA 1IXCA 4GLIA 3TFLA 3OO6A 1SW4A 2FA7A 2XXRA 4OMBA 5CBSA 2F36A 3PPOA 4ZEKA 2QS3A 3VLVA 1PBPA 3MZ1A 4EDPA 2XXIA 3S9NC 2I58A 4X1BA 3O66A 1MY1A 2X7QA 1N3WA 3SEUA 3LC8A 4H5FA 2D3IA 1LFHA 3CFLA 3K02A 5I57A 1A40A 4IO6A 3RTWB 5H8FB 3RGYA 1MQJA 4XIGQ 3VV5A 1FTLA 5ISUA 3OEKA 5DYHA 2R6GE 2BJJX 3V5AA 2Z8DA 1ZBMA 3F11A 2UVIA 3UA8A 2V25A 1JW4A 4NF5B 4LA9A 1BP5A 1R9QA 1H3DA 5ICTA 2GHAA 3ZS6A 1IXIA 4BDRA 4R72A 1M5EA 2ZYKA 3MZ9A 2QSXA 1POY1 1O7TA 4OTEA 2DYXA 4YB6A 3WAEA 1B4ZA 3DLNA 2OJTA 1SDXA 4BDQA 1SW1A 1OQGA 1LB8A 4BLAA 3VXCA 1B7HA 2DXYA 2D5WA 4K3FA 2YPNA 1XHYA 1HSLA 5EHSA 3SETA 3KGCA 1VE4A 5AA2B 1JVXA 2Y7RA 4O3CA 3VLUA 2QRYA 1A8EA 2ZYMA 5CC2A 1AIVA 2UVGA 3K2DA 1M5BA 3TTLA 1OVTA 2G29A 5FHOA 1JW5A 3GZGA 4F3PA 3MUQA 2H98A 1LAXA 4LP2B 3KN8A 4IO5A 5AA3A 4FAJA 4KQPA 1UIUA 4TLMB 2PX1A 5FHMA 3FXRA 3V89B 3B7DA 3L6GA 3DP6A 1LFGA 3LSWA 3CVGA 1UTHA 3PPPA 1B9JA 1UQWA 4G8MA 4ELOA 1NNKA 1Y1ZA 1MH3A 5JEIA 3PMVA 5CRYA 2ALUA 4KPTA 4F3BA 4OESA 5H8QA 3MWBA 3CFZA 1YPNA 4XKRA 3MC2A 1LCTA 1XC1A 1IXHA 1LB9A 2Q9TA 3CIJA 1NL5A 3KBRA 2W7YA 3JZJA 3U8QA 2HAUA 4YAHX 4ESXA 1SYIA 4FEBA 3S9LC 2I3VA 3IAZA 4EQBA 1N84A 3FVOA 2Y7KA 4DCYA 1LLSA 3RN8A 1MQDA 5L9MA 2I6EA 4QSCA 5I2KB 2B3FA 2Y7IA 3G3GA 2O7IA 3PMWA 1EZOA 5EHMA 4ZZEA 4GRKA 1B4HA 2GH9A 1OLAA 4Q0CA 4AB6A 3Q27A 3RT6B 5ICQA 1NKXA 1YTVA 1EU8A 2F97A 1N7WA 4KFQA 3OO8A 1IIWA 4IGRA 3S4UA 1SW2A 2LAOA 1USYH 1EZPA 4IO7A 3USDA 3OO7A 2Y7PA 5TP9A 2NVUB 4QSDA 4HCWA 5IAIA 4P0IA 1SVXB 3T9HB 5CBRA 2ONRA 1NFTA 1GVCA 1F9BA 4RNSA 3K00A 2I49A 2QMXA 1D3KA 3KEIA 2O84X 2QPQA 1B32A 2DS9A 4Q8RA 4LQ2A 1MQHA 1B1HA 4M1VA 4R75A 3VXBA 2AIXA 4DXCA 2QJEA 3I6VA 4HCYA 5CMKA 1MPCA 2F78A 3PPRA 1XOCA 5HBCA 4QFPA 5I59B 4JDFA 4RK2A 1FTMA 4GD5A 5AE4A 1Q35A 1R1NA 1J1NA 4QFOA 1NMUA 3FD3A 2UYEA 2XX7A 3E13X 1URDA 2ABHA 1II5A 2ZNUA 3MBPA 4U1OA 4LVQA 3W9WA 1MQGA 5FTIA 4OFOA 3TELA 5TPAB 4KCDA 3G3IA 3MP8A 3T93B 3PPQA 1B46A 4ZS9A 3QAXA 2OZZA 2RINA 4OEUA 4OXVA 2O6AA 3FZVA 1QUIA 4YU0A 2A5TB 1PB7A 1US5A 4RK9A 2DE3A 4I62A 2NXOA 2NWJA 1XVXA 3K6VA 3O6GA 1IZ1A 4DZ1A 1H44A 4R2FA 3T96B 4ONYA 5K2YA 4GF8A 3PUZE 3K6XA 3QIMA 4POWA 2AYSA 1RYXA 4ECFA 2AL5A 4UACA 4YKIA 1LFIA 1QUJA 3TUSA 2NOOA 1I69A 3SERA 1N76A 4F22A 3VVDA 4FORA 2NUVA 2H9BA 4EQ7A 2XXVA 3LR1A 1AMFA 4TOZA 4E0WA 4OETA 2GRVA 4ELRA 3K1MA 3H6TA 4H1XA 1CB6A 4F2QA 2OLBA 4LZ8A 4NWCA 5AA4B 1QW0A 3OELA 5H8NA 3Q28A 1WODA 1BTJA 4ZEFA 3VE1B 4NF8B 3VVEA 4QFNA 2PYYA 5I2NA 1FW0A 2HAVA 2ZNTA 1H45A 4NEDA 4HTGA 1SW5A 2XHDA 2R71A 2F7CA 1L5TA 4PETA 1AL3A 1MY3A 4IB2A 3HV1A 4R9FA 2HXWA 1MDQA 1XT8A 4GWOA 4ZE8A 3BFTA 3ZKLA 4ZEBA 3CI8A 1PB8A 1FTJA 2CMOA 1MPDA 3BBRA 3UP9A 2I0CA 2M8CA 3V83A 2DOJA 4ESWA 1MG1A 1P1OA 4PQJA 4LUBA 3KOSA 4ZE9A 3IJXB 4NWDA 4GIZA 3PUYE 4GFRA 1B0LA 4BDOA 2E0SA 3BFUA 3VLWA 3EF7A 1NH8A 1TFDA 4MF3A 4WXJA 3TEPA 3KSXA 4JWYA 1N0TA 1B3LA 4DE8A 2Q2CA 4NF4A 2XXHA 1MS7A 3O29A 2Z8EA 5L9SA 3FUZA 3O9PA 5KCJB 2XD3A 4QRZA 3PPNA 1GGGA 5A5XA 3M3KA 4F19A 4Z7EA 5LOMA 1DMBA 4MBPA 4R73A 4TQUQ 4R74A 1MY4A 3I3VA 4GL0A 1NNTA 1WVJA 1MXZA 3IB2A 5I58A 1LAFE 2REGA 2V93A 1UIVA 3PUXE 2XXUA 2VOZA 1ZU0A 1Y9UA 2XXWA 3VVFA 5H8HA 5BUUA 3FJMA 5BWJA 2O68A 1A55A 3N94A 3MP6A 5EYFA 4LQ5A 2PT1A 1JNFA 3C35A 3GBBA 3R7XA 3FJ7A 4XKNA 2H99A 4PFYA 3G7WA 1B3GA 2ZYOA 1O64A 2V84A 3K6WA 5I56A 2O69A 3KG2A 1US4A 1LGBC 2QS1A 2QS2A 4RPOA 5CM6A 1NNFA 3O6IA 4WEDA 1OMPA 3SKPA 5FTHA 1IEJA 3N5LA 2ZNSA 4XKQA 2F8DA 3MPKA 5I57B 4PFUA 2UVHA 2OCUA 4P11A 2QL3A 1MRPA 3CSGA 3LSFB 4DLDA 1DOTA 2KLFA 4KYDA 2DSFA 4G68A 4ZECA 3OSRA 4G4PA 4IY6A 3QYTA 4RXLA 2ZYNA 4FIMA 1MXYA 4NF6A 1VR5A 2UVJA 2QMWA 4OERA 3R26A 1USYE 4OEVA 3D4CA 4RYAA 2DWIA 2DVCA 3FATA 1D9VA 2PT2A 2RF1A 3CG1A 1DTGA 3TCFA 3G3FA 5I58B 3M3LA 5B7DA 3K6UA 2IEEA 2DWJA 4F1VA 1RYOA 1JVYA 3P7IA 3DM0A 2DE4A 4LONB 1MXUA 2OK2A 2ESNA 4N6PA 3UIFA 1R6ZA 4KYEA 2A5SA 3O97A 1I6BA 2Q8JA 1S50A 1R9LA 2I0BA 1GV8A 4U4SA 5JTYA 2DP8A 1ANFA 3IORA 1MQIA 1MM7A 3OEMA 2V3QA 2ONSA 3ILTB 4NTLA 5DVIA 1SBPA 3O2AA 2THIA 1IITA 1SI0A 1HSEA 4WKMA 4ZEDA 3UGWA 1UTHB 2VGQA 1DSNA 3A09A 5DT6A 3IR1A 4IY5A 1AOVA 1QUKA 4MFIA 3SDFA 3THIA 2VD3A 4EXLA 3GBAA 4KCCA 5KDTA 2H4IA 1URSA 5H8QB 1Y4TA 4C1UA 3H6UA 4Q5TA 4R6YA 2AL4A 1QJMA 4C1TA 2IA4A 1HSJA 4BDNA 1IQ7A 3KN7A 1H43A 3KN3A 3PMXA 4H8IA 4EQ9A 3H6VA 3K1NA 4ZDMA 3QSLA 3N6UA 1B3EA 2DQVA 2R9JA 1IUDA 3HO7A 3EHSA 2I4BA 3IO4A 3PD8A 1VFDA 1Z7NE 1QVSA 4E0XA 3RTFB 4AB5A 4ND9A 3T9UA 1Y3NA 2OWSA 2RCAA 3DELB 4I1DA 2YJPA 3OD7A 4ZZAA 4KR5A 3VFJA 3PU5A 4AQ4A 1BLFA 5CMMA 4IO3A 3HN0A 2VD2A 4JSOA 4U1ZA 1D4NA 1MM6A 1ZMGA 2F7AA 3PUWE 4N13A 4H6DA 4MLVA 4OENA 3IO6A 2F5XA 2YLNA 4OQOA 3MPLA 5TP9B 5KDTB 2DWAA 3TODA 1M5FA 3LSXA 1SD3A 2XXXA 2X26A 4FECA 3VDFA 5ITOA 4F1YA 3JV9A 4OYVA
chains in the Genus database with same CATH superfamily
4OWDA 3RPLB 4POXA 3Q25A 2Q2AA 4QXDA 4KD5A 1P99A 4H5GA 3TTRA 1MY0A 2QFLA 3MW0A 1LBZA 3U72A 3FXUA 2O7UA 1OVBA 2WKYA 1B05A 3TKDA 2GFEA 1JP4A 3MP1A 3PV0E 1NNPA 2V3UA 4OZ9A 3IOUA 5AA2D 3H4ZA 4WEPA 3HSTA 2B4MA 4PFIA 1PBQA 1FQDA 1UTBA 5DEXA 2O1MA 1Z7ME 2ANJA 3HHGA 4I8CA 4X9TA 1CE2A 3B6TA 2XD2A 1LAGE 2HCAA 4R2BA 3RUMA 3E79A 1VFEA 2F6GA 1JEVA 3E3KA 3T0JA 4Q30B 5DW8A 1VSOA 4ZEIA 1DPEA 1FQBA 1YXIA 4QF9A 1PC3A 4XEQA 4RJZA 3IL1B 1BIYA 3TAJA 1TXFA 3OMBA 4QFLA 4U4XA 1RKMA 3TYHA 2I4CA 2REJA 4NE4A 4THIA 3K1PA 3IK6B 1B52A 4H8JA 3SESA 4JB7A 1FBHA 3FXQA 2PVUA 3A29A 5H8FA 4EUOA 1TWYA 4PAFA 4RA1A 5F24A 2OWTA 3FGSA 3K0VA 3K01A 4UA8A 5CMBA 1NV3A 1MH4A 1PB9A 3SEWA 1SYHA 1JW1A 4HS7A 1ZJLA 4BDLA 4RPNA 4PE5B 1NUWA 4NF5A 3RLFE 3PTYA 1B1XA 2WYKA 3OXNA 4HW8A 2PCRA 2VPNA 3SEYA 1LBBA 1B6HA 5HM4B 1EZ9A 1LCFA 1P1NA 1YYZA 1MXWA 2F35A 1P1WA 2DXRA 4NMYA 3SEXA 4PFWA 4MAGA 5K2XA 3M3FA 4EF2A 3TMGA 2O51A 4M4GA 4OA4A 5DEXB 5KZTA 4PFRA 2CZKA 4O3BA 4N8YA 4R9GA 2HQ0A 4GX4A 2RCBA 2HXRA 2QS4A 3T22A 5IM2A 4C0RA 3U92A 1JETA 3PGFA 1MDP1 4OVRA 5AA2A 3LSLA 4PDDA 2P0SA 4Z0IA 1G0HA 5I84A 2P2AA 1NV4A 1M5CA 1ZTYA 1B7UA 5H8NB 3IB1A 3H03A 5DTBA 4JVCA 4GXSB 2WBBA 1IMFA 1DTZA 2ZXTA 2Q74A 3MVZA 1Q1KA 4BDMA 2VHAA 3FVGA 5I2NB 2I48A 2KQZA 3CFXA 3TTKA 2ZZVA 5CI5A 3OSQA 4PF8A 3MAMA 3MVXA 4ELPA 5M2VA 5B70A 3C36A 4MH5A 2I3WA 1FBFA 3ZSFA 4JBZA 3TCHA 1NV5A 3LBSA 4LATA 2WEFA 3N26A 1A99A 3TQWA 3FIRA 3T66A 1Y3QA 4F39A 1SI1A 5FBPA 2HZKA 3CSBA 1B51A 3RPWA 2DVZA 4O3AA 4YMBA 4OFJA 5IZ3A 5ELVA 4H65A 4GXAA 4ELQA 1OIBA 4F2OA 4H67A 3IOWA 1FTOA 3H7MA 3H3GA 1IMDA 2FBPA 3G3JA 4XTCQ 4YKKA 3WAFA 1T0KA 4F18A 4DXUA 3O6HA 4N07A 4PTKA 1FBCA 2HFBA 4JVDA 4MLQA 3C32A 2E1SA 2Q89A 5FHNA 1DK4A 4QFKA 2HZLA 4GVOA 1B58A 4QBAA 1SQYA 4FATA 3B6WA 4G68C 3B8BA 5I2KA 1B5HA 3FVNA 3KOTA 1S9TA 1YAEA 5IGAA 1G0IA 3FV2A 3MQ9A 4NF4B 2Y84A 4GWSA 1FCKA 4ISUA 4YMAA 3H6WA 3ODBA 2H5YA 3GXAA 4MJOA 5A5XB 3GLBA 3RT8A 4YB5A 1FTKA 3C33A 3UN6A 1FJ6A 3N6TA 4N17A 2RC9A 1NV2A 3TTMA 1OLCA 3EHUA 3HCQA 4N15A 2O1LA 2UXAA 2P1SA 1JEUA 3CRBA 1MXXA 5H8HB 3ECRA 4EF1A 3D4GA 2VP1A 4IGTA 1YZ0A 3EN3A 3BIHA 4G2ZA 5IZ3B 2PMSA 1QKBA 1N04A 1P1QA 4LZ5A 3CG3A 1B3FA 5TU0A 3OO9A 5IZ1A 1ZIUA 4YZZA 1MXVA 3ILUB 1NH7A 4KI0E 1Y20A 3IB0A 3MVWA 2D21A 1DPPA 4LZ7A 1M5DA 3H06B 4OFLA 3LUYA 1FQFA 3OOAA 1NUXA 5I56B 3IOVA 2XXPA 1S7YA 3TCGA 3G3KA 3CR9A 1AH5A 1FBGA 3HPIA 3UORA 1LBXA 3AXFA 1GR2A 1JQFA 4KXPA 1GTKA 1P1UA 3EQ1A 1OQHA 3HHFA 1MY2A 2DWHA 3S9MC 2F34A 2XWVA 1B5IA 3KFMA 5I59A 4RY1A 4DIGA 5F1QA 2HEUA 2PFYA 3TQLA 4G68B 4TLLB 5ITPA 1A8FA 3T9XB 3KJ7A 3O28A 4GX6A 1N7XA 3OENA 4GQOA 3FV1A 4JWOA 4NF6B 5LTCA 3EPEA 2ZMBA 3EHTA 5IKBA 4OHNA 4MNPA 3BKIB 2F6PA 1FQEA 3PUVE 3Q29A 5A5LA 3QUJA 3FBPA 5J1DA 3U93A 3B6QA 4QSEA 5L9OA 4NG7A 3FASA 1LBCA 5DVJA 5TPAA 3SZPA 1Y1MA 4G77A 4G61A 1QULA 4F3SA 4L17A 3KJTA 4XKPA 1Y4CA 4KYSA 4I3EA 1ELJA 4IO4A 3A3CA 2V3TA 1ZKBA 5F7VA 2A5TA 3IX1A 2Q88A 2DE2A 2RKMA 2RC7A 1B3HA 2FYIA 5DVFA 2XWKA 3MZBA 4G8NA 2XXQA 1XVYA 4JXIA 1PDAA 2XX9A 4KHZE 5JTYB 1FPFA 3PD9A 3LV0A 1TFAA 5EYGA 4JWXA 4OVJA 4DXBA 4GWYA 4U21A 2XX8A 3QUFA 3RQTA 4GOTA 3QXMA 4IO2A 4YICA 3KSJA 3C31A 2XA5A 3KBZA 3DP4A 3TZAA 4I9DA 1IXGA 1FBPA 3G3HA 4H0WA 1FQAA 3M8UA 2QVRA 3KZGA 2XXTA 1IMAA 3LUZA 3JYRA 2Y7WA 4XXUA 3U1OA 2VPOA 2UYFA 4U22A 4OVTA 2B65A 1WDNA 1B40A 2OBGA 1O63A 1EH3A 4QHQA 4YKPA 1N3XA 4GBVA 4U23A 5AA4A 1FJ9A 4NX1A 2Z8FA 3FVKA 3W9VA 3U94A 3DP8A 3IJOB 4R6KA 4PFTA 5I3SA 1TT1A 4NF8A 3R6UA 4OVQA 1A54A 3T9VA 4H46A 1PEBA 4PF6A 3B50A 3V8XB 5AA1A 1B2HA 3IFAA 2CZHA 4F29A 3W15C 1URGA 3I5OA 3E9XA 4MNCA 2Z22A 1KA1A 4FE8A 5JK4A 4X1DA 4NF0A 4G8HA 1ATGA 4DDDA 1KWHA 3FJGA 2X7PA 4O7MA 3RNNA 3IOTA 4PP0A 3TPAA 4FJPA 2F7BA 2OX3A 3TTNA 1LSTA 4GL8A 3NOHA 1FRPA 3ZKKA 2RC8A 1LAHE 1XS5A 2XXYA 4JSDA 2H25A 3S9EA 1IMEA 2ONKE 4EXKA 1ZLQA 2G93A 1A7LA 1RDYA 3SEVA 1FPKA 4U2RA 4R6HA 3A3UA 3MJNA 5L8DA 5H8SA 1QKAA 3IFCA 3C4MA 1H76A 3K4UA 3C9HA 1D9YA 1I6QA 3TDJA 5CMCA 4AS5A 2B3BA 1B0HA 2HHMA 4DCXA 1POTA 3C34A 4P1EA 4X48A 1MPBA 1D9QA 1KZ8A 4FEDA 4YKJA 3ONMA 4F1UA 3MVYA 5KCJA 2PBWA 4HE0A 4F31B 2GHBA 5HPQA 3Q26A 3RY3A 2CZLA 2PFZA 4XFEA 2Z23A 3E4RA 1YCJA 1BKAA 4YB7A 5ESYA 4NAPA 3QK6A 2V4CA 1B5JA 1FQCA 3UK4A 3L6HA 1Y3PA 2FNCA 1B7ZA 1I6AA 4F3GA 1AWBA 1UTBB 4P0GA 1CNQA 3S2VA 4GWXA 1IXCA 4GLIA 3TFLA 3OO6A 1SW4A 2FA7A 2XXRA 1BK4A 4OMBA 5CBSA 2F36A 3PPOA 4ZEKA 4O7IA 2QS3A 3VLVA 1PBPA 4GWWA 4I3YA 3MZ1A 4EDPA 2XXIA 3S9NC 4X04A 2I58A 4X1BA 3O66A 1NI9A 1MY1A 2X7QA 1N3WA 3SEUA 3LC8A 5EQAA 4H5FA 3ISPA 2D3IA 1LFHA 3CFLA 3K02A 2FVZA 5I57A 1A40A 1FBDA 4IO6A 3RTWB 4HE1A 5H8FB 3RGYA 1MQJA 4XIGQ 3VV5A 2BJIA 1FTLA 4P56A 5ISUA 3OEKA 5DYHA 2R6GE 4N8GA 2BJJX 3V5AA 2Z8DA 1ZBMA 3F11A 2UVIA 3UA8A 2V25A 3ROJA 4GX3A 1JW4A 4NF5B 4LA9A 4N6DA 1BP5A 1R9QA 1H3DA 5ICTA 2GHAA 3ZS6A 1IXIA 4BDRA 4R72A 1M5EA 2ZYKA 3MZ9A 2QSXA 1POY1 1O7TA 3KC0A 4OTEA 2DYXA 4YB6A 3WAEA 2CEYA 1B4ZA 3DLNA 5EQ7A 2OJTA 1NV0A 1SDXA 4BDQA 2QVVA 2DDKA 1SW1A 4MEVA 1OQGA 1LB8A 4BLAA 3VXCA 1B7HA 2DXYA 2D5WA 4K3FA 2YPNA 1XHYA 1HSLA 5EHSA 3SETA 3KGCA 1VE4A 5AA2B 1JVXA 2Y7RA 4O3CA 3VLUA 2QRYA 1A8EA 2ZYMA 5CC2A 1AIVA 2UVGA 3K2DA 4JVIA 1M5BA 3TTLA 4MNIA 1OVTA 2G29A 5FHOA 1JW5A 3GZGA 4F3PA 3MUQA 2H98A 1LAXA 4LP2B 3KN8A 4IO5A 5AA3A 4FBPA 4FAJA 4KQPA 1UIUA 4TLMB 2PX1A 5FHMA 3FXRA 3V89B 1KA0A 2P3VA 3B7DA 3L6GA 3DP6A 1IMBA 3E78A 1LFGA 3LSWA 3CVGA 1UTHA 3PPPA 1B9JA 1UQWA 4G8MA 3FXBA 4ELOA 1NNKA 1Y1ZA 1MH3A 5JEIA 3PMVA 5CRYA 2ALUA 4KPTA 4F3BA 4PFBA 4OESA 5H8QA 3MWBA 3CFZA 1YPNA 4XKRA 3MC2A 1LCTA 1XC1A 1IXHA 1LB9A 2Q9TA 3D1RA 3CIJA 1NL5A 4GWUA 3KBRA 2W7YA 3JZJA 3U8QA 2GQ1A 2HAUA 4YAHX 4ESXA 1SYIA 4FEBA 3S9LC 2I3VA 3IAZA 4EQBA 1N84A 1LBVA 4PDHA 3FVOA 2Y7KA 4DCYA 1LLSA 3RN8A 1MQDA 5L9MA 2I6EA 4QSCA 5I2KB 2B3FA 2Y7IA 3G3GA 2O7IA 3PMWA 1DBZA 1EZOA 5EHMA 4ZZEA 4GRKA 4DI4B 1B4HA 2GH9A 2WYPA 1OLAA 4Q0CA 4AB6A 2ZZWA 3Q27A 3RT6B 5LDZA 2FIEA 4MX6A 5ICQA 2Y5LA 1NKXA 1YTVA 1EU8A 2F97A 1N7WA 4KFQA 3OO8A 2F3BA 5EYHA 1IIWA 4IGRA 3S4UA 1SW2A 4N6KA 3T1BA 2LAOA 1USYH 1EZPA 4IO7A 3USDA 3OO7A 2Y7PA 5I7IA 5TP9A 2NVUB 4QSDA 4HCWA 5IAIA 4LN5A 4P0IA 4OVPA 1SVXB 3T9HB 5CBRA 2ONRA 1NFTA 3RPLA 1GVCA 1F9BA 4RNSA 3K00A 2I49A 2QMXA 1D3KA 3KEIA 2O84X 2QPQA 1FPIA 1IMCA 1B32A 2DS9A 4Q8RA 1LBWA 4LQ2A 1MQHA 3U65A 1B1HA 4M1VA 4R75A 3VXBA 2AIXA 4DXCA 2QJEA 3I6VA 4HCYA 5CMKA 1MPCA 2F78A 3PPRA 1XOCA 5HBCA 4QFPA 1SPIA 5I59B 2ZZXA 4JDFA 4RK2A 1FTMA 4GD5A 5AE4A 1Q35A 1R1NA 1VDWA 1NV6A 4PC9A 1J1NA 4QFOA 1NMUA 1LEVA 3FD3A 4XF5A 4GBWA 4NN3A 2UYEA 2XX7A 1EYIA 3E13X 4HXVA 4PGPA 1URDA 2ABHA 1II5A 2ZNUA 3MSTA 3MBPA 4U1OA 3EKIA 4LVQA 4GWZA 3W9WA 1MQGA 5FTIA 4OFOA 3TELA 5TPAB 4KCDA 1FSAA 3G3IA 3MP8A 4UABA 3T93B 3PPQA 1B46A 4ZS9A 3QAXA 4P9KA 2OZZA 2RINA 4OEUA 4OXVA 2O6AA 3FZVA 1QUIA 4YU0A 2A5TB 1PB7A 1US5A 4RK9A 2DE3A 4I62A 2NXOA 5ET5A 2NWJA 1XVXA 3K6VA 3O6GA 1IZ1A 4DZ1A 1H44A 2B4LA 4R2FA 3T96B 4ONYA 5K2YA 4GF8A 4PGNA 3PUZE 3K6XA 3QIMA 2CEXA 4POWA 2AYSA 1RYXA 4ECFA 2AL5A 4UACA 4YKIA 1LFIA 1QUJA 2XWOA 2OWZA 3TUSA 2NOOA 1I69A 4P47A 3SERA 1N76A 4AS4A 4F22A 3VVDA 4FORA 2NUVA 2H9BA 1QGXA 4EQ7A 2XXVA 3LR1A 4OVSA 1AMFA 4TOZA 4E0WA 4OETA 2GRVA 2CZIA 1Q9DA 4ELRA 3GYYA 3K1MA 3H6TA 3RYDA 4H1XA 1CB6A 1EYJA 4F2QA 2OLBA 4LZ8A 4NWCA 5AA4B 1QW0A 3OELA 5H8NA 1FTAA 3Q28A 1WODA 1BTJA 4ZEFA 3VE1B 4NF8B 3VVEA 4QFNA 2PYYA 5I2NA 1FW0A 2HAVA 1INPA 2QVUA 2ZNTA 1H45A 3QMFA 4NEDA 4HTGA 1SW5A 2XHDA 2R71A 2F7CA 1L5TA 4PETA 1AL3A 5T3JA 1MY3A 4IB2A 4N4UA 4MCOA 3HV1A 4R9FA 2HXWA 1MDQA 1XT8A 1DCUA 4GWOA 4I40A 4ZE8A 3BFTA 3ZKLA 4ZEBA 3CI8A 2JJKA 4O94A 4N81A 5EQ8A 2KR0A 1PB8A 1FTJA 2CMOA 1MPDA 3BBRA 3UP9A 2I0CA 2M8CA 3V83A 4PBHA 4DI3D 2DOJA 2WX9A 4ESWA 1MG1A 1P1OA 4PQJA 4LUBA 3KOSA 4ZE9A 2MKZA 2FHYA 3IJXB 4NWDA 4GIZA 3PUYE 4GFRA 1B0LA 4BDOA 2E0SA 3BFUA 3VLWA 3EF7A 4OANA 1NH8A 1TFDA 4MF3A 5IZZA 4WXJA 3TEPA 3KSXA 4JWYA 1N0TA 1B3LA 4DE8A 2Q2CA 4NF4A 2XXHA 1MS7A 3O29A 2Z8EA 5L9SA 3FUZA 3O9PA 5KCJB 2XD3A 4QRZA 3PPNA 1GGGA 5A5XA 3M3KA 4F19A 4Z7EA 5LOMA 1FPLA 1DMBA 4MBPA 4R73A 4TQUQ 4R74A 1MY4A 3I3VA 4GL0A 1NNTA 1WVJA 1MXZA 1FBEA 3IB2A 5I58A 1LAFE 3PUXE 2REGA 2V93A 1UIVA 2XXUA 2VOZA 4PE3A 1ZU0A 2Y5KA 1Y9UA 2XXWA 3VVFA 5I5PA 5H8HA 5BUUA 3FJMA 5BWJA 2O68A 4P8BA 1A55A 3N94A 3MP6A 5EYFA 4LQ5A 2PT1A 1JNFA 3C35A 3GBBA 3R7XA 3FJ7A 4XKNA 2H99A 5J16A 4PFYA 3G7WA 4NGUA 1B3GA 2ZYOA 1NV1A 1O64A 2V84A 3K6WA 5I56A 2O69A 3KG2A 1US4A 1LGBC 2QS1A 2QS2A 4RPOA 5ET8A 5CM6A 1NNFA 3O6IA 4P3LA 4WEDA 1OMPA 3SKPA 5FTHA 1IEJA 3N5LA 2ZNSA 4XKQA 1K9YA 2F8DA 3MPKA 5I57B 4PFUA 2UVHA 2OCUA 4P11A 1NUZA 2QL3A 1MRPA 3CSGA 3LSFB 4DLDA 1DOTA 2KLFA 4KYDA 2DSFA 4G68A 4ZECA 3OSRA 4G4PA 4IY6A 3QYTA 4MMPA 4RXLA 2ZYNA 4FIMA 1MXYA 4NF6A 1VR5A 1FPJA 2UVJA 2QMWA 4OERA 3R26A 1USYE 4OEVA 4HE2A 3D4CA 4RYAA 2DWIA 2DVCA 3FATA 1D9VA 2PT2A 4X8RA 2RF1A 3CG1A 1DTGA 3TCFA 3G3FA 5I58B 3M3LA 5B7DA 1FPEA 2P3NA 3K6UA 2IEEA 4N91A 1RDXA 3HFUA 2DWJA 4F1VA 4P1LA 4MHFA 1RYOA 1JVYA 3P7IA 5ET6A 1XI6A 4PAIA 3DM0A 2DE4A 4LONB 1MXUA 2FIXA 2OK2A 2ESNA 4N6PA 3UIFA 1FPDA 1R6ZA 4KYEA 2A5SA 4NHBA 3O97A 1I6BA 2Q8JA 1S50A 4O8MA 1R9LA 2I0BA 1EYKA 1GV8A 4H45A 4U4SA 5JTYA 2DP8A 1ANFA 1RDZA 1K9ZA 3IORA 1MQIA 1MM7A 3OEMA 2VT5A 2V3QA 2ONSA 3ILTB 2F3DA 4NTLA 5DVIA 1SBPA 3O2AA 2THIA 1IITA 1SI0A 4PBQA 1HSEA 4WKMA 4ZEDA 3UGWA 1UTHB 2VGQA 2XWIA 1DSNA 3A09A 5DT6A 3IR1A 4IY5A 4MIJA 1AOVA 1QUKA 4MFIA 3SDFA 3THIA 2VD3A 4EXLA 3GBAA 2XXKA 4KCCA 5KDTA 2H4IA 1URSA 5H8QB 1Y4TA 4C1UA 4PAKA 3H6UA 4Q5TA 4R6YA 2WBDA 2AL4A 1QJMA 4C1TA 2IA4A 3CHGA 2R8TA 1HSJA 4BDNA 1IQ7A 3KN7A 1H43A 3KN3A 3PMXA 4H8IA 4EQ9A 3H6VA 3K1NA 4ZDMA 3QSLA 3N6UA 1B3EA 2DQVA 2R9JA 1IUDA 3HO7A 3EHSA 2I4BA 3IO4A 3PD8A 1VFDA 1Z7NE 1QVSA 4E0XA 3RTFB 4AB5A 4ND9A 3T9UA 1Y3NA 3KC1A 1LBYA 2OWSA 2RCAA 1FPGA 2HPGA 3DELB 4I1DA 2YJPA 3OD7A 2Q8MA 4ZZAA 4KR5A 5EQ9A 3VFJA 3PU5A 4AQ4A 1BLFA 5CMMA 4IO3A 3HN0A 3BIGA 2VD2A 4JSOA 4NQ8A 4U1ZA 1FPBA 1D4NA 1MM6A 4IR8A 1ZMGA 2F7AA 1NV7A 3PUWE 4N13A 4H6DA 4MLVA 4OENA 4PCDA 5ET7A 3IO6A 2F5XA 2YLNA 4OQOA 3MPLA 5TP9B 5KDTB 2DWAA 3TODA 1M5FA 3LSXA 1SD3A 2XXXA 2X26A 4FECA 3VDFA 2L5VA 5ITOA 1NUYA 3MYUA 4F1YA 3JV9A 4OYVA
chains in the Genus database with same CATH topology
4OWDA 4POXA 3Q25A 2Q2AA 4KD5A 1P99A 4H5GA 3TTRA 1MY0A 3MW0A 3U72A 3FXUA 2O7UA 1OVBA 2WKYA 1B05A 3TKDA 2GFEA 3MP1A 3PV0E 1NNPA 2V3UA 4OZ9A 3IOUA 5AA2D 3H4ZA 4WEPA 3HSTA 1PBQA 1FQDA 1UTBA 5DEXA 2O1MA 1Z7ME 2ANJA 3HHGA 4I8CA 4X9TA 1CE2A 3B6TA 2XD2A 1LAGE 2HCAA 4R2BA 3RUMA 1VFEA 2F6GA 1JEVA 3E3KA 4Q30B 1VSOA 4ZEIA 1DPEA 1FQBA 4QF9A 1PC3A 4RJZA 3IL1B 1BIYA 3TAJA 1TXFA 3OMBA 4QFLA 4U4XA 1RKMA 3TYHA 2I4CA 2REJA 4NE4A 4THIA 3K1PA 3IK6B 1B52A 4H8JA 3SESA 4JB7A 3FXQA 2PVUA 5H8FA 4EUOA 1TWYA 4RA1A 2OWTA 3FGSA 3K0VA 3K01A 4UA8A 5CMBA 1MH4A 1PB9A 3SEWA 1SYHA 1JW1A 4HS7A 1ZJLA 4BDLA 4RPNA 4PE5B 4NF5A 3RLFE 1B1XA 3OXNA 4HW8A 3SEYA 1LBBA 1B6HA 5HM4B 1EZ9A 1LCFA 1P1NA 1MXWA 2F35A 1P1WA 2DXRA 4NMYA 3SEXA 4PFWA 5K2XA 3M3FA 4EF2A 3TMGA 2O51A 4M4GA 5DEXB 5KZTA 4O3BA 4R9GA 2HQ0A 2RCBA 2QS4A 3T22A 4C0RA 3U92A 1JETA 3PGFA 1MDP1 5AA2A 3LSLA 2P0SA 4Z0IA 5I84A 2P2AA 1M5CA 1ZTYA 1B7UA 5H8NB 3IB1A 3H03A 5DTBA 4GXSB 1DTZA 2ZXTA 4BDMA 3MVZA 1Q1KA 2VHAA 3FVGA 5I2NB 2I48A 3CFXA 3TTKA 5CI5A 3OSQA 3MAMA 3MVXA 4ELPA 5M2VA 5B70A 3C36A 4MH5A 2I3WA 3ZSFA 4JBZA 3TCHA 3LBSA 4LATA 3N26A 1A99A 3TQWA 3FIRA 3T66A 1Y3QA 4F39A 1SI1A 2HZKA 3CSBA 1B51A 3RPWA 2DVZA 4O3AA 4YMBA 4OFJA 5ELVA 4H65A 4GXAA 4ELQA 1OIBA 4F2OA 4H67A 3IOWA 1FTOA 3H7MA 3H3GA 3G3JA 4XTCQ 4YKKA 3WAFA 1T0KA 4F18A 4DXUA 3O6HA 4N07A 2HFBA 4MLQA 3C32A 2E1SA 2Q89A 5FHNA 4QFKA 2HZLA 4GVOA 1B58A 1SQYA 4FATA 3B6WA 4G68C 5I2KA 1B5HA 3FVNA 3KOTA 1S9TA 1YAEA 3FV2A 3MQ9A 4NF4B 2Y84A 1FCKA 4ISUA 4YMAA 3H6WA 3ODBA 2H5YA 3GXAA 5A5XB 3GLBA 3RT8A 4YB5A 1FTKA 3C33A 3UN6A 3N6TA 2RC9A 3TTMA 1OLCA 3EHUA 3HCQA 2O1LA 2UXAA 2P1SA 1JEUA 3CRBA 1MXXA 5H8HB 3ECRA 4EF1A 3D4GA 2VP1A 4IGTA 3EN3A 4G2ZA 2PMSA 1QKBA 1N04A 1P1QA 4LZ5A 3CG3A 1B3FA 5TU0A 3OO9A 1ZIUA 4YZZA 1MXVA 3ILUB 1NH7A 4KI0E 1Y20A 3IB0A 3MVWA 2D21A 1DPPA 4LZ7A 1M5DA 3H06B 4OFLA 3LUYA 1FQFA 3OOAA 5I56B 3IOVA 2XXPA 1S7YA 3TCGA 3G3KA 3CR9A 1AH5A 3HPIA 3UORA 3AXFA 1GR2A 1JQFA 1GTKA 1P1UA 3EQ1A 1OQHA 3HHFA 1MY2A 2DWHA 3S9MC 2F34A 1B5IA 3KFMA 5I59A 4RY1A 4DIGA 5F1QA 2HEUA 3TQLA 4G68B 4TLLB 5ITPA 1A8FA 3T9XB 3KJ7A 3O28A 1N7XA 3OENA 4GQOA 3FV1A 4JWOA 4NF6B 3EPEA 2ZMBA 3EHTA 5IKBA 4OHNA 3BKIB 2F6PA 1FQEA 3PUVE 3Q29A 3QUJA 5J1DA 3U93A 3B6QA 4QSEA 5L9OA 3FASA 1LBCA 5DVJA 5TPAA 1Y1MA 4G77A 1QULA 4F3SA 4L17A 3KJTA 4XKPA 1Y4CA 4KYSA 1ELJA 4IO4A 3A3CA 2V3TA 1ZKBA 5F7VA 2A5TA 3IX1A 2Q88A 2DE2A 2RKMA 2RC7A 1B3HA 2FYIA 5DVFA 3MZBA 4G8NA 2XXQA 1XVYA 4JXIA 1PDAA 2XX9A 4KHZE 5JTYB 3PD9A 1TFAA 4JWXA 4OVJA 4DXBA 4U21A 2XX8A 3QUFA 3RQTA 4GOTA 3QXMA 4IO2A 4YICA 3KSJA 3C31A 3TZAA 3DP4A 4I9DA 1IXGA 3G3HA 4H0WA 1FQAA 3M8UA 3KZGA 2XXTA 3JYRA 2Y7WA 4XXUA 3U1OA 2UYFA 4U22A 2B65A 1WDNA 1B40A 2OBGA 1O63A 1EH3A 4QHQA 4YKPA 1N3XA 4U23A 5AA4A 2Z8FA 3FVKA 3W9VA 3U94A 3DP8A 3IJOB 4R6KA 4PFTA 1TT1A 4NF8A 3R6UA 1A54A 3T9VA 1PEBA 3V8XB 5AA1A 1B2HA 4F29A 3W15C 1URGA 3I5OA 3E9XA 2Z22A 4FE8A 5JK4A 4X1DA 4G8HA 1ATGA 4DDDA 1KWHA 3FJGA 2X7PA 3RNNA 3IOTA 4PP0A 3TPAA 4FJPA 2F7BA 3TTNA 1LSTA 4GL8A 3ZKKA 2RC8A 1LAHE 1XS5A 2XXYA 4JSDA 2H25A 3S9EA 2ONKE 4EXKA 1ZLQA 2G93A 1A7LA 3SEVA 4U2RA 4R6HA 3A3UA 3MJNA 5L8DA 5H8SA 1QKAA 3C4MA 1H76A 3K4UA 3C9HA 1D9YA 1I6QA 3TDJA 5CMCA 2B3BA 1B0HA 4DCXA 1POTA 3C34A 4X48A 1MPBA 4FEDA 4YKJA 3ONMA 4F1UA 3MVYA 5KCJA 2PBWA 4F31B 2GHBA 5HPQA 3Q26A 3RY3A 2CZLA 2Z23A 3E4RA 1YCJA 1BKAA 4YB7A 3QK6A 1B5JA 1FQCA 3UK4A 3L6HA 1Y3PA 2FNCA 1B7ZA 1I6AA 4F3GA 1UTBB 4P0GA 3S2VA 1IXCA 4GLIA 3TFLA 3OO6A 1SW4A 2FA7A 2XXRA 4OMBA 5CBSA 2F36A 3PPOA 4ZEKA 2QS3A 3VLVA 1PBPA 3MZ1A 4EDPA 2XXIA 3S9NC 2I58A 4X1BA 3O66A 1MY1A 2X7QA 1N3WA 3SEUA 3LC8A 4H5FA 2D3IA 1LFHA 3CFLA 3K02A 5I57A 1A40A 4IO6A 3RTWB 5H8FB 3RGYA 1MQJA 4XIGQ 3VV5A 1FTLA 5ISUA 3OEKA 5DYHA 2R6GE 2BJJX 3V5AA 2Z8DA 1ZBMA 3F11A 2UVIA 3UA8A 2V25A 1JW4A 4NF5B 4LA9A 1BP5A 1R9QA 1H3DA 5ICTA 2GHAA 3ZS6A 1IXIA 4BDRA 4R72A 1M5EA 2ZYKA 3MZ9A 2QSXA 1POY1 1O7TA 4OTEA 2DYXA 4YB6A 3WAEA 1B4ZA 3DLNA 2OJTA 1SDXA 4BDQA 1SW1A 1OQGA 1LB8A 4BLAA 3VXCA 1B7HA 2DXYA 2D5WA 4K3FA 2YPNA 1XHYA 1HSLA 5EHSA 3SETA 3KGCA 1VE4A 5AA2B 1JVXA 2Y7RA 4O3CA 3VLUA 2QRYA 1A8EA 2ZYMA 5CC2A 1AIVA 2UVGA 3K2DA 1M5BA 3TTLA 1OVTA 2G29A 5FHOA 1JW5A 3GZGA 4F3PA 3MUQA 2H98A 1LAXA 4LP2B 3KN8A 4IO5A 5AA3A 4FAJA 4KQPA 1UIUA 4TLMB 2PX1A 5FHMA 3FXRA 3V89B 3B7DA 3L6GA 3DP6A 1LFGA 3LSWA 3CVGA 1UTHA 3PPPA 1B9JA 1UQWA 4G8MA 4ELOA 1NNKA 1Y1ZA 1MH3A 5JEIA 3PMVA 5CRYA 2ALUA 4KPTA 4F3BA 4OESA 5H8QA 3MWBA 3CFZA 1YPNA 4XKRA 3MC2A 1LCTA 1XC1A 1IXHA 1LB9A 2Q9TA 3CIJA 1NL5A 3KBRA 2W7YA 3JZJA 3U8QA 2HAUA 4YAHX 4ESXA 1SYIA 4FEBA 3S9LC 2I3VA 3IAZA 4EQBA 1N84A 3FVOA 2Y7KA 4DCYA 1LLSA 3RN8A 1MQDA 5L9MA 2I6EA 4QSCA 5I2KB 2B3FA 2Y7IA 3G3GA 2O7IA 3PMWA 1EZOA 5EHMA 4ZZEA 4GRKA 1B4HA 2GH9A 1OLAA 4Q0CA 4AB6A 3Q27A 3RT6B 5ICQA 1NKXA 1YTVA 1EU8A 2F97A 1N7WA 4KFQA 3OO8A 1IIWA 4IGRA 3S4UA 1SW2A 2LAOA 1USYH 1EZPA 4IO7A 3USDA 3OO7A 2Y7PA 5TP9A 2NVUB 4QSDA 4HCWA 5IAIA 4P0IA 1SVXB 3T9HB 5CBRA 2ONRA 1NFTA 1GVCA 1F9BA 4RNSA 3K00A 2I49A 2QMXA 1D3KA 3KEIA 2O84X 2QPQA 1B32A 2DS9A 4Q8RA 4LQ2A 1MQHA 1B1HA 4M1VA 4R75A 3VXBA 2AIXA 4DXCA 2QJEA 3I6VA 4HCYA 5CMKA 1MPCA 2F78A 3PPRA 1XOCA 5HBCA 4QFPA 5I59B 4JDFA 4RK2A 1FTMA 4GD5A 5AE4A 1Q35A 1R1NA 1J1NA 4QFOA 1NMUA 3FD3A 2UYEA 2XX7A 3E13X 1URDA 2ABHA 1II5A 2ZNUA 3MBPA 4U1OA 4LVQA 3W9WA 1MQGA 5FTIA 4OFOA 3TELA 5TPAB 4KCDA 3G3IA 3MP8A 3T93B 3PPQA 1B46A 4ZS9A 3QAXA 2OZZA 2RINA 4OEUA 4OXVA 2O6AA 3FZVA 1QUIA 4YU0A 2A5TB 1PB7A 1US5A 4RK9A 2DE3A 4I62A 2NXOA 2NWJA 1XVXA 3K6VA 3O6GA 1IZ1A 4DZ1A 1H44A 4R2FA 3T96B 4ONYA 5K2YA 4GF8A 3PUZE 3K6XA 3QIMA 4POWA 2AYSA 1RYXA 4ECFA 2AL5A 4UACA 4YKIA 1LFIA 1QUJA 3TUSA 2NOOA 1I69A 3SERA 1N76A 4F22A 3VVDA 4FORA 2NUVA 2H9BA 4EQ7A 2XXVA 3LR1A 1AMFA 4TOZA 4E0WA 4OETA 2GRVA 4ELRA 3K1MA 3H6TA 4H1XA 1CB6A 4F2QA 2OLBA 4LZ8A 4NWCA 5AA4B 1QW0A 3OELA 5H8NA 3Q28A 1WODA 1BTJA 4ZEFA 3VE1B 4NF8B 3VVEA 4QFNA 2PYYA 5I2NA 1FW0A 2HAVA 2ZNTA 1H45A 4NEDA 4HTGA 1SW5A 2XHDA 2R71A 2F7CA 1L5TA 4PETA 1AL3A 1MY3A 4IB2A 3HV1A 4R9FA 2HXWA 1MDQA 1XT8A 4GWOA 4ZE8A 3BFTA 3ZKLA 4ZEBA 3CI8A 1PB8A 1FTJA 2CMOA 1MPDA 3BBRA 3UP9A 2I0CA 2M8CA 3V83A 2DOJA 4ESWA 1MG1A 1P1OA 4PQJA 4LUBA 3KOSA 4ZE9A 3IJXB 4NWDA 4GIZA 3PUYE 4GFRA 1B0LA 4BDOA 2E0SA 3BFUA 3VLWA 3EF7A 1NH8A 1TFDA 4MF3A 4WXJA 3TEPA 3KSXA 4JWYA 1N0TA 1B3LA 4DE8A 2Q2CA 4NF4A 2XXHA 1MS7A 3O29A 2Z8EA 5L9SA 3FUZA 3O9PA 5KCJB 2XD3A 4QRZA 3PPNA 1GGGA 5A5XA 3M3KA 4F19A 4Z7EA 5LOMA 1DMBA 4MBPA 4R73A 4TQUQ 4R74A 1MY4A 3I3VA 4GL0A 1NNTA 1WVJA 1MXZA 3IB2A 5I58A 1LAFE 2REGA 2V93A 1UIVA 3PUXE 2XXUA 2VOZA 1ZU0A 1Y9UA 2XXWA 3VVFA 5H8HA 5BUUA 3FJMA 5BWJA 2O68A 1A55A 3N94A 3MP6A 5EYFA 4LQ5A 2PT1A 1JNFA 3C35A 3GBBA 3R7XA 3FJ7A 4XKNA 2H99A 4PFYA 3G7WA 1B3GA 2ZYOA 1O64A 2V84A 3K6WA 5I56A 2O69A 3KG2A 1US4A 1LGBC 2QS1A 2QS2A 4RPOA 5CM6A 1NNFA 3O6IA 4WEDA 1OMPA 3SKPA 5FTHA 1IEJA 3N5LA 2ZNSA 4XKQA 2F8DA 3MPKA 5I57B 4PFUA 2UVHA 2OCUA 4P11A 2QL3A 1MRPA 3CSGA 3LSFB 4DLDA 1DOTA 2KLFA 4KYDA 2DSFA 4G68A 4ZECA 3OSRA 4G4PA 4IY6A 3QYTA 4RXLA 2ZYNA 4FIMA 1MXYA 4NF6A 1VR5A 2UVJA 2QMWA 4OERA 3R26A 1USYE 4OEVA 3D4CA 4RYAA 2DWIA 2DVCA 3FATA 1D9VA 2PT2A 2RF1A 3CG1A 1DTGA 3TCFA 3G3FA 5I58B 3M3LA 5B7DA 3K6UA 2IEEA 2DWJA 4F1VA 1RYOA 1JVYA 3P7IA 3DM0A 2DE4A 4LONB 1MXUA 2OK2A 2ESNA 4N6PA 3UIFA 1R6ZA 4KYEA 2A5SA 3O97A 1I6BA 2Q8JA 1S50A 1R9LA 2I0BA 1GV8A 4U4SA 5JTYA 2DP8A 1ANFA 3IORA 1MQIA 1MM7A 3OEMA 2V3QA 2ONSA 3ILTB 4NTLA 5DVIA 1SBPA 3O2AA 2THIA 1IITA 1SI0A 1HSEA 4WKMA 4ZEDA 3UGWA 1UTHB 2VGQA 1DSNA 3A09A 5DT6A 3IR1A 4IY5A 1AOVA 1QUKA 4MFIA 3SDFA 3THIA 2VD3A 4EXLA 3GBAA 4KCCA 5KDTA 2H4IA 1URSA 5H8QB 1Y4TA 4C1UA 3H6UA 4Q5TA 4R6YA 2AL4A 1QJMA 4C1TA 2IA4A 1HSJA 4BDNA 1IQ7A 3KN7A 1H43A 3KN3A 3PMXA 4H8IA 4EQ9A 3H6VA 3K1NA 4ZDMA 3QSLA 3N6UA 1B3EA 2DQVA 2R9JA 1IUDA 3HO7A 3EHSA 2I4BA 3IO4A 3PD8A 1VFDA 1Z7NE 1QVSA 4E0XA 3RTFB 4AB5A 4ND9A 3T9UA 1Y3NA 2OWSA 2RCAA 3DELB 4I1DA 2YJPA 3OD7A 4ZZAA 4KR5A 3VFJA 3PU5A 4AQ4A 1BLFA 5CMMA 4IO3A 3HN0A 2VD2A 4JSOA 4U1ZA 1D4NA 1MM6A 1ZMGA 2F7AA 3PUWE 4N13A 4H6DA 4MLVA 4OENA 3IO6A 2F5XA 2YLNA 4OQOA 3MPLA 5TP9B 5KDTB 2DWAA 3TODA 1M5FA 3LSXA 1SD3A 2XXXA 2X26A 4FECA 3VDFA 5ITOA 4F1YA 3JV9A 4OYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OWD A;  4POX A;  3Q25 A;  2Q2A A;  4KD5 A;  1P99 A;  4H5G A;  3TTR A;  1MY0 A;  3MW0 A;  3U72 A;  3FXU A;  2O7U A;  1OVB A;  2WKY A;  1B05 A;  3TKD A;  2GFE A;  3MP1 A;  3PV0 E;  1NNP A;  2V3U A;  4OZ9 A;  3IOU A;  5AA2 D;  3H4Z A;  4WEP A;  3HST A;  1PBQ A;  1FQD A;  1UTB A;  5DEX A;  2O1M A;  1Z7M E;  2ANJ A;  3HHG A;  4I8C A;  4X9T A;  1CE2 A;  3B6T A;  2XD2 A;  1LAG E;  2HCA A;  4R2B A;  3RUM A;  1VFE A;  2F6G A;  1JEV A;  3E3K A;  4Q30 B;  1VSO A;  4ZEI A;  1DPE A;  1FQB A;  4QF9 A;  1PC3 A;  4RJZ A;  3IL1 B;  1BIY A;  3TAJ A;  1TXF A;  3OMB A;  4QFL A;  4U4X A;  1RKM A;  3TYH A;  2I4C A;  2REJ A;  4NE4 A;  4THI A;  3K1P A;  3IK6 B;  1B52 A;  4H8J A;  3SES A;  4JB7 A;  3FXQ A;  2PVU A;  5H8F A;  4EUO A;  1TWY A;  4RA1 A;  2OWT A;  3FGS A;  3K0V A;  3K01 A;  4UA8 A;  5CMB A;  1MH4 A;  1PB9 A;  3SEW A;  1SYH A;  1JW1 A;  4HS7 A;  1ZJL A;  4BDL A;  4RPN A;  4PE5 B;  4NF5 A;  3RLF E;  1B1X A;  3OXN A;  4HW8 A;  3SEY A;  1LBB A;  1B6H A;  5HM4 B;  1EZ9 A;  1LCF A;  1P1N A;  1MXW A;  2F35 A;  1P1W A;  2DXR A;  4NMY A;  3SEX A;  4PFW A;  5K2X A;  3M3F A;  4EF2 A;  3TMG A;  2O51 A;  4M4G A;  5DEX B;  5KZT A;  4O3B A;  4R9G A;  2HQ0 A;  2RCB A;  2QS4 A;  3T22 A;  4C0R A;  3U92 A;  1JET A;  3PGF A;  1MDP 1;  5AA2 A;  3LSL A;  2P0S A;  4Z0I A;  5I84 A;  2P2A A;  1M5C A;  1ZTY A;  1B7U A;  5H8N B;  3IB1 A;  3H03 A;  5DTB A;  4GXS B;  1DTZ A;  2ZXT A;  4BDM A;  3MVZ A;  1Q1K A;  2VHA A;  3FVG A;  5I2N B;  2I48 A;  3CFX A;  3TTK A;  5CI5 A;  3OSQ A;  3MAM A;  3MVX A;  4ELP A;  5M2V A;  5B70 A;  3C36 A;  4MH5 A;  2I3W A;  3ZSF A;  4JBZ A;  3TCH A;  3LBS A;  4LAT A;  3N26 A;  1A99 A;  3TQW A;  3FIR A;  3T66 A;  1Y3Q A;  4F39 A;  1SI1 A;  2HZK A;  3CSB A;  1B51 A;  3RPW A;  2DVZ A;  4O3A A;  4YMB A;  4OFJ A;  5ELV A;  4H65 A;  4GXA A;  4ELQ A;  1OIB A;  4F2O A;  4H67 A;  3IOW A;  1FTO A;  3H7M A;  3H3G A;  3G3J A;  4XTC Q;  4YKK A;  3WAF A;  1T0K A;  4F18 A;  4DXU A;  3O6H A;  4N07 A;  2HFB A;  4MLQ A;  3C32 A;  2E1S A;  2Q89 A;  5FHN A;  4QFK A;  2HZL A;  4GVO A;  1B58 A;  1SQY A;  4FAT A;  3B6W A;  4G68 C;  5I2K A;  1B5H A;  3FVN A;  3KOT A;  1S9T A;  1YAE A;  3FV2 A;  3MQ9 A;  4NF4 B;  2Y84 A;  1FCK A;  4ISU A;  4YMA A;  3H6W A;  3ODB A;  2H5Y A;  3GXA A;  5A5X B;  3GLB A;  3RT8 A;  4YB5 A;  1FTK A;  3C33 A;  3UN6 A;  3N6T A;  2RC9 A;  3TTM A;  1OLC A;  3EHU A;  3HCQ A;  2O1L A;  2UXA A;  2P1S A;  1JEU A;  3CRB A;  1MXX A;  5H8H B;  3ECR A;  4EF1 A;  3D4G A;  2VP1 A;  4IGT A;  3EN3 A;  4G2Z A;  2PMS A;  1QKB A;  1N04 A;  1P1Q A;  4LZ5 A;  3CG3 A;  1B3F A;  5TU0 A;  3OO9 A;  1ZIU A;  4YZZ A;  1MXV A;  3ILU B;  1NH7 A;  4KI0 E;  1Y20 A;  3IB0 A;  3MVW A;  2D21 A;  1DPP A;  4LZ7 A;  1M5D A;  3H06 B;  4OFL A;  3LUY A;  1FQF A;  3OOA A;  5I56 B;  3IOV A;  2XXP A;  1S7Y A;  3TCG A;  3G3K A;  3CR9 A;  1AH5 A;  3HPI A;  3UOR A;  3AXF A;  1GR2 A;  1JQF A;  1GTK A;  1P1U A;  3EQ1 A;  1OQH A;  3HHF A;  1MY2 A;  2DWH A;  3S9M C;  2F34 A;  1B5I A;  3KFM A;  5I59 A;  4RY1 A;  4DIG A;  5F1Q A;  2HEU A;  3TQL A;  4G68 B;  4TLL B;  5ITP A;  1A8F A;  3T9X B;  3KJ7 A;  3O28 A;  1N7X A;  3OEN A;  4GQO A;  3FV1 A;  4JWO A;  4NF6 B;  3EPE A;  2ZMB A;  3EHT A;  5IKB A;  4OHN A;  3BKI B;  2F6P A;  1FQE A;  3PUV E;  3Q29 A;  3QUJ A;  5J1D A;  3U93 A;  3B6Q A;  4QSE A;  5L9O A;  3FAS A;  1LBC A;  5DVJ A;  5TPA A;  1Y1M A;  4G77 A;  1QUL A;  4F3S A;  4L17 A;  3KJT A;  4XKP A;  1Y4C A;  4KYS A;  1ELJ A;  4IO4 A;  3A3C A;  2V3T A;  1ZKB A;  5F7V A;  2A5T A;  3IX1 A;  2Q88 A;  2DE2 A;  2RKM A;  2RC7 A;  1B3H A;  2FYI A;  5DVF A;  3MZB A;  4G8N A;  2XXQ A;  1XVY A;  4JXI A;  1PDA A;  2XX9 A;  4KHZ E;  5JTY B;  3PD9 A;  1TFA A;  4JWX A;  4OVJ A;  4DXB A;  4U21 A;  2XX8 A;  3QUF A;  3RQT A;  4GOT A;  3QXM A;  4IO2 A;  4YIC A;  3KSJ A;  3C31 A;  3TZA A;  3DP4 A;  4I9D A;  1IXG A;  3G3H A;  4H0W A;  1FQA A;  3M8U A;  3KZG A;  2XXT A;  3JYR A;  2Y7W A;  4XXU A;  3U1O A;  2UYF A;  4U22 A;  2B65 A;  1WDN A;  1B40 A;  2OBG A;  1O63 A;  1EH3 A;  4QHQ A;  4YKP A;  1N3X A;  4U23 A;  5AA4 A;  2Z8F A;  3FVK A;  3W9V A;  3U94 A;  3DP8 A;  3IJO B;  4R6K A;  4PFT A;  1TT1 A;  4NF8 A;  3R6U A;  1A54 A;  3T9V A;  1PEB A;  3V8X B;  5AA1 A;  1B2H A;  4F29 A;  3W15 C;  1URG A;  3I5O A;  3E9X A;  2Z22 A;  4FE8 A;  5JK4 A;  4X1D A;  4G8H A;  1ATG A;  4DDD A;  1KWH A;  3FJG A;  2X7P A;  3RNN A;  3IOT A;  4PP0 A;  3TPA A;  4FJP A;  2F7B A;  3TTN A;  1LST A;  4GL8 A;  3ZKK A;  2RC8 A;  1LAH E;  1XS5 A;  2XXY A;  4JSD A;  2H25 A;  3S9E A;  2ONK E;  4EXK A;  1ZLQ A;  2G93 A;  1A7L A;  3SEV A;  4U2R A;  4R6H A;  3A3U A;  3MJN A;  5L8D A;  5H8S A;  1QKA A;  3C4M A;  1H76 A;  3K4U A;  3C9H A;  1D9Y A;  1I6Q A;  3TDJ A;  5CMC A;  2B3B A;  1B0H A;  4DCX A;  1POT A;  3C34 A;  4X48 A;  1MPB A;  4FED A;  4YKJ A;  3ONM A;  4F1U A;  3MVY A;  5KCJ A;  2PBW A;  4F31 B;  2GHB A;  5HPQ A;  3Q26 A;  3RY3 A;  2CZL A;  2Z23 A;  3E4R A;  1YCJ A;  1BKA A;  4YB7 A;  3QK6 A;  1B5J A;  1FQC A;  3UK4 A;  3L6H A;  1Y3P A;  2FNC A;  1B7Z A;  1I6A A;  4F3G A;  1UTB B;  4P0G A;  3S2V A;  1IXC A;  4GLI A;  3TFL A;  3OO6 A;  1SW4 A;  2FA7 A;  2XXR A;  4OMB A;  5CBS A;  2F36 A;  3PPO A;  4ZEK A;  2QS3 A;  3VLV A;  1PBP A;  3MZ1 A;  4EDP A;  2XXI A;  3S9N C;  2I58 A;  4X1B A;  3O66 A;  1MY1 A;  2X7Q A;  1N3W A;  3SEU A;  3LC8 A;  4H5F A;  2D3I A;  1LFH A;  3CFL A;  3K02 A;  5I57 A;  1A40 A;  4IO6 A;  3RTW B;  5H8F B;  3RGY A;  1MQJ A;  4XIG Q;  3VV5 A;  1FTL A;  5ISU A;  3OEK A;  5DYH A;  2R6G E;  2BJJ X;  3V5A A;  2Z8D A;  1ZBM A;  3F11 A;  2UVI A;  3UA8 A;  2V25 A;  1JW4 A;  4NF5 B;  4LA9 A;  1BP5 A;  1R9Q A;  1H3D A;  5ICT A;  2GHA A;  3ZS6 A;  1IXI A;  4BDR A;  4R72 A;  1M5E A;  2ZYK A;  3MZ9 A;  2QSX A;  1POY 1;  1O7T A;  4OTE A;  2DYX A;  4YB6 A;  3WAE A;  1B4Z A;  3DLN A;  2OJT A;  1SDX A;  4BDQ A;  1SW1 A;  1OQG A;  1LB8 A;  4BLA A;  3VXC A;  1B7H A;  2DXY A;  2D5W A;  4K3F A;  2YPN A;  1XHY A;  1HSL A;  5EHS A;  3SET A;  3KGC A;  1VE4 A;  5AA2 B;  1JVX A;  2Y7R A;  4O3C A;  3VLU A;  2QRY A;  1A8E A;  2ZYM A;  5CC2 A;  1AIV A;  2UVG A;  3K2D A;  1M5B A;  3TTL A;  1OVT A;  2G29 A;  5FHO A;  1JW5 A;  3GZG A;  4F3P A;  3MUQ A;  2H98 A;  1LAX A;  4LP2 B;  3KN8 A;  4IO5 A;  5AA3 A;  4FAJ A;  4KQP A;  1UIU A;  4TLM B;  2PX1 A;  5FHM A;  3FXR A;  3V89 B;  3B7D A;  3L6G A;  3DP6 A;  1LFG A;  3LSW A;  3CVG A;  1UTH A;  3PPP A;  1B9J A;  1UQW A;  4G8M A;  4ELO A;  1NNK A;  1Y1Z A;  1MH3 A;  5JEI A;  3PMV A;  5CRY A;  2ALU A;  4KPT A;  4F3B A;  4OES A;  5H8Q A;  3MWB A;  3CFZ A;  1YPN A;  4XKR A;  3MC2 A;  1LCT A;  1XC1 A;  1IXH A;  1LB9 A;  2Q9T A;  3CIJ A;  1NL5 A;  3KBR A;  2W7Y A;  3JZJ A;  3U8Q A;  2HAU A;  4YAH X;  4ESX A;  1SYI A;  4FEB A;  3S9L C;  2I3V A;  3IAZ A;  4EQB A;  1N84 A;  3FVO A;  2Y7K A;  4DCY A;  1LLS A;  3RN8 A;  1MQD A;  5L9M A;  2I6E A;  4QSC A;  5I2K B;  2B3F A;  2Y7I A;  3G3G A;  2O7I A;  3PMW A;  1EZO A;  5EHM A;  4ZZE A;  4GRK A;  1B4H A;  2GH9 A;  1OLA A;  4Q0C A;  4AB6 A;  3Q27 A;  3RT6 B;  5ICQ A;  1NKX A;  1YTV A;  1EU8 A;  2F97 A;  1N7W A;  4KFQ A;  3OO8 A;  1IIW A;  4IGR A;  3S4U A;  1SW2 A;  2LAO A;  1USY H;  1EZP A;  4IO7 A;  3USD A;  3OO7 A;  2Y7P A;  5TP9 A;  2NVU B;  4QSD A;  4HCW A;  5IAI A;  4P0I A;  1SVX B;  3T9H B;  5CBR A;  2ONR A;  1NFT A;  1GVC A;  1F9B A;  4RNS A;  3K00 A;  2I49 A;  2QMX A;  1D3K A;  3KEI A;  2O84 X;  2QPQ A;  1B32 A;  2DS9 A;  4Q8R A;  4LQ2 A;  1MQH A;  1B1H A;  4M1V A;  4R75 A;  3VXB A;  2AIX A;  4DXC A;  2QJE A;  3I6V A;  4HCY A;  5CMK A;  1MPC A;  2F78 A;  3PPR A;  1XOC A;  5HBC A;  4QFP A;  5I59 B;  4JDF A;  4RK2 A;  1FTM A;  4GD5 A;  5AE4 A;  1Q35 A;  1R1N A;  1J1N A;  4QFO A;  1NMU A;  3FD3 A;  2UYE A;  2XX7 A;  3E13 X;  1URD A;  2ABH A;  1II5 A;  2ZNU A;  3MBP A;  4U1O A;  4LVQ A;  3W9W A;  1MQG A;  5FTI A;  4OFO A;  3TEL A;  5TPA B;  4KCD A;  3G3I A;  3MP8 A;  3T93 B;  3PPQ A;  1B46 A;  4ZS9 A;  3QAX A;  2OZZ A;  2RIN A;  4OEU A;  4OXV A;  2O6A A;  3FZV A;  1QUI A;  4YU0 A;  2A5T B;  1PB7 A;  1US5 A;  4RK9 A;  2DE3 A;  4I62 A;  2NXO A;  2NWJ A;  1XVX A;  3K6V A;  3O6G A;  1IZ1 A;  4DZ1 A;  1H44 A;  4R2F A;  3T96 B;  4ONY A;  5K2Y A;  4GF8 A;  3PUZ E;  3K6X A;  3QIM A;  4POW A;  2AYS A;  1RYX A;  4ECF A;  2AL5 A;  4UAC A;  4YKI A;  1LFI A;  1QUJ A;  3TUS A;  2NOO A;  1I69 A;  3SER A;  1N76 A;  4F22 A;  3VVD A;  4FOR A;  2NUV A;  2H9B A;  4EQ7 A;  2XXV A;  3LR1 A;  1AMF A;  4TOZ A;  4E0W A;  4OET A;  2GRV A;  4ELR A;  3K1M A;  3H6T A;  4H1X A;  1CB6 A;  4F2Q A;  2OLB A;  4LZ8 A;  4NWC A;  5AA4 B;  1QW0 A;  3OEL A;  5H8N A;  3Q28 A;  1WOD A;  1BTJ A;  4ZEF A;  3VE1 B;  4NF8 B;  3VVE A;  4QFN A;  2PYY A;  5I2N A;  1FW0 A;  2HAV A;  2ZNT A;  1H45 A;  4NED A;  4HTG A;  1SW5 A;  2XHD A;  2R71 A;  2F7C A;  1L5T A;  4PET A;  1AL3 A;  1MY3 A;  4IB2 A;  3HV1 A;  4R9F A;  2HXW A;  1MDQ A;  1XT8 A;  4GWO A;  4ZE8 A;  3BFT A;  3ZKL A;  4ZEB A;  3CI8 A;  1PB8 A;  1FTJ A;  2CMO A;  1MPD A;  3BBR A;  3UP9 A;  2I0C A;  2M8C A;  3V83 A;  2DOJ A;  4ESW A;  1MG1 A;  1P1O A;  4PQJ A;  4LUB A;  3KOS A;  4ZE9 A;  3IJX B;  4NWD A;  4GIZ A;  3PUY E;  4GFR A;  1B0L A;  4BDO A;  2E0S A;  3BFU A;  3VLW A;  3EF7 A;  1NH8 A;  1TFD A;  4MF3 A;  4WXJ A;  3TEP A;  3KSX A;  4JWY A;  1N0T A;  1B3L A;  4DE8 A;  2Q2C A;  4NF4 A;  2XXH A;  1MS7 A;  3O29 A;  2Z8E A;  5L9S A;  3FUZ A;  3O9P A;  5KCJ B;  2XD3 A;  4QRZ A;  3PPN A;  1GGG A;  5A5X A;  3M3K A;  4F19 A;  4Z7E A;  5LOM A;  1DMB A;  4MBP A;  4R73 A;  4TQU Q;  4R74 A;  1MY4 A;  3I3V A;  4GL0 A;  1NNT A;  1WVJ A;  1MXZ A;  3IB2 A;  5I58 A;  1LAF E;  2REG A;  2V93 A;  1UIV A;  3PUX E;  2XXU A;  2VOZ A;  1ZU0 A;  1Y9U A;  2XXW A;  3VVF A;  5H8H A;  5BUU A;  3FJM A;  5BWJ A;  2O68 A;  1A55 A;  3N94 A;  3MP6 A;  5EYF A;  4LQ5 A;  2PT1 A;  1JNF A;  3C35 A;  3GBB A;  3R7X A;  3FJ7 A;  4XKN A;  2H99 A;  4PFY A;  3G7W A;  1B3G A;  2ZYO A;  1O64 A;  2V84 A;  3K6W A;  5I56 A;  2O69 A;  3KG2 A;  1US4 A;  1LGB C;  2QS1 A;  2QS2 A;  4RPO A;  5CM6 A;  1NNF A;  3O6I A;  4WED A;  1OMP A;  3SKP A;  5FTH A;  1IEJ A;  3N5L A;  2ZNS A;  4XKQ A;  2F8D A;  3MPK A;  5I57 B;  4PFU A;  2UVH A;  2OCU A;  4P11 A;  2QL3 A;  1MRP A;  3CSG A;  3LSF B;  4DLD A;  1DOT A;  2KLF A;  4KYD A;  2DSF A;  4G68 A;  4ZEC A;  3OSR A;  4G4P A;  4IY6 A;  3QYT A;  4RXL A;  2ZYN A;  4FIM A;  1MXY A;  4NF6 A;  1VR5 A;  2UVJ A;  2QMW A;  4OER A;  3R26 A;  1USY E;  4OEV A;  3D4C A;  4RYA A;  2DWI A;  2DVC A;  3FAT A;  1D9V A;  2PT2 A;  2RF1 A;  3CG1 A;  1DTG A;  3TCF A;  3G3F A;  5I58 B;  3M3L A;  5B7D A;  3K6U A;  2IEE A;  2DWJ A;  4F1V A;  1RYO A;  1JVY A;  3P7I A;  3DM0 A;  2DE4 A;  4LON B;  1MXU A;  2OK2 A;  2ESN A;  4N6P A;  3UIF A;  1R6Z A;  4KYE A;  2A5S A;  3O97 A;  1I6B A;  2Q8J A;  1S50 A;  1R9L A;  2I0B A;  1GV8 A;  4U4S A;  5JTY A;  2DP8 A;  1ANF A;  3IOR A;  1MQI A;  1MM7 A;  3OEM A;  2V3Q A;  2ONS A;  3ILT B;  4NTL A;  5DVI A;  1SBP A;  3O2A A;  2THI A;  1IIT A;  1SI0 A;  1HSE A;  4WKM A;  4ZED A;  3UGW A;  1UTH B;  2VGQ A;  1DSN A;  3A09 A;  5DT6 A;  3IR1 A;  4IY5 A;  1AOV A;  1QUK A;  4MFI A;  3SDF A;  3THI A;  2VD3 A;  4EXL A;  3GBA A;  4KCC A;  5KDT A;  2H4I A;  1URS A;  5H8Q B;  1Y4T A;  4C1U A;  3H6U A;  4Q5T A;  4R6Y A;  2AL4 A;  1QJM A;  4C1T A;  2IA4 A;  1HSJ A;  4BDN A;  1IQ7 A;  3KN7 A;  1H43 A;  3KN3 A;  3PMX A;  4H8I A;  4EQ9 A;  3H6V A;  3K1N A;  4ZDM A;  3QSL A;  3N6U A;  1B3E A;  2DQV A;  2R9J A;  1IUD A;  3HO7 A;  3EHS A;  2I4B A;  3IO4 A;  3PD8 A;  1VFD A;  1Z7N E;  1QVS A;  4E0X A;  3RTF B;  4AB5 A;  4ND9 A;  3T9U A;  1Y3N A;  2OWS A;  2RCA A;  3DEL B;  4I1D A;  2YJP A;  3OD7 A;  4ZZA A;  4KR5 A;  3VFJ A;  3PU5 A;  4AQ4 A;  1BLF A;  5CMM A;  4IO3 A;  3HN0 A;  2VD2 A;  4JSO A;  4U1Z A;  1D4N A;  1MM6 A;  1ZMG A;  2F7A A;  3PUW E;  4N13 A;  4H6D A;  4MLV A;  4OEN A;  3IO6 A;  2F5X A;  2YLN A;  4OQO A;  3MPL A;  5TP9 B;  5KDT B;  2DWA A;  3TOD A;  1M5F A;  3LSX A;  1SD3 A;  2XXX A;  2X26 A;  4FEC A;  3VDF A;  5ITO A;  4F1Y A;  3JV9 A;  4OYV A; 
#chains in the Genus database with same CATH topology
 4OWD A;  3RPL B;  4POX A;  3Q25 A;  2Q2A A;  4QXD A;  4KD5 A;  1P99 A;  4H5G A;  3TTR A;  1MY0 A;  2QFL A;  3MW0 A;  1LBZ A;  3U72 A;  3FXU A;  2O7U A;  1OVB A;  2WKY A;  1B05 A;  3TKD A;  2GFE A;  1JP4 A;  3MP1 A;  3PV0 E;  1NNP A;  2V3U A;  4OZ9 A;  3IOU A;  5AA2 D;  3H4Z A;  4WEP A;  3HST A;  2B4M A;  4PFI A;  1PBQ A;  1FQD A;  1UTB A;  5DEX A;  2O1M A;  1Z7M E;  2ANJ A;  3HHG A;  4I8C A;  4X9T A;  1CE2 A;  3B6T A;  2XD2 A;  1LAG E;  2HCA A;  4R2B A;  3RUM A;  3E79 A;  1VFE A;  2F6G A;  1JEV A;  3E3K A;  3T0J A;  4Q30 B;  5DW8 A;  1VSO A;  4ZEI A;  1DPE A;  1FQB A;  1YXI A;  4QF9 A;  1PC3 A;  4XEQ A;  4RJZ A;  3IL1 B;  1BIY A;  3TAJ A;  1TXF A;  3OMB A;  4QFL A;  4U4X A;  1RKM A;  3TYH A;  2I4C A;  2REJ A;  4NE4 A;  4THI A;  3K1P A;  3IK6 B;  1B52 A;  4H8J A;  3SES A;  4JB7 A;  1FBH A;  3FXQ A;  2PVU A;  3A29 A;  5H8F A;  4EUO A;  1TWY A;  4PAF A;  4RA1 A;  5F24 A;  2OWT A;  3FGS A;  3K0V A;  3K01 A;  4UA8 A;  5CMB A;  1NV3 A;  1MH4 A;  1PB9 A;  3SEW A;  1SYH A;  1JW1 A;  4HS7 A;  1ZJL A;  4BDL A;  4RPN A;  4PE5 B;  1NUW A;  4NF5 A;  3RLF E;  3PTY A;  1B1X A;  2WYK A;  3OXN A;  4HW8 A;  2PCR A;  2VPN A;  3SEY A;  1LBB A;  1B6H A;  5HM4 B;  1EZ9 A;  1LCF A;  1P1N A;  1YYZ A;  1MXW A;  2F35 A;  1P1W A;  2DXR A;  4NMY A;  3SEX A;  4PFW A;  4MAG A;  5K2X A;  3M3F A;  4EF2 A;  3TMG A;  2O51 A;  4M4G A;  4OA4 A;  5DEX B;  5KZT A;  4PFR A;  2CZK A;  4O3B A;  4N8Y A;  4R9G A;  2HQ0 A;  4GX4 A;  2RCB A;  2HXR A;  2QS4 A;  3T22 A;  5IM2 A;  4C0R A;  3U92 A;  1JET A;  3PGF A;  1MDP 1;  4OVR A;  5AA2 A;  3LSL A;  4PDD A;  2P0S A;  4Z0I A;  1G0H A;  5I84 A;  2P2A A;  1NV4 A;  1M5C A;  1ZTY A;  1B7U A;  5H8N B;  3IB1 A;  3H03 A;  5DTB A;  4JVC A;  4GXS B;  2WBB A;  1IMF A;  1DTZ A;  2ZXT A;  2Q74 A;  3MVZ A;  1Q1K A;  4BDM A;  2VHA A;  3FVG A;  5I2N B;  2I48 A;  2KQZ A;  3CFX A;  3TTK A;  2ZZV A;  5CI5 A;  3OSQ A;  4PF8 A;  3MAM A;  3MVX A;  4ELP A;  5M2V A;  5B70 A;  3C36 A;  4MH5 A;  2I3W A;  1FBF A;  3ZSF A;  4JBZ A;  3TCH A;  1NV5 A;  3LBS A;  4LAT A;  2WEF A;  3N26 A;  1A99 A;  3TQW A;  3FIR A;  3T66 A;  1Y3Q A;  4F39 A;  1SI1 A;  5FBP A;  2HZK A;  3CSB A;  1B51 A;  3RPW A;  2DVZ A;  4O3A A;  4YMB A;  4OFJ A;  5IZ3 A;  5ELV A;  4H65 A;  4GXA A;  4ELQ A;  1OIB A;  4F2O A;  4H67 A;  3IOW A;  1FTO A;  3H7M A;  3H3G A;  1IMD A;  2FBP A;  3G3J A;  4XTC Q;  4YKK A;  3WAF A;  1T0K A;  4F18 A;  4DXU A;  3O6H A;  4N07 A;  4PTK A;  1FBC A;  2HFB A;  4JVD A;  4MLQ A;  3C32 A;  2E1S A;  2Q89 A;  5FHN A;  1DK4 A;  4QFK A;  2HZL A;  4GVO A;  1B58 A;  4QBA A;  1SQY A;  4FAT A;  3B6W A;  4G68 C;  3B8B A;  5I2K A;  1B5H A;  3FVN A;  3KOT A;  1S9T A;  1YAE A;  5IGA A;  1G0I A;  3FV2 A;  3MQ9 A;  4NF4 B;  2Y84 A;  4GWS A;  1FCK A;  4ISU A;  4YMA A;  3H6W A;  3ODB A;  2H5Y A;  3GXA A;  4MJO A;  5A5X B;  3GLB A;  3RT8 A;  4YB5 A;  1FTK A;  3C33 A;  3UN6 A;  1FJ6 A;  3N6T A;  4N17 A;  2RC9 A;  1NV2 A;  3TTM A;  1OLC A;  3EHU A;  3HCQ A;  4N15 A;  2O1L A;  2UXA A;  2P1S A;  1JEU A;  3CRB A;  1MXX A;  5H8H B;  3ECR A;  4EF1 A;  3D4G A;  2VP1 A;  4IGT A;  1YZ0 A;  3EN3 A;  3BIH A;  4G2Z A;  5IZ3 B;  2PMS A;  1QKB A;  1N04 A;  1P1Q A;  4LZ5 A;  3CG3 A;  1B3F A;  5TU0 A;  3OO9 A;  5IZ1 A;  1ZIU A;  4YZZ A;  1MXV A;  3ILU B;  1NH7 A;  4KI0 E;  1Y20 A;  3IB0 A;  3MVW A;  2D21 A;  1DPP A;  4LZ7 A;  1M5D A;  3H06 B;  4OFL A;  3LUY A;  1FQF A;  3OOA A;  1NUX A;  5I56 B;  3IOV A;  2XXP A;  1S7Y A;  3TCG A;  3G3K A;  3CR9 A;  1AH5 A;  1FBG A;  3HPI A;  3UOR A;  1LBX A;  3AXF A;  1GR2 A;  1JQF A;  4KXP A;  1GTK A;  1P1U A;  3EQ1 A;  1OQH A;  3HHF A;  1MY2 A;  2DWH A;  3S9M C;  2F34 A;  2XWV A;  1B5I A;  3KFM A;  5I59 A;  4RY1 A;  4DIG A;  5F1Q A;  2HEU A;  2PFY A;  3TQL A;  4G68 B;  4TLL B;  5ITP A;  1A8F A;  3T9X B;  3KJ7 A;  3O28 A;  4GX6 A;  1N7X A;  3OEN A;  4GQO A;  3FV1 A;  4JWO A;  4NF6 B;  5LTC A;  3EPE A;  2ZMB A;  3EHT A;  5IKB A;  4OHN A;  4MNP A;  3BKI B;  2F6P A;  1FQE A;  3PUV E;  3Q29 A;  5A5L A;  3QUJ A;  3FBP A;  5J1D A;  3U93 A;  3B6Q A;  4QSE A;  5L9O A;  4NG7 A;  3FAS A;  1LBC A;  5DVJ A;  5TPA A;  3SZP A;  1Y1M A;  4G77 A;  4G61 A;  1QUL A;  4F3S A;  4L17 A;  3KJT A;  4XKP A;  1Y4C A;  4KYS A;  4I3E A;  1ELJ A;  4IO4 A;  3A3C A;  2V3T A;  1ZKB A;  5F7V A;  2A5T A;  3IX1 A;  2Q88 A;  2DE2 A;  2RKM A;  2RC7 A;  1B3H A;  2FYI A;  5DVF A;  2XWK A;  3MZB A;  4G8N A;  2XXQ A;  1XVY A;  4JXI A;  1PDA A;  2XX9 A;  4KHZ E;  5JTY B;  1FPF A;  3PD9 A;  3LV0 A;  1TFA A;  5EYG A;  4JWX A;  4OVJ A;  4DXB A;  4GWY A;  4U21 A;  2XX8 A;  3QUF A;  3RQT A;  4GOT A;  3QXM A;  4IO2 A;  4YIC A;  3KSJ A;  3C31 A;  2XA5 A;  3KBZ A;  3DP4 A;  3TZA A;  4I9D A;  1IXG A;  1FBP A;  3G3H A;  4H0W A;  1FQA A;  3M8U A;  2QVR A;  3KZG A;  2XXT A;  1IMA A;  3LUZ A;  3JYR A;  2Y7W A;  4XXU A;  3U1O A;  2VPO A;  2UYF A;  4U22 A;  4OVT A;  2B65 A;  1WDN A;  1B40 A;  2OBG A;  1O63 A;  1EH3 A;  4QHQ A;  4YKP A;  1N3X A;  4GBV A;  4U23 A;  5AA4 A;  1FJ9 A;  4NX1 A;  2Z8F A;  3FVK A;  3W9V A;  3U94 A;  3DP8 A;  3IJO B;  4R6K A;  4PFT A;  5I3S A;  1TT1 A;  4NF8 A;  3R6U A;  4OVQ A;  1A54 A;  3T9V A;  4H46 A;  1PEB A;  4PF6 A;  3B50 A;  3V8X B;  5AA1 A;  1B2H A;  3IFA A;  2CZH A;  4F29 A;  3W15 C;  1URG A;  3I5O A;  3E9X A;  4MNC A;  2Z22 A;  1KA1 A;  4FE8 A;  5JK4 A;  4X1D A;  4NF0 A;  4G8H A;  1ATG A;  4DDD A;  1KWH A;  3FJG A;  2X7P A;  4O7M A;  3RNN A;  3IOT A;  4PP0 A;  3TPA A;  4FJP A;  2F7B A;  2OX3 A;  3TTN A;  1LST A;  4GL8 A;  3NOH A;  1FRP A;  3ZKK A;  2RC8 A;  1LAH E;  1XS5 A;  2XXY A;  4JSD A;  2H25 A;  3S9E A;  1IME A;  2ONK E;  4EXK A;  1ZLQ A;  2G93 A;  1A7L A;  1RDY A;  3SEV A;  1FPK A;  4U2R A;  4R6H A;  3A3U A;  3MJN A;  5L8D A;  5H8S A;  1QKA A;  3IFC A;  3C4M A;  1H76 A;  3K4U A;  3C9H A;  1D9Y A;  1I6Q A;  3TDJ A;  5CMC A;  4AS5 A;  2B3B A;  1B0H A;  2HHM A;  4DCX A;  1POT A;  3C34 A;  4P1E A;  4X48 A;  1MPB A;  1D9Q A;  1KZ8 A;  4FED A;  4YKJ A;  3ONM A;  4F1U A;  3MVY A;  5KCJ A;  2PBW A;  4HE0 A;  4F31 B;  2GHB A;  5HPQ A;  3Q26 A;  3RY3 A;  2CZL A;  2PFZ A;  4XFE A;  2Z23 A;  3E4R A;  1YCJ A;  1BKA A;  4YB7 A;  5ESY A;  4NAP A;  3QK6 A;  2V4C A;  1B5J A;  1FQC A;  3UK4 A;  3L6H A;  1Y3P A;  2FNC A;  1B7Z A;  1I6A A;  4F3G A;  1AWB A;  1UTB B;  4P0G A;  1CNQ A;  3S2V A;  4GWX A;  1IXC A;  4GLI A;  3TFL A;  3OO6 A;  1SW4 A;  2FA7 A;  2XXR A;  1BK4 A;  4OMB A;  5CBS A;  2F36 A;  3PPO A;  4ZEK A;  4O7I A;  2QS3 A;  3VLV A;  1PBP A;  4GWW A;  4I3Y A;  3MZ1 A;  4EDP A;  2XXI A;  3S9N C;  4X04 A;  2I58 A;  4X1B A;  3O66 A;  1NI9 A;  1MY1 A;  2X7Q A;  1N3W A;  3SEU A;  3LC8 A;  5EQA A;  4H5F A;  3ISP A;  2D3I A;  1LFH A;  3CFL A;  3K02 A;  2FVZ A;  5I57 A;  1A40 A;  1FBD A;  4IO6 A;  3RTW B;  4HE1 A;  5H8F B;  3RGY A;  1MQJ A;  4XIG Q;  3VV5 A;  2BJI A;  1FTL A;  4P56 A;  5ISU A;  3OEK A;  5DYH A;  2R6G E;  4N8G A;  2BJJ X;  3V5A A;  2Z8D A;  1ZBM A;  3F11 A;  2UVI A;  3UA8 A;  2V25 A;  3ROJ A;  4GX3 A;  1JW4 A;  4NF5 B;  4LA9 A;  4N6D A;  1BP5 A;  1R9Q A;  1H3D A;  5ICT A;  2GHA A;  3ZS6 A;  1IXI A;  4BDR A;  4R72 A;  1M5E A;  2ZYK A;  3MZ9 A;  2QSX A;  1POY 1;  1O7T A;  3KC0 A;  4OTE A;  2DYX A;  4YB6 A;  3WAE A;  2CEY A;  1B4Z A;  3DLN A;  5EQ7 A;  2OJT A;  1NV0 A;  1SDX A;  4BDQ A;  2QVV A;  2DDK A;  1SW1 A;  4MEV A;  1OQG A;  1LB8 A;  4BLA A;  3VXC A;  1B7H A;  2DXY A;  2D5W A;  4K3F A;  2YPN A;  1XHY A;  1HSL A;  5EHS A;  3SET A;  3KGC A;  1VE4 A;  5AA2 B;  1JVX A;  2Y7R A;  4O3C A;  3VLU A;  2QRY A;  1A8E A;  2ZYM A;  5CC2 A;  1AIV A;  2UVG A;  3K2D A;  4JVI A;  1M5B A;  3TTL A;  4MNI A;  1OVT A;  2G29 A;  5FHO A;  1JW5 A;  3GZG A;  4F3P A;  3MUQ A;  2H98 A;  1LAX A;  4LP2 B;  3KN8 A;  4IO5 A;  5AA3 A;  4FBP A;  4FAJ A;  4KQP A;  1UIU A;  4TLM B;  2PX1 A;  5FHM A;  3FXR A;  3V89 B;  1KA0 A;  2P3V A;  3B7D A;  3L6G A;  3DP6 A;  1IMB A;  3E78 A;  1LFG A;  3LSW A;  3CVG A;  1UTH A;  3PPP A;  1B9J A;  1UQW A;  4G8M A;  3FXB A;  4ELO A;  1NNK A;  1Y1Z A;  1MH3 A;  5JEI A;  3PMV A;  5CRY A;  2ALU A;  4KPT A;  4F3B A;  4PFB A;  4OES A;  5H8Q A;  3MWB A;  3CFZ A;  1YPN A;  4XKR A;  3MC2 A;  1LCT A;  1XC1 A;  1IXH A;  1LB9 A;  2Q9T A;  3D1R A;  3CIJ A;  1NL5 A;  4GWU A;  3KBR A;  2W7Y A;  3JZJ A;  3U8Q A;  2GQ1 A;  2HAU A;  4YAH X;  4ESX A;  1SYI A;  4FEB A;  3S9L C;  2I3V A;  3IAZ A;  4EQB A;  1N84 A;  1LBV A;  4PDH A;  3FVO A;  2Y7K A;  4DCY A;  1LLS A;  3RN8 A;  1MQD A;  5L9M A;  2I6E A;  4QSC A;  5I2K B;  2B3F A;  2Y7I A;  3G3G A;  2O7I A;  3PMW A;  1DBZ A;  1EZO A;  5EHM A;  4ZZE A;  4GRK A;  4DI4 B;  1B4H A;  2GH9 A;  2WYP A;  1OLA A;  4Q0C A;  4AB6 A;  2ZZW A;  3Q27 A;  3RT6 B;  5LDZ A;  2FIE A;  4MX6 A;  5ICQ A;  2Y5L A;  1NKX A;  1YTV A;  1EU8 A;  2F97 A;  1N7W A;  4KFQ A;  3OO8 A;  2F3B A;  5EYH A;  1IIW A;  4IGR A;  3S4U A;  1SW2 A;  4N6K A;  3T1B A;  2LAO A;  1USY H;  1EZP A;  4IO7 A;  3USD A;  3OO7 A;  2Y7P A;  5I7I A;  5TP9 A;  2NVU B;  4QSD A;  4HCW A;  5IAI A;  4LN5 A;  4P0I A;  4OVP A;  1SVX B;  3T9H B;  5CBR A;  2ONR A;  1NFT A;  3RPL A;  1GVC A;  1F9B A;  4RNS A;  3K00 A;  2I49 A;  2QMX A;  1D3K A;  3KEI A;  2O84 X;  2QPQ A;  1FPI A;  1IMC A;  1B32 A;  2DS9 A;  4Q8R A;  1LBW A;  4LQ2 A;  1MQH A;  3U65 A;  1B1H A;  4M1V A;  4R75 A;  3VXB A;  2AIX A;  4DXC A;  2QJE A;  3I6V A;  4HCY A;  5CMK A;  1MPC A;  2F78 A;  3PPR A;  1XOC A;  5HBC A;  4QFP A;  1SPI A;  5I59 B;  2ZZX A;  4JDF A;  4RK2 A;  1FTM A;  4GD5 A;  5AE4 A;  1Q35 A;  1R1N A;  1VDW A;  1NV6 A;  4PC9 A;  1J1N A;  4QFO A;  1NMU A;  1LEV A;  3FD3 A;  4XF5 A;  4GBW A;  4NN3 A;  2UYE A;  2XX7 A;  1EYI A;  3E13 X;  4HXV A;  4PGP A;  1URD A;  2ABH A;  1II5 A;  2ZNU A;  3MST A;  3MBP A;  4U1O A;  3EKI A;  4LVQ A;  4GWZ A;  3W9W A;  1MQG A;  5FTI A;  4OFO A;  3TEL A;  5TPA B;  4KCD A;  1FSA A;  3G3I A;  3MP8 A;  4UAB A;  3T93 B;  3PPQ A;  1B46 A;  4ZS9 A;  3QAX A;  4P9K A;  2OZZ A;  2RIN A;  4OEU A;  4OXV A;  2O6A A;  3FZV A;  1QUI A;  4YU0 A;  2A5T B;  1PB7 A;  1US5 A;  4RK9 A;  2DE3 A;  4I62 A;  2NXO A;  5ET5 A;  2NWJ A;  1XVX A;  3K6V A;  3O6G A;  1IZ1 A;  4DZ1 A;  1H44 A;  2B4L A;  4R2F A;  3T96 B;  4ONY A;  5K2Y A;  4GF8 A;  4PGN A;  3PUZ E;  3K6X A;  3QIM A;  2CEX A;  4POW A;  2AYS A;  1RYX A;  4ECF A;  2AL5 A;  4UAC A;  4YKI A;  1LFI A;  1QUJ A;  2XWO A;  2OWZ A;  3TUS A;  2NOO A;  1I69 A;  4P47 A;  3SER A;  1N76 A;  4AS4 A;  4F22 A;  3VVD A;  4FOR A;  2NUV A;  2H9B A;  1QGX A;  4EQ7 A;  2XXV A;  3LR1 A;  4OVS A;  1AMF A;  4TOZ A;  4E0W A;  4OET A;  2GRV A;  2CZI A;  1Q9D A;  4ELR A;  3GYY A;  3K1M A;  3H6T A;  3RYD A;  4H1X A;  1CB6 A;  1EYJ A;  4F2Q A;  2OLB A;  4LZ8 A;  4NWC A;  5AA4 B;  1QW0 A;  3OEL A;  5H8N A;  1FTA A;  3Q28 A;  1WOD A;  1BTJ A;  4ZEF A;  3VE1 B;  4NF8 B;  3VVE A;  4QFN A;  2PYY A;  5I2N A;  1FW0 A;  2HAV A;  1INP A;  2QVU A;  2ZNT A;  1H45 A;  3QMF A;  4NED A;  4HTG A;  1SW5 A;  2XHD A;  2R71 A;  2F7C A;  1L5T A;  4PET A;  1AL3 A;  5T3J A;  1MY3 A;  4IB2 A;  4N4U A;  4MCO A;  3HV1 A;  4R9F A;  2HXW A;  1MDQ A;  1XT8 A;  1DCU A;  4GWO A;  4I40 A;  4ZE8 A;  3BFT A;  3ZKL A;  4ZEB A;  3CI8 A;  2JJK A;  4O94 A;  4N81 A;  5EQ8 A;  2KR0 A;  1PB8 A;  1FTJ A;  2CMO A;  1MPD A;  3BBR A;  3UP9 A;  2I0C A;  2M8C A;  3V83 A;  4PBH A;  4DI3 D;  2DOJ A;  2WX9 A;  4ESW A;  1MG1 A;  1P1O A;  4PQJ A;  4LUB A;  3KOS A;  4ZE9 A;  2MKZ A;  2FHY A;  3IJX B;  4NWD A;  4GIZ A;  3PUY E;  4GFR A;  1B0L A;  4BDO A;  2E0S A;  3BFU A;  3VLW A;  3EF7 A;  4OAN A;  1NH8 A;  1TFD A;  4MF3 A;  5IZZ A;  4WXJ A;  3TEP A;  3KSX A;  4JWY A;  1N0T A;  1B3L A;  4DE8 A;  2Q2C A;  4NF4 A;  2XXH A;  1MS7 A;  3O29 A;  2Z8E A;  5L9S A;  3FUZ A;  3O9P A;  5KCJ B;  2XD3 A;  4QRZ A;  3PPN A;  1GGG A;  5A5X A;  3M3K A;  4F19 A;  4Z7E A;  5LOM A;  1FPL A;  1DMB A;  4MBP A;  4R73 A;  4TQU Q;  4R74 A;  1MY4 A;  3I3V A;  4GL0 A;  1NNT A;  1WVJ A;  1MXZ A;  1FBE A;  3IB2 A;  5I58 A;  1LAF E;  3PUX E;  2REG A;  2V93 A;  1UIV A;  2XXU A;  2VOZ A;  4PE3 A;  1ZU0 A;  2Y5K A;  1Y9U A;  2XXW A;  3VVF A;  5I5P A;  5H8H A;  5BUU A;  3FJM A;  5BWJ A;  2O68 A;  4P8B A;  1A55 A;  3N94 A;  3MP6 A;  5EYF A;  4LQ5 A;  2PT1 A;  1JNF A;  3C35 A;  3GBB A;  3R7X A;  3FJ7 A;  4XKN A;  2H99 A;  5J16 A;  4PFY A;  3G7W A;  4NGU A;  1B3G A;  2ZYO A;  1NV1 A;  1O64 A;  2V84 A;  3K6W A;  5I56 A;  2O69 A;  3KG2 A;  1US4 A;  1LGB C;  2QS1 A;  2QS2 A;  4RPO A;  5ET8 A;  5CM6 A;  1NNF A;  3O6I A;  4P3L A;  4WED A;  1OMP A;  3SKP A;  5FTH A;  1IEJ A;  3N5L A;  2ZNS A;  4XKQ A;  1K9Y A;  2F8D A;  3MPK A;  5I57 B;  4PFU A;  2UVH A;  2OCU A;  4P11 A;  1NUZ A;  2QL3 A;  1MRP A;  3CSG A;  3LSF B;  4DLD A;  1DOT A;  2KLF A;  4KYD A;  2DSF A;  4G68 A;  4ZEC A;  3OSR A;  4G4P A;  4IY6 A;  3QYT A;  4MMP A;  4RXL A;  2ZYN A;  4FIM A;  1MXY A;  4NF6 A;  1VR5 A;  1FPJ A;  2UVJ A;  2QMW A;  4OER A;  3R26 A;  1USY E;  4OEV A;  4HE2 A;  3D4C A;  4RYA A;  2DWI A;  2DVC A;  3FAT A;  1D9V A;  2PT2 A;  4X8R A;  2RF1 A;  3CG1 A;  1DTG A;  3TCF A;  3G3F A;  5I58 B;  3M3L A;  5B7D A;  1FPE A;  2P3N A;  3K6U A;  2IEE A;  4N91 A;  1RDX A;  3HFU A;  2DWJ A;  4F1V A;  4P1L A;  4MHF A;  1RYO A;  1JVY A;  3P7I A;  5ET6 A;  1XI6 A;  4PAI A;  3DM0 A;  2DE4 A;  4LON B;  1MXU A;  2FIX A;  2OK2 A;  2ESN A;  4N6P A;  3UIF A;  1FPD A;  1R6Z A;  4KYE A;  2A5S A;  4NHB A;  3O97 A;  1I6B A;  2Q8J A;  1S50 A;  4O8M A;  1R9L A;  2I0B A;  1EYK A;  1GV8 A;  4H45 A;  4U4S A;  5JTY A;  2DP8 A;  1ANF A;  1RDZ A;  1K9Z A;  3IOR A;  1MQI A;  1MM7 A;  3OEM A;  2VT5 A;  2V3Q A;  2ONS A;  3ILT B;  2F3D A;  4NTL A;  5DVI A;  1SBP A;  3O2A A;  2THI A;  1IIT A;  1SI0 A;  4PBQ A;  1HSE A;  4WKM A;  4ZED A;  3UGW A;  1UTH B;  2VGQ A;  2XWI A;  1DSN A;  3A09 A;  5DT6 A;  3IR1 A;  4IY5 A;  4MIJ A;  1AOV A;  1QUK A;  4MFI A;  3SDF A;  3THI A;  2VD3 A;  4EXL A;  3GBA A;  2XXK A;  4KCC A;  5KDT A;  2H4I A;  1URS A;  5H8Q B;  1Y4T A;  4C1U A;  4PAK A;  3H6U A;  4Q5T A;  4R6Y A;  2WBD A;  2AL4 A;  1QJM A;  4C1T A;  2IA4 A;  3CHG A;  2R8T A;  1HSJ A;  4BDN A;  1IQ7 A;  3KN7 A;  1H43 A;  3KN3 A;  3PMX A;  4H8I A;  4EQ9 A;  3H6V A;  3K1N A;  4ZDM A;  3QSL A;  3N6U A;  1B3E A;  2DQV A;  2R9J A;  1IUD A;  3HO7 A;  3EHS A;  2I4B A;  3IO4 A;  3PD8 A;  1VFD A;  1Z7N E;  1QVS A;  4E0X A;  3RTF B;  4AB5 A;  4ND9 A;  3T9U A;  1Y3N A;  3KC1 A;  1LBY A;  2OWS A;  2RCA A;  1FPG A;  2HPG A;  3DEL B;  4I1D A;  2YJP A;  3OD7 A;  2Q8M A;  4ZZA A;  4KR5 A;  5EQ9 A;  3VFJ A;  3PU5 A;  4AQ4 A;  1BLF A;  5CMM A;  4IO3 A;  3HN0 A;  3BIG A;  2VD2 A;  4JSO A;  4NQ8 A;  4U1Z A;  1FPB A;  1D4N A;  1MM6 A;  4IR8 A;  1ZMG A;  2F7A A;  1NV7 A;  3PUW E;  4N13 A;  4H6D A;  4MLV A;  4OEN A;  4PCD A;  5ET7 A;  3IO6 A;  2F5X A;  2YLN A;  4OQO A;  3MPL A;  5TP9 B;  5KDT B;  2DWA A;  3TOD A;  1M5F A;  3LSX A;  1SD3 A;  2XXX A;  2X26 A;  4FEC A;  3VDF A;  2L5V A;  5ITO A;  1NUY A;  3MYU A;  4F1Y A;  3JV9 A;  4OYV A; 
#chains in the Genus database with same CATH homology
 4OWD A;  4POX A;  3Q25 A;  2Q2A A;  4KD5 A;  1P99 A;  4H5G A;  3TTR A;  1MY0 A;  3MW0 A;  3U72 A;  3FXU A;  2O7U A;  1OVB A;  2WKY A;  1B05 A;  3TKD A;  2GFE A;  3MP1 A;  3PV0 E;  1NNP A;  2V3U A;  4OZ9 A;  3IOU A;  5AA2 D;  3H4Z A;  4WEP A;  3HST A;  1PBQ A;  1FQD A;  1UTB A;  5DEX A;  2O1M A;  1Z7M E;  2ANJ A;  3HHG A;  4I8C A;  4X9T A;  1CE2 A;  3B6T A;  2XD2 A;  1LAG E;  2HCA A;  4R2B A;  3RUM A;  1VFE A;  2F6G A;  1JEV A;  3E3K A;  4Q30 B;  1VSO A;  4ZEI A;  1DPE A;  1FQB A;  4QF9 A;  1PC3 A;  4RJZ A;  3IL1 B;  1BIY A;  3TAJ A;  1TXF A;  3OMB A;  4QFL A;  4U4X A;  1RKM A;  3TYH A;  2I4C A;  2REJ A;  4NE4 A;  4THI A;  3K1P A;  3IK6 B;  1B52 A;  4H8J A;  3SES A;  4JB7 A;  3FXQ A;  2PVU A;  5H8F A;  4EUO A;  1TWY A;  4RA1 A;  2OWT A;  3FGS A;  3K0V A;  3K01 A;  4UA8 A;  5CMB A;  1MH4 A;  1PB9 A;  3SEW A;  1SYH A;  1JW1 A;  4HS7 A;  1ZJL A;  4BDL A;  4RPN A;  4PE5 B;  4NF5 A;  3RLF E;  1B1X A;  3OXN A;  4HW8 A;  3SEY A;  1LBB A;  1B6H A;  5HM4 B;  1EZ9 A;  1LCF A;  1P1N A;  1MXW A;  2F35 A;  1P1W A;  2DXR A;  4NMY A;  3SEX A;  4PFW A;  5K2X A;  3M3F A;  4EF2 A;  3TMG A;  2O51 A;  4M4G A;  5DEX B;  5KZT A;  4O3B A;  4R9G A;  2HQ0 A;  2RCB A;  2QS4 A;  3T22 A;  4C0R A;  3U92 A;  1JET A;  3PGF A;  1MDP 1;  5AA2 A;  3LSL A;  2P0S A;  4Z0I A;  5I84 A;  2P2A A;  1M5C A;  1ZTY A;  1B7U A;  5H8N B;  3IB1 A;  3H03 A;  5DTB A;  4GXS B;  1DTZ A;  2ZXT A;  4BDM A;  3MVZ A;  1Q1K A;  2VHA A;  3FVG A;  5I2N B;  2I48 A;  3CFX A;  3TTK A;  5CI5 A;  3OSQ A;  3MAM A;  3MVX A;  4ELP A;  5M2V A;  5B70 A;  3C36 A;  4MH5 A;  2I3W A;  3ZSF A;  4JBZ A;  3TCH A;  3LBS A;  4LAT A;  3N26 A;  1A99 A;  3TQW A;  3FIR A;  3T66 A;  1Y3Q A;  4F39 A;  1SI1 A;  2HZK A;  3CSB A;  1B51 A;  3RPW A;  2DVZ A;  4O3A A;  4YMB A;  4OFJ A;  5ELV A;  4H65 A;  4GXA A;  4ELQ A;  1OIB A;  4F2O A;  4H67 A;  3IOW A;  1FTO A;  3H7M A;  3H3G A;  3G3J A;  4XTC Q;  4YKK A;  3WAF A;  1T0K A;  4F18 A;  4DXU A;  3O6H A;  4N07 A;  2HFB A;  4MLQ A;  3C32 A;  2E1S A;  2Q89 A;  5FHN A;  4QFK A;  2HZL A;  4GVO A;  1B58 A;  1SQY A;  4FAT A;  3B6W A;  4G68 C;  5I2K A;  1B5H A;  3FVN A;  3KOT A;  1S9T A;  1YAE A;  3FV2 A;  3MQ9 A;  4NF4 B;  2Y84 A;  1FCK A;  4ISU A;  4YMA A;  3H6W A;  3ODB A;  2H5Y A;  3GXA A;  5A5X B;  3GLB A;  3RT8 A;  4YB5 A;  1FTK A;  3C33 A;  3UN6 A;  3N6T A;  2RC9 A;  3TTM A;  1OLC A;  3EHU A;  3HCQ A;  2O1L A;  2UXA A;  2P1S A;  1JEU A;  3CRB A;  1MXX A;  5H8H B;  3ECR A;  4EF1 A;  3D4G A;  2VP1 A;  4IGT A;  3EN3 A;  4G2Z A;  2PMS A;  1QKB A;  1N04 A;  1P1Q A;  4LZ5 A;  3CG3 A;  1B3F A;  5TU0 A;  3OO9 A;  1ZIU A;  4YZZ A;  1MXV A;  3ILU B;  1NH7 A;  4KI0 E;  1Y20 A;  3IB0 A;  3MVW A;  2D21 A;  1DPP A;  4LZ7 A;  1M5D A;  3H06 B;  4OFL A;  3LUY A;  1FQF A;  3OOA A;  5I56 B;  3IOV A;  2XXP A;  1S7Y A;  3TCG A;  3G3K A;  3CR9 A;  1AH5 A;  3HPI A;  3UOR A;  3AXF A;  1GR2 A;  1JQF A;  1GTK A;  1P1U A;  3EQ1 A;  1OQH A;  3HHF A;  1MY2 A;  2DWH A;  3S9M C;  2F34 A;  1B5I A;  3KFM A;  5I59 A;  4RY1 A;  4DIG A;  5F1Q A;  2HEU A;  3TQL A;  4G68 B;  4TLL B;  5ITP A;  1A8F A;  3T9X B;  3KJ7 A;  3O28 A;  1N7X A;  3OEN A;  4GQO A;  3FV1 A;  4JWO A;  4NF6 B;  3EPE A;  2ZMB A;  3EHT A;  5IKB A;  4OHN A;  3BKI B;  2F6P A;  1FQE A;  3PUV E;  3Q29 A;  3QUJ A;  5J1D A;  3U93 A;  3B6Q A;  4QSE A;  5L9O A;  3FAS A;  1LBC A;  5DVJ A;  5TPA A;  1Y1M A;  4G77 A;  1QUL A;  4F3S A;  4L17 A;  3KJT A;  4XKP A;  1Y4C A;  4KYS A;  1ELJ A;  4IO4 A;  3A3C A;  2V3T A;  1ZKB A;  5F7V A;  2A5T A;  3IX1 A;  2Q88 A;  2DE2 A;  2RKM A;  2RC7 A;  1B3H A;  2FYI A;  5DVF A;  3MZB A;  4G8N A;  2XXQ A;  1XVY A;  4JXI A;  1PDA A;  2XX9 A;  4KHZ E;  5JTY B;  3PD9 A;  1TFA A;  4JWX A;  4OVJ A;  4DXB A;  4U21 A;  2XX8 A;  3QUF A;  3RQT A;  4GOT A;  3QXM A;  4IO2 A;  4YIC A;  3KSJ A;  3C31 A;  3TZA A;  3DP4 A;  4I9D A;  1IXG A;  3G3H A;  4H0W A;  1FQA A;  3M8U A;  3KZG A;  2XXT A;  3JYR A;  2Y7W A;  4XXU A;  3U1O A;  2UYF A;  4U22 A;  2B65 A;  1WDN A;  1B40 A;  2OBG A;  1O63 A;  1EH3 A;  4QHQ A;  4YKP A;  1N3X A;  4U23 A;  5AA4 A;  2Z8F A;  3FVK A;  3W9V A;  3U94 A;  3DP8 A;  3IJO B;  4R6K A;  4PFT A;  1TT1 A;  4NF8 A;  3R6U A;  1A54 A;  3T9V A;  1PEB A;  3V8X B;  5AA1 A;  1B2H A;  4F29 A;  3W15 C;  1URG A;  3I5O A;  3E9X A;  2Z22 A;  4FE8 A;  5JK4 A;  4X1D A;  4G8H A;  1ATG A;  4DDD A;  1KWH A;  3FJG A;  2X7P A;  3RNN A;  3IOT A;  4PP0 A;  3TPA A;  4FJP A;  2F7B A;  3TTN A;  1LST A;  4GL8 A;  3ZKK A;  2RC8 A;  1LAH E;  1XS5 A;  2XXY A;  4JSD A;  2H25 A;  3S9E A;  2ONK E;  4EXK A;  1ZLQ A;  2G93 A;  1A7L A;  3SEV A;  4U2R A;  4R6H A;  3A3U A;  3MJN A;  5L8D A;  5H8S A;  1QKA A;  3C4M A;  1H76 A;  3K4U A;  3C9H A;  1D9Y A;  1I6Q A;  3TDJ A;  5CMC A;  2B3B A;  1B0H A;  4DCX A;  1POT A;  3C34 A;  4X48 A;  1MPB A;  4FED A;  4YKJ A;  3ONM A;  4F1U A;  3MVY A;  5KCJ A;  2PBW A;  4F31 B;  2GHB A;  5HPQ A;  3Q26 A;  3RY3 A;  2CZL A;  2Z23 A;  3E4R A;  1YCJ A;  1BKA A;  4YB7 A;  3QK6 A;  1B5J A;  1FQC A;  3UK4 A;  3L6H A;  1Y3P A;  2FNC A;  1B7Z A;  1I6A A;  4F3G A;  1UTB B;  4P0G A;  3S2V A;  1IXC A;  4GLI A;  3TFL A;  3OO6 A;  1SW4 A;  2FA7 A;  2XXR A;  4OMB A;  5CBS A;  2F36 A;  3PPO A;  4ZEK A;  2QS3 A;  3VLV A;  1PBP A;  3MZ1 A;  4EDP A;  2XXI A;  3S9N C;  2I58 A;  4X1B A;  3O66 A;  1MY1 A;  2X7Q A;  1N3W A;  3SEU A;  3LC8 A;  4H5F A;  2D3I A;  1LFH A;  3CFL A;  3K02 A;  5I57 A;  1A40 A;  4IO6 A;  3RTW B;  5H8F B;  3RGY A;  1MQJ A;  4XIG Q;  3VV5 A;  1FTL A;  5ISU A;  3OEK A;  5DYH A;  2R6G E;  2BJJ X;  3V5A A;  2Z8D A;  1ZBM A;  3F11 A;  2UVI A;  3UA8 A;  2V25 A;  1JW4 A;  4NF5 B;  4LA9 A;  1BP5 A;  1R9Q A;  1H3D A;  5ICT A;  2GHA A;  3ZS6 A;  1IXI A;  4BDR A;  4R72 A;  1M5E A;  2ZYK A;  3MZ9 A;  2QSX A;  1POY 1;  1O7T A;  4OTE A;  2DYX A;  4YB6 A;  3WAE A;  1B4Z A;  3DLN A;  2OJT A;  1SDX A;  4BDQ A;  1SW1 A;  1OQG A;  1LB8 A;  4BLA A;  3VXC A;  1B7H A;  2DXY A;  2D5W A;  4K3F A;  2YPN A;  1XHY A;  1HSL A;  5EHS A;  3SET A;  3KGC A;  1VE4 A;  5AA2 B;  1JVX A;  2Y7R A;  4O3C A;  3VLU A;  2QRY A;  1A8E A;  2ZYM A;  5CC2 A;  1AIV A;  2UVG A;  3K2D A;  1M5B A;  3TTL A;  1OVT A;  2G29 A;  5FHO A;  1JW5 A;  3GZG A;  4F3P A;  3MUQ A;  2H98 A;  1LAX A;  4LP2 B;  3KN8 A;  4IO5 A;  5AA3 A;  4FAJ A;  4KQP A;  1UIU A;  4TLM B;  2PX1 A;  5FHM A;  3FXR A;  3V89 B;  3B7D A;  3L6G A;  3DP6 A;  1LFG A;  3LSW A;  3CVG A;  1UTH A;  3PPP A;  1B9J A;  1UQW A;  4G8M A;  4ELO A;  1NNK A;  1Y1Z A;  1MH3 A;  5JEI A;  3PMV A;  5CRY A;  2ALU A;  4KPT A;  4F3B A;  4OES A;  5H8Q A;  3MWB A;  3CFZ A;  1YPN A;  4XKR A;  3MC2 A;  1LCT A;  1XC1 A;  1IXH A;  1LB9 A;  2Q9T A;  3CIJ A;  1NL5 A;  3KBR A;  2W7Y A;  3JZJ A;  3U8Q A;  2HAU A;  4YAH X;  4ESX A;  1SYI A;  4FEB A;  3S9L C;  2I3V A;  3IAZ A;  4EQB A;  1N84 A;  3FVO A;  2Y7K A;  4DCY A;  1LLS A;  3RN8 A;  1MQD A;  5L9M A;  2I6E A;  4QSC A;  5I2K B;  2B3F A;  2Y7I A;  3G3G A;  2O7I A;  3PMW A;  1EZO A;  5EHM A;  4ZZE A;  4GRK A;  1B4H A;  2GH9 A;  1OLA A;  4Q0C A;  4AB6 A;  3Q27 A;  3RT6 B;  5ICQ A;  1NKX A;  1YTV A;  1EU8 A;  2F97 A;  1N7W A;  4KFQ A;  3OO8 A;  1IIW A;  4IGR A;  3S4U A;  1SW2 A;  2LAO A;  1USY H;  1EZP A;  4IO7 A;  3USD A;  3OO7 A;  2Y7P A;  5TP9 A;  2NVU B;  4QSD A;  4HCW A;  5IAI A;  4P0I A;  1SVX B;  3T9H B;  5CBR A;  2ONR A;  1NFT A;  1GVC A;  1F9B A;  4RNS A;  3K00 A;  2I49 A;  2QMX A;  1D3K A;  3KEI A;  2O84 X;  2QPQ A;  1B32 A;  2DS9 A;  4Q8R A;  4LQ2 A;  1MQH A;  1B1H A;  4M1V A;  4R75 A;  3VXB A;  2AIX A;  4DXC A;  2QJE A;  3I6V A;  4HCY A;  5CMK A;  1MPC A;  2F78 A;  3PPR A;  1XOC A;  5HBC A;  4QFP A;  5I59 B;  4JDF A;  4RK2 A;  1FTM A;  4GD5 A;  5AE4 A;  1Q35 A;  1R1N A;  1J1N A;  4QFO A;  1NMU A;  3FD3 A;  2UYE A;  2XX7 A;  3E13 X;  1URD A;  2ABH A;  1II5 A;  2ZNU A;  3MBP A;  4U1O A;  4LVQ A;  3W9W A;  1MQG A;  5FTI A;  4OFO A;  3TEL A;  5TPA B;  4KCD A;  3G3I A;  3MP8 A;  3T93 B;  3PPQ A;  1B46 A;  4ZS9 A;  3QAX A;  2OZZ A;  2RIN A;  4OEU A;  4OXV A;  2O6A A;  3FZV A;  1QUI A;  4YU0 A;  2A5T B;  1PB7 A;  1US5 A;  4RK9 A;  2DE3 A;  4I62 A;  2NXO A;  2NWJ A;  1XVX A;  3K6V A;  3O6G A;  1IZ1 A;  4DZ1 A;  1H44 A;  4R2F A;  3T96 B;  4ONY A;  5K2Y A;  4GF8 A;  3PUZ E;  3K6X A;  3QIM A;  4POW A;  2AYS A;  1RYX A;  4ECF A;  2AL5 A;  4UAC A;  4YKI A;  1LFI A;  1QUJ A;  3TUS A;  2NOO A;  1I69 A;  3SER A;  1N76 A;  4F22 A;  3VVD A;  4FOR A;  2NUV A;  2H9B A;  4EQ7 A;  2XXV A;  3LR1 A;  1AMF A;  4TOZ A;  4E0W A;  4OET A;  2GRV A;  4ELR A;  3K1M A;  3H6T A;  4H1X A;  1CB6 A;  4F2Q A;  2OLB A;  4LZ8 A;  4NWC A;  5AA4 B;  1QW0 A;  3OEL A;  5H8N A;  3Q28 A;  1WOD A;  1BTJ A;  4ZEF A;  3VE1 B;  4NF8 B;  3VVE A;  4QFN A;  2PYY A;  5I2N A;  1FW0 A;  2HAV A;  2ZNT A;  1H45 A;  4NED A;  4HTG A;  1SW5 A;  2XHD A;  2R71 A;  2F7C A;  1L5T A;  4PET A;  1AL3 A;  1MY3 A;  4IB2 A;  3HV1 A;  4R9F A;  2HXW A;  1MDQ A;  1XT8 A;  4GWO A;  4ZE8 A;  3BFT A;  3ZKL A;  4ZEB A;  3CI8 A;  1PB8 A;  1FTJ A;  2CMO A;  1MPD A;  3BBR A;  3UP9 A;  2I0C A;  2M8C A;  3V83 A;  2DOJ A;  4ESW A;  1MG1 A;  1P1O A;  4PQJ A;  4LUB A;  3KOS A;  4ZE9 A;  3IJX B;  4NWD A;  4GIZ A;  3PUY E;  4GFR A;  1B0L A;  4BDO A;  2E0S A;  3BFU A;  3VLW A;  3EF7 A;  1NH8 A;  1TFD A;  4MF3 A;  4WXJ A;  3TEP A;  3KSX A;  4JWY A;  1N0T A;  1B3L A;  4DE8 A;  2Q2C A;  4NF4 A;  2XXH A;  1MS7 A;  3O29 A;  2Z8E A;  5L9S A;  3FUZ A;  3O9P A;  5KCJ B;  2XD3 A;  4QRZ A;  3PPN A;  1GGG A;  5A5X A;  3M3K A;  4F19 A;  4Z7E A;  5LOM A;  1DMB A;  4MBP A;  4R73 A;  4TQU Q;  4R74 A;  1MY4 A;  3I3V A;  4GL0 A;  1NNT A;  1WVJ A;  1MXZ A;  3IB2 A;  5I58 A;  1LAF E;  2REG A;  2V93 A;  1UIV A;  3PUX E;  2XXU A;  2VOZ A;  1ZU0 A;  1Y9U A;  2XXW A;  3VVF A;  5H8H A;  5BUU A;  3FJM A;  5BWJ A;  2O68 A;  1A55 A;  3N94 A;  3MP6 A;  5EYF A;  4LQ5 A;  2PT1 A;  1JNF A;  3C35 A;  3GBB A;  3R7X A;  3FJ7 A;  4XKN A;  2H99 A;  4PFY A;  3G7W A;  1B3G A;  2ZYO A;  1O64 A;  2V84 A;  3K6W A;  5I56 A;  2O69 A;  3KG2 A;  1US4 A;  1LGB C;  2QS1 A;  2QS2 A;  4RPO A;  5CM6 A;  1NNF A;  3O6I A;  4WED A;  1OMP A;  3SKP A;  5FTH A;  1IEJ A;  3N5L A;  2ZNS A;  4XKQ A;  2F8D A;  3MPK A;  5I57 B;  4PFU A;  2UVH A;  2OCU A;  4P11 A;  2QL3 A;  1MRP A;  3CSG A;  3LSF B;  4DLD A;  1DOT A;  2KLF A;  4KYD A;  2DSF A;  4G68 A;  4ZEC A;  3OSR A;  4G4P A;  4IY6 A;  3QYT A;  4RXL A;  2ZYN A;  4FIM A;  1MXY A;  4NF6 A;  1VR5 A;  2UVJ A;  2QMW A;  4OER A;  3R26 A;  1USY E;  4OEV A;  3D4C A;  4RYA A;  2DWI A;  2DVC A;  3FAT A;  1D9V A;  2PT2 A;  2RF1 A;  3CG1 A;  1DTG A;  3TCF A;  3G3F A;  5I58 B;  3M3L A;  5B7D A;  3K6U A;  2IEE A;  2DWJ A;  4F1V A;  1RYO A;  1JVY A;  3P7I A;  3DM0 A;  2DE4 A;  4LON B;  1MXU A;  2OK2 A;  2ESN A;  4N6P A;  3UIF A;  1R6Z A;  4KYE A;  2A5S A;  3O97 A;  1I6B A;  2Q8J A;  1S50 A;  1R9L A;  2I0B A;  1GV8 A;  4U4S A;  5JTY A;  2DP8 A;  1ANF A;  3IOR A;  1MQI A;  1MM7 A;  3OEM A;  2V3Q A;  2ONS A;  3ILT B;  4NTL A;  5DVI A;  1SBP A;  3O2A A;  2THI A;  1IIT A;  1SI0 A;  1HSE A;  4WKM A;  4ZED A;  3UGW A;  1UTH B;  2VGQ A;  1DSN A;  3A09 A;  5DT6 A;  3IR1 A;  4IY5 A;  1AOV A;  1QUK A;  4MFI A;  3SDF A;  3THI A;  2VD3 A;  4EXL A;  3GBA A;  4KCC A;  5KDT A;  2H4I A;  1URS A;  5H8Q B;  1Y4T A;  4C1U A;  3H6U A;  4Q5T A;  4R6Y A;  2AL4 A;  1QJM A;  4C1T A;  2IA4 A;  1HSJ A;  4BDN A;  1IQ7 A;  3KN7 A;  1H43 A;  3KN3 A;  3PMX A;  4H8I A;  4EQ9 A;  3H6V A;  3K1N A;  4ZDM A;  3QSL A;  3N6U A;  1B3E A;  2DQV A;  2R9J A;  1IUD A;  3HO7 A;  3EHS A;  2I4B A;  3IO4 A;  3PD8 A;  1VFD A;  1Z7N E;  1QVS A;  4E0X A;  3RTF B;  4AB5 A;  4ND9 A;  3T9U A;  1Y3N A;  2OWS A;  2RCA A;  3DEL B;  4I1D A;  2YJP A;  3OD7 A;  4ZZA A;  4KR5 A;  3VFJ A;  3PU5 A;  4AQ4 A;  1BLF A;  5CMM A;  4IO3 A;  3HN0 A;  2VD2 A;  4JSO A;  4U1Z A;  1D4N A;  1MM6 A;  1ZMG A;  2F7A A;  3PUW E;  4N13 A;  4H6D A;  4MLV A;  4OEN A;  3IO6 A;  2F5X A;  2YLN A;  4OQO A;  3MPL A;  5TP9 B;  5KDT B;  2DWA A;  3TOD A;  1M5F A;  3LSX A;  1SD3 A;  2XXX A;  2X26 A;  4FEC A;  3VDF A;  5ITO A;  4F1Y A;  3JV9 A;  4OYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...