4UACA

Eur_01830 with acarbose
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
383
structure length
383
Chain Sequence
GKETITVMGPAEDLDDAQGAWLKTECEAFAKANPDFNIEFKYVTSSESDAKDVVTKDPKAAADVYMFANDQLEPLIKANAIAKLGGDTAEYVKSSNSEAMAATVTYDGDIYAVPYTSNTWFMYYDKRVFSEDDVKSLDTMLTKGKVSFPFDNGWYLNAFYAANGCTIFGDGTDKAAGYDFSGDKGTAVTNYIVDLFANPNFVMDNNEGSLGLAGLKDGSINAYFNGNWNYDKVKEALGEENVGVAALPTINIGGKDCQLKAFLGSKAIGVNPNCKNQEVAVKLAAFLGSEDAQLAHFKLRGQAPVNKDLATNEEVAADPVAAAMAKVSSDCSVAQPIIDMSGYWDAATPFGDAFQNGAEGQITKDNAAQKTEDFNTQLNDSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Carbohydrate ABC transporter substrate-binding protein, CUT1
publication title Molecular details of a starch utilization pathway in the human gut symbiont Eubacterium rectale.
pubmed doi rcsb
source organism Eubacterium rectale dsm 17629
total genus 138
structure length 383
sequence length 383
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4uacA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4uacA01
2XX8A 1A55A 2DVCA 2XXHA 3BFUA 1RYOA 3OENA 1OLCA 4AB5A 1JNFA 1MQIA 1OQHA 1FTKA 5L9MA 1O64A 4KYSA 2PYYA 4NF6B 1NKXA 1Y4CA 2QRYA 4M1VA 3R6UA 1Z7NE 3VLUA 2G29A 1B5JA 5J1DA 1FQBA 2OJTA 3Q26A 2V84A 2ONRA 3C32A 3IJOB 2F36A 3MP8A 3RNNA 1GV8A 1MXXA 1FQEA 4OEUA 4DXUA 3B6TA 1B46A 5KCJA 4LQ2A 2M8CA 2NUVA 1B3EA 2D3IA 2RC9A 2XD2A 4O3BA 1QUJA 1M5DA 4IGRA 2HZKA 4UA8A 2CZLA 1URGA 1CB6A 3T9XB 1LAGE 4GF8A 1EH3A 3OO9A 4YKPA 4NEDA 4R6HA 3USDA 2XXRA 5H8NB 1N84A 4M4GA 5AA4A 3O66A 3N6UA 1SI1A 3ECRA 4PFTA 3FATA 2CMOA 3S9EA 3B6WA 4F22A 3IR1A 5AE4A 2F78A 3SEXA 4IO7A 5CRYA 2Y7KA 4WEDA 2UVJA 3LBSA 3K6UA 1R6ZA 2XXQA 1QKBA 3MQ9A 4YICA 1TXFA 2R9JA 3O97A 3AXFA 4G68C 3C34A 3SDFA 4G8NA 4IO5A 2O1LA 3PUYE 3PUVE 1HSJA 3CG3A 3Q28A 4EUOA 3QUFA 1B58A 1B05A 3KBRA 5I57A 3EF7A 2FA7A 5I59A 1SBPA 2I4CA 2GH9A 4C0RA 3TMGA 3RPWA 1WODA 3PPPA 4U4XA 4H67A 1USYE 2DYXA 3D4CA 2REJA 2VD2A 1URSA 4IB2A 3DP6A 1VE4A 4LZ7A 2IEEA 1A40A 2XHDA 3GZGA 3PGFA 1UIVA 3OXNA 3ZKLA 3O6GA 3TCGA 2B3FA 3N6TA 4GL0A 2A5TB 1SW2A 5DYHA 3VVDA 3K2DA 1LFHA 2HCAA 3W15C 3S4UA 4QFOA 2ONKE 5F7VA 3PUXE 4F3GA 1B0HA 4DIGA 1FQCA 5CI5A 1I6QA 2RF1A 3O2AA 2NVUB 2FYIA 1SDXA 3ILUB 3F11A 2YLNA 3C9HA 2PVUA 2ZYNA 3HV1A 1LGBC 1ZKBA 1UTBA 3PPRA 4JSDA 4Z7EA 1XVXA 2AL5A 1UTHB 4R6YA 4TLLB 2XX7A 5A5XB 3LR1A 1B51A 2I4BA 4DDDA 1II5A 1IEJA 1ZU0A 1LAXA 3MZ9A 4U1ZA 1A7LA 3TTNA 3T9HB 5I2NA 3VXCA 3PMXA 4YU0A 4FORA 3KFMA 2Q88A 3K1PA 3GXAA 2ZNSA 3CG1A 1BP5A 2V3QA 5JEIA 1AOVA 1Y4TA 1AIVA 4JSOA 4EDPA 4GLIA 5I58A 5LOMA 5H8HB 4ZDMA 1B5IA 2Q2CA 1GVCA 2DE4A 4H0WA 2G93A 1POY1 1SYIA 4OESA 2VGQA 1R1NA 4QSCA 3EN3A 3TAJA 4ISUA 1FTLA 4JDFA 2F7CA 3FJMA 1NNTA 2HQ0A 3V8XB 1PEBA 5ELVA 3IOUA 1FTJA 3KEIA 4K3FA 3MP6A 3H6WA 1IITA 1Y3QA 3RTFB 5B70A 3QUJA 4ELPA 2GFEA 2RC7A 4ESXA 3L6GA 5IAIA 1LAFE 2QL3A 1R9LA 5DEXA 1MG1A 2O84X 1MM6A 1NNPA 3Q25A 2H98A 4G68A 2X7QA 2Z23A 4IO4A 2QS3A 1S50A 4H8JA 3QK6A 2DWIA 2W7YA 4KYDA 1XC1A 3T22A 3G3IA 3ILTB 4X48A 3LSXA 2THIA 1IUDA 5FHOA 2QS4A 1LFGA 4NF4B 2F5XA 4AB6A 1IZ1A 1LSTA 3K00A 1NFTA 3H6VA 3VLVA 1Z7ME 4RJZA 3HSTA 3U94A 1LAHE 4I9DA 4PFYA 4YB7A 1LFIA 2O6AA 1MXZA 4P0IA 3FV2A 4WEPA 5H8FA 2VD3A 4ZE8A 1NH8A 1NNFA 4EXLA 3VVFA 2Z8EA 5KCJB 4ZEDA 2YPNA 4QFKA 4MFIA 2Y7IA 2XXPA 3O6IA 4YAHX 4N13A 3SKPA 1UIUA 1B1HA 4U1OA 4EF2A 4OXVA 3GBBA 1GR2A 2PT1A 1IXHA 1M5FA 4RXLA 2RCBA 3FV1A 5CMBA 4P11A 3IB2A 3MPLA 1PC3A 1BLFA 1VSOA 3I6VA 1J1NA 1B7UA 4KPTA 1OIBA 2Z8DA 3G3HA 2DP8A 1S7YA 4L17A 3UIFA 2UYFA 3S9MC 1POTA 2O7IA 4KI0E 4KD5A 4OMBA 3PD8A 3W9VA 4DCYA 4F18A 2Q9TA 3DELB 3T96B 3IB0A 1EU8A 4O3CA 2V3UA 3PU5A 4ND9A 2XXUA 3RUMA 2HXWA 3OEMA 1LLSA 2I6EA 1H44A 2HZLA 1Q1KA 4MH5A 5JTYA 5K2YA 3VE1B 3TTRA 3WAFA 4R74A 4R2BA 1IQ7A 5I2KA 3CFLA 3G3GA 4PETA 4ELOA 5FTIA 5I57B 1T0KA 1PB9A 4GD5A 1ANFA 1EZPA 4IO3A 3KN8A 3C4MA 1D3KA 3H03A 2VOZA 5KDTA 3TTMA 3CSBA 2Z22A 1IIWA 5H8QA 1NNKA 4P0GA 1IXGA 4GXAA 3IAZA 1B7ZA 3KJ7A 5KZTA 3C31A 4WXJA 2DWJA 4PQJA 4DLDA 3TKDA 4KFQA 4ECFA 3SEYA 1SI0A 4G77A 3M3FA 1WVJA 5TU0A 4GRKA 1LB9A 4U21A 1MPBA 1P1OA 2ABHA 3WAEA 4IO2A 1B52A 4RK9A 3FUZA 3TODA 1B5HA 3OO8A 4R9GA 4NF8A 4F1YA 1P99A 3QYTA 4RY1A 1SVXB 3GBAA 2QS1A 3MAMA 1A54A 2I3VA 4I62A 3VDFA 5TP9A 4F3PA 4LQ5A 3EQ1A 5DVFA 2QPQA 2AYSA 3MVZA 3H6UA 3MZ1A 2B65A 1A8FA 3E3KA 3FJGA 3MWBA 4JWYA 1YAEA 2Q2AA 3KN3A 1XT8A 2DWAA 3FVKA 5DVJA 3SERA 2Y7RA 3CSGA 1MQGA 3N94A 1MXYA 2ZYOA 1DMBA 3DM0A 1GGGA 1XHYA 2Y7WA 4IY6A 3VV5A 1B9JA 3IOVA 5JK4A 3E4RA 2LAOA 4E0WA 3FD3A 2XXWA 4HS7A 5HPQA 1B40A 3MZBA 1FQDA 4JBZA 3B7DA 1Y9UA 5B7DA 3TDJA 4UACA 1USYH 4ZECA 4ZS9A 1M5CA 1L5TA 4FIMA 1PB7A 4FE8A 1FCKA 2F8DA 1OVBA 5CMKA 4NF5A 4F1VA 1GTKA 5L8DA 4FEDA 3JZJA 5HM4B 3U72A 1PBQA 4DE8A 3IORA 3FXQA 3A09A 1OVTA 3MW0A 2F7AA 1QULA 3T9UA 2H5YA 4BDMA 1B3GA 5TPAB 4OVJA 4X1BA 3RY3A 5DEXB 1NH7A 2ZYKA 2I3WA 3TCHA 4LONB 3S9NC 3LUYA 3OOAA 2Q8JA 1ZTYA 4OERA 1R9QA 1MQJA 3D4GA 3MUQA 1AH5A 4F39A 3JV9A 3TTKA 2OBGA 3KG2A 4R6KA 1JETA 4NMYA 1MY3A 1H3DA 5H8NA 4YMBA 4YB6A 5CMCA 4ZZAA 5H8SA 4AQ4A 2F97A 2QSXA 2FNCA 1M5EA 2F7BA 2X26A 4ZEFA 2ZNTA 1F9BA 5F1QA 3DP4A 5ICQA 2H99A 3QSLA 1M5BA 1SD3A 3K4UA 5K2XA 4ZZEA 4GL8A 4HCYA 1MY1A 1DPPA 1A99A 4DCXA 4U2RA 1I69A 5FHMA 2ANJA 1MS7A 4BLAA 4POWA 4RPOA 4FEBA 4F1UA 1MM7A 5AA2B 1LB8A 3KOTA 1TT1A 1XS5A 3G3KA 1Y1MA 4F29A 4OTEA 4XKNA 4POXA 1N7WA 3IOTA 4NWDA 3A3UA 2OK2A 4HTGA 1LCTA 1CE2A 3MJNA 4THIA 1ELJA 1QUIA 4OHNA 4PE5B 3UORA 5CBRA 4GOTA 1HSEA 4OYVA 3V89B 2VP1A 2XD3A 4U23A 1FTOA 4EQBA 4ZEKA 2OWTA 1DSNA 3KOSA 2V93A 2DE3A 3N26A 2A5TA 2DQVA 3OO7A 1B3LA 1JW1A 1HSLA 1N0TA 2E1SA 3FVNA 4RPNA 4YB5A 3UA8A 1N3XA 4FAJA 3S2VA 4PFWA 1B3FA 4DZ1A 3VLWA 3FJ7A 1QUKA 4DXBA 3LSWA 3PPOA 1BIYA 3IX1A 3O9PA 5CM6A 5DVIA 3R26A 4ELQA 5CC2A 3OELA 3H6TA 3K02A 1URDA 1QKAA 2HAVA 2I0CA 1Q35A 3MVYA 1IXIA 1UTHA 3IK6B 3LSFB 4H5GA 1H76A 3IOWA 1MRPA 3U92A 1ZMGA 4YKJA 1PB8A 2P1SA 2AIXA 4H1XA 3EHSA 1P1NA 2REGA 1N04A 4QSEA 3FXRA 2OWSA 2XXTA 3KZGA 2Z8FA 2ZXTA 1LBCA 4EXKA 4RA1A 3C35A 3G3FA 5AA4B 4F3SA 4JB7A 4EF1A 1OMPA 5IKBA 1B6HA 5H8HA 2PT2A 3HCQA 1QW0A 4U4SA 4I8CA 2HAUA 4F3BA 2DXYA 1H43A 3LC8A 2QS2A 3KGCA 2E0SA 4TLMB 3OD7A 3UK4A 3UP9A 4KR5A 1Y3NA 4R73A 1B32A 2XXIA 1P1QA 2ALUA 1MPCA 1US5A 3QIMA 3V5AA 3EPEA 3M3LA 1DTZA 1EZ9A 2V3TA 4EQ9A 3S9LC 1MPDA 5I59B 4OZ9A 3CR9A 4ZEIA 2QMXA 1B0LA 4XKQA 2I49A 2IA4A 1SQYA 3PUWE 3R7XA 4LP2B 1VFEA 3K1NA 1RKMA 3IJXB 1MQDA 5DT6A 1A8EA 1P1WA 4NF5B 2XXVA 3I3VA 4NF4A 3FIRA 1JEVA 3TUSA 3U93A 1YTVA 4KCCA 3CVGA 4Q8RA 4GWOA 3K6XA 2O69A 1Y3PA 4NWCA 2KLFA 1JVXA 1MXWA 1OQGA 2D5WA 2UYEA 4QF9A 3MVXA 5M2VA 2RKMA 3E13X 3RGYA 3ODBA 4GFRA 2O7UA 4FECA 2UVGA 3M3KA 3U8QA 5AA1A 1US4A 4YKIA 3TYHA 1MH4A 4IO6A 3W9WA 4ZEBA 2X7PA 2ZMBA 3BBRA 2AL4A 4JWXA 1UTBB 2I0BA 3DLNA 4R72A 5BUUA 1SYHA 2H4IA 4BDRA 2RC8A 4XKRA 1B7HA 3UN6A 2R6GE 1XVYA 4X9TA 1ZJLA 2F6PA 1IXCA 3C33A 1AL3A 4PP0A 2HFBA 3MVWA 5I56A 2ESNA 5AA3A 4F31B 4RNSA 3K1MA 3TPAA 5I2NB 2ONSA 4G8MA 5EHSA 2ZYMA 3K01A 3KSXA 3FVOA 2Y7PA 4WKMA 2Y84A 4OEVA 1I6AA 3B6QA 4YKKA 3CFXA 4F19A 2NXOA 3OMBA 3EHTA 4QHQA 1BTJA 3T93B 1ATGA 4Q5TA 2OZZA 3BFTA 2DE2A 2DS9A 4MLVA 4IY5A 5I58B 1PBPA 1OLAA 3DP8A 2NWJA 4EQ7A 2XXYA 5DTBA 2F35A 4R75A 3TEPA 3VVEA 3Q27A 2XX9A 4F2QA 4G8HA 4OFLA 4H8IA 2QMWA 3A3CA 3SEWA 1D9VA 3FZVA 1LCFA 4LATA 2UXAA 1MXVA 4RK2A 1MH3A 3MBPA 4LVQA 2B3BA 4TQUQ 1XOCA 2UVHA 2F6GA 3CRBA 3H4ZA 4NF6A 4XKPA 2GHBA 1TFAA 3SEVA 4QFPA 1TWYA 1MDQA 3TTLA 3FXUA 2UVIA 5ISUA 3SETA 4OFOA 3TQWA 1FQAA 3TZAA 1EZOA 4C1TA 1ZIUA 4G68B 3PV0E 2GRVA 3RLFE 3RT6B 1DPEA 1NMUA 5L9SA 3OEKA 3PMVA 3MC2A 3RN8A 3ZS6A 2F34A 3CIJA 1O63A 3O28A 3IL1B 3RT8A 2I48A 1B3HA 1DOTA 3G7WA 3M8UA 5BWJA 1N76A 5AA2D 2OLBA 4LZ8A 4NE4A 2PMSA 4NTLA 2RCAA 2YJPA 4H5FA 5H8FB 2O68A 3RTWB 4X1DA 2HEUA 1B4ZA 1QJMA 2GHAA 4BDLA 2DVZA 3OSQA 2ZNUA 2DOJA 3KJTA 1NL5A 3IO6A 3HPIA 4TOZA 4GIZA 5EYFA 3JYRA 5HBCA 5CMMA 2O1MA 4E0XA 3FASA 2H9BA 3H3GA 3T66A 3VFJA 3LSLA 3ZSFA 3CFZA 1MY4A 1Y1ZA 2DXRA 4XTCQ 1YCJA 3OSRA 1RYXA 2H25A 5EHMA 3FVGA 3HN0A 3O6HA 1TFDA 4U22A 4H65A 1ZBMA 4MF3A 3V83A 2P2AA 3PPNA 4QFNA 1H45A 3E9XA 3ZKKA 1JW5A 1FTMA 2QJEA 3QXMA 1MY2A 1B1XA 4BDQA 4OETA 3PD9A 5ICTA 3SESA 2D21A 4KCDA 1B4HA 5CBSA 1SW4A 3L6HA 4OENA 3THIA 3U1OA 4G4PA 3VXBA 2V25A 1KWHA 3G3JA 3RQTA 4GQOA 1MDP1 5JTYB 3O29A 4JXIA 4GXSB 1N7XA 3C36A 5I2KB 4RYAA 3HHGA 2BJJX 3K6WA 4Z0IA 5TPAA 1Y20A 2OCUA 1JEUA 3H7MA 1B2HA 1N3WA 1P1UA 4ELRA 3QAXA 4XIGQ 2DSFA 3TFLA 4N07A 1VR5A 4YZZA 3BKIB 4ONYA 3H06B 5I84A 5KDTB 3PMWA 2R71A 1MQHA 4KHZE 5H8QB 3Q29A 1QVSA 3I5OA 3FGSA 1FW0A 4FATA 1PDAA 3MP1A 3P7IA 4GVOA 3IB1A 4MBPA 5A5XA 4XXUA 1UQWA 2VHAA 4OFJA 4ZE9A 3K6VA 4DXCA 4LA9A 1SW5A 3EHUA 1O7TA 3PUZE 4F2OA 1JQFA 4FJPA 2NOOA 4C1UA 2I58A 2WKYA 2A5SA 4JWOA 3KN7A 1WDNA 4G2ZA 3TCFA 1FQFA 5FTHA 2XXXA 2P0SA 4NF8B 1ZLQA 1JW4A 5ITOA 1LBBA 5FHNA 3N5LA 3UGWA 4HW8A 3PPQA 4Q0CA 3ONMA 4R2FA 3K0VA 4BDNA 4IGTA 2PX1A 4PFUA 5TP9B 4Q30B 3T9VA 3KSJA 5AA2A 3MPKA 4OQOA 4HCWA 4QFLA 4H6DA 1I6BA 4R9FA 4N6PA 5L9OA 4ESWA 1S9TA 5I56B 1D4NA 3CI8A 4BDOA 4KYEA 3HHFA 1AMFA 1D9YA 1SW1A 4OWDA 1MXUA 5ITPA 4YMAA 2PBWA 3SEUA 1MY0A 4I1DA 3GLBA 1YPNA 3TELA 2RINA 1VFDA 4KQPA 4QSDA 4LZ5A 4O3AA 3TQLA 4MLQA 4QRZA 3IO4A 2O51A 3OO6A 1BKAA 4LUBA 1DTGA 1JVYA 2DWHA 2Q89A 3HO7A
chains in the Genus database with same CATH superfamily
2XX8A 1A55A 2DVCA 2XXHA 3BFUA 4PCDA 1RYOA 3OENA 1OLCA 4AB5A 1JNFA 1MQIA 1OQHA 1FTKA 5L9MA 3QMFA 1O64A 4KYSA 2PYYA 4NF6B 1NKXA 1Y4CA 2QRYA 4M1VA 3R6UA 1Z7NE 3VLUA 2G29A 1B5JA 2VPNA 5J1DA 1FQBA 4PTKA 2OJTA 4JVCA 3Q26A 2V84A 2ONRA 3C32A 4PE3A 1FPEA 3IJOB 2F36A 3MP8A 3RNNA 1GV8A 1MXXA 1FQEA 4OEUA 4DXUA 3B6TA 1B46A 5KCJA 4JVDA 4LQ2A 2M8CA 2NUVA 3ISPA 1B3EA 2D3IA 4X8RA 2RC9A 2XD2A 4O3BA 1QUJA 1M5DA 4IGRA 2HZKA 4UA8A 2CZLA 2WEFA 1URGA 1CB6A 4XEQA 3T9XB 1LAGE 4GF8A 1EH3A 3OO9A 4YKPA 4NEDA 4R6HA 3USDA 1FBGA 2XXRA 5H8NB 1N84A 4M4GA 4G61A 5AA4A 1LBVA 3O66A 3N6UA 1SI1A 3ECRA 4PFTA 3FATA 5ET5A 2CMOA 4AS5A 3S9EA 3B6WA 4F22A 3IR1A 5AE4A 2F78A 3SEXA 4IO7A 5CRYA 2Y7KA 4WEDA 2UVJA 3LBSA 3K6UA 1R6ZA 2XXQA 1QKBA 3MQ9A 4YICA 1TXFA 2R9JA 3O97A 5ET7A 4HE2A 3AXFA 4G68C 4PC9A 3C34A 3SDFA 4G8NA 4IO5A 2XWVA 2O1LA 3PUYE 3PUVE 1HSJA 5EYGA 3KC0A 1FPIA 3CG3A 3Q28A 2CZIA 4EUOA 3QUFA 4JVIA 4N91A 1B58A 1NUXA 1B05A 3KBRA 5I57A 3EF7A 2FA7A 5I59A 1SBPA 2I4CA 2GH9A 4C0RA 3TMGA 3RPWA 1WODA 3PPPA 4U4XA 4H67A 1USYE 4N4UA 2DYXA 3IFCA 3D4CA 2REJA 2MKZA 1NV7A 2VD2A 1URSA 4IB2A 4P1LA 3DP6A 1VE4A 4LZ7A 2IEEA 4P47A 1A40A 2XHDA 3GZGA 3PGFA 1UIVA 3OXNA 3ZKLA 3O6GA 3B50A 3TCGA 2B3FA 3N6TA 4GL0A 4MHFA 3T0JA 2A5TB 1SW2A 5DYHA 3VVDA 3K2DA 1LFHA 2HCAA 3W15C 3S4UA 5DW8A 4QFOA 2ONKE 4P9KA 5F7VA 2FBPA 3PUXE 1KZ8A 4F3GA 1B0HA 4DIGA 1FQCA 5CI5A 1I6QA 2RF1A 3O2AA 4GBWA 3BIHA 2NVUB 2FYIA 1SDXA 3E78A 3ILUB 3F11A 2YLNA 3C9HA 2PVUA 4AS4A 2ZYNA 3HV1A 1LGBC 1ZKBA 1UTBA 3PPRA 4IR8A 2ZZWA 4P1EA 3U65A 4JSDA 4Z7EA 1XVXA 2AL5A 1UTHB 4R6YA 4TLLB 1NV5A 2XX7A 4N15A 5A5XB 3LR1A 1B51A 2I4BA 4DDDA 1II5A 1IEJA 1ZU0A 1FJ9A 1LAXA 3MZ9A 4U1ZA 1A7LA 3TTNA 3T9HB 5I2NA 3VXCA 3PMXA 4YU0A 4FORA 1FPKA 3KFMA 2Q88A 3K1PA 3GXAA 2ZNSA 3CG1A 1BP5A 2V3QA 5JEIA 1AOVA 1IMAA 1Y4TA 3CHGA 1AIVA 1VDWA 4JSOA 4EDPA 4GLIA 5I58A 5LOMA 2CZKA 5H8HB 4ZDMA 5FBPA 1B5IA 2Q2CA 1GVCA 2DE4A 4H0WA 2G93A 1POY1 1SYIA 4OESA 2VGQA 2Q74A 1R1NA 4QSCA 1K9ZA 3EN3A 4GWSA 3TAJA 4ISUA 1FTLA 4JDFA 4GWWA 4O7MA 2F7CA 3FJMA 1NNTA 2HQ0A 4HE1A 3V8XB 1PEBA 5ELVA 3IOUA 1FTJA 3KEIA 4K3FA 3MP6A 3H6WA 1LBXA 1IITA 1Y3QA 2L5VA 3RTFB 5B70A 3QUJA 4ELPA 2GFEA 1FPJA 2RC7A 4ESXA 3L6GA 5IAIA 5EQ9A 1LAFE 2QL3A 1R9LA 5DEXA 1MG1A 2O84X 1MM6A 1NNPA 3Q25A 2H98A 4G68A 1SPIA 2X7QA 2Z23A 4IO4A 2QS3A 1S50A 4H8JA 3QK6A 2DWIA 2W7YA 4GX6A 4KYDA 1XC1A 3T22A 3G3IA 3ILTB 4X48A 3LSXA 2THIA 1IUDA 4PAFA 5FHOA 2QS4A 1LFGA 4NF4B 2F5XA 4AB6A 5LTCA 1IZ1A 1LSTA 3K00A 1NFTA 3H6VA 3VLVA 1Z7ME 1LBWA 4RJZA 3HSTA 5EYHA 3U94A 1LAHE 4I9DA 4PFYA 4YB7A 3A29A 2GQ1A 1KA0A 1LFIA 2O6AA 1MXZA 4P0IA 3FV2A 4WEPA 5H8FA 2VD3A 3RPLB 5A5LA 4ZE8A 4MIJA 1NH8A 1NNFA 4EXLA 4NHBA 3VVFA 2Z8EA 4X04A 4NF0A 1LBZA 5KCJB 4ZEDA 2YPNA 4PGPA 4QFKA 4MFIA 2Y7IA 2XXPA 3O6IA 4YAHX 4N13A 3SKPA 1UIUA 1B1HA 4U1OA 4EF2A 4OXVA 3GBBA 1GR2A 2PT1A 1IXHA 1M5FA 4RXLA 2RCBA 3FV1A 4OA4A 5CMBA 4P11A 3IB2A 3MPLA 1YZ0A 4GWUA 1PC3A 1BLFA 1VSOA 3I6VA 1J1NA 1B7UA 4KPTA 3LV0A 1OIBA 2Z8DA 3G3HA 5T3JA 2DP8A 1S7YA 4L17A 3UIFA 2UYFA 3S9MC 1DCUA 1POTA 4PDDA 2O7IA 4KI0E 4KD5A 4OMBA 3PD8A 3W9VA 4PFIA 4XFEA 2FHYA 4DCYA 4F18A 2Q9TA 3DELB 3T96B 1RDZA 3IB0A 1EU8A 1IMEA 4O3CA 2V3UA 3PU5A 4ND9A 2XXUA 3RUMA 2HXWA 3OEMA 1LLSA 2I6EA 1H44A 2HZLA 2XA5A 1Q1KA 4MH5A 5JTYA 5K2YA 3VE1B 3TTRA 3WAFA 4R74A 4R2BA 1IQ7A 5I2KA 3CFLA 3G3GA 4PETA 4ELOA 5FTIA 5I57B 1FPGA 1T0KA 1PB9A 4GD5A 1ANFA 1EZPA 4IO3A 1IMFA 3KN8A 3C4MA 1D3KA 3H03A 2VOZA 5KDTA 3TTMA 3CSBA 2Z22A 1FRPA 1IIWA 5H8QA 3HFUA 1NNKA 4P0GA 5ET8A 1IXGA 4GXAA 3IAZA 1B7ZA 5IGAA 3KJ7A 5KZTA 3C31A 3LUZA 2DDKA 4N8GA 4WXJA 2DWJA 3PTYA 3GYYA 4PQJA 1FPFA 4DLDA 3TKDA 4KFQA 4ECFA 2WBBA 5I5PA 3SEYA 1SI0A 4G77A 3M3FA 1WVJA 5TU0A 4GRKA 1LB9A 4U21A 4PFRA 2V4CA 1MPBA 1P1OA 2QVVA 2OX3A 2ABHA 1KA1A 1NV0A 3WAEA 4IO2A 1B52A 4RK9A 3FUZA 3TODA 1B5HA 3OO8A 4R9GA 4NX1A 2CEYA 4NF8A 4F1YA 1P99A 3QYTA 4RY1A 1SVXB 3GBAA 2QS1A 3MAMA 1A54A 2I3VA 4I62A 2Q8MA 4MNCA 3VDFA 5TP9A 4O8MA 4F3PA 4LQ5A 3EQ1A 3NOHA 5DVFA 2QPQA 2AYSA 3MVZA 3H6UA 3MZ1A 2B65A 1A8FA 2QFLA 1EYKA 4MCOA 3E3KA 3FJGA 3MWBA 4JWYA 1YAEA 2Q2AA 3KN3A 4GBVA 1XT8A 2HXRA 2DWAA 3FVKA 5DVJA 3SERA 2Y7RA 3CSGA 1MQGA 3N94A 1MXYA 2ZYOA 1DMBA 4N17A 4O7IA 3DM0A 1IMDA 1GGGA 1XHYA 2Y7WA 4IY6A 1NI9A 2Y5KA 3VV5A 1B9JA 3IOVA 5JK4A 3E4RA 2LAOA 4E0WA 3E79A 4GWYA 3FD3A 2XXWA 4HS7A 5HPQA 1B40A 1FSAA 3MZBA 1FQDA 4JBZA 3B7DA 1Y9UA 5B7DA 3TDJA 4UACA 1USYH 4ZECA 4ZS9A 4NG7A 3FBPA 1M5CA 1L5TA 4FIMA 1PB7A 4FE8A 1FCKA 2F8DA 1OVBA 5CMKA 4NF5A 4F1VA 1GTKA 5L8DA 4FEDA 4OVQA 5IZ3B 3JZJA 5HM4B 3U72A 1PBQA 4DE8A 3IORA 2HPGA 3FXQA 2WX9A 3A09A 4PF8A 1OVTA 3MW0A 2F7AA 1QULA 3T9UA 1NV2A 2H5YA 1B3GA 5TPAB 2Y5LA 4BDMA 4OVJA 4X1BA 1G0IA 2QVRA 3RY3A 5DEXB 5J16A 1NH7A 2ZYKA 2I3WA 3TCHA 1EYJA 4LONB 3S9NC 3LUYA 3OOAA 2Q8JA 1ZTYA 4OERA 1R9QA 1MQJA 3D4GA 1FBPA 3MUQA 1AH5A 4F39A 3JV9A 4NN3A 2R8TA 3TTKA 2OBGA 3KG2A 5EQ8A 4R6KA 1JETA 1NV6A 4NMYA 1MY3A 2KR0A 4H46A 1H3DA 5H8NA 4YMBA 1FBDA 4YB6A 5CMCA 4ZZAA 5H8SA 4AQ4A 2F97A 2QSXA 2FNCA 1M5EA 2F7BA 2X26A 4ZEFA 3BIGA 2ZNTA 1F9BA 5F1QA 3DP4A 5ICQA 2H99A 3QSLA 1M5BA 1SD3A 3K4UA 5K2XA 4ZZEA 4GL8A 1AWBA 4HCYA 1MY1A 3KBZA 1DPPA 1A99A 4DCXA 4U2RA 1I69A 5FHMA 2ANJA 1MS7A 4BLAA 4POWA 4RPOA 4FEBA 4F1UA 1MM7A 5AA2B 4P8BA 1LB8A 3KOTA 1TT1A 1XS5A 3G3KA 1Y1MA 4NAPA 4DI3D 4F29A 4OTEA 4NGUA 4I3YA 4XKNA 4POXA 2PCRA 1N7WA 3IOTA 4NWDA 3A3UA 2OK2A 4HTGA 5IZ1A 4PBHA 1LCTA 1CE2A 3MJNA 4PBQA 4THIA 1ELJA 1QUIA 4OHNA 4PE5B 3UORA 5CBRA 4GOTA 1HSEA 4OYVA 3V89B 3RYDA 2VP1A 2XD3A 4U23A 1FTOA 4EQBA 4ZEKA 2OWTA 1DSNA 3KOSA 2V93A 2DE3A 2F3BA 2A5TA 2DQVA 3OO7A 1B3LA 3N26A 1JW1A 1HSLA 1N0TA 2E1SA 3FVNA 4RPNA 3ROJA 2P3NA 4YB5A 3UA8A 1N3XA 4FAJA 4OVSA 4PFWA 3S2VA 1B3FA 4DZ1A 3VLWA 3FJ7A 1QUKA 4DXBA 3LSWA 3PPOA 1BIYA 3IX1A 3O9PA 5CM6A 5DVIA 3R26A 4ELQA 2FVZA 5CC2A 3OELA 3H6TA 3K02A 1URDA 4OVTA 1QKAA 2HAVA 2I0CA 1Q35A 3MVYA 5ESYA 1IXIA 1UTHA 2ZZVA 3IK6B 3LSFB 1RDYA 5EQ7A 4H5GA 1H76A 3IOWA 1FPLA 4PF6A 1MRPA 3U92A 1ZMGA 4YKJA 1PB8A 2P1SA 2AIXA 2VT5A 4H1XA 3EHSA 2BJIA 1P1NA 2REGA 4MAGA 2QVUA 1N04A 4QSEA 3FXRA 2OWSA 2XXTA 3KZGA 2OWZA 2Z8FA 2ZXTA 1LBCA 1G0HA 4EXKA 4RA1A 3C35A 3G3FA 5AA4B 4F3SA 4PGNA 4JB7A 4EF1A 4GWZA 1OMPA 5IKBA 1B6HA 5H8HA 2PT2A 3HCQA 4P3LA 1QW0A 1BK4A 4U4SA 4I8CA 2XWOA 2HAUA 5I7IA 2XWKA 2FIXA 1LEVA 4F3BA 2DXYA 1H43A 3LC8A 2QS2A 3KGCA 2E0SA 4TLMB 3OD7A 1NUZA 3UK4A 3UP9A 1YYZA 1FJ6A 4KR5A 4N81A 4PAKA 1Y3NA 4R73A 5IM2A 1B32A 2XXIA 1P1QA 2ALUA 1NV3A 1MPCA 1US5A 3QIMA 4GX4A 3V5AA 3EPEA 3M3LA 1DTZA 1EZ9A 2V3TA 4EQ9A 3S9LC 1MPDA 5I59B 4OZ9A 3CR9A 4ZEIA 2QMXA 1B0LA 4XKQA 2I49A 2IA4A 1SQYA 3PUWE 3R7XA 4LP2B 1VFEA 3K1NA 1RKMA 3IJXB 4GWXA 1MQDA 5DT6A 1A8EA 1NV4A 1DBZA 1P1WA 4NF5B 2XXVA 3I3VA 4NF4A 3FIRA 1JEVA 2PFZA 3TUSA 3U93A 1YTVA 4KCCA 3CVGA 1IMCA 4Q8RA 2PFYA 4GWOA 3K6XA 2O69A 1Y3PA 4NWCA 2KLFA 1JVXA 1MXWA 1OQGA 2WBDA 2D5WA 2UYEA 3RPLA 4QF9A 3MVXA 5M2VA 2RKMA 3E13X 3RGYA 3ODBA 4GFRA 2O7UA 4FECA 2UVGA 3M3KA 3U8QA 5AA1A 1US4A 4YKIA 3TYHA 1MH4A 4IO6A 3W9WA 3IFAA 4ZEBA 2X7PA 2ZMBA 3BBRA 2AL4A 4JWXA 1UTBB 2I0BA 2P3VA 3DLNA 3T1BA 4R72A 5BUUA 1SYHA 2CEXA 2H4IA 4BDRA 2RC8A 4XKRA 1B7HA 3UN6A 2R6GE 1XVYA 4X9TA 1ZJLA 2F6PA 1IXCA 3C33A 4OVPA 4HE0A 1AL3A 4PP0A 2HFBA 3MVWA 2WYKA 5I56A 2ESNA 4P56A 5AA3A 4F31B 4RNSA 3K1MA 3TPAA 4H45A 5I2NB 2ONSA 4G8MA 1FPBA 5EHSA 2ZYMA 3K01A 3KSXA 3FVOA 2Y7PA 4WKMA 2Y84A 4OEVA 1I6AA 3B6QA 4YKKA 1YXIA 3CFXA 4MJOA 4F19A 2NXOA 3OMBA 3EHTA 4QHQA 1BTJA 3T93B 1ATGA 4Q5TA 2XXKA 2OZZA 3BFTA 2DE2A 2DS9A 4MLVA 4IY5A 5I58B 1PBPA 1OLAA 3DP8A 2NWJA 4EQ7A 1FBHA 2XXYA 5DTBA 2F35A 4R75A 3TEPA 3VVEA 3Q27A 2XX9A 4F2QA 4G8HA 4OFLA 4H8IA 2QMWA 3A3CA 3SEWA 1D9VA 4MNIA 4OVRA 3FZVA 1LCFA 4LATA 2UXAA 1MXVA 4RK2A 1MH3A 3MBPA 4LVQA 2B3BA 4DI4B 4TQUQ 1XOCA 2UVHA 4NQ8A 2F6GA 3CRBA 3H4ZA 4NF6A 4XKPA 2GHBA 1TFAA 4OANA 3SEVA 4QFPA 1TWYA 1MDQA 4N6KA 4PFBA 1NUWA 4HXVA 1XI6A 3TTLA 3FXUA 2UVIA 5ISUA 3SETA 4O94A 4OFOA 3TQWA 1FQAA 3TZAA 1EZOA 4C1TA 1ZIUA 4G68B 3PV0E 2GRVA 3RLFE 3RT6B 3FXBA 1DPEA 4QXDA 1NMUA 5L9SA 3OEKA 3PMVA 3MC2A 3RN8A 3ZS6A 2F34A 1EYIA 3CIJA 1O63A 3O28A 3IL1B 3RT8A 2I48A 1B3HA 1DOTA 2XWIA 3G7WA 3M8UA 5BWJA 1N76A 4MNPA 1FBFA 1JP4A 5AA2D 2OLBA 4LZ8A 4NE4A 2PMSA 4NTLA 2RCAA 2YJPA 4H5FA 1IMBA 2O68A 5H8FB 3RTWB 3MYUA 4X1DA 2HEUA 1B4ZA 1QJMA 2GHAA 4BDLA 2DVZA 3OSQA 4FBPA 2ZNUA 2DOJA 2FIEA 3KJTA 2B4MA 1NL5A 1INPA 3IO6A 3HPIA 2ZZXA 4TOZA 4GIZA 5EYFA 3JYRA 5HBCA 5LDZA 5CMMA 2O1MA 4E0XA 3FASA 2H9BA 3H3GA 3T66A 3VFJA 3LSLA 3ZSFA 3CFZA 2JJKA 1MY4A 1Y1ZA 2DXRA 1NUYA 1NV1A 4XTCQ 1YCJA 3OSRA 1RYXA 2H25A 5EHMA 3FVGA 3HN0A 5I3SA 2KQZA 3O6HA 1TFDA 1FPDA 4U22A 4H65A 1ZBMA 4MF3A 3V83A 2P2AA 3SZPA 3PPNA 4QFNA 1CNQA 4KXPA 1H45A 3E9XA 3ZKKA 1JW5A 4I40A 1FTMA 4N6DA 2QJEA 4MEVA 3QXMA 1MY2A 1B1XA 4BDQA 4PAIA 4OETA 3PD9A 5ICTA 3SESA 2D21A 4KCDA 1B4HA 1LBYA 5CBSA 1SW4A 3L6HA 4I3EA 5IZ3A 4OENA 3THIA 3U1OA 4G4PA 3VXBA 2V25A 1KWHA 3G3JA 3RQTA 4GQOA 1MDP1 5JTYB 1K9YA 3O29A 4JXIA 4GXSB 1N7XA 3C36A 5I2KB 4RYAA 3HHGA 2BJJX 3K6WA 4Z0IA 5TPAA 4MMPA 1Y20A 2OCUA 1JEUA 3H7MA 1B2HA 1N3WA 1P1UA 1QGXA 2F3DA 4ELRA 3MSTA 3QAXA 4XIGQ 2WYPA 2DSFA 3TFLA 4N07A 1VR5A 4YZZA 3BKIB 4ONYA 3H06B 5I84A 5KDTB 3PMWA 2R71A 1DK4A 1MQHA 4KHZE 5H8QB 1FBEA 3Q29A 1QVSA 3I5OA 3FGSA 4N8YA 1FW0A 4FATA 1PDAA 3MP1A 3P7IA 2HHMA 4GVOA 4LN5A 5EQAA 1FBCA 3IB1A 3KC1A 4MBPA 5ET6A 5A5XA 4XXUA 4UABA 1UQWA 2B4LA 4OFJA 2VHAA 4ZE9A 3K6VA 4PDHA 4DXCA 4XF5A 4LA9A 4GX3A 1SW5A 3EHUA 1O7TA 3PUZE 4F2OA 1JQFA 4FJPA 2NOOA 4C1UA 2I58A 2WKYA 2A5SA 4JWOA 3KN7A 1WDNA 4G2ZA 3TCFA 1FQFA 5FTHA 2XXXA 2P0SA 3B8BA 4NF8B 1ZLQA 3D1RA 1JW4A 5ITOA 1LBBA 5FHNA 3N5LA 3UGWA 4HW8A 1Q9DA 4Q0CA 4R2FA 3PPQA 3ONMA 4MX6A 3K0VA 4BDNA 4IGTA 2PX1A 1RDXA 4PFUA 5TP9B 5F24A 4Q30B 3T9VA 3KSJA 5AA2A 3MPKA 4OQOA 4HCWA 4QFLA 1FTAA 4H6DA 5IZZA 1I6BA 4R9FA 4N6PA 5L9OA 4ESWA 1S9TA 5I56B 1D4NA 3CI8A 4BDOA 4KYEA 3HHFA 1AMFA 1D9YA 1SW1A 4OWDA 1MXUA 2VPOA 5ITPA 4YMAA 1D9QA 2CZHA 2PBWA 3SEUA 1MY0A 4I1DA 3GLBA 1YPNA 3TELA 2RINA 1VFDA 3EKIA 4KQPA 4QSDA 4LZ5A 4O3AA 3TQLA 4MLQA 4QBAA 4QRZA 3IO4A 2O51A 3OO6A 1BKAA 4LUBA 1DTGA 1JVYA 2DWHA 2Q89A 3HO7A
chains in the Genus database with same CATH topology
2XX8A 1A55A 2DVCA 2XXHA 3BFUA 1RYOA 3OENA 1OLCA 4AB5A 1JNFA 1MQIA 1OQHA 1FTKA 5L9MA 1O64A 4KYSA 2PYYA 4NF6B 1NKXA 1Y4CA 2QRYA 4M1VA 3R6UA 1Z7NE 3VLUA 2G29A 1B5JA 5J1DA 1FQBA 2OJTA 3Q26A 2V84A 2ONRA 3C32A 3IJOB 2F36A 3MP8A 3RNNA 1GV8A 1MXXA 1FQEA 4OEUA 4DXUA 3B6TA 1B46A 5KCJA 4LQ2A 2M8CA 2NUVA 1B3EA 2D3IA 2RC9A 2XD2A 4O3BA 1QUJA 1M5DA 4IGRA 2HZKA 4UA8A 2CZLA 1URGA 1CB6A 3T9XB 1LAGE 4GF8A 1EH3A 3OO9A 4YKPA 4NEDA 4R6HA 3USDA 2XXRA 5H8NB 1N84A 4M4GA 5AA4A 3O66A 3N6UA 1SI1A 3ECRA 4PFTA 3FATA 2CMOA 3S9EA 3B6WA 4F22A 3IR1A 5AE4A 2F78A 3SEXA 4IO7A 5CRYA 2Y7KA 4WEDA 2UVJA 3LBSA 3K6UA 1R6ZA 2XXQA 1QKBA 3MQ9A 4YICA 1TXFA 2R9JA 3O97A 3AXFA 4G68C 3C34A 3SDFA 4G8NA 4IO5A 2O1LA 3PUYE 3PUVE 1HSJA 3CG3A 3Q28A 4EUOA 3QUFA 1B58A 1B05A 3KBRA 5I57A 3EF7A 2FA7A 5I59A 1SBPA 2I4CA 2GH9A 4C0RA 3TMGA 3RPWA 1WODA 3PPPA 4U4XA 4H67A 1USYE 2DYXA 3D4CA 2REJA 2VD2A 1URSA 4IB2A 3DP6A 1VE4A 4LZ7A 2IEEA 1A40A 2XHDA 3GZGA 3PGFA 1UIVA 3OXNA 3ZKLA 3O6GA 3TCGA 2B3FA 3N6TA 4GL0A 2A5TB 1SW2A 5DYHA 3VVDA 3K2DA 1LFHA 2HCAA 3W15C 3S4UA 4QFOA 2ONKE 5F7VA 3PUXE 4F3GA 1B0HA 4DIGA 1FQCA 5CI5A 1I6QA 2RF1A 3O2AA 2NVUB 2FYIA 1SDXA 3ILUB 3F11A 2YLNA 3C9HA 2PVUA 2ZYNA 3HV1A 1LGBC 1ZKBA 1UTBA 3PPRA 4JSDA 4Z7EA 1XVXA 2AL5A 1UTHB 4R6YA 4TLLB 2XX7A 5A5XB 3LR1A 1B51A 2I4BA 4DDDA 1II5A 1IEJA 1ZU0A 1LAXA 3MZ9A 4U1ZA 1A7LA 3TTNA 3T9HB 5I2NA 3VXCA 3PMXA 4YU0A 4FORA 3KFMA 2Q88A 3K1PA 3GXAA 2ZNSA 3CG1A 1BP5A 2V3QA 5JEIA 1AOVA 1Y4TA 1AIVA 4JSOA 4EDPA 4GLIA 5I58A 5LOMA 5H8HB 4ZDMA 1B5IA 2Q2CA 1GVCA 2DE4A 4H0WA 2G93A 1POY1 1SYIA 4OESA 2VGQA 1R1NA 4QSCA 3EN3A 3TAJA 4ISUA 1FTLA 4JDFA 2F7CA 3FJMA 1NNTA 2HQ0A 3V8XB 1PEBA 5ELVA 3IOUA 1FTJA 3KEIA 4K3FA 3MP6A 3H6WA 1IITA 1Y3QA 3RTFB 5B70A 3QUJA 4ELPA 2GFEA 2RC7A 4ESXA 3L6GA 5IAIA 1LAFE 2QL3A 1R9LA 5DEXA 1MG1A 2O84X 1MM6A 1NNPA 3Q25A 2H98A 4G68A 2X7QA 2Z23A 4IO4A 2QS3A 1S50A 4H8JA 3QK6A 2DWIA 2W7YA 4KYDA 1XC1A 3T22A 3G3IA 3ILTB 4X48A 3LSXA 2THIA 1IUDA 5FHOA 2QS4A 1LFGA 4NF4B 2F5XA 4AB6A 1IZ1A 1LSTA 3K00A 1NFTA 3H6VA 3VLVA 1Z7ME 4RJZA 3HSTA 3U94A 1LAHE 4I9DA 4PFYA 4YB7A 1LFIA 2O6AA 1MXZA 4P0IA 3FV2A 4WEPA 5H8FA 2VD3A 4ZE8A 1NH8A 1NNFA 4EXLA 3VVFA 2Z8EA 5KCJB 4ZEDA 2YPNA 4QFKA 4MFIA 2Y7IA 2XXPA 3O6IA 4YAHX 4N13A 3SKPA 1UIUA 1B1HA 4U1OA 4EF2A 4OXVA 3GBBA 1GR2A 2PT1A 1IXHA 1M5FA 4RXLA 2RCBA 3FV1A 5CMBA 4P11A 3IB2A 3MPLA 1PC3A 1BLFA 1VSOA 3I6VA 1J1NA 1B7UA 4KPTA 1OIBA 2Z8DA 3G3HA 2DP8A 1S7YA 4L17A 3UIFA 2UYFA 3S9MC 1POTA 2O7IA 4KI0E 4KD5A 4OMBA 3PD8A 3W9VA 4DCYA 4F18A 2Q9TA 3DELB 3T96B 3IB0A 1EU8A 4O3CA 2V3UA 3PU5A 4ND9A 2XXUA 3RUMA 2HXWA 3OEMA 1LLSA 2I6EA 1H44A 2HZLA 1Q1KA 4MH5A 5JTYA 5K2YA 3VE1B 3TTRA 3WAFA 4R74A 4R2BA 1IQ7A 5I2KA 3CFLA 3G3GA 4PETA 4ELOA 5FTIA 5I57B 1T0KA 1PB9A 4GD5A 1ANFA 1EZPA 4IO3A 3KN8A 3C4MA 1D3KA 3H03A 2VOZA 5KDTA 3TTMA 3CSBA 2Z22A 1IIWA 5H8QA 1NNKA 4P0GA 1IXGA 4GXAA 3IAZA 1B7ZA 3KJ7A 5KZTA 3C31A 4WXJA 2DWJA 4PQJA 4DLDA 3TKDA 4KFQA 4ECFA 3SEYA 1SI0A 4G77A 3M3FA 1WVJA 5TU0A 4GRKA 1LB9A 4U21A 1MPBA 1P1OA 2ABHA 3WAEA 4IO2A 1B52A 4RK9A 3FUZA 3TODA 1B5HA 3OO8A 4R9GA 4NF8A 4F1YA 1P99A 3QYTA 4RY1A 1SVXB 3GBAA 2QS1A 3MAMA 1A54A 2I3VA 4I62A 3VDFA 5TP9A 4F3PA 4LQ5A 3EQ1A 5DVFA 2QPQA 2AYSA 3MVZA 3H6UA 3MZ1A 2B65A 1A8FA 3E3KA 3FJGA 3MWBA 4JWYA 1YAEA 2Q2AA 3KN3A 1XT8A 2DWAA 3FVKA 5DVJA 3SERA 2Y7RA 3CSGA 1MQGA 3N94A 1MXYA 2ZYOA 1DMBA 3DM0A 1GGGA 1XHYA 2Y7WA 4IY6A 3VV5A 1B9JA 3IOVA 5JK4A 3E4RA 2LAOA 4E0WA 3FD3A 2XXWA 4HS7A 5HPQA 1B40A 3MZBA 1FQDA 4JBZA 3B7DA 1Y9UA 5B7DA 3TDJA 4UACA 1USYH 4ZECA 4ZS9A 1M5CA 1L5TA 4FIMA 1PB7A 4FE8A 1FCKA 2F8DA 1OVBA 5CMKA 4NF5A 4F1VA 1GTKA 5L8DA 4FEDA 3JZJA 5HM4B 3U72A 1PBQA 4DE8A 3IORA 3FXQA 3A09A 1OVTA 3MW0A 2F7AA 1QULA 3T9UA 2H5YA 4BDMA 1B3GA 5TPAB 4OVJA 4X1BA 3RY3A 5DEXB 1NH7A 2ZYKA 2I3WA 3TCHA 4LONB 3S9NC 3LUYA 3OOAA 2Q8JA 1ZTYA 4OERA 1R9QA 1MQJA 3D4GA 3MUQA 1AH5A 4F39A 3JV9A 3TTKA 2OBGA 3KG2A 4R6KA 1JETA 4NMYA 1MY3A 1H3DA 5H8NA 4YMBA 4YB6A 5CMCA 4ZZAA 5H8SA 4AQ4A 2F97A 2QSXA 2FNCA 1M5EA 2F7BA 2X26A 4ZEFA 2ZNTA 1F9BA 5F1QA 3DP4A 5ICQA 2H99A 3QSLA 1M5BA 1SD3A 3K4UA 5K2XA 4ZZEA 4GL8A 4HCYA 1MY1A 1DPPA 1A99A 4DCXA 4U2RA 1I69A 5FHMA 2ANJA 1MS7A 4BLAA 4POWA 4RPOA 4FEBA 4F1UA 1MM7A 5AA2B 1LB8A 3KOTA 1TT1A 1XS5A 3G3KA 1Y1MA 4F29A 4OTEA 4XKNA 4POXA 1N7WA 3IOTA 4NWDA 3A3UA 2OK2A 4HTGA 1LCTA 1CE2A 3MJNA 4THIA 1ELJA 1QUIA 4OHNA 4PE5B 3UORA 5CBRA 4GOTA 1HSEA 4OYVA 3V89B 2VP1A 2XD3A 4U23A 1FTOA 4EQBA 4ZEKA 2OWTA 1DSNA 3KOSA 2V93A 2DE3A 3N26A 2A5TA 2DQVA 3OO7A 1B3LA 1JW1A 1HSLA 1N0TA 2E1SA 3FVNA 4RPNA 4YB5A 3UA8A 1N3XA 4FAJA 3S2VA 4PFWA 1B3FA 4DZ1A 3VLWA 3FJ7A 1QUKA 4DXBA 3LSWA 3PPOA 1BIYA 3IX1A 3O9PA 5CM6A 5DVIA 3R26A 4ELQA 5CC2A 3OELA 3H6TA 3K02A 1URDA 1QKAA 2HAVA 2I0CA 1Q35A 3MVYA 1IXIA 1UTHA 3IK6B 3LSFB 4H5GA 1H76A 3IOWA 1MRPA 3U92A 1ZMGA 4YKJA 1PB8A 2P1SA 2AIXA 4H1XA 3EHSA 1P1NA 2REGA 1N04A 4QSEA 3FXRA 2OWSA 2XXTA 3KZGA 2Z8FA 2ZXTA 1LBCA 4EXKA 4RA1A 3C35A 3G3FA 5AA4B 4F3SA 4JB7A 4EF1A 1OMPA 5IKBA 1B6HA 5H8HA 2PT2A 3HCQA 1QW0A 4U4SA 4I8CA 2HAUA 4F3BA 2DXYA 1H43A 3LC8A 2QS2A 3KGCA 2E0SA 4TLMB 3OD7A 3UK4A 3UP9A 4KR5A 1Y3NA 4R73A 1B32A 2XXIA 1P1QA 2ALUA 1MPCA 1US5A 3QIMA 3V5AA 3EPEA 3M3LA 1DTZA 1EZ9A 2V3TA 4EQ9A 3S9LC 1MPDA 5I59B 4OZ9A 3CR9A 4ZEIA 2QMXA 1B0LA 4XKQA 2I49A 2IA4A 1SQYA 3PUWE 3R7XA 4LP2B 1VFEA 3K1NA 1RKMA 3IJXB 1MQDA 5DT6A 1A8EA 1P1WA 4NF5B 2XXVA 3I3VA 4NF4A 3FIRA 1JEVA 3TUSA 3U93A 1YTVA 4KCCA 3CVGA 4Q8RA 4GWOA 3K6XA 2O69A 1Y3PA 4NWCA 2KLFA 1JVXA 1MXWA 1OQGA 2D5WA 2UYEA 4QF9A 3MVXA 5M2VA 2RKMA 3E13X 3RGYA 3ODBA 4GFRA 2O7UA 4FECA 2UVGA 3M3KA 3U8QA 5AA1A 1US4A 4YKIA 3TYHA 1MH4A 4IO6A 3W9WA 4ZEBA 2X7PA 2ZMBA 3BBRA 2AL4A 4JWXA 1UTBB 2I0BA 3DLNA 4R72A 5BUUA 1SYHA 2H4IA 4BDRA 2RC8A 4XKRA 1B7HA 3UN6A 2R6GE 1XVYA 4X9TA 1ZJLA 2F6PA 1IXCA 3C33A 1AL3A 4PP0A 2HFBA 3MVWA 5I56A 2ESNA 5AA3A 4F31B 4RNSA 3K1MA 3TPAA 5I2NB 2ONSA 4G8MA 5EHSA 2ZYMA 3K01A 3KSXA 3FVOA 2Y7PA 4WKMA 2Y84A 4OEVA 1I6AA 3B6QA 4YKKA 3CFXA 4F19A 2NXOA 3OMBA 3EHTA 4QHQA 1BTJA 3T93B 1ATGA 4Q5TA 2OZZA 3BFTA 2DE2A 2DS9A 4MLVA 4IY5A 5I58B 1PBPA 1OLAA 3DP8A 2NWJA 4EQ7A 2XXYA 5DTBA 2F35A 4R75A 3TEPA 3VVEA 3Q27A 2XX9A 4F2QA 4G8HA 4OFLA 4H8IA 2QMWA 3A3CA 3SEWA 1D9VA 3FZVA 1LCFA 4LATA 2UXAA 1MXVA 4RK2A 1MH3A 3MBPA 4LVQA 2B3BA 4TQUQ 1XOCA 2UVHA 2F6GA 3CRBA 3H4ZA 4NF6A 4XKPA 2GHBA 1TFAA 3SEVA 4QFPA 1TWYA 1MDQA 3TTLA 3FXUA 2UVIA 5ISUA 3SETA 4OFOA 3TQWA 1FQAA 3TZAA 1EZOA 4C1TA 1ZIUA 4G68B 3PV0E 2GRVA 3RLFE 3RT6B 1DPEA 1NMUA 5L9SA 3OEKA 3PMVA 3MC2A 3RN8A 3ZS6A 2F34A 3CIJA 1O63A 3O28A 3IL1B 3RT8A 2I48A 1B3HA 1DOTA 3G7WA 3M8UA 5BWJA 1N76A 5AA2D 2OLBA 4LZ8A 4NE4A 2PMSA 4NTLA 2RCAA 2YJPA 4H5FA 5H8FB 2O68A 3RTWB 4X1DA 2HEUA 1B4ZA 1QJMA 2GHAA 4BDLA 2DVZA 3OSQA 2ZNUA 2DOJA 3KJTA 1NL5A 3IO6A 3HPIA 4TOZA 4GIZA 5EYFA 3JYRA 5HBCA 5CMMA 2O1MA 4E0XA 3FASA 2H9BA 3H3GA 3T66A 3VFJA 3LSLA 3ZSFA 3CFZA 1MY4A 1Y1ZA 2DXRA 4XTCQ 1YCJA 3OSRA 1RYXA 2H25A 5EHMA 3FVGA 3HN0A 3O6HA 1TFDA 4U22A 4H65A 1ZBMA 4MF3A 3V83A 2P2AA 3PPNA 4QFNA 1H45A 3E9XA 3ZKKA 1JW5A 1FTMA 2QJEA 3QXMA 1MY2A 1B1XA 4BDQA 4OETA 3PD9A 5ICTA 3SESA 2D21A 4KCDA 1B4HA 5CBSA 1SW4A 3L6HA 4OENA 3THIA 3U1OA 4G4PA 3VXBA 2V25A 1KWHA 3G3JA 3RQTA 4GQOA 1MDP1 5JTYB 3O29A 4JXIA 4GXSB 1N7XA 3C36A 5I2KB 4RYAA 3HHGA 2BJJX 3K6WA 4Z0IA 5TPAA 1Y20A 2OCUA 1JEUA 3H7MA 1B2HA 1N3WA 1P1UA 4ELRA 3QAXA 4XIGQ 2DSFA 3TFLA 4N07A 1VR5A 4YZZA 3BKIB 4ONYA 3H06B 5I84A 5KDTB 3PMWA 2R71A 1MQHA 4KHZE 5H8QB 3Q29A 1QVSA 3I5OA 3FGSA 1FW0A 4FATA 1PDAA 3MP1A 3P7IA 4GVOA 3IB1A 4MBPA 5A5XA 4XXUA 1UQWA 2VHAA 4OFJA 4ZE9A 3K6VA 4DXCA 4LA9A 1SW5A 3EHUA 1O7TA 3PUZE 4F2OA 1JQFA 4FJPA 2NOOA 4C1UA 2I58A 2WKYA 2A5SA 4JWOA 3KN7A 1WDNA 4G2ZA 3TCFA 1FQFA 5FTHA 2XXXA 2P0SA 4NF8B 1ZLQA 1JW4A 5ITOA 1LBBA 5FHNA 3N5LA 3UGWA 4HW8A 3PPQA 4Q0CA 3ONMA 4R2FA 3K0VA 4BDNA 4IGTA 2PX1A 4PFUA 5TP9B 4Q30B 3T9VA 3KSJA 5AA2A 3MPKA 4OQOA 4HCWA 4QFLA 4H6DA 1I6BA 4R9FA 4N6PA 5L9OA 4ESWA 1S9TA 5I56B 1D4NA 3CI8A 4BDOA 4KYEA 3HHFA 1AMFA 1D9YA 1SW1A 4OWDA 1MXUA 5ITPA 4YMAA 2PBWA 3SEUA 1MY0A 4I1DA 3GLBA 1YPNA 3TELA 2RINA 1VFDA 4KQPA 4QSDA 4LZ5A 4O3AA 3TQLA 4MLQA 4QRZA 3IO4A 2O51A 3OO6A 1BKAA 4LUBA 1DTGA 1JVYA 2DWHA 2Q89A 3HO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XX8 A;  1A55 A;  2DVC A;  2XXH A;  3BFU A;  1RYO A;  3OEN A;  1OLC A;  4AB5 A;  1JNF A;  1MQI A;  1OQH A;  1FTK A;  5L9M A;  1O64 A;  4KYS A;  2PYY A;  4NF6 B;  1NKX A;  1Y4C A;  2QRY A;  4M1V A;  3R6U A;  1Z7N E;  3VLU A;  2G29 A;  1B5J A;  5J1D A;  1FQB A;  2OJT A;  3Q26 A;  2V84 A;  2ONR A;  3C32 A;  3IJO B;  2F36 A;  3MP8 A;  3RNN A;  1GV8 A;  1MXX A;  1FQE A;  4OEU A;  4DXU A;  3B6T A;  1B46 A;  5KCJ A;  4LQ2 A;  2M8C A;  2NUV A;  1B3E A;  2D3I A;  2RC9 A;  2XD2 A;  4O3B A;  1QUJ A;  1M5D A;  4IGR A;  2HZK A;  4UA8 A;  2CZL A;  1URG A;  1CB6 A;  3T9X B;  1LAG E;  4GF8 A;  1EH3 A;  3OO9 A;  4YKP A;  4NED A;  4R6H A;  3USD A;  2XXR A;  5H8N B;  1N84 A;  4M4G A;  5AA4 A;  3O66 A;  3N6U A;  1SI1 A;  3ECR A;  4PFT A;  3FAT A;  2CMO A;  3S9E A;  3B6W A;  4F22 A;  3IR1 A;  5AE4 A;  2F78 A;  3SEX A;  4IO7 A;  5CRY A;  2Y7K A;  4WED A;  2UVJ A;  3LBS A;  3K6U A;  1R6Z A;  2XXQ A;  1QKB A;  3MQ9 A;  4YIC A;  1TXF A;  2R9J A;  3O97 A;  3AXF A;  4G68 C;  3C34 A;  3SDF A;  4G8N A;  4IO5 A;  2O1L A;  3PUY E;  3PUV E;  1HSJ A;  3CG3 A;  3Q28 A;  4EUO A;  3QUF A;  1B58 A;  1B05 A;  3KBR A;  5I57 A;  3EF7 A;  2FA7 A;  5I59 A;  1SBP A;  2I4C A;  2GH9 A;  4C0R A;  3TMG A;  3RPW A;  1WOD A;  3PPP A;  4U4X A;  4H67 A;  1USY E;  2DYX A;  3D4C A;  2REJ A;  2VD2 A;  1URS A;  4IB2 A;  3DP6 A;  1VE4 A;  4LZ7 A;  2IEE A;  1A40 A;  2XHD A;  3GZG A;  3PGF A;  1UIV A;  3OXN A;  3ZKL A;  3O6G A;  3TCG A;  2B3F A;  3N6T A;  4GL0 A;  2A5T B;  1SW2 A;  5DYH A;  3VVD A;  3K2D A;  1LFH A;  2HCA A;  3W15 C;  3S4U A;  4QFO A;  2ONK E;  5F7V A;  3PUX E;  4F3G A;  1B0H A;  4DIG A;  1FQC A;  5CI5 A;  1I6Q A;  2RF1 A;  3O2A A;  2NVU B;  2FYI A;  1SDX A;  3ILU B;  3F11 A;  2YLN A;  3C9H A;  2PVU A;  2ZYN A;  3HV1 A;  1LGB C;  1ZKB A;  1UTB A;  3PPR A;  4JSD A;  4Z7E A;  1XVX A;  2AL5 A;  1UTH B;  4R6Y A;  4TLL B;  2XX7 A;  5A5X B;  3LR1 A;  1B51 A;  2I4B A;  4DDD A;  1II5 A;  1IEJ A;  1ZU0 A;  1LAX A;  3MZ9 A;  4U1Z A;  1A7L A;  3TTN A;  3T9H B;  5I2N A;  3VXC A;  3PMX A;  4YU0 A;  4FOR A;  3KFM A;  2Q88 A;  3K1P A;  3GXA A;  2ZNS A;  3CG1 A;  1BP5 A;  2V3Q A;  5JEI A;  1AOV A;  1Y4T A;  1AIV A;  4JSO A;  4EDP A;  4GLI A;  5I58 A;  5LOM A;  5H8H B;  4ZDM A;  1B5I A;  2Q2C A;  1GVC A;  2DE4 A;  4H0W A;  2G93 A;  1POY 1;  1SYI A;  4OES A;  2VGQ A;  1R1N A;  4QSC A;  3EN3 A;  3TAJ A;  4ISU A;  1FTL A;  4JDF A;  2F7C A;  3FJM A;  1NNT A;  2HQ0 A;  3V8X B;  1PEB A;  5ELV A;  3IOU A;  1FTJ A;  3KEI A;  4K3F A;  3MP6 A;  3H6W A;  1IIT A;  1Y3Q A;  3RTF B;  5B70 A;  3QUJ A;  4ELP A;  2GFE A;  2RC7 A;  4ESX A;  3L6G A;  5IAI A;  1LAF E;  2QL3 A;  1R9L A;  5DEX A;  1MG1 A;  2O84 X;  1MM6 A;  1NNP A;  3Q25 A;  2H98 A;  4G68 A;  2X7Q A;  2Z23 A;  4IO4 A;  2QS3 A;  1S50 A;  4H8J A;  3QK6 A;  2DWI A;  2W7Y A;  4KYD A;  1XC1 A;  3T22 A;  3G3I A;  3ILT B;  4X48 A;  3LSX A;  2THI A;  1IUD A;  5FHO A;  2QS4 A;  1LFG A;  4NF4 B;  2F5X A;  4AB6 A;  1IZ1 A;  1LST A;  3K00 A;  1NFT A;  3H6V A;  3VLV A;  1Z7M E;  4RJZ A;  3HST A;  3U94 A;  1LAH E;  4I9D A;  4PFY A;  4YB7 A;  1LFI A;  2O6A A;  1MXZ A;  4P0I A;  3FV2 A;  4WEP A;  5H8F A;  2VD3 A;  4ZE8 A;  1NH8 A;  1NNF A;  4EXL A;  3VVF A;  2Z8E A;  5KCJ B;  4ZED A;  2YPN A;  4QFK A;  4MFI A;  2Y7I A;  2XXP A;  3O6I A;  4YAH X;  4N13 A;  3SKP A;  1UIU A;  1B1H A;  4U1O A;  4EF2 A;  4OXV A;  3GBB A;  1GR2 A;  2PT1 A;  1IXH A;  1M5F A;  4RXL A;  2RCB A;  3FV1 A;  5CMB A;  4P11 A;  3IB2 A;  3MPL A;  1PC3 A;  1BLF A;  1VSO A;  3I6V A;  1J1N A;  1B7U A;  4KPT A;  1OIB A;  2Z8D A;  3G3H A;  2DP8 A;  1S7Y A;  4L17 A;  3UIF A;  2UYF A;  3S9M C;  1POT A;  2O7I A;  4KI0 E;  4KD5 A;  4OMB A;  3PD8 A;  3W9V A;  4DCY A;  4F18 A;  2Q9T A;  3DEL B;  3T96 B;  3IB0 A;  1EU8 A;  4O3C A;  2V3U A;  3PU5 A;  4ND9 A;  2XXU A;  3RUM A;  2HXW A;  3OEM A;  1LLS A;  2I6E A;  1H44 A;  2HZL A;  1Q1K A;  4MH5 A;  5JTY A;  5K2Y A;  3VE1 B;  3TTR A;  3WAF A;  4R74 A;  4R2B A;  1IQ7 A;  5I2K A;  3CFL A;  3G3G A;  4PET A;  4ELO A;  5FTI A;  5I57 B;  1T0K A;  1PB9 A;  4GD5 A;  1ANF A;  1EZP A;  4IO3 A;  3KN8 A;  3C4M A;  1D3K A;  3H03 A;  2VOZ A;  5KDT A;  3TTM A;  3CSB A;  2Z22 A;  1IIW A;  5H8Q A;  1NNK A;  4P0G A;  1IXG A;  4GXA A;  3IAZ A;  1B7Z A;  3KJ7 A;  5KZT A;  3C31 A;  4WXJ A;  2DWJ A;  4PQJ A;  4DLD A;  3TKD A;  4KFQ A;  4ECF A;  3SEY A;  1SI0 A;  4G77 A;  3M3F A;  1WVJ A;  5TU0 A;  4GRK A;  1LB9 A;  4U21 A;  1MPB A;  1P1O A;  2ABH A;  3WAE A;  4IO2 A;  1B52 A;  4RK9 A;  3FUZ A;  3TOD A;  1B5H A;  3OO8 A;  4R9G A;  4NF8 A;  4F1Y A;  1P99 A;  3QYT A;  4RY1 A;  1SVX B;  3GBA A;  2QS1 A;  3MAM A;  1A54 A;  2I3V A;  4I62 A;  3VDF A;  5TP9 A;  4F3P A;  4LQ5 A;  3EQ1 A;  5DVF A;  2QPQ A;  2AYS A;  3MVZ A;  3H6U A;  3MZ1 A;  2B65 A;  1A8F A;  3E3K A;  3FJG A;  3MWB A;  4JWY A;  1YAE A;  2Q2A A;  3KN3 A;  1XT8 A;  2DWA A;  3FVK A;  5DVJ A;  3SER A;  2Y7R A;  3CSG A;  1MQG A;  3N94 A;  1MXY A;  2ZYO A;  1DMB A;  3DM0 A;  1GGG A;  1XHY A;  2Y7W A;  4IY6 A;  3VV5 A;  1B9J A;  3IOV A;  5JK4 A;  3E4R A;  2LAO A;  4E0W A;  3FD3 A;  2XXW A;  4HS7 A;  5HPQ A;  1B40 A;  3MZB A;  1FQD A;  4JBZ A;  3B7D A;  1Y9U A;  5B7D A;  3TDJ A;  4UAC A;  1USY H;  4ZEC A;  4ZS9 A;  1M5C A;  1L5T A;  4FIM A;  1PB7 A;  4FE8 A;  1FCK A;  2F8D A;  1OVB A;  5CMK A;  4NF5 A;  4F1V A;  1GTK A;  5L8D A;  4FED A;  3JZJ A;  5HM4 B;  3U72 A;  1PBQ A;  4DE8 A;  3IOR A;  3FXQ A;  3A09 A;  1OVT A;  3MW0 A;  2F7A A;  1QUL A;  3T9U A;  2H5Y A;  4BDM A;  1B3G A;  5TPA B;  4OVJ A;  4X1B A;  3RY3 A;  5DEX B;  1NH7 A;  2ZYK A;  2I3W A;  3TCH A;  4LON B;  3S9N C;  3LUY A;  3OOA A;  2Q8J A;  1ZTY A;  4OER A;  1R9Q A;  1MQJ A;  3D4G A;  3MUQ A;  1AH5 A;  4F39 A;  3JV9 A;  3TTK A;  2OBG A;  3KG2 A;  4R6K A;  1JET A;  4NMY A;  1MY3 A;  1H3D A;  5H8N A;  4YMB A;  4YB6 A;  5CMC A;  4ZZA A;  5H8S A;  4AQ4 A;  2F97 A;  2QSX A;  2FNC A;  1M5E A;  2F7B A;  2X26 A;  4ZEF A;  2ZNT A;  1F9B A;  5F1Q A;  3DP4 A;  5ICQ A;  2H99 A;  3QSL A;  1M5B A;  1SD3 A;  3K4U A;  5K2X A;  4ZZE A;  4GL8 A;  4HCY A;  1MY1 A;  1DPP A;  1A99 A;  4DCX A;  4U2R A;  1I69 A;  5FHM A;  2ANJ A;  1MS7 A;  4BLA A;  4POW A;  4RPO A;  4FEB A;  4F1U A;  1MM7 A;  5AA2 B;  1LB8 A;  3KOT A;  1TT1 A;  1XS5 A;  3G3K A;  1Y1M A;  4F29 A;  4OTE A;  4XKN A;  4POX A;  1N7W A;  3IOT A;  4NWD A;  3A3U A;  2OK2 A;  4HTG A;  1LCT A;  1CE2 A;  3MJN A;  4THI A;  1ELJ A;  1QUI A;  4OHN A;  4PE5 B;  3UOR A;  5CBR A;  4GOT A;  1HSE A;  4OYV A;  3V89 B;  2VP1 A;  2XD3 A;  4U23 A;  1FTO A;  4EQB A;  4ZEK A;  2OWT A;  1DSN A;  3KOS A;  2V93 A;  2DE3 A;  3N26 A;  2A5T A;  2DQV A;  3OO7 A;  1B3L A;  1JW1 A;  1HSL A;  1N0T A;  2E1S A;  3FVN A;  4RPN A;  4YB5 A;  3UA8 A;  1N3X A;  4FAJ A;  3S2V A;  4PFW A;  1B3F A;  4DZ1 A;  3VLW A;  3FJ7 A;  1QUK A;  4DXB A;  3LSW A;  3PPO A;  1BIY A;  3IX1 A;  3O9P A;  5CM6 A;  5DVI A;  3R26 A;  4ELQ A;  5CC2 A;  3OEL A;  3H6T A;  3K02 A;  1URD A;  1QKA A;  2HAV A;  2I0C A;  1Q35 A;  3MVY A;  1IXI A;  1UTH A;  3IK6 B;  3LSF B;  4H5G A;  1H76 A;  3IOW A;  1MRP A;  3U92 A;  1ZMG A;  4YKJ A;  1PB8 A;  2P1S A;  2AIX A;  4H1X A;  3EHS A;  1P1N A;  2REG A;  1N04 A;  4QSE A;  3FXR A;  2OWS A;  2XXT A;  3KZG A;  2Z8F A;  2ZXT A;  1LBC A;  4EXK A;  4RA1 A;  3C35 A;  3G3F A;  5AA4 B;  4F3S A;  4JB7 A;  4EF1 A;  1OMP A;  5IKB A;  1B6H A;  5H8H A;  2PT2 A;  3HCQ A;  1QW0 A;  4U4S A;  4I8C A;  2HAU A;  4F3B A;  2DXY A;  1H43 A;  3LC8 A;  2QS2 A;  3KGC A;  2E0S A;  4TLM B;  3OD7 A;  3UK4 A;  3UP9 A;  4KR5 A;  1Y3N A;  4R73 A;  1B32 A;  2XXI A;  1P1Q A;  2ALU A;  1MPC A;  1US5 A;  3QIM A;  3V5A A;  3EPE A;  3M3L A;  1DTZ A;  1EZ9 A;  2V3T A;  4EQ9 A;  3S9L C;  1MPD A;  5I59 B;  4OZ9 A;  3CR9 A;  4ZEI A;  2QMX A;  1B0L A;  4XKQ A;  2I49 A;  2IA4 A;  1SQY A;  3PUW E;  3R7X A;  4LP2 B;  1VFE A;  3K1N A;  1RKM A;  3IJX B;  1MQD A;  5DT6 A;  1A8E A;  1P1W A;  4NF5 B;  2XXV A;  3I3V A;  4NF4 A;  3FIR A;  1JEV A;  3TUS A;  3U93 A;  1YTV A;  4KCC A;  3CVG A;  4Q8R A;  4GWO A;  3K6X A;  2O69 A;  1Y3P A;  4NWC A;  2KLF A;  1JVX A;  1MXW A;  1OQG A;  2D5W A;  2UYE A;  4QF9 A;  3MVX A;  5M2V A;  2RKM A;  3E13 X;  3RGY A;  3ODB A;  4GFR A;  2O7U A;  4FEC A;  2UVG A;  3M3K A;  3U8Q A;  5AA1 A;  1US4 A;  4YKI A;  3TYH A;  1MH4 A;  4IO6 A;  3W9W A;  4ZEB A;  2X7P A;  2ZMB A;  3BBR A;  2AL4 A;  4JWX A;  1UTB B;  2I0B A;  3DLN A;  4R72 A;  5BUU A;  1SYH A;  2H4I A;  4BDR A;  2RC8 A;  4XKR A;  1B7H A;  3UN6 A;  2R6G E;  1XVY A;  4X9T A;  1ZJL A;  2F6P A;  1IXC A;  3C33 A;  1AL3 A;  4PP0 A;  2HFB A;  3MVW A;  5I56 A;  2ESN A;  5AA3 A;  4F31 B;  4RNS A;  3K1M A;  3TPA A;  5I2N B;  2ONS A;  4G8M A;  5EHS A;  2ZYM A;  3K01 A;  3KSX A;  3FVO A;  2Y7P A;  4WKM A;  2Y84 A;  4OEV A;  1I6A A;  3B6Q A;  4YKK A;  3CFX A;  4F19 A;  2NXO A;  3OMB A;  3EHT A;  4QHQ A;  1BTJ A;  3T93 B;  1ATG A;  4Q5T A;  2OZZ A;  3BFT A;  2DE2 A;  2DS9 A;  4MLV A;  4IY5 A;  5I58 B;  1PBP A;  1OLA A;  3DP8 A;  2NWJ A;  4EQ7 A;  2XXY A;  5DTB A;  2F35 A;  4R75 A;  3TEP A;  3VVE A;  3Q27 A;  2XX9 A;  4F2Q A;  4G8H A;  4OFL A;  4H8I A;  2QMW A;  3A3C A;  3SEW A;  1D9V A;  3FZV A;  1LCF A;  4LAT A;  2UXA A;  1MXV A;  4RK2 A;  1MH3 A;  3MBP A;  4LVQ A;  2B3B A;  4TQU Q;  1XOC A;  2UVH A;  2F6G A;  3CRB A;  3H4Z A;  4NF6 A;  4XKP A;  2GHB A;  1TFA A;  3SEV A;  4QFP A;  1TWY A;  1MDQ A;  3TTL A;  3FXU A;  2UVI A;  5ISU A;  3SET A;  4OFO A;  3TQW A;  1FQA A;  3TZA A;  1EZO A;  4C1T A;  1ZIU A;  4G68 B;  3PV0 E;  2GRV A;  3RLF E;  3RT6 B;  1DPE A;  1NMU A;  5L9S A;  3OEK A;  3PMV A;  3MC2 A;  3RN8 A;  3ZS6 A;  2F34 A;  3CIJ A;  1O63 A;  3O28 A;  3IL1 B;  3RT8 A;  2I48 A;  1B3H A;  1DOT A;  3G7W A;  3M8U A;  5BWJ A;  1N76 A;  5AA2 D;  2OLB A;  4LZ8 A;  4NE4 A;  2PMS A;  4NTL A;  2RCA A;  2YJP A;  4H5F A;  5H8F B;  2O68 A;  3RTW B;  4X1D A;  2HEU A;  1B4Z A;  1QJM A;  2GHA A;  4BDL A;  2DVZ A;  3OSQ A;  2ZNU A;  2DOJ A;  3KJT A;  1NL5 A;  3IO6 A;  3HPI A;  4TOZ A;  4GIZ A;  5EYF A;  3JYR A;  5HBC A;  5CMM A;  2O1M A;  4E0X A;  3FAS A;  2H9B A;  3H3G A;  3T66 A;  3VFJ A;  3LSL A;  3ZSF A;  3CFZ A;  1MY4 A;  1Y1Z A;  2DXR A;  4XTC Q;  1YCJ A;  3OSR A;  1RYX A;  2H25 A;  5EHM A;  3FVG A;  3HN0 A;  3O6H A;  1TFD A;  4U22 A;  4H65 A;  1ZBM A;  4MF3 A;  3V83 A;  2P2A A;  3PPN A;  4QFN A;  1H45 A;  3E9X A;  3ZKK A;  1JW5 A;  1FTM A;  2QJE A;  3QXM A;  1MY2 A;  1B1X A;  4BDQ A;  4OET A;  3PD9 A;  5ICT A;  3SES A;  2D21 A;  4KCD A;  1B4H A;  5CBS A;  1SW4 A;  3L6H A;  4OEN A;  3THI A;  3U1O A;  4G4P A;  3VXB A;  2V25 A;  1KWH A;  3G3J A;  3RQT A;  4GQO A;  1MDP 1;  5JTY B;  3O29 A;  4JXI A;  4GXS B;  1N7X A;  3C36 A;  5I2K B;  4RYA A;  3HHG A;  2BJJ X;  3K6W A;  4Z0I A;  5TPA A;  1Y20 A;  2OCU A;  1JEU A;  3H7M A;  1B2H A;  1N3W A;  1P1U A;  4ELR A;  3QAX A;  4XIG Q;  2DSF A;  3TFL A;  4N07 A;  1VR5 A;  4YZZ A;  3BKI B;  4ONY A;  3H06 B;  5I84 A;  5KDT B;  3PMW A;  2R71 A;  1MQH A;  4KHZ E;  5H8Q B;  3Q29 A;  1QVS A;  3I5O A;  3FGS A;  1FW0 A;  4FAT A;  1PDA A;  3MP1 A;  3P7I A;  4GVO A;  3IB1 A;  4MBP A;  5A5X A;  4XXU A;  1UQW A;  2VHA A;  4OFJ A;  4ZE9 A;  3K6V A;  4DXC A;  4LA9 A;  1SW5 A;  3EHU A;  1O7T A;  3PUZ E;  4F2O A;  1JQF A;  4FJP A;  2NOO A;  4C1U A;  2I58 A;  2WKY A;  2A5S A;  4JWO A;  3KN7 A;  1WDN A;  4G2Z A;  3TCF A;  1FQF A;  5FTH A;  2XXX A;  2P0S A;  4NF8 B;  1ZLQ A;  1JW4 A;  5ITO A;  1LBB A;  5FHN A;  3N5L A;  3UGW A;  4HW8 A;  3PPQ A;  4Q0C A;  3ONM A;  4R2F A;  3K0V A;  4BDN A;  4IGT A;  2PX1 A;  4PFU A;  5TP9 B;  4Q30 B;  3T9V A;  3KSJ A;  5AA2 A;  3MPK A;  4OQO A;  4HCW A;  4QFL A;  4H6D A;  1I6B A;  4R9F A;  4N6P A;  5L9O A;  4ESW A;  1S9T A;  5I56 B;  1D4N A;  3CI8 A;  4BDO A;  4KYE A;  3HHF A;  1AMF A;  1D9Y A;  1SW1 A;  4OWD A;  1MXU A;  5ITP A;  4YMA A;  2PBW A;  3SEU A;  1MY0 A;  4I1D A;  3GLB A;  1YPN A;  3TEL A;  2RIN A;  1VFD A;  4KQP A;  4QSD A;  4LZ5 A;  4O3A A;  3TQL A;  4MLQ A;  4QRZ A;  3IO4 A;  2O51 A;  3OO6 A;  1BKA A;  4LUB A;  1DTG A;  1JVY A;  2DWH A;  2Q89 A;  3HO7 A; 
#chains in the Genus database with same CATH topology
 2XX8 A;  1A55 A;  2DVC A;  2XXH A;  3BFU A;  4PCD A;  1RYO A;  3OEN A;  1OLC A;  4AB5 A;  1JNF A;  1MQI A;  1OQH A;  1FTK A;  5L9M A;  3QMF A;  1O64 A;  4KYS A;  2PYY A;  4NF6 B;  1NKX A;  1Y4C A;  2QRY A;  4M1V A;  3R6U A;  1Z7N E;  3VLU A;  2G29 A;  1B5J A;  2VPN A;  5J1D A;  1FQB A;  4PTK A;  2OJT A;  4JVC A;  3Q26 A;  2V84 A;  2ONR A;  3C32 A;  4PE3 A;  1FPE A;  3IJO B;  2F36 A;  3MP8 A;  3RNN A;  1GV8 A;  1MXX A;  1FQE A;  4OEU A;  4DXU A;  3B6T A;  1B46 A;  5KCJ A;  4JVD A;  4LQ2 A;  2M8C A;  2NUV A;  3ISP A;  1B3E A;  2D3I A;  4X8R A;  2RC9 A;  2XD2 A;  4O3B A;  1QUJ A;  1M5D A;  4IGR A;  2HZK A;  4UA8 A;  2CZL A;  2WEF A;  1URG A;  1CB6 A;  4XEQ A;  3T9X B;  1LAG E;  4GF8 A;  1EH3 A;  3OO9 A;  4YKP A;  4NED A;  4R6H A;  3USD A;  1FBG A;  2XXR A;  5H8N B;  1N84 A;  4M4G A;  4G61 A;  5AA4 A;  1LBV A;  3O66 A;  3N6U A;  1SI1 A;  3ECR A;  4PFT A;  3FAT A;  5ET5 A;  2CMO A;  4AS5 A;  3S9E A;  3B6W A;  4F22 A;  3IR1 A;  5AE4 A;  2F78 A;  3SEX A;  4IO7 A;  5CRY A;  2Y7K A;  4WED A;  2UVJ A;  3LBS A;  3K6U A;  1R6Z A;  2XXQ A;  1QKB A;  3MQ9 A;  4YIC A;  1TXF A;  2R9J A;  3O97 A;  5ET7 A;  4HE2 A;  3AXF A;  4G68 C;  4PC9 A;  3C34 A;  3SDF A;  4G8N A;  4IO5 A;  2XWV A;  2O1L A;  3PUY E;  3PUV E;  1HSJ A;  5EYG A;  3KC0 A;  1FPI A;  3CG3 A;  3Q28 A;  2CZI A;  4EUO A;  3QUF A;  4JVI A;  4N91 A;  1B58 A;  1NUX A;  1B05 A;  3KBR A;  5I57 A;  3EF7 A;  2FA7 A;  5I59 A;  1SBP A;  2I4C A;  2GH9 A;  4C0R A;  3TMG A;  3RPW A;  1WOD A;  3PPP A;  4U4X A;  4H67 A;  1USY E;  4N4U A;  2DYX A;  3IFC A;  3D4C A;  2REJ A;  2MKZ A;  1NV7 A;  2VD2 A;  1URS A;  4IB2 A;  4P1L A;  3DP6 A;  1VE4 A;  4LZ7 A;  2IEE A;  4P47 A;  1A40 A;  2XHD A;  3GZG A;  3PGF A;  1UIV A;  3OXN A;  3ZKL A;  3O6G A;  3B50 A;  3TCG A;  2B3F A;  3N6T A;  4GL0 A;  4MHF A;  3T0J A;  2A5T B;  1SW2 A;  5DYH A;  3VVD A;  3K2D A;  1LFH A;  2HCA A;  3W15 C;  3S4U A;  5DW8 A;  4QFO A;  2ONK E;  4P9K A;  5F7V A;  2FBP A;  3PUX E;  1KZ8 A;  4F3G A;  1B0H A;  4DIG A;  1FQC A;  5CI5 A;  1I6Q A;  2RF1 A;  3O2A A;  4GBW A;  3BIH A;  2NVU B;  2FYI A;  1SDX A;  3E78 A;  3ILU B;  3F11 A;  2YLN A;  3C9H A;  2PVU A;  4AS4 A;  2ZYN A;  3HV1 A;  1LGB C;  1ZKB A;  1UTB A;  3PPR A;  4IR8 A;  2ZZW A;  4P1E A;  3U65 A;  4JSD A;  4Z7E A;  1XVX A;  2AL5 A;  1UTH B;  4R6Y A;  4TLL B;  1NV5 A;  2XX7 A;  4N15 A;  5A5X B;  3LR1 A;  1B51 A;  2I4B A;  4DDD A;  1II5 A;  1IEJ A;  1ZU0 A;  1FJ9 A;  1LAX A;  3MZ9 A;  4U1Z A;  1A7L A;  3TTN A;  3T9H B;  5I2N A;  3VXC A;  3PMX A;  4YU0 A;  4FOR A;  1FPK A;  3KFM A;  2Q88 A;  3K1P A;  3GXA A;  2ZNS A;  3CG1 A;  1BP5 A;  2V3Q A;  5JEI A;  1AOV A;  1IMA A;  1Y4T A;  3CHG A;  1AIV A;  1VDW A;  4JSO A;  4EDP A;  4GLI A;  5I58 A;  5LOM A;  2CZK A;  5H8H B;  4ZDM A;  5FBP A;  1B5I A;  2Q2C A;  1GVC A;  2DE4 A;  4H0W A;  2G93 A;  1POY 1;  1SYI A;  4OES A;  2VGQ A;  2Q74 A;  1R1N A;  4QSC A;  1K9Z A;  3EN3 A;  4GWS A;  3TAJ A;  4ISU A;  1FTL A;  4JDF A;  4GWW A;  4O7M A;  2F7C A;  3FJM A;  1NNT A;  2HQ0 A;  4HE1 A;  3V8X B;  1PEB A;  5ELV A;  3IOU A;  1FTJ A;  3KEI A;  4K3F A;  3MP6 A;  3H6W A;  1LBX A;  1IIT A;  1Y3Q A;  2L5V A;  3RTF B;  5B70 A;  3QUJ A;  4ELP A;  2GFE A;  1FPJ A;  2RC7 A;  4ESX A;  3L6G A;  5IAI A;  5EQ9 A;  1LAF E;  2QL3 A;  1R9L A;  5DEX A;  1MG1 A;  2O84 X;  1MM6 A;  1NNP A;  3Q25 A;  2H98 A;  4G68 A;  1SPI A;  2X7Q A;  2Z23 A;  4IO4 A;  2QS3 A;  1S50 A;  4H8J A;  3QK6 A;  2DWI A;  2W7Y A;  4GX6 A;  4KYD A;  1XC1 A;  3T22 A;  3G3I A;  3ILT B;  4X48 A;  3LSX A;  2THI A;  1IUD A;  4PAF A;  5FHO A;  2QS4 A;  1LFG A;  4NF4 B;  2F5X A;  4AB6 A;  5LTC A;  1IZ1 A;  1LST A;  3K00 A;  1NFT A;  3H6V A;  3VLV A;  1Z7M E;  1LBW A;  4RJZ A;  3HST A;  5EYH A;  3U94 A;  1LAH E;  4I9D A;  4PFY A;  4YB7 A;  3A29 A;  2GQ1 A;  1KA0 A;  1LFI A;  2O6A A;  1MXZ A;  4P0I A;  3FV2 A;  4WEP A;  5H8F A;  2VD3 A;  3RPL B;  5A5L A;  4ZE8 A;  4MIJ A;  1NH8 A;  1NNF A;  4EXL A;  4NHB A;  3VVF A;  2Z8E A;  4X04 A;  4NF0 A;  1LBZ A;  5KCJ B;  4ZED A;  2YPN A;  4PGP A;  4QFK A;  4MFI A;  2Y7I A;  2XXP A;  3O6I A;  4YAH X;  4N13 A;  3SKP A;  1UIU A;  1B1H A;  4U1O A;  4EF2 A;  4OXV A;  3GBB A;  1GR2 A;  2PT1 A;  1IXH A;  1M5F A;  4RXL A;  2RCB A;  3FV1 A;  4OA4 A;  5CMB A;  4P11 A;  3IB2 A;  3MPL A;  1YZ0 A;  4GWU A;  1PC3 A;  1BLF A;  1VSO A;  3I6V A;  1J1N A;  1B7U A;  4KPT A;  3LV0 A;  1OIB A;  2Z8D A;  3G3H A;  5T3J A;  2DP8 A;  1S7Y A;  4L17 A;  3UIF A;  2UYF A;  3S9M C;  1DCU A;  1POT A;  4PDD A;  2O7I A;  4KI0 E;  4KD5 A;  4OMB A;  3PD8 A;  3W9V A;  4PFI A;  4XFE A;  2FHY A;  4DCY A;  4F18 A;  2Q9T A;  3DEL B;  3T96 B;  1RDZ A;  3IB0 A;  1EU8 A;  1IME A;  4O3C A;  2V3U A;  3PU5 A;  4ND9 A;  2XXU A;  3RUM A;  2HXW A;  3OEM A;  1LLS A;  2I6E A;  1H44 A;  2HZL A;  2XA5 A;  1Q1K A;  4MH5 A;  5JTY A;  5K2Y A;  3VE1 B;  3TTR A;  3WAF A;  4R74 A;  4R2B A;  1IQ7 A;  5I2K A;  3CFL A;  3G3G A;  4PET A;  4ELO A;  5FTI A;  5I57 B;  1FPG A;  1T0K A;  1PB9 A;  4GD5 A;  1ANF A;  1EZP A;  4IO3 A;  1IMF A;  3KN8 A;  3C4M A;  1D3K A;  3H03 A;  2VOZ A;  5KDT A;  3TTM A;  3CSB A;  2Z22 A;  1FRP A;  1IIW A;  5H8Q A;  3HFU A;  1NNK A;  4P0G A;  5ET8 A;  1IXG A;  4GXA A;  3IAZ A;  1B7Z A;  5IGA A;  3KJ7 A;  5KZT A;  3C31 A;  3LUZ A;  2DDK A;  4N8G A;  4WXJ A;  2DWJ A;  3PTY A;  3GYY A;  4PQJ A;  1FPF A;  4DLD A;  3TKD A;  4KFQ A;  4ECF A;  2WBB A;  5I5P A;  3SEY A;  1SI0 A;  4G77 A;  3M3F A;  1WVJ A;  5TU0 A;  4GRK A;  1LB9 A;  4U21 A;  4PFR A;  2V4C A;  1MPB A;  1P1O A;  2QVV A;  2OX3 A;  2ABH A;  1KA1 A;  1NV0 A;  3WAE A;  4IO2 A;  1B52 A;  4RK9 A;  3FUZ A;  3TOD A;  1B5H A;  3OO8 A;  4R9G A;  4NX1 A;  2CEY A;  4NF8 A;  4F1Y A;  1P99 A;  3QYT A;  4RY1 A;  1SVX B;  3GBA A;  2QS1 A;  3MAM A;  1A54 A;  2I3V A;  4I62 A;  2Q8M A;  4MNC A;  3VDF A;  5TP9 A;  4O8M A;  4F3P A;  4LQ5 A;  3EQ1 A;  3NOH A;  5DVF A;  2QPQ A;  2AYS A;  3MVZ A;  3H6U A;  3MZ1 A;  2B65 A;  1A8F A;  2QFL A;  1EYK A;  4MCO A;  3E3K A;  3FJG A;  3MWB A;  4JWY A;  1YAE A;  2Q2A A;  3KN3 A;  4GBV A;  1XT8 A;  2HXR A;  2DWA A;  3FVK A;  5DVJ A;  3SER A;  2Y7R A;  3CSG A;  1MQG A;  3N94 A;  1MXY A;  2ZYO A;  1DMB A;  4N17 A;  4O7I A;  3DM0 A;  1IMD A;  1GGG A;  1XHY A;  2Y7W A;  4IY6 A;  1NI9 A;  2Y5K A;  3VV5 A;  1B9J A;  3IOV A;  5JK4 A;  3E4R A;  2LAO A;  4E0W A;  3E79 A;  4GWY A;  3FD3 A;  2XXW A;  4HS7 A;  5HPQ A;  1B40 A;  1FSA A;  3MZB A;  1FQD A;  4JBZ A;  3B7D A;  1Y9U A;  5B7D A;  3TDJ A;  4UAC A;  1USY H;  4ZEC A;  4ZS9 A;  4NG7 A;  3FBP A;  1M5C A;  1L5T A;  4FIM A;  1PB7 A;  4FE8 A;  1FCK A;  2F8D A;  1OVB A;  5CMK A;  4NF5 A;  4F1V A;  1GTK A;  5L8D A;  4FED A;  4OVQ A;  5IZ3 B;  3JZJ A;  5HM4 B;  3U72 A;  1PBQ A;  4DE8 A;  3IOR A;  2HPG A;  3FXQ A;  2WX9 A;  3A09 A;  4PF8 A;  1OVT A;  3MW0 A;  2F7A A;  1QUL A;  3T9U A;  1NV2 A;  2H5Y A;  1B3G A;  5TPA B;  2Y5L A;  4BDM A;  4OVJ A;  4X1B A;  1G0I A;  2QVR A;  3RY3 A;  5DEX B;  5J16 A;  1NH7 A;  2ZYK A;  2I3W A;  3TCH A;  1EYJ A;  4LON B;  3S9N C;  3LUY A;  3OOA A;  2Q8J A;  1ZTY A;  4OER A;  1R9Q A;  1MQJ A;  3D4G A;  1FBP A;  3MUQ A;  1AH5 A;  4F39 A;  3JV9 A;  4NN3 A;  2R8T A;  3TTK A;  2OBG A;  3KG2 A;  5EQ8 A;  4R6K A;  1JET A;  1NV6 A;  4NMY A;  1MY3 A;  2KR0 A;  4H46 A;  1H3D A;  5H8N A;  4YMB A;  1FBD A;  4YB6 A;  5CMC A;  4ZZA A;  5H8S A;  4AQ4 A;  2F97 A;  2QSX A;  2FNC A;  1M5E A;  2F7B A;  2X26 A;  4ZEF A;  3BIG A;  2ZNT A;  1F9B A;  5F1Q A;  3DP4 A;  5ICQ A;  2H99 A;  3QSL A;  1M5B A;  1SD3 A;  3K4U A;  5K2X A;  4ZZE A;  4GL8 A;  1AWB A;  4HCY A;  1MY1 A;  3KBZ A;  1DPP A;  1A99 A;  4DCX A;  4U2R A;  1I69 A;  5FHM A;  2ANJ A;  1MS7 A;  4BLA A;  4POW A;  4RPO A;  4FEB A;  4F1U A;  1MM7 A;  5AA2 B;  4P8B A;  1LB8 A;  3KOT A;  1TT1 A;  1XS5 A;  3G3K A;  1Y1M A;  4NAP A;  4DI3 D;  4F29 A;  4OTE A;  4NGU A;  4I3Y A;  4XKN A;  4POX A;  2PCR A;  1N7W A;  3IOT A;  4NWD A;  3A3U A;  2OK2 A;  4HTG A;  5IZ1 A;  4PBH A;  1LCT A;  1CE2 A;  3MJN A;  4PBQ A;  4THI A;  1ELJ A;  1QUI A;  4OHN A;  4PE5 B;  3UOR A;  5CBR A;  4GOT A;  1HSE A;  4OYV A;  3V89 B;  3RYD A;  2VP1 A;  2XD3 A;  4U23 A;  1FTO A;  4EQB A;  4ZEK A;  2OWT A;  1DSN A;  3KOS A;  2V93 A;  2DE3 A;  2F3B A;  2A5T A;  2DQV A;  3OO7 A;  1B3L A;  3N26 A;  1JW1 A;  1HSL A;  1N0T A;  2E1S A;  3FVN A;  4RPN A;  3ROJ A;  2P3N A;  4YB5 A;  3UA8 A;  1N3X A;  4FAJ A;  4OVS A;  4PFW A;  3S2V A;  1B3F A;  4DZ1 A;  3VLW A;  3FJ7 A;  1QUK A;  4DXB A;  3LSW A;  3PPO A;  1BIY A;  3IX1 A;  3O9P A;  5CM6 A;  5DVI A;  3R26 A;  4ELQ A;  2FVZ A;  5CC2 A;  3OEL A;  3H6T A;  3K02 A;  1URD A;  4OVT A;  1QKA A;  2HAV A;  2I0C A;  1Q35 A;  3MVY A;  5ESY A;  1IXI A;  1UTH A;  2ZZV A;  3IK6 B;  3LSF B;  1RDY A;  5EQ7 A;  4H5G A;  1H76 A;  3IOW A;  1FPL A;  4PF6 A;  1MRP A;  3U92 A;  1ZMG A;  4YKJ A;  1PB8 A;  2P1S A;  2AIX A;  2VT5 A;  4H1X A;  3EHS A;  2BJI A;  1P1N A;  2REG A;  4MAG A;  2QVU A;  1N04 A;  4QSE A;  3FXR A;  2OWS A;  2XXT A;  3KZG A;  2OWZ A;  2Z8F A;  2ZXT A;  1LBC A;  1G0H A;  4EXK A;  4RA1 A;  3C35 A;  3G3F A;  5AA4 B;  4F3S A;  4PGN A;  4JB7 A;  4EF1 A;  4GWZ A;  1OMP A;  5IKB A;  1B6H A;  5H8H A;  2PT2 A;  3HCQ A;  4P3L A;  1QW0 A;  1BK4 A;  4U4S A;  4I8C A;  2XWO A;  2HAU A;  5I7I A;  2XWK A;  2FIX A;  1LEV A;  4F3B A;  2DXY A;  1H43 A;  3LC8 A;  2QS2 A;  3KGC A;  2E0S A;  4TLM B;  3OD7 A;  1NUZ A;  3UK4 A;  3UP9 A;  1YYZ A;  1FJ6 A;  4KR5 A;  4N81 A;  4PAK A;  1Y3N A;  4R73 A;  5IM2 A;  1B32 A;  2XXI A;  1P1Q A;  2ALU A;  1NV3 A;  1MPC A;  1US5 A;  3QIM A;  4GX4 A;  3V5A A;  3EPE A;  3M3L A;  1DTZ A;  1EZ9 A;  2V3T A;  4EQ9 A;  3S9L C;  1MPD A;  5I59 B;  4OZ9 A;  3CR9 A;  4ZEI A;  2QMX A;  1B0L A;  4XKQ A;  2I49 A;  2IA4 A;  1SQY A;  3PUW E;  3R7X A;  4LP2 B;  1VFE A;  3K1N A;  1RKM A;  3IJX B;  4GWX A;  1MQD A;  5DT6 A;  1A8E A;  1NV4 A;  1DBZ A;  1P1W A;  4NF5 B;  2XXV A;  3I3V A;  4NF4 A;  3FIR A;  1JEV A;  2PFZ A;  3TUS A;  3U93 A;  1YTV A;  4KCC A;  3CVG A;  1IMC A;  4Q8R A;  2PFY A;  4GWO A;  3K6X A;  2O69 A;  1Y3P A;  4NWC A;  2KLF A;  1JVX A;  1MXW A;  1OQG A;  2WBD A;  2D5W A;  2UYE A;  3RPL A;  4QF9 A;  3MVX A;  5M2V A;  2RKM A;  3E13 X;  3RGY A;  3ODB A;  4GFR A;  2O7U A;  4FEC A;  2UVG A;  3M3K A;  3U8Q A;  5AA1 A;  1US4 A;  4YKI A;  3TYH A;  1MH4 A;  4IO6 A;  3W9W A;  3IFA A;  4ZEB A;  2X7P A;  2ZMB A;  3BBR A;  2AL4 A;  4JWX A;  1UTB B;  2I0B A;  2P3V A;  3DLN A;  3T1B A;  4R72 A;  5BUU A;  1SYH A;  2CEX A;  2H4I A;  4BDR A;  2RC8 A;  4XKR A;  1B7H A;  3UN6 A;  2R6G E;  1XVY A;  4X9T A;  1ZJL A;  2F6P A;  1IXC A;  3C33 A;  4OVP A;  4HE0 A;  1AL3 A;  4PP0 A;  2HFB A;  3MVW A;  2WYK A;  5I56 A;  2ESN A;  4P56 A;  5AA3 A;  4F31 B;  4RNS A;  3K1M A;  3TPA A;  4H45 A;  5I2N B;  2ONS A;  4G8M A;  1FPB A;  5EHS A;  2ZYM A;  3K01 A;  3KSX A;  3FVO A;  2Y7P A;  4WKM A;  2Y84 A;  4OEV A;  1I6A A;  3B6Q A;  4YKK A;  1YXI A;  3CFX A;  4MJO A;  4F19 A;  2NXO A;  3OMB A;  3EHT A;  4QHQ A;  1BTJ A;  3T93 B;  1ATG A;  4Q5T A;  2XXK A;  2OZZ A;  3BFT A;  2DE2 A;  2DS9 A;  4MLV A;  4IY5 A;  5I58 B;  1PBP A;  1OLA A;  3DP8 A;  2NWJ A;  4EQ7 A;  1FBH A;  2XXY A;  5DTB A;  2F35 A;  4R75 A;  3TEP A;  3VVE A;  3Q27 A;  2XX9 A;  4F2Q A;  4G8H A;  4OFL A;  4H8I A;  2QMW A;  3A3C A;  3SEW A;  1D9V A;  4MNI A;  4OVR A;  3FZV A;  1LCF A;  4LAT A;  2UXA A;  1MXV A;  4RK2 A;  1MH3 A;  3MBP A;  4LVQ A;  2B3B A;  4DI4 B;  4TQU Q;  1XOC A;  2UVH A;  4NQ8 A;  2F6G A;  3CRB A;  3H4Z A;  4NF6 A;  4XKP A;  2GHB A;  1TFA A;  4OAN A;  3SEV A;  4QFP A;  1TWY A;  1MDQ A;  4N6K A;  4PFB A;  1NUW A;  4HXV A;  1XI6 A;  3TTL A;  3FXU A;  2UVI A;  5ISU A;  3SET A;  4O94 A;  4OFO A;  3TQW A;  1FQA A;  3TZA A;  1EZO A;  4C1T A;  1ZIU A;  4G68 B;  3PV0 E;  2GRV A;  3RLF E;  3RT6 B;  3FXB A;  1DPE A;  4QXD A;  1NMU A;  5L9S A;  3OEK A;  3PMV A;  3MC2 A;  3RN8 A;  3ZS6 A;  2F34 A;  1EYI A;  3CIJ A;  1O63 A;  3O28 A;  3IL1 B;  3RT8 A;  2I48 A;  1B3H A;  1DOT A;  2XWI A;  3G7W A;  3M8U A;  5BWJ A;  1N76 A;  4MNP A;  1FBF A;  1JP4 A;  5AA2 D;  2OLB A;  4LZ8 A;  4NE4 A;  2PMS A;  4NTL A;  2RCA A;  2YJP A;  4H5F A;  1IMB A;  2O68 A;  5H8F B;  3RTW B;  3MYU A;  4X1D A;  2HEU A;  1B4Z A;  1QJM A;  2GHA A;  4BDL A;  2DVZ A;  3OSQ A;  4FBP A;  2ZNU A;  2DOJ A;  2FIE A;  3KJT A;  2B4M A;  1NL5 A;  1INP A;  3IO6 A;  3HPI A;  2ZZX A;  4TOZ A;  4GIZ A;  5EYF A;  3JYR A;  5HBC A;  5LDZ A;  5CMM A;  2O1M A;  4E0X A;  3FAS A;  2H9B A;  3H3G A;  3T66 A;  3VFJ A;  3LSL A;  3ZSF A;  3CFZ A;  2JJK A;  1MY4 A;  1Y1Z A;  2DXR A;  1NUY A;  1NV1 A;  4XTC Q;  1YCJ A;  3OSR A;  1RYX A;  2H25 A;  5EHM A;  3FVG A;  3HN0 A;  5I3S A;  2KQZ A;  3O6H A;  1TFD A;  1FPD A;  4U22 A;  4H65 A;  1ZBM A;  4MF3 A;  3V83 A;  2P2A A;  3SZP A;  3PPN A;  4QFN A;  1CNQ A;  4KXP A;  1H45 A;  3E9X A;  3ZKK A;  1JW5 A;  4I40 A;  1FTM A;  4N6D A;  2QJE A;  4MEV A;  3QXM A;  1MY2 A;  1B1X A;  4BDQ A;  4PAI A;  4OET A;  3PD9 A;  5ICT A;  3SES A;  2D21 A;  4KCD A;  1B4H A;  1LBY A;  5CBS A;  1SW4 A;  3L6H A;  4I3E A;  5IZ3 A;  4OEN A;  3THI A;  3U1O A;  4G4P A;  3VXB A;  2V25 A;  1KWH A;  3G3J A;  3RQT A;  4GQO A;  1MDP 1;  5JTY B;  1K9Y A;  3O29 A;  4JXI A;  4GXS B;  1N7X A;  3C36 A;  5I2K B;  4RYA A;  3HHG A;  2BJJ X;  3K6W A;  4Z0I A;  5TPA A;  4MMP A;  1Y20 A;  2OCU A;  1JEU A;  3H7M A;  1B2H A;  1N3W A;  1P1U A;  1QGX A;  2F3D A;  4ELR A;  3MST A;  3QAX A;  4XIG Q;  2WYP A;  2DSF A;  3TFL A;  4N07 A;  1VR5 A;  4YZZ A;  3BKI B;  4ONY A;  3H06 B;  5I84 A;  5KDT B;  3PMW A;  2R71 A;  1DK4 A;  1MQH A;  4KHZ E;  5H8Q B;  1FBE A;  3Q29 A;  1QVS A;  3I5O A;  3FGS A;  4N8Y A;  1FW0 A;  4FAT A;  1PDA A;  3MP1 A;  3P7I A;  2HHM A;  4GVO A;  4LN5 A;  5EQA A;  1FBC A;  3IB1 A;  3KC1 A;  4MBP A;  5ET6 A;  5A5X A;  4XXU A;  4UAB A;  1UQW A;  2B4L A;  4OFJ A;  2VHA A;  4ZE9 A;  3K6V A;  4PDH A;  4DXC A;  4XF5 A;  4LA9 A;  4GX3 A;  1SW5 A;  3EHU A;  1O7T A;  3PUZ E;  4F2O A;  1JQF A;  4FJP A;  2NOO A;  4C1U A;  2I58 A;  2WKY A;  2A5S A;  4JWO A;  3KN7 A;  1WDN A;  4G2Z A;  3TCF A;  1FQF A;  5FTH A;  2XXX A;  2P0S A;  3B8B A;  4NF8 B;  1ZLQ A;  3D1R A;  1JW4 A;  5ITO A;  1LBB A;  5FHN A;  3N5L A;  3UGW A;  4HW8 A;  1Q9D A;  4Q0C A;  4R2F A;  3PPQ A;  3ONM A;  4MX6 A;  3K0V A;  4BDN A;  4IGT A;  2PX1 A;  1RDX A;  4PFU A;  5TP9 B;  5F24 A;  4Q30 B;  3T9V A;  3KSJ A;  5AA2 A;  3MPK A;  4OQO A;  4HCW A;  4QFL A;  1FTA A;  4H6D A;  5IZZ A;  1I6B A;  4R9F A;  4N6P A;  5L9O A;  4ESW A;  1S9T A;  5I56 B;  1D4N A;  3CI8 A;  4BDO A;  4KYE A;  3HHF A;  1AMF A;  1D9Y A;  1SW1 A;  4OWD A;  1MXU A;  2VPO A;  5ITP A;  4YMA A;  1D9Q A;  2CZH A;  2PBW A;  3SEU A;  1MY0 A;  4I1D A;  3GLB A;  1YPN A;  3TEL A;  2RIN A;  1VFD A;  3EKI A;  4KQP A;  4QSD A;  4LZ5 A;  4O3A A;  3TQL A;  4MLQ A;  4QBA A;  4QRZ A;  3IO4 A;  2O51 A;  3OO6 A;  1BKA A;  4LUB A;  1DTG A;  1JVY A;  2DWH A;  2Q89 A;  3HO7 A; 
#chains in the Genus database with same CATH homology
 2XX8 A;  1A55 A;  2DVC A;  2XXH A;  3BFU A;  1RYO A;  3OEN A;  1OLC A;  4AB5 A;  1JNF A;  1MQI A;  1OQH A;  1FTK A;  5L9M A;  1O64 A;  4KYS A;  2PYY A;  4NF6 B;  1NKX A;  1Y4C A;  2QRY A;  4M1V A;  3R6U A;  1Z7N E;  3VLU A;  2G29 A;  1B5J A;  5J1D A;  1FQB A;  2OJT A;  3Q26 A;  2V84 A;  2ONR A;  3C32 A;  3IJO B;  2F36 A;  3MP8 A;  3RNN A;  1GV8 A;  1MXX A;  1FQE A;  4OEU A;  4DXU A;  3B6T A;  1B46 A;  5KCJ A;  4LQ2 A;  2M8C A;  2NUV A;  1B3E A;  2D3I A;  2RC9 A;  2XD2 A;  4O3B A;  1QUJ A;  1M5D A;  4IGR A;  2HZK A;  4UA8 A;  2CZL A;  1URG A;  1CB6 A;  3T9X B;  1LAG E;  4GF8 A;  1EH3 A;  3OO9 A;  4YKP A;  4NED A;  4R6H A;  3USD A;  2XXR A;  5H8N B;  1N84 A;  4M4G A;  5AA4 A;  3O66 A;  3N6U A;  1SI1 A;  3ECR A;  4PFT A;  3FAT A;  2CMO A;  3S9E A;  3B6W A;  4F22 A;  3IR1 A;  5AE4 A;  2F78 A;  3SEX A;  4IO7 A;  5CRY A;  2Y7K A;  4WED A;  2UVJ A;  3LBS A;  3K6U A;  1R6Z A;  2XXQ A;  1QKB A;  3MQ9 A;  4YIC A;  1TXF A;  2R9J A;  3O97 A;  3AXF A;  4G68 C;  3C34 A;  3SDF A;  4G8N A;  4IO5 A;  2O1L A;  3PUY E;  3PUV E;  1HSJ A;  3CG3 A;  3Q28 A;  4EUO A;  3QUF A;  1B58 A;  1B05 A;  3KBR A;  5I57 A;  3EF7 A;  2FA7 A;  5I59 A;  1SBP A;  2I4C A;  2GH9 A;  4C0R A;  3TMG A;  3RPW A;  1WOD A;  3PPP A;  4U4X A;  4H67 A;  1USY E;  2DYX A;  3D4C A;  2REJ A;  2VD2 A;  1URS A;  4IB2 A;  3DP6 A;  1VE4 A;  4LZ7 A;  2IEE A;  1A40 A;  2XHD A;  3GZG A;  3PGF A;  1UIV A;  3OXN A;  3ZKL A;  3O6G A;  3TCG A;  2B3F A;  3N6T A;  4GL0 A;  2A5T B;  1SW2 A;  5DYH A;  3VVD A;  3K2D A;  1LFH A;  2HCA A;  3W15 C;  3S4U A;  4QFO A;  2ONK E;  5F7V A;  3PUX E;  4F3G A;  1B0H A;  4DIG A;  1FQC A;  5CI5 A;  1I6Q A;  2RF1 A;  3O2A A;  2NVU B;  2FYI A;  1SDX A;  3ILU B;  3F11 A;  2YLN A;  3C9H A;  2PVU A;  2ZYN A;  3HV1 A;  1LGB C;  1ZKB A;  1UTB A;  3PPR A;  4JSD A;  4Z7E A;  1XVX A;  2AL5 A;  1UTH B;  4R6Y A;  4TLL B;  2XX7 A;  5A5X B;  3LR1 A;  1B51 A;  2I4B A;  4DDD A;  1II5 A;  1IEJ A;  1ZU0 A;  1LAX A;  3MZ9 A;  4U1Z A;  1A7L A;  3TTN A;  3T9H B;  5I2N A;  3VXC A;  3PMX A;  4YU0 A;  4FOR A;  3KFM A;  2Q88 A;  3K1P A;  3GXA A;  2ZNS A;  3CG1 A;  1BP5 A;  2V3Q A;  5JEI A;  1AOV A;  1Y4T A;  1AIV A;  4JSO A;  4EDP A;  4GLI A;  5I58 A;  5LOM A;  5H8H B;  4ZDM A;  1B5I A;  2Q2C A;  1GVC A;  2DE4 A;  4H0W A;  2G93 A;  1POY 1;  1SYI A;  4OES A;  2VGQ A;  1R1N A;  4QSC A;  3EN3 A;  3TAJ A;  4ISU A;  1FTL A;  4JDF A;  2F7C A;  3FJM A;  1NNT A;  2HQ0 A;  3V8X B;  1PEB A;  5ELV A;  3IOU A;  1FTJ A;  3KEI A;  4K3F A;  3MP6 A;  3H6W A;  1IIT A;  1Y3Q A;  3RTF B;  5B70 A;  3QUJ A;  4ELP A;  2GFE A;  2RC7 A;  4ESX A;  3L6G A;  5IAI A;  1LAF E;  2QL3 A;  1R9L A;  5DEX A;  1MG1 A;  2O84 X;  1MM6 A;  1NNP A;  3Q25 A;  2H98 A;  4G68 A;  2X7Q A;  2Z23 A;  4IO4 A;  2QS3 A;  1S50 A;  4H8J A;  3QK6 A;  2DWI A;  2W7Y A;  4KYD A;  1XC1 A;  3T22 A;  3G3I A;  3ILT B;  4X48 A;  3LSX A;  2THI A;  1IUD A;  5FHO A;  2QS4 A;  1LFG A;  4NF4 B;  2F5X A;  4AB6 A;  1IZ1 A;  1LST A;  3K00 A;  1NFT A;  3H6V A;  3VLV A;  1Z7M E;  4RJZ A;  3HST A;  3U94 A;  1LAH E;  4I9D A;  4PFY A;  4YB7 A;  1LFI A;  2O6A A;  1MXZ A;  4P0I A;  3FV2 A;  4WEP A;  5H8F A;  2VD3 A;  4ZE8 A;  1NH8 A;  1NNF A;  4EXL A;  3VVF A;  2Z8E A;  5KCJ B;  4ZED A;  2YPN A;  4QFK A;  4MFI A;  2Y7I A;  2XXP A;  3O6I A;  4YAH X;  4N13 A;  3SKP A;  1UIU A;  1B1H A;  4U1O A;  4EF2 A;  4OXV A;  3GBB A;  1GR2 A;  2PT1 A;  1IXH A;  1M5F A;  4RXL A;  2RCB A;  3FV1 A;  5CMB A;  4P11 A;  3IB2 A;  3MPL A;  1PC3 A;  1BLF A;  1VSO A;  3I6V A;  1J1N A;  1B7U A;  4KPT A;  1OIB A;  2Z8D A;  3G3H A;  2DP8 A;  1S7Y A;  4L17 A;  3UIF A;  2UYF A;  3S9M C;  1POT A;  2O7I A;  4KI0 E;  4KD5 A;  4OMB A;  3PD8 A;  3W9V A;  4DCY A;  4F18 A;  2Q9T A;  3DEL B;  3T96 B;  3IB0 A;  1EU8 A;  4O3C A;  2V3U A;  3PU5 A;  4ND9 A;  2XXU A;  3RUM A;  2HXW A;  3OEM A;  1LLS A;  2I6E A;  1H44 A;  2HZL A;  1Q1K A;  4MH5 A;  5JTY A;  5K2Y A;  3VE1 B;  3TTR A;  3WAF A;  4R74 A;  4R2B A;  1IQ7 A;  5I2K A;  3CFL A;  3G3G A;  4PET A;  4ELO A;  5FTI A;  5I57 B;  1T0K A;  1PB9 A;  4GD5 A;  1ANF A;  1EZP A;  4IO3 A;  3KN8 A;  3C4M A;  1D3K A;  3H03 A;  2VOZ A;  5KDT A;  3TTM A;  3CSB A;  2Z22 A;  1IIW A;  5H8Q A;  1NNK A;  4P0G A;  1IXG A;  4GXA A;  3IAZ A;  1B7Z A;  3KJ7 A;  5KZT A;  3C31 A;  4WXJ A;  2DWJ A;  4PQJ A;  4DLD A;  3TKD A;  4KFQ A;  4ECF A;  3SEY A;  1SI0 A;  4G77 A;  3M3F A;  1WVJ A;  5TU0 A;  4GRK A;  1LB9 A;  4U21 A;  1MPB A;  1P1O A;  2ABH A;  3WAE A;  4IO2 A;  1B52 A;  4RK9 A;  3FUZ A;  3TOD A;  1B5H A;  3OO8 A;  4R9G A;  4NF8 A;  4F1Y A;  1P99 A;  3QYT A;  4RY1 A;  1SVX B;  3GBA A;  2QS1 A;  3MAM A;  1A54 A;  2I3V A;  4I62 A;  3VDF A;  5TP9 A;  4F3P A;  4LQ5 A;  3EQ1 A;  5DVF A;  2QPQ A;  2AYS A;  3MVZ A;  3H6U A;  3MZ1 A;  2B65 A;  1A8F A;  3E3K A;  3FJG A;  3MWB A;  4JWY A;  1YAE A;  2Q2A A;  3KN3 A;  1XT8 A;  2DWA A;  3FVK A;  5DVJ A;  3SER A;  2Y7R A;  3CSG A;  1MQG A;  3N94 A;  1MXY A;  2ZYO A;  1DMB A;  3DM0 A;  1GGG A;  1XHY A;  2Y7W A;  4IY6 A;  3VV5 A;  1B9J A;  3IOV A;  5JK4 A;  3E4R A;  2LAO A;  4E0W A;  3FD3 A;  2XXW A;  4HS7 A;  5HPQ A;  1B40 A;  3MZB A;  1FQD A;  4JBZ A;  3B7D A;  1Y9U A;  5B7D A;  3TDJ A;  4UAC A;  1USY H;  4ZEC A;  4ZS9 A;  1M5C A;  1L5T A;  4FIM A;  1PB7 A;  4FE8 A;  1FCK A;  2F8D A;  1OVB A;  5CMK A;  4NF5 A;  4F1V A;  1GTK A;  5L8D A;  4FED A;  3JZJ A;  5HM4 B;  3U72 A;  1PBQ A;  4DE8 A;  3IOR A;  3FXQ A;  3A09 A;  1OVT A;  3MW0 A;  2F7A A;  1QUL A;  3T9U A;  2H5Y A;  4BDM A;  1B3G A;  5TPA B;  4OVJ A;  4X1B A;  3RY3 A;  5DEX B;  1NH7 A;  2ZYK A;  2I3W A;  3TCH A;  4LON B;  3S9N C;  3LUY A;  3OOA A;  2Q8J A;  1ZTY A;  4OER A;  1R9Q A;  1MQJ A;  3D4G A;  3MUQ A;  1AH5 A;  4F39 A;  3JV9 A;  3TTK A;  2OBG A;  3KG2 A;  4R6K A;  1JET A;  4NMY A;  1MY3 A;  1H3D A;  5H8N A;  4YMB A;  4YB6 A;  5CMC A;  4ZZA A;  5H8S A;  4AQ4 A;  2F97 A;  2QSX A;  2FNC A;  1M5E A;  2F7B A;  2X26 A;  4ZEF A;  2ZNT A;  1F9B A;  5F1Q A;  3DP4 A;  5ICQ A;  2H99 A;  3QSL A;  1M5B A;  1SD3 A;  3K4U A;  5K2X A;  4ZZE A;  4GL8 A;  4HCY A;  1MY1 A;  1DPP A;  1A99 A;  4DCX A;  4U2R A;  1I69 A;  5FHM A;  2ANJ A;  1MS7 A;  4BLA A;  4POW A;  4RPO A;  4FEB A;  4F1U A;  1MM7 A;  5AA2 B;  1LB8 A;  3KOT A;  1TT1 A;  1XS5 A;  3G3K A;  1Y1M A;  4F29 A;  4OTE A;  4XKN A;  4POX A;  1N7W A;  3IOT A;  4NWD A;  3A3U A;  2OK2 A;  4HTG A;  1LCT A;  1CE2 A;  3MJN A;  4THI A;  1ELJ A;  1QUI A;  4OHN A;  4PE5 B;  3UOR A;  5CBR A;  4GOT A;  1HSE A;  4OYV A;  3V89 B;  2VP1 A;  2XD3 A;  4U23 A;  1FTO A;  4EQB A;  4ZEK A;  2OWT A;  1DSN A;  3KOS A;  2V93 A;  2DE3 A;  3N26 A;  2A5T A;  2DQV A;  3OO7 A;  1B3L A;  1JW1 A;  1HSL A;  1N0T A;  2E1S A;  3FVN A;  4RPN A;  4YB5 A;  3UA8 A;  1N3X A;  4FAJ A;  3S2V A;  4PFW A;  1B3F A;  4DZ1 A;  3VLW A;  3FJ7 A;  1QUK A;  4DXB A;  3LSW A;  3PPO A;  1BIY A;  3IX1 A;  3O9P A;  5CM6 A;  5DVI A;  3R26 A;  4ELQ A;  5CC2 A;  3OEL A;  3H6T A;  3K02 A;  1URD A;  1QKA A;  2HAV A;  2I0C A;  1Q35 A;  3MVY A;  1IXI A;  1UTH A;  3IK6 B;  3LSF B;  4H5G A;  1H76 A;  3IOW A;  1MRP A;  3U92 A;  1ZMG A;  4YKJ A;  1PB8 A;  2P1S A;  2AIX A;  4H1X A;  3EHS A;  1P1N A;  2REG A;  1N04 A;  4QSE A;  3FXR A;  2OWS A;  2XXT A;  3KZG A;  2Z8F A;  2ZXT A;  1LBC A;  4EXK A;  4RA1 A;  3C35 A;  3G3F A;  5AA4 B;  4F3S A;  4JB7 A;  4EF1 A;  1OMP A;  5IKB A;  1B6H A;  5H8H A;  2PT2 A;  3HCQ A;  1QW0 A;  4U4S A;  4I8C A;  2HAU A;  4F3B A;  2DXY A;  1H43 A;  3LC8 A;  2QS2 A;  3KGC A;  2E0S A;  4TLM B;  3OD7 A;  3UK4 A;  3UP9 A;  4KR5 A;  1Y3N A;  4R73 A;  1B32 A;  2XXI A;  1P1Q A;  2ALU A;  1MPC A;  1US5 A;  3QIM A;  3V5A A;  3EPE A;  3M3L A;  1DTZ A;  1EZ9 A;  2V3T A;  4EQ9 A;  3S9L C;  1MPD A;  5I59 B;  4OZ9 A;  3CR9 A;  4ZEI A;  2QMX A;  1B0L A;  4XKQ A;  2I49 A;  2IA4 A;  1SQY A;  3PUW E;  3R7X A;  4LP2 B;  1VFE A;  3K1N A;  1RKM A;  3IJX B;  1MQD A;  5DT6 A;  1A8E A;  1P1W A;  4NF5 B;  2XXV A;  3I3V A;  4NF4 A;  3FIR A;  1JEV A;  3TUS A;  3U93 A;  1YTV A;  4KCC A;  3CVG A;  4Q8R A;  4GWO A;  3K6X A;  2O69 A;  1Y3P A;  4NWC A;  2KLF A;  1JVX A;  1MXW A;  1OQG A;  2D5W A;  2UYE A;  4QF9 A;  3MVX A;  5M2V A;  2RKM A;  3E13 X;  3RGY A;  3ODB A;  4GFR A;  2O7U A;  4FEC A;  2UVG A;  3M3K A;  3U8Q A;  5AA1 A;  1US4 A;  4YKI A;  3TYH A;  1MH4 A;  4IO6 A;  3W9W A;  4ZEB A;  2X7P A;  2ZMB A;  3BBR A;  2AL4 A;  4JWX A;  1UTB B;  2I0B A;  3DLN A;  4R72 A;  5BUU A;  1SYH A;  2H4I A;  4BDR A;  2RC8 A;  4XKR A;  1B7H A;  3UN6 A;  2R6G E;  1XVY A;  4X9T A;  1ZJL A;  2F6P A;  1IXC A;  3C33 A;  1AL3 A;  4PP0 A;  2HFB A;  3MVW A;  5I56 A;  2ESN A;  5AA3 A;  4F31 B;  4RNS A;  3K1M A;  3TPA A;  5I2N B;  2ONS A;  4G8M A;  5EHS A;  2ZYM A;  3K01 A;  3KSX A;  3FVO A;  2Y7P A;  4WKM A;  2Y84 A;  4OEV A;  1I6A A;  3B6Q A;  4YKK A;  3CFX A;  4F19 A;  2NXO A;  3OMB A;  3EHT A;  4QHQ A;  1BTJ A;  3T93 B;  1ATG A;  4Q5T A;  2OZZ A;  3BFT A;  2DE2 A;  2DS9 A;  4MLV A;  4IY5 A;  5I58 B;  1PBP A;  1OLA A;  3DP8 A;  2NWJ A;  4EQ7 A;  2XXY A;  5DTB A;  2F35 A;  4R75 A;  3TEP A;  3VVE A;  3Q27 A;  2XX9 A;  4F2Q A;  4G8H A;  4OFL A;  4H8I A;  2QMW A;  3A3C A;  3SEW A;  1D9V A;  3FZV A;  1LCF A;  4LAT A;  2UXA A;  1MXV A;  4RK2 A;  1MH3 A;  3MBP A;  4LVQ A;  2B3B A;  4TQU Q;  1XOC A;  2UVH A;  2F6G A;  3CRB A;  3H4Z A;  4NF6 A;  4XKP A;  2GHB A;  1TFA A;  3SEV A;  4QFP A;  1TWY A;  1MDQ A;  3TTL A;  3FXU A;  2UVI A;  5ISU A;  3SET A;  4OFO A;  3TQW A;  1FQA A;  3TZA A;  1EZO A;  4C1T A;  1ZIU A;  4G68 B;  3PV0 E;  2GRV A;  3RLF E;  3RT6 B;  1DPE A;  1NMU A;  5L9S A;  3OEK A;  3PMV A;  3MC2 A;  3RN8 A;  3ZS6 A;  2F34 A;  3CIJ A;  1O63 A;  3O28 A;  3IL1 B;  3RT8 A;  2I48 A;  1B3H A;  1DOT A;  3G7W A;  3M8U A;  5BWJ A;  1N76 A;  5AA2 D;  2OLB A;  4LZ8 A;  4NE4 A;  2PMS A;  4NTL A;  2RCA A;  2YJP A;  4H5F A;  5H8F B;  2O68 A;  3RTW B;  4X1D A;  2HEU A;  1B4Z A;  1QJM A;  2GHA A;  4BDL A;  2DVZ A;  3OSQ A;  2ZNU A;  2DOJ A;  3KJT A;  1NL5 A;  3IO6 A;  3HPI A;  4TOZ A;  4GIZ A;  5EYF A;  3JYR A;  5HBC A;  5CMM A;  2O1M A;  4E0X A;  3FAS A;  2H9B A;  3H3G A;  3T66 A;  3VFJ A;  3LSL A;  3ZSF A;  3CFZ A;  1MY4 A;  1Y1Z A;  2DXR A;  4XTC Q;  1YCJ A;  3OSR A;  1RYX A;  2H25 A;  5EHM A;  3FVG A;  3HN0 A;  3O6H A;  1TFD A;  4U22 A;  4H65 A;  1ZBM A;  4MF3 A;  3V83 A;  2P2A A;  3PPN A;  4QFN A;  1H45 A;  3E9X A;  3ZKK A;  1JW5 A;  1FTM A;  2QJE A;  3QXM A;  1MY2 A;  1B1X A;  4BDQ A;  4OET A;  3PD9 A;  5ICT A;  3SES A;  2D21 A;  4KCD A;  1B4H A;  5CBS A;  1SW4 A;  3L6H A;  4OEN A;  3THI A;  3U1O A;  4G4P A;  3VXB A;  2V25 A;  1KWH A;  3G3J A;  3RQT A;  4GQO A;  1MDP 1;  5JTY B;  3O29 A;  4JXI A;  4GXS B;  1N7X A;  3C36 A;  5I2K B;  4RYA A;  3HHG A;  2BJJ X;  3K6W A;  4Z0I A;  5TPA A;  1Y20 A;  2OCU A;  1JEU A;  3H7M A;  1B2H A;  1N3W A;  1P1U A;  4ELR A;  3QAX A;  4XIG Q;  2DSF A;  3TFL A;  4N07 A;  1VR5 A;  4YZZ A;  3BKI B;  4ONY A;  3H06 B;  5I84 A;  5KDT B;  3PMW A;  2R71 A;  1MQH A;  4KHZ E;  5H8Q B;  3Q29 A;  1QVS A;  3I5O A;  3FGS A;  1FW0 A;  4FAT A;  1PDA A;  3MP1 A;  3P7I A;  4GVO A;  3IB1 A;  4MBP A;  5A5X A;  4XXU A;  1UQW A;  2VHA A;  4OFJ A;  4ZE9 A;  3K6V A;  4DXC A;  4LA9 A;  1SW5 A;  3EHU A;  1O7T A;  3PUZ E;  4F2O A;  1JQF A;  4FJP A;  2NOO A;  4C1U A;  2I58 A;  2WKY A;  2A5S A;  4JWO A;  3KN7 A;  1WDN A;  4G2Z A;  3TCF A;  1FQF A;  5FTH A;  2XXX A;  2P0S A;  4NF8 B;  1ZLQ A;  1JW4 A;  5ITO A;  1LBB A;  5FHN A;  3N5L A;  3UGW A;  4HW8 A;  3PPQ A;  4Q0C A;  3ONM A;  4R2F A;  3K0V A;  4BDN A;  4IGT A;  2PX1 A;  4PFU A;  5TP9 B;  4Q30 B;  3T9V A;  3KSJ A;  5AA2 A;  3MPK A;  4OQO A;  4HCW A;  4QFL A;  4H6D A;  1I6B A;  4R9F A;  4N6P A;  5L9O A;  4ESW A;  1S9T A;  5I56 B;  1D4N A;  3CI8 A;  4BDO A;  4KYE A;  3HHF A;  1AMF A;  1D9Y A;  1SW1 A;  4OWD A;  1MXU A;  5ITP A;  4YMA A;  2PBW A;  3SEU A;  1MY0 A;  4I1D A;  3GLB A;  1YPN A;  3TEL A;  2RIN A;  1VFD A;  4KQP A;  4QSD A;  4LZ5 A;  4O3A A;  3TQL A;  4MLQ A;  4QRZ A;  3IO4 A;  2O51 A;  3OO6 A;  1BKA A;  4LUB A;  1DTG A;  1JVY A;  2DWH A;  2Q89 A;  3HO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...