4EQBA

1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
323
structure length
323
Chain Sequence
SQKLVIYNWGDYIDPELLTQFTEETGIQVQYETFDSNEAMYTKIKQGGTTYDIAIPSEYMINKMKDEDLLVPLDYSKIEGIENIGPEFLNQSFDPGNKFSIPYFWGTLGIVYNETMVDEAPEHWDDLWKLEYKNSIMLFDGAREVLGLGLNSLGYSLNSKDPQQLEETVDKLYKLTPNIKAIVADEMKGYMIQNNVAIGVTFSGEASQMLEKNENLRYVVPTEASNLWFDNMVIPKTVKNQDSAYAFINFMLKPENALQNAEYVGYSTPNLPAKELLPEETKEDKAFYPDVETMKHLEVYEKFDHKWTGKYSDLFLQFKMYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Spermidine/putrescine ABC superfamily ATP binding cassette t
publication title 1.5 Angstrom Crystal Structure of Spermidine/Putrescine ABC Transporter Substrate-Binding Protein from Streptococcus pneumoniae strain Canada MDR_19A in Complex with Calcium and HEPES.
rcsb
source organism Streptococcus pneumoniae tch8431
total genus 130
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4eqbA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4eqbA01
1ATGA 4HTGA 3EN3A 4DCXA 1VE4A 3U92A 3DELB 4OYVA 2AYSA 2E1SA 4XIGQ 4YB6A 3KSJA 2P1SA 2VGQA 3OENA 1MXVA 1YCJA 3PMXA 3TTKA 2DQVA 5I2NB 2HQ0A 3JZJA 4QSEA 1MRPA 1ZTYA 5CRYA 3ZSFA 3MQ9A 2ZNUA 1EU8A 3IO4A 4JBZA 5HM4B 3CFLA 4F2QA 4KCDA 3JYRA 5I56A 1Y3NA 2ESNA 1US4A 4G4PA 1I6AA 3TTNA 3OO7A 3KEIA 2F6PA 4LUBA 1FQDA 2HFBA 4NF6B 3T9VA 1MS7A 2VHAA 2QS1A 3FV1A 3IOTA 1Y20A 2PBWA 3BFUA 1IIWA 4K3FA 1JQFA 2FYIA 2H25A 3RQTA 4ZDMA 4FAJA 4YMBA 4GOTA 4HCWA 4ZECA 3OSQA 2B3FA 2DE2A 4OERA 3IK6B 1B5JA 3GBAA 4RY1A 3SESA 4O3BA 4G77A 2VD2A 4ZEFA 5A5XB 4NF5A 4EF1A 3MVWA 1JW1A 3E13X 1Z7NE 2GH9A 2Z23A 3HSTA 2F5XA 1MY1A 1JVYA 3LSLA 1O63A 3R26A 4WEPA 2XX7A 1MDQA 1SYIA 4IY5A 1KWHA 5DEXA 4NF8B 4U23A 5CBRA 4F3GA 1MQJA 3FASA 2Q2CA 3TTRA 1UTHA 2H99A 4PE5B 2WKYA 5H8HB 4QSCA 3O6GA 4G68B 4F1YA 3EF7A 3B6TA 4KI0E 1NH8A 4OZ9A 3QAXA 3K00A 4FORA 5L9MA 3BKIB 4N6PA 3CRBA 1B3HA 3RT8A 3CFXA 5IAIA 3G3KA 1MG1A 2ZMBA 3S9EA 2UVGA 2Z8EA 4NEDA 4TLMB 2O7IA 1N7XA 3O97A 4OVJA 2NOOA 3L6HA 4MLQA 2ONRA 3VLUA 2A5TA 3KOTA 3OEKA 4LQ2A 2THIA 2G93A 4JWOA 2DWHA 2O6AA 3ILUB 4PETA 3ONMA 2OZZA 4JDFA 1P1QA 1OVTA 2ZYOA 1DTGA 1Y4TA 1PBQA 2PT1A 4MBPA 5CMCA 3OD7A 2V3QA 3M8UA 4H6DA 2DP8A 4U22A 1FCKA 1FTLA 2KLFA 3FUZA 1Y3QA 1JNFA 2DE3A 2ONKE 4LQ5A 3C9HA 1SW5A 5F7VA 4R6KA 2V3UA 4GIZA 1WDNA 2QSXA 3PD9A 2GHBA 4GL0A 5L9OA 4BLAA 3R7XA 5AA2B 3MVZA 3H6VA 3KN3A 2Q9TA 4C1UA 3A3CA 3TCHA 2NWJA 1UIVA 4C1TA 2XXPA 3BFTA 2DWIA 2UYFA 2DE4A 3KGCA 3V83A 3TQLA 2X7QA 3V89B 3H03A 1LB9A 3ILTB 1XC1A 3QYTA 1TFDA 2RC8A 3T93B 4PP0A 4THIA 3IX1A 4QHQA 3RNNA 3LBSA 3A3UA 3ECRA 4KR5A 3SEWA 4AB6A 2HEUA 3PUWE 1P1WA 4DXCA 5KCJB 2PYYA 3P7IA 1NNPA 4OEVA 4OEUA 3Q25A 4BDMA 1UIUA 3TMGA 1IXHA 3IR1A 3GBBA 1EZPA 1FQFA 5AA2D 1SW2A 1ANFA 1S50A 4E0WA 3DM0A 5ELVA 3MZBA 1USYE 4JSOA 2I4CA 4JXIA 4NF5B 1Y9UA 3IJXB 3SEXA 4I9DA 4IO2A 5K2YA 1B46A 1M5FA 3U93A 1A40A 3FXQA 3PD8A 5A5XA 3D4GA 2DXYA 3KJ7A 3MPLA 1FTMA 5DVFA 3VXBA 4H8IA 1R9LA 2X26A 4X9TA 3F11A 1RYXA 2OCUA 3K1MA 2XXUA 3SEYA 3E9XA 3T66A 1UTHB 2OWTA 1B52A 1FQCA 1URSA 1DPEA 4KFQA 2HZKA 3UIFA 3G3HA 2Q88A 2YLNA 1GVCA 5AA1A 1ZMGA 4G8HA 2B3BA 1B40A 5I2KB 5TP9B 5H8HA 4P11A 2H5YA 3FVGA 4QFNA 2HCAA 4G68A 2ANJA 2QS3A 4YB7A 4ZE8A 1LLSA 4DE8A 1MM7A 4R9FA 3QIMA 3I3VA 1NNKA 1FTOA 4ND9A 4R73A 3SETA 3K6VA 4AB5A 1UTBB 4EDPA 4BDNA 3H7MA 4QFLA 1RYOA 4R75A 4BDLA 3VVDA 1MQIA 3USDA 3MVXA 1H76A 1OVBA 4XKPA 4ZS9A 2O68A 2O7UA 4Q8RA 3TAJA 3RUMA 5F1QA 3LUYA 1A7LA 5DVIA 3PMWA 2DWAA 2O51A 1B1XA 3PUYE 1R9QA 5CI5A 2XX9A 3UK4A 5JEIA 3RGYA 4DLDA 3V8XB 4EUOA 1JEVA 3VVEA 3S9LC 1JVXA 3C31A 3DP4A 3FIRA 1OQHA 3QUFA 1B32A 3DP8A 1H44A 4U2RA 3LSXA 1B4ZA 2REJA 1N04A 3RN8A 1I69A 2AIXA 1HSEA 3PPNA 4OQOA 5CMKA 1B7UA 3FGSA 1B58A 3TYHA 4KD5A 2PVUA 1PDAA 2R9JA 3R6UA 3ZS6A 5FHOA 4F18A 4PFYA 4XKQA 1M5BA 1PB8A 3HN0A 1B4HA 5AA2A 1B0LA 3H06B 3B6QA 3UN6A 1R6ZA 2M8CA 3VV5A 1S9TA 1N7WA 2Y7RA 4F3BA 3MJNA 4FE8A 3KFMA 4QF9A 1DOTA 5DT6A 3VVFA 4OFLA 3FJMA 3O6HA 3MZ9A 3DP6A 3K1PA 1OLAA 1WVJA 4O3CA 2B65A 3U72A 3HCQA 3I6VA 1A55A 1TFAA 1USYH 5CMBA 4GRKA 1FQAA 4IO6A 1Y1MA 4H1XA 5KCJA 3PPRA 4IGRA 1YPNA 3W9WA 4NF4B 2CZLA 2FNCA 4Q0CA 2GFEA 2O84X 2F7BA 3S2VA 3Q29A 4NTLA 1MY4A 4ECFA 1VSOA 2XXXA 3MVYA 1RKMA 3VLVA 4ELPA 3S9NC 1PC3A 1B0HA 3K6WA 5I84A 3O2AA 4X48A 4P0GA 4QSDA 3I5OA 5AE4A 5B70A 4KQPA 3K4UA 4OESA 3T9XB 3VLWA 4MF3A 2XXVA 2ZYNA 3EHUA 3O66A 4KYDA 3G3JA 1JW4A 3OELA 4OMBA 4ELQA 4KPTA 1ZU0A 2E0SA 1QUIA 2UXAA 1SQYA 2H4IA 3TFLA 1IXIA 3CG1A 1IZ1A 1MH3A 4F1VA 3FD3A 1A99A 3K02A 2UVHA 2VD3A 4ELOA 3UP9A 4ONYA 5I2KA 4NE4A 5TP9A 1TXFA 2CMOA 4DDDA 4R72A 3MC2A 2Q8JA 5FTHA 4BDRA 4FECA 1BIYA 1DSNA 1M5DA 2F7AA 4H5FA 1O7TA 2O69A 4OHNA 1B51A 1P99A 1GV8A 1UTBA 1LGBC 3MWBA 4YZZA 1SI0A 2Y7PA 1US5A 2Z22A 4LZ5A 4TLLB 3MPKA 5H8SA 4YKIA 2Y7IA 4LZ7A 2RC7A 4F3PA 4X1DA 4PFWA 1EZOA 3W9VA 2XD3A 4BDOA 3O29A 2I49A 4IO7A 3U94A 2XXTA 3UGWA 4R9GA 1FTKA 4OFOA 4BDQA 1LB8A 5EYFA 3QSLA 1GTKA 1Y1ZA 3EHSA 2YJPA 2NXOA 1B7ZA 4M1VA 1IEJA 3PUXE 2DOJA 4ESWA 1B05A 3PU5A 4EXKA 4F2OA 2XXWA 1LAXA 2ZNTA 5LOMA 1OIBA 1IUDA 1BKAA 3HHFA 4FATA 5I58B 4NWCA 3RPWA 3E3KA 4OTEA 4U21A 4X1BA 4RYAA 4IO4A 4H65A 2D3IA 2XXYA 5AA4B 4R6HA 3JV9A 1ZLQA 4GLIA 4F1UA 1POTA 2OJTA 4YU0A 5EHMA 1Z7ME 1MH4A 3S4UA 2RC9A 1AMFA 4R2BA 3D4CA 5I59B 1QUKA 5H8NA 1H43A 3TCGA 1TWYA 3M3KA 2F8DA 4H5GA 2P2AA 4YMAA 2H98A 2VP1A 4G2ZA 4OENA 3H4ZA 4PQJA 3IOUA 3MAMA 3VDFA 2DWJA 3IB1A 3IL1B 4N07A 1CB6A 4YKJA 1FW0A 1B3FA 2XXQA 1LFIA 4EQ9A 1AOVA 2Z8FA 2V84A 4EF2A 1J1NA 2REGA 1A8EA 3PGFA 4RNSA 4NF4A 3KG2A 4DXBA 4IO5A 3HPIA 4R6YA 4F29A 1IXGA 1B6HA 1II5A 4JWYA 1UQWA 4E0XA 4EQ7A 3O28A 2F7CA 3KSXA 2DSFA 1B7HA 1O64A 1NKXA 4MH5A 1SW4A 1N0TA 1B5HA 3LR1A 1JETA 2XXIA 5TU0A 2QS4A 3OO6A 3C4MA 4G8NA 4XKNA 5EHSA 4LA9A 4I1DA 1AL3A 3HO7A 2W7YA 3N94A 1SD3A 1NFTA 4DIGA 1T0KA 3FATA 4ZZEA 3T9UA 1LCTA 5KZTA 1JW5A 4UACA 2XXHA 1OQGA 1XHYA 5HPQA 1VFDA 3CFZA 3K2DA 4GQOA 1LAFE 4GF8A 3ZKLA 3QUJA 3WAEA 4UA8A 4GXSB 4H8JA 1B3EA 1Q35A 2QL3A 3SERA 2DXRA 1OMPA 4GFRA 3RY3A 3TEPA 3H6UA 3U8QA 3O9PA 5ICTA 1D9YA 4YB5A 3MZ1A 3IORA 2VOZA 3LSWA 3S9MC 4FJPA 2Q89A 3CI8A 1MPCA 4GXAA 2R71A 1JEUA 1LSTA 2ZYMA 3G3FA 4G8MA 3CSGA 3FVKA 2XX8A 1I6QA 1FQBA 3GXAA 1L5TA 2ZNSA 1XS5A 1TT1A 3Q28A 3OEMA 1SYHA 4XTCQ 5IKBA 3FV2A 2RCBA 1N3XA 3B7DA 4ELRA 5H8QB 3MP1A 5AA3A 3ODBA 1WODA 2XXRA 4OXVA 3MUQA 1N76A 3T22A 2ONSA 3FZVA 5FHMA 3CIJA 1IXCA 1QULA 3GZGA 1QVSA 1D4NA 3IOVA 3DLNA 1SI1A 1QUJA 1MPDA 3FXUA 2RF1A 2OLBA 3SDFA 1LCFA 1H3DA 4FIMA 1VFEA 1URGA 4HCYA 3HHGA 3K01A 3TELA 2QMWA 2I4BA 1ELJA 5CC2A 1F9BA 2Q2AA 1ZIUA 3O6IA 2F35A 3TTMA 3M3LA 4JB7A 1A8FA 2I3VA 1A54A 5I58A 3PPQA 5ITPA 1NMUA 2D21A 4JWXA 2IA4A 3V5AA 2XHDA 1MXYA 4Z0IA 3HV1A 3TUSA 5H8NB 2IEEA 5AA4A 2NVUB 2DYXA 1B5IA 4YKPA 2V3TA 4WKMA 5H8FB 1QW0A 5L8DA 3G7WA 1PBPA 2F6GA 3N26A 3QXMA 1DMBA 3TTLA 2I0CA 4F19A 3H6TA 1N84A 3VFJA 4AQ4A 3PPOA 5I59A 4IGTA 4F3SA 4DXUA 3IAZA 3FJGA 3RT6B 1Q1KA 1HSJA 4FEDA 3G3IA 5B7DA 3KZGA 4RPNA 2UVJA 2D5WA 4EXLA 2ZYKA 1MY0A 3C33A 1IQ7A 5ISUA 3LC8A 4RK2A 1XVYA 3PMVA 4MLVA 5I57A 4GVOA 5BWJA 1MXWA 1NNTA 1R1NA 1Y4CA 4F31B 2F34A 3IJOB 3MW0A 3TZAA 5DVJA 2I48A 4XXUA 4C0RA 3UORA 1XOCA 2RKMA 4YKKA 2YPNA 5FTIA 3T96B 3UA8A 1MY3A 1PB7A 2H9BA 1HSLA 2DVZA 3KJTA 1AH5A 1LAGE 1S7YA 1QJMA 4H67A 5TPAA 1MDP1 4M4GA 1P1OA 5JTYB 4ZEKA 2PT2A 1EZ9A 3IO6A 2Y7KA 1MQGA 1BLFA 2I58A 4LATA 4P0IA 2OBGA 3IB2A 2RCAA 3OSRA 4NWDA 3PUZE 4R2FA 5CM6A 4Z7EA 3LSFB 4LZ8A 1NH7A 1MPBA 1SW1A 2ALUA 2PX1A 2V25A 1MQDA 3TDJA 4POXA 1IITA 3PV0E 2Y84A 1OLCA 2G29A 1LBBA 3KBRA 5CMMA 2O1MA 3PUVE 5KDTA 1H45A 3CSBA 3FJ7A 5ICQA 1SDXA 4H0WA 1ZKBA 4KCCA 3N6TA 2LAOA 4KYEA 5J1DA 2BJJX 3THIA 3G3GA 4HW8A 2XD2A 2Z8DA 1BP5A 3KN7A 1Y3PA 1SBPA 4QFKA 2HAUA 5H8QA 4GD5A 4QRZA 3OO9A 3H3GA 4PFTA 2P0SA 3U1OA 2QMXA 3K0VA 4Q30B 5M2VA 3K6XA 4NMYA 4WEDA 3CR9A 1ZBMA 5FHNA 3ZKKA 1GGGA 2HZLA 4F39A 1YAEA 1QKAA 3OMBA 4RK9A 1PEBA 1I6BA 3SEUA 2X7PA 2V93A 1QKBA 2AL4A 1BTJA 4I62A 4XKRA 4ZEDA 3A09A 1VR5A 3L6GA 4JSDA 1FTJA 5DYHA 1GR2A 3B6WA 3K1NA 2HAVA 2GHAA 3OOAA 2AL5A 4Q5TA 3C34A 3QK6A 5I2NA 1B3LA 1LFHA 5H8FA 1CE2A 5I56B 1DTZA 4LP2B 2QJEA 3TKDA 3TPAA 4WXJA 4R74A 4PFUA 4LVQA 2QPQA 3WAFA 2PMSA 3FXRA 3TODA 4TOZA 5HBCA 4QFPA 4POWA 1B9JA 5I57B 4IB2A 1M5EA 3PPPA 3W15C 1YTVA 3AXFA 4ESXA 4FEBA 1N3WA 4RA1A 4OETA 4U4XA 4YICA 1XT8A 3OO8A 4NF6A 1URDA 1LAHE 3Q27A 4DZ1A 4RPOA 1EH3A 4GWOA 1SVXB 2Y7WA 3OXNA 5L9SA 2F36A 4O3AA 1D3KA 2A5SA 4QFOA 1DPPA 3KOSA 1B3GA 3EPEA 4U4SA 2QS2A 1D9VA 4ZEIA 4KHZE 4G68C 3MBPA 5TPAB 5JK4A 4RXLA 4OFJA 3EHTA 3IB0A 3T9HB 4DCYA 3RTWB 4HS7A 4LONB 3MP8A 5DEXB 3IOWA 3TQWA 4ISUA 1MQHA 3MP6A 3TCFA 4TQUQ 1MY2A 5JTYA 3H6WA 4EQBA 4I8CA 3C32A 4NF8A 2UVIA 2RINA 1NNFA 4IY6A 1NL5A 1B2HA 2HXWA 1MM6A 1LFGA 2O1LA 3KN8A 3C36A 1MXUA 2F97A 4MFIA 1P1UA 3GLBA 5KDTB 2I3WA 4U1OA 3RLFE 4YAHX 4RJZA 4F22A 1PB9A 3SEVA 1MXXA 5BUUA 4KYSA 4GL8A 2F78A 2DS9A 3M3FA 3FVOA 3CG3A 1LBCA 2OWSA 1B1HA 3N6UA 3BBRA 2A5TB 5K2XA 3K6UA 1AIVA 2I0BA 2I6EA 3C35A 3N5LA 1POY1 5CBSA 5DTBA 3VE1B 4ZEBA 3SKPA 4ZE9A 1FQEA 4OWDA 3EQ1A 1XVXA 2OK2A 4ZZAA 3CVGA 1MXZA 3RTFB 2DVCA 1M5CA 3Q26A 3FVNA 2QRYA 4N13A 3E4RA 2ABHA 1ZJLA 2FA7A 4U1ZA 5ITOA 2ZXTA 2GRVA 4L17A 3VXCA 4IO3A 2R6GE 2NUVA 2UYEA 1P1NA
chains in the Genus database with same CATH superfamily
1ATGA 1SPIA 4HTGA 1G0HA 3EN3A 4DCXA 1VE4A 4PTKA 3U92A 3DELB 1NV1A 4OYVA 2AYSA 2E1SA 4XIGQ 4YB6A 3KSJA 4GBWA 2P1SA 2VGQA 3OENA 1MXVA 1YCJA 3PMXA 3TTKA 4P56A 2DQVA 5I2NB 2HQ0A 3JZJA 2WYKA 4QSEA 1MRPA 4P9KA 1ZTYA 5CRYA 3ZSFA 4PCDA 3MQ9A 2ZNUA 1EU8A 3IO4A 4JBZA 1AWBA 5HM4B 3CFLA 4F2QA 4KCDA 3JYRA 5I56A 1Y3NA 2ESNA 1US4A 2FIEA 3KC1A 4G4PA 3T1BA 1I6AA 4IR8A 4MAGA 3TTNA 3OO7A 3KEIA 1RDXA 2F6PA 4LUBA 1FQDA 2HFBA 4NF6B 3T9VA 1MS7A 3IFCA 2VHAA 1LBYA 2QS1A 2V4CA 4HE0A 3FV1A 5ET8A 3IOTA 1Y20A 2PBWA 5F24A 3BFUA 4GX3A 1IIWA 4K3FA 1JQFA 2FYIA 2H25A 3RQTA 4ZDMA 4FAJA 1Q9DA 4YMBA 1NUZA 5IZZA 4GOTA 4HCWA 4ZECA 3OSQA 2B3FA 5I5PA 4GWYA 2DE2A 4OERA 3ROJA 3IK6B 1B5JA 3GBAA 4RY1A 3SESA 4O3BA 4G77A 2QVUA 2VD2A 4ZEFA 5A5XB 4NF5A 4EF1A 4MCOA 3MVWA 1JW1A 1LBWA 3E13X 1Z7NE 2GH9A 2R8TA 2Z23A 3HSTA 2F5XA 1MY1A 1JVYA 3LSLA 3LV0A 1O63A 4PDDA 3R26A 4WEPA 2XX7A 1MDQA 1SYIA 3B8BA 2XXKA 4IY5A 1KWHA 5DEXA 4NF8B 4U23A 4N8GA 5CBRA 4F3GA 1MQJA 4OA4A 3FASA 2Q2CA 3TTRA 1UTHA 2H99A 2Y5LA 4PE5B 2WKYA 5H8HB 4QSCA 3O6GA 4G68B 5IGAA 1FPDA 4F1YA 3EF7A 3B6TA 4KI0E 1NH8A 2WBDA 4OZ9A 1IMFA 2QVRA 3QAXA 3K00A 4FORA 5L9MA 3BKIB 3D1RA 4N6PA 3CRBA 1B3HA 3RT8A 3CFXA 4N17A 5IAIA 3G3KA 1MG1A 2ZMBA 4PFRA 5FBPA 3S9EA 2UVGA 2Z8EA 4NEDA 4TLMB 3SZPA 2O7IA 1KA0A 1N7XA 2KQZA 3O97A 4OVJA 2NOOA 3B50A 3L6HA 4MLQA 2ONRA 3E78A 3VLUA 2A5TA 3KOTA 3OEKA 4LQ2A 2THIA 2G93A 4JWOA 2DWHA 4N4UA 2O6AA 3ILUB 4PETA 2VPNA 1NV6A 3ONMA 2OZZA 4JDFA 1P1QA 1OVTA 2ZYOA 1DTGA 1Y4TA 1PBQA 2PT1A 4MBPA 5CMCA 3OD7A 2V3QA 3M8UA 4H6DA 2DP8A 4U22A 3E79A 1FCKA 1FTLA 2KLFA 3FUZA 1Y3QA 1EYIA 3HFUA 1JNFA 2DE3A 2ONKE 4LQ5A 3C9HA 1SW5A 5F7VA 4R6KA 1IMEA 2V3UA 1NV4A 4GIZA 1NUWA 1WDNA 2QSXA 3PD9A 1NV0A 2GHBA 4GL0A 5L9OA 4BLAA 3R7XA 5AA2B 3MVZA 3H6VA 3KN3A 2Q9TA 4C1UA 1IMBA 3A3CA 4NG7A 3TCHA 2NWJA 1UIVA 4C1TA 2XXPA 3BFTA 2DWIA 2UYFA 2DE4A 3KGCA 3V83A 2WBBA 3TQLA 2X7QA 2OWZA 3H03A 3V89B 1LB9A 3ILTB 1XC1A 3QYTA 1TFDA 2DDKA 2RC8A 3T93B 4PP0A 4THIA 3IX1A 4NQ8A 4QHQA 3RNNA 3ISPA 3LBSA 3A3UA 3ECRA 4KR5A 3SEWA 4AB6A 4O8MA 2HEUA 3PUWE 1P1WA 4XF5A 4DXCA 5KCJB 2PYYA 1FPIA 3P7IA 1NNPA 4OEVA 4OEUA 3Q25A 4BDMA 2Q74A 1UIUA 3TMGA 1IXHA 3IR1A 3GBBA 1EZPA 1FQFA 5AA2D 1SW2A 1ANFA 2QVVA 1S50A 4E0WA 3DM0A 5ELVA 3MZBA 1USYE 4JSOA 1FBFA 2I4CA 4JXIA 4NF5B 2XWKA 3FXBA 1Y9UA 3IJXB 3SEXA 4I9DA 4IO2A 5K2YA 1B46A 1M5FA 3U93A 1A40A 3FXQA 3PD8A 5A5XA 3D4GA 2DXYA 3KJ7A 3MPLA 1FTMA 5DVFA 3VXBA 4H8IA 1R9LA 2X26A 4X9TA 3F11A 1RYXA 2OCUA 3K1MA 2XXUA 3SEYA 3E9XA 3T66A 1UTHB 2OWTA 1B52A 1FQCA 1URSA 1DPEA 4KFQA 4P3LA 5A5LA 2HZKA 3UIFA 3G3HA 2Q88A 2YLNA 4GX4A 1GVCA 5AA1A 1ZMGA 4G8HA 2B3BA 1B40A 5I2KB 3A29A 5TP9B 5H8HA 4P11A 2H5YA 3FVGA 4H46A 4QFNA 2HCAA 4G68A 2ANJA 2QS3A 4YB7A 4ZE8A 1LLSA 4DE8A 1MM7A 4R9FA 3QIMA 3I3VA 1NNKA 1FTOA 4ND9A 1FBGA 4R73A 4PC9A 3SETA 3K6VA 4AB5A 1UTBB 4EDPA 4BDNA 3H7MA 4QFLA 1RYOA 4R75A 2XWVA 4BDLA 3VVDA 1MQIA 1IMDA 3USDA 3MVXA 1H76A 1OVBA 4XKPA 4ZS9A 2O68A 2O7UA 4Q8RA 2HXRA 3TAJA 3RUMA 5F1QA 3LUYA 1A7LA 5DVIA 3PMWA 2DWAA 2O51A 1B1XA 3PUYE 1R9QA 5CI5A 2CEYA 2XX9A 3UK4A 5JEIA 3RGYA 4DLDA 3V8XB 4EUOA 1JEVA 3VVEA 3S9LC 1JVXA 3C31A 3DP4A 3FIRA 1OQHA 4GWWA 2CZKA 3QUFA 1B32A 3DP8A 2KR0A 1H44A 4U2RA 1NI9A 3LSXA 3EKIA 1B4ZA 2REJA 1N04A 3RN8A 1I69A 2AIXA 1HSEA 3PPNA 4OQOA 4OVQA 4P47A 5CMKA 5LTCA 1B7UA 3FGSA 1B58A 3TYHA 4KD5A 2PVUA 5DW8A 1PDAA 5EYHA 2R9JA 3R6UA 1VDWA 1EYJA 4NF0A 3ZS6A 5FHOA 4F18A 1XI6A 1LBZA 4PFYA 4XKQA 1M5BA 1PB8A 3HN0A 1B4HA 5AA2A 1B0LA 3H06B 3B6QA 3UN6A 1R6ZA 2M8CA 2Q8MA 2XWIA 3VV5A 1RDYA 4PAIA 1S9TA 5EQAA 1N7WA 2Y7RA 1DK4A 4MNCA 4F3BA 3MJNA 4FE8A 3KFMA 4QF9A 1DOTA 5DT6A 3GYYA 3LUZA 3VVFA 4OFLA 3FJMA 3O6HA 3MZ9A 3DP6A 3K1PA 1OLAA 1WVJA 4O3CA 4MEVA 2B65A 3U72A 3HCQA 4NHBA 4N15A 3I6VA 1A55A 1TFAA 1USYH 5CMBA 4GRKA 1FBCA 1FQAA 4IO6A 1Y1MA 4H1XA 5KCJA 3PPRA 4IGRA 1YPNA 3W9WA 4HE1A 4NF4B 2CZLA 2FNCA 4Q0CA 1K9YA 2GFEA 2O84X 2F7BA 4MMPA 3S2VA 3Q29A 4NTLA 1MY4A 1FPBA 4ECFA 1VSOA 2XXXA 3MVYA 1RKMA 2VPOA 3VLVA 4N91A 4QBAA 4XFEA 4GWZA 4ELPA 3S9NC 1PC3A 1B0HA 3K6WA 5I84A 5IZ1A 3O2AA 4X48A 4P0GA 1NV5A 4QSDA 3I5OA 5AE4A 5B70A 4KQPA 3K4UA 4OESA 3T9XB 3VLWA 4MF3A 2XXVA 4PGPA 2ZYNA 3EHUA 3O66A 4KYDA 3G3JA 1JW4A 3OELA 4OMBA 4ELQA 2FHYA 4KPTA 1ZU0A 1D9QA 4N6DA 2E0SA 1QUIA 2GQ1A 2UXAA 1QGXA 1SQYA 2H4IA 3BIHA 3TFLA 1IXIA 1RDZA 3CG1A 1IZ1A 1MH3A 4F1VA 3FD3A 1A99A 3K02A 2UVHA 2WEFA 2VD3A 4ELOA 3UP9A 4ONYA 5I2KA 4NE4A 4MJOA 4OVRA 5TP9A 1TXFA 2CMOA 4DDDA 4R72A 3MC2A 2Q8JA 5FTHA 4BDRA 4FECA 1BIYA 1DSNA 1M5DA 4FBPA 2F7AA 3QMFA 4H5FA 1FTAA 1O7TA 2O69A 4OHNA 1B51A 1P99A 1GV8A 1UTBA 3FBPA 1LGBC 3MWBA 4YZZA 1SI0A 2Y7PA 1US5A 4MHFA 2Z22A 4JVIA 4LZ5A 3MPKA 4TLLB 5H8SA 1KA1A 4YKIA 2Y7IA 4LZ7A 2RC7A 4F3PA 4X1DA 4P1LA 4PFWA 1EZOA 3W9VA 2XD3A 4BDOA 3O29A 2I49A 4IO7A 1YXIA 3U94A 2XXTA 3UGWA 1FBPA 4X8RA 4R9GA 1FTKA 4OFOA 4BDQA 1LB8A 5EYFA 3QSLA 1GTKA 1Y1ZA 3EHSA 2YJPA 2NXOA 4GWXA 1B7ZA 4M1VA 1IEJA 3PUXE 2DOJA 4ESWA 1B05A 3PU5A 4EXKA 4F2OA 2XXWA 1LAXA 2ZNTA 2FIXA 5LOMA 1OIBA 1IUDA 1BKAA 3HHFA 4FATA 5I58B 5I3SA 4NWCA 3RPWA 3E3KA 4OTEA 4U21A 2F3BA 5LDZA 4X1BA 4RYAA 4PE3A 5I7IA 2PFZA 4IO4A 4H65A 2D3IA 2XXYA 5AA4B 4R6HA 3JV9A 4MX6A 1ZLQA 2F3DA 4GLIA 4F1UA 1POTA 2OJTA 4YU0A 5EHMA 1Z7ME 1MH4A 2PFYA 3S4UA 2RC9A 1AMFA 4R2BA 3D4CA 5I59B 4NN3A 1QUKA 5H8NA 1H43A 4PFIA 3TCGA 1TWYA 3M3KA 4OVTA 2F8DA 4H5GA 5ET5A 2P2AA 4YMAA 2H98A 2VP1A 4G2ZA 4OENA 3H4ZA 4PQJA 3IOUA 3MAMA 3VDFA 2DWJA 3IB1A 3IL1B 4N07A 1CB6A 4YKJA 1FW0A 1B3FA 2XXQA 1LFIA 4EQ9A 1NV2A 3NOHA 1AOVA 2Z8FA 2V84A 1IMCA 4EF2A 1J1NA 2REGA 1A8EA 3PGFA 4RNSA 4NF4A 3KG2A 4DXBA 4IO5A 3HPIA 4R6YA 4F29A 1IXGA 1B6HA 1II5A 4JWYA 1UQWA 4E0XA 4GX6A 4EQ7A 3O28A 2F7CA 4JVDA 3KSXA 5ET7A 2DSFA 1B7HA 1O64A 4LN5A 1NKXA 4MH5A 1SW4A 1N0TA 1B5HA 3LR1A 1JETA 2OX3A 2XXIA 3T0JA 5TU0A 2QS4A 3OO6A 3C4MA 4G8NA 1FBDA 4XKNA 5EHSA 4LA9A 4I1DA 1AL3A 3HO7A 4I3EA 2W7YA 3N94A 1FPKA 1SD3A 1NFTA 4DIGA 1KZ8A 1T0KA 3FATA 4ZZEA 3T9UA 4KXPA 1LCTA 5KZTA 1JW5A 4UACA 2XXHA 1OQGA 1XHYA 5HPQA 3MYUA 1VFDA 3CFZA 3K2DA 4GQOA 1LAFE 2CZHA 4GF8A 3ZKLA 3QUJA 3WAEA 4UA8A 4GXSB 4H8JA 1B3EA 1Q35A 2QL3A 3SERA 2DXRA 1FSAA 1OMPA 4GFRA 3RY3A 3TEPA 3H6UA 3U8QA 3O9PA 5ICTA 1D9YA 4YB5A 3MZ1A 4AS5A 1FPEA 3IORA 2VOZA 3LSWA 3S9MC 4FJPA 2Q89A 1DCUA 3CI8A 1MPCA 4GXAA 2R71A 1JEUA 1LSTA 2ZYMA 3G3FA 4G8MA 3CSGA 3FVKA 2XX8A 1I6QA 1FQBA 3GXAA 4HE2A 2Y5KA 1L5TA 2ZNSA 1XS5A 1TT1A 3Q28A 3OEMA 1SYHA 4XTCQ 5IKBA 2L5VA 2FVZA 3FV2A 2RCBA 1N3XA 3B7DA 4ELRA 5H8QB 3MP1A 3ODBA 5AA3A 1WODA 2XXRA 4OXVA 3MUQA 1N76A 3T22A 2ONSA 3FZVA 5FHMA 3CIJA 1IXCA 1QULA 4DI4B 1LBXA 3GZGA 1QVSA 1D4NA 3IOVA 3DLNA 1SI1A 1QUJA 4O7MA 5IZ3B 1MPDA 3FXUA 2RF1A 2OLBA 3SDFA 1LCFA 1H3DA 4FIMA 1VFEA 1URGA 4HCYA 4O94A 3HHGA 3K01A 2B4LA 3TELA 2QMWA 2I4BA 3KC0A 1ELJA 4OVSA 5CC2A 1F9BA 2Q2AA 4AS4A 4HXVA 1ZIUA 3O6IA 2F35A 3TTMA 5EQ7A 3M3LA 4JB7A 1A8FA 2I3VA 1A54A 5I58A 3PPQA 5ITPA 1FRPA 1NMUA 2D21A 4JWXA 4DI3D 2IA4A 3V5AA 2XHDA 1MXYA 4Z0IA 3HV1A 3TUSA 5H8NB 2IEEA 5AA4A 2NVUB 2DYXA 1B5IA 4YKPA 2V3TA 4WKMA 5H8FB 1QW0A 5L8DA 3G7WA 1PBPA 2F6GA 3N26A 3QXMA 2BJIA 1DMBA 3TTLA 2I0CA 4F19A 3H6TA 1N84A 3VFJA 1NUXA 4AQ4A 3PPOA 5I59A 4IGTA 4F3SA 1FJ6A 2P3NA 2XA5A 4DXUA 3IAZA 3FJGA 3RT6B 1Q1KA 1HSJA 4FEDA 3G3IA 5B7DA 3KZGA 4MNPA 4RPNA 2UVJA 2D5WA 4EXLA 2ZYKA 1MY0A 3C33A 1FBHA 1IQ7A 4G61A 5ISUA 2ZZXA 3LC8A 4RK2A 1XVYA 3KBZA 3PMVA 4MLVA 5I57A 4GVOA 5BWJA 1MXWA 1NNTA 1R1NA 4NAPA 1Y4CA 4F31B 2F34A 3IJOB 5J16A 3MW0A 3TZAA 1EYKA 5DVJA 2B4MA 2I48A 1FPLA 4XXUA 4C0RA 3UORA 4UABA 4OVPA 4X04A 1XOCA 3MSTA 2P3VA 2RKMA 2ZZVA 4YKKA 2YPNA 5FTIA 3T96B 1G0IA 3UA8A 1MY3A 1PB7A 2H9BA 5EQ9A 1HSLA 2DVZA 4PAKA 3KJTA 1AH5A 1LAGE 1S7YA 1QJMA 4H67A 5TPAA 4NX1A 1MDP1 5IM2A 4M4GA 1P1OA 5JTYB 4ZEKA 2PT2A 1EZ9A 3IO6A 2Y7KA 1MQGA 1BLFA 2I58A 2JJKA 4P0IA 4LATA 2OBGA 3IB2A 2RCAA 4GBVA 3OSRA 4NWDA 3PUZE 4R2FA 4PGNA 5CM6A 4Z7EA 3LSFB 4LZ8A 1NH7A 1MPBA 5EQ8A 1SW1A 2ALUA 2PX1A 2V25A 1MQDA 3TDJA 2CEXA 4POXA 1IITA 3PV0E 1YYZA 2Y84A 1CNQA 1OLCA 2G29A 1LBBA 3KBRA 5CMMA 4XEQA 2O1MA 3PUVE 5EYGA 5KDTA 1H45A 3CSBA 3FJ7A 5ICQA 2FBPA 1SDXA 4H0WA 1ZKBA 4KCCA 3N6TA 2LAOA 4KYEA 1NUYA 5J1DA 2BJJX 3THIA 3G3GA 1YZ0A 4HW8A 3IFAA 2XD2A 2Z8DA 1BP5A 3KN7A 1Y3PA 1SBPA 4QFKA 2HAUA 5H8QA 4GD5A 4QRZA 3OO9A 2HHMA 3H3GA 4PFTA 4PF8A 4GWUA 4GWSA 2P0SA 3U1OA 2QMXA 3K0VA 5ESYA 4Q30B 5M2VA 4OANA 3K6XA 4NMYA 2HPGA 1FPJA 4WEDA 3RPLB 4QXDA 3CR9A 1ZBMA 5FHNA 4N81A 5IZ3A 2PCRA 3ZKKA 4JVCA 1GGGA 2HZLA 4F39A 4PBQA 1YAEA 1QKAA 3OMBA 4I3YA 4RK9A 1PEBA 1I6BA 3SEUA 2X7PA 2V93A 4N8YA 1QKBA 2AL4A 1BTJA 4I62A 4XKRA 4ZEDA 3A09A 2MKZA 1VR5A 3L6GA 4JSDA 4H45A 1FTJA 5T3JA 5DYHA 1GR2A 3B6WA 3K1NA 2HAVA 2GHAA 3OOAA 4O7IA 2AL5A 4Q5TA 3C34A 3QK6A 5I2NA 1B3LA 1LFHA 5H8FA 1CE2A 4P8BA 5I56B 1DTZA 4LP2B 2QJEA 3TKDA 3TPAA 4PFBA 4WXJA 4R74A 4PFUA 4LVQA 2QPQA 3WAFA 2PMSA 3FXRA 3TODA 4TOZA 5HBCA 1FBEA 4QFPA 4POWA 1B9JA 5I57B 4IB2A 1M5EA 3PPPA 3W15C 1YTVA 3AXFA 1FJ9A 4ESXA 4FEBA 1N3WA 2ZZWA 4RA1A 4OETA 4U4XA 4YICA 1XT8A 1NV7A 3OO8A 4NF6A 1URDA 1LAHE 3Q27A 4DZ1A 3RYDA 4RPOA 1EH3A 4GWOA 1SVXB 3BIGA 4N6KA 2Y7WA 3OXNA 5L9SA 1LEVA 5ET6A 2F36A 4O3AA 1D3KA 2A5SA 4QFOA 1DPPA 3KOSA 1B3GA 4PDHA 1INPA 3EPEA 4U4SA 2QS2A 1D9VA 2WYPA 4ZEIA 4KHZE 1FPFA 4G68C 3U65A 3MBPA 2WX9A 5TPAB 4RXLA 5JK4A 4OFJA 3PTYA 3EHTA 3IB0A 3T9HB 4DCYA 3RTWB 4HS7A 4PF6A 4LONB 3MP8A 5DEXB 3IOWA 2XWOA 3TQWA 4ISUA 1MQHA 3MP6A 1LBVA 3TCFA 4TQUQ 1MY2A 2VT5A 5JTYA 3H6WA 4EQBA 4I40A 4I8CA 3C32A 4NF8A 2UVIA 2RINA 1NNFA 4IY6A 1NL5A 1B2HA 2HXWA 1MM6A 1LFGA 2O1LA 3KN8A 3C36A 1NV3A 1MXUA 2F97A 4MFIA 1P1UA 3GLBA 5KDTB 2I3WA 4U1OA 3RLFE 4YAHX 4RJZA 4F22A 2QFLA 1PB9A 3SEVA 1MXXA 5BUUA 4KYSA 4GL8A 2F78A 1K9ZA 2DS9A 3M3FA 3FVOA 3CG3A 1LBCA 1JP4A 1DBZA 2OWSA 1B1HA 4MIJA 3N6UA 3BBRA 4NGUA 2A5TB 3CHGA 5K2XA 3K6UA 1AIVA 2I0BA 2I6EA 3C35A 3N5LA 1IMAA 1POY1 5CBSA 5DTBA 3VE1B 4ZEBA 3SKPA 4ZE9A 4PAFA 4PBHA 1FQEA 1FPGA 4OWDA 2CZIA 3EQ1A 1XVXA 2OK2A 4ZZAA 3CVGA 1MXZA 3RTFB 2DVCA 1M5CA 3Q26A 3FVNA 2QRYA 4N13A 3E4RA 4MNIA 1BK4A 4P1EA 2ABHA 3RPLA 1ZJLA 2FA7A 4U1ZA 5ITOA 2ZXTA 2GRVA 4L17A 3VXCA 4IO3A 2R6GE 2NUVA 2UYEA 1P1NA
chains in the Genus database with same CATH topology
1ATGA 4HTGA 3EN3A 4DCXA 1VE4A 3U92A 3DELB 4OYVA 2AYSA 2E1SA 4XIGQ 4YB6A 3KSJA 2P1SA 2VGQA 3OENA 1MXVA 1YCJA 3PMXA 3TTKA 2DQVA 5I2NB 2HQ0A 3JZJA 4QSEA 1MRPA 1ZTYA 5CRYA 3ZSFA 3MQ9A 2ZNUA 1EU8A 3IO4A 4JBZA 5HM4B 3CFLA 4F2QA 4KCDA 3JYRA 5I56A 1Y3NA 2ESNA 1US4A 4G4PA 1I6AA 3TTNA 3OO7A 3KEIA 2F6PA 4LUBA 1FQDA 2HFBA 4NF6B 3T9VA 1MS7A 2VHAA 2QS1A 3FV1A 3IOTA 1Y20A 2PBWA 3BFUA 1IIWA 4K3FA 1JQFA 2FYIA 2H25A 3RQTA 4ZDMA 4FAJA 4YMBA 4GOTA 4HCWA 4ZECA 3OSQA 2B3FA 2DE2A 4OERA 3IK6B 1B5JA 3GBAA 4RY1A 3SESA 4O3BA 4G77A 2VD2A 4ZEFA 5A5XB 4NF5A 4EF1A 3MVWA 1JW1A 3E13X 1Z7NE 2GH9A 2Z23A 3HSTA 2F5XA 1MY1A 1JVYA 3LSLA 1O63A 3R26A 4WEPA 2XX7A 1MDQA 1SYIA 4IY5A 1KWHA 5DEXA 4NF8B 4U23A 5CBRA 4F3GA 1MQJA 3FASA 2Q2CA 3TTRA 1UTHA 2H99A 4PE5B 2WKYA 5H8HB 4QSCA 3O6GA 4G68B 4F1YA 3EF7A 3B6TA 4KI0E 1NH8A 4OZ9A 3QAXA 3K00A 4FORA 5L9MA 3BKIB 4N6PA 3CRBA 1B3HA 3RT8A 3CFXA 5IAIA 3G3KA 1MG1A 2ZMBA 3S9EA 2UVGA 2Z8EA 4NEDA 4TLMB 2O7IA 1N7XA 3O97A 4OVJA 2NOOA 3L6HA 4MLQA 2ONRA 3VLUA 2A5TA 3KOTA 3OEKA 4LQ2A 2THIA 2G93A 4JWOA 2DWHA 2O6AA 3ILUB 4PETA 3ONMA 2OZZA 4JDFA 1P1QA 1OVTA 2ZYOA 1DTGA 1Y4TA 1PBQA 2PT1A 4MBPA 5CMCA 3OD7A 2V3QA 3M8UA 4H6DA 2DP8A 4U22A 1FCKA 1FTLA 2KLFA 3FUZA 1Y3QA 1JNFA 2DE3A 2ONKE 4LQ5A 3C9HA 1SW5A 5F7VA 4R6KA 2V3UA 4GIZA 1WDNA 2QSXA 3PD9A 2GHBA 4GL0A 5L9OA 4BLAA 3R7XA 5AA2B 3MVZA 3H6VA 3KN3A 2Q9TA 4C1UA 3A3CA 3TCHA 2NWJA 1UIVA 4C1TA 2XXPA 3BFTA 2DWIA 2UYFA 2DE4A 3KGCA 3V83A 3TQLA 2X7QA 3V89B 3H03A 1LB9A 3ILTB 1XC1A 3QYTA 1TFDA 2RC8A 3T93B 4PP0A 4THIA 3IX1A 4QHQA 3RNNA 3LBSA 3A3UA 3ECRA 4KR5A 3SEWA 4AB6A 2HEUA 3PUWE 1P1WA 4DXCA 5KCJB 2PYYA 3P7IA 1NNPA 4OEVA 4OEUA 3Q25A 4BDMA 1UIUA 3TMGA 1IXHA 3IR1A 3GBBA 1EZPA 1FQFA 5AA2D 1SW2A 1ANFA 1S50A 4E0WA 3DM0A 5ELVA 3MZBA 1USYE 4JSOA 2I4CA 4JXIA 4NF5B 1Y9UA 3IJXB 3SEXA 4I9DA 4IO2A 5K2YA 1B46A 1M5FA 3U93A 1A40A 3FXQA 3PD8A 5A5XA 3D4GA 2DXYA 3KJ7A 3MPLA 1FTMA 5DVFA 3VXBA 4H8IA 1R9LA 2X26A 4X9TA 3F11A 1RYXA 2OCUA 3K1MA 2XXUA 3SEYA 3E9XA 3T66A 1UTHB 2OWTA 1B52A 1FQCA 1URSA 1DPEA 4KFQA 2HZKA 3UIFA 3G3HA 2Q88A 2YLNA 1GVCA 5AA1A 1ZMGA 4G8HA 2B3BA 1B40A 5I2KB 5TP9B 5H8HA 4P11A 2H5YA 3FVGA 4QFNA 2HCAA 4G68A 2ANJA 2QS3A 4YB7A 4ZE8A 1LLSA 4DE8A 1MM7A 4R9FA 3QIMA 3I3VA 1NNKA 1FTOA 4ND9A 4R73A 3SETA 3K6VA 4AB5A 1UTBB 4EDPA 4BDNA 3H7MA 4QFLA 1RYOA 4R75A 4BDLA 3VVDA 1MQIA 3USDA 3MVXA 1H76A 1OVBA 4XKPA 4ZS9A 2O68A 2O7UA 4Q8RA 3TAJA 3RUMA 5F1QA 3LUYA 1A7LA 5DVIA 3PMWA 2DWAA 2O51A 1B1XA 3PUYE 1R9QA 5CI5A 2XX9A 3UK4A 5JEIA 3RGYA 4DLDA 3V8XB 4EUOA 1JEVA 3VVEA 3S9LC 1JVXA 3C31A 3DP4A 3FIRA 1OQHA 3QUFA 1B32A 3DP8A 1H44A 4U2RA 3LSXA 1B4ZA 2REJA 1N04A 3RN8A 1I69A 2AIXA 1HSEA 3PPNA 4OQOA 5CMKA 1B7UA 3FGSA 1B58A 3TYHA 4KD5A 2PVUA 1PDAA 2R9JA 3R6UA 3ZS6A 5FHOA 4F18A 4PFYA 4XKQA 1M5BA 1PB8A 3HN0A 1B4HA 5AA2A 1B0LA 3H06B 3B6QA 3UN6A 1R6ZA 2M8CA 3VV5A 1S9TA 1N7WA 2Y7RA 4F3BA 3MJNA 4FE8A 3KFMA 4QF9A 1DOTA 5DT6A 3VVFA 4OFLA 3FJMA 3O6HA 3MZ9A 3DP6A 3K1PA 1OLAA 1WVJA 4O3CA 2B65A 3U72A 3HCQA 3I6VA 1A55A 1TFAA 1USYH 5CMBA 4GRKA 1FQAA 4IO6A 1Y1MA 4H1XA 5KCJA 3PPRA 4IGRA 1YPNA 3W9WA 4NF4B 2CZLA 2FNCA 4Q0CA 2GFEA 2O84X 2F7BA 3S2VA 3Q29A 4NTLA 1MY4A 4ECFA 1VSOA 2XXXA 3MVYA 1RKMA 3VLVA 4ELPA 3S9NC 1PC3A 1B0HA 3K6WA 5I84A 3O2AA 4X48A 4P0GA 4QSDA 3I5OA 5AE4A 5B70A 4KQPA 3K4UA 4OESA 3T9XB 3VLWA 4MF3A 2XXVA 2ZYNA 3EHUA 3O66A 4KYDA 3G3JA 1JW4A 3OELA 4OMBA 4ELQA 4KPTA 1ZU0A 2E0SA 1QUIA 2UXAA 1SQYA 2H4IA 3TFLA 1IXIA 3CG1A 1IZ1A 1MH3A 4F1VA 3FD3A 1A99A 3K02A 2UVHA 2VD3A 4ELOA 3UP9A 4ONYA 5I2KA 4NE4A 5TP9A 1TXFA 2CMOA 4DDDA 4R72A 3MC2A 2Q8JA 5FTHA 4BDRA 4FECA 1BIYA 1DSNA 1M5DA 2F7AA 4H5FA 1O7TA 2O69A 4OHNA 1B51A 1P99A 1GV8A 1UTBA 1LGBC 3MWBA 4YZZA 1SI0A 2Y7PA 1US5A 2Z22A 4LZ5A 4TLLB 3MPKA 5H8SA 4YKIA 2Y7IA 4LZ7A 2RC7A 4F3PA 4X1DA 4PFWA 1EZOA 3W9VA 2XD3A 4BDOA 3O29A 2I49A 4IO7A 3U94A 2XXTA 3UGWA 4R9GA 1FTKA 4OFOA 4BDQA 1LB8A 5EYFA 3QSLA 1GTKA 1Y1ZA 3EHSA 2YJPA 2NXOA 1B7ZA 4M1VA 1IEJA 3PUXE 2DOJA 4ESWA 1B05A 3PU5A 4EXKA 4F2OA 2XXWA 1LAXA 2ZNTA 5LOMA 1OIBA 1IUDA 1BKAA 3HHFA 4FATA 5I58B 4NWCA 3RPWA 3E3KA 4OTEA 4U21A 4X1BA 4RYAA 4IO4A 4H65A 2D3IA 2XXYA 5AA4B 4R6HA 3JV9A 1ZLQA 4GLIA 4F1UA 1POTA 2OJTA 4YU0A 5EHMA 1Z7ME 1MH4A 3S4UA 2RC9A 1AMFA 4R2BA 3D4CA 5I59B 1QUKA 5H8NA 1H43A 3TCGA 1TWYA 3M3KA 2F8DA 4H5GA 2P2AA 4YMAA 2H98A 2VP1A 4G2ZA 4OENA 3H4ZA 4PQJA 3IOUA 3MAMA 3VDFA 2DWJA 3IB1A 3IL1B 4N07A 1CB6A 4YKJA 1FW0A 1B3FA 2XXQA 1LFIA 4EQ9A 1AOVA 2Z8FA 2V84A 4EF2A 1J1NA 2REGA 1A8EA 3PGFA 4RNSA 4NF4A 3KG2A 4DXBA 4IO5A 3HPIA 4R6YA 4F29A 1IXGA 1B6HA 1II5A 4JWYA 1UQWA 4E0XA 4EQ7A 3O28A 2F7CA 3KSXA 2DSFA 1B7HA 1O64A 1NKXA 4MH5A 1SW4A 1N0TA 1B5HA 3LR1A 1JETA 2XXIA 5TU0A 2QS4A 3OO6A 3C4MA 4G8NA 4XKNA 5EHSA 4LA9A 4I1DA 1AL3A 3HO7A 2W7YA 3N94A 1SD3A 1NFTA 4DIGA 1T0KA 3FATA 4ZZEA 3T9UA 1LCTA 5KZTA 1JW5A 4UACA 2XXHA 1OQGA 1XHYA 5HPQA 1VFDA 3CFZA 3K2DA 4GQOA 1LAFE 4GF8A 3ZKLA 3QUJA 3WAEA 4UA8A 4GXSB 4H8JA 1B3EA 1Q35A 2QL3A 3SERA 2DXRA 1OMPA 4GFRA 3RY3A 3TEPA 3H6UA 3U8QA 3O9PA 5ICTA 1D9YA 4YB5A 3MZ1A 3IORA 2VOZA 3LSWA 3S9MC 4FJPA 2Q89A 3CI8A 1MPCA 4GXAA 2R71A 1JEUA 1LSTA 2ZYMA 3G3FA 4G8MA 3CSGA 3FVKA 2XX8A 1I6QA 1FQBA 3GXAA 1L5TA 2ZNSA 1XS5A 1TT1A 3Q28A 3OEMA 1SYHA 4XTCQ 5IKBA 3FV2A 2RCBA 1N3XA 3B7DA 4ELRA 5H8QB 3MP1A 5AA3A 3ODBA 1WODA 2XXRA 4OXVA 3MUQA 1N76A 3T22A 2ONSA 3FZVA 5FHMA 3CIJA 1IXCA 1QULA 3GZGA 1QVSA 1D4NA 3IOVA 3DLNA 1SI1A 1QUJA 1MPDA 3FXUA 2RF1A 2OLBA 3SDFA 1LCFA 1H3DA 4FIMA 1VFEA 1URGA 4HCYA 3HHGA 3K01A 3TELA 2QMWA 2I4BA 1ELJA 5CC2A 1F9BA 2Q2AA 1ZIUA 3O6IA 2F35A 3TTMA 3M3LA 4JB7A 1A8FA 2I3VA 1A54A 5I58A 3PPQA 5ITPA 1NMUA 2D21A 4JWXA 2IA4A 3V5AA 2XHDA 1MXYA 4Z0IA 3HV1A 3TUSA 5H8NB 2IEEA 5AA4A 2NVUB 2DYXA 1B5IA 4YKPA 2V3TA 4WKMA 5H8FB 1QW0A 5L8DA 3G7WA 1PBPA 2F6GA 3N26A 3QXMA 1DMBA 3TTLA 2I0CA 4F19A 3H6TA 1N84A 3VFJA 4AQ4A 3PPOA 5I59A 4IGTA 4F3SA 4DXUA 3IAZA 3FJGA 3RT6B 1Q1KA 1HSJA 4FEDA 3G3IA 5B7DA 3KZGA 4RPNA 2UVJA 2D5WA 4EXLA 2ZYKA 1MY0A 3C33A 1IQ7A 5ISUA 3LC8A 4RK2A 1XVYA 3PMVA 4MLVA 5I57A 4GVOA 5BWJA 1MXWA 1NNTA 1R1NA 1Y4CA 4F31B 2F34A 3IJOB 3MW0A 3TZAA 5DVJA 2I48A 4XXUA 4C0RA 3UORA 1XOCA 2RKMA 4YKKA 2YPNA 5FTIA 3T96B 3UA8A 1MY3A 1PB7A 2H9BA 1HSLA 2DVZA 3KJTA 1AH5A 1LAGE 1S7YA 1QJMA 4H67A 5TPAA 1MDP1 4M4GA 1P1OA 5JTYB 4ZEKA 2PT2A 1EZ9A 3IO6A 2Y7KA 1MQGA 1BLFA 2I58A 4LATA 4P0IA 2OBGA 3IB2A 2RCAA 3OSRA 4NWDA 3PUZE 4R2FA 5CM6A 4Z7EA 3LSFB 4LZ8A 1NH7A 1MPBA 1SW1A 2ALUA 2PX1A 2V25A 1MQDA 3TDJA 4POXA 1IITA 3PV0E 2Y84A 1OLCA 2G29A 1LBBA 3KBRA 5CMMA 2O1MA 3PUVE 5KDTA 1H45A 3CSBA 3FJ7A 5ICQA 1SDXA 4H0WA 1ZKBA 4KCCA 3N6TA 2LAOA 4KYEA 5J1DA 2BJJX 3THIA 3G3GA 4HW8A 2XD2A 2Z8DA 1BP5A 3KN7A 1Y3PA 1SBPA 4QFKA 2HAUA 5H8QA 4GD5A 4QRZA 3OO9A 3H3GA 4PFTA 2P0SA 3U1OA 2QMXA 3K0VA 4Q30B 5M2VA 3K6XA 4NMYA 4WEDA 3CR9A 1ZBMA 5FHNA 3ZKKA 1GGGA 2HZLA 4F39A 1YAEA 1QKAA 3OMBA 4RK9A 1PEBA 1I6BA 3SEUA 2X7PA 2V93A 1QKBA 2AL4A 1BTJA 4I62A 4XKRA 4ZEDA 3A09A 1VR5A 3L6GA 4JSDA 1FTJA 5DYHA 1GR2A 3B6WA 3K1NA 2HAVA 2GHAA 3OOAA 2AL5A 4Q5TA 3C34A 3QK6A 5I2NA 1B3LA 1LFHA 5H8FA 1CE2A 5I56B 1DTZA 4LP2B 2QJEA 3TKDA 3TPAA 4WXJA 4R74A 4PFUA 4LVQA 2QPQA 3WAFA 2PMSA 3FXRA 3TODA 4TOZA 5HBCA 4QFPA 4POWA 1B9JA 5I57B 4IB2A 1M5EA 3PPPA 3W15C 1YTVA 3AXFA 4ESXA 4FEBA 1N3WA 4RA1A 4OETA 4U4XA 4YICA 1XT8A 3OO8A 4NF6A 1URDA 1LAHE 3Q27A 4DZ1A 4RPOA 1EH3A 4GWOA 1SVXB 2Y7WA 3OXNA 5L9SA 2F36A 4O3AA 1D3KA 2A5SA 4QFOA 1DPPA 3KOSA 1B3GA 3EPEA 4U4SA 2QS2A 1D9VA 4ZEIA 4KHZE 4G68C 3MBPA 5TPAB 5JK4A 4RXLA 4OFJA 3EHTA 3IB0A 3T9HB 4DCYA 3RTWB 4HS7A 4LONB 3MP8A 5DEXB 3IOWA 3TQWA 4ISUA 1MQHA 3MP6A 3TCFA 4TQUQ 1MY2A 5JTYA 3H6WA 4EQBA 4I8CA 3C32A 4NF8A 2UVIA 2RINA 1NNFA 4IY6A 1NL5A 1B2HA 2HXWA 1MM6A 1LFGA 2O1LA 3KN8A 3C36A 1MXUA 2F97A 4MFIA 1P1UA 3GLBA 5KDTB 2I3WA 4U1OA 3RLFE 4YAHX 4RJZA 4F22A 1PB9A 3SEVA 1MXXA 5BUUA 4KYSA 4GL8A 2F78A 2DS9A 3M3FA 3FVOA 3CG3A 1LBCA 2OWSA 1B1HA 3N6UA 3BBRA 2A5TB 5K2XA 3K6UA 1AIVA 2I0BA 2I6EA 3C35A 3N5LA 1POY1 5CBSA 5DTBA 3VE1B 4ZEBA 3SKPA 4ZE9A 1FQEA 4OWDA 3EQ1A 1XVXA 2OK2A 4ZZAA 3CVGA 1MXZA 3RTFB 2DVCA 1M5CA 3Q26A 3FVNA 2QRYA 4N13A 3E4RA 2ABHA 1ZJLA 2FA7A 4U1ZA 5ITOA 2ZXTA 2GRVA 4L17A 3VXCA 4IO3A 2R6GE 2NUVA 2UYEA 1P1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ATG A;  4HTG A;  3EN3 A;  4DCX A;  1VE4 A;  3U92 A;  3DEL B;  4OYV A;  2AYS A;  2E1S A;  4XIG Q;  4YB6 A;  3KSJ A;  2P1S A;  2VGQ A;  3OEN A;  1MXV A;  1YCJ A;  3PMX A;  3TTK A;  2DQV A;  5I2N B;  2HQ0 A;  3JZJ A;  4QSE A;  1MRP A;  1ZTY A;  5CRY A;  3ZSF A;  3MQ9 A;  2ZNU A;  1EU8 A;  3IO4 A;  4JBZ A;  5HM4 B;  3CFL A;  4F2Q A;  4KCD A;  3JYR A;  5I56 A;  1Y3N A;  2ESN A;  1US4 A;  4G4P A;  1I6A A;  3TTN A;  3OO7 A;  3KEI A;  2F6P A;  4LUB A;  1FQD A;  2HFB A;  4NF6 B;  3T9V A;  1MS7 A;  2VHA A;  2QS1 A;  3FV1 A;  3IOT A;  1Y20 A;  2PBW A;  3BFU A;  1IIW A;  4K3F A;  1JQF A;  2FYI A;  2H25 A;  3RQT A;  4ZDM A;  4FAJ A;  4YMB A;  4GOT A;  4HCW A;  4ZEC A;  3OSQ A;  2B3F A;  2DE2 A;  4OER A;  3IK6 B;  1B5J A;  3GBA A;  4RY1 A;  3SES A;  4O3B A;  4G77 A;  2VD2 A;  4ZEF A;  5A5X B;  4NF5 A;  4EF1 A;  3MVW A;  1JW1 A;  3E13 X;  1Z7N E;  2GH9 A;  2Z23 A;  3HST A;  2F5X A;  1MY1 A;  1JVY A;  3LSL A;  1O63 A;  3R26 A;  4WEP A;  2XX7 A;  1MDQ A;  1SYI A;  4IY5 A;  1KWH A;  5DEX A;  4NF8 B;  4U23 A;  5CBR A;  4F3G A;  1MQJ A;  3FAS A;  2Q2C A;  3TTR A;  1UTH A;  2H99 A;  4PE5 B;  2WKY A;  5H8H B;  4QSC A;  3O6G A;  4G68 B;  4F1Y A;  3EF7 A;  3B6T A;  4KI0 E;  1NH8 A;  4OZ9 A;  3QAX A;  3K00 A;  4FOR A;  5L9M A;  3BKI B;  4N6P A;  3CRB A;  1B3H A;  3RT8 A;  3CFX A;  5IAI A;  3G3K A;  1MG1 A;  2ZMB A;  3S9E A;  2UVG A;  2Z8E A;  4NED A;  4TLM B;  2O7I A;  1N7X A;  3O97 A;  4OVJ A;  2NOO A;  3L6H A;  4MLQ A;  2ONR A;  3VLU A;  2A5T A;  3KOT A;  3OEK A;  4LQ2 A;  2THI A;  2G93 A;  4JWO A;  2DWH A;  2O6A A;  3ILU B;  4PET A;  3ONM A;  2OZZ A;  4JDF A;  1P1Q A;  1OVT A;  2ZYO A;  1DTG A;  1Y4T A;  1PBQ A;  2PT1 A;  4MBP A;  5CMC A;  3OD7 A;  2V3Q A;  3M8U A;  4H6D A;  2DP8 A;  4U22 A;  1FCK A;  1FTL A;  2KLF A;  3FUZ A;  1Y3Q A;  1JNF A;  2DE3 A;  2ONK E;  4LQ5 A;  3C9H A;  1SW5 A;  5F7V A;  4R6K A;  2V3U A;  4GIZ A;  1WDN A;  2QSX A;  3PD9 A;  2GHB A;  4GL0 A;  5L9O A;  4BLA A;  3R7X A;  5AA2 B;  3MVZ A;  3H6V A;  3KN3 A;  2Q9T A;  4C1U A;  3A3C A;  3TCH A;  2NWJ A;  1UIV A;  4C1T A;  2XXP A;  3BFT A;  2DWI A;  2UYF A;  2DE4 A;  3KGC A;  3V83 A;  3TQL A;  2X7Q A;  3V89 B;  3H03 A;  1LB9 A;  3ILT B;  1XC1 A;  3QYT A;  1TFD A;  2RC8 A;  3T93 B;  4PP0 A;  4THI A;  3IX1 A;  4QHQ A;  3RNN A;  3LBS A;  3A3U A;  3ECR A;  4KR5 A;  3SEW A;  4AB6 A;  2HEU A;  3PUW E;  1P1W A;  4DXC A;  5KCJ B;  2PYY A;  3P7I A;  1NNP A;  4OEV A;  4OEU A;  3Q25 A;  4BDM A;  1UIU A;  3TMG A;  1IXH A;  3IR1 A;  3GBB A;  1EZP A;  1FQF A;  5AA2 D;  1SW2 A;  1ANF A;  1S50 A;  4E0W A;  3DM0 A;  5ELV A;  3MZB A;  1USY E;  4JSO A;  2I4C A;  4JXI A;  4NF5 B;  1Y9U A;  3IJX B;  3SEX A;  4I9D A;  4IO2 A;  5K2Y A;  1B46 A;  1M5F A;  3U93 A;  1A40 A;  3FXQ A;  3PD8 A;  5A5X A;  3D4G A;  2DXY A;  3KJ7 A;  3MPL A;  1FTM A;  5DVF A;  3VXB A;  4H8I A;  1R9L A;  2X26 A;  4X9T A;  3F11 A;  1RYX A;  2OCU A;  3K1M A;  2XXU A;  3SEY A;  3E9X A;  3T66 A;  1UTH B;  2OWT A;  1B52 A;  1FQC A;  1URS A;  1DPE A;  4KFQ A;  2HZK A;  3UIF A;  3G3H A;  2Q88 A;  2YLN A;  1GVC A;  5AA1 A;  1ZMG A;  4G8H A;  2B3B A;  1B40 A;  5I2K B;  5TP9 B;  5H8H A;  4P11 A;  2H5Y A;  3FVG A;  4QFN A;  2HCA A;  4G68 A;  2ANJ A;  2QS3 A;  4YB7 A;  4ZE8 A;  1LLS A;  4DE8 A;  1MM7 A;  4R9F A;  3QIM A;  3I3V A;  1NNK A;  1FTO A;  4ND9 A;  4R73 A;  3SET A;  3K6V A;  4AB5 A;  1UTB B;  4EDP A;  4BDN A;  3H7M A;  4QFL A;  1RYO A;  4R75 A;  4BDL A;  3VVD A;  1MQI A;  3USD A;  3MVX A;  1H76 A;  1OVB A;  4XKP A;  4ZS9 A;  2O68 A;  2O7U A;  4Q8R A;  3TAJ A;  3RUM A;  5F1Q A;  3LUY A;  1A7L A;  5DVI A;  3PMW A;  2DWA A;  2O51 A;  1B1X A;  3PUY E;  1R9Q A;  5CI5 A;  2XX9 A;  3UK4 A;  5JEI A;  3RGY A;  4DLD A;  3V8X B;  4EUO A;  1JEV A;  3VVE A;  3S9L C;  1JVX A;  3C31 A;  3DP4 A;  3FIR A;  1OQH A;  3QUF A;  1B32 A;  3DP8 A;  1H44 A;  4U2R A;  3LSX A;  1B4Z A;  2REJ A;  1N04 A;  3RN8 A;  1I69 A;  2AIX A;  1HSE A;  3PPN A;  4OQO A;  5CMK A;  1B7U A;  3FGS A;  1B58 A;  3TYH A;  4KD5 A;  2PVU A;  1PDA A;  2R9J A;  3R6U A;  3ZS6 A;  5FHO A;  4F18 A;  4PFY A;  4XKQ A;  1M5B A;  1PB8 A;  3HN0 A;  1B4H A;  5AA2 A;  1B0L A;  3H06 B;  3B6Q A;  3UN6 A;  1R6Z A;  2M8C A;  3VV5 A;  1S9T A;  1N7W A;  2Y7R A;  4F3B A;  3MJN A;  4FE8 A;  3KFM A;  4QF9 A;  1DOT A;  5DT6 A;  3VVF A;  4OFL A;  3FJM A;  3O6H A;  3MZ9 A;  3DP6 A;  3K1P A;  1OLA A;  1WVJ A;  4O3C A;  2B65 A;  3U72 A;  3HCQ A;  3I6V A;  1A55 A;  1TFA A;  1USY H;  5CMB A;  4GRK A;  1FQA A;  4IO6 A;  1Y1M A;  4H1X A;  5KCJ A;  3PPR A;  4IGR A;  1YPN A;  3W9W A;  4NF4 B;  2CZL A;  2FNC A;  4Q0C A;  2GFE A;  2O84 X;  2F7B A;  3S2V A;  3Q29 A;  4NTL A;  1MY4 A;  4ECF A;  1VSO A;  2XXX A;  3MVY A;  1RKM A;  3VLV A;  4ELP A;  3S9N C;  1PC3 A;  1B0H A;  3K6W A;  5I84 A;  3O2A A;  4X48 A;  4P0G A;  4QSD A;  3I5O A;  5AE4 A;  5B70 A;  4KQP A;  3K4U A;  4OES A;  3T9X B;  3VLW A;  4MF3 A;  2XXV A;  2ZYN A;  3EHU A;  3O66 A;  4KYD A;  3G3J A;  1JW4 A;  3OEL A;  4OMB A;  4ELQ A;  4KPT A;  1ZU0 A;  2E0S A;  1QUI A;  2UXA A;  1SQY A;  2H4I A;  3TFL A;  1IXI A;  3CG1 A;  1IZ1 A;  1MH3 A;  4F1V A;  3FD3 A;  1A99 A;  3K02 A;  2UVH A;  2VD3 A;  4ELO A;  3UP9 A;  4ONY A;  5I2K A;  4NE4 A;  5TP9 A;  1TXF A;  2CMO A;  4DDD A;  4R72 A;  3MC2 A;  2Q8J A;  5FTH A;  4BDR A;  4FEC A;  1BIY A;  1DSN A;  1M5D A;  2F7A A;  4H5F A;  1O7T A;  2O69 A;  4OHN A;  1B51 A;  1P99 A;  1GV8 A;  1UTB A;  1LGB C;  3MWB A;  4YZZ A;  1SI0 A;  2Y7P A;  1US5 A;  2Z22 A;  4LZ5 A;  4TLL B;  3MPK A;  5H8S A;  4YKI A;  2Y7I A;  4LZ7 A;  2RC7 A;  4F3P A;  4X1D A;  4PFW A;  1EZO A;  3W9V A;  2XD3 A;  4BDO A;  3O29 A;  2I49 A;  4IO7 A;  3U94 A;  2XXT A;  3UGW A;  4R9G A;  1FTK A;  4OFO A;  4BDQ A;  1LB8 A;  5EYF A;  3QSL A;  1GTK A;  1Y1Z A;  3EHS A;  2YJP A;  2NXO A;  1B7Z A;  4M1V A;  1IEJ A;  3PUX E;  2DOJ A;  4ESW A;  1B05 A;  3PU5 A;  4EXK A;  4F2O A;  2XXW A;  1LAX A;  2ZNT A;  5LOM A;  1OIB A;  1IUD A;  1BKA A;  3HHF A;  4FAT A;  5I58 B;  4NWC A;  3RPW A;  3E3K A;  4OTE A;  4U21 A;  4X1B A;  4RYA A;  4IO4 A;  4H65 A;  2D3I A;  2XXY A;  5AA4 B;  4R6H A;  3JV9 A;  1ZLQ A;  4GLI A;  4F1U A;  1POT A;  2OJT A;  4YU0 A;  5EHM A;  1Z7M E;  1MH4 A;  3S4U A;  2RC9 A;  1AMF A;  4R2B A;  3D4C A;  5I59 B;  1QUK A;  5H8N A;  1H43 A;  3TCG A;  1TWY A;  3M3K A;  2F8D A;  4H5G A;  2P2A A;  4YMA A;  2H98 A;  2VP1 A;  4G2Z A;  4OEN A;  3H4Z A;  4PQJ A;  3IOU A;  3MAM A;  3VDF A;  2DWJ A;  3IB1 A;  3IL1 B;  4N07 A;  1CB6 A;  4YKJ A;  1FW0 A;  1B3F A;  2XXQ A;  1LFI A;  4EQ9 A;  1AOV A;  2Z8F A;  2V84 A;  4EF2 A;  1J1N A;  2REG A;  1A8E A;  3PGF A;  4RNS A;  4NF4 A;  3KG2 A;  4DXB A;  4IO5 A;  3HPI A;  4R6Y A;  4F29 A;  1IXG A;  1B6H A;  1II5 A;  4JWY A;  1UQW A;  4E0X A;  4EQ7 A;  3O28 A;  2F7C A;  3KSX A;  2DSF A;  1B7H A;  1O64 A;  1NKX A;  4MH5 A;  1SW4 A;  1N0T A;  1B5H A;  3LR1 A;  1JET A;  2XXI A;  5TU0 A;  2QS4 A;  3OO6 A;  3C4M A;  4G8N A;  4XKN A;  5EHS A;  4LA9 A;  4I1D A;  1AL3 A;  3HO7 A;  2W7Y A;  3N94 A;  1SD3 A;  1NFT A;  4DIG A;  1T0K A;  3FAT A;  4ZZE A;  3T9U A;  1LCT A;  5KZT A;  1JW5 A;  4UAC A;  2XXH A;  1OQG A;  1XHY A;  5HPQ A;  1VFD A;  3CFZ A;  3K2D A;  4GQO A;  1LAF E;  4GF8 A;  3ZKL A;  3QUJ A;  3WAE A;  4UA8 A;  4GXS B;  4H8J A;  1B3E A;  1Q35 A;  2QL3 A;  3SER A;  2DXR A;  1OMP A;  4GFR A;  3RY3 A;  3TEP A;  3H6U A;  3U8Q A;  3O9P A;  5ICT A;  1D9Y A;  4YB5 A;  3MZ1 A;  3IOR A;  2VOZ A;  3LSW A;  3S9M C;  4FJP A;  2Q89 A;  3CI8 A;  1MPC A;  4GXA A;  2R71 A;  1JEU A;  1LST A;  2ZYM A;  3G3F A;  4G8M A;  3CSG A;  3FVK A;  2XX8 A;  1I6Q A;  1FQB A;  3GXA A;  1L5T A;  2ZNS A;  1XS5 A;  1TT1 A;  3Q28 A;  3OEM A;  1SYH A;  4XTC Q;  5IKB A;  3FV2 A;  2RCB A;  1N3X A;  3B7D A;  4ELR A;  5H8Q B;  3MP1 A;  5AA3 A;  3ODB A;  1WOD A;  2XXR A;  4OXV A;  3MUQ A;  1N76 A;  3T22 A;  2ONS A;  3FZV A;  5FHM A;  3CIJ A;  1IXC A;  1QUL A;  3GZG A;  1QVS A;  1D4N A;  3IOV A;  3DLN A;  1SI1 A;  1QUJ A;  1MPD A;  3FXU A;  2RF1 A;  2OLB A;  3SDF A;  1LCF A;  1H3D A;  4FIM A;  1VFE A;  1URG A;  4HCY A;  3HHG A;  3K01 A;  3TEL A;  2QMW A;  2I4B A;  1ELJ A;  5CC2 A;  1F9B A;  2Q2A A;  1ZIU A;  3O6I A;  2F35 A;  3TTM A;  3M3L A;  4JB7 A;  1A8F A;  2I3V A;  1A54 A;  5I58 A;  3PPQ A;  5ITP A;  1NMU A;  2D21 A;  4JWX A;  2IA4 A;  3V5A A;  2XHD A;  1MXY A;  4Z0I A;  3HV1 A;  3TUS A;  5H8N B;  2IEE A;  5AA4 A;  2NVU B;  2DYX A;  1B5I A;  4YKP A;  2V3T A;  4WKM A;  5H8F B;  1QW0 A;  5L8D A;  3G7W A;  1PBP A;  2F6G A;  3N26 A;  3QXM A;  1DMB A;  3TTL A;  2I0C A;  4F19 A;  3H6T A;  1N84 A;  3VFJ A;  4AQ4 A;  3PPO A;  5I59 A;  4IGT A;  4F3S A;  4DXU A;  3IAZ A;  3FJG A;  3RT6 B;  1Q1K A;  1HSJ A;  4FED A;  3G3I A;  5B7D A;  3KZG A;  4RPN A;  2UVJ A;  2D5W A;  4EXL A;  2ZYK A;  1MY0 A;  3C33 A;  1IQ7 A;  5ISU A;  3LC8 A;  4RK2 A;  1XVY A;  3PMV A;  4MLV A;  5I57 A;  4GVO A;  5BWJ A;  1MXW A;  1NNT A;  1R1N A;  1Y4C A;  4F31 B;  2F34 A;  3IJO B;  3MW0 A;  3TZA A;  5DVJ A;  2I48 A;  4XXU A;  4C0R A;  3UOR A;  1XOC A;  2RKM A;  4YKK A;  2YPN A;  5FTI A;  3T96 B;  3UA8 A;  1MY3 A;  1PB7 A;  2H9B A;  1HSL A;  2DVZ A;  3KJT A;  1AH5 A;  1LAG E;  1S7Y A;  1QJM A;  4H67 A;  5TPA A;  1MDP 1;  4M4G A;  1P1O A;  5JTY B;  4ZEK A;  2PT2 A;  1EZ9 A;  3IO6 A;  2Y7K A;  1MQG A;  1BLF A;  2I58 A;  4LAT A;  4P0I A;  2OBG A;  3IB2 A;  2RCA A;  3OSR A;  4NWD A;  3PUZ E;  4R2F A;  5CM6 A;  4Z7E A;  3LSF B;  4LZ8 A;  1NH7 A;  1MPB A;  1SW1 A;  2ALU A;  2PX1 A;  2V25 A;  1MQD A;  3TDJ A;  4POX A;  1IIT A;  3PV0 E;  2Y84 A;  1OLC A;  2G29 A;  1LBB A;  3KBR A;  5CMM A;  2O1M A;  3PUV E;  5KDT A;  1H45 A;  3CSB A;  3FJ7 A;  5ICQ A;  1SDX A;  4H0W A;  1ZKB A;  4KCC A;  3N6T A;  2LAO A;  4KYE A;  5J1D A;  2BJJ X;  3THI A;  3G3G A;  4HW8 A;  2XD2 A;  2Z8D A;  1BP5 A;  3KN7 A;  1Y3P A;  1SBP A;  4QFK A;  2HAU A;  5H8Q A;  4GD5 A;  4QRZ A;  3OO9 A;  3H3G A;  4PFT A;  2P0S A;  3U1O A;  2QMX A;  3K0V A;  4Q30 B;  5M2V A;  3K6X A;  4NMY A;  4WED A;  3CR9 A;  1ZBM A;  5FHN A;  3ZKK A;  1GGG A;  2HZL A;  4F39 A;  1YAE A;  1QKA A;  3OMB A;  4RK9 A;  1PEB A;  1I6B A;  3SEU A;  2X7P A;  2V93 A;  1QKB A;  2AL4 A;  1BTJ A;  4I62 A;  4XKR A;  4ZED A;  3A09 A;  1VR5 A;  3L6G A;  4JSD A;  1FTJ A;  5DYH A;  1GR2 A;  3B6W A;  3K1N A;  2HAV A;  2GHA A;  3OOA A;  2AL5 A;  4Q5T A;  3C34 A;  3QK6 A;  5I2N A;  1B3L A;  1LFH A;  5H8F A;  1CE2 A;  5I56 B;  1DTZ A;  4LP2 B;  2QJE A;  3TKD A;  3TPA A;  4WXJ A;  4R74 A;  4PFU A;  4LVQ A;  2QPQ A;  3WAF A;  2PMS A;  3FXR A;  3TOD A;  4TOZ A;  5HBC A;  4QFP A;  4POW A;  1B9J A;  5I57 B;  4IB2 A;  1M5E A;  3PPP A;  3W15 C;  1YTV A;  3AXF A;  4ESX A;  4FEB A;  1N3W A;  4RA1 A;  4OET A;  4U4X A;  4YIC A;  1XT8 A;  3OO8 A;  4NF6 A;  1URD A;  1LAH E;  3Q27 A;  4DZ1 A;  4RPO A;  1EH3 A;  4GWO A;  1SVX B;  2Y7W A;  3OXN A;  5L9S A;  2F36 A;  4O3A A;  1D3K A;  2A5S A;  4QFO A;  1DPP A;  3KOS A;  1B3G A;  3EPE A;  4U4S A;  2QS2 A;  1D9V A;  4ZEI A;  4KHZ E;  4G68 C;  3MBP A;  5TPA B;  5JK4 A;  4RXL A;  4OFJ A;  3EHT A;  3IB0 A;  3T9H B;  4DCY A;  3RTW B;  4HS7 A;  4LON B;  3MP8 A;  5DEX B;  3IOW A;  3TQW A;  4ISU A;  1MQH A;  3MP6 A;  3TCF A;  4TQU Q;  1MY2 A;  5JTY A;  3H6W A;  4EQB A;  4I8C A;  3C32 A;  4NF8 A;  2UVI A;  2RIN A;  1NNF A;  4IY6 A;  1NL5 A;  1B2H A;  2HXW A;  1MM6 A;  1LFG A;  2O1L A;  3KN8 A;  3C36 A;  1MXU A;  2F97 A;  4MFI A;  1P1U A;  3GLB A;  5KDT B;  2I3W A;  4U1O A;  3RLF E;  4YAH X;  4RJZ A;  4F22 A;  1PB9 A;  3SEV A;  1MXX A;  5BUU A;  4KYS A;  4GL8 A;  2F78 A;  2DS9 A;  3M3F A;  3FVO A;  3CG3 A;  1LBC A;  2OWS A;  1B1H A;  3N6U A;  3BBR A;  2A5T B;  5K2X A;  3K6U A;  1AIV A;  2I0B A;  2I6E A;  3C35 A;  3N5L A;  1POY 1;  5CBS A;  5DTB A;  3VE1 B;  4ZEB A;  3SKP A;  4ZE9 A;  1FQE A;  4OWD A;  3EQ1 A;  1XVX A;  2OK2 A;  4ZZA A;  3CVG A;  1MXZ A;  3RTF B;  2DVC A;  1M5C A;  3Q26 A;  3FVN A;  2QRY A;  4N13 A;  3E4R A;  2ABH A;  1ZJL A;  2FA7 A;  4U1Z A;  5ITO A;  2ZXT A;  2GRV A;  4L17 A;  3VXC A;  4IO3 A;  2R6G E;  2NUV A;  2UYE A;  1P1N A; 
#chains in the Genus database with same CATH topology
 1ATG A;  1SPI A;  4HTG A;  1G0H A;  3EN3 A;  4DCX A;  1VE4 A;  4PTK A;  3U92 A;  3DEL B;  1NV1 A;  4OYV A;  2AYS A;  2E1S A;  4XIG Q;  4YB6 A;  3KSJ A;  4GBW A;  2P1S A;  2VGQ A;  3OEN A;  1MXV A;  1YCJ A;  3PMX A;  3TTK A;  4P56 A;  2DQV A;  5I2N B;  2HQ0 A;  3JZJ A;  2WYK A;  4QSE A;  1MRP A;  4P9K A;  1ZTY A;  5CRY A;  3ZSF A;  4PCD A;  3MQ9 A;  2ZNU A;  1EU8 A;  3IO4 A;  4JBZ A;  1AWB A;  5HM4 B;  3CFL A;  4F2Q A;  4KCD A;  3JYR A;  5I56 A;  1Y3N A;  2ESN A;  1US4 A;  2FIE A;  3KC1 A;  4G4P A;  3T1B A;  1I6A A;  4IR8 A;  4MAG A;  3TTN A;  3OO7 A;  3KEI A;  1RDX A;  2F6P A;  4LUB A;  1FQD A;  2HFB A;  4NF6 B;  3T9V A;  1MS7 A;  3IFC A;  2VHA A;  1LBY A;  2QS1 A;  2V4C A;  4HE0 A;  3FV1 A;  5ET8 A;  3IOT A;  1Y20 A;  2PBW A;  5F24 A;  3BFU A;  4GX3 A;  1IIW A;  4K3F A;  1JQF A;  2FYI A;  2H25 A;  3RQT A;  4ZDM A;  4FAJ A;  1Q9D A;  4YMB A;  1NUZ A;  5IZZ A;  4GOT A;  4HCW A;  4ZEC A;  3OSQ A;  2B3F A;  5I5P A;  4GWY A;  2DE2 A;  4OER A;  3ROJ A;  3IK6 B;  1B5J A;  3GBA A;  4RY1 A;  3SES A;  4O3B A;  4G77 A;  2QVU A;  2VD2 A;  4ZEF A;  5A5X B;  4NF5 A;  4EF1 A;  4MCO A;  3MVW A;  1JW1 A;  1LBW A;  3E13 X;  1Z7N E;  2GH9 A;  2R8T A;  2Z23 A;  3HST A;  2F5X A;  1MY1 A;  1JVY A;  3LSL A;  3LV0 A;  1O63 A;  4PDD A;  3R26 A;  4WEP A;  2XX7 A;  1MDQ A;  1SYI A;  3B8B A;  2XXK A;  4IY5 A;  1KWH A;  5DEX A;  4NF8 B;  4U23 A;  4N8G A;  5CBR A;  4F3G A;  1MQJ A;  4OA4 A;  3FAS A;  2Q2C A;  3TTR A;  1UTH A;  2H99 A;  2Y5L A;  4PE5 B;  2WKY A;  5H8H B;  4QSC A;  3O6G A;  4G68 B;  5IGA A;  1FPD A;  4F1Y A;  3EF7 A;  3B6T A;  4KI0 E;  1NH8 A;  2WBD A;  4OZ9 A;  1IMF A;  2QVR A;  3QAX A;  3K00 A;  4FOR A;  5L9M A;  3BKI B;  3D1R A;  4N6P A;  3CRB A;  1B3H A;  3RT8 A;  3CFX A;  4N17 A;  5IAI A;  3G3K A;  1MG1 A;  2ZMB A;  4PFR A;  5FBP A;  3S9E A;  2UVG A;  2Z8E A;  4NED A;  4TLM B;  3SZP A;  2O7I A;  1KA0 A;  1N7X A;  2KQZ A;  3O97 A;  4OVJ A;  2NOO A;  3B50 A;  3L6H A;  4MLQ A;  2ONR A;  3E78 A;  3VLU A;  2A5T A;  3KOT A;  3OEK A;  4LQ2 A;  2THI A;  2G93 A;  4JWO A;  2DWH A;  4N4U A;  2O6A A;  3ILU B;  4PET A;  2VPN A;  1NV6 A;  3ONM A;  2OZZ A;  4JDF A;  1P1Q A;  1OVT A;  2ZYO A;  1DTG A;  1Y4T A;  1PBQ A;  2PT1 A;  4MBP A;  5CMC A;  3OD7 A;  2V3Q A;  3M8U A;  4H6D A;  2DP8 A;  4U22 A;  3E79 A;  1FCK A;  1FTL A;  2KLF A;  3FUZ A;  1Y3Q A;  1EYI A;  3HFU A;  1JNF A;  2DE3 A;  2ONK E;  4LQ5 A;  3C9H A;  1SW5 A;  5F7V A;  4R6K A;  1IME A;  2V3U A;  1NV4 A;  4GIZ A;  1NUW A;  1WDN A;  2QSX A;  3PD9 A;  1NV0 A;  2GHB A;  4GL0 A;  5L9O A;  4BLA A;  3R7X A;  5AA2 B;  3MVZ A;  3H6V A;  3KN3 A;  2Q9T A;  4C1U A;  1IMB A;  3A3C A;  4NG7 A;  3TCH A;  2NWJ A;  1UIV A;  4C1T A;  2XXP A;  3BFT A;  2DWI A;  2UYF A;  2DE4 A;  3KGC A;  3V83 A;  2WBB A;  3TQL A;  2X7Q A;  2OWZ A;  3H03 A;  3V89 B;  1LB9 A;  3ILT B;  1XC1 A;  3QYT A;  1TFD A;  2DDK A;  2RC8 A;  3T93 B;  4PP0 A;  4THI A;  3IX1 A;  4NQ8 A;  4QHQ A;  3RNN A;  3ISP A;  3LBS A;  3A3U A;  3ECR A;  4KR5 A;  3SEW A;  4AB6 A;  4O8M A;  2HEU A;  3PUW E;  1P1W A;  4XF5 A;  4DXC A;  5KCJ B;  2PYY A;  1FPI A;  3P7I A;  1NNP A;  4OEV A;  4OEU A;  3Q25 A;  4BDM A;  2Q74 A;  1UIU A;  3TMG A;  1IXH A;  3IR1 A;  3GBB A;  1EZP A;  1FQF A;  5AA2 D;  1SW2 A;  1ANF A;  2QVV A;  1S50 A;  4E0W A;  3DM0 A;  5ELV A;  3MZB A;  1USY E;  4JSO A;  1FBF A;  2I4C A;  4JXI A;  4NF5 B;  2XWK A;  3FXB A;  1Y9U A;  3IJX B;  3SEX A;  4I9D A;  4IO2 A;  5K2Y A;  1B46 A;  1M5F A;  3U93 A;  1A40 A;  3FXQ A;  3PD8 A;  5A5X A;  3D4G A;  2DXY A;  3KJ7 A;  3MPL A;  1FTM A;  5DVF A;  3VXB A;  4H8I A;  1R9L A;  2X26 A;  4X9T A;  3F11 A;  1RYX A;  2OCU A;  3K1M A;  2XXU A;  3SEY A;  3E9X A;  3T66 A;  1UTH B;  2OWT A;  1B52 A;  1FQC A;  1URS A;  1DPE A;  4KFQ A;  4P3L A;  5A5L A;  2HZK A;  3UIF A;  3G3H A;  2Q88 A;  2YLN A;  4GX4 A;  1GVC A;  5AA1 A;  1ZMG A;  4G8H A;  2B3B A;  1B40 A;  5I2K B;  3A29 A;  5TP9 B;  5H8H A;  4P11 A;  2H5Y A;  3FVG A;  4H46 A;  4QFN A;  2HCA A;  4G68 A;  2ANJ A;  2QS3 A;  4YB7 A;  4ZE8 A;  1LLS A;  4DE8 A;  1MM7 A;  4R9F A;  3QIM A;  3I3V A;  1NNK A;  1FTO A;  4ND9 A;  1FBG A;  4R73 A;  4PC9 A;  3SET A;  3K6V A;  4AB5 A;  1UTB B;  4EDP A;  4BDN A;  3H7M A;  4QFL A;  1RYO A;  4R75 A;  2XWV A;  4BDL A;  3VVD A;  1MQI A;  1IMD A;  3USD A;  3MVX A;  1H76 A;  1OVB A;  4XKP A;  4ZS9 A;  2O68 A;  2O7U A;  4Q8R A;  2HXR A;  3TAJ A;  3RUM A;  5F1Q A;  3LUY A;  1A7L A;  5DVI A;  3PMW A;  2DWA A;  2O51 A;  1B1X A;  3PUY E;  1R9Q A;  5CI5 A;  2CEY A;  2XX9 A;  3UK4 A;  5JEI A;  3RGY A;  4DLD A;  3V8X B;  4EUO A;  1JEV A;  3VVE A;  3S9L C;  1JVX A;  3C31 A;  3DP4 A;  3FIR A;  1OQH A;  4GWW A;  2CZK A;  3QUF A;  1B32 A;  3DP8 A;  2KR0 A;  1H44 A;  4U2R A;  1NI9 A;  3LSX A;  3EKI A;  1B4Z A;  2REJ A;  1N04 A;  3RN8 A;  1I69 A;  2AIX A;  1HSE A;  3PPN A;  4OQO A;  4OVQ A;  4P47 A;  5CMK A;  5LTC A;  1B7U A;  3FGS A;  1B58 A;  3TYH A;  4KD5 A;  2PVU A;  5DW8 A;  1PDA A;  5EYH A;  2R9J A;  3R6U A;  1VDW A;  1EYJ A;  4NF0 A;  3ZS6 A;  5FHO A;  4F18 A;  1XI6 A;  1LBZ A;  4PFY A;  4XKQ A;  1M5B A;  1PB8 A;  3HN0 A;  1B4H A;  5AA2 A;  1B0L A;  3H06 B;  3B6Q A;  3UN6 A;  1R6Z A;  2M8C A;  2Q8M A;  2XWI A;  3VV5 A;  1RDY A;  4PAI A;  1S9T A;  5EQA A;  1N7W A;  2Y7R A;  1DK4 A;  4MNC A;  4F3B A;  3MJN A;  4FE8 A;  3KFM A;  4QF9 A;  1DOT A;  5DT6 A;  3GYY A;  3LUZ A;  3VVF A;  4OFL A;  3FJM A;  3O6H A;  3MZ9 A;  3DP6 A;  3K1P A;  1OLA A;  1WVJ A;  4O3C A;  4MEV A;  2B65 A;  3U72 A;  3HCQ A;  4NHB A;  4N15 A;  3I6V A;  1A55 A;  1TFA A;  1USY H;  5CMB A;  4GRK A;  1FBC A;  1FQA A;  4IO6 A;  1Y1M A;  4H1X A;  5KCJ A;  3PPR A;  4IGR A;  1YPN A;  3W9W A;  4HE1 A;  4NF4 B;  2CZL A;  2FNC A;  4Q0C A;  1K9Y A;  2GFE A;  2O84 X;  2F7B A;  4MMP A;  3S2V A;  3Q29 A;  4NTL A;  1MY4 A;  1FPB A;  4ECF A;  1VSO A;  2XXX A;  3MVY A;  1RKM A;  2VPO A;  3VLV A;  4N91 A;  4QBA A;  4XFE A;  4GWZ A;  4ELP A;  3S9N C;  1PC3 A;  1B0H A;  3K6W A;  5I84 A;  5IZ1 A;  3O2A A;  4X48 A;  4P0G A;  1NV5 A;  4QSD A;  3I5O A;  5AE4 A;  5B70 A;  4KQP A;  3K4U A;  4OES A;  3T9X B;  3VLW A;  4MF3 A;  2XXV A;  4PGP A;  2ZYN A;  3EHU A;  3O66 A;  4KYD A;  3G3J A;  1JW4 A;  3OEL A;  4OMB A;  4ELQ A;  2FHY A;  4KPT A;  1ZU0 A;  1D9Q A;  4N6D A;  2E0S A;  1QUI A;  2GQ1 A;  2UXA A;  1QGX A;  1SQY A;  2H4I A;  3BIH A;  3TFL A;  1IXI A;  1RDZ A;  3CG1 A;  1IZ1 A;  1MH3 A;  4F1V A;  3FD3 A;  1A99 A;  3K02 A;  2UVH A;  2WEF A;  2VD3 A;  4ELO A;  3UP9 A;  4ONY A;  5I2K A;  4NE4 A;  4MJO A;  4OVR A;  5TP9 A;  1TXF A;  2CMO A;  4DDD A;  4R72 A;  3MC2 A;  2Q8J A;  5FTH A;  4BDR A;  4FEC A;  1BIY A;  1DSN A;  1M5D A;  4FBP A;  2F7A A;  3QMF A;  4H5F A;  1FTA A;  1O7T A;  2O69 A;  4OHN A;  1B51 A;  1P99 A;  1GV8 A;  1UTB A;  3FBP A;  1LGB C;  3MWB A;  4YZZ A;  1SI0 A;  2Y7P A;  1US5 A;  4MHF A;  2Z22 A;  4JVI A;  4LZ5 A;  3MPK A;  4TLL B;  5H8S A;  1KA1 A;  4YKI A;  2Y7I A;  4LZ7 A;  2RC7 A;  4F3P A;  4X1D A;  4P1L A;  4PFW A;  1EZO A;  3W9V A;  2XD3 A;  4BDO A;  3O29 A;  2I49 A;  4IO7 A;  1YXI A;  3U94 A;  2XXT A;  3UGW A;  1FBP A;  4X8R A;  4R9G A;  1FTK A;  4OFO A;  4BDQ A;  1LB8 A;  5EYF A;  3QSL A;  1GTK A;  1Y1Z A;  3EHS A;  2YJP A;  2NXO A;  4GWX A;  1B7Z A;  4M1V A;  1IEJ A;  3PUX E;  2DOJ A;  4ESW A;  1B05 A;  3PU5 A;  4EXK A;  4F2O A;  2XXW A;  1LAX A;  2ZNT A;  2FIX A;  5LOM A;  1OIB A;  1IUD A;  1BKA A;  3HHF A;  4FAT A;  5I58 B;  5I3S A;  4NWC A;  3RPW A;  3E3K A;  4OTE A;  4U21 A;  2F3B A;  5LDZ A;  4X1B A;  4RYA A;  4PE3 A;  5I7I A;  2PFZ A;  4IO4 A;  4H65 A;  2D3I A;  2XXY A;  5AA4 B;  4R6H A;  3JV9 A;  4MX6 A;  1ZLQ A;  2F3D A;  4GLI A;  4F1U A;  1POT A;  2OJT A;  4YU0 A;  5EHM A;  1Z7M E;  1MH4 A;  2PFY A;  3S4U A;  2RC9 A;  1AMF A;  4R2B A;  3D4C A;  5I59 B;  4NN3 A;  1QUK A;  5H8N A;  1H43 A;  4PFI A;  3TCG A;  1TWY A;  3M3K A;  4OVT A;  2F8D A;  4H5G A;  5ET5 A;  2P2A A;  4YMA A;  2H98 A;  2VP1 A;  4G2Z A;  4OEN A;  3H4Z A;  4PQJ A;  3IOU A;  3MAM A;  3VDF A;  2DWJ A;  3IB1 A;  3IL1 B;  4N07 A;  1CB6 A;  4YKJ A;  1FW0 A;  1B3F A;  2XXQ A;  1LFI A;  4EQ9 A;  1NV2 A;  3NOH A;  1AOV A;  2Z8F A;  2V84 A;  1IMC A;  4EF2 A;  1J1N A;  2REG A;  1A8E A;  3PGF A;  4RNS A;  4NF4 A;  3KG2 A;  4DXB A;  4IO5 A;  3HPI A;  4R6Y A;  4F29 A;  1IXG A;  1B6H A;  1II5 A;  4JWY A;  1UQW A;  4E0X A;  4GX6 A;  4EQ7 A;  3O28 A;  2F7C A;  4JVD A;  3KSX A;  5ET7 A;  2DSF A;  1B7H A;  1O64 A;  4LN5 A;  1NKX A;  4MH5 A;  1SW4 A;  1N0T A;  1B5H A;  3LR1 A;  1JET A;  2OX3 A;  2XXI A;  3T0J A;  5TU0 A;  2QS4 A;  3OO6 A;  3C4M A;  4G8N A;  1FBD A;  4XKN A;  5EHS A;  4LA9 A;  4I1D A;  1AL3 A;  3HO7 A;  4I3E A;  2W7Y A;  3N94 A;  1FPK A;  1SD3 A;  1NFT A;  4DIG A;  1KZ8 A;  1T0K A;  3FAT A;  4ZZE A;  3T9U A;  4KXP A;  1LCT A;  5KZT A;  1JW5 A;  4UAC A;  2XXH A;  1OQG A;  1XHY A;  5HPQ A;  3MYU A;  1VFD A;  3CFZ A;  3K2D A;  4GQO A;  1LAF E;  2CZH A;  4GF8 A;  3ZKL A;  3QUJ A;  3WAE A;  4UA8 A;  4GXS B;  4H8J A;  1B3E A;  1Q35 A;  2QL3 A;  3SER A;  2DXR A;  1FSA A;  1OMP A;  4GFR A;  3RY3 A;  3TEP A;  3H6U A;  3U8Q A;  3O9P A;  5ICT A;  1D9Y A;  4YB5 A;  3MZ1 A;  4AS5 A;  1FPE A;  3IOR A;  2VOZ A;  3LSW A;  3S9M C;  4FJP A;  2Q89 A;  1DCU A;  3CI8 A;  1MPC A;  4GXA A;  2R71 A;  1JEU A;  1LST A;  2ZYM A;  3G3F A;  4G8M A;  3CSG A;  3FVK A;  2XX8 A;  1I6Q A;  1FQB A;  3GXA A;  4HE2 A;  2Y5K A;  1L5T A;  2ZNS A;  1XS5 A;  1TT1 A;  3Q28 A;  3OEM A;  1SYH A;  4XTC Q;  5IKB A;  2L5V A;  2FVZ A;  3FV2 A;  2RCB A;  1N3X A;  3B7D A;  4ELR A;  5H8Q B;  3MP1 A;  3ODB A;  5AA3 A;  1WOD A;  2XXR A;  4OXV A;  3MUQ A;  1N76 A;  3T22 A;  2ONS A;  3FZV A;  5FHM A;  3CIJ A;  1IXC A;  1QUL A;  4DI4 B;  1LBX A;  3GZG A;  1QVS A;  1D4N A;  3IOV A;  3DLN A;  1SI1 A;  1QUJ A;  4O7M A;  5IZ3 B;  1MPD A;  3FXU A;  2RF1 A;  2OLB A;  3SDF A;  1LCF A;  1H3D A;  4FIM A;  1VFE A;  1URG A;  4HCY A;  4O94 A;  3HHG A;  3K01 A;  2B4L A;  3TEL A;  2QMW A;  2I4B A;  3KC0 A;  1ELJ A;  4OVS A;  5CC2 A;  1F9B A;  2Q2A A;  4AS4 A;  4HXV A;  1ZIU A;  3O6I A;  2F35 A;  3TTM A;  5EQ7 A;  3M3L A;  4JB7 A;  1A8F A;  2I3V A;  1A54 A;  5I58 A;  3PPQ A;  5ITP A;  1FRP A;  1NMU A;  2D21 A;  4JWX A;  4DI3 D;  2IA4 A;  3V5A A;  2XHD A;  1MXY A;  4Z0I A;  3HV1 A;  3TUS A;  5H8N B;  2IEE A;  5AA4 A;  2NVU B;  2DYX A;  1B5I A;  4YKP A;  2V3T A;  4WKM A;  5H8F B;  1QW0 A;  5L8D A;  3G7W A;  1PBP A;  2F6G A;  3N26 A;  3QXM A;  2BJI A;  1DMB A;  3TTL A;  2I0C A;  4F19 A;  3H6T A;  1N84 A;  3VFJ A;  1NUX A;  4AQ4 A;  3PPO A;  5I59 A;  4IGT A;  4F3S A;  1FJ6 A;  2P3N A;  2XA5 A;  4DXU A;  3IAZ A;  3FJG A;  3RT6 B;  1Q1K A;  1HSJ A;  4FED A;  3G3I A;  5B7D A;  3KZG A;  4MNP A;  4RPN A;  2UVJ A;  2D5W A;  4EXL A;  2ZYK A;  1MY0 A;  3C33 A;  1FBH A;  1IQ7 A;  4G61 A;  5ISU A;  2ZZX A;  3LC8 A;  4RK2 A;  1XVY A;  3KBZ A;  3PMV A;  4MLV A;  5I57 A;  4GVO A;  5BWJ A;  1MXW A;  1NNT A;  1R1N A;  4NAP A;  1Y4C A;  4F31 B;  2F34 A;  3IJO B;  5J16 A;  3MW0 A;  3TZA A;  1EYK A;  5DVJ A;  2B4M A;  2I48 A;  1FPL A;  4XXU A;  4C0R A;  3UOR A;  4UAB A;  4OVP A;  4X04 A;  1XOC A;  3MST A;  2P3V A;  2RKM A;  2ZZV A;  4YKK A;  2YPN A;  5FTI A;  3T96 B;  1G0I A;  3UA8 A;  1MY3 A;  1PB7 A;  2H9B A;  5EQ9 A;  1HSL A;  2DVZ A;  4PAK A;  3KJT A;  1AH5 A;  1LAG E;  1S7Y A;  1QJM A;  4H67 A;  5TPA A;  4NX1 A;  1MDP 1;  5IM2 A;  4M4G A;  1P1O A;  5JTY B;  4ZEK A;  2PT2 A;  1EZ9 A;  3IO6 A;  2Y7K A;  1MQG A;  1BLF A;  2I58 A;  2JJK A;  4P0I A;  4LAT A;  2OBG A;  3IB2 A;  2RCA A;  4GBV A;  3OSR A;  4NWD A;  3PUZ E;  4R2F A;  4PGN A;  5CM6 A;  4Z7E A;  3LSF B;  4LZ8 A;  1NH7 A;  1MPB A;  5EQ8 A;  1SW1 A;  2ALU A;  2PX1 A;  2V25 A;  1MQD A;  3TDJ A;  2CEX A;  4POX A;  1IIT A;  3PV0 E;  1YYZ A;  2Y84 A;  1CNQ A;  1OLC A;  2G29 A;  1LBB A;  3KBR A;  5CMM A;  4XEQ A;  2O1M A;  3PUV E;  5EYG A;  5KDT A;  1H45 A;  3CSB A;  3FJ7 A;  5ICQ A;  2FBP A;  1SDX A;  4H0W A;  1ZKB A;  4KCC A;  3N6T A;  2LAO A;  4KYE A;  1NUY A;  5J1D A;  2BJJ X;  3THI A;  3G3G A;  1YZ0 A;  4HW8 A;  3IFA A;  2XD2 A;  2Z8D A;  1BP5 A;  3KN7 A;  1Y3P A;  1SBP A;  4QFK A;  2HAU A;  5H8Q A;  4GD5 A;  4QRZ A;  3OO9 A;  2HHM A;  3H3G A;  4PFT A;  4PF8 A;  4GWU A;  4GWS A;  2P0S A;  3U1O A;  2QMX A;  3K0V A;  5ESY A;  4Q30 B;  5M2V A;  4OAN A;  3K6X A;  4NMY A;  2HPG A;  1FPJ A;  4WED A;  3RPL B;  4QXD A;  3CR9 A;  1ZBM A;  5FHN A;  4N81 A;  5IZ3 A;  2PCR A;  3ZKK A;  4JVC A;  1GGG A;  2HZL A;  4F39 A;  4PBQ A;  1YAE A;  1QKA A;  3OMB A;  4I3Y A;  4RK9 A;  1PEB A;  1I6B A;  3SEU A;  2X7P A;  2V93 A;  4N8Y A;  1QKB A;  2AL4 A;  1BTJ A;  4I62 A;  4XKR A;  4ZED A;  3A09 A;  2MKZ A;  1VR5 A;  3L6G A;  4JSD A;  4H45 A;  1FTJ A;  5T3J A;  5DYH A;  1GR2 A;  3B6W A;  3K1N A;  2HAV A;  2GHA A;  3OOA A;  4O7I A;  2AL5 A;  4Q5T A;  3C34 A;  3QK6 A;  5I2N A;  1B3L A;  1LFH A;  5H8F A;  1CE2 A;  4P8B A;  5I56 B;  1DTZ A;  4LP2 B;  2QJE A;  3TKD A;  3TPA A;  4PFB A;  4WXJ A;  4R74 A;  4PFU A;  4LVQ A;  2QPQ A;  3WAF A;  2PMS A;  3FXR A;  3TOD A;  4TOZ A;  5HBC A;  1FBE A;  4QFP A;  4POW A;  1B9J A;  5I57 B;  4IB2 A;  1M5E A;  3PPP A;  3W15 C;  1YTV A;  3AXF A;  1FJ9 A;  4ESX A;  4FEB A;  1N3W A;  2ZZW A;  4RA1 A;  4OET A;  4U4X A;  4YIC A;  1XT8 A;  1NV7 A;  3OO8 A;  4NF6 A;  1URD A;  1LAH E;  3Q27 A;  4DZ1 A;  3RYD A;  4RPO A;  1EH3 A;  4GWO A;  1SVX B;  3BIG A;  4N6K A;  2Y7W A;  3OXN A;  5L9S A;  1LEV A;  5ET6 A;  2F36 A;  4O3A A;  1D3K A;  2A5S A;  4QFO A;  1DPP A;  3KOS A;  1B3G A;  4PDH A;  1INP A;  3EPE A;  4U4S A;  2QS2 A;  1D9V A;  2WYP A;  4ZEI A;  4KHZ E;  1FPF A;  4G68 C;  3U65 A;  3MBP A;  2WX9 A;  5TPA B;  4RXL A;  5JK4 A;  4OFJ A;  3PTY A;  3EHT A;  3IB0 A;  3T9H B;  4DCY A;  3RTW B;  4HS7 A;  4PF6 A;  4LON B;  3MP8 A;  5DEX B;  3IOW A;  2XWO A;  3TQW A;  4ISU A;  1MQH A;  3MP6 A;  1LBV A;  3TCF A;  4TQU Q;  1MY2 A;  2VT5 A;  5JTY A;  3H6W A;  4EQB A;  4I40 A;  4I8C A;  3C32 A;  4NF8 A;  2UVI A;  2RIN A;  1NNF A;  4IY6 A;  1NL5 A;  1B2H A;  2HXW A;  1MM6 A;  1LFG A;  2O1L A;  3KN8 A;  3C36 A;  1NV3 A;  1MXU A;  2F97 A;  4MFI A;  1P1U A;  3GLB A;  5KDT B;  2I3W A;  4U1O A;  3RLF E;  4YAH X;  4RJZ A;  4F22 A;  2QFL A;  1PB9 A;  3SEV A;  1MXX A;  5BUU A;  4KYS A;  4GL8 A;  2F78 A;  1K9Z A;  2DS9 A;  3M3F A;  3FVO A;  3CG3 A;  1LBC A;  1JP4 A;  1DBZ A;  2OWS A;  1B1H A;  4MIJ A;  3N6U A;  3BBR A;  4NGU A;  2A5T B;  3CHG A;  5K2X A;  3K6U A;  1AIV A;  2I0B A;  2I6E A;  3C35 A;  3N5L A;  1IMA A;  1POY 1;  5CBS A;  5DTB A;  3VE1 B;  4ZEB A;  3SKP A;  4ZE9 A;  4PAF A;  4PBH A;  1FQE A;  1FPG A;  4OWD A;  2CZI A;  3EQ1 A;  1XVX A;  2OK2 A;  4ZZA A;  3CVG A;  1MXZ A;  3RTF B;  2DVC A;  1M5C A;  3Q26 A;  3FVN A;  2QRY A;  4N13 A;  3E4R A;  4MNI A;  1BK4 A;  4P1E A;  2ABH A;  3RPL A;  1ZJL A;  2FA7 A;  4U1Z A;  5ITO A;  2ZXT A;  2GRV A;  4L17 A;  3VXC A;  4IO3 A;  2R6G E;  2NUV A;  2UYE A;  1P1N A; 
#chains in the Genus database with same CATH homology
 1ATG A;  4HTG A;  3EN3 A;  4DCX A;  1VE4 A;  3U92 A;  3DEL B;  4OYV A;  2AYS A;  2E1S A;  4XIG Q;  4YB6 A;  3KSJ A;  2P1S A;  2VGQ A;  3OEN A;  1MXV A;  1YCJ A;  3PMX A;  3TTK A;  2DQV A;  5I2N B;  2HQ0 A;  3JZJ A;  4QSE A;  1MRP A;  1ZTY A;  5CRY A;  3ZSF A;  3MQ9 A;  2ZNU A;  1EU8 A;  3IO4 A;  4JBZ A;  5HM4 B;  3CFL A;  4F2Q A;  4KCD A;  3JYR A;  5I56 A;  1Y3N A;  2ESN A;  1US4 A;  4G4P A;  1I6A A;  3TTN A;  3OO7 A;  3KEI A;  2F6P A;  4LUB A;  1FQD A;  2HFB A;  4NF6 B;  3T9V A;  1MS7 A;  2VHA A;  2QS1 A;  3FV1 A;  3IOT A;  1Y20 A;  2PBW A;  3BFU A;  1IIW A;  4K3F A;  1JQF A;  2FYI A;  2H25 A;  3RQT A;  4ZDM A;  4FAJ A;  4YMB A;  4GOT A;  4HCW A;  4ZEC A;  3OSQ A;  2B3F A;  2DE2 A;  4OER A;  3IK6 B;  1B5J A;  3GBA A;  4RY1 A;  3SES A;  4O3B A;  4G77 A;  2VD2 A;  4ZEF A;  5A5X B;  4NF5 A;  4EF1 A;  3MVW A;  1JW1 A;  3E13 X;  1Z7N E;  2GH9 A;  2Z23 A;  3HST A;  2F5X A;  1MY1 A;  1JVY A;  3LSL A;  1O63 A;  3R26 A;  4WEP A;  2XX7 A;  1MDQ A;  1SYI A;  4IY5 A;  1KWH A;  5DEX A;  4NF8 B;  4U23 A;  5CBR A;  4F3G A;  1MQJ A;  3FAS A;  2Q2C A;  3TTR A;  1UTH A;  2H99 A;  4PE5 B;  2WKY A;  5H8H B;  4QSC A;  3O6G A;  4G68 B;  4F1Y A;  3EF7 A;  3B6T A;  4KI0 E;  1NH8 A;  4OZ9 A;  3QAX A;  3K00 A;  4FOR A;  5L9M A;  3BKI B;  4N6P A;  3CRB A;  1B3H A;  3RT8 A;  3CFX A;  5IAI A;  3G3K A;  1MG1 A;  2ZMB A;  3S9E A;  2UVG A;  2Z8E A;  4NED A;  4TLM B;  2O7I A;  1N7X A;  3O97 A;  4OVJ A;  2NOO A;  3L6H A;  4MLQ A;  2ONR A;  3VLU A;  2A5T A;  3KOT A;  3OEK A;  4LQ2 A;  2THI A;  2G93 A;  4JWO A;  2DWH A;  2O6A A;  3ILU B;  4PET A;  3ONM A;  2OZZ A;  4JDF A;  1P1Q A;  1OVT A;  2ZYO A;  1DTG A;  1Y4T A;  1PBQ A;  2PT1 A;  4MBP A;  5CMC A;  3OD7 A;  2V3Q A;  3M8U A;  4H6D A;  2DP8 A;  4U22 A;  1FCK A;  1FTL A;  2KLF A;  3FUZ A;  1Y3Q A;  1JNF A;  2DE3 A;  2ONK E;  4LQ5 A;  3C9H A;  1SW5 A;  5F7V A;  4R6K A;  2V3U A;  4GIZ A;  1WDN A;  2QSX A;  3PD9 A;  2GHB A;  4GL0 A;  5L9O A;  4BLA A;  3R7X A;  5AA2 B;  3MVZ A;  3H6V A;  3KN3 A;  2Q9T A;  4C1U A;  3A3C A;  3TCH A;  2NWJ A;  1UIV A;  4C1T A;  2XXP A;  3BFT A;  2DWI A;  2UYF A;  2DE4 A;  3KGC A;  3V83 A;  3TQL A;  2X7Q A;  3V89 B;  3H03 A;  1LB9 A;  3ILT B;  1XC1 A;  3QYT A;  1TFD A;  2RC8 A;  3T93 B;  4PP0 A;  4THI A;  3IX1 A;  4QHQ A;  3RNN A;  3LBS A;  3A3U A;  3ECR A;  4KR5 A;  3SEW A;  4AB6 A;  2HEU A;  3PUW E;  1P1W A;  4DXC A;  5KCJ B;  2PYY A;  3P7I A;  1NNP A;  4OEV A;  4OEU A;  3Q25 A;  4BDM A;  1UIU A;  3TMG A;  1IXH A;  3IR1 A;  3GBB A;  1EZP A;  1FQF A;  5AA2 D;  1SW2 A;  1ANF A;  1S50 A;  4E0W A;  3DM0 A;  5ELV A;  3MZB A;  1USY E;  4JSO A;  2I4C A;  4JXI A;  4NF5 B;  1Y9U A;  3IJX B;  3SEX A;  4I9D A;  4IO2 A;  5K2Y A;  1B46 A;  1M5F A;  3U93 A;  1A40 A;  3FXQ A;  3PD8 A;  5A5X A;  3D4G A;  2DXY A;  3KJ7 A;  3MPL A;  1FTM A;  5DVF A;  3VXB A;  4H8I A;  1R9L A;  2X26 A;  4X9T A;  3F11 A;  1RYX A;  2OCU A;  3K1M A;  2XXU A;  3SEY A;  3E9X A;  3T66 A;  1UTH B;  2OWT A;  1B52 A;  1FQC A;  1URS A;  1DPE A;  4KFQ A;  2HZK A;  3UIF A;  3G3H A;  2Q88 A;  2YLN A;  1GVC A;  5AA1 A;  1ZMG A;  4G8H A;  2B3B A;  1B40 A;  5I2K B;  5TP9 B;  5H8H A;  4P11 A;  2H5Y A;  3FVG A;  4QFN A;  2HCA A;  4G68 A;  2ANJ A;  2QS3 A;  4YB7 A;  4ZE8 A;  1LLS A;  4DE8 A;  1MM7 A;  4R9F A;  3QIM A;  3I3V A;  1NNK A;  1FTO A;  4ND9 A;  4R73 A;  3SET A;  3K6V A;  4AB5 A;  1UTB B;  4EDP A;  4BDN A;  3H7M A;  4QFL A;  1RYO A;  4R75 A;  4BDL A;  3VVD A;  1MQI A;  3USD A;  3MVX A;  1H76 A;  1OVB A;  4XKP A;  4ZS9 A;  2O68 A;  2O7U A;  4Q8R A;  3TAJ A;  3RUM A;  5F1Q A;  3LUY A;  1A7L A;  5DVI A;  3PMW A;  2DWA A;  2O51 A;  1B1X A;  3PUY E;  1R9Q A;  5CI5 A;  2XX9 A;  3UK4 A;  5JEI A;  3RGY A;  4DLD A;  3V8X B;  4EUO A;  1JEV A;  3VVE A;  3S9L C;  1JVX A;  3C31 A;  3DP4 A;  3FIR A;  1OQH A;  3QUF A;  1B32 A;  3DP8 A;  1H44 A;  4U2R A;  3LSX A;  1B4Z A;  2REJ A;  1N04 A;  3RN8 A;  1I69 A;  2AIX A;  1HSE A;  3PPN A;  4OQO A;  5CMK A;  1B7U A;  3FGS A;  1B58 A;  3TYH A;  4KD5 A;  2PVU A;  1PDA A;  2R9J A;  3R6U A;  3ZS6 A;  5FHO A;  4F18 A;  4PFY A;  4XKQ A;  1M5B A;  1PB8 A;  3HN0 A;  1B4H A;  5AA2 A;  1B0L A;  3H06 B;  3B6Q A;  3UN6 A;  1R6Z A;  2M8C A;  3VV5 A;  1S9T A;  1N7W A;  2Y7R A;  4F3B A;  3MJN A;  4FE8 A;  3KFM A;  4QF9 A;  1DOT A;  5DT6 A;  3VVF A;  4OFL A;  3FJM A;  3O6H A;  3MZ9 A;  3DP6 A;  3K1P A;  1OLA A;  1WVJ A;  4O3C A;  2B65 A;  3U72 A;  3HCQ A;  3I6V A;  1A55 A;  1TFA A;  1USY H;  5CMB A;  4GRK A;  1FQA A;  4IO6 A;  1Y1M A;  4H1X A;  5KCJ A;  3PPR A;  4IGR A;  1YPN A;  3W9W A;  4NF4 B;  2CZL A;  2FNC A;  4Q0C A;  2GFE A;  2O84 X;  2F7B A;  3S2V A;  3Q29 A;  4NTL A;  1MY4 A;  4ECF A;  1VSO A;  2XXX A;  3MVY A;  1RKM A;  3VLV A;  4ELP A;  3S9N C;  1PC3 A;  1B0H A;  3K6W A;  5I84 A;  3O2A A;  4X48 A;  4P0G A;  4QSD A;  3I5O A;  5AE4 A;  5B70 A;  4KQP A;  3K4U A;  4OES A;  3T9X B;  3VLW A;  4MF3 A;  2XXV A;  2ZYN A;  3EHU A;  3O66 A;  4KYD A;  3G3J A;  1JW4 A;  3OEL A;  4OMB A;  4ELQ A;  4KPT A;  1ZU0 A;  2E0S A;  1QUI A;  2UXA A;  1SQY A;  2H4I A;  3TFL A;  1IXI A;  3CG1 A;  1IZ1 A;  1MH3 A;  4F1V A;  3FD3 A;  1A99 A;  3K02 A;  2UVH A;  2VD3 A;  4ELO A;  3UP9 A;  4ONY A;  5I2K A;  4NE4 A;  5TP9 A;  1TXF A;  2CMO A;  4DDD A;  4R72 A;  3MC2 A;  2Q8J A;  5FTH A;  4BDR A;  4FEC A;  1BIY A;  1DSN A;  1M5D A;  2F7A A;  4H5F A;  1O7T A;  2O69 A;  4OHN A;  1B51 A;  1P99 A;  1GV8 A;  1UTB A;  1LGB C;  3MWB A;  4YZZ A;  1SI0 A;  2Y7P A;  1US5 A;  2Z22 A;  4LZ5 A;  4TLL B;  3MPK A;  5H8S A;  4YKI A;  2Y7I A;  4LZ7 A;  2RC7 A;  4F3P A;  4X1D A;  4PFW A;  1EZO A;  3W9V A;  2XD3 A;  4BDO A;  3O29 A;  2I49 A;  4IO7 A;  3U94 A;  2XXT A;  3UGW A;  4R9G A;  1FTK A;  4OFO A;  4BDQ A;  1LB8 A;  5EYF A;  3QSL A;  1GTK A;  1Y1Z A;  3EHS A;  2YJP A;  2NXO A;  1B7Z A;  4M1V A;  1IEJ A;  3PUX E;  2DOJ A;  4ESW A;  1B05 A;  3PU5 A;  4EXK A;  4F2O A;  2XXW A;  1LAX A;  2ZNT A;  5LOM A;  1OIB A;  1IUD A;  1BKA A;  3HHF A;  4FAT A;  5I58 B;  4NWC A;  3RPW A;  3E3K A;  4OTE A;  4U21 A;  4X1B A;  4RYA A;  4IO4 A;  4H65 A;  2D3I A;  2XXY A;  5AA4 B;  4R6H A;  3JV9 A;  1ZLQ A;  4GLI A;  4F1U A;  1POT A;  2OJT A;  4YU0 A;  5EHM A;  1Z7M E;  1MH4 A;  3S4U A;  2RC9 A;  1AMF A;  4R2B A;  3D4C A;  5I59 B;  1QUK A;  5H8N A;  1H43 A;  3TCG A;  1TWY A;  3M3K A;  2F8D A;  4H5G A;  2P2A A;  4YMA A;  2H98 A;  2VP1 A;  4G2Z A;  4OEN A;  3H4Z A;  4PQJ A;  3IOU A;  3MAM A;  3VDF A;  2DWJ A;  3IB1 A;  3IL1 B;  4N07 A;  1CB6 A;  4YKJ A;  1FW0 A;  1B3F A;  2XXQ A;  1LFI A;  4EQ9 A;  1AOV A;  2Z8F A;  2V84 A;  4EF2 A;  1J1N A;  2REG A;  1A8E A;  3PGF A;  4RNS A;  4NF4 A;  3KG2 A;  4DXB A;  4IO5 A;  3HPI A;  4R6Y A;  4F29 A;  1IXG A;  1B6H A;  1II5 A;  4JWY A;  1UQW A;  4E0X A;  4EQ7 A;  3O28 A;  2F7C A;  3KSX A;  2DSF A;  1B7H A;  1O64 A;  1NKX A;  4MH5 A;  1SW4 A;  1N0T A;  1B5H A;  3LR1 A;  1JET A;  2XXI A;  5TU0 A;  2QS4 A;  3OO6 A;  3C4M A;  4G8N A;  4XKN A;  5EHS A;  4LA9 A;  4I1D A;  1AL3 A;  3HO7 A;  2W7Y A;  3N94 A;  1SD3 A;  1NFT A;  4DIG A;  1T0K A;  3FAT A;  4ZZE A;  3T9U A;  1LCT A;  5KZT A;  1JW5 A;  4UAC A;  2XXH A;  1OQG A;  1XHY A;  5HPQ A;  1VFD A;  3CFZ A;  3K2D A;  4GQO A;  1LAF E;  4GF8 A;  3ZKL A;  3QUJ A;  3WAE A;  4UA8 A;  4GXS B;  4H8J A;  1B3E A;  1Q35 A;  2QL3 A;  3SER A;  2DXR A;  1OMP A;  4GFR A;  3RY3 A;  3TEP A;  3H6U A;  3U8Q A;  3O9P A;  5ICT A;  1D9Y A;  4YB5 A;  3MZ1 A;  3IOR A;  2VOZ A;  3LSW A;  3S9M C;  4FJP A;  2Q89 A;  3CI8 A;  1MPC A;  4GXA A;  2R71 A;  1JEU A;  1LST A;  2ZYM A;  3G3F A;  4G8M A;  3CSG A;  3FVK A;  2XX8 A;  1I6Q A;  1FQB A;  3GXA A;  1L5T A;  2ZNS A;  1XS5 A;  1TT1 A;  3Q28 A;  3OEM A;  1SYH A;  4XTC Q;  5IKB A;  3FV2 A;  2RCB A;  1N3X A;  3B7D A;  4ELR A;  5H8Q B;  3MP1 A;  5AA3 A;  3ODB A;  1WOD A;  2XXR A;  4OXV A;  3MUQ A;  1N76 A;  3T22 A;  2ONS A;  3FZV A;  5FHM A;  3CIJ A;  1IXC A;  1QUL A;  3GZG A;  1QVS A;  1D4N A;  3IOV A;  3DLN A;  1SI1 A;  1QUJ A;  1MPD A;  3FXU A;  2RF1 A;  2OLB A;  3SDF A;  1LCF A;  1H3D A;  4FIM A;  1VFE A;  1URG A;  4HCY A;  3HHG A;  3K01 A;  3TEL A;  2QMW A;  2I4B A;  1ELJ A;  5CC2 A;  1F9B A;  2Q2A A;  1ZIU A;  3O6I A;  2F35 A;  3TTM A;  3M3L A;  4JB7 A;  1A8F A;  2I3V A;  1A54 A;  5I58 A;  3PPQ A;  5ITP A;  1NMU A;  2D21 A;  4JWX A;  2IA4 A;  3V5A A;  2XHD A;  1MXY A;  4Z0I A;  3HV1 A;  3TUS A;  5H8N B;  2IEE A;  5AA4 A;  2NVU B;  2DYX A;  1B5I A;  4YKP A;  2V3T A;  4WKM A;  5H8F B;  1QW0 A;  5L8D A;  3G7W A;  1PBP A;  2F6G A;  3N26 A;  3QXM A;  1DMB A;  3TTL A;  2I0C A;  4F19 A;  3H6T A;  1N84 A;  3VFJ A;  4AQ4 A;  3PPO A;  5I59 A;  4IGT A;  4F3S A;  4DXU A;  3IAZ A;  3FJG A;  3RT6 B;  1Q1K A;  1HSJ A;  4FED A;  3G3I A;  5B7D A;  3KZG A;  4RPN A;  2UVJ A;  2D5W A;  4EXL A;  2ZYK A;  1MY0 A;  3C33 A;  1IQ7 A;  5ISU A;  3LC8 A;  4RK2 A;  1XVY A;  3PMV A;  4MLV A;  5I57 A;  4GVO A;  5BWJ A;  1MXW A;  1NNT A;  1R1N A;  1Y4C A;  4F31 B;  2F34 A;  3IJO B;  3MW0 A;  3TZA A;  5DVJ A;  2I48 A;  4XXU A;  4C0R A;  3UOR A;  1XOC A;  2RKM A;  4YKK A;  2YPN A;  5FTI A;  3T96 B;  3UA8 A;  1MY3 A;  1PB7 A;  2H9B A;  1HSL A;  2DVZ A;  3KJT A;  1AH5 A;  1LAG E;  1S7Y A;  1QJM A;  4H67 A;  5TPA A;  1MDP 1;  4M4G A;  1P1O A;  5JTY B;  4ZEK A;  2PT2 A;  1EZ9 A;  3IO6 A;  2Y7K A;  1MQG A;  1BLF A;  2I58 A;  4LAT A;  4P0I A;  2OBG A;  3IB2 A;  2RCA A;  3OSR A;  4NWD A;  3PUZ E;  4R2F A;  5CM6 A;  4Z7E A;  3LSF B;  4LZ8 A;  1NH7 A;  1MPB A;  1SW1 A;  2ALU A;  2PX1 A;  2V25 A;  1MQD A;  3TDJ A;  4POX A;  1IIT A;  3PV0 E;  2Y84 A;  1OLC A;  2G29 A;  1LBB A;  3KBR A;  5CMM A;  2O1M A;  3PUV E;  5KDT A;  1H45 A;  3CSB A;  3FJ7 A;  5ICQ A;  1SDX A;  4H0W A;  1ZKB A;  4KCC A;  3N6T A;  2LAO A;  4KYE A;  5J1D A;  2BJJ X;  3THI A;  3G3G A;  4HW8 A;  2XD2 A;  2Z8D A;  1BP5 A;  3KN7 A;  1Y3P A;  1SBP A;  4QFK A;  2HAU A;  5H8Q A;  4GD5 A;  4QRZ A;  3OO9 A;  3H3G A;  4PFT A;  2P0S A;  3U1O A;  2QMX A;  3K0V A;  4Q30 B;  5M2V A;  3K6X A;  4NMY A;  4WED A;  3CR9 A;  1ZBM A;  5FHN A;  3ZKK A;  1GGG A;  2HZL A;  4F39 A;  1YAE A;  1QKA A;  3OMB A;  4RK9 A;  1PEB A;  1I6B A;  3SEU A;  2X7P A;  2V93 A;  1QKB A;  2AL4 A;  1BTJ A;  4I62 A;  4XKR A;  4ZED A;  3A09 A;  1VR5 A;  3L6G A;  4JSD A;  1FTJ A;  5DYH A;  1GR2 A;  3B6W A;  3K1N A;  2HAV A;  2GHA A;  3OOA A;  2AL5 A;  4Q5T A;  3C34 A;  3QK6 A;  5I2N A;  1B3L A;  1LFH A;  5H8F A;  1CE2 A;  5I56 B;  1DTZ A;  4LP2 B;  2QJE A;  3TKD A;  3TPA A;  4WXJ A;  4R74 A;  4PFU A;  4LVQ A;  2QPQ A;  3WAF A;  2PMS A;  3FXR A;  3TOD A;  4TOZ A;  5HBC A;  4QFP A;  4POW A;  1B9J A;  5I57 B;  4IB2 A;  1M5E A;  3PPP A;  3W15 C;  1YTV A;  3AXF A;  4ESX A;  4FEB A;  1N3W A;  4RA1 A;  4OET A;  4U4X A;  4YIC A;  1XT8 A;  3OO8 A;  4NF6 A;  1URD A;  1LAH E;  3Q27 A;  4DZ1 A;  4RPO A;  1EH3 A;  4GWO A;  1SVX B;  2Y7W A;  3OXN A;  5L9S A;  2F36 A;  4O3A A;  1D3K A;  2A5S A;  4QFO A;  1DPP A;  3KOS A;  1B3G A;  3EPE A;  4U4S A;  2QS2 A;  1D9V A;  4ZEI A;  4KHZ E;  4G68 C;  3MBP A;  5TPA B;  5JK4 A;  4RXL A;  4OFJ A;  3EHT A;  3IB0 A;  3T9H B;  4DCY A;  3RTW B;  4HS7 A;  4LON B;  3MP8 A;  5DEX B;  3IOW A;  3TQW A;  4ISU A;  1MQH A;  3MP6 A;  3TCF A;  4TQU Q;  1MY2 A;  5JTY A;  3H6W A;  4EQB A;  4I8C A;  3C32 A;  4NF8 A;  2UVI A;  2RIN A;  1NNF A;  4IY6 A;  1NL5 A;  1B2H A;  2HXW A;  1MM6 A;  1LFG A;  2O1L A;  3KN8 A;  3C36 A;  1MXU A;  2F97 A;  4MFI A;  1P1U A;  3GLB A;  5KDT B;  2I3W A;  4U1O A;  3RLF E;  4YAH X;  4RJZ A;  4F22 A;  1PB9 A;  3SEV A;  1MXX A;  5BUU A;  4KYS A;  4GL8 A;  2F78 A;  2DS9 A;  3M3F A;  3FVO A;  3CG3 A;  1LBC A;  2OWS A;  1B1H A;  3N6U A;  3BBR A;  2A5T B;  5K2X A;  3K6U A;  1AIV A;  2I0B A;  2I6E A;  3C35 A;  3N5L A;  1POY 1;  5CBS A;  5DTB A;  3VE1 B;  4ZEB A;  3SKP A;  4ZE9 A;  1FQE A;  4OWD A;  3EQ1 A;  1XVX A;  2OK2 A;  4ZZA A;  3CVG A;  1MXZ A;  3RTF B;  2DVC A;  1M5C A;  3Q26 A;  3FVN A;  2QRY A;  4N13 A;  3E4R A;  2ABH A;  1ZJL A;  2FA7 A;  4U1Z A;  5ITO A;  2ZXT A;  2GRV A;  4L17 A;  3VXC A;  4IO3 A;  2R6G E;  2NUV A;  2UYE A;  1P1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...