4MNCA

Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. js666 (bpro_4736), target efi-510156, with bound benzoyl formate, space group p21
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
305
structure length
305
Chain Sequence
QEVTLRLVSAFPENGIYVQRLLPWIAKVNAEGKGVLQINFLGGPKAIPTFEAGNAVKTGVVDMAMNTGAFYTNVMPEADFLKLTQIPVAEQRKNGAFDAINKVWNEKGNTQYLARMVENQPFHIYTNKKIDKPDLSGQKIRISPVYRDFFQALNANVVTTPPGEVYTALERGVVDGYGWPIGGIFDLNWQEKTKFRVDPGFYDAEVSLTMNLPAYKKLTDAQRNYLQKQLLVLEAENTFWTRYGNVETARQETAGIQTIKFDAATSKAFREKAYEVGWAGAMKQSPEVAARFKTLFSKAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter-DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Polaromonas sp.
total genus 113
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mncA00
4NHBA 5IM2A 4O94A 4MNIA 4PCDA 2HZKA 4MCOA 5CM6A 4P9KA 4PGNA 4PETA 4PC9A 4P47A 4P1LA 4MMPA 4NG7A 2ZZWA 5I5PA 4O8MA 2WYPA 4N17A 4P8BA 2WX9A 4YZZA 4MAGA 4PAKA 4DI4B 4X04A 4OVRA 5IZZA 4NF0A 4N6DA 4PFIA 2HZLA 2XWIA 4PGPA 2PFYA 4O7MA 2XXKA 4OVQA 4PBHA 2ZZXA 4X8RA 4DI3D 4N6KA 4YICA 4OVPA 4XFEA 3GYYA 4N8GA 4MX6A 4OVSA 4N8YA 4P56A 5LTCA 4MHFA 4N4UA 4PAFA 4N15A 5IGAA 2VPNA 4NN3A 4PFRA 3FXBA 4NGUA 4PE3A 4MNPA 4XF5A 3B50A 2XWKA 2XA5A 4MNCA 2PFZA 2VPOA 4MIJA 3U65A 4N91A 4MEVA 4PF6A 2V4CA 4OANA 2WYKA 4NQ8A 4PFBA 2CEYA 4P3LA 4P1EA 2XWOA 4XEQA 4PDDA 4PBQA 4NX1A 4PDHA 2XWVA 4PF8A 4PAIA 2ZZVA 2CEXA 4NAPA 4OA4A 4OVTA 5I7IA 4LN5A 2HPGA 4UABA
chains in the Genus database with same CATH superfamily
2P3NA 3EKIA 1Y20A 3H3GA 5FTIA 3C34A 4KHZE 1IMDA 3KN8A 2XXIA 4R2BA 3V83A 4YZZA 2ABHA 3CSGA 5TU0A 2XXVA 1B05A 2QSXA 1B1XA 1BK4A 5I56A 2VD2A 1JP4A 1PBPA 2I48A 3IL1B 3GXAA 4QFLA 2FVZA 1B7ZA 1DTZA 1FQEA 3TTNA 4HE2A 1JETA 1B5IA 3K6UA 3M3KA 3QUJA 3BBRA 5IGAA 2DXRA 2CZIA 4ELQA 3O6IA 1R9LA 2Y7IA 4PFRA 2Q9TA 3FXUA 1MPDA 3W9WA 1MQHA 5TPAB 5ESYA 1ZBMA 2XA5A 1AL3A 1B4ZA 1P1WA 1I6AA 4OTEA 5L8DA 5DEXA 4KYEA 4MH5A 2OWSA 3C31A 1SI1A 2OCUA 5I2KB 2Q2AA 4ELPA 2H9BA 3TAJA 4R73A 3OENA 3SDFA 5I7IA 4LATA 4ZEKA 1FJ6A 3VFJA 2ONKE 4F1VA 3WAEA 2I4BA 1ZJLA 4DZ1A 1A7LA 4DI4B 1IITA 3FUZA 4R9FA 4JXIA 2ANJA 4JB7A 2OWTA 3EF7A 5H8HA 2LAOA 1NV3A 2E1SA 4GLIA 1UTHB 4O7MA 3V89B 2I6EA 4PBHA 2VP1A 1WVJA 4EXKA 5I58A 2L5VA 2OBGA 1FTMA 4QSDA 4JBZA 3FASA 2V3TA 3VVEA 3HO7A 1ELJA 1IIWA 1IXIA 2A5TB 4HS7A 4F3PA 1OQGA 2UVGA 3CRBA 4DXCA 3K00A 4IB2A 2VPNA 2O84X 5ICQA 5JEIA 1SDXA 1MY3A 1XC1A 4BDNA 4MJOA 1SI0A 3IJXB 2I58A 1P1OA 1NFTA 1MQDA 3O2AA 5CBSA 2DYXA 1UTBA 3K0VA 4LZ8A 1YCJA 3TZAA 4GF8A 1MPBA 3D4CA 4X1DA 3KSXA 1FPEA 4DIGA 2CEYA 2E0SA 2ZNSA 4P3LA 4YMBA 4I40A 1D9YA 5ICTA 1HSJA 4F19A 3D1RA 4GWUA 1YZ0A 4OWDA 3CFXA 3Q28A 1ZKBA 4NMYA 4EQ7A 3IFAA 3ZKKA 4OA4A 2QVVA 1PB8A 2ONSA 3W9VA 2I3WA 2XX9A 3MZ9A 4DDDA 4R72A 2QMWA 4RXLA 2P0SA 3VVFA 3QMFA 4PETA 3O9PA 2B3BA 1HSEA 2V25A 1Q9DA 1DOTA 2Q74A 3MW0A 3BFTA 4IY6A 4P8BA 3S2VA 2RC7A 1EU8A 1NUYA 4F3SA 1RDXA 3L6HA 2I3VA 4N6DA 4UACA 1N76A 3BFUA 5EQ9A 2O7IA 2XXKA 2XXUA 1CE2A 3PPOA 4DXUA 5M2VA 3TEPA 3T22A 1LFHA 2XXRA 1B5HA 1SW5A 2V93A 2DWJA 3KFMA 1ZLQA 4OEVA 4ECFA 3B6TA 3H06B 4RPNA 5TPAA 2B3FA 3K01A 4ZECA 3FVGA 3EPEA 4LZ5A 1KZ8A 5I84A 4P0IA 4BDRA 1NV1A 4LQ2A 5B7DA 1SPIA 2D5WA 1FPIA 4PFWA 1GTKA 1Y1ZA 2I0CA 2AIXA 2F5XA 5I2KA 2JJKA 4AS5A 3PMXA 4HCYA 4RA1A 3LC8A 4JWXA 5IKBA 1SYHA 1SW1A 1B3FA 4F1UA 1VSOA 3T93B 3RPWA 1DTGA 5ET5A 1EZPA 2QMXA 1US4A 2XXHA 3FIRA 1N7XA 2Q8MA 4Q30B 3SERA 2F8DA 2V3QA 2M8CA 3FVOA 4LN5A 4OFLA 4N81A 1B40A 2A5SA 4NHBA 3RT6B 4GWZA 1IXGA 2VT5A 1DPPA 1B51A 4P9KA 1UTHA 1POY1 4HE0A 2Z23A 4QBAA 4JVDA 1CNQA 1FTLA 4ZEBA 2OZZA 3MPLA 2WX9A 3S9LC 3MQ9A 3FXRA 1MXWA 1BTJA 4KQPA 2DE2A 2X26A 2GH9A 4PGPA 1DBZA 2A5TA 3FV2A 1OQHA 3USDA 4R2FA 5AA2B 3VDFA 4ONYA 5CMKA 3T9HB 5LOMA 4MF3A 3LSFB 4M1VA 1FTJA 3R7XA 3LSWA 4DLDA 5CI5A 4BLAA 1GGGA 3ONMA 1QGXA 2CMOA 3T9VA 4R6YA 2ZNTA 4YU0A 1H44A 4IO7A 3FZVA 1QUJA 1NV4A 4NF4B 4EQ9A 3M3LA 4OETA 3TTMA 4KI0E 1INPA 2XXPA 3HSTA 2Y7KA 1B32A 2ZYMA 4PFBA 3G3HA 1SD3A 1A55A 1YAEA 4U4XA 2Z8EA 3OO7A 1M5FA 4H67A 5B70A 2KQZA 4E0WA 1N3WA 1MY4A 4U23A 3IB1A 4AB6A 3HPIA 1MH3A 1TT1A 3PPRA 3B8BA 2PBWA 2WBBA 4QSEA 4XKQA 3KJ7A 3CFZA 3IK6B 3P7IA 3K6WA 5I57A 4MMPA 4ESWA 1LGBC 3E79A 3KEIA 2Y7RA 4DXBA 3R26A 3OO6A 2G29A 1LBWA 3PV0E 3SEYA 4NF6B 1B52A 3UA8A 1Q1KA 1IEJA 5CMCA 3DP6A 3N6UA 1LAFE 1FBCA 4YICA 4JWOA 1Q35A 2I49A 2D3IA 4I3EA 4OVPA 4XFEA 1S7YA 2B65A 1AH5A 4F3BA 4MHFA 3RTWB 2XXYA 2OLBA 5H8FB 2P1SA 2FA7A 4GX6A 2OJTA 3OOAA 3PUYE 2F6PA 4POXA 3THIA 5KCJB 1N0TA 4WEDA 3U94A 1NH8A 4U21A 2PMSA 4FORA 3IJOB 3KC0A 1LBCA 4GWSA 1QKAA 1POTA 4OANA 2WYKA 4IO4A 2W7YA 4FE8A 4BDQA 4H8JA 4X1BA 4C0RA 3TCGA 1FTOA 3HHFA 4F39A 2XWVA 2Q88A 1NNKA 4EF2A 5EHMA 2HHMA 1L5TA 4O3CA 4F18A 1B7HA 3FV1A 4OZ9A 4O94A 1OMPA 5EYFA 2QS2A 2HZKA 4YKKA 4I8CA 5AA2A 4QFNA 3HHGA 1A54A 1YXIA 2AYSA 4FECA 1FBPA 3KN3A 2HXWA 4O8MA 5T3JA 4G61A 3T96B 2BJJX 3QUFA 2MKZA 4BDLA 3G3FA 3UK4A 4I3YA 1I6BA 4OYVA 4FATA 2REJA 4NF4A 4YB5A 2PYYA 3TCFA 4OVSA 3IB2A 2NWJA 1IXCA 2GHBA 3CVGA 2O1MA 2KR0A 4IY5A 3GLBA 3MP8A 3PPQA 3CR9A 1M5DA 4IO3A 4P0GA 3QAXA 2Y7WA 3E3KA 1FPJA 2RF1A 3MVZA 1EYKA 5DW8A 2GHAA 4NWCA 1PB7A 3GBBA 3M8UA 4YB6A 3OSRA 4P1EA 1VR5A 4TOZA 3U72A 1YYZA 5BUUA 1NNFA 2IEEA 2QS1A 3MJNA 4NAPA 3U92A 1XS5A 4H6DA 1LSTA 4NF6A 5IM2A 2UVJA 5BWJA 1FCKA 2UYEA 2XXXA 4F29A 4GFRA 4R75A 1MXUA 3ISPA 3SZPA 1H43A 1MG1A 2NUVA 4F2QA 4ZEDA 3GBAA 2DWHA 2WYPA 5H8QB 4Q0CA 2DDKA 3KBZA 1LLSA 3H6TA 4PAKA 2X7QA 4X04A 1H3DA 3H7MA 1FPGA 1D3KA 1D4NA 1PC3A 4OVQA 5H8FA 3MP1A 3IX1A 2ZZXA 4N6KA 4JSDA 5FHOA 5KCJA 1LB9A 2Y7PA 4MX6A 1MH4A 3IFCA 4Q8RA 3OELA 3PUXE 1QVSA 2PT2A 4PAFA 2NXOA 3CI8A 1FQBA 3NOHA 2F7CA 2P2AA 2ZYKA 3O29A 2ZNUA 3E13X 1SQYA 1TFAA 2FYIA 5ET6A 3I5OA 1SYIA 2V4CA 4GOTA 1XVYA 4G68B 2F78A 3UIFA 4RJZA 4IO2A 3I6VA 1TWYA 1NV0A 3TTKA 4ZS9A 3IOTA 3UORA 3HN0A 1N3XA 1P1NA 4R6KA 4OVTA 1M5BA 4NWDA 3SEXA 4PE5B 1Y3NA 4G8HA 3H6WA 2X7PA 3DELB 1IMFA 5CC2A 3C9HA 4NG7A 1N84A 1XOCA 3MAMA 2DS9A 5F7VA 2Z22A 5IAIA 3RGYA 5ITPA 4DE8A 4NF0A 4PFIA 5I59B 4E0XA 4GXSB 2O51A 1AIVA 2PVUA 2QL3A 2Q8JA 3RYDA 5JK4A 4FEDA 2H98A 3PD8A 4PFYA 4LQ5A 3O97A 3A3UA 5A5XB 1LBZA 3IOWA 5DTBA 3S9EA 2HAVA 4EUOA 1JNFA 3DP8A 2G93A 1IMBA 3TTRA 4KPTA 1AOVA 4QRZA 4GWOA 3FBPA 3O6GA 2QVRA 2REGA 3LSLA 2NOOA 4GWYA 2QRYA 3K1NA 1MDQA 4NGUA 4MNPA 4AS4A 3Q27A 5L9OA 4JVCA 3PD9A 4YB7A 3RT8A 2NVUB 3TFLA 3N5LA 4MIJA 3EHTA 3Q26A 4IGRA 2VD3A 4I1DA 1R9QA 1SBPA 1DPEA 1B9JA 2HAUA 2HEUA 1MQJA 5AA2D 2GFEA 4I62A 3Q29A 1MXXA 2AL4A 1DK4A 3PU5A 3K4UA 5FTHA 4PTKA 1YPNA 1FBGA 1KA0A 4N6PA 5F24A 3MZ1A 3B6WA 2GQ1A 4X9TA 2F3BA 2R6GE 4MCOA 3QYTA 2KLFA 1QUIA 4YAHX 2ZXTA 1MXZA 3MZBA 4JDFA 1R1NA 4HE1A 2UYFA 5FHMA 4X48A 4KYDA 1T0KA 2Q89A 1RDYA 4OVRA 5IZZA 1NI9A 2FNCA 2RCBA 3S4UA 3HFUA 4H65A 1MDP1 1SW2A 4R6HA 1JW5A 4RK2A 1NV5A 4C1TA 2HXRA 3HV1A 1D9QA 5K2YA 1MQGA 4N8GA 1EYJA 3IR1A 4RNSA 3KGCA 5LTCA 4QFPA 5H8NB 4FIMA 4K3FA 1OVTA 3E78A 1FRPA 3HCQA 4G68A 1G0IA 3U93A 1EH3A 3CG3A 4XTCQ 3H4ZA 2WKYA 4U1OA 3RN8A 2F6GA 4IGTA 5AA1A 1DCUA 1FPFA 2UVHA 4MNCA 3A09A 5AA4B 3S9NC 2DP8A 4F2OA 4MEVA 4PF6A 1M5CA 3MVYA 4OESA 4NQ8A 4OQOA 3MYUA 4I9DA 4Q5TA 4XEQA 2I0BA 3SKPA 1WDNA 5EYGA 1MY2A 4PBQA 3KJTA 3S9MC 3VLUA 2UXAA 3KN7A 1Z7NE 1Y4TA 1Y4CA 1UQWA 4ELOA 4TLLB 3CFLA 2QS3A 2Y5KA 1B6HA 3K1PA 3C36A 3SETA 1VDWA 5CRYA 3TELA 3OO8A 3BIHA 5I59A 4Z0IA 4AB5A 5HBCA 3QXMA 4P1LA 4XIGQ 2F3DA 1JEVA 5A5XA 1LFGA 1S50A 1S9TA 1MXVA 4PQJA 3OO9A 1ZTYA 1US5A 2BJIA 4LUBA 2HFBA 4G2ZA 2FHYA 4LA9A 3K1MA 4KD5A 1FPKA 2HCAA 1D9VA 4QFOA 1FW0A 3ILUB 2H25A 2I4CA 1LCTA 4RY1A 3I3VA 4NF8B 2V84A 3OXNA 1Y9UA 4HXVA 4H46A 3TODA 1OLAA 1II5A 3U1OA 1ANFA 1UIUA 4GBWA 4JVIA 1FBFA 1OLCA 4FJPA 3ILTB 1QKBA 3U65A 3QK6A 2IA4A 5CBRA 5DVFA 4U22A 3TTLA 1A8FA 4KCCA 3MVWA 5DVIA 2R8TA 2ZZVA 1OVBA 5LDZA 3VLWA 1LB8A 4GIZA 1B3EA 1FBEA 3FJGA 4OXVA 1IMAA 1FQDA 2H5YA 1IMCA 3PMVA 2QVUA 4ZDMA 4EQBA 5IZ3B 5A5LA 1B7UA 1B3GA 4LONB 4G4PA 4LP2B 4P47A 3KSJA 3C4MA 4KYSA 5ISUA 4JSOA 1J1NA 5ET7A 1PBQA 1FTAA 4MAGA 4O7IA 3TCHA 1K9YA 3PGFA 4Z7EA 2HZLA 4OENA 3BKIB 1JEUA 5H8NA 3E9XA 5I58B 4NEDA 4PFTA 1ZU0A 2PCRA 1LFIA 1YTVA 5I2NB 1MM7A 4GL0A 4P56A 3UP9A 1MM6A 2PX1A 3KBRA 5AA4A 1NNPA 3DLNA 1TXFA 1IXHA 3ROJA 3SEUA 2YLNA 4ND9A 3RLFE 1GR2A 4AQ4A 3PMWA 2CZLA 5EQAA 1MPCA 2R71A 3KZGA 2FIXA 4C1UA 4GXAA 2QFLA 3PUWE 1DMBA 3T1BA 2H4IA 3O6HA 4P11A 3MP6A 2OX3A 3IOVA 5FHNA 1LBVA 1R6ZA 3A3CA 4F31B 3GZGA 4KXPA 1WODA 1I6QA 4IO6A 4GX3A 4PAIA 3JV9A 1URSA 1B46A 1LEVA 4ZE8A 2Z8FA 4F1YA 4H45A 3G3JA 4UABA 1H45A 1RYOA 3SEWA 4PCDA 3CIJA 3BIGA 2F7AA 3FATA 1RDZA 3IOUA 3R6UA 4PC9A 1NH7A 1NV2A 1A40A 4GX4A 1NMUA 1Y3QA 2XXTA 2ZMBA 1MRPA 1B5JA 3RPLB 3T66A 2ONRA 4MBPA 1O63A 4ZZEA 2RCAA 4F22A 2PFYA 3M3FA 4YKJA 4QSCA 4NF8A 4X8RA 4IO5A 5I3SA 1KWHA 2F7BA 3EQ1A 4M4GA 3PPNA 2XX8A 3GYYA 5HPQA 1IQ7A 1GVCA 1NL5A 5CMMA 4L17A 5EQ7A 4N4UA 1FSAA 5CMBA 2F35A 5H8SA 1NNTA 3K2DA 4FBPA 2Q2CA 3FXBA 3DM0A 1RYXA 5KDTB 1NV6A 1M5EA 1IMEA 2YPNA 4PE3A 2ALUA 3LBSA 5AA3A 1CB6A 1QW0A 2F97A 1XI6A 4N91A 4O3AA 3MWBA 4G8MA 4ISUA 4OERA 2XHDA 3RTFB 4POWA 5DVJA 4DCYA 4U4SA 3C35A 2Z8DA 5IZ3A 2B4LA 4PDDA 4HTGA 2VHAA 4MFIA 4WKMA 4OVJA 4KFQA 2DE4A 4NF5B 3ODBA 3T9UA 3TQWA 4H0WA 3V5AA 1O64A 1B2HA 3C32A 4THIA 2DSFA 2O7UA 3QSLA 2DE3A 1EZ9A 3IAZA 3UGWA 1XT8A 3G3KA 5FBPA 5AE4A 4PGNA 2AL5A 3C33A 1DSNA 4FEBA 2ZZWA 3G3IA 1FBHA 3D4GA 1BIYA 4GD5A 3RNNA 2QPQA 5I2NA 3L6GA 2XD3A 3RQTA 5IZ1A 4QXDA 1I69A 3MPKA 1BLFA 1URDA 1KA1A 2F34A 2FIEA 4GRKA 2PT1A 5ITOA 5J1DA 4G8NA 1VE4A 1LBXA 3TUSA 2XXWA 3KOSA 3K02A 4U1ZA 1IUDA 3CG1A 4OFOA 2FBPA 4HW8A 1XHYA 4BDOA 1JVYA 3K6VA 4MLQA 1PB9A 4O3BA 4JWYA 1B4HA 3KG2A 3TYHA 4RPOA 2RINA 3N6TA 1G0HA 2O69A 2V3UA 4RYAA 1SVXB 2D21A 4KR5A 4XF5A 4YKIA 3VXBA 4GWXA 3OEKA 2RKMA 3K6XA 5HM4B 4OMBA 4N13A 1ZMGA 5JTYB 1B1HA 3VLVA 1UIVA 2GRVA 2XWOA 3FD3A 3IORA 2WEFA 1F9BA 3RY3A 1NKXA 5ET8A 1Z7ME 1NUXA 2VOZA 1FJ9A 1LAGE 3RPLA 3ECRA 1A8EA 5EYHA 5I57B 1ZIUA 4LZ7A 3ZKLA 4UA8A 1P99A 3JYRA 2XD2A 3SESA 3B7DA 2P3VA 4WEPA 3DP4A 3Q25A 2B4MA 1USYE 4N17A 4R9GA 1QUKA 3IB0A 5H8QA 1NV7A 1BP5A 4F3GA 4G68C 2H99A 1FQCA 3V8XB 3UN6A 1FBDA 1JQFA 4ZZAA 5KDTA 1FTKA 3H6VA 2RC8A 2UVIA 4H5GA 1AWBA 1NUZA 1IZ1A 4NN3A 2OK2A 1URGA 3RUMA 4OEUA 1VFDA 4GQOA 3FVNA 3B50A 4MLVA 4ZEIA 4ZE9A 4EDPA 4QFKA 4NF5A 5TP9B 1XVXA 3O66A 3B6QA 3G7WA 4ESXA 1QJMA 1O7TA 1Y3PA 4XXUA 1B0HA 3QIMA 4H5FA 2WBDA 1MXYA 3G3GA 3WAFA 1QULA 1N7WA 1USYH 4QHQA 4PDHA 3EN3A 4PF8A 5L9MA 2OWZA 4H8IA 4GVOA 3FGSA 3H03A 4KCDA 1JVXA 4WXJA 3MBPA 5L9SA 1MS7A 1ATGA 3TMGA 4R74A 3ZS6A 3LUYA 4TQUQ 1Y1MA 2DOJA 5CM6A 4LVQA 1MQIA 3FXQA 2DWAA 3OD7A 5KZTA 5K2XA 4N07A 2THIA 3LSXA 3W15C 5I5PA 3ZSFA 2CZHA 1PEBA 3PPPA 4OFJA 3TKDA 5DT6A 3VV5A 2DQVA 3OEMA 3KOTA 4NTLA 4DI3D 4EF1A 3LV0A 3SEVA 3IO6A 4DCXA 2VGQA 3FVKA 1K9ZA 4N8YA 2O1LA 1LBYA 4TLMB 5I56B 4N15A 1AMFA 3CSBA 3E4RA 4G77A 5JTYA 2DXYA 5DYHA 1HSLA 1B0LA 3PUVE 1P1UA 2ZYNA 4RK9A 2RC9A 3KC1A 2XWKA 2XX7A 2PFZA 3FJMA 4YMAA 2VPOA 3JZJA 3PTYA 1OIBA 3MUQA 1A99A 1FPDA 3MVXA 3FJ7A 3EHUA 5F1QA 3AXFA 3VE1B 1FQFA 1SW4A 1B58A 2CEXA 3TPAA 1JW4A 3EHSA 5DEXB 1EYIA 1LAXA 2HPGA 2O6AA 3OMBA 1FPBA 4EXLA 2DVCA 4MNIA 3MC2A 1LBBA 3T0JA 5ELVA 3U8QA 3VXCA 1B3LA 3VVDA 1PDAA 1BKAA 5EHSA 1EZOA 1MY1A 2F36A 1NUWA 2ZYOA 3PUZE 2XWIA 1FQAA 2QS4A 4U2RA 3A29A 3LR1A 4XKPA 2ESNA 4GWWA 4NE4A 1B3HA 3N94A 1H76A 3TDJA 1N04A 4IR8A 4GBVA 3H6UA 4H1XA 5H8HB 2HQ0A 4XKRA 5TP9A 1LAHE 3TQLA 2DWIA 2QJEA 4GL8A 3LUZA 2Y5LA 4BDMA 2DVZA 1VFEA 3IO4A 3T9XB 4PP0A 1GV8A 2O68A 4XKNA 3F11A 5J16A 3MSTA 4ZEFA 1JW1A 2R9JA 4ELRA 1RKMA 4NX1A 3OSQA 1UTBB 2Y84A 1LCFA 1TFDA 4PFUA 3N26A 1FPLA 2YJPA 1P1QA 2CZKA 4FAJA 1MY0A 4HCWA 3CHGA 2XXQA 5EQ8A 4OHNA 3O28A 4QF9A 4YKPA
chains in the Genus database with same CATH topology
2F3BA 2DE3A 2WBBA 2P3NA 3EKIA 4MCOA 5FBPA 4PGNA 4HE1A 4MMPA 1IMDA 2ZZWA 3E79A 1FBHA 4YZZA 2QPQA 1LBWA 1RDYA 4OVRA 5IZZA 1NI9A 3HFUA 5IZ1A 4QXDA 1BK4A 1NV5A 1JP4A 1KA1A 1FBCA 2FIEA 2HXRA 4YICA 5J1DA 4I3EA 4OVPA 4XFEA 1D9QA 1LBXA 4N8GA 1EYJA 2FVZA 2FBPA 5LTCA 4MHFA 4HE2A 5IGAA 3E78A 2CZIA 1FRPA 4GX6A 1G0HA 1G0IA 4PFRA 2Q9TA 3W9WA 4XF5A 5ESYA 1DCUA 4GWXA 1FPFA 2XA5A 4MNCA 3KC0A 4GWSA 4MEVA 4PF6A 4OANA 2WYKA 4NQ8A 3MYUA 2XWOA 4XEQA 5EYGA 4PBQA 2WEFA 2XWVA 5ET8A 1NUXA 1FJ9A 2HHMA 4F18A 2Y5KA 5I7IA 3RPLA 1VDWA 5EYHA 3BIHA 1FJ6A 4O94A 2HZKA 4P1LA 4F1VA 1YXIA 2P3VA 1FBPA 2B4MA 4O8MA 4N17A 5T3JA 2F3DA 4DI4B 4G61A 1NV7A 2MKZA 4O7MA 1NV3A 4PBHA 4I3YA 1FBDA 2BJIA 2L5VA 2FHYA 4OVSA 1FPKA 1AWBA 1NUZA 2KR0A 2VPNA 4NN3A 4HXVA 4H46A 4MJOA 1FPJA 4GBWA 3B50A 4JVIA 1EYKA 1FBFA 5DW8A 3U65A 1FPEA 2CEYA 4P3LA 4P1EA 2WBDA 4I40A 1YYZA 4F19A 4PDHA 3D1RA 4GWUA 2R8TA 4PF8A 2OWZA 1YZ0A 2ZZVA 5LDZA 4NAPA 3IFAA 1FBEA 4OA4A 2QVVA 1IMAA 1IMCA 2QVUA 3W9VA 5IM2A 5IZ3B 5A5LA 5CM6A 3ISPA 3QMFA 4PETA 3SZPA 4P47A 1Q9DA 2Q74A 5I5PA 2WYPA 4P8BA 5ET7A 2DDKA 4O7IA 1FTAA 3KBZA 4MAGA 1NUYA 4PAKA 1RDXA 1K9YA 4X04A 2CZHA 4N6DA 2HZLA 5EQ9A 1FPGA 2XXKA 4OVQA 2ZZXA 4DI3D 2PCRA 3LV0A 4N6KA 4MX6A 1K9ZA 3IFCA 4N8YA 4P56A 1LBYA 4PAFA 4N15A 3NOHA 1KZ8A 3ROJA 1NV1A 1SPIA 1FPIA 5EQAA 3KC1A 2XWKA 2F5XA 2PFZA 2FIXA 2JJKA 5ET6A 4AS5A 2VPOA 2QFLA 4HCYA 3T1BA 2V4CA 2OX3A 3PTYA 4F1UA 1LBVA 1FPDA 5ET5A 1NV0A 4KXPA 4GX3A 4PAIA 2Q8MA 2CEXA 2V3QA 1LEVA 4OVTA 1EYIA 4H45A 4LN5A 4N81A 2HPGA 4UABA 4NHBA 1FPBA 4GWZA 4MNIA 4PCDA 2VT5A 3BIGA 4P9KA 4HE0A 1RDZA 1IMFA 4PC9A 4QBAA 3T0JA 1NV2A 4JVDA 4GX4A 4NG7A 1CNQA 2WX9A 3RPLB 1NUWA 2DE2A 4NF0A 4PFIA 2XWIA 4PGPA 1DBZA 3A29A 2PFYA 3RYDA 5JK4A 4X8RA 4GWWA 5I3SA 3GYYA 4IR8A 4M1VA 1LBZA 4GBVA 5EQ7A 1QGXA 4N4UA 1FSAA 1IMBA 3FBPA 2QVRA 4FBPA 1NV4A 3FXBA 4GWYA 3LUZA 1NV6A 1IMEA 2Y5LA 4NGUA 4PE3A 2DVZA 4MNPA 4AS4A 4JVCA 1INPA 1XI6A 4MIJA 4N91A 4PFBA 5J16A 3MSTA 5IZ3A 2B4LA 4PDDA 2KQZA 4NX1A 1DK4A 2DE4A 1FPLA 2CZKA 4PTKA 4HCWA 3CHGA 5EQ8A 1FBGA 1KA0A 5F24A 3B8BA 2GQ1A 4X9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHB A;  5IM2 A;  4O94 A;  4MNI A;  4PCD A;  2HZK A;  4MCO A;  5CM6 A;  4P9K A;  4PGN A;  4PET A;  4PC9 A;  4P47 A;  4P1L A;  4MMP A;  4NG7 A;  2ZZW A;  5I5P A;  4O8M A;  2WYP A;  4N17 A;  4P8B A;  2WX9 A;  4YZZ A;  4MAG A;  4PAK A;  4DI4 B;  4X04 A;  4OVR A;  5IZZ A;  4NF0 A;  4N6D A;  4PFI A;  2HZL A;  2XWI A;  4PGP A;  2PFY A;  4O7M A;  2XXK A;  4OVQ A;  4PBH A;  2ZZX A;  4X8R A;  4DI3 D;  4N6K A;  4YIC A;  4OVP A;  4XFE A;  3GYY A;  4N8G A;  4MX6 A;  4OVS A;  4N8Y A;  4P56 A;  5LTC A;  4MHF A;  4N4U A;  4PAF A;  4N15 A;  5IGA A;  2VPN A;  4NN3 A;  4PFR A;  3FXB A;  4NGU A;  4PE3 A;  4MNP A;  4XF5 A;  3B50 A;  2XWK A;  2XA5 A;  4MNC A;  2PFZ A;  2VPO A;  4MIJ A;  3U65 A;  4N91 A;  4MEV A;  4PF6 A;  2V4C A;  4OAN A;  2WYK A;  4NQ8 A;  4PFB A;  2CEY A;  4P3L A;  4P1E A;  2XWO A;  4XEQ A;  4PDD A;  4PBQ A;  4NX1 A;  4PDH A;  2XWV A;  4PF8 A;  4PAI A;  2ZZV A;  2CEX A;  4NAP A;  4OA4 A;  4OVT A;  5I7I A;  4LN5 A;  2HPG A;  4UAB A; 
#chains in the Genus database with same CATH topology
 2P3N A;  3EKI A;  1Y20 A;  3H3G A;  5FTI A;  3C34 A;  4KHZ E;  1IMD A;  3KN8 A;  2XXI A;  4R2B A;  3V83 A;  4YZZ A;  2ABH A;  3CSG A;  5TU0 A;  2XXV A;  1B05 A;  2QSX A;  1B1X A;  1BK4 A;  5I56 A;  2VD2 A;  1JP4 A;  1PBP A;  2I48 A;  3IL1 B;  3GXA A;  4QFL A;  2FVZ A;  1B7Z A;  1DTZ A;  1FQE A;  3TTN A;  4HE2 A;  1JET A;  1B5I A;  3K6U A;  3M3K A;  3QUJ A;  3BBR A;  5IGA A;  2DXR A;  2CZI A;  4ELQ A;  3O6I A;  1R9L A;  2Y7I A;  4PFR A;  2Q9T A;  3FXU A;  1MPD A;  3W9W A;  1MQH A;  5TPA B;  5ESY A;  1ZBM A;  2XA5 A;  1AL3 A;  1B4Z A;  1P1W A;  1I6A A;  4OTE A;  5L8D A;  5DEX A;  4KYE A;  4MH5 A;  2OWS A;  3C31 A;  1SI1 A;  2OCU A;  5I2K B;  2Q2A A;  4ELP A;  2H9B A;  3TAJ A;  4R73 A;  3OEN A;  3SDF A;  5I7I A;  4LAT A;  4ZEK A;  1FJ6 A;  3VFJ A;  2ONK E;  4F1V A;  3WAE A;  2I4B A;  1ZJL A;  4DZ1 A;  1A7L A;  4DI4 B;  1IIT A;  3FUZ A;  4R9F A;  4JXI A;  2ANJ A;  4JB7 A;  2OWT A;  3EF7 A;  5H8H A;  2LAO A;  1NV3 A;  2E1S A;  4GLI A;  1UTH B;  4O7M A;  3V89 B;  2I6E A;  4PBH A;  2VP1 A;  1WVJ A;  4EXK A;  5I58 A;  2L5V A;  2OBG A;  1FTM A;  4QSD A;  4JBZ A;  3FAS A;  2V3T A;  3VVE A;  3HO7 A;  1ELJ A;  1IIW A;  1IXI A;  2A5T B;  4HS7 A;  4F3P A;  1OQG A;  2UVG A;  3CRB A;  4DXC A;  3K00 A;  4IB2 A;  2VPN A;  2O84 X;  5ICQ A;  5JEI A;  1SDX A;  1MY3 A;  1XC1 A;  4BDN A;  4MJO A;  1SI0 A;  3IJX B;  2I58 A;  1P1O A;  1NFT A;  1MQD A;  3O2A A;  5CBS A;  2DYX A;  1UTB A;  3K0V A;  4LZ8 A;  1YCJ A;  3TZA A;  4GF8 A;  1MPB A;  3D4C A;  4X1D A;  3KSX A;  1FPE A;  4DIG A;  2CEY A;  2E0S A;  2ZNS A;  4P3L A;  4YMB A;  4I40 A;  1D9Y A;  5ICT A;  1HSJ A;  4F19 A;  3D1R A;  4GWU A;  1YZ0 A;  4OWD A;  3CFX A;  3Q28 A;  1ZKB A;  4NMY A;  4EQ7 A;  3IFA A;  3ZKK A;  4OA4 A;  2QVV A;  1PB8 A;  2ONS A;  3W9V A;  2I3W A;  2XX9 A;  3MZ9 A;  4DDD A;  4R72 A;  2QMW A;  4RXL A;  2P0S A;  3VVF A;  3QMF A;  4PET A;  3O9P A;  2B3B A;  1HSE A;  2V25 A;  1Q9D A;  1DOT A;  2Q74 A;  3MW0 A;  3BFT A;  4IY6 A;  4P8B A;  3S2V A;  2RC7 A;  1EU8 A;  1NUY A;  4F3S A;  1RDX A;  3L6H A;  2I3V A;  4N6D A;  4UAC A;  1N76 A;  3BFU A;  5EQ9 A;  2O7I A;  2XXK A;  2XXU A;  1CE2 A;  3PPO A;  4DXU A;  5M2V A;  3TEP A;  3T22 A;  1LFH A;  2XXR A;  1B5H A;  1SW5 A;  2V93 A;  2DWJ A;  3KFM A;  1ZLQ A;  4OEV A;  4ECF A;  3B6T A;  3H06 B;  4RPN A;  5TPA A;  2B3F A;  3K01 A;  4ZEC A;  3FVG A;  3EPE A;  4LZ5 A;  1KZ8 A;  5I84 A;  4P0I A;  4BDR A;  1NV1 A;  4LQ2 A;  5B7D A;  1SPI A;  2D5W A;  1FPI A;  4PFW A;  1GTK A;  1Y1Z A;  2I0C A;  2AIX A;  2F5X A;  5I2K A;  2JJK A;  4AS5 A;  3PMX A;  4HCY A;  4RA1 A;  3LC8 A;  4JWX A;  5IKB A;  1SYH A;  1SW1 A;  1B3F A;  4F1U A;  1VSO A;  3T93 B;  3RPW A;  1DTG A;  5ET5 A;  1EZP A;  2QMX A;  1US4 A;  2XXH A;  3FIR A;  1N7X A;  2Q8M A;  4Q30 B;  3SER A;  2F8D A;  2V3Q A;  2M8C A;  3FVO A;  4LN5 A;  4OFL A;  4N81 A;  1B40 A;  2A5S A;  4NHB A;  3RT6 B;  4GWZ A;  1IXG A;  2VT5 A;  1DPP A;  1B51 A;  4P9K A;  1UTH A;  1POY 1;  4HE0 A;  2Z23 A;  4QBA A;  4JVD A;  1CNQ A;  1FTL A;  4ZEB A;  2OZZ A;  3MPL A;  2WX9 A;  3S9L C;  3MQ9 A;  3FXR A;  1MXW A;  1BTJ A;  4KQP A;  2DE2 A;  2X26 A;  2GH9 A;  4PGP A;  1DBZ A;  2A5T A;  3FV2 A;  1OQH A;  3USD A;  4R2F A;  5AA2 B;  3VDF A;  4ONY A;  5CMK A;  3T9H B;  5LOM A;  4MF3 A;  3LSF B;  4M1V A;  1FTJ A;  3R7X A;  3LSW A;  4DLD A;  5CI5 A;  4BLA A;  1GGG A;  3ONM A;  1QGX A;  2CMO A;  3T9V A;  4R6Y A;  2ZNT A;  4YU0 A;  1H44 A;  4IO7 A;  3FZV A;  1QUJ A;  1NV4 A;  4NF4 B;  4EQ9 A;  3M3L A;  4OET A;  3TTM A;  4KI0 E;  1INP A;  2XXP A;  3HST A;  2Y7K A;  1B32 A;  2ZYM A;  4PFB A;  3G3H A;  1SD3 A;  1A55 A;  1YAE A;  4U4X A;  2Z8E A;  3OO7 A;  1M5F A;  4H67 A;  5B70 A;  2KQZ A;  4E0W A;  1N3W A;  1MY4 A;  4U23 A;  3IB1 A;  4AB6 A;  3HPI A;  1MH3 A;  1TT1 A;  3PPR A;  3B8B A;  2PBW A;  2WBB A;  4QSE A;  4XKQ A;  3KJ7 A;  3CFZ A;  3IK6 B;  3P7I A;  3K6W A;  5I57 A;  4MMP A;  4ESW A;  1LGB C;  3E79 A;  3KEI A;  2Y7R A;  4DXB A;  3R26 A;  3OO6 A;  2G29 A;  1LBW A;  3PV0 E;  3SEY A;  4NF6 B;  1B52 A;  3UA8 A;  1Q1K A;  1IEJ A;  5CMC A;  3DP6 A;  3N6U A;  1LAF E;  1FBC A;  4YIC A;  4JWO A;  1Q35 A;  2I49 A;  2D3I A;  4I3E A;  4OVP A;  4XFE A;  1S7Y A;  2B65 A;  1AH5 A;  4F3B A;  4MHF A;  3RTW B;  2XXY A;  2OLB A;  5H8F B;  2P1S A;  2FA7 A;  4GX6 A;  2OJT A;  3OOA A;  3PUY E;  2F6P A;  4POX A;  3THI A;  5KCJ B;  1N0T A;  4WED A;  3U94 A;  1NH8 A;  4U21 A;  2PMS A;  4FOR A;  3IJO B;  3KC0 A;  1LBC A;  4GWS A;  1QKA A;  1POT A;  4OAN A;  2WYK A;  4IO4 A;  2W7Y A;  4FE8 A;  4BDQ A;  4H8J A;  4X1B A;  4C0R A;  3TCG A;  1FTO A;  3HHF A;  4F39 A;  2XWV A;  2Q88 A;  1NNK A;  4EF2 A;  5EHM A;  2HHM A;  1L5T A;  4O3C A;  4F18 A;  1B7H A;  3FV1 A;  4OZ9 A;  4O94 A;  1OMP A;  5EYF A;  2QS2 A;  2HZK A;  4YKK A;  4I8C A;  5AA2 A;  4QFN A;  3HHG A;  1A54 A;  1YXI A;  2AYS A;  4FEC A;  1FBP A;  3KN3 A;  2HXW A;  4O8M A;  5T3J A;  4G61 A;  3T96 B;  2BJJ X;  3QUF A;  2MKZ A;  4BDL A;  3G3F A;  3UK4 A;  4I3Y A;  1I6B A;  4OYV A;  4FAT A;  2REJ A;  4NF4 A;  4YB5 A;  2PYY A;  3TCF A;  4OVS A;  3IB2 A;  2NWJ A;  1IXC A;  2GHB A;  3CVG A;  2O1M A;  2KR0 A;  4IY5 A;  3GLB A;  3MP8 A;  3PPQ A;  3CR9 A;  1M5D A;  4IO3 A;  4P0G A;  3QAX A;  2Y7W A;  3E3K A;  1FPJ A;  2RF1 A;  3MVZ A;  1EYK A;  5DW8 A;  2GHA A;  4NWC A;  1PB7 A;  3GBB A;  3M8U A;  4YB6 A;  3OSR A;  4P1E A;  1VR5 A;  4TOZ A;  3U72 A;  1YYZ A;  5BUU A;  1NNF A;  2IEE A;  2QS1 A;  3MJN A;  4NAP A;  3U92 A;  1XS5 A;  4H6D A;  1LST A;  4NF6 A;  5IM2 A;  2UVJ A;  5BWJ A;  1FCK A;  2UYE A;  2XXX A;  4F29 A;  4GFR A;  4R75 A;  1MXU A;  3ISP A;  3SZP A;  1H43 A;  1MG1 A;  2NUV A;  4F2Q A;  4ZED A;  3GBA A;  2DWH A;  2WYP A;  5H8Q B;  4Q0C A;  2DDK A;  3KBZ A;  1LLS A;  3H6T A;  4PAK A;  2X7Q A;  4X04 A;  1H3D A;  3H7M A;  1FPG A;  1D3K A;  1D4N A;  1PC3 A;  4OVQ A;  5H8F A;  3MP1 A;  3IX1 A;  2ZZX A;  4N6K A;  4JSD A;  5FHO A;  5KCJ A;  1LB9 A;  2Y7P A;  4MX6 A;  1MH4 A;  3IFC A;  4Q8R A;  3OEL A;  3PUX E;  1QVS A;  2PT2 A;  4PAF A;  2NXO A;  3CI8 A;  1FQB A;  3NOH A;  2F7C A;  2P2A A;  2ZYK A;  3O29 A;  2ZNU A;  3E13 X;  1SQY A;  1TFA A;  2FYI A;  5ET6 A;  3I5O A;  1SYI A;  2V4C A;  4GOT A;  1XVY A;  4G68 B;  2F78 A;  3UIF A;  4RJZ A;  4IO2 A;  3I6V A;  1TWY A;  1NV0 A;  3TTK A;  4ZS9 A;  3IOT A;  3UOR A;  3HN0 A;  1N3X A;  1P1N A;  4R6K A;  4OVT A;  1M5B A;  4NWD A;  3SEX A;  4PE5 B;  1Y3N A;  4G8H A;  3H6W A;  2X7P A;  3DEL B;  1IMF A;  5CC2 A;  3C9H A;  4NG7 A;  1N84 A;  1XOC A;  3MAM A;  2DS9 A;  5F7V A;  2Z22 A;  5IAI A;  3RGY A;  5ITP A;  4DE8 A;  4NF0 A;  4PFI A;  5I59 B;  4E0X A;  4GXS B;  2O51 A;  1AIV A;  2PVU A;  2QL3 A;  2Q8J A;  3RYD A;  5JK4 A;  4FED A;  2H98 A;  3PD8 A;  4PFY A;  4LQ5 A;  3O97 A;  3A3U A;  5A5X B;  1LBZ A;  3IOW A;  5DTB A;  3S9E A;  2HAV A;  4EUO A;  1JNF A;  3DP8 A;  2G93 A;  1IMB A;  3TTR A;  4KPT A;  1AOV A;  4QRZ A;  4GWO A;  3FBP A;  3O6G A;  2QVR A;  2REG A;  3LSL A;  2NOO A;  4GWY A;  2QRY A;  3K1N A;  1MDQ A;  4NGU A;  4MNP A;  4AS4 A;  3Q27 A;  5L9O A;  4JVC A;  3PD9 A;  4YB7 A;  3RT8 A;  2NVU B;  3TFL A;  3N5L A;  4MIJ A;  3EHT A;  3Q26 A;  4IGR A;  2VD3 A;  4I1D A;  1R9Q A;  1SBP A;  1DPE A;  1B9J A;  2HAU A;  2HEU A;  1MQJ A;  5AA2 D;  2GFE A;  4I62 A;  3Q29 A;  1MXX A;  2AL4 A;  1DK4 A;  3PU5 A;  3K4U A;  5FTH A;  4PTK A;  1YPN A;  1FBG A;  1KA0 A;  4N6P A;  5F24 A;  3MZ1 A;  3B6W A;  2GQ1 A;  4X9T A;  2F3B A;  2R6G E;  4MCO A;  3QYT A;  2KLF A;  1QUI A;  4YAH X;  2ZXT A;  1MXZ A;  3MZB A;  4JDF A;  1R1N A;  4HE1 A;  2UYF A;  5FHM A;  4X48 A;  4KYD A;  1T0K A;  2Q89 A;  1RDY A;  4OVR A;  5IZZ A;  1NI9 A;  2FNC A;  2RCB A;  3S4U A;  3HFU A;  4H65 A;  1MDP 1;  1SW2 A;  4R6H A;  1JW5 A;  4RK2 A;  1NV5 A;  4C1T A;  2HXR A;  3HV1 A;  1D9Q A;  5K2Y A;  1MQG A;  4N8G A;  1EYJ A;  3IR1 A;  4RNS A;  3KGC A;  5LTC A;  4QFP A;  5H8N B;  4FIM A;  4K3F A;  1OVT A;  3E78 A;  1FRP A;  3HCQ A;  4G68 A;  1G0I A;  3U93 A;  1EH3 A;  3CG3 A;  4XTC Q;  3H4Z A;  2WKY A;  4U1O A;  3RN8 A;  2F6G A;  4IGT A;  5AA1 A;  1DCU A;  1FPF A;  2UVH A;  4MNC A;  3A09 A;  5AA4 B;  3S9N C;  2DP8 A;  4F2O A;  4MEV A;  4PF6 A;  1M5C A;  3MVY A;  4OES A;  4NQ8 A;  4OQO A;  3MYU A;  4I9D A;  4Q5T A;  4XEQ A;  2I0B A;  3SKP A;  1WDN A;  5EYG A;  1MY2 A;  4PBQ A;  3KJT A;  3S9M C;  3VLU A;  2UXA A;  3KN7 A;  1Z7N E;  1Y4T A;  1Y4C A;  1UQW A;  4ELO A;  4TLL B;  3CFL A;  2QS3 A;  2Y5K A;  1B6H A;  3K1P A;  3C36 A;  3SET A;  1VDW A;  5CRY A;  3TEL A;  3OO8 A;  3BIH A;  5I59 A;  4Z0I A;  4AB5 A;  5HBC A;  3QXM A;  4P1L A;  4XIG Q;  2F3D A;  1JEV A;  5A5X A;  1LFG A;  1S50 A;  1S9T A;  1MXV A;  4PQJ A;  3OO9 A;  1ZTY A;  1US5 A;  2BJI A;  4LUB A;  2HFB A;  4G2Z A;  2FHY A;  4LA9 A;  3K1M A;  4KD5 A;  1FPK A;  2HCA A;  1D9V A;  4QFO A;  1FW0 A;  3ILU B;  2H25 A;  2I4C A;  1LCT A;  4RY1 A;  3I3V A;  4NF8 B;  2V84 A;  3OXN A;  1Y9U A;  4HXV A;  4H46 A;  3TOD A;  1OLA A;  1II5 A;  3U1O A;  1ANF A;  1UIU A;  4GBW A;  4JVI A;  1FBF A;  1OLC A;  4FJP A;  3ILT B;  1QKB A;  3U65 A;  3QK6 A;  2IA4 A;  5CBR A;  5DVF A;  4U22 A;  3TTL A;  1A8F A;  4KCC A;  3MVW A;  5DVI A;  2R8T A;  2ZZV A;  1OVB A;  5LDZ A;  3VLW A;  1LB8 A;  4GIZ A;  1B3E A;  1FBE A;  3FJG A;  4OXV A;  1IMA A;  1FQD A;  2H5Y A;  1IMC A;  3PMV A;  2QVU A;  4ZDM A;  4EQB A;  5IZ3 B;  5A5L A;  1B7U A;  1B3G A;  4LON B;  4G4P A;  4LP2 B;  4P47 A;  3KSJ A;  3C4M A;  4KYS A;  5ISU A;  4JSO A;  1J1N A;  5ET7 A;  1PBQ A;  1FTA A;  4MAG A;  4O7I A;  3TCH A;  1K9Y A;  3PGF A;  4Z7E A;  2HZL A;  4OEN A;  3BKI B;  1JEU A;  5H8N A;  3E9X A;  5I58 B;  4NED A;  4PFT A;  1ZU0 A;  2PCR A;  1LFI A;  1YTV A;  5I2N B;  1MM7 A;  4GL0 A;  4P56 A;  3UP9 A;  1MM6 A;  2PX1 A;  3KBR A;  5AA4 A;  1NNP A;  3DLN A;  1TXF A;  1IXH A;  3ROJ A;  3SEU A;  2YLN A;  4ND9 A;  3RLF E;  1GR2 A;  4AQ4 A;  3PMW A;  2CZL A;  5EQA A;  1MPC A;  2R71 A;  3KZG A;  2FIX A;  4C1U A;  4GXA A;  2QFL A;  3PUW E;  1DMB A;  3T1B A;  2H4I A;  3O6H A;  4P11 A;  3MP6 A;  2OX3 A;  3IOV A;  5FHN A;  1LBV A;  1R6Z A;  3A3C A;  4F31 B;  3GZG A;  4KXP A;  1WOD A;  1I6Q A;  4IO6 A;  4GX3 A;  4PAI A;  3JV9 A;  1URS A;  1B46 A;  1LEV A;  4ZE8 A;  2Z8F A;  4F1Y A;  4H45 A;  3G3J A;  4UAB A;  1H45 A;  1RYO A;  3SEW A;  4PCD A;  3CIJ A;  3BIG A;  2F7A A;  3FAT A;  1RDZ A;  3IOU A;  3R6U A;  4PC9 A;  1NH7 A;  1NV2 A;  1A40 A;  4GX4 A;  1NMU A;  1Y3Q A;  2XXT A;  2ZMB A;  1MRP A;  1B5J A;  3RPL B;  3T66 A;  2ONR A;  4MBP A;  1O63 A;  4ZZE A;  2RCA A;  4F22 A;  2PFY A;  3M3F A;  4YKJ A;  4QSC A;  4NF8 A;  4X8R A;  4IO5 A;  5I3S A;  1KWH A;  2F7B A;  3EQ1 A;  4M4G A;  3PPN A;  2XX8 A;  3GYY A;  5HPQ A;  1IQ7 A;  1GVC A;  1NL5 A;  5CMM A;  4L17 A;  5EQ7 A;  4N4U A;  1FSA A;  5CMB A;  2F35 A;  5H8S A;  1NNT A;  3K2D A;  4FBP A;  2Q2C A;  3FXB A;  3DM0 A;  1RYX A;  5KDT B;  1NV6 A;  1M5E A;  1IME A;  2YPN A;  4PE3 A;  2ALU A;  3LBS A;  5AA3 A;  1CB6 A;  1QW0 A;  2F97 A;  1XI6 A;  4N91 A;  4O3A A;  3MWB A;  4G8M A;  4ISU A;  4OER A;  2XHD A;  3RTF B;  4POW A;  5DVJ A;  4DCY A;  4U4S A;  3C35 A;  2Z8D A;  5IZ3 A;  2B4L A;  4PDD A;  4HTG A;  2VHA A;  4MFI A;  4WKM A;  4OVJ A;  4KFQ A;  2DE4 A;  4NF5 B;  3ODB A;  3T9U A;  3TQW A;  4H0W A;  3V5A A;  1O64 A;  1B2H A;  3C32 A;  4THI A;  2DSF A;  2O7U A;  3QSL A;  2DE3 A;  1EZ9 A;  3IAZ A;  3UGW A;  1XT8 A;  3G3K A;  5FBP A;  5AE4 A;  4PGN A;  2AL5 A;  3C33 A;  1DSN A;  4FEB A;  2ZZW A;  3G3I A;  1FBH A;  3D4G A;  1BIY A;  4GD5 A;  3RNN A;  2QPQ A;  5I2N A;  3L6G A;  2XD3 A;  3RQT A;  5IZ1 A;  4QXD A;  1I69 A;  3MPK A;  1BLF A;  1URD A;  1KA1 A;  2F34 A;  2FIE A;  4GRK A;  2PT1 A;  5ITO A;  5J1D A;  4G8N A;  1VE4 A;  1LBX A;  3TUS A;  2XXW A;  3KOS A;  3K02 A;  4U1Z A;  1IUD A;  3CG1 A;  4OFO A;  2FBP A;  4HW8 A;  1XHY A;  4BDO A;  1JVY A;  3K6V A;  4MLQ A;  1PB9 A;  4O3B A;  4JWY A;  1B4H A;  3KG2 A;  3TYH A;  4RPO A;  2RIN A;  3N6T A;  1G0H A;  2O69 A;  2V3U A;  4RYA A;  1SVX B;  2D21 A;  4KR5 A;  4XF5 A;  4YKI A;  3VXB A;  4GWX A;  3OEK A;  2RKM A;  3K6X A;  5HM4 B;  4OMB A;  4N13 A;  1ZMG A;  5JTY B;  1B1H A;  3VLV A;  1UIV A;  2GRV A;  2XWO A;  3FD3 A;  3IOR A;  2WEF A;  1F9B A;  3RY3 A;  1NKX A;  5ET8 A;  1Z7M E;  1NUX A;  2VOZ A;  1FJ9 A;  1LAG E;  3RPL A;  3ECR A;  1A8E A;  5EYH A;  5I57 B;  1ZIU A;  4LZ7 A;  3ZKL A;  4UA8 A;  1P99 A;  3JYR A;  2XD2 A;  3SES A;  3B7D A;  2P3V A;  4WEP A;  3DP4 A;  3Q25 A;  2B4M A;  1USY E;  4N17 A;  4R9G A;  1QUK A;  3IB0 A;  5H8Q A;  1NV7 A;  1BP5 A;  4F3G A;  4G68 C;  2H99 A;  1FQC A;  3V8X B;  3UN6 A;  1FBD A;  1JQF A;  4ZZA A;  5KDT A;  1FTK A;  3H6V A;  2RC8 A;  2UVI A;  4H5G A;  1AWB A;  1NUZ A;  1IZ1 A;  4NN3 A;  2OK2 A;  1URG A;  3RUM A;  4OEU A;  1VFD A;  4GQO A;  3FVN A;  3B50 A;  4MLV A;  4ZEI A;  4ZE9 A;  4EDP A;  4QFK A;  4NF5 A;  5TP9 B;  1XVX A;  3O66 A;  3B6Q A;  3G7W A;  4ESX A;  1QJM A;  1O7T A;  1Y3P A;  4XXU A;  1B0H A;  3QIM A;  4H5F A;  2WBD A;  1MXY A;  3G3G A;  3WAF A;  1QUL A;  1N7W A;  1USY H;  4QHQ A;  4PDH A;  3EN3 A;  4PF8 A;  5L9M A;  2OWZ A;  4H8I A;  4GVO A;  3FGS A;  3H03 A;  4KCD A;  1JVX A;  4WXJ A;  3MBP A;  5L9S A;  1MS7 A;  1ATG A;  3TMG A;  4R74 A;  3ZS6 A;  3LUY A;  4TQU Q;  1Y1M A;  2DOJ A;  5CM6 A;  4LVQ A;  1MQI A;  3FXQ A;  2DWA A;  3OD7 A;  5KZT A;  5K2X A;  4N07 A;  2THI A;  3LSX A;  3W15 C;  5I5P A;  3ZSF A;  2CZH A;  1PEB A;  3PPP A;  4OFJ A;  3TKD A;  5DT6 A;  3VV5 A;  2DQV A;  3OEM A;  3KOT A;  4NTL A;  4DI3 D;  4EF1 A;  3LV0 A;  3SEV A;  3IO6 A;  4DCX A;  2VGQ A;  3FVK A;  1K9Z A;  4N8Y A;  2O1L A;  1LBY A;  4TLM B;  5I56 B;  4N15 A;  1AMF A;  3CSB A;  3E4R A;  4G77 A;  5JTY A;  2DXY A;  5DYH A;  1HSL A;  1B0L A;  3PUV E;  1P1U A;  2ZYN A;  4RK9 A;  2RC9 A;  3KC1 A;  2XWK A;  2XX7 A;  2PFZ A;  3FJM A;  4YMA A;  2VPO A;  3JZJ A;  3PTY A;  1OIB A;  3MUQ A;  1A99 A;  1FPD A;  3MVX A;  3FJ7 A;  3EHU A;  5F1Q A;  3AXF A;  3VE1 B;  1FQF A;  1SW4 A;  1B58 A;  2CEX A;  3TPA A;  1JW4 A;  3EHS A;  5DEX B;  1EYI A;  1LAX A;  2HPG A;  2O6A A;  3OMB A;  1FPB A;  4EXL A;  2DVC A;  4MNI A;  3MC2 A;  1LBB A;  3T0J A;  5ELV A;  3U8Q A;  3VXC A;  1B3L A;  3VVD A;  1PDA A;  1BKA A;  5EHS A;  1EZO A;  1MY1 A;  2F36 A;  1NUW A;  2ZYO A;  3PUZ E;  2XWI A;  1FQA A;  2QS4 A;  4U2R A;  3A29 A;  3LR1 A;  4XKP A;  2ESN A;  4GWW A;  4NE4 A;  1B3H A;  3N94 A;  1H76 A;  3TDJ A;  1N04 A;  4IR8 A;  4GBV A;  3H6U A;  4H1X A;  5H8H B;  2HQ0 A;  4XKR A;  5TP9 A;  1LAH E;  3TQL A;  2DWI A;  2QJE A;  4GL8 A;  3LUZ A;  2Y5L A;  4BDM A;  2DVZ A;  1VFE A;  3IO4 A;  3T9X B;  4PP0 A;  1GV8 A;  2O68 A;  4XKN A;  3F11 A;  5J16 A;  3MST A;  4ZEF A;  1JW1 A;  2R9J A;  4ELR A;  1RKM A;  4NX1 A;  3OSQ A;  1UTB B;  2Y84 A;  1LCF A;  1TFD A;  4PFU A;  3N26 A;  1FPL A;  2YJP A;  1P1Q A;  2CZK A;  4FAJ A;  1MY0 A;  4HCW A;  3CHG A;  2XXQ A;  5EQ8 A;  4OHN A;  3O28 A;  4QF9 A;  4YKP A; 
#chains in the Genus database with same CATH homology
 2F3B A;  2DE3 A;  2WBB A;  2P3N A;  3EKI A;  4MCO A;  5FBP A;  4PGN A;  4HE1 A;  4MMP A;  1IMD A;  2ZZW A;  3E79 A;  1FBH A;  4YZZ A;  2QPQ A;  1LBW A;  1RDY A;  4OVR A;  5IZZ A;  1NI9 A;  3HFU A;  5IZ1 A;  4QXD A;  1BK4 A;  1NV5 A;  1JP4 A;  1KA1 A;  1FBC A;  2FIE A;  2HXR A;  4YIC A;  5J1D A;  4I3E A;  4OVP A;  4XFE A;  1D9Q A;  1LBX A;  4N8G A;  1EYJ A;  2FVZ A;  2FBP A;  5LTC A;  4MHF A;  4HE2 A;  5IGA A;  3E78 A;  2CZI A;  1FRP A;  4GX6 A;  1G0H A;  1G0I A;  4PFR A;  2Q9T A;  3W9W A;  4XF5 A;  5ESY A;  1DCU A;  4GWX A;  1FPF A;  2XA5 A;  4MNC A;  3KC0 A;  4GWS A;  4MEV A;  4PF6 A;  4OAN A;  2WYK A;  4NQ8 A;  3MYU A;  2XWO A;  4XEQ A;  5EYG A;  4PBQ A;  2WEF A;  2XWV A;  5ET8 A;  1NUX A;  1FJ9 A;  2HHM A;  4F18 A;  2Y5K A;  5I7I A;  3RPL A;  1VDW A;  5EYH A;  3BIH A;  1FJ6 A;  4O94 A;  2HZK A;  4P1L A;  4F1V A;  1YXI A;  2P3V A;  1FBP A;  2B4M A;  4O8M A;  4N17 A;  5T3J A;  2F3D A;  4DI4 B;  4G61 A;  1NV7 A;  2MKZ A;  4O7M A;  1NV3 A;  4PBH A;  4I3Y A;  1FBD A;  2BJI A;  2L5V A;  2FHY A;  4OVS A;  1FPK A;  1AWB A;  1NUZ A;  2KR0 A;  2VPN A;  4NN3 A;  4HXV A;  4H46 A;  4MJO A;  1FPJ A;  4GBW A;  3B50 A;  4JVI A;  1EYK A;  1FBF A;  5DW8 A;  3U65 A;  1FPE A;  2CEY A;  4P3L A;  4P1E A;  2WBD A;  4I40 A;  1YYZ A;  4F19 A;  4PDH A;  3D1R A;  4GWU A;  2R8T A;  4PF8 A;  2OWZ A;  1YZ0 A;  2ZZV A;  5LDZ A;  4NAP A;  3IFA A;  1FBE A;  4OA4 A;  2QVV A;  1IMA A;  1IMC A;  2QVU A;  3W9V A;  5IM2 A;  5IZ3 B;  5A5L A;  5CM6 A;  3ISP A;  3QMF A;  4PET A;  3SZP A;  4P47 A;  1Q9D A;  2Q74 A;  5I5P A;  2WYP A;  4P8B A;  5ET7 A;  2DDK A;  4O7I A;  1FTA A;  3KBZ A;  4MAG A;  1NUY A;  4PAK A;  1RDX A;  1K9Y A;  4X04 A;  2CZH A;  4N6D A;  2HZL A;  5EQ9 A;  1FPG A;  2XXK A;  4OVQ A;  2ZZX A;  4DI3 D;  2PCR A;  3LV0 A;  4N6K A;  4MX6 A;  1K9Z A;  3IFC A;  4N8Y A;  4P56 A;  1LBY A;  4PAF A;  4N15 A;  3NOH A;  1KZ8 A;  3ROJ A;  1NV1 A;  1SPI A;  1FPI A;  5EQA A;  3KC1 A;  2XWK A;  2F5X A;  2PFZ A;  2FIX A;  2JJK A;  5ET6 A;  4AS5 A;  2VPO A;  2QFL A;  4HCY A;  3T1B A;  2V4C A;  2OX3 A;  3PTY A;  4F1U A;  1LBV A;  1FPD A;  5ET5 A;  1NV0 A;  4KXP A;  4GX3 A;  4PAI A;  2Q8M A;  2CEX A;  2V3Q A;  1LEV A;  4OVT A;  1EYI A;  4H45 A;  4LN5 A;  4N81 A;  2HPG A;  4UAB A;  4NHB A;  1FPB A;  4GWZ A;  4MNI A;  4PCD A;  2VT5 A;  3BIG A;  4P9K A;  4HE0 A;  1RDZ A;  1IMF A;  4PC9 A;  4QBA A;  3T0J A;  1NV2 A;  4JVD A;  4GX4 A;  4NG7 A;  1CNQ A;  2WX9 A;  3RPL B;  1NUW A;  2DE2 A;  4NF0 A;  4PFI A;  2XWI A;  4PGP A;  1DBZ A;  3A29 A;  2PFY A;  3RYD A;  5JK4 A;  4X8R A;  4GWW A;  5I3S A;  3GYY A;  4IR8 A;  4M1V A;  1LBZ A;  4GBV A;  5EQ7 A;  1QGX A;  4N4U A;  1FSA A;  1IMB A;  3FBP A;  2QVR A;  4FBP A;  1NV4 A;  3FXB A;  4GWY A;  3LUZ A;  1NV6 A;  1IME A;  2Y5L A;  4NGU A;  4PE3 A;  2DVZ A;  4MNP A;  4AS4 A;  4JVC A;  1INP A;  1XI6 A;  4MIJ A;  4N91 A;  4PFB A;  5J16 A;  3MST A;  5IZ3 A;  2B4L A;  4PDD A;  2KQZ A;  4NX1 A;  1DK4 A;  2DE4 A;  1FPL A;  2CZK A;  4PTK A;  4HCW A;  3CHG A;  5EQ8 A;  1FBG A;  1KA0 A;  5F24 A;  3B8B A;  2GQ1 A;  4X9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...