4MNCA

Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. js666 (bpro_4736), target efi-510156, with bound benzoyl formate, space group p21
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
305
structure length
305
Chain Sequence
QEVTLRLVSAFPENGIYVQRLLPWIAKVNAEGKGVLQINFLGGPKAIPTFEAGNAVKTGVVDMAMNTGAFYTNVMPEADFLKLTQIPVAEQRKNGAFDAINKVWNEKGNTQYLARMVENQPFHIYTNKKIDKPDLSGQKIRISPVYRDFFQALNANVVTTPPGEVYTALERGVVDGYGWPIGGIFDLNWQEKTKFRVDPGFYDAEVSLTMNLPAYKKLTDAQRNYLQKQLLVLEAENTFWTRYGNVETARQETAGIQTIKFDAATSKAFREKAYEVGWAGAMKQSPEVAARFKTLFSKAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Polaromonas sp.
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter-DctP subunit
total genus 113
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mncA00
5I7IA 4O8MA 4PAKA 4P9KA 4PBQA 4PDDA 2HPGA 4PCDA 2ZZVA 4MMPA 4LN5A 5IZZA 4OVRA 4PF6A 4OVQA 2WYKA 4PBHA 4YZZA 3GYYA 2VPNA 4NAPA 2XA5A 3U65A 4NG7A 4NQ8A 4P3LA 4PFBA 4N4UA 4PFRA 5LTCA 4PGPA 3FXBA 4XFEA 4P56A 4DI4B 4PAIA 4X04A 4N17A 4PGNA 2HZKA 4MNPA 4UABA 4X8RA 4XF5A 5I5PA 4MNCA 2PFYA 4PDHA 2PFZA 2CEXA 4OVTA 4MCOA 4N91A 4PE3A 4P1LA 2HZLA 4NX1A 4MNIA 4OANA 2XWIA 4OA4A 2ZZWA 4PETA 2WYPA 4PFIA 2V4CA 4DI3D 2CEYA 4O94A 4PC9A 2XWVA 4MHFA 4P8BA 4MAGA 4P47A 2XXKA 4MX6A 4PF8A 5CM6A 4N6KA 4O7MA 4NGUA 4N6DA 2WX9A 4P1EA 4NHBA 4N8YA 2ZZXA 4N15A 4OVPA 3B50A 5IGAA 2XWOA 4OVSA 4XEQA 4NN3A 4MIJA 4NF0A 5IM2A 2XWKA 4N8GA 2VPOA 4YICA 4MEVA 4PAFA
chains in the Genus database with same CATH superfamily
3UA8A 3IOTA 1ZJLA 4O3AA 3WAFA 4OYVA 3N5LA 2ZYKA 4F19A 1SVXB 3Q26A 4ZEIA 4AS4A 2B4LA 2F6PA 4YAHX 1LBXA 2NWJA 3KSXA 4LA9A 4O7IA 3AXFA 4N4UA 1IIWA 2I0CA 1PC3A 4DXCA 4I9DA 4G77A 1FBDA 2I58A 2UYEA 3K6VA 2NVUB 3S4UA 4PGNA 4GL0A 3FXUA 3SEXA 2V84A 3G3KA 3VVDA 1FJ9A 3FATA 3ILUB 1GGGA 3W15C 5DEXA 2VHAA 2HHMA 4MNCA 3TELA 3CSGA 3PD9A 2PT1A 4NF4A 2L5VA 5IZ3B 1XS5A 1B32A 2ZZWA 4E0WA 1D9VA 4ZE8A 3IORA 1B3HA 2H9BA 4Z0IA 3Q27A 1A7LA 4PC9A 1JP4A 1NI9A 1NNKA 1PB8A 4N6KA 3MVXA 3MP1A 4THIA 1LAGE 1BIYA 4GD5A 4PFYA 4X1DA 5AA4B 1ZU0A 3DELB 4F3PA 5H8SA 3C9HA 5KDTB 3B6TA 2RC8A 1AOVA 1FRPA 1CNQA 5CMMA 5JEIA 3KJTA 4N8GA 4H67A 1N7XA 4H1XA 3T0JA 1P1UA 4Q0CA 3K6WA 5A5XB 4C1TA 1P1WA 5B7DA 4HS7A 1IMFA 1LFGA 1FPFA 1GVCA 2DQVA 4YZZA 5H8HB 2HEUA 3LC8A 3QIMA 4KQPA 3RLFE 3C31A 2XXTA 3PPPA 3TQLA 3MZ9A 3PV0E 1O7TA 5I2KA 3C4MA 3MW0A 3CFXA 4WKMA 3MP8A 5EQAA 5A5LA 3V83A 2QVUA 3VLWA 4N17A 3QXMA 3DLNA 1YXIA 3PGFA 2RINA 3CG1A 1AH5A 2XXVA 3EN3A 1KZ8A 3GLBA 3IX1A 1A8EA 4HCYA 4LVQA 3SKPA 4MNIA 3P7IA 4FORA 2QVRA 1SYIA 2V4CA 4EF2A 1MXXA 4Z7EA 4FAJA 3KZGA 4DCYA 3GXAA 2HQ0A 2KQZA 1USYE 1NNPA 4MAGA 3RT8A 2H5YA 4GX6A 2B3BA 3R7XA 2Q8MA 1FPBA 1HSEA 4I3EA 2QRYA 2ZZXA 4YMAA 1MPBA 2UVJA 1A8FA 4QFNA 1US4A 3S9NC 3RN8A 4C0RA 3B7DA 3PD8A 1B5JA 3TTKA 3QSLA 3QAXA 3S9EA 4LONB 2VPOA 4OFOA 4RPNA 4ZEKA 4RJZA 4IO4A 4MBPA 4GF8A 3D1RA 1M5EA 5KDTA 2BJJX 1LB8A 4QHQA 1DTGA 2HPGA 4AQ4A 2M8CA 3QK6A 3I6VA 4QXDA 3S9MC 1R6ZA 3GYYA 2D5WA 1OMPA 2R9JA 4NMYA 4QRZA 3KGCA 5F7VA 4IO6A 1B4HA 1BK4A 3SERA 3Q29A 4DZ1A 4GWYA 4DI4B 1JW1A 3EHUA 3O9PA 1MRPA 3K01A 2RCAA 3HPIA 5I58B 4PE5B 4JXIA 2PFZA 3SDFA 1IMAA 4QSCA 4KFQA 1FSAA 2I49A 2DOJA 5JTYA 1MDQA 3IJXB 2H25A 1GTKA 4JVDA 4HE1A 1MXWA 2DE2A 4MHFA 1YPNA 2IA4A 3FVGA 2HAVA 4PF8A 4IO5A 5ISUA 1LEVA 5CMCA 1A54A 1US5A 3OD7A 5CBSA 2VD2A 5IGAA 2YLNA 1URSA 2ZMBA 1FBEA 4P11A 1XVXA 5BUUA 5I57B 1LBZA 2DVZA 3M3FA 5IM2A 2DE4A 5AA4A 1BP5A 1B7UA 2G29A 3G3FA 2XXXA 4YICA 1B58A 5IAIA 4U1OA 2Z8EA 4ELOA 4DCXA 3B8BA 3PUYE 4ZE9A 4NF5B 1Y1MA 2QS2A 2FA7A 2VT5A 1B7ZA 2WYKA 1LAHE 3IR1A 2VPNA 4EQBA 1LFIA 5ESYA 5DT6A 2X26A 3CFZA 5I84A 1O63A 4DIGA 2FIXA 3MZBA 3FD3A 1VFDA 3MUQA 2ZXTA 1NV2A 2OBGA 4Q8RA 2AL5A 4KYEA 1UTHA 3G7WA 4IGRA 1YYZA 1Y20A 3L6HA 2XXHA 4H65A 1OQGA 4JWYA 5A5XA 4U1ZA 3CVGA 4OVTA 3KFMA 4MCOA 4P1LA 2REJA 4N13A 4GOTA 1Q9DA 1YAEA 3A29A 1NL5A 1UIUA 3VDFA 2F7AA 3S9LC 2UYFA 1Q1KA 4OWDA 4H8JA 4H6DA 2E1SA 5AA1A 1NUXA 4HCWA 1AWBA 4R9FA 3T1BA 4KXPA 4EF1A 2H4IA 4P1EA 2ONRA 1Z7ME 4PP0A 2DWAA 2GRVA 5I56A 3FJGA 3MVWA 3OO8A 2QMXA 2Y5KA 4XEQA 4MJOA 3K02A 3M8UA 5EQ8A 5FTHA 4H45A 1R9QA 1N3XA 4N6PA 3TQWA 1YTVA 3O28A 3TCFA 1VR5A 2Y7IA 4K3FA 1EZ9A 5I7IA 1SBPA 1FPJA 4OTEA 3PMWA 2Z8FA 3W9WA 4ZEBA 3KC1A 5TP9A 1D9YA 1LAXA 1AL3A 4IB2A 2F34A 4NAPA 2DXRA 4ND9A 4OESA 4NTLA 4EXLA 3FJ7A 1EYKA 2OLBA 4E0XA 4NF6B 1FTJA 4GRKA 3QUFA 4PFRA 2PVUA 1B3EA 1FBPA 3PPQA 3OSQA 1SW2A 2HZKA 4MNPA 3RPLB 5HPQA 2DXYA 1JETA 4G68C 2QS3A 1OLAA 4OFLA 4C1UA 2XXPA 5ICTA 1DK4A 5ET5A 1DOTA 4UACA 1UTHB 3FXRA 3A3CA 4ELQA 3T9XB 2WEFA 2DWIA 2QL3A 3LSLA 4NF8B 1UTBA 3K6XA 1DSNA 3K00A 3PUZE 4F2QA 2Q74A 4RK2A 3E4RA 1P99A 2Z22A 1MQIA 4GX4A 2CZHA 1OIBA 4MLVA 4F3SA 1SW1A 5CC2A 3EHSA 2OZZA 4ZDMA 4JB7A 2Y5LA 3O2AA 1LBCA 4MFIA 5DVIA 3ZSFA 4F39A 3TAJA 3IB2A 4PDDA 4OFJA 3T9VA 4MMPA 2XXYA 4LATA 4RNSA 2DVCA 4ISUA 1HSLA 2Q8JA 3O6IA 2X7PA 3RPWA 4GVOA 3C35A 1SI1A 4PFBA 1B1XA 1M5CA 4BDLA 1L5TA 1H43A 5BWJA 4IO3A 2O69A 3GBBA 4PAIA 1TFAA 1WDNA 4LQ2A 5L9MA 4GBVA 1EZOA 4R74A 5I59A 2XX9A 4N91A 1MY0A 1MY1A 2FHYA 3WAEA 2F7CA 1NKXA 3MPLA 4OANA 4PETA 4OA4A 1ZBMA 3W9VA 1QGXA 4OHNA 3K1NA 3OO6A 3DM0A 4PQJA 2FVZA 2ZYNA 1N84A 4POWA 4G61A 3MZ1A 2P0SA 4GXSB 4MF3A 3PUWE 5FBPA 3H03A 5H8HA 2JJKA 3S2VA 4O3CA 3VVFA 1PB7A 1FPGA 5H8NA 5EYGA 1MY3A 5HBCA 3CFLA 4OMBA 1FTAA 5CMKA 3ECRA 2XXIA 4JBZA 1FQCA 3BBRA 3RGYA 4XKQA 3LUZA 3MVYA 1IITA 2WKYA 4O8MA 1QVSA 2F78A 4PBQA 4ZZEA 5LOMA 3FVKA 1FQEA 3C33A 5DVFA 4OVQA 3GBAA 4ECFA 2O68A 3Q25A 3A3UA 2XA5A 4EUOA 4RY1A 3KC0A 3IJOB 1SD3A 4XKPA 1NNFA 3TYHA 1B5IA 4PGPA 2ABHA 1F9BA 3IB0A 2B4MA 2HAUA 1SDXA 1JEVA 3OELA 3KBZA 5AA2B 4YKJA 3UIFA 4QFLA 2V3QA 4NF5A 3SZPA 5KZTA 2A5SA 1J1NA 1LGBC 1RYXA 1FBHA 4GX3A 3CRBA 1FBCA 4O3BA 5FHNA 2FYIA 4R6KA 5AA2A 1WODA 2F6GA 3IO6A 4U4SA 4KYSA 1VSOA 5EYFA 3IO4A 4O94A 4WXJA 3TODA 4XXUA 3T93B 4ZEFA 5CM6A 1DPPA 1NUYA 4ZEDA 4EDPA 3ZS6A 2AL4A 1NNTA 4F29A 1RDYA 3PPOA 4I62A 4NHBA 2QVVA 2VD3A 3PU5A 2I4BA 1Y3QA 4OVSA 1XI6A 3PPNA 1FPKA 4WEDA 4H5GA 1S7YA 2Q2CA 2ONSA 1JVXA 2ONKE 1B7HA 3ONMA 4U2RA 2F3BA 3EHTA 3ILTB 3MWBA 4TQUQ 4PCDA 1SPIA 1MXVA 4G68B 5KCJA 1ZTYA 1VE4A 3CR9A 3FVNA 1PBPA 1OQHA 2Z8DA 4KHZE 4R2BA 2FNCA 3K6UA 2RF1A 4XIGQ 4JVCA 4OZ9A 3KN7A 3TUSA 2ZNTA 3G3HA 3ISPA 1B3LA 1QJMA 2OWTA 2R8TA 1NV3A 3HN0A 1NV5A 1IMBA 1NV6A 3O66A 2Q2AA 4PE3A 3VE1B 3RT6B 1MY2A 3N26A 4PFIA 2ZYOA 3LV0A 1DMBA 2F8DA 1QW0A 1R1NA 3UP9A 5FHOA 1EU8A 1OVBA 5ET6A 1IXGA 3E78A 3RYDA 4M4GA 5AA2D 4O7MA 2F5XA 3K2DA 4N8YA 5TP9B 1FQFA 4U4XA 3RUMA 3CIJA 2XHDA 3QYTA 5EHSA 4R75A 1I6QA 3USDA 2UXAA 4N81A 3N94A 2VP1A 1B9JA 2VGQA 4MEVA 4HE0A 2AYSA 3Q28A 1MPDA 3HHGA 1FQBA 2ESNA 1FPEA 3VLUA 3H3GA 3DP6A 3U65A 3E3KA 1VFEA 4R72A 3OXNA 1B4ZA 5H8QA 3HV1A 4QSEA 4G8NA 4FJPA 2HCAA 4BDMA 5FHMA 1IXHA 3MJNA 1IEJA 1NMUA 1QKAA 2DWHA 3OOAA 4OEVA 3PMXA 3SESA 1A99A 4YU0A 1II5A 2DS9A 3ROJA 5EHMA 4ESWA 1FPLA 2A5TA 4YB7A 2V3TA 3IFAA 2V3UA 4JDFA 1LLSA 1MM6A 4QFKA 4KR5A 4Q5TA 4KI0E 5AA3A 4NWCA 5ITPA 1ZMGA 3IOWA 1LCFA 4P8BA 1SYHA 5I2KB 1HSJA 1N3WA 1NH7A 5J1DA 1XC1A 4OQOA 1QUJA 1TT1A 4YMBA 3D4GA 3IFCA 5K2YA 4N15A 1SQYA 3PUVE 1IQ7A 5F1QA 4OEUA 4AB6A 5AE4A 3K0VA 4X1BA 2I3WA 1JW5A 3TFLA 4I3YA 1TFDA 3A09A 4KYDA 1JVYA 2XWKA 2I3VA 1B1HA 1IUDA 1JEUA 3KEIA 1B3FA 3FV2A 4I8CA 3FVOA 3MBPA 3TEPA 1BKAA 1SW4A 1DCUA 1H44A 3H6WA 1LCTA 2X7QA 3K4UA 3TTRA 3BIGA 2XD2A 3LSXA 3BKIB 4RA1A 4R6HA 3U72A 3KOTA 3R6UA 3RPLA 3CSBA 3HO7A 4OXVA 5CI5A 4FE8A 1EZPA 2P3NA 4U21A 4JVIA 4XF5A 5IKBA 5I5PA 5L9SA 4BDQA 3KN8A 3DP8A 2GHBA 4GWXA 4G4PA 5H8QB 3V8XB 1IZ1A 4R6YA 2CEXA 3VFJA 2B65A 3L6GA 4OVJA 1Y4CA 4DDDA 4GWZA 4OETA 4OENA 1POY1 2XWIA 1LBWA 4G68A 5KCJB 2CEYA 3OO9A 2Y7RA 2I48A 1USYH 4JSOA 4LZ8A 4YB5A 3G3IA 4X48A 3PUXE 2R6GE 2F97A 3RQTA 3CI8A 3G3GA 3G3JA 2OWZA 2O6AA 1VDWA 1ZLQA 4ZZAA 1PDAA 5I56B 4DXUA 2D21A 4X9TA 3FGSA 5L8DA 4JSDA 4NF0A 4FATA 3EQ1A 3LSWA 2XXRA 4YB6A 4PAFA 2NOOA 3FIRA 2I6EA 2REGA 5M2VA 2XXUA 1B5HA 1NH8A 4U23A 4OVRA 3FZVA 3JZJA 3T96B 2O1LA 5K2XA 2O51A 1AMFA 3ZKLA 4NQ8A 3M3LA 4H8IA 3HHFA 1FQAA 2OWSA 5I59B 4LZ7A 4BDOA 5L9OA 4GWOA 1LFHA 5B70A 3KBRA 1M5BA 2PBWA 4YKIA 2YPNA 4G2ZA 1UIVA 4UABA 2GH9A 3JYRA 3IOVA 3T66A 3MP6A 3VV5A 2RC9A 4GIZA 1MM7A 4FIMA 4IR8A 5T3JA 3RNNA 3FV1A 1KA0A 2QS1A 1FPIA 1B0HA 1I69A 3OEMA 1PEBA 5TPAB 2UVHA 3GZGA 4KD5A 3MC2A 4I1DA 2XX7A 1IXIA 4GLIA 3HCQA 3E79A 4LP2B 1EYIA 4QFOA 2F3DA 4F18A 3IOUA 4NF8A 3FBPA 1MXYA 4YKKA 2ZNSA 2PCRA 2F35A 3I3VA 2CZKA 1B52A 3TTNA 4ESXA 2XD3A 2OCUA 5LDZA 4NN3A 2QJEA 4G8MA 4TLMB 3E13X 2IEEA 5FTIA 1CE2A 2I0BA 3MSTA 2FIEA 1SW5A 2RC7A 4PAKA 3T22A 4FBPA 1I6BA 1TXFA 1XVYA 2QFLA 2QS4A 2YJPA 1FCKA 4F1YA 1P1QA 4LN5A 3LSFB 3F11A 4IO2A 3PMVA 4P3LA 2GHAA 1FTMA 5EYHA 1LBBA 1P1NA 3QMFA 3O29A 2KLFA 3EKIA 4TOZA 2WBDA 4JWOA 3HSTA 1IMEA 1INPA 4IGTA 5J16A 4IY5A 5DEXB 1RDZA 1S50A 3FUZA 3VXCA 3TKDA 4GXAA 1M5DA 2QMWA 4YKPA 4H46A 3LR1A 1QULA 4ZS9A 3TCGA 1Y3PA 2DDKA 2UVIA 1GR2A 2DYXA 1D4NA 3KG2A 2PX1A 2ALUA 4L17A 3TCHA 3U1OA 5HM4B 1LSTA 2XWVA 1LB9A 3PTYA 2XXKA 4MX6A 1YZ0A 1DTZA 1MH3A 2WX9A 4F3BA 1MQDA 2QSXA 1Q35A 2Q9TA 3MQ9A 1N7WA 2CZIA 3BFTA 5DVJA 4GL8A 4N07A 5CRYA 1XT8A 1MPCA 5JK4A 1B2HA 3MYUA 4BLAA 1OLCA 1S9TA 2R71A 4KCDA 5TPAA 2ZZVA 5TU0A 5ELVA 1TWYA 3ODBA 1H45A 1Y3NA 3HFUA 1N0TA 4NG7A 3H6TA 1AIVA 2Y84A 3R26A 3I5OA 4PFTA 2RKMA 1A55A 2A5TB 3FXBA 4F2OA 1NUWA 1FTLA 3RY3A 3V5AA 1FW0A 2F7BA 4QFPA 4DXBA 4X04A 2FBPA 3OO7A 5EQ9A 2NXOA 3EF7A 3TTMA 4FEBA 1T0KA 3VXBA 1MXUA 3OENA 5ET7A 4BDRA 1OVTA 4GWUA 1JW4A 4BDNA 1PB9A 4NX1A 3THIA 3OEKA 2CMOA 4R9GA 3ZKKA 2DWJA 1B05A 3RTFB 3V89B 1MQHA 2P3VA 1A40A 4M1VA 2XXWA 4ELPA 1B3GA 2ZNUA 1R9LA 4LZ5A 4NWDA 5ICQA 1D9QA 3K1PA 3B50A 1N04A 3E9XA 4HXVA 3FXQA 4ONYA 1MG1A 2H99A 2HFBA 3NOHA 1MQJA 2WBBA 2OX3A 3IAZA 1UTBB 1DPEA 4DE8A 4IO7A 3H6UA 2VOZA 4R2FA 3T9HB 3OMBA 2O84X 5H8NB 3KSJA 2F36A 3IB1A 4LQ5A 4ZECA 5H8FA 5IZZA 4PBHA 1RDXA 1G0HA 4KPTA 1BTJA 3CG3A 5I2NB 3TPAA 1MQGA 2MKZA 4P56A 4Q30B 1M5FA 1LAFE 1IMCA 4UA8A 2H98A 3MAMA 1JQFA 2THIA 4X8RA 1ZKBA 1MXZA 1CB6A 2GFEA 2KR0A 2PFYA 4DLDA 3FASA 1G0IA 2OK2A 1H76A 1QKBA 2HZLA 1XOCA 3UORA 1WVJA 4PFWA 3C32A 2V25A 1LBVA 1KA1A 1NV0A 3T9UA 3BIHA 1LBYA 2Q88A 3LUYA 5I3SA 1FBGA 4GBWA 3RTWB 3CHGA 4P0GA 2AIXA 4WEPA 4RK9A 5I57A 4OVPA 2ZYMA 3DP4A 3FJMA 3SEUA 1NFTA 1NUZA 4XKRA 1MS7A 3VVEA 2OJTA 1Y1ZA 2Y7KA 4F3GA 4FECA 4LUBA 4EXKA 1YCJA 2GQ1A 2O7IA 3TMGA 4EQ7A 1B6HA 2UVGA 3U92A 3K1MA 3IL1B 2CZLA 1FTOA 2G93A 4MLQA 4NF4B 1FBFA 3SEVA 5F24A 3EPEA 3PPRA 1FQDA 3MVZA 4U22A 3H4ZA 4XTCQ 4PF6A 4HE2A 4NE4A 1IMDA 3VLVA 1Y4TA 1BLFA 2DP8A 3KN3A 1FTKA 5ET8A 3B6QA 3KJ7A 4RYAA 4F1VA 2BJIA 4R73A 1ELJA 1URGA 4JWXA 1QUIA 1H3DA 4AB5A 4NF6A 2O1MA 3U93A 3TDJA 4QF9A 3MPKA 2V93A 1P1OA 5H8FB 4P0IA 1EYJA 3H06B 4EQ9A 2O7UA 2RCBA 1SI0A 2Y7WA 3TTLA 1B46A 2DSFA 3H7MA 4H0WA 2PYYA 4NGUA 4N6DA 3C34A 1XHYA 1NV4A 2D3IA 4NEDA 1UQWA 3O97A 5IZ1A 1K9ZA 2XWOA 4F1UA 1POTA 3N6TA 2I4CA 2W7YA 4GQOA 5DW8A 5JTYB 1B40A 1MH4A 2HXWA 4I40A 5IZ3A 3UGWA 5DTBA 3N6UA 2DE3A 4P9KA 3SEWA 2P2AA 3B6WA 5I58A 4TLLB 3OSRA 3U8QA 1QUKA 1RYOA 4GWSA 4RXLA 4XKNA 3SEYA 2Q89A 2Y7PA 5CBRA 3D4CA 1I6AA 1MY4A 4HTGA 5DYHA 4OERA 2XXQA 4KCCA 5LTCA 1ZIUA 1K9YA 1ATGA 4XFEA 3U94A 2E0SA 4F31B 4HW8A 4POXA 2ANJA 1EH3A 4FEDA 2XX8A 4G8HA 1Z7NE 4AS5A 2HXRA 1NV1A 1KWHA 1GV8A 1RKMA 4PDHA 4PTKA 4MH5A 1FJ6A 3O6GA 4F22A 5EQ7A 3JV9A 1IXCA 4IY6A 1O64A 2WYPA 3H6VA 1D3KA 2B3FA 4DI3D 4GFRA 3SETA 3KOSA 3TZAA 2LAOA 1ANFA 5I2NA 4P47A 3UN6A 1JNFA 3M3KA 1URDA 3BFUA 4ELRA 1NV7A 3LBSA 4H5FA 1FPDA 3QUJA 1B51A 3UK4A 3O6HA 4GWWA 1PBQA 3IK6B 2NUVA 2QPQA 1N76A 4PFUA 3C36A 1Y9UA 5ITOA 4MIJA 5CMBA 1DBZA 2PT2A 2P1SA 1MDP1 1B0LA 2PMSA 4QSDA 4QBAA 4RPOA 2Z23A
chains in the Genus database with same CATH topology
4HE0A 2FIEA 3T0JA 3D1RA 5I7IA 5JK4A 2F3BA 4O8MA 1FBFA 3MYUA 2DE3A 1FPJA 4PAKA 4P9KA 3B8BA 4PBQA 4FBPA 4PDDA 2HPGA 5F24A 2QFLA 4PCDA 1IMFA 2ZZVA 4QXDA 4MMPA 3W9WA 1SPIA 1DCUA 4LN5A 1FPFA 3KC1A 1FPEA 4F19A 2VT5A 5IZZA 4OVRA 4PF6A 4OVQA 5IM2A 2WYKA 4GWSA 4PBHA 1RDXA 4HE2A 4YZZA 4AS4A 3GYYA 2B4LA 2VPNA 5ESYA 4NAPA 1LBXA 1IMDA 1G0HA 2XA5A 3BIGA 3HFUA 4NG7A 4NQ8A 3U65A 3KC0A 4O7IA 4P3LA 1EYKA 5EYHA 4JVCA 3QMFA 5ET8A 3EKIA 2FIXA 2WBDA 4PFBA 4N4UA 4PFRA 5LTCA 1K9YA 4PGPA 1IMEA 3FXBA 4XFEA 1INPA 1BK4A 4PETA 5J16A 1NUWA 4PTKA 3ISPA 5EQAA 2MKZA 1RDZA 3MSTA 4GWYA 4P56A 3RPLA 2B4MA 2QVUA 1FBPA 4DI4B 1NV2A 4PAIA 5A5LA 4X04A 1IMCA 1FBDA 2FBPA 3KBZA 4N17A 4PGNA 4AS5A 2HXRA 5EQ9A 2HZKA 4MNPA 1YXIA 4F1VA 1NV1A 1YYZA 4UABA 2V3QA 1FJ9A 2P3NA 2BJIA 4JVIA 4X8RA 4XF5A 3RPLB 5I5PA 2R8TA 3SZPA 4GBVA 2HHMA 1NV3A 3ROJA 4MNCA 1NV5A 1KZ8A 4GWXA 2KR0A 2PFYA 1IMBA 1FPLA 4PDHA 4H46A 5ET7A 2PFZA 3IFAA 1FBHA 1NV6A 4GX3A 1DK4A 2CEXA 2L5VA 1IMAA 1FJ6A 1G0IA 4HCYA 4MCOA 4N91A 4OVTA 5EQ7A 4GWUA 4P1LA 2HZLA 2FHYA 4PE3A 4GWZA 1FBCA 1FSAA 5ET5A 4NX1A 4IR8A 4MNIA 5T3JA 1Q9DA 2XWIA 3A29A 2ZZWA 4OA4A 4OANA 1LBWA 2QVRA 1QGXA 2DDKA 2WYPA 3LV0A 2V4CA 4PFIA 3W9VA 1KA0A 1LBVA 1FPIA 4DI3D 1KA1A 2CEYA 2WEFA 4JVDA 1NV0A 3BIHA 1EYJA 1LBYA 4HE1A 2FVZA 4O94A 2KQZA 2P3VA 4PC9A 2DE2A 2XWVA 1JP4A 4G61A 4MHFA 1NI9A 5ET6A 5I3SA 3E78A 3RYDA 4P8BA 4MAGA 1FBGA 1NUXA 4HCWA 4M1VA 3PTYA 4P47A 2XXKA 4MX6A 3E79A 5J1DA 1AWBA 4GBWA 4PF8A 5CM6A 4GX6A 1EYIA 1NUYA 3CHGA 1YZ0A 4N6KA 4KXPA 4O7MA 2F5XA 3T1BA 1LEVA 1NV7A 2F3DA 4N6DA 1FPDA 1FPBA 4NGUA 2JJKA 1NV4A 2WX9A 2Q8MA 4F18A 5FBPA 1RDYA 3IFCA 4I3EA 1D9QA 2Q74A 2ZZXA 3FBPA 2QVVA 4N8YA 4NHBA 4N15A 4OVPA 2OWZA 3B50A 4GWWA 1FPGA 2PCRA 5EYGA 4HXVA 5IGAA 1NUZA 5IZ1A 1K9ZA 1VDWA 2QPQA 2Q9TA 2XWOA 2CZKA 2CZIA 2Y5KA 4F1UA 4NN3A 1FBEA 1FTAA 4OVSA 4XEQA 4MJOA 1XI6A 5IZ3B 1LBZA 4X9TA 5EQ8A 3NOHA 4H45A 4N81A 5LDZA 2DVZA 4MIJA 4NF0A 2DE4A 4GX4A 1FPKA 2WBBA 2GQ1A 1FRPA 1CNQA 4P1EA 3LUZA 1DBZA 2CZHA 2OX3A 5DW8A 5IZ3A 4I3YA 2XWKA 4N8GA 2VPOA 4I40A 4QBAA 4YICA 4MEVA 2Y5LA 4PAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I7I A;  4O8M A;  4PAK A;  4P9K A;  4PBQ A;  4PDD A;  2HPG A;  4PCD A;  2ZZV A;  4MMP A;  4LN5 A;  5IZZ A;  4OVR A;  4PF6 A;  4OVQ A;  2WYK A;  4PBH A;  4YZZ A;  3GYY A;  2VPN A;  4NAP A;  2XA5 A;  3U65 A;  4NG7 A;  4NQ8 A;  4P3L A;  4PFB A;  4N4U A;  4PFR A;  5LTC A;  4PGP A;  3FXB A;  4XFE A;  4P56 A;  4DI4 B;  4PAI A;  4X04 A;  4N17 A;  4PGN A;  2HZK A;  4MNP A;  4UAB A;  4X8R A;  4XF5 A;  5I5P A;  4MNC A;  2PFY A;  4PDH A;  2PFZ A;  2CEX A;  4OVT A;  4MCO A;  4N91 A;  4PE3 A;  4P1L A;  2HZL A;  4NX1 A;  4MNI A;  4OAN A;  2XWI A;  4OA4 A;  2ZZW A;  4PET A;  2WYP A;  4PFI A;  2V4C A;  4DI3 D;  2CEY A;  4O94 A;  4PC9 A;  2XWV A;  4MHF A;  4P8B A;  4MAG A;  4P47 A;  2XXK A;  4MX6 A;  4PF8 A;  5CM6 A;  4N6K A;  4O7M A;  4NGU A;  4N6D A;  2WX9 A;  4P1E A;  4NHB A;  4N8Y A;  2ZZX A;  4N15 A;  4OVP A;  3B50 A;  5IGA A;  2XWO A;  4OVS A;  4XEQ A;  4NN3 A;  4MIJ A;  4NF0 A;  5IM2 A;  2XWK A;  4N8G A;  2VPO A;  4YIC A;  4MEV A;  4PAF A; 
#chains in the Genus database with same CATH topology
 3UA8 A;  3IOT A;  1ZJL A;  4O3A A;  3WAF A;  4OYV A;  3N5L A;  2ZYK A;  4F19 A;  1SVX B;  3Q26 A;  4ZEI A;  4AS4 A;  2B4L A;  2F6P A;  4YAH X;  1LBX A;  2NWJ A;  3KSX A;  4LA9 A;  4O7I A;  3AXF A;  4N4U A;  1IIW A;  2I0C A;  1PC3 A;  4DXC A;  4I9D A;  4G77 A;  1FBD A;  2I58 A;  2UYE A;  3K6V A;  2NVU B;  3S4U A;  4PGN A;  4GL0 A;  3FXU A;  3SEX A;  2V84 A;  3G3K A;  3VVD A;  1FJ9 A;  3FAT A;  3ILU B;  1GGG A;  3W15 C;  5DEX A;  2VHA A;  2HHM A;  4MNC A;  3TEL A;  3CSG A;  3PD9 A;  2PT1 A;  4NF4 A;  2L5V A;  5IZ3 B;  1XS5 A;  1B32 A;  2ZZW A;  4E0W A;  1D9V A;  4ZE8 A;  3IOR A;  1B3H A;  2H9B A;  4Z0I A;  3Q27 A;  1A7L A;  4PC9 A;  1JP4 A;  1NI9 A;  1NNK A;  1PB8 A;  4N6K A;  3MVX A;  3MP1 A;  4THI A;  1LAG E;  1BIY A;  4GD5 A;  4PFY A;  4X1D A;  5AA4 B;  1ZU0 A;  3DEL B;  4F3P A;  5H8S A;  3C9H A;  5KDT B;  3B6T A;  2RC8 A;  1AOV A;  1FRP A;  1CNQ A;  5CMM A;  5JEI A;  3KJT A;  4N8G A;  4H67 A;  1N7X A;  4H1X A;  3T0J A;  1P1U A;  4Q0C A;  3K6W A;  5A5X B;  4C1T A;  1P1W A;  5B7D A;  4HS7 A;  1IMF A;  1LFG A;  1FPF A;  1GVC A;  2DQV A;  4YZZ A;  5H8H B;  2HEU A;  3LC8 A;  3QIM A;  4KQP A;  3RLF E;  3C31 A;  2XXT A;  3PPP A;  3TQL A;  3MZ9 A;  3PV0 E;  1O7T A;  5I2K A;  3C4M A;  3MW0 A;  3CFX A;  4WKM A;  3MP8 A;  5EQA A;  5A5L A;  3V83 A;  2QVU A;  3VLW A;  4N17 A;  3QXM A;  3DLN A;  1YXI A;  3PGF A;  2RIN A;  3CG1 A;  1AH5 A;  2XXV A;  3EN3 A;  1KZ8 A;  3GLB A;  3IX1 A;  1A8E A;  4HCY A;  4LVQ A;  3SKP A;  4MNI A;  3P7I A;  4FOR A;  2QVR A;  1SYI A;  2V4C A;  4EF2 A;  1MXX A;  4Z7E A;  4FAJ A;  3KZG A;  4DCY A;  3GXA A;  2HQ0 A;  2KQZ A;  1USY E;  1NNP A;  4MAG A;  3RT8 A;  2H5Y A;  4GX6 A;  2B3B A;  3R7X A;  2Q8M A;  1FPB A;  1HSE A;  4I3E A;  2QRY A;  2ZZX A;  4YMA A;  1MPB A;  2UVJ A;  1A8F A;  4QFN A;  1US4 A;  3S9N C;  3RN8 A;  4C0R A;  3B7D A;  3PD8 A;  1B5J A;  3TTK A;  3QSL A;  3QAX A;  3S9E A;  4LON B;  2VPO A;  4OFO A;  4RPN A;  4ZEK A;  4RJZ A;  4IO4 A;  4MBP A;  4GF8 A;  3D1R A;  1M5E A;  5KDT A;  2BJJ X;  1LB8 A;  4QHQ A;  1DTG A;  2HPG A;  4AQ4 A;  2M8C A;  3QK6 A;  3I6V A;  4QXD A;  3S9M C;  1R6Z A;  3GYY A;  2D5W A;  1OMP A;  2R9J A;  4NMY A;  4QRZ A;  3KGC A;  5F7V A;  4IO6 A;  1B4H A;  1BK4 A;  3SER A;  3Q29 A;  4DZ1 A;  4GWY A;  4DI4 B;  1JW1 A;  3EHU A;  3O9P A;  1MRP A;  3K01 A;  2RCA A;  3HPI A;  5I58 B;  4PE5 B;  4JXI A;  2PFZ A;  3SDF A;  1IMA A;  4QSC A;  4KFQ A;  1FSA A;  2I49 A;  2DOJ A;  5JTY A;  1MDQ A;  3IJX B;  2H25 A;  1GTK A;  4JVD A;  4HE1 A;  1MXW A;  2DE2 A;  4MHF A;  1YPN A;  2IA4 A;  3FVG A;  2HAV A;  4PF8 A;  4IO5 A;  5ISU A;  1LEV A;  5CMC A;  1A54 A;  1US5 A;  3OD7 A;  5CBS A;  2VD2 A;  5IGA A;  2YLN A;  1URS A;  2ZMB A;  1FBE A;  4P11 A;  1XVX A;  5BUU A;  5I57 B;  1LBZ A;  2DVZ A;  3M3F A;  5IM2 A;  2DE4 A;  5AA4 A;  1BP5 A;  1B7U A;  2G29 A;  3G3F A;  2XXX A;  4YIC A;  1B58 A;  5IAI A;  4U1O A;  2Z8E A;  4ELO A;  4DCX A;  3B8B A;  3PUY E;  4ZE9 A;  4NF5 B;  1Y1M A;  2QS2 A;  2FA7 A;  2VT5 A;  1B7Z A;  2WYK A;  1LAH E;  3IR1 A;  2VPN A;  4EQB A;  1LFI A;  5ESY A;  5DT6 A;  2X26 A;  3CFZ A;  5I84 A;  1O63 A;  4DIG A;  2FIX A;  3MZB A;  3FD3 A;  1VFD A;  3MUQ A;  2ZXT A;  1NV2 A;  2OBG A;  4Q8R A;  2AL5 A;  4KYE A;  1UTH A;  3G7W A;  4IGR A;  1YYZ A;  1Y20 A;  3L6H A;  2XXH A;  4H65 A;  1OQG A;  4JWY A;  5A5X A;  4U1Z A;  3CVG A;  4OVT A;  3KFM A;  4MCO A;  4P1L A;  2REJ A;  4N13 A;  4GOT A;  1Q9D A;  1YAE A;  3A29 A;  1NL5 A;  1UIU A;  3VDF A;  2F7A A;  3S9L C;  2UYF A;  1Q1K A;  4OWD A;  4H8J A;  4H6D A;  2E1S A;  5AA1 A;  1NUX A;  4HCW A;  1AWB A;  4R9F A;  3T1B A;  4KXP A;  4EF1 A;  2H4I A;  4P1E A;  2ONR A;  1Z7M E;  4PP0 A;  2DWA A;  2GRV A;  5I56 A;  3FJG A;  3MVW A;  3OO8 A;  2QMX A;  2Y5K A;  4XEQ A;  4MJO A;  3K02 A;  3M8U A;  5EQ8 A;  5FTH A;  4H45 A;  1R9Q A;  1N3X A;  4N6P A;  3TQW A;  1YTV A;  3O28 A;  3TCF A;  1VR5 A;  2Y7I A;  4K3F A;  1EZ9 A;  5I7I A;  1SBP A;  1FPJ A;  4OTE A;  3PMW A;  2Z8F A;  3W9W A;  4ZEB A;  3KC1 A;  5TP9 A;  1D9Y A;  1LAX A;  1AL3 A;  4IB2 A;  2F34 A;  4NAP A;  2DXR A;  4ND9 A;  4OES A;  4NTL A;  4EXL A;  3FJ7 A;  1EYK A;  2OLB A;  4E0X A;  4NF6 B;  1FTJ A;  4GRK A;  3QUF A;  4PFR A;  2PVU A;  1B3E A;  1FBP A;  3PPQ A;  3OSQ A;  1SW2 A;  2HZK A;  4MNP A;  3RPL B;  5HPQ A;  2DXY A;  1JET A;  4G68 C;  2QS3 A;  1OLA A;  4OFL A;  4C1U A;  2XXP A;  5ICT A;  1DK4 A;  5ET5 A;  1DOT A;  4UAC A;  1UTH B;  3FXR A;  3A3C A;  4ELQ A;  3T9X B;  2WEF A;  2DWI A;  2QL3 A;  3LSL A;  4NF8 B;  1UTB A;  3K6X A;  1DSN A;  3K00 A;  3PUZ E;  4F2Q A;  2Q74 A;  4RK2 A;  3E4R A;  1P99 A;  2Z22 A;  1MQI A;  4GX4 A;  2CZH A;  1OIB A;  4MLV A;  4F3S A;  1SW1 A;  5CC2 A;  3EHS A;  2OZZ A;  4ZDM A;  4JB7 A;  2Y5L A;  3O2A A;  1LBC A;  4MFI A;  5DVI A;  3ZSF A;  4F39 A;  3TAJ A;  3IB2 A;  4PDD A;  4OFJ A;  3T9V A;  4MMP A;  2XXY A;  4LAT A;  4RNS A;  2DVC A;  4ISU A;  1HSL A;  2Q8J A;  3O6I A;  2X7P A;  3RPW A;  4GVO A;  3C35 A;  1SI1 A;  4PFB A;  1B1X A;  1M5C A;  4BDL A;  1L5T A;  1H43 A;  5BWJ A;  4IO3 A;  2O69 A;  3GBB A;  4PAI A;  1TFA A;  1WDN A;  4LQ2 A;  5L9M A;  4GBV A;  1EZO A;  4R74 A;  5I59 A;  2XX9 A;  4N91 A;  1MY0 A;  1MY1 A;  2FHY A;  3WAE A;  2F7C A;  1NKX A;  3MPL A;  4OAN A;  4PET A;  4OA4 A;  1ZBM A;  3W9V A;  1QGX A;  4OHN A;  3K1N A;  3OO6 A;  3DM0 A;  4PQJ A;  2FVZ A;  2ZYN A;  1N84 A;  4POW A;  4G61 A;  3MZ1 A;  2P0S A;  4GXS B;  4MF3 A;  3PUW E;  5FBP A;  3H03 A;  5H8H A;  2JJK A;  3S2V A;  4O3C A;  3VVF A;  1PB7 A;  1FPG A;  5H8N A;  5EYG A;  1MY3 A;  5HBC A;  3CFL A;  4OMB A;  1FTA A;  5CMK A;  3ECR A;  2XXI A;  4JBZ A;  1FQC A;  3BBR A;  3RGY A;  4XKQ A;  3LUZ A;  3MVY A;  1IIT A;  2WKY A;  4O8M A;  1QVS A;  2F78 A;  4PBQ A;  4ZZE A;  5LOM A;  3FVK A;  1FQE A;  3C33 A;  5DVF A;  4OVQ A;  3GBA A;  4ECF A;  2O68 A;  3Q25 A;  3A3U A;  2XA5 A;  4EUO A;  4RY1 A;  3KC0 A;  3IJO B;  1SD3 A;  4XKP A;  1NNF A;  3TYH A;  1B5I A;  4PGP A;  2ABH A;  1F9B A;  3IB0 A;  2B4M A;  2HAU A;  1SDX A;  1JEV A;  3OEL A;  3KBZ A;  5AA2 B;  4YKJ A;  3UIF A;  4QFL A;  2V3Q A;  4NF5 A;  3SZP A;  5KZT A;  2A5S A;  1J1N A;  1LGB C;  1RYX A;  1FBH A;  4GX3 A;  3CRB A;  1FBC A;  4O3B A;  5FHN A;  2FYI A;  4R6K A;  5AA2 A;  1WOD A;  2F6G A;  3IO6 A;  4U4S A;  4KYS A;  1VSO A;  5EYF A;  3IO4 A;  4O94 A;  4WXJ A;  3TOD A;  4XXU A;  3T93 B;  4ZEF A;  5CM6 A;  1DPP A;  1NUY A;  4ZED A;  4EDP A;  3ZS6 A;  2AL4 A;  1NNT A;  4F29 A;  1RDY A;  3PPO A;  4I62 A;  4NHB A;  2QVV A;  2VD3 A;  3PU5 A;  2I4B A;  1Y3Q A;  4OVS A;  1XI6 A;  3PPN A;  1FPK A;  4WED A;  4H5G A;  1S7Y A;  2Q2C A;  2ONS A;  1JVX A;  2ONK E;  1B7H A;  3ONM A;  4U2R A;  2F3B A;  3EHT A;  3ILT B;  3MWB A;  4TQU Q;  4PCD A;  1SPI A;  1MXV A;  4G68 B;  5KCJ A;  1ZTY A;  1VE4 A;  3CR9 A;  3FVN A;  1PBP A;  1OQH A;  2Z8D A;  4KHZ E;  4R2B A;  2FNC A;  3K6U A;  2RF1 A;  4XIG Q;  4JVC A;  4OZ9 A;  3KN7 A;  3TUS A;  2ZNT A;  3G3H A;  3ISP A;  1B3L A;  1QJM A;  2OWT A;  2R8T A;  1NV3 A;  3HN0 A;  1NV5 A;  1IMB A;  1NV6 A;  3O66 A;  2Q2A A;  4PE3 A;  3VE1 B;  3RT6 B;  1MY2 A;  3N26 A;  4PFI A;  2ZYO A;  3LV0 A;  1DMB A;  2F8D A;  1QW0 A;  1R1N A;  3UP9 A;  5FHO A;  1EU8 A;  1OVB A;  5ET6 A;  1IXG A;  3E78 A;  3RYD A;  4M4G A;  5AA2 D;  4O7M A;  2F5X A;  3K2D A;  4N8Y A;  5TP9 B;  1FQF A;  4U4X A;  3RUM A;  3CIJ A;  2XHD A;  3QYT A;  5EHS A;  4R75 A;  1I6Q A;  3USD A;  2UXA A;  4N81 A;  3N94 A;  2VP1 A;  1B9J A;  2VGQ A;  4MEV A;  4HE0 A;  2AYS A;  3Q28 A;  1MPD A;  3HHG A;  1FQB A;  2ESN A;  1FPE A;  3VLU A;  3H3G A;  3DP6 A;  3U65 A;  3E3K A;  1VFE A;  4R72 A;  3OXN A;  1B4Z A;  5H8Q A;  3HV1 A;  4QSE A;  4G8N A;  4FJP A;  2HCA A;  4BDM A;  5FHM A;  1IXH A;  3MJN A;  1IEJ A;  1NMU A;  1QKA A;  2DWH A;  3OOA A;  4OEV A;  3PMX A;  3SES A;  1A99 A;  4YU0 A;  1II5 A;  2DS9 A;  3ROJ A;  5EHM A;  4ESW A;  1FPL A;  2A5T A;  4YB7 A;  2V3T A;  3IFA A;  2V3U A;  4JDF A;  1LLS A;  1MM6 A;  4QFK A;  4KR5 A;  4Q5T A;  4KI0 E;  5AA3 A;  4NWC A;  5ITP A;  1ZMG A;  3IOW A;  1LCF A;  4P8B A;  1SYH A;  5I2K B;  1HSJ A;  1N3W A;  1NH7 A;  5J1D A;  1XC1 A;  4OQO A;  1QUJ A;  1TT1 A;  4YMB A;  3D4G A;  3IFC A;  5K2Y A;  4N15 A;  1SQY A;  3PUV E;  1IQ7 A;  5F1Q A;  4OEU A;  4AB6 A;  5AE4 A;  3K0V A;  4X1B A;  2I3W A;  1JW5 A;  3TFL A;  4I3Y A;  1TFD A;  3A09 A;  4KYD A;  1JVY A;  2XWK A;  2I3V A;  1B1H A;  1IUD A;  1JEU A;  3KEI A;  1B3F A;  3FV2 A;  4I8C A;  3FVO A;  3MBP A;  3TEP A;  1BKA A;  1SW4 A;  1DCU A;  1H44 A;  3H6W A;  1LCT A;  2X7Q A;  3K4U A;  3TTR A;  3BIG A;  2XD2 A;  3LSX A;  3BKI B;  4RA1 A;  4R6H A;  3U72 A;  3KOT A;  3R6U A;  3RPL A;  3CSB A;  3HO7 A;  4OXV A;  5CI5 A;  4FE8 A;  1EZP A;  2P3N A;  4U21 A;  4JVI A;  4XF5 A;  5IKB A;  5I5P A;  5L9S A;  4BDQ A;  3KN8 A;  3DP8 A;  2GHB A;  4GWX A;  4G4P A;  5H8Q B;  3V8X B;  1IZ1 A;  4R6Y A;  2CEX A;  3VFJ A;  2B65 A;  3L6G A;  4OVJ A;  1Y4C A;  4DDD A;  4GWZ A;  4OET A;  4OEN A;  1POY 1;  2XWI A;  1LBW A;  4G68 A;  5KCJ B;  2CEY A;  3OO9 A;  2Y7R A;  2I48 A;  1USY H;  4JSO A;  4LZ8 A;  4YB5 A;  3G3I A;  4X48 A;  3PUX E;  2R6G E;  2F97 A;  3RQT A;  3CI8 A;  3G3G A;  3G3J A;  2OWZ A;  2O6A A;  1VDW A;  1ZLQ A;  4ZZA A;  1PDA A;  5I56 B;  4DXU A;  2D21 A;  4X9T A;  3FGS A;  5L8D A;  4JSD A;  4NF0 A;  4FAT A;  3EQ1 A;  3LSW A;  2XXR A;  4YB6 A;  4PAF A;  2NOO A;  3FIR A;  2I6E A;  2REG A;  5M2V A;  2XXU A;  1B5H A;  1NH8 A;  4U23 A;  4OVR A;  3FZV A;  3JZJ A;  3T96 B;  2O1L A;  5K2X A;  2O51 A;  1AMF A;  3ZKL A;  4NQ8 A;  3M3L A;  4H8I A;  3HHF A;  1FQA A;  2OWS A;  5I59 B;  4LZ7 A;  4BDO A;  5L9O A;  4GWO A;  1LFH A;  5B70 A;  3KBR A;  1M5B A;  2PBW A;  4YKI A;  2YPN A;  4G2Z A;  1UIV A;  4UAB A;  2GH9 A;  3JYR A;  3IOV A;  3T66 A;  3MP6 A;  3VV5 A;  2RC9 A;  4GIZ A;  1MM7 A;  4FIM A;  4IR8 A;  5T3J A;  3RNN A;  3FV1 A;  1KA0 A;  2QS1 A;  1FPI A;  1B0H A;  1I69 A;  3OEM A;  1PEB A;  5TPA B;  2UVH A;  3GZG A;  4KD5 A;  3MC2 A;  4I1D A;  2XX7 A;  1IXI A;  4GLI A;  3HCQ A;  3E79 A;  4LP2 B;  1EYI A;  4QFO A;  2F3D A;  4F18 A;  3IOU A;  4NF8 A;  3FBP A;  1MXY A;  4YKK A;  2ZNS A;  2PCR A;  2F35 A;  3I3V A;  2CZK A;  1B52 A;  3TTN A;  4ESX A;  2XD3 A;  2OCU A;  5LDZ A;  4NN3 A;  2QJE A;  4G8M A;  4TLM B;  3E13 X;  2IEE A;  5FTI A;  1CE2 A;  2I0B A;  3MST A;  2FIE A;  1SW5 A;  2RC7 A;  4PAK A;  3T22 A;  4FBP A;  1I6B A;  1TXF A;  1XVY A;  2QFL A;  2QS4 A;  2YJP A;  1FCK A;  4F1Y A;  1P1Q A;  4LN5 A;  3LSF B;  3F11 A;  4IO2 A;  3PMV A;  4P3L A;  2GHA A;  1FTM A;  5EYH A;  1LBB A;  1P1N A;  3QMF A;  3O29 A;  2KLF A;  3EKI A;  4TOZ A;  2WBD A;  4JWO A;  3HST A;  1IME A;  1INP A;  4IGT A;  5J16 A;  4IY5 A;  5DEX B;  1RDZ A;  1S50 A;  3FUZ A;  3VXC A;  3TKD A;  4GXA A;  1M5D A;  2QMW A;  4YKP A;  4H46 A;  3LR1 A;  1QUL A;  4ZS9 A;  3TCG A;  1Y3P A;  2DDK A;  2UVI A;  1GR2 A;  2DYX A;  1D4N A;  3KG2 A;  2PX1 A;  2ALU A;  4L17 A;  3TCH A;  3U1O A;  5HM4 B;  1LST A;  2XWV A;  1LB9 A;  3PTY A;  2XXK A;  4MX6 A;  1YZ0 A;  1DTZ A;  1MH3 A;  2WX9 A;  4F3B A;  1MQD A;  2QSX A;  1Q35 A;  2Q9T A;  3MQ9 A;  1N7W A;  2CZI A;  3BFT A;  5DVJ A;  4GL8 A;  4N07 A;  5CRY A;  1XT8 A;  1MPC A;  5JK4 A;  1B2H A;  3MYU A;  4BLA A;  1OLC A;  1S9T A;  2R71 A;  4KCD A;  5TPA A;  2ZZV A;  5TU0 A;  5ELV A;  1TWY A;  3ODB A;  1H45 A;  1Y3N A;  3HFU A;  1N0T A;  4NG7 A;  3H6T A;  1AIV A;  2Y84 A;  3R26 A;  3I5O A;  4PFT A;  2RKM A;  1A55 A;  2A5T B;  3FXB A;  4F2O A;  1NUW A;  1FTL A;  3RY3 A;  3V5A A;  1FW0 A;  2F7B A;  4QFP A;  4DXB A;  4X04 A;  2FBP A;  3OO7 A;  5EQ9 A;  2NXO A;  3EF7 A;  3TTM A;  4FEB A;  1T0K A;  3VXB A;  1MXU A;  3OEN A;  5ET7 A;  4BDR A;  1OVT A;  4GWU A;  1JW4 A;  4BDN A;  1PB9 A;  4NX1 A;  3THI A;  3OEK A;  2CMO A;  4R9G A;  3ZKK A;  2DWJ A;  1B05 A;  3RTF B;  3V89 B;  1MQH A;  2P3V A;  1A40 A;  4M1V A;  2XXW A;  4ELP A;  1B3G A;  2ZNU A;  1R9L A;  4LZ5 A;  4NWD A;  5ICQ A;  1D9Q A;  3K1P A;  3B50 A;  1N04 A;  3E9X A;  4HXV A;  3FXQ A;  4ONY A;  1MG1 A;  2H99 A;  2HFB A;  3NOH A;  1MQJ A;  2WBB A;  2OX3 A;  3IAZ A;  1UTB B;  1DPE A;  4DE8 A;  4IO7 A;  3H6U A;  2VOZ A;  4R2F A;  3T9H B;  3OMB A;  2O84 X;  5H8N B;  3KSJ A;  2F36 A;  3IB1 A;  4LQ5 A;  4ZEC A;  5H8F A;  5IZZ A;  4PBH A;  1RDX A;  1G0H A;  4KPT A;  1BTJ A;  3CG3 A;  5I2N B;  3TPA A;  1MQG A;  2MKZ A;  4P56 A;  4Q30 B;  1M5F A;  1LAF E;  1IMC A;  4UA8 A;  2H98 A;  3MAM A;  1JQF A;  2THI A;  4X8R A;  1ZKB A;  1MXZ A;  1CB6 A;  2GFE A;  2KR0 A;  2PFY A;  4DLD A;  3FAS A;  1G0I A;  2OK2 A;  1H76 A;  1QKB A;  2HZL A;  1XOC A;  3UOR A;  1WVJ A;  4PFW A;  3C32 A;  2V25 A;  1LBV A;  1KA1 A;  1NV0 A;  3T9U A;  3BIH A;  1LBY A;  2Q88 A;  3LUY A;  5I3S A;  1FBG A;  4GBW A;  3RTW B;  3CHG A;  4P0G A;  2AIX A;  4WEP A;  4RK9 A;  5I57 A;  4OVP A;  2ZYM A;  3DP4 A;  3FJM A;  3SEU A;  1NFT A;  1NUZ A;  4XKR A;  1MS7 A;  3VVE A;  2OJT A;  1Y1Z A;  2Y7K A;  4F3G A;  4FEC A;  4LUB A;  4EXK A;  1YCJ A;  2GQ1 A;  2O7I A;  3TMG A;  4EQ7 A;  1B6H A;  2UVG A;  3U92 A;  3K1M A;  3IL1 B;  2CZL A;  1FTO A;  2G93 A;  4MLQ A;  4NF4 B;  1FBF A;  3SEV A;  5F24 A;  3EPE A;  3PPR A;  1FQD A;  3MVZ A;  4U22 A;  3H4Z A;  4XTC Q;  4PF6 A;  4HE2 A;  4NE4 A;  1IMD A;  3VLV A;  1Y4T A;  1BLF A;  2DP8 A;  3KN3 A;  1FTK A;  5ET8 A;  3B6Q A;  3KJ7 A;  4RYA A;  4F1V A;  2BJI A;  4R73 A;  1ELJ A;  1URG A;  4JWX A;  1QUI A;  1H3D A;  4AB5 A;  4NF6 A;  2O1M A;  3U93 A;  3TDJ A;  4QF9 A;  3MPK A;  2V93 A;  1P1O A;  5H8F B;  4P0I A;  1EYJ A;  3H06 B;  4EQ9 A;  2O7U A;  2RCB A;  1SI0 A;  2Y7W A;  3TTL A;  1B46 A;  2DSF A;  3H7M A;  4H0W A;  2PYY A;  4NGU A;  4N6D A;  3C34 A;  1XHY A;  1NV4 A;  2D3I A;  4NED A;  1UQW A;  3O97 A;  5IZ1 A;  1K9Z A;  2XWO A;  4F1U A;  1POT A;  3N6T A;  2I4C A;  2W7Y A;  4GQO A;  5DW8 A;  5JTY B;  1B40 A;  1MH4 A;  2HXW A;  4I40 A;  5IZ3 A;  3UGW A;  5DTB A;  3N6U A;  2DE3 A;  4P9K A;  3SEW A;  2P2A A;  3B6W A;  5I58 A;  4TLL B;  3OSR A;  3U8Q A;  1QUK A;  1RYO A;  4GWS A;  4RXL A;  4XKN A;  3SEY A;  2Q89 A;  2Y7P A;  5CBR A;  3D4C A;  1I6A A;  1MY4 A;  4HTG A;  5DYH A;  4OER A;  2XXQ A;  4KCC A;  5LTC A;  1ZIU A;  1K9Y A;  1ATG A;  4XFE A;  3U94 A;  2E0S A;  4F31 B;  4HW8 A;  4POX A;  2ANJ A;  1EH3 A;  4FED A;  2XX8 A;  4G8H A;  1Z7N E;  4AS5 A;  2HXR A;  1NV1 A;  1KWH A;  1GV8 A;  1RKM A;  4PDH A;  4PTK A;  4MH5 A;  1FJ6 A;  3O6G A;  4F22 A;  5EQ7 A;  3JV9 A;  1IXC A;  4IY6 A;  1O64 A;  2WYP A;  3H6V A;  1D3K A;  2B3F A;  4DI3 D;  4GFR A;  3SET A;  3KOS A;  3TZA A;  2LAO A;  1ANF A;  5I2N A;  4P47 A;  3UN6 A;  1JNF A;  3M3K A;  1URD A;  3BFU A;  4ELR A;  1NV7 A;  3LBS A;  4H5F A;  1FPD A;  3QUJ A;  1B51 A;  3UK4 A;  3O6H A;  4GWW A;  1PBQ A;  3IK6 B;  2NUV A;  2QPQ A;  1N76 A;  4PFU A;  3C36 A;  1Y9U A;  5ITO A;  4MIJ A;  5CMB A;  1DBZ A;  2PT2 A;  2P1S A;  1MDP 1;  1B0L A;  2PMS A;  4QSD A;  4QBA A;  4RPO A;  2Z23 A; 
#chains in the Genus database with same CATH homology
 4HE0 A;  2FIE A;  3T0J A;  3D1R A;  5I7I A;  5JK4 A;  2F3B A;  4O8M A;  1FBF A;  3MYU A;  2DE3 A;  1FPJ A;  4PAK A;  4P9K A;  3B8B A;  4PBQ A;  4FBP A;  4PDD A;  2HPG A;  5F24 A;  2QFL A;  4PCD A;  1IMF A;  2ZZV A;  4QXD A;  4MMP A;  3W9W A;  1SPI A;  1DCU A;  4LN5 A;  1FPF A;  3KC1 A;  1FPE A;  4F19 A;  2VT5 A;  5IZZ A;  4OVR A;  4PF6 A;  4OVQ A;  5IM2 A;  2WYK A;  4GWS A;  4PBH A;  1RDX A;  4HE2 A;  4YZZ A;  4AS4 A;  3GYY A;  2B4L A;  2VPN A;  5ESY A;  4NAP A;  1LBX A;  1IMD A;  1G0H A;  2XA5 A;  3BIG A;  3HFU A;  4NG7 A;  4NQ8 A;  3U65 A;  3KC0 A;  4O7I A;  4P3L A;  1EYK A;  5EYH A;  4JVC A;  3QMF A;  5ET8 A;  3EKI A;  2FIX A;  2WBD A;  4PFB A;  4N4U A;  4PFR A;  5LTC A;  1K9Y A;  4PGP A;  1IME A;  3FXB A;  4XFE A;  1INP A;  1BK4 A;  4PET A;  5J16 A;  1NUW A;  4PTK A;  3ISP A;  5EQA A;  2MKZ A;  1RDZ A;  3MST A;  4GWY A;  4P56 A;  3RPL A;  2B4M A;  2QVU A;  1FBP A;  4DI4 B;  1NV2 A;  4PAI A;  5A5L A;  4X04 A;  1IMC A;  1FBD A;  2FBP A;  3KBZ A;  4N17 A;  4PGN A;  4AS5 A;  2HXR A;  5EQ9 A;  2HZK A;  4MNP A;  1YXI A;  4F1V A;  1NV1 A;  1YYZ A;  4UAB A;  2V3Q A;  1FJ9 A;  2P3N A;  2BJI A;  4JVI A;  4X8R A;  4XF5 A;  3RPL B;  5I5P A;  2R8T A;  3SZP A;  4GBV A;  2HHM A;  1NV3 A;  3ROJ A;  4MNC A;  1NV5 A;  1KZ8 A;  4GWX A;  2KR0 A;  2PFY A;  1IMB A;  1FPL A;  4PDH A;  4H46 A;  5ET7 A;  2PFZ A;  3IFA A;  1FBH A;  1NV6 A;  4GX3 A;  1DK4 A;  2CEX A;  2L5V A;  1IMA A;  1FJ6 A;  1G0I A;  4HCY A;  4MCO A;  4N91 A;  4OVT A;  5EQ7 A;  4GWU A;  4P1L A;  2HZL A;  2FHY A;  4PE3 A;  4GWZ A;  1FBC A;  1FSA A;  5ET5 A;  4NX1 A;  4IR8 A;  4MNI A;  5T3J A;  1Q9D A;  2XWI A;  3A29 A;  2ZZW A;  4OA4 A;  4OAN A;  1LBW A;  2QVR A;  1QGX A;  2DDK A;  2WYP A;  3LV0 A;  2V4C A;  4PFI A;  3W9V A;  1KA0 A;  1LBV A;  1FPI A;  4DI3 D;  1KA1 A;  2CEY A;  2WEF A;  4JVD A;  1NV0 A;  3BIH A;  1EYJ A;  1LBY A;  4HE1 A;  2FVZ A;  4O94 A;  2KQZ A;  2P3V A;  4PC9 A;  2DE2 A;  2XWV A;  1JP4 A;  4G61 A;  4MHF A;  1NI9 A;  5ET6 A;  5I3S A;  3E78 A;  3RYD A;  4P8B A;  4MAG A;  1FBG A;  1NUX A;  4HCW A;  4M1V A;  3PTY A;  4P47 A;  2XXK A;  4MX6 A;  3E79 A;  5J1D A;  1AWB A;  4GBW A;  4PF8 A;  5CM6 A;  4GX6 A;  1EYI A;  1NUY A;  3CHG A;  1YZ0 A;  4N6K A;  4KXP A;  4O7M A;  2F5X A;  3T1B A;  1LEV A;  1NV7 A;  2F3D A;  4N6D A;  1FPD A;  1FPB A;  4NGU A;  2JJK A;  1NV4 A;  2WX9 A;  2Q8M A;  4F18 A;  5FBP A;  1RDY A;  3IFC A;  4I3E A;  1D9Q A;  2Q74 A;  2ZZX A;  3FBP A;  2QVV A;  4N8Y A;  4NHB A;  4N15 A;  4OVP A;  2OWZ A;  3B50 A;  4GWW A;  1FPG A;  2PCR A;  5EYG A;  4HXV A;  5IGA A;  1NUZ A;  5IZ1 A;  1K9Z A;  1VDW A;  2QPQ A;  2Q9T A;  2XWO A;  2CZK A;  2CZI A;  2Y5K A;  4F1U A;  4NN3 A;  1FBE A;  1FTA A;  4OVS A;  4XEQ A;  4MJO A;  1XI6 A;  5IZ3 B;  1LBZ A;  4X9T A;  5EQ8 A;  3NOH A;  4H45 A;  4N81 A;  5LDZ A;  2DVZ A;  4MIJ A;  4NF0 A;  2DE4 A;  4GX4 A;  1FPK A;  2WBB A;  2GQ1 A;  1FRP A;  1CNQ A;  4P1E A;  3LUZ A;  1DBZ A;  2CZH A;  2OX3 A;  5DW8 A;  5IZ3 A;  4I3Y A;  2XWK A;  4N8G A;  2VPO A;  4I40 A;  4QBA A;  4YIC A;  4MEV A;  2Y5L A;  4PAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...