2H5YA

Crystallographic structure of the molybdate-binding protein of xanthomonas citri at 1.7 ang resolution bound to molybdate
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
232
structure length
232
Chain Sequence
TAPVTVFAAASLKESMDEAATAYEKATGTPVRVSYAASSALARQIEQGAPADVFLSADLEWMDYLQQHGLVLPAQRHNLLGNTLVLVAPASSKLRVDPRAPGAIAKALGENGRLAVGQTASVPAGKYAAAALRKLGQWDSVSNRLAESESVRAALMLVSRGEAPLGIVYGSDARADAKVRVVATFPDDSHDAIVYPVAALKNSNNPATAAFVSWLGSKPAKAIFARRGFSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Molybdate-binding periplasmic protein
publication title Crystallization, data collection and phasing of the molybdate-binding protein of the phytopathogen Xanthomonas axonopodis pv. citri
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
total genus 75
structure length 232
sequence length 232
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2h5yA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2h5yA02
4PQJA 1A40A 5I58B 4P0GA 3CFZA 4ZEKA 2O69A 3F11A 3MQ9A 4G68C 4C0RA 2D3IA 4LVQA 5HBCA 3R26A 3CFLA 1OMPA 4NF5B 3PMXA 3B6TA 5BUUA 4O3BA 2QMWA 1O63A 3RPWA 4DXCA 5JTYA 3CRBA 3TTNA 2DVCA 2P2AA 3OO9A 1PC3A 4F29A 4PFTA 1LB9A 1TFAA 4POXA 3M8UA 1Y4CA 4F39A 1LB8A 3CR9A 3QYTA 3IX1A 4DIGA 3PD8A 3TFLA 2FA7A 4I1DA 4ND9A 1UTHB 3TTKA 4I62A 4AQ4A 5K2XA 3C31A 1MH4A 4HCYA 1OQGA 1NNKA 2QS3A 5DVIA 4OEVA 1SW1A 3S9NC 5ELVA 1LCTA 3C33A 1EU8A 4NF8B 2VD2A 1ZIUA 4RPOA 5H8SA 1MH3A 4F1UA 4GL0A 1I6BA 4FORA 4F1YA 1SQYA 3GBAA 1B2HA 1H3DA 2F7BA 3IL1B 1Y20A 3TMGA 5CMKA 3PV0E 5H8HB 2ANJA 1LSTA 1B0LA 3IK6B 2F36A 4GVOA 3O6IA 4LZ7A 2I0BA 3JZJA 3OSRA 4PP0A 4QRZA 2Q89A 5CBRA 4NWDA 3PD9A 5KZTA 2I4CA 5F7VA 5JK4A 5A5XA 1B52A 4XTCQ 3TUSA 5LOMA 3LSLA 3KG2A 3S9LC 2O84X 2Z22A 3B6WA 3FJMA 3IOVA 3USDA 3GXAA 3O6HA 4OENA 1MXVA 1N3WA 2I6EA 3HSTA 1GVCA 2HAUA 4KCCA 1B3LA 3HV1A 1SI0A 5IAIA 2F5XA 2XXTA 4ISUA 4YU0A 5DVFA 1B0HA 1IUDA 2Z8EA 4RK9A 3TQWA 3OELA 4DDDA 3PPOA 4YB5A 5TP9B 4R9GA 1MY4A 4WEDA 3O28A 1SBPA 2DYXA 4YB6A 3H3GA 4ZEDA 4F3GA 3E3KA 3U72A 1ZBMA 4LUBA 3KZGA 5FHOA 4AB5A 3EHTA 2RC7A 4IO6A 3FGSA 3IOTA 4LONB 2F34A 1ZLQA 1B32A 3KSXA 1NNFA 1DPPA 2F7AA 4TQUQ 3ILTB 4E0XA 2HEUA 5H8NB 3RY3A 5EYFA 3KN7A 5B7DA 3FATA 4FAJA 3DLNA 1F9BA 2P1SA 3OO6A 3UGWA 2H4IA 3EN3A 2ZYKA 3H6VA 1VSOA 3VVDA 2HZKA 3A3CA 3UN6A 3U1OA 1RYOA 2ONKE 2X7PA 4MBPA 4QFPA 2Q2AA 3JYRA 3FVNA 3FJ7A 1FTKA 1II5A 4TLMB 2XHDA 3P7IA 3FIRA 3VVEA 1MY2A 3H06B 3C35A 4Z0IA 4WXJA 3PPRA 2OWSA 3ILUB 1JW1A 3R6UA 1BLFA 3BBRA 5EHMA 2D21A 1UTHA 5I56B 1D3KA 1LLSA 1I6QA 4UACA 3O9PA 5I84A 1B3EA 3EHUA 2E1SA 4XKQA 1PB8A 2A5TB 2O51A 1US5A 3MVZA 5AA1A 3MW0A 4NF8A 2HAVA 2VP1A 2AL4A 3QSLA 3SEUA 3CSGA 3BKIB 3Q26A 2RCBA 4F18A 4RA1A 1JVYA 4IGTA 4U1ZA 1RKMA 4U1OA 1AIVA 4EQBA 1MQGA 1B3HA 1SYIA 3GBBA 1XVYA 3PGFA 2VD3A 5HPQA 4FE8A 3HHFA 4U2RA 4O3AA 5KDTB 2QS4A 2CZLA 2O1MA 4ELOA 3VE1B 3K2DA 3KFMA 3OO8A 3OO7A 1URSA 4M1VA 1LFGA 3OENA 2NWJA 2DQVA 3MP1A 3L6GA 2ZYNA 4R75A 1Q1KA 3QUJA 2ESNA 1MXWA 3IR1A 1BIYA 3DM0A 3SDFA 4I8CA 2Y7IA 3UA8A 5H8QB 4RK2A 5DEXB 1PBQA 2PBWA 5AA2D 3H6WA 1AH5A 4BDQA 3OOAA 2DWJA 1NKXA 2DXYA 1PB9A 3OEMA 3CVGA 4QFNA 1QJMA 1LFIA 2HFBA 4H8IA 1MQDA 2P0SA 4PFWA 3TDJA 1O64A 3RGYA 1JEUA 2XXHA 3H03A 4R2BA 1UQWA 5H8FB 4IB2A 3UK4A 2HQ0A 4NF6B 2Z8DA 4IY5A 1YPNA 4U23A 5CRYA 5FTIA 3LUYA 4P0IA 1P1OA 2OBGA 4JWXA 3MVXA 2ZYOA 4X1BA 2XD2A 2WKYA 2GH9A 2D5WA 2O7IA 1FTLA 1WODA 3MWBA 4H65A 1YTVA 1B9JA 4RYAA 1B4HA 1NH8A 1D9VA 3IO6A 2W7YA 4NTLA 1MPCA 1POTA 1N7WA 4X48A 2E0SA 3IO4A 2DS9A 4ZEIA 4ZEFA 4FEBA 5CMCA 3SKPA 2G29A 2VOZA 4XKNA 4OEUA 2XXQA 3T9VA 4F2OA 3OMBA 1R9LA 3M3KA 1M5DA 1P1QA 3DP6A 2AL5A 2V3TA 1XC1A 3RN8A 1O7TA 4ELQA 3AXFA 1IZ1A 3PUYE 2I3VA 1ZU0A 3IOWA 4BDOA 4MFIA 1B1HA 5I2NA 3HPIA 4JSOA 4F22A 4OQOA 5BWJA 5AA4A 3THIA 1B40A 3PMWA 4OYVA 3PMVA 4ECFA 2NOOA 2XX9A 5ISUA 1XOCA 3G7WA 4LQ2A 3KBRA 2Z8FA 4RNSA 4NMYA 4U4XA 1GGGA 4C1UA 2YJPA 3ZS6A 3N5LA 3W9VA 1A7LA 1WDNA 1OVTA 4KR5A 4I9DA 1B7HA 3U8QA 4H67A 1PEBA 5CM6A 4G8HA 1MY0A 1CE2A 4E0WA 2UYFA 1NNPA 1B4ZA 4MLVA 3H7MA 1QVSA 4YICA 2RINA 3O2AA 4GLIA 4H1XA 2RKMA 2UVHA 3KOSA 4QFLA 4YKIA 3FV2A 4Q8RA 1UTBB 3BFTA 4GOTA 5KDTA 3CG1A 4LZ5A 2O7UA 4ZS9A 2Z23A 4IGRA 4FEDA 3Q29A 3OD7A 4BDLA 2ZYMA 3GZGA 4X9TA 3RUMA 1FQEA 3CSBA 3KN3A 2ZXTA 1USYH 5ITOA 1GTKA 4H5GA 1P1WA 2XXVA 3H6UA 3TKDA 3TTLA 4OETA 5DT6A 1MG1A 5H8QA 1L5TA 2UVJA 2H5YA 2X7QA 3QIMA 5ITPA 3TQLA 2KLFA 1ANFA 2H25A 2PYYA 4HS7A 4F3SA 4YKJA 3O66A 4BLAA 1A54A 4P11A 1HSLA 4GIZA 2F8DA 2Y7WA 1LFHA 1ZKBA 3V8XB 1FQDA 2HXWA 3MVWA 4IO5A 4KPTA 4OWDA 3O97A 1USYE 4KI0E 3C34A 5H8FA 1QW0A 4JXIA 1DPEA 5ICQA 3B6QA 4BDNA 5AA2A 1LAFE 1UIUA 1RYXA 3G3FA 2UYEA 1DTZA 3TZAA 4PFUA 4HCWA 1N84A 1Y1MA 5TPAB 3FZVA 4F31B 2DP8A 2ONRA 4JWOA 3R7XA 4EXKA 2V84A 1EH3A 2REJA 3S9EA 2XXPA 2Y7PA 1MS7A 1HSJA 3CIJA 4JSDA 4OFJA 4N13A 3IOUA 1BTJA 1QKAA 3LC8A 4HTGA 3C32A 4GF8A 5I59B 1XHYA 3QK6A 3M3LA 3K6UA 2FNCA 1AMFA 2OCUA 3K6WA 4BDMA 3QAXA 1TXFA 1LAXA 3OSQA 3VV5A 3HHGA 1CB6A 1OLAA 4DE8A 4JDFA 1B58A 3IJOB 2XXRA 1LCFA 2QJEA 4R9FA 1QUJA 5I58A 1POY1 2F35A 4GXAA 4RJZA 1VE4A 4N07A 2RC8A 4NF5A 3T22A 4FECA 3TEPA 3FXQA 1IXGA 3ZKKA 1EZOA 3MP8A 2V3UA 1MXXA 3MPKA 4QFKA 1Z7NE 2NVUB 2QS1A 4G68B 4YMAA 1ATGA 2B3BA 4LATA 2B65A 3TCFA 2I4BA 5KCJB 3SEXA 3RQTA 3VXBA 1GR2A 4GD5A 1B51A 4QSDA 1PB7A 2AIXA 3CI8A 3U92A 3TCGA 5FTHA 4ONYA 3HO7A 1M5EA 1N04A 4X1DA 3S4UA 3ONMA 1Y3NA 1UTBA 1OIBA 3S2VA 2GHBA 4HW8A 4RXLA 1JW5A 2XXWA 1NNTA 2XXXA 1R9QA 5CMBA 5JTYB 1Y9UA 2DE4A 4EF1A 5H8HA 5CC2A 2O6AA 1S50A 1UIVA 3K6XA 3Q27A 1NFTA 3C9HA 3KN8A 1P1UA 1H43A 1Y3PA 4JBZA 1P1NA 3UORA 3KSJA 3E4RA 3ECRA 3TTRA 1DMBA 4F2QA 1MPBA 2HZLA 3MPLA 1SDXA 1QUKA 1URDA 3I5OA 4H0WA 3E9XA 3V83A 1B5JA 1SW2A 2I3WA 4OFOA 4R6YA 4G2ZA 4ELRA 2B3FA 3H6TA 3E13X 3B7DA 4L17A 2O1LA 5TP9A 3U94A 1MY1A 4LZ8A 5FHNA 2X26A 1WVJA 3UIFA 4UA8A 3T9HB 2IA4A 1VFEA 4PFYA 3T93B 1FW0A 5TU0A 1IXIA 4ELPA 2O68A 4RPNA 3FVGA 3ODBA 3K00A 1FQAA 4DXUA 1Q35A 3HCQA 1ZMGA 3G3HA 1D4NA 2H98A 2V93A 5I57B 1LBCA 3MJNA 4PETA 1PBPA 4ESWA 4LP2B 3IB2A 3VDFA 5H8NA 1YAEA 3L6HA 5IKBA 3DELB 1SW5A 1SD3A 2IEEA 3K02A 2F97A 4GWOA 3N6TA 1JW4A 1IQ7A 3D4GA 4OXVA 2A5SA 1S9TA 1JEVA 4QHQA 2H9BA 2DXRA 4XKRA 1A55A 2DWIA 3W9WA 3VXCA 4H6DA 4ZEBA 4RY1A 1JETA 3FUZA 3VVFA 4KQPA 4ZE8A 1MM7A 2ZNUA 1ELJA 1LGBC 1GV8A 3C36A 3K0VA 2DVZA 4ZECA 3LSXA 1KWHA 3KGCA 3PPPA 3FVKA 4Q0CA 3G3JA 1B1XA 4NEDA 5L9OA 5I56A 2H99A 3KJTA 1MQHA 1B46A 4F3PA 3S9MC 3K1NA 3LSFB 3SEVA 2QRYA 2A5TA 2FYIA 1B5HA 4DXBA 4H5FA 3N94A 1H44A 4DZ1A 2PT1A 3DP8A 2R71A 2RCAA 1IITA 4ESXA 3O29A 4IO3A 3SEWA 2OLBA 5CMMA 3MZ9A 2QL3A 3JV9A 3OXNA 4OMBA 4YKKA 4MH5A 3EQ1A 2DE2A 1QUIA 2DE3A 1LAHE 1B3FA 2I49A 4GFRA 1JNFA 4XKPA 1MRPA 4IO4A 3RT6B 3N6UA 4QSEA 4H8JA 3UP9A 3IB1A 3K6VA 3TAJA 4YKPA 2PVUA 2QS2A 2XXIA 2REGA 4G77A 3U93A 1MXUA 2UVIA 1AL3A 5AA3A 3ZSFA 4U22A 1B3GA 3MBPA 3H4ZA 3QUFA 4OERA 4F19A 4GQOA 2XXUA 2RF1A 2OJTA 3PUVE 2UVGA 4ZE9A 2ZNTA 4POWA 2HCAA 5DEXA 4KYDA 2ALUA 5EHSA 3SETA 5DYHA 4F1VA 4K3FA 1FTOA 2NUVA 1B05A 5L8DA 3VLUA 2ABHA 4YZZA 1MM6A 3EPEA 2ZMBA 1DTGA 4KYEA 2PX1A 1FQBA 3TODA 2OWTA 3CG3A 1ZJLA 3WAEA 2XX8A 4U4SA 4EXLA 3FJGA 4R73A 4R2FA 3IORA 1T0KA 4NF6A 4YAHX 4NF4B 3FXRA 3PUZE 1URGA 2VGQA 1A99A 5I57A 1DOTA 4ZZEA 4IY6A 3ZKLA 4THIA 1MDP1 4U21A 1ZTYA 3EF7A 2PT2A 1M5FA 3MZBA 3RTWB 1VR5A 2GHAA 1N7XA 2F7CA 3KEIA 3VLWA 4Z7EA 4KHZE 2QMXA 1NL5A 4R74A 4Q5TA 5I2KB 1MXYA 2ONSA 1I6AA 4EF2A 3M3FA 5B70A 1S7YA 4XIGQ 3CFXA 3TPAA 1XVXA 4WEPA 3T66A 1I69A 1R1NA 1M5BA 4PE5B 2NXOA 1PDAA 5L9MA 1MXZA 1R6ZA 3W15C 2DWAA 2V3QA 3N26A 2DWHA 2YLNA 5FHMA 2I48A 3T9XB 1A8EA 1SI1A 5M2VA 3BFUA 2M8CA 2GFEA 3KJ7A 3TTMA 3PUXE 2LAOA 3G3KA 2XX7A 4GRKA 4DLDA 4O3CA 3RNNA 2UXAA 3TYHA 3WAFA 2Q9TA 1H76A 1IEJA 3LBSA 3PPNA 5L9SA 4BDRA 2QPQA 1QKBA 4NE4A 1FTJA 4EQ9A 1IIWA 3IB0A 1XT8A 3MZ1A 1MQIA 4MLQA 1D9YA 1OLCA 1IXHA 4LQ5A 4OZ9A 3C4MA 1FCKA 3G3IA 3T9UA 3FD3A 1B7UA 5J1DA 2XD3A 3PUWE 3Q28A 2DOJA 1A8FA 2XXYA 3O6GA 1IXCA 1MY3A 3DP4A 4KCDA 5ICTA 4QF9A 2AYSA 5I2NB 1SW4A 5HM4B 4OTEA 2QSXA 3HN0A 3K1MA 5CI5A 4ZDMA 5AA4B 1JQFA 2OK2A 5AE4A 3FXUA 1OQHA 1US4A 3LSWA 4R6KA 1NH7A 4DCXA 1B6HA 2ZNSA 3PU5A 4KD5A 1TT1A 1LAGE 4G8NA 3K1PA 2F78A 3I3VA 4FIMA 1XS5A 3IJXB 3LR1A 1EZ9A 4WKMA 2Q2CA 3Q25A 4OFLA 3RTFB 1N0TA 4IO7A 2F6GA 3MAMA 1LBBA 4G8MA 2Y84A 3TELA 1TFDA 1SVXB 4FATA 1NMUA 4F3BA 2Q8JA 3VFJA 4EQ7A 3KOTA 3SERA 1SYHA 2CMOA 3A09A 3SEYA 1FQCA 4QSCA 1OVBA 3FV1A 2VHAA 4IO2A 5K2YA 3FASA 2Y7KA 2BJJX 3K01A 4EDPA 4NF4A 3V5AA 3FVOA 5DTBA 4MF3A 2GRVA 3EHSA 4LA9A 4R72A 1DSNA 2DSFA 5F1QA 2I0CA 5TPAA 4GL8A 3MP6A 4DCYA 4AB6A 1B5IA 2G93A 4EUOA 4OHNA 1BKAA 4TLLB 5A5XB 1H45A 2R9JA 1BP5A 3MUQA 3A3UA 4KYSA 3QXMA 1AOVA 1FQFA 1MQJA 3TCHA 4TOZA 1N76A 3SESA 5I2KA 1YCJA 1MPDA 2YPNA 4JB7A 5I59A 3D4CA 4R6HA 1TWYA 2R6GE 1FTMA 3MC2A 1Y3QA 5JEIA 2I58A 4KFQA 4OESA 3G3GA 4QFOA 4OVJA 4XXUA 1N3XA 5AA2B 1Y1ZA 1Y4TA 1B7ZA 1QULA 4YB7A 2Y7RA 2OZZA 3RT8A 4ZZAA 1MDQA 3K4UA 3RLFE 5DVJA 3IAZA 1HSEA 4M4GA 4FJPA 5CBSA 4G4PA 2Q88A 1JVXA 4G68A 3T96B 3V89B 2PMSA 1P99A 3PPQA 1Z7ME 2F6PA 4JWYA 1J1NA 3I6VA 1VFDA 4Q30B 4YMBA 3MVYA 2THIA 5KCJA 4N6PA 2RC9A 3VLVA 3GLBA 4C1TA 2V25A 1EZPA 1M5CA 4GXSB 4NWCA 3OEKA
chains in the Genus database with same CATH superfamily
4PQJA 5LTCA 1A40A 5I58B 4P0GA 3CFZA 4ZEKA 1IMCA 2O69A 2QVUA 3F11A 3MQ9A 4G68C 4C0RA 1LBWA 2D3IA 2V4CA 4LVQA 5HBCA 3R26A 1FPIA 3CFLA 1OMPA 4NF5B 3PMXA 3B6TA 5BUUA 4O3BA 2QMWA 1O63A 3RPWA 4DXCA 5JTYA 3CRBA 4PTKA 3TTNA 1IMEA 2DVCA 2P2AA 3OO9A 1PC3A 4F29A 4PFTA 1LB9A 1TFAA 4POXA 3M8UA 1Y4CA 4F39A 1LB8A 3CR9A 3QYTA 3IX1A 4DIGA 3PD8A 3TFLA 2FA7A 4I1DA 4ND9A 3B50A 1UTHB 3TTKA 4NG7A 4I62A 4AQ4A 5K2XA 3C31A 1MH4A 5A5LA 2KR0A 4HCYA 1OQGA 1NNKA 2QS3A 5DVIA 4OEVA 1SW1A 3S9NC 5ELVA 1LCTA 3C33A 1EU8A 2WYKA 4I40A 4NF8B 4PGNA 2VD2A 1ZIUA 4RPOA 5H8SA 1MH3A 4F1UA 4GL0A 1I6BA 4FORA 2XWVA 4F1YA 3MSTA 1SQYA 3GBAA 1B2HA 1H3DA 2F7BA 3IL1B 1Y20A 3TMGA 1FBCA 5CMKA 3PV0E 5H8HB 2ANJA 1LSTA 1B0LA 1LBVA 4MAGA 3IK6B 2F36A 4GVOA 4N81A 3O6IA 4LZ7A 2I0BA 3JZJA 3OSRA 4PP0A 4QRZA 2Q89A 5CBRA 4NWDA 3PD9A 5KZTA 2I4CA 5F7VA 5JK4A 5A5XA 1B52A 4XTCQ 3TUSA 5LOMA 3LSLA 3KG2A 1LBXA 3S9LC 2O84X 2DDKA 2Z22A 3B6WA 3FJMA 4P1LA 3IOVA 4PBHA 3IFAA 3USDA 3GXAA 3O6HA 3KBZA 5I5PA 4OENA 1MXVA 1N3WA 2I6EA 3HSTA 1GVCA 2HAUA 4KCCA 1B3LA 3HV1A 1SI0A 5IAIA 2F5XA 1IMBA 2XXTA 4ISUA 4YU0A 5DVFA 1FPLA 1B0HA 4GX4A 1IUDA 2Z8EA 4RK9A 3TQWA 4DI4B 4AS5A 1NUWA 3OELA 3RPLA 4DDDA 3PPOA 4YB5A 5TP9B 4R9GA 1FPFA 1MY4A 4WEDA 5IZ1A 3O28A 1SBPA 2DYXA 4YB6A 3H3GA 4ZEDA 4F3GA 2XWOA 3E3KA 3U72A 3E78A 1ZBMA 4LUBA 3KZGA 5FHOA 4AB5A 3EHTA 2RC7A 4IO6A 1NV2A 3FGSA 3IOTA 4LONB 2F34A 1ZLQA 1B32A 4XF5A 3KSXA 2HPGA 1NNFA 1DPPA 2F7AA 4TQUQ 3ILTB 4E0XA 2HEUA 5H8NB 5T3JA 3RY3A 5EYFA 1KA0A 3KN7A 5B7DA 3FATA 4GX6A 4O94A 4FAJA 3DLNA 4P8BA 1F9BA 2P1SA 3OO6A 3UGWA 2H4IA 3EN3A 2ZYKA 3H6VA 1VSOA 3VVDA 2HZKA 3A3CA 3UN6A 3U1OA 4NX1A 1RYOA 2ONKE 2X7PA 4MBPA 4QFPA 5EQ7A 2Q2AA 3JYRA 3FVNA 3FJ7A 4PFRA 1FTKA 1II5A 4TLMB 2XHDA 3P7IA 3FIRA 3VVEA 1MY2A 3H06B 3C35A 4Z0IA 4WXJA 4HE2A 3PPRA 2OWSA 3ILUB 1JW1A 3R6UA 1BLFA 3BBRA 5EHMA 2D21A 1UTHA 1FBHA 5I56B 1D3KA 1LLSA 1I6QA 4UACA 3O9PA 5I84A 1B3EA 3EHUA 2E1SA 4XKQA 1PB8A 2A5TB 2O51A 1US5A 3MVZA 1D9QA 5AA1A 5ET7A 4PDHA 3MW0A 4NF8A 2HAVA 2VP1A 2AL4A 3QSLA 3ROJA 3SEUA 2OWZA 3CSGA 4OVPA 3BKIB 3Q26A 2RCBA 4F18A 4RA1A 1JVYA 1NV5A 4IGTA 4U1ZA 1RKMA 4U1OA 1AIVA 4EQBA 4XFEA 3T1BA 1KA1A 1MQGA 1B3HA 1SYIA 3GBBA 1XVYA 3PGFA 2VD3A 1IMAA 4N4UA 4FE8A 5HPQA 4NN3A 4QXDA 2PFZA 2CZIA 4MHFA 5EQ8A 3HHFA 4U2RA 4O3AA 5KDTB 2QS4A 2CZLA 2O1MA 4ELOA 3VE1B 4GWYA 2HXRA 3IFCA 3K2DA 3KFMA 3OO8A 3OO7A 1URSA 4M1VA 1LFGA 3OENA 2NWJA 2DQVA 3MP1A 3L6GA 2ZYNA 4R75A 1Q1KA 3QUJA 2ESNA 1MXWA 3IR1A 1BIYA 3DM0A 3SDFA 4I8CA 2Y7IA 3UA8A 2VT5A 5H8QB 4RK2A 5DEXB 1PBQA 2PBWA 5AA2D 3H6WA 3B8BA 1AH5A 4BDQA 2XWKA 3OOAA 2DWJA 1NKXA 2DXYA 1PB9A 4P9KA 1BK4A 3OEMA 3CVGA 4QFNA 1QJMA 4GWZA 1LFIA 2HFBA 1FPGA 4H8IA 1MQDA 2P0SA 4PFWA 4PBQA 1Q9DA 3TDJA 4PE3A 1O64A 3RGYA 1JEUA 2XXHA 3H03A 4R2BA 4GBVA 1UQWA 5H8FB 2BJIA 4IB2A 3UK4A 2HQ0A 4NF6B 2Z8DA 4IY5A 2FVZA 1YPNA 4U23A 5CRYA 2FIXA 4MJOA 5FTIA 3LUYA 4P0IA 1P1OA 2OBGA 4JWXA 3MVXA 2ZYOA 4X1BA 2XD2A 4MNPA 2WKYA 4JVCA 2GH9A 2D5WA 2O7IA 1IMFA 1FTLA 1WODA 3MWBA 4H65A 1YTVA 1B9JA 4RYAA 1B4HA 1NH8A 1D9VA 3IO6A 2W7YA 4NTLA 1MPCA 1POTA 1N7WA 4X48A 2E0SA 3IO4A 1CNQA 2DS9A 4ZEIA 4N8GA 4ZEFA 4PF8A 4FEBA 5CMCA 4QBAA 3SKPA 2G29A 2VOZA 4XKNA 4OEUA 2XXQA 3KC0A 3T9VA 4F2OA 3OMBA 1R9LA 2ZZVA 1EYKA 3M3KA 1M5DA 1P1QA 4GWSA 3DP6A 2AL5A 2V3TA 1XC1A 3RN8A 1RDZA 1O7TA 4ELQA 3AXFA 1IZ1A 3PUYE 2I3VA 3CHGA 1ZU0A 3IOWA 4BDOA 4MFIA 1B1HA 5I2NA 3HPIA 4JSOA 4F22A 4OQOA 5BWJA 5AA4A 2CZKA 3THIA 1B40A 3PMWA 4OYVA 3PMVA 4ECFA 2NOOA 2VPOA 2XX9A 5ISUA 1XOCA 2F3BA 1NUYA 3G7WA 4MIJA 4LQ2A 3KBRA 2Z8FA 4RNSA 4NMYA 2CEXA 4UABA 4U4XA 1GGGA 1LBZA 4C1UA 2YJPA 3ZS6A 3N5LA 3W9VA 1A7LA 1WDNA 1OVTA 4KR5A 4I9DA 1B7HA 3U8QA 4GWUA 4H67A 1PEBA 5CM6A 4G8HA 1FPDA 1MY0A 1CE2A 4E0WA 2UYFA 1NNPA 1B4ZA 4MLVA 3H7MA 1QVSA 4YICA 2RINA 3O2AA 4GLIA 4H1XA 2RKMA 2UVHA 3KOSA 5FBPA 4QFLA 4YKIA 3FV2A 4AS4A 4Q8RA 1UTBB 3BFTA 4GOTA 4GWXA 5KDTA 2HHMA 3CG1A 2O7UA 4LZ5A 4ZS9A 5EYGA 2Z23A 4IGRA 2OX3A 4FEDA 3Q29A 3OD7A 4BDLA 2ZYMA 2FHYA 3GZGA 4X9TA 3RUMA 1FQEA 3CSBA 3KN3A 2ZXTA 1USYH 5DW8A 5ITOA 1GTKA 4H5GA 1P1WA 2XXVA 3H6UA 3TKDA 3TTLA 4OETA 5DT6A 1MG1A 2JJKA 4MEVA 5H8QA 2CZHA 2QVRA 1L5TA 2UVJA 1FPEA 2H5YA 2X7QA 3QIMA 5ITPA 3TQLA 2KLFA 1ANFA 2H25A 2PYYA 1NUXA 4HS7A 5I3SA 4F3SA 4YKJA 4GWWA 3O66A 4BLAA 1A54A 4OVRA 4P11A 1HSLA 4GIZA 2F8DA 2Y7WA 1LFHA 1ZKBA 3V8XB 1FQDA 2HXWA 3MVWA 4IO5A 4KPTA 4OWDA 3O97A 1USYE 4KI0E 3C34A 5H8FA 1QW0A 4JXIA 1DPEA 5ICQA 3B6QA 4BDNA 3NOHA 5AA2A 1LAFE 1UIUA 1RYXA 3G3FA 2UYEA 1DTZA 3TZAA 4PFUA 4HCWA 4GX3A 1N84A 1Y1MA 1FJ9A 5TPAB 3FZVA 4F31B 2DP8A 2ONRA 4JWOA 4KXPA 3R7XA 4EXKA 2V84A 1EH3A 2B4LA 2REJA 3S9EA 2XXPA 2Y7PA 1MS7A 1HSJA 3CIJA 4JSDA 4OFJA 4N13A 3IOUA 1BTJA 1QKAA 3LC8A 4HTGA 3C32A 4GF8A 5I59B 1XHYA 3QK6A 4MNIA 3M3LA 3K6UA 2FNCA 1AMFA 2OCUA 3K6WA 3QMFA 4BDMA 4NAPA 1FBEA 1NI9A 3QAXA 1TXFA 1LAXA 3OSQA 1FSAA 3VV5A 3HHGA 1CB6A 1OLAA 4DE8A 3U65A 4JDFA 5I7IA 1B58A 3IJOB 3SZPA 2XXRA 2F3DA 2L5VA 1LCFA 2QJEA 4R9FA 1QUJA 5I58A 1POY1 1IMDA 1INPA 2F35A 4GXAA 2QVVA 4RJZA 1VE4A 4HXVA 4N07A 5EYHA 2RC8A 4NF5A 3T22A 4FECA 3TEPA 3FXQA 1IXGA 3ZKKA 1EZOA 3MP8A 2V3UA 1MXXA 3MPKA 4QFKA 1Z7NE 2NVUB 2QS1A 4G68B 4YMAA 1ATGA 2B3BA 4LATA 2B65A 3TCFA 2I4BA 1FBPA 5KCJB 3SEXA 3RQTA 3VXBA 1GR2A 4GD5A 1B51A 4QSDA 1PB7A 2AIXA 3CI8A 2R8TA 3U92A 3TCGA 5FTHA 4ONYA 3HO7A 1M5EA 1N04A 4X1DA 3S4UA 3ONMA 4HE1A 1Y3NA 5ESYA 1UTBA 1OIBA 3S2VA 2GHBA 4HW8A 4RXLA 1JW5A 2XXWA 1NNTA 2XXXA 1FRPA 1R9QA 1FPJA 5CMBA 5JTYB 1Y9UA 3ISPA 2DE4A 4EF1A 5H8HA 5CC2A 2O6AA 1S50A 1G0IA 5IGAA 1UIVA 3K6XA 3Q27A 1NFTA 3C9HA 3KN8A 2P3VA 1P1UA 1H43A 1Y3PA 4N6KA 2XWIA 1YXIA 4I3YA 4JBZA 1P1NA 5IM2A 4PCDA 3UORA 3KSJA 3E4RA 3ECRA 3TTRA 1DMBA 1NUZA 4F2QA 1MPBA 2HZLA 3MPLA 4O7IA 1SDXA 3MYUA 1QUKA 1URDA 3FBPA 3I5OA 4H0WA 3E9XA 3V83A 1B5JA 1SW2A 2I3WA 4NF0A 4H46A 4OFOA 4R6YA 4G2ZA 4ELRA 2B3FA 1FBFA 3H6TA 3E13X 3B7DA 4L17A 2O1LA 5TP9A 3U94A 1MY1A 4LZ8A 5FHNA 2X26A 1WVJA 3UIFA 4PGPA 5F24A 4UA8A 4N15A 3T9HB 2IA4A 1VFEA 4PFYA 3T93B 1FW0A 4PFBA 5TU0A 4NHBA 1IXIA 4ELPA 2O68A 4RPNA 3FVGA 3ODBA 3K00A 3LV0A 2P3NA 4N6DA 1FQAA 4DXUA 1Q35A 3HCQA 1ZMGA 2GQ1A 5EQAA 3G3HA 1D4NA 2H98A 2V93A 5I57B 1LBCA 3MJNA 4PETA 1PBPA 4IR8A 4LP2B 4ESWA 4JVIA 3IB2A 3VDFA 5H8NA 3T0JA 2XA5A 1YAEA 3L6HA 5IKBA 3DELB 1SW5A 1SD3A 1KZ8A 2IEEA 3RPLB 3K02A 2F97A 4GWOA 4P56A 3N6TA 1JW4A 1IQ7A 3D4GA 4OXVA 2A5SA 2PCRA 2ZZXA 1S9TA 1JEVA 4QHQA 2H9BA 3EKIA 2DXRA 4XKRA 1A55A 2DWIA 3W9WA 3VXCA 5EQ9A 4H6DA 3PTYA 4ZEBA 4RY1A 1FJ6A 1JETA 3FUZA 3VVFA 4KQPA 4ZE8A 1MM7A 2ZNUA 1ELJA 1SPIA 1LGBC 1GV8A 3C36A 3K0VA 2DVZA 4ZECA 3LSXA 1KWHA 3KGCA 3PPPA 3FVKA 4Q0CA 1RDYA 4G61A 3G3JA 1B1XA 4NEDA 5L9OA 5I56A 4N17A 2H99A 3KJTA 1MQHA 1B46A 4F3PA 3S9MC 3K1NA 3LSFB 3SEVA 2QRYA 2A5TA 2FYIA 1B5HA 2FIEA 4DXBA 4PAFA 4H5FA 3N94A 2PFYA 1H44A 4DZ1A 4NQ8A 2PT1A 3DP8A 2R71A 2RCAA 1IITA 4ESXA 3O29A 4IO3A 3FXBA 3SEWA 2OLBA 5CMMA 3MZ9A 2ZZWA 2QL3A 3JV9A 3OXNA 1NV1A 4OMBA 4YKKA 4MH5A 3EQ1A 2DE2A 4P47A 1QUIA 2DE3A 1LAHE 1B3FA 2I49A 1NV3A 3E79A 4GFRA 1JNFA 4XKPA 1MRPA 4IO4A 3RT6B 3N6UA 3GYYA 4QSEA 4H8JA 5ET5A 3UP9A 3IB1A 3K6VA 3TAJA 4YKPA 2PVUA 2QS2A 2XXIA 2REGA 4G77A 5IZ3B 1XI6A 1MXUA 3U93A 2UVIA 1AL3A 4GBWA 5AA3A 3ZSFA 4U22A 1B3GA 3MBPA 2MKZA 3H4ZA 3QUFA 4OERA 4F19A 4OVTA 4GQOA 1FBGA 5J16A 2XXUA 1JP4A 2RF1A 4JVDA 2OJTA 3PUVE 2UVGA 4ZE9A 2ZNTA 4POWA 2HCAA 5DEXA 4KYDA 2ALUA 5EHSA 3SETA 5DYHA 4F1VA 4K3FA 1FTOA 2NUVA 4LN5A 1B05A 5L8DA 3VLUA 2ABHA 4MCOA 4YZZA 1MM6A 3EPEA 2WX9A 2ZMBA 1DTGA 1FBDA 1LBYA 4KYEA 2PX1A 1FQBA 3TODA 2OWTA 3CG3A 2FBPA 1ZJLA 3WAEA 2XX8A 4U4SA 4FBPA 4EXLA 2WEFA 3FJGA 4R73A 4R2FA 4O7MA 5ET6A 4OANA 3IORA 1T0KA 4NF6A 4YAHX 4NF4B 3FXRA 3PUZE 1URGA 2VGQA 1A99A 5I57A 1DOTA 2WBBA 4ZZEA 4IY6A 3ZKLA 4THIA 1MDP1 4U21A 1ZTYA 3EF7A 2PT2A 1NV4A 2QFLA 1M5FA 3MZBA 3RTWB 1VR5A 2GHAA 1N7XA 2F7CA 3KEIA 3VLWA 4Z7EA 4KHZE 2QMXA 4MNCA 1NL5A 4R74A 4Q5TA 5I2KB 1MXYA 2ONSA 1I6AA 4EF2A 3M3FA 5B70A 1S7YA 4XIGQ 3CFXA 3TPAA 1XVXA 4WEPA 3T66A 1I69A 1R1NA 1M5BA 1G0HA 2NXOA 4PE5B 1PDAA 1K9ZA 5L9MA 1RDXA 1MXZA 1R6ZA 3W15C 2DWAA 2V3QA 3N26A 2DWHA 4OA4A 1AWBA 2YLNA 5FHMA 3KC1A 2I48A 3T9XB 1A8EA 4P1EA 4MMPA 1SI1A 5M2VA 3BFUA 2M8CA 2GFEA 3KJ7A 3TTMA 3PUXE 2LAOA 3G3KA 4PFIA 2XX7A 4GRKA 4DLDA 4O3CA 3RNNA 2UXAA 3TYHA 3WAFA 2Q9TA 1H76A 1IEJA 4XEQA 3LBSA 3LUZA 3PPNA 5L9SA 4BDRA 2QPQA 1QKBA 4NE4A 1FTJA 2Y5LA 4EQ9A 4OVSA 1IIWA 3IB0A 1DBZA 1XT8A 1FTAA 3MZ1A 1MQIA 5ET8A 4MLQA 1D9YA 1OLCA 1IXHA 2B4MA 4LQ5A 4MX6A 4OZ9A 3C4MA 1FCKA 3G3IA 3T9UA 3FD3A 2WYPA 3D1RA 1B7UA 5J1DA 2XD3A 3PUWE 3Q28A 1NV6A 2DOJA 4PAKA 4X8RA 1NV0A 1A8FA 2XXYA 4N8YA 2Q8MA 3O6GA 1IXCA 1MY3A 3DP4A 4KCDA 5ICTA 4QF9A 2AYSA 5I2NB 1SW4A 5HM4B 4OTEA 5IZZA 2QSXA 3HN0A 3K1MA 5CI5A 5IZ3A 4ZDMA 5AA4B 1JQFA 2OK2A 5AE4A 3FXUA 1OQHA 1QGXA 1US4A 3LSWA 4R6KA 1NH7A 4DCXA 1B6HA 2ZNSA 3PU5A 4KD5A 1TT1A 1LAGE 1EYJA 4G8NA 3K1PA 2F78A 3I3VA 4FIMA 1XS5A 3A29A 3IJXB 4HE0A 3BIHA 3LR1A 1EZ9A 4WKMA 2Q2CA 3Q25A 4OFLA 3RTFB 1N0TA 4IO7A 2F6GA 1VDWA 3MAMA 1LBBA 4G8MA 2Y84A 3TELA 1TFDA 1SVXB 1LEVA 4FATA 2WBDA 3BIGA 1NMUA 4F3BA 2Q8JA 3VFJA 4EQ7A 3KOTA 3SERA 1SYHA 2CMOA 2Q74A 3A09A 3SEYA 2XXKA 1FQCA 4X04A 4I3EA 4QSCA 1OVBA 4NGUA 3FV1A 2VHAA 4IO2A 5K2YA 3FASA 2Y7KA 1FPKA 2BJJX 4N91A 3K01A 4OVQA 1FPBA 4EDPA 4NF4A 3V5AA 3HFUA 3FVOA 5DTBA 4MF3A 2GRVA 3EHSA 4LA9A 4R72A 1DSNA 2DSFA 5F1QA 2I0CA 5LDZA 5TPAA 4GL8A 3MP6A 4DCYA 4AB6A 1B5IA 2G93A 4EUOA 4OHNA 1BKAA 4TLLB 5A5XB 1H45A 4PF6A 2R9JA 1BP5A 3MUQA 3A3UA 4KYSA 3QXMA 1AOVA 1FQFA 1MQJA 3TCHA 4TOZA 1N76A 3SESA 4H45A 5I2KA 4O8MA 1YCJA 1MPDA 2YPNA 4JB7A 5I59A 1NV7A 3D4CA 4R6HA 1TWYA 2R6GE 1FTMA 3MC2A 1Y3QA 5JEIA 2I58A 4KFQA 4OESA 2Y5KA 3G3GA 1DK4A 4QFOA 4OVJA 4XXUA 4PC9A 4DI3D 2CEYA 4PDDA 1N3XA 5AA2B 1Y1ZA 1Y4TA 1B7ZA 1QULA 4YB7A 2Y7RA 1DCUA 2OZZA 3RT8A 1K9YA 4ZZAA 1MDQA 3K4UA 3RLFE 5DVJA 3IAZA 1EYIA 1HSEA 4M4GA 4FJPA 5CBSA 4PAIA 4G4PA 2Q88A 1JVXA 4G68A 3RYDA 3T96B 3V89B 2PMSA 2KQZA 1P99A 3PPQA 1YZ0A 1Z7ME 2F6PA 4JWYA 1J1NA 3I6VA 4P3LA 1VFDA 4Q30B 4YMBA 3MVYA 2THIA 5KCJA 4N6PA 2RC9A 3VLVA 3GLBA 4C1TA 2V25A 2VPNA 1EZPA 1YYZA 1M5CA 4GXSB 4NWCA 3OEKA
chains in the Genus database with same CATH topology
4PQJA 1A40A 5I58B 4P0GA 3CFZA 4ZEKA 2O69A 3F11A 3MQ9A 4G68C 4C0RA 2D3IA 4LVQA 5HBCA 3R26A 3CFLA 1OMPA 4NF5B 3PMXA 3B6TA 5BUUA 4O3BA 2QMWA 1O63A 3RPWA 4DXCA 5JTYA 3CRBA 3TTNA 2DVCA 2P2AA 3OO9A 1PC3A 4F29A 4PFTA 1LB9A 1TFAA 4POXA 3M8UA 1Y4CA 4F39A 1LB8A 3CR9A 3QYTA 3IX1A 4DIGA 3PD8A 3TFLA 2FA7A 4I1DA 4ND9A 1UTHB 3TTKA 4I62A 4AQ4A 5K2XA 3C31A 1MH4A 4HCYA 1OQGA 1NNKA 2QS3A 5DVIA 4OEVA 1SW1A 3S9NC 5ELVA 1LCTA 3C33A 1EU8A 4NF8B 2VD2A 1ZIUA 4RPOA 5H8SA 1MH3A 4F1UA 4GL0A 1I6BA 4FORA 4F1YA 1SQYA 3GBAA 1B2HA 1H3DA 2F7BA 3IL1B 1Y20A 3TMGA 5CMKA 3PV0E 5H8HB 2ANJA 1LSTA 1B0LA 3IK6B 2F36A 4GVOA 3O6IA 4LZ7A 2I0BA 3JZJA 3OSRA 4PP0A 4QRZA 2Q89A 5CBRA 4NWDA 3PD9A 5KZTA 2I4CA 5F7VA 5JK4A 5A5XA 1B52A 4XTCQ 3TUSA 5LOMA 3LSLA 3KG2A 3S9LC 2O84X 2Z22A 3B6WA 3FJMA 3IOVA 3USDA 3GXAA 3O6HA 4OENA 1MXVA 1N3WA 2I6EA 3HSTA 1GVCA 2HAUA 4KCCA 1B3LA 3HV1A 1SI0A 5IAIA 2F5XA 2XXTA 4ISUA 4YU0A 5DVFA 1B0HA 1IUDA 2Z8EA 4RK9A 3TQWA 3OELA 4DDDA 3PPOA 4YB5A 5TP9B 4R9GA 1MY4A 4WEDA 3O28A 1SBPA 2DYXA 4YB6A 3H3GA 4ZEDA 4F3GA 3E3KA 3U72A 1ZBMA 4LUBA 3KZGA 5FHOA 4AB5A 3EHTA 2RC7A 4IO6A 3FGSA 3IOTA 4LONB 2F34A 1ZLQA 1B32A 3KSXA 1NNFA 1DPPA 2F7AA 4TQUQ 3ILTB 4E0XA 2HEUA 5H8NB 3RY3A 5EYFA 3KN7A 5B7DA 3FATA 4FAJA 3DLNA 1F9BA 2P1SA 3OO6A 3UGWA 2H4IA 3EN3A 2ZYKA 3H6VA 1VSOA 3VVDA 2HZKA 3A3CA 3UN6A 3U1OA 1RYOA 2ONKE 2X7PA 4MBPA 4QFPA 2Q2AA 3JYRA 3FVNA 3FJ7A 1FTKA 1II5A 4TLMB 2XHDA 3P7IA 3FIRA 3VVEA 1MY2A 3H06B 3C35A 4Z0IA 4WXJA 3PPRA 2OWSA 3ILUB 1JW1A 3R6UA 1BLFA 3BBRA 5EHMA 2D21A 1UTHA 5I56B 1D3KA 1LLSA 1I6QA 4UACA 3O9PA 5I84A 1B3EA 3EHUA 2E1SA 4XKQA 1PB8A 2A5TB 2O51A 1US5A 3MVZA 5AA1A 3MW0A 4NF8A 2HAVA 2VP1A 2AL4A 3QSLA 3SEUA 3CSGA 3BKIB 3Q26A 2RCBA 4F18A 4RA1A 1JVYA 4IGTA 4U1ZA 1RKMA 4U1OA 1AIVA 4EQBA 1MQGA 1B3HA 1SYIA 3GBBA 1XVYA 3PGFA 2VD3A 5HPQA 4FE8A 3HHFA 4U2RA 4O3AA 5KDTB 2QS4A 2CZLA 2O1MA 4ELOA 3VE1B 3K2DA 3KFMA 3OO8A 3OO7A 1URSA 4M1VA 1LFGA 3OENA 2NWJA 2DQVA 3MP1A 3L6GA 2ZYNA 4R75A 1Q1KA 3QUJA 2ESNA 1MXWA 3IR1A 1BIYA 3DM0A 3SDFA 4I8CA 2Y7IA 3UA8A 5H8QB 4RK2A 5DEXB 1PBQA 2PBWA 5AA2D 3H6WA 1AH5A 4BDQA 3OOAA 2DWJA 1NKXA 2DXYA 1PB9A 3OEMA 3CVGA 4QFNA 1QJMA 1LFIA 2HFBA 4H8IA 1MQDA 2P0SA 4PFWA 3TDJA 1O64A 3RGYA 1JEUA 2XXHA 3H03A 4R2BA 1UQWA 5H8FB 4IB2A 3UK4A 2HQ0A 4NF6B 2Z8DA 4IY5A 1YPNA 4U23A 5CRYA 5FTIA 3LUYA 4P0IA 1P1OA 2OBGA 4JWXA 3MVXA 2ZYOA 4X1BA 2XD2A 2WKYA 2GH9A 2D5WA 2O7IA 1FTLA 1WODA 3MWBA 4H65A 1YTVA 1B9JA 4RYAA 1B4HA 1NH8A 1D9VA 3IO6A 2W7YA 4NTLA 1MPCA 1POTA 1N7WA 4X48A 2E0SA 3IO4A 2DS9A 4ZEIA 4ZEFA 4FEBA 5CMCA 3SKPA 2G29A 2VOZA 4XKNA 4OEUA 2XXQA 3T9VA 4F2OA 3OMBA 1R9LA 3M3KA 1M5DA 1P1QA 3DP6A 2AL5A 2V3TA 1XC1A 3RN8A 1O7TA 4ELQA 3AXFA 1IZ1A 3PUYE 2I3VA 1ZU0A 3IOWA 4BDOA 4MFIA 1B1HA 5I2NA 3HPIA 4JSOA 4F22A 4OQOA 5BWJA 5AA4A 3THIA 1B40A 3PMWA 4OYVA 3PMVA 4ECFA 2NOOA 2XX9A 5ISUA 1XOCA 3G7WA 4LQ2A 3KBRA 2Z8FA 4RNSA 4NMYA 4U4XA 1GGGA 4C1UA 2YJPA 3ZS6A 3N5LA 3W9VA 1A7LA 1WDNA 1OVTA 4KR5A 4I9DA 1B7HA 3U8QA 4H67A 1PEBA 5CM6A 4G8HA 1MY0A 1CE2A 4E0WA 2UYFA 1NNPA 1B4ZA 4MLVA 3H7MA 1QVSA 4YICA 2RINA 3O2AA 4GLIA 4H1XA 2RKMA 2UVHA 3KOSA 4QFLA 4YKIA 3FV2A 4Q8RA 1UTBB 3BFTA 4GOTA 5KDTA 3CG1A 4LZ5A 2O7UA 4ZS9A 2Z23A 4IGRA 4FEDA 3Q29A 3OD7A 4BDLA 2ZYMA 3GZGA 4X9TA 3RUMA 1FQEA 3CSBA 3KN3A 2ZXTA 1USYH 5ITOA 1GTKA 4H5GA 1P1WA 2XXVA 3H6UA 3TKDA 3TTLA 4OETA 5DT6A 1MG1A 5H8QA 1L5TA 2UVJA 2H5YA 2X7QA 3QIMA 5ITPA 3TQLA 2KLFA 1ANFA 2H25A 2PYYA 4HS7A 4F3SA 4YKJA 3O66A 4BLAA 1A54A 4P11A 1HSLA 4GIZA 2F8DA 2Y7WA 1LFHA 1ZKBA 3V8XB 1FQDA 2HXWA 3MVWA 4IO5A 4KPTA 4OWDA 3O97A 1USYE 4KI0E 3C34A 5H8FA 1QW0A 4JXIA 1DPEA 5ICQA 3B6QA 4BDNA 5AA2A 1LAFE 1UIUA 1RYXA 3G3FA 2UYEA 1DTZA 3TZAA 4PFUA 4HCWA 1N84A 1Y1MA 5TPAB 3FZVA 4F31B 2DP8A 2ONRA 4JWOA 3R7XA 4EXKA 2V84A 1EH3A 2REJA 3S9EA 2XXPA 2Y7PA 1MS7A 1HSJA 3CIJA 4JSDA 4OFJA 4N13A 3IOUA 1BTJA 1QKAA 3LC8A 4HTGA 3C32A 4GF8A 5I59B 1XHYA 3QK6A 3M3LA 3K6UA 2FNCA 1AMFA 2OCUA 3K6WA 4BDMA 3QAXA 1TXFA 1LAXA 3OSQA 3VV5A 3HHGA 1CB6A 1OLAA 4DE8A 4JDFA 1B58A 3IJOB 2XXRA 1LCFA 2QJEA 4R9FA 1QUJA 5I58A 1POY1 2F35A 4GXAA 4RJZA 1VE4A 4N07A 2RC8A 4NF5A 3T22A 4FECA 3TEPA 3FXQA 1IXGA 3ZKKA 1EZOA 3MP8A 2V3UA 1MXXA 3MPKA 4QFKA 1Z7NE 2NVUB 2QS1A 4G68B 4YMAA 1ATGA 2B3BA 4LATA 2B65A 3TCFA 2I4BA 5KCJB 3SEXA 3RQTA 3VXBA 1GR2A 4GD5A 1B51A 4QSDA 1PB7A 2AIXA 3CI8A 3U92A 3TCGA 5FTHA 4ONYA 3HO7A 1M5EA 1N04A 4X1DA 3S4UA 3ONMA 1Y3NA 1UTBA 1OIBA 3S2VA 2GHBA 4HW8A 4RXLA 1JW5A 2XXWA 1NNTA 2XXXA 1R9QA 5CMBA 5JTYB 1Y9UA 2DE4A 4EF1A 5H8HA 5CC2A 2O6AA 1S50A 1UIVA 3K6XA 3Q27A 1NFTA 3C9HA 3KN8A 1P1UA 1H43A 1Y3PA 4JBZA 1P1NA 3UORA 3KSJA 3E4RA 3ECRA 3TTRA 1DMBA 4F2QA 1MPBA 2HZLA 3MPLA 1SDXA 1QUKA 1URDA 3I5OA 4H0WA 3E9XA 3V83A 1B5JA 1SW2A 2I3WA 4OFOA 4R6YA 4G2ZA 4ELRA 2B3FA 3H6TA 3E13X 3B7DA 4L17A 2O1LA 5TP9A 3U94A 1MY1A 4LZ8A 5FHNA 2X26A 1WVJA 3UIFA 4UA8A 3T9HB 2IA4A 1VFEA 4PFYA 3T93B 1FW0A 5TU0A 1IXIA 4ELPA 2O68A 4RPNA 3FVGA 3ODBA 3K00A 1FQAA 4DXUA 1Q35A 3HCQA 1ZMGA 3G3HA 1D4NA 2H98A 2V93A 5I57B 1LBCA 3MJNA 4PETA 1PBPA 4ESWA 4LP2B 3IB2A 3VDFA 5H8NA 1YAEA 3L6HA 5IKBA 3DELB 1SW5A 1SD3A 2IEEA 3K02A 2F97A 4GWOA 3N6TA 1JW4A 1IQ7A 3D4GA 4OXVA 2A5SA 1S9TA 1JEVA 4QHQA 2H9BA 2DXRA 4XKRA 1A55A 2DWIA 3W9WA 3VXCA 4H6DA 4ZEBA 4RY1A 1JETA 3FUZA 3VVFA 4KQPA 4ZE8A 1MM7A 2ZNUA 1ELJA 1LGBC 1GV8A 3C36A 3K0VA 2DVZA 4ZECA 3LSXA 1KWHA 3KGCA 3PPPA 3FVKA 4Q0CA 3G3JA 1B1XA 4NEDA 5L9OA 5I56A 2H99A 3KJTA 1MQHA 1B46A 4F3PA 3S9MC 3K1NA 3LSFB 3SEVA 2QRYA 2A5TA 2FYIA 1B5HA 4DXBA 4H5FA 3N94A 1H44A 4DZ1A 2PT1A 3DP8A 2R71A 2RCAA 1IITA 4ESXA 3O29A 4IO3A 3SEWA 2OLBA 5CMMA 3MZ9A 2QL3A 3JV9A 3OXNA 4OMBA 4YKKA 4MH5A 3EQ1A 2DE2A 1QUIA 2DE3A 1LAHE 1B3FA 2I49A 4GFRA 1JNFA 4XKPA 1MRPA 4IO4A 3RT6B 3N6UA 4QSEA 4H8JA 3UP9A 3IB1A 3K6VA 3TAJA 4YKPA 2PVUA 2QS2A 2XXIA 2REGA 4G77A 3U93A 1MXUA 2UVIA 1AL3A 5AA3A 3ZSFA 4U22A 1B3GA 3MBPA 3H4ZA 3QUFA 4OERA 4F19A 4GQOA 2XXUA 2RF1A 2OJTA 3PUVE 2UVGA 4ZE9A 2ZNTA 4POWA 2HCAA 5DEXA 4KYDA 2ALUA 5EHSA 3SETA 5DYHA 4F1VA 4K3FA 1FTOA 2NUVA 1B05A 5L8DA 3VLUA 2ABHA 4YZZA 1MM6A 3EPEA 2ZMBA 1DTGA 4KYEA 2PX1A 1FQBA 3TODA 2OWTA 3CG3A 1ZJLA 3WAEA 2XX8A 4U4SA 4EXLA 3FJGA 4R73A 4R2FA 3IORA 1T0KA 4NF6A 4YAHX 4NF4B 3FXRA 3PUZE 1URGA 2VGQA 1A99A 5I57A 1DOTA 4ZZEA 4IY6A 3ZKLA 4THIA 1MDP1 4U21A 1ZTYA 3EF7A 2PT2A 1M5FA 3MZBA 3RTWB 1VR5A 2GHAA 1N7XA 2F7CA 3KEIA 3VLWA 4Z7EA 4KHZE 2QMXA 1NL5A 4R74A 4Q5TA 5I2KB 1MXYA 2ONSA 1I6AA 4EF2A 3M3FA 5B70A 1S7YA 4XIGQ 3CFXA 3TPAA 1XVXA 4WEPA 3T66A 1I69A 1R1NA 1M5BA 4PE5B 2NXOA 1PDAA 5L9MA 1MXZA 1R6ZA 3W15C 2DWAA 2V3QA 3N26A 2DWHA 2YLNA 5FHMA 2I48A 3T9XB 1A8EA 1SI1A 5M2VA 3BFUA 2M8CA 2GFEA 3KJ7A 3TTMA 3PUXE 2LAOA 3G3KA 2XX7A 4GRKA 4DLDA 4O3CA 3RNNA 2UXAA 3TYHA 3WAFA 2Q9TA 1H76A 1IEJA 3LBSA 3PPNA 5L9SA 4BDRA 2QPQA 1QKBA 4NE4A 1FTJA 4EQ9A 1IIWA 3IB0A 1XT8A 3MZ1A 1MQIA 4MLQA 1D9YA 1OLCA 1IXHA 4LQ5A 4OZ9A 3C4MA 1FCKA 3G3IA 3T9UA 3FD3A 1B7UA 5J1DA 2XD3A 3PUWE 3Q28A 2DOJA 1A8FA 2XXYA 3O6GA 1IXCA 1MY3A 3DP4A 4KCDA 5ICTA 4QF9A 2AYSA 5I2NB 1SW4A 5HM4B 4OTEA 2QSXA 3HN0A 3K1MA 5CI5A 4ZDMA 5AA4B 1JQFA 2OK2A 5AE4A 3FXUA 1OQHA 1US4A 3LSWA 4R6KA 1NH7A 4DCXA 1B6HA 2ZNSA 3PU5A 4KD5A 1TT1A 1LAGE 4G8NA 3K1PA 2F78A 3I3VA 4FIMA 1XS5A 3IJXB 3LR1A 1EZ9A 4WKMA 2Q2CA 3Q25A 4OFLA 3RTFB 1N0TA 4IO7A 2F6GA 3MAMA 1LBBA 4G8MA 2Y84A 3TELA 1TFDA 1SVXB 4FATA 1NMUA 4F3BA 2Q8JA 3VFJA 4EQ7A 3KOTA 3SERA 1SYHA 2CMOA 3A09A 3SEYA 1FQCA 4QSCA 1OVBA 3FV1A 2VHAA 4IO2A 5K2YA 3FASA 2Y7KA 2BJJX 3K01A 4EDPA 4NF4A 3V5AA 3FVOA 5DTBA 4MF3A 2GRVA 3EHSA 4LA9A 4R72A 1DSNA 2DSFA 5F1QA 2I0CA 5TPAA 4GL8A 3MP6A 4DCYA 4AB6A 1B5IA 2G93A 4EUOA 4OHNA 1BKAA 4TLLB 5A5XB 1H45A 2R9JA 1BP5A 3MUQA 3A3UA 4KYSA 3QXMA 1AOVA 1FQFA 1MQJA 3TCHA 4TOZA 1N76A 3SESA 5I2KA 1YCJA 1MPDA 2YPNA 4JB7A 5I59A 3D4CA 4R6HA 1TWYA 2R6GE 1FTMA 3MC2A 1Y3QA 5JEIA 2I58A 4KFQA 4OESA 3G3GA 4QFOA 4OVJA 4XXUA 1N3XA 5AA2B 1Y1ZA 1Y4TA 1B7ZA 1QULA 4YB7A 2Y7RA 2OZZA 3RT8A 4ZZAA 1MDQA 3K4UA 3RLFE 5DVJA 3IAZA 1HSEA 4M4GA 4FJPA 5CBSA 4G4PA 2Q88A 1JVXA 4G68A 3T96B 3V89B 2PMSA 1P99A 3PPQA 1Z7ME 2F6PA 4JWYA 1J1NA 3I6VA 1VFDA 4Q30B 4YMBA 3MVYA 2THIA 5KCJA 4N6PA 2RC9A 3VLVA 3GLBA 4C1TA 2V25A 1EZPA 1M5CA 4GXSB 4NWCA 3OEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQJ A;  1A40 A;  5I58 B;  4P0G A;  3CFZ A;  4ZEK A;  2O69 A;  3F11 A;  3MQ9 A;  4G68 C;  4C0R A;  2D3I A;  4LVQ A;  5HBC A;  3R26 A;  3CFL A;  1OMP A;  4NF5 B;  3PMX A;  3B6T A;  5BUU A;  4O3B A;  2QMW A;  1O63 A;  3RPW A;  4DXC A;  5JTY A;  3CRB A;  3TTN A;  2DVC A;  2P2A A;  3OO9 A;  1PC3 A;  4F29 A;  4PFT A;  1LB9 A;  1TFA A;  4POX A;  3M8U A;  1Y4C A;  4F39 A;  1LB8 A;  3CR9 A;  3QYT A;  3IX1 A;  4DIG A;  3PD8 A;  3TFL A;  2FA7 A;  4I1D A;  4ND9 A;  1UTH B;  3TTK A;  4I62 A;  4AQ4 A;  5K2X A;  3C31 A;  1MH4 A;  4HCY A;  1OQG A;  1NNK A;  2QS3 A;  5DVI A;  4OEV A;  1SW1 A;  3S9N C;  5ELV A;  1LCT A;  3C33 A;  1EU8 A;  4NF8 B;  2VD2 A;  1ZIU A;  4RPO A;  5H8S A;  1MH3 A;  4F1U A;  4GL0 A;  1I6B A;  4FOR A;  4F1Y A;  1SQY A;  3GBA A;  1B2H A;  1H3D A;  2F7B A;  3IL1 B;  1Y20 A;  3TMG A;  5CMK A;  3PV0 E;  5H8H B;  2ANJ A;  1LST A;  1B0L A;  3IK6 B;  2F36 A;  4GVO A;  3O6I A;  4LZ7 A;  2I0B A;  3JZJ A;  3OSR A;  4PP0 A;  4QRZ A;  2Q89 A;  5CBR A;  4NWD A;  3PD9 A;  5KZT A;  2I4C A;  5F7V A;  5JK4 A;  5A5X A;  1B52 A;  4XTC Q;  3TUS A;  5LOM A;  3LSL A;  3KG2 A;  3S9L C;  2O84 X;  2Z22 A;  3B6W A;  3FJM A;  3IOV A;  3USD A;  3GXA A;  3O6H A;  4OEN A;  1MXV A;  1N3W A;  2I6E A;  3HST A;  1GVC A;  2HAU A;  4KCC A;  1B3L A;  3HV1 A;  1SI0 A;  5IAI A;  2F5X A;  2XXT A;  4ISU A;  4YU0 A;  5DVF A;  1B0H A;  1IUD A;  2Z8E A;  4RK9 A;  3TQW A;  3OEL A;  4DDD A;  3PPO A;  4YB5 A;  5TP9 B;  4R9G A;  1MY4 A;  4WED A;  3O28 A;  1SBP A;  2DYX A;  4YB6 A;  3H3G A;  4ZED A;  4F3G A;  3E3K A;  3U72 A;  1ZBM A;  4LUB A;  3KZG A;  5FHO A;  4AB5 A;  3EHT A;  2RC7 A;  4IO6 A;  3FGS A;  3IOT A;  4LON B;  2F34 A;  1ZLQ A;  1B32 A;  3KSX A;  1NNF A;  1DPP A;  2F7A A;  4TQU Q;  3ILT B;  4E0X A;  2HEU A;  5H8N B;  3RY3 A;  5EYF A;  3KN7 A;  5B7D A;  3FAT A;  4FAJ A;  3DLN A;  1F9B A;  2P1S A;  3OO6 A;  3UGW A;  2H4I A;  3EN3 A;  2ZYK A;  3H6V A;  1VSO A;  3VVD A;  2HZK A;  3A3C A;  3UN6 A;  3U1O A;  1RYO A;  2ONK E;  2X7P A;  4MBP A;  4QFP A;  2Q2A A;  3JYR A;  3FVN A;  3FJ7 A;  1FTK A;  1II5 A;  4TLM B;  2XHD A;  3P7I A;  3FIR A;  3VVE A;  1MY2 A;  3H06 B;  3C35 A;  4Z0I A;  4WXJ A;  3PPR A;  2OWS A;  3ILU B;  1JW1 A;  3R6U A;  1BLF A;  3BBR A;  5EHM A;  2D21 A;  1UTH A;  5I56 B;  1D3K A;  1LLS A;  1I6Q A;  4UAC A;  3O9P A;  5I84 A;  1B3E A;  3EHU A;  2E1S A;  4XKQ A;  1PB8 A;  2A5T B;  2O51 A;  1US5 A;  3MVZ A;  5AA1 A;  3MW0 A;  4NF8 A;  2HAV A;  2VP1 A;  2AL4 A;  3QSL A;  3SEU A;  3CSG A;  3BKI B;  3Q26 A;  2RCB A;  4F18 A;  4RA1 A;  1JVY A;  4IGT A;  4U1Z A;  1RKM A;  4U1O A;  1AIV A;  4EQB A;  1MQG A;  1B3H A;  1SYI A;  3GBB A;  1XVY A;  3PGF A;  2VD3 A;  5HPQ A;  4FE8 A;  3HHF A;  4U2R A;  4O3A A;  5KDT B;  2QS4 A;  2CZL A;  2O1M A;  4ELO A;  3VE1 B;  3K2D A;  3KFM A;  3OO8 A;  3OO7 A;  1URS A;  4M1V A;  1LFG A;  3OEN A;  2NWJ A;  2DQV A;  3MP1 A;  3L6G A;  2ZYN A;  4R75 A;  1Q1K A;  3QUJ A;  2ESN A;  1MXW A;  3IR1 A;  1BIY A;  3DM0 A;  3SDF A;  4I8C A;  2Y7I A;  3UA8 A;  5H8Q B;  4RK2 A;  5DEX B;  1PBQ A;  2PBW A;  5AA2 D;  3H6W A;  1AH5 A;  4BDQ A;  3OOA A;  2DWJ A;  1NKX A;  2DXY A;  1PB9 A;  3OEM A;  3CVG A;  4QFN A;  1QJM A;  1LFI A;  2HFB A;  4H8I A;  1MQD A;  2P0S A;  4PFW A;  3TDJ A;  1O64 A;  3RGY A;  1JEU A;  2XXH A;  3H03 A;  4R2B A;  1UQW A;  5H8F B;  4IB2 A;  3UK4 A;  2HQ0 A;  4NF6 B;  2Z8D A;  4IY5 A;  1YPN A;  4U23 A;  5CRY A;  5FTI A;  3LUY A;  4P0I A;  1P1O A;  2OBG A;  4JWX A;  3MVX A;  2ZYO A;  4X1B A;  2XD2 A;  2WKY A;  2GH9 A;  2D5W A;  2O7I A;  1FTL A;  1WOD A;  3MWB A;  4H65 A;  1YTV A;  1B9J A;  4RYA A;  1B4H A;  1NH8 A;  1D9V A;  3IO6 A;  2W7Y A;  4NTL A;  1MPC A;  1POT A;  1N7W A;  4X48 A;  2E0S A;  3IO4 A;  2DS9 A;  4ZEI A;  4ZEF A;  4FEB A;  5CMC A;  3SKP A;  2G29 A;  2VOZ A;  4XKN A;  4OEU A;  2XXQ A;  3T9V A;  4F2O A;  3OMB A;  1R9L A;  3M3K A;  1M5D A;  1P1Q A;  3DP6 A;  2AL5 A;  2V3T A;  1XC1 A;  3RN8 A;  1O7T A;  4ELQ A;  3AXF A;  1IZ1 A;  3PUY E;  2I3V A;  1ZU0 A;  3IOW A;  4BDO A;  4MFI A;  1B1H A;  5I2N A;  3HPI A;  4JSO A;  4F22 A;  4OQO A;  5BWJ A;  5AA4 A;  3THI A;  1B40 A;  3PMW A;  4OYV A;  3PMV A;  4ECF A;  2NOO A;  2XX9 A;  5ISU A;  1XOC A;  3G7W A;  4LQ2 A;  3KBR A;  2Z8F A;  4RNS A;  4NMY A;  4U4X A;  1GGG A;  4C1U A;  2YJP A;  3ZS6 A;  3N5L A;  3W9V A;  1A7L A;  1WDN A;  1OVT A;  4KR5 A;  4I9D A;  1B7H A;  3U8Q A;  4H67 A;  1PEB A;  5CM6 A;  4G8H A;  1MY0 A;  1CE2 A;  4E0W A;  2UYF A;  1NNP A;  1B4Z A;  4MLV A;  3H7M A;  1QVS A;  4YIC A;  2RIN A;  3O2A A;  4GLI A;  4H1X A;  2RKM A;  2UVH A;  3KOS A;  4QFL A;  4YKI A;  3FV2 A;  4Q8R A;  1UTB B;  3BFT A;  4GOT A;  5KDT A;  3CG1 A;  4LZ5 A;  2O7U A;  4ZS9 A;  2Z23 A;  4IGR A;  4FED A;  3Q29 A;  3OD7 A;  4BDL A;  2ZYM A;  3GZG A;  4X9T A;  3RUM A;  1FQE A;  3CSB A;  3KN3 A;  2ZXT A;  1USY H;  5ITO A;  1GTK A;  4H5G A;  1P1W A;  2XXV A;  3H6U A;  3TKD A;  3TTL A;  4OET A;  5DT6 A;  1MG1 A;  5H8Q A;  1L5T A;  2UVJ A;  2H5Y A;  2X7Q A;  3QIM A;  5ITP A;  3TQL A;  2KLF A;  1ANF A;  2H25 A;  2PYY A;  4HS7 A;  4F3S A;  4YKJ A;  3O66 A;  4BLA A;  1A54 A;  4P11 A;  1HSL A;  4GIZ A;  2F8D A;  2Y7W A;  1LFH A;  1ZKB A;  3V8X B;  1FQD A;  2HXW A;  3MVW A;  4IO5 A;  4KPT A;  4OWD A;  3O97 A;  1USY E;  4KI0 E;  3C34 A;  5H8F A;  1QW0 A;  4JXI A;  1DPE A;  5ICQ A;  3B6Q A;  4BDN A;  5AA2 A;  1LAF E;  1UIU A;  1RYX A;  3G3F A;  2UYE A;  1DTZ A;  3TZA A;  4PFU A;  4HCW A;  1N84 A;  1Y1M A;  5TPA B;  3FZV A;  4F31 B;  2DP8 A;  2ONR A;  4JWO A;  3R7X A;  4EXK A;  2V84 A;  1EH3 A;  2REJ A;  3S9E A;  2XXP A;  2Y7P A;  1MS7 A;  1HSJ A;  3CIJ A;  4JSD A;  4OFJ A;  4N13 A;  3IOU A;  1BTJ A;  1QKA A;  3LC8 A;  4HTG A;  3C32 A;  4GF8 A;  5I59 B;  1XHY A;  3QK6 A;  3M3L A;  3K6U A;  2FNC A;  1AMF A;  2OCU A;  3K6W A;  4BDM A;  3QAX A;  1TXF A;  1LAX A;  3OSQ A;  3VV5 A;  3HHG A;  1CB6 A;  1OLA A;  4DE8 A;  4JDF A;  1B58 A;  3IJO B;  2XXR A;  1LCF A;  2QJE A;  4R9F A;  1QUJ A;  5I58 A;  1POY 1;  2F35 A;  4GXA A;  4RJZ A;  1VE4 A;  4N07 A;  2RC8 A;  4NF5 A;  3T22 A;  4FEC A;  3TEP A;  3FXQ A;  1IXG A;  3ZKK A;  1EZO A;  3MP8 A;  2V3U A;  1MXX A;  3MPK A;  4QFK A;  1Z7N E;  2NVU B;  2QS1 A;  4G68 B;  4YMA A;  1ATG A;  2B3B A;  4LAT A;  2B65 A;  3TCF A;  2I4B A;  5KCJ B;  3SEX A;  3RQT A;  3VXB A;  1GR2 A;  4GD5 A;  1B51 A;  4QSD A;  1PB7 A;  2AIX A;  3CI8 A;  3U92 A;  3TCG A;  5FTH A;  4ONY A;  3HO7 A;  1M5E A;  1N04 A;  4X1D A;  3S4U A;  3ONM A;  1Y3N A;  1UTB A;  1OIB A;  3S2V A;  2GHB A;  4HW8 A;  4RXL A;  1JW5 A;  2XXW A;  1NNT A;  2XXX A;  1R9Q A;  5CMB A;  5JTY B;  1Y9U A;  2DE4 A;  4EF1 A;  5H8H A;  5CC2 A;  2O6A A;  1S50 A;  1UIV A;  3K6X A;  3Q27 A;  1NFT A;  3C9H A;  3KN8 A;  1P1U A;  1H43 A;  1Y3P A;  4JBZ A;  1P1N A;  3UOR A;  3KSJ A;  3E4R A;  3ECR A;  3TTR A;  1DMB A;  4F2Q A;  1MPB A;  2HZL A;  3MPL A;  1SDX A;  1QUK A;  1URD A;  3I5O A;  4H0W A;  3E9X A;  3V83 A;  1B5J A;  1SW2 A;  2I3W A;  4OFO A;  4R6Y A;  4G2Z A;  4ELR A;  2B3F A;  3H6T A;  3E13 X;  3B7D A;  4L17 A;  2O1L A;  5TP9 A;  3U94 A;  1MY1 A;  4LZ8 A;  5FHN A;  2X26 A;  1WVJ A;  3UIF A;  4UA8 A;  3T9H B;  2IA4 A;  1VFE A;  4PFY A;  3T93 B;  1FW0 A;  5TU0 A;  1IXI A;  4ELP A;  2O68 A;  4RPN A;  3FVG A;  3ODB A;  3K00 A;  1FQA A;  4DXU A;  1Q35 A;  3HCQ A;  1ZMG A;  3G3H A;  1D4N A;  2H98 A;  2V93 A;  5I57 B;  1LBC A;  3MJN A;  4PET A;  1PBP A;  4ESW A;  4LP2 B;  3IB2 A;  3VDF A;  5H8N A;  1YAE A;  3L6H A;  5IKB A;  3DEL B;  1SW5 A;  1SD3 A;  2IEE A;  3K02 A;  2F97 A;  4GWO A;  3N6T A;  1JW4 A;  1IQ7 A;  3D4G A;  4OXV A;  2A5S A;  1S9T A;  1JEV A;  4QHQ A;  2H9B A;  2DXR A;  4XKR A;  1A55 A;  2DWI A;  3W9W A;  3VXC A;  4H6D A;  4ZEB A;  4RY1 A;  1JET A;  3FUZ A;  3VVF A;  4KQP A;  4ZE8 A;  1MM7 A;  2ZNU A;  1ELJ A;  1LGB C;  1GV8 A;  3C36 A;  3K0V A;  2DVZ A;  4ZEC A;  3LSX A;  1KWH A;  3KGC A;  3PPP A;  3FVK A;  4Q0C A;  3G3J A;  1B1X A;  4NED A;  5L9O A;  5I56 A;  2H99 A;  3KJT A;  1MQH A;  1B46 A;  4F3P A;  3S9M C;  3K1N A;  3LSF B;  3SEV A;  2QRY A;  2A5T A;  2FYI A;  1B5H A;  4DXB A;  4H5F A;  3N94 A;  1H44 A;  4DZ1 A;  2PT1 A;  3DP8 A;  2R71 A;  2RCA A;  1IIT A;  4ESX A;  3O29 A;  4IO3 A;  3SEW A;  2OLB A;  5CMM A;  3MZ9 A;  2QL3 A;  3JV9 A;  3OXN A;  4OMB A;  4YKK A;  4MH5 A;  3EQ1 A;  2DE2 A;  1QUI A;  2DE3 A;  1LAH E;  1B3F A;  2I49 A;  4GFR A;  1JNF A;  4XKP A;  1MRP A;  4IO4 A;  3RT6 B;  3N6U A;  4QSE A;  4H8J A;  3UP9 A;  3IB1 A;  3K6V A;  3TAJ A;  4YKP A;  2PVU A;  2QS2 A;  2XXI A;  2REG A;  4G77 A;  3U93 A;  1MXU A;  2UVI A;  1AL3 A;  5AA3 A;  3ZSF A;  4U22 A;  1B3G A;  3MBP A;  3H4Z A;  3QUF A;  4OER A;  4F19 A;  4GQO A;  2XXU A;  2RF1 A;  2OJT A;  3PUV E;  2UVG A;  4ZE9 A;  2ZNT A;  4POW A;  2HCA A;  5DEX A;  4KYD A;  2ALU A;  5EHS A;  3SET A;  5DYH A;  4F1V A;  4K3F A;  1FTO A;  2NUV A;  1B05 A;  5L8D A;  3VLU A;  2ABH A;  4YZZ A;  1MM6 A;  3EPE A;  2ZMB A;  1DTG A;  4KYE A;  2PX1 A;  1FQB A;  3TOD A;  2OWT A;  3CG3 A;  1ZJL A;  3WAE A;  2XX8 A;  4U4S A;  4EXL A;  3FJG A;  4R73 A;  4R2F A;  3IOR A;  1T0K A;  4NF6 A;  4YAH X;  4NF4 B;  3FXR A;  3PUZ E;  1URG A;  2VGQ A;  1A99 A;  5I57 A;  1DOT A;  4ZZE A;  4IY6 A;  3ZKL A;  4THI A;  1MDP 1;  4U21 A;  1ZTY A;  3EF7 A;  2PT2 A;  1M5F A;  3MZB A;  3RTW B;  1VR5 A;  2GHA A;  1N7X A;  2F7C A;  3KEI A;  3VLW A;  4Z7E A;  4KHZ E;  2QMX A;  1NL5 A;  4R74 A;  4Q5T A;  5I2K B;  1MXY A;  2ONS A;  1I6A A;  4EF2 A;  3M3F A;  5B70 A;  1S7Y A;  4XIG Q;  3CFX A;  3TPA A;  1XVX A;  4WEP A;  3T66 A;  1I69 A;  1R1N A;  1M5B A;  4PE5 B;  2NXO A;  1PDA A;  5L9M A;  1MXZ A;  1R6Z A;  3W15 C;  2DWA A;  2V3Q A;  3N26 A;  2DWH A;  2YLN A;  5FHM A;  2I48 A;  3T9X B;  1A8E A;  1SI1 A;  5M2V A;  3BFU A;  2M8C A;  2GFE A;  3KJ7 A;  3TTM A;  3PUX E;  2LAO A;  3G3K A;  2XX7 A;  4GRK A;  4DLD A;  4O3C A;  3RNN A;  2UXA A;  3TYH A;  3WAF A;  2Q9T A;  1H76 A;  1IEJ A;  3LBS A;  3PPN A;  5L9S A;  4BDR A;  2QPQ A;  1QKB A;  4NE4 A;  1FTJ A;  4EQ9 A;  1IIW A;  3IB0 A;  1XT8 A;  3MZ1 A;  1MQI A;  4MLQ A;  1D9Y A;  1OLC A;  1IXH A;  4LQ5 A;  4OZ9 A;  3C4M A;  1FCK A;  3G3I A;  3T9U A;  3FD3 A;  1B7U A;  5J1D A;  2XD3 A;  3PUW E;  3Q28 A;  2DOJ A;  1A8F A;  2XXY A;  3O6G A;  1IXC A;  1MY3 A;  3DP4 A;  4KCD A;  5ICT A;  4QF9 A;  2AYS A;  5I2N B;  1SW4 A;  5HM4 B;  4OTE A;  2QSX A;  3HN0 A;  3K1M A;  5CI5 A;  4ZDM A;  5AA4 B;  1JQF A;  2OK2 A;  5AE4 A;  3FXU A;  1OQH A;  1US4 A;  3LSW A;  4R6K A;  1NH7 A;  4DCX A;  1B6H A;  2ZNS A;  3PU5 A;  4KD5 A;  1TT1 A;  1LAG E;  4G8N A;  3K1P A;  2F78 A;  3I3V A;  4FIM A;  1XS5 A;  3IJX B;  3LR1 A;  1EZ9 A;  4WKM A;  2Q2C A;  3Q25 A;  4OFL A;  3RTF B;  1N0T A;  4IO7 A;  2F6G A;  3MAM A;  1LBB A;  4G8M A;  2Y84 A;  3TEL A;  1TFD A;  1SVX B;  4FAT A;  1NMU A;  4F3B A;  2Q8J A;  3VFJ A;  4EQ7 A;  3KOT A;  3SER A;  1SYH A;  2CMO A;  3A09 A;  3SEY A;  1FQC A;  4QSC A;  1OVB A;  3FV1 A;  2VHA A;  4IO2 A;  5K2Y A;  3FAS A;  2Y7K A;  2BJJ X;  3K01 A;  4EDP A;  4NF4 A;  3V5A A;  3FVO A;  5DTB A;  4MF3 A;  2GRV A;  3EHS A;  4LA9 A;  4R72 A;  1DSN A;  2DSF A;  5F1Q A;  2I0C A;  5TPA A;  4GL8 A;  3MP6 A;  4DCY A;  4AB6 A;  1B5I A;  2G93 A;  4EUO A;  4OHN A;  1BKA A;  4TLL B;  5A5X B;  1H45 A;  2R9J A;  1BP5 A;  3MUQ A;  3A3U A;  4KYS A;  3QXM A;  1AOV A;  1FQF A;  1MQJ A;  3TCH A;  4TOZ A;  1N76 A;  3SES A;  5I2K A;  1YCJ A;  1MPD A;  2YPN A;  4JB7 A;  5I59 A;  3D4C A;  4R6H A;  1TWY A;  2R6G E;  1FTM A;  3MC2 A;  1Y3Q A;  5JEI A;  2I58 A;  4KFQ A;  4OES A;  3G3G A;  4QFO A;  4OVJ A;  4XXU A;  1N3X A;  5AA2 B;  1Y1Z A;  1Y4T A;  1B7Z A;  1QUL A;  4YB7 A;  2Y7R A;  2OZZ A;  3RT8 A;  4ZZA A;  1MDQ A;  3K4U A;  3RLF E;  5DVJ A;  3IAZ A;  1HSE A;  4M4G A;  4FJP A;  5CBS A;  4G4P A;  2Q88 A;  1JVX A;  4G68 A;  3T96 B;  3V89 B;  2PMS A;  1P99 A;  3PPQ A;  1Z7M E;  2F6P A;  4JWY A;  1J1N A;  3I6V A;  1VFD A;  4Q30 B;  4YMB A;  3MVY A;  2THI A;  5KCJ A;  4N6P A;  2RC9 A;  3VLV A;  3GLB A;  4C1T A;  2V25 A;  1EZP A;  1M5C A;  4GXS B;  4NWC A;  3OEK A; 
#chains in the Genus database with same CATH topology
 4PQJ A;  5LTC A;  1A40 A;  5I58 B;  4P0G A;  3CFZ A;  4ZEK A;  1IMC A;  2O69 A;  2QVU A;  3F11 A;  3MQ9 A;  4G68 C;  4C0R A;  1LBW A;  2D3I A;  2V4C A;  4LVQ A;  5HBC A;  3R26 A;  1FPI A;  3CFL A;  1OMP A;  4NF5 B;  3PMX A;  3B6T A;  5BUU A;  4O3B A;  2QMW A;  1O63 A;  3RPW A;  4DXC A;  5JTY A;  3CRB A;  4PTK A;  3TTN A;  1IME A;  2DVC A;  2P2A A;  3OO9 A;  1PC3 A;  4F29 A;  4PFT A;  1LB9 A;  1TFA A;  4POX A;  3M8U A;  1Y4C A;  4F39 A;  1LB8 A;  3CR9 A;  3QYT A;  3IX1 A;  4DIG A;  3PD8 A;  3TFL A;  2FA7 A;  4I1D A;  4ND9 A;  3B50 A;  1UTH B;  3TTK A;  4NG7 A;  4I62 A;  4AQ4 A;  5K2X A;  3C31 A;  1MH4 A;  5A5L A;  2KR0 A;  4HCY A;  1OQG A;  1NNK A;  2QS3 A;  5DVI A;  4OEV A;  1SW1 A;  3S9N C;  5ELV A;  1LCT A;  3C33 A;  1EU8 A;  2WYK A;  4I40 A;  4NF8 B;  4PGN A;  2VD2 A;  1ZIU A;  4RPO A;  5H8S A;  1MH3 A;  4F1U A;  4GL0 A;  1I6B A;  4FOR A;  2XWV A;  4F1Y A;  3MST A;  1SQY A;  3GBA A;  1B2H A;  1H3D A;  2F7B A;  3IL1 B;  1Y20 A;  3TMG A;  1FBC A;  5CMK A;  3PV0 E;  5H8H B;  2ANJ A;  1LST A;  1B0L A;  1LBV A;  4MAG A;  3IK6 B;  2F36 A;  4GVO A;  4N81 A;  3O6I A;  4LZ7 A;  2I0B A;  3JZJ A;  3OSR A;  4PP0 A;  4QRZ A;  2Q89 A;  5CBR A;  4NWD A;  3PD9 A;  5KZT A;  2I4C A;  5F7V A;  5JK4 A;  5A5X A;  1B52 A;  4XTC Q;  3TUS A;  5LOM A;  3LSL A;  3KG2 A;  1LBX A;  3S9L C;  2O84 X;  2DDK A;  2Z22 A;  3B6W A;  3FJM A;  4P1L A;  3IOV A;  4PBH A;  3IFA A;  3USD A;  3GXA A;  3O6H A;  3KBZ A;  5I5P A;  4OEN A;  1MXV A;  1N3W A;  2I6E A;  3HST A;  1GVC A;  2HAU A;  4KCC A;  1B3L A;  3HV1 A;  1SI0 A;  5IAI A;  2F5X A;  1IMB A;  2XXT A;  4ISU A;  4YU0 A;  5DVF A;  1FPL A;  1B0H A;  4GX4 A;  1IUD A;  2Z8E A;  4RK9 A;  3TQW A;  4DI4 B;  4AS5 A;  1NUW A;  3OEL A;  3RPL A;  4DDD A;  3PPO A;  4YB5 A;  5TP9 B;  4R9G A;  1FPF A;  1MY4 A;  4WED A;  5IZ1 A;  3O28 A;  1SBP A;  2DYX A;  4YB6 A;  3H3G A;  4ZED A;  4F3G A;  2XWO A;  3E3K A;  3U72 A;  3E78 A;  1ZBM A;  4LUB A;  3KZG A;  5FHO A;  4AB5 A;  3EHT A;  2RC7 A;  4IO6 A;  1NV2 A;  3FGS A;  3IOT A;  4LON B;  2F34 A;  1ZLQ A;  1B32 A;  4XF5 A;  3KSX A;  2HPG A;  1NNF A;  1DPP A;  2F7A A;  4TQU Q;  3ILT B;  4E0X A;  2HEU A;  5H8N B;  5T3J A;  3RY3 A;  5EYF A;  1KA0 A;  3KN7 A;  5B7D A;  3FAT A;  4GX6 A;  4O94 A;  4FAJ A;  3DLN A;  4P8B A;  1F9B A;  2P1S A;  3OO6 A;  3UGW A;  2H4I A;  3EN3 A;  2ZYK A;  3H6V A;  1VSO A;  3VVD A;  2HZK A;  3A3C A;  3UN6 A;  3U1O A;  4NX1 A;  1RYO A;  2ONK E;  2X7P A;  4MBP A;  4QFP A;  5EQ7 A;  2Q2A A;  3JYR A;  3FVN A;  3FJ7 A;  4PFR A;  1FTK A;  1II5 A;  4TLM B;  2XHD A;  3P7I A;  3FIR A;  3VVE A;  1MY2 A;  3H06 B;  3C35 A;  4Z0I A;  4WXJ A;  4HE2 A;  3PPR A;  2OWS A;  3ILU B;  1JW1 A;  3R6U A;  1BLF A;  3BBR A;  5EHM A;  2D21 A;  1UTH A;  1FBH A;  5I56 B;  1D3K A;  1LLS A;  1I6Q A;  4UAC A;  3O9P A;  5I84 A;  1B3E A;  3EHU A;  2E1S A;  4XKQ A;  1PB8 A;  2A5T B;  2O51 A;  1US5 A;  3MVZ A;  1D9Q A;  5AA1 A;  5ET7 A;  4PDH A;  3MW0 A;  4NF8 A;  2HAV A;  2VP1 A;  2AL4 A;  3QSL A;  3ROJ A;  3SEU A;  2OWZ A;  3CSG A;  4OVP A;  3BKI B;  3Q26 A;  2RCB A;  4F18 A;  4RA1 A;  1JVY A;  1NV5 A;  4IGT A;  4U1Z A;  1RKM A;  4U1O A;  1AIV A;  4EQB A;  4XFE A;  3T1B A;  1KA1 A;  1MQG A;  1B3H A;  1SYI A;  3GBB A;  1XVY A;  3PGF A;  2VD3 A;  1IMA A;  4N4U A;  4FE8 A;  5HPQ A;  4NN3 A;  4QXD A;  2PFZ A;  2CZI A;  4MHF A;  5EQ8 A;  3HHF A;  4U2R A;  4O3A A;  5KDT B;  2QS4 A;  2CZL A;  2O1M A;  4ELO A;  3VE1 B;  4GWY A;  2HXR A;  3IFC A;  3K2D A;  3KFM A;  3OO8 A;  3OO7 A;  1URS A;  4M1V A;  1LFG A;  3OEN A;  2NWJ A;  2DQV A;  3MP1 A;  3L6G A;  2ZYN A;  4R75 A;  1Q1K A;  3QUJ A;  2ESN A;  1MXW A;  3IR1 A;  1BIY A;  3DM0 A;  3SDF A;  4I8C A;  2Y7I A;  3UA8 A;  2VT5 A;  5H8Q B;  4RK2 A;  5DEX B;  1PBQ A;  2PBW A;  5AA2 D;  3H6W A;  3B8B A;  1AH5 A;  4BDQ A;  2XWK A;  3OOA A;  2DWJ A;  1NKX A;  2DXY A;  1PB9 A;  4P9K A;  1BK4 A;  3OEM A;  3CVG A;  4QFN A;  1QJM A;  4GWZ A;  1LFI A;  2HFB A;  1FPG A;  4H8I A;  1MQD A;  2P0S A;  4PFW A;  4PBQ A;  1Q9D A;  3TDJ A;  4PE3 A;  1O64 A;  3RGY A;  1JEU A;  2XXH A;  3H03 A;  4R2B A;  4GBV A;  1UQW A;  5H8F B;  2BJI A;  4IB2 A;  3UK4 A;  2HQ0 A;  4NF6 B;  2Z8D A;  4IY5 A;  2FVZ A;  1YPN A;  4U23 A;  5CRY A;  2FIX A;  4MJO A;  5FTI A;  3LUY A;  4P0I A;  1P1O A;  2OBG A;  4JWX A;  3MVX A;  2ZYO A;  4X1B A;  2XD2 A;  4MNP A;  2WKY A;  4JVC A;  2GH9 A;  2D5W A;  2O7I A;  1IMF A;  1FTL A;  1WOD A;  3MWB A;  4H65 A;  1YTV A;  1B9J A;  4RYA A;  1B4H A;  1NH8 A;  1D9V A;  3IO6 A;  2W7Y A;  4NTL A;  1MPC A;  1POT A;  1N7W A;  4X48 A;  2E0S A;  3IO4 A;  1CNQ A;  2DS9 A;  4ZEI A;  4N8G A;  4ZEF A;  4PF8 A;  4FEB A;  5CMC A;  4QBA A;  3SKP A;  2G29 A;  2VOZ A;  4XKN A;  4OEU A;  2XXQ A;  3KC0 A;  3T9V A;  4F2O A;  3OMB A;  1R9L A;  2ZZV A;  1EYK A;  3M3K A;  1M5D A;  1P1Q A;  4GWS A;  3DP6 A;  2AL5 A;  2V3T A;  1XC1 A;  3RN8 A;  1RDZ A;  1O7T A;  4ELQ A;  3AXF A;  1IZ1 A;  3PUY E;  2I3V A;  3CHG A;  1ZU0 A;  3IOW A;  4BDO A;  4MFI A;  1B1H A;  5I2N A;  3HPI A;  4JSO A;  4F22 A;  4OQO A;  5BWJ A;  5AA4 A;  2CZK A;  3THI A;  1B40 A;  3PMW A;  4OYV A;  3PMV A;  4ECF A;  2NOO A;  2VPO A;  2XX9 A;  5ISU A;  1XOC A;  2F3B A;  1NUY A;  3G7W A;  4MIJ A;  4LQ2 A;  3KBR A;  2Z8F A;  4RNS A;  4NMY A;  2CEX A;  4UAB A;  4U4X A;  1GGG A;  1LBZ A;  4C1U A;  2YJP A;  3ZS6 A;  3N5L A;  3W9V A;  1A7L A;  1WDN A;  1OVT A;  4KR5 A;  4I9D A;  1B7H A;  3U8Q A;  4GWU A;  4H67 A;  1PEB A;  5CM6 A;  4G8H A;  1FPD A;  1MY0 A;  1CE2 A;  4E0W A;  2UYF A;  1NNP A;  1B4Z A;  4MLV A;  3H7M A;  1QVS A;  4YIC A;  2RIN A;  3O2A A;  4GLI A;  4H1X A;  2RKM A;  2UVH A;  3KOS A;  5FBP A;  4QFL A;  4YKI A;  3FV2 A;  4AS4 A;  4Q8R A;  1UTB B;  3BFT A;  4GOT A;  4GWX A;  5KDT A;  2HHM A;  3CG1 A;  2O7U A;  4LZ5 A;  4ZS9 A;  5EYG A;  2Z23 A;  4IGR A;  2OX3 A;  4FED A;  3Q29 A;  3OD7 A;  4BDL A;  2ZYM A;  2FHY A;  3GZG A;  4X9T A;  3RUM A;  1FQE A;  3CSB A;  3KN3 A;  2ZXT A;  1USY H;  5DW8 A;  5ITO A;  1GTK A;  4H5G A;  1P1W A;  2XXV A;  3H6U A;  3TKD A;  3TTL A;  4OET A;  5DT6 A;  1MG1 A;  2JJK A;  4MEV A;  5H8Q A;  2CZH A;  2QVR A;  1L5T A;  2UVJ A;  1FPE A;  2H5Y A;  2X7Q A;  3QIM A;  5ITP A;  3TQL A;  2KLF A;  1ANF A;  2H25 A;  2PYY A;  1NUX A;  4HS7 A;  5I3S A;  4F3S A;  4YKJ A;  4GWW A;  3O66 A;  4BLA A;  1A54 A;  4OVR A;  4P11 A;  1HSL A;  4GIZ A;  2F8D A;  2Y7W A;  1LFH A;  1ZKB A;  3V8X B;  1FQD A;  2HXW A;  3MVW A;  4IO5 A;  4KPT A;  4OWD A;  3O97 A;  1USY E;  4KI0 E;  3C34 A;  5H8F A;  1QW0 A;  4JXI A;  1DPE A;  5ICQ A;  3B6Q A;  4BDN A;  3NOH A;  5AA2 A;  1LAF E;  1UIU A;  1RYX A;  3G3F A;  2UYE A;  1DTZ A;  3TZA A;  4PFU A;  4HCW A;  4GX3 A;  1N84 A;  1Y1M A;  1FJ9 A;  5TPA B;  3FZV A;  4F31 B;  2DP8 A;  2ONR A;  4JWO A;  4KXP A;  3R7X A;  4EXK A;  2V84 A;  1EH3 A;  2B4L A;  2REJ A;  3S9E A;  2XXP A;  2Y7P A;  1MS7 A;  1HSJ A;  3CIJ A;  4JSD A;  4OFJ A;  4N13 A;  3IOU A;  1BTJ A;  1QKA A;  3LC8 A;  4HTG A;  3C32 A;  4GF8 A;  5I59 B;  1XHY A;  3QK6 A;  4MNI A;  3M3L A;  3K6U A;  2FNC A;  1AMF A;  2OCU A;  3K6W A;  3QMF A;  4BDM A;  4NAP A;  1FBE A;  1NI9 A;  3QAX A;  1TXF A;  1LAX A;  3OSQ A;  1FSA A;  3VV5 A;  3HHG A;  1CB6 A;  1OLA A;  4DE8 A;  3U65 A;  4JDF A;  5I7I A;  1B58 A;  3IJO B;  3SZP A;  2XXR A;  2F3D A;  2L5V A;  1LCF A;  2QJE A;  4R9F A;  1QUJ A;  5I58 A;  1POY 1;  1IMD A;  1INP A;  2F35 A;  4GXA A;  2QVV A;  4RJZ A;  1VE4 A;  4HXV A;  4N07 A;  5EYH A;  2RC8 A;  4NF5 A;  3T22 A;  4FEC A;  3TEP A;  3FXQ A;  1IXG A;  3ZKK A;  1EZO A;  3MP8 A;  2V3U A;  1MXX A;  3MPK A;  4QFK A;  1Z7N E;  2NVU B;  2QS1 A;  4G68 B;  4YMA A;  1ATG A;  2B3B A;  4LAT A;  2B65 A;  3TCF A;  2I4B A;  1FBP A;  5KCJ B;  3SEX A;  3RQT A;  3VXB A;  1GR2 A;  4GD5 A;  1B51 A;  4QSD A;  1PB7 A;  2AIX A;  3CI8 A;  2R8T A;  3U92 A;  3TCG A;  5FTH A;  4ONY A;  3HO7 A;  1M5E A;  1N04 A;  4X1D A;  3S4U A;  3ONM A;  4HE1 A;  1Y3N A;  5ESY A;  1UTB A;  1OIB A;  3S2V A;  2GHB A;  4HW8 A;  4RXL A;  1JW5 A;  2XXW A;  1NNT A;  2XXX A;  1FRP A;  1R9Q A;  1FPJ A;  5CMB A;  5JTY B;  1Y9U A;  3ISP A;  2DE4 A;  4EF1 A;  5H8H A;  5CC2 A;  2O6A A;  1S50 A;  1G0I A;  5IGA A;  1UIV A;  3K6X A;  3Q27 A;  1NFT A;  3C9H A;  3KN8 A;  2P3V A;  1P1U A;  1H43 A;  1Y3P A;  4N6K A;  2XWI A;  1YXI A;  4I3Y A;  4JBZ A;  1P1N A;  5IM2 A;  4PCD A;  3UOR A;  3KSJ A;  3E4R A;  3ECR A;  3TTR A;  1DMB A;  1NUZ A;  4F2Q A;  1MPB A;  2HZL A;  3MPL A;  4O7I A;  1SDX A;  3MYU A;  1QUK A;  1URD A;  3FBP A;  3I5O A;  4H0W A;  3E9X A;  3V83 A;  1B5J A;  1SW2 A;  2I3W A;  4NF0 A;  4H46 A;  4OFO A;  4R6Y A;  4G2Z A;  4ELR A;  2B3F A;  1FBF A;  3H6T A;  3E13 X;  3B7D A;  4L17 A;  2O1L A;  5TP9 A;  3U94 A;  1MY1 A;  4LZ8 A;  5FHN A;  2X26 A;  1WVJ A;  3UIF A;  4PGP A;  5F24 A;  4UA8 A;  4N15 A;  3T9H B;  2IA4 A;  1VFE A;  4PFY A;  3T93 B;  1FW0 A;  4PFB A;  5TU0 A;  4NHB A;  1IXI A;  4ELP A;  2O68 A;  4RPN A;  3FVG A;  3ODB A;  3K00 A;  3LV0 A;  2P3N A;  4N6D A;  1FQA A;  4DXU A;  1Q35 A;  3HCQ A;  1ZMG A;  2GQ1 A;  5EQA A;  3G3H A;  1D4N A;  2H98 A;  2V93 A;  5I57 B;  1LBC A;  3MJN A;  4PET A;  1PBP A;  4IR8 A;  4LP2 B;  4ESW A;  4JVI A;  3IB2 A;  3VDF A;  5H8N A;  3T0J A;  2XA5 A;  1YAE A;  3L6H A;  5IKB A;  3DEL B;  1SW5 A;  1SD3 A;  1KZ8 A;  2IEE A;  3RPL B;  3K02 A;  2F97 A;  4GWO A;  4P56 A;  3N6T A;  1JW4 A;  1IQ7 A;  3D4G A;  4OXV A;  2A5S A;  2PCR A;  2ZZX A;  1S9T A;  1JEV A;  4QHQ A;  2H9B A;  3EKI A;  2DXR A;  4XKR A;  1A55 A;  2DWI A;  3W9W A;  3VXC A;  5EQ9 A;  4H6D A;  3PTY A;  4ZEB A;  4RY1 A;  1FJ6 A;  1JET A;  3FUZ A;  3VVF A;  4KQP A;  4ZE8 A;  1MM7 A;  2ZNU A;  1ELJ A;  1SPI A;  1LGB C;  1GV8 A;  3C36 A;  3K0V A;  2DVZ A;  4ZEC A;  3LSX A;  1KWH A;  3KGC A;  3PPP A;  3FVK A;  4Q0C A;  1RDY A;  4G61 A;  3G3J A;  1B1X A;  4NED A;  5L9O A;  5I56 A;  4N17 A;  2H99 A;  3KJT A;  1MQH A;  1B46 A;  4F3P A;  3S9M C;  3K1N A;  3LSF B;  3SEV A;  2QRY A;  2A5T A;  2FYI A;  1B5H A;  2FIE A;  4DXB A;  4PAF A;  4H5F A;  3N94 A;  2PFY A;  1H44 A;  4DZ1 A;  4NQ8 A;  2PT1 A;  3DP8 A;  2R71 A;  2RCA A;  1IIT A;  4ESX A;  3O29 A;  4IO3 A;  3FXB A;  3SEW A;  2OLB A;  5CMM A;  3MZ9 A;  2ZZW A;  2QL3 A;  3JV9 A;  3OXN A;  1NV1 A;  4OMB A;  4YKK A;  4MH5 A;  3EQ1 A;  2DE2 A;  4P47 A;  1QUI A;  2DE3 A;  1LAH E;  1B3F A;  2I49 A;  1NV3 A;  3E79 A;  4GFR A;  1JNF A;  4XKP A;  1MRP A;  4IO4 A;  3RT6 B;  3N6U A;  3GYY A;  4QSE A;  4H8J A;  5ET5 A;  3UP9 A;  3IB1 A;  3K6V A;  3TAJ A;  4YKP A;  2PVU A;  2QS2 A;  2XXI A;  2REG A;  4G77 A;  5IZ3 B;  1XI6 A;  1MXU A;  3U93 A;  2UVI A;  1AL3 A;  4GBW A;  5AA3 A;  3ZSF A;  4U22 A;  1B3G A;  3MBP A;  2MKZ A;  3H4Z A;  3QUF A;  4OER A;  4F19 A;  4OVT A;  4GQO A;  1FBG A;  5J16 A;  2XXU A;  1JP4 A;  2RF1 A;  4JVD A;  2OJT A;  3PUV E;  2UVG A;  4ZE9 A;  2ZNT A;  4POW A;  2HCA A;  5DEX A;  4KYD A;  2ALU A;  5EHS A;  3SET A;  5DYH A;  4F1V A;  4K3F A;  1FTO A;  2NUV A;  4LN5 A;  1B05 A;  5L8D A;  3VLU A;  2ABH A;  4MCO A;  4YZZ A;  1MM6 A;  3EPE A;  2WX9 A;  2ZMB A;  1DTG A;  1FBD A;  1LBY A;  4KYE A;  2PX1 A;  1FQB A;  3TOD A;  2OWT A;  3CG3 A;  2FBP A;  1ZJL A;  3WAE A;  2XX8 A;  4U4S A;  4FBP A;  4EXL A;  2WEF A;  3FJG A;  4R73 A;  4R2F A;  4O7M A;  5ET6 A;  4OAN A;  3IOR A;  1T0K A;  4NF6 A;  4YAH X;  4NF4 B;  3FXR A;  3PUZ E;  1URG A;  2VGQ A;  1A99 A;  5I57 A;  1DOT A;  2WBB A;  4ZZE A;  4IY6 A;  3ZKL A;  4THI A;  1MDP 1;  4U21 A;  1ZTY A;  3EF7 A;  2PT2 A;  1NV4 A;  2QFL A;  1M5F A;  3MZB A;  3RTW B;  1VR5 A;  2GHA A;  1N7X A;  2F7C A;  3KEI A;  3VLW A;  4Z7E A;  4KHZ E;  2QMX A;  4MNC A;  1NL5 A;  4R74 A;  4Q5T A;  5I2K B;  1MXY A;  2ONS A;  1I6A A;  4EF2 A;  3M3F A;  5B70 A;  1S7Y A;  4XIG Q;  3CFX A;  3TPA A;  1XVX A;  4WEP A;  3T66 A;  1I69 A;  1R1N A;  1M5B A;  1G0H A;  2NXO A;  4PE5 B;  1PDA A;  1K9Z A;  5L9M A;  1RDX A;  1MXZ A;  1R6Z A;  3W15 C;  2DWA A;  2V3Q A;  3N26 A;  2DWH A;  4OA4 A;  1AWB A;  2YLN A;  5FHM A;  3KC1 A;  2I48 A;  3T9X B;  1A8E A;  4P1E A;  4MMP A;  1SI1 A;  5M2V A;  3BFU A;  2M8C A;  2GFE A;  3KJ7 A;  3TTM A;  3PUX E;  2LAO A;  3G3K A;  4PFI A;  2XX7 A;  4GRK A;  4DLD A;  4O3C A;  3RNN A;  2UXA A;  3TYH A;  3WAF A;  2Q9T A;  1H76 A;  1IEJ A;  4XEQ A;  3LBS A;  3LUZ A;  3PPN A;  5L9S A;  4BDR A;  2QPQ A;  1QKB A;  4NE4 A;  1FTJ A;  2Y5L A;  4EQ9 A;  4OVS A;  1IIW A;  3IB0 A;  1DBZ A;  1XT8 A;  1FTA A;  3MZ1 A;  1MQI A;  5ET8 A;  4MLQ A;  1D9Y A;  1OLC A;  1IXH A;  2B4M A;  4LQ5 A;  4MX6 A;  4OZ9 A;  3C4M A;  1FCK A;  3G3I A;  3T9U A;  3FD3 A;  2WYP A;  3D1R A;  1B7U A;  5J1D A;  2XD3 A;  3PUW E;  3Q28 A;  1NV6 A;  2DOJ A;  4PAK A;  4X8R A;  1NV0 A;  1A8F A;  2XXY A;  4N8Y A;  2Q8M A;  3O6G A;  1IXC A;  1MY3 A;  3DP4 A;  4KCD A;  5ICT A;  4QF9 A;  2AYS A;  5I2N B;  1SW4 A;  5HM4 B;  4OTE A;  5IZZ A;  2QSX A;  3HN0 A;  3K1M A;  5CI5 A;  5IZ3 A;  4ZDM A;  5AA4 B;  1JQF A;  2OK2 A;  5AE4 A;  3FXU A;  1OQH A;  1QGX A;  1US4 A;  3LSW A;  4R6K A;  1NH7 A;  4DCX A;  1B6H A;  2ZNS A;  3PU5 A;  4KD5 A;  1TT1 A;  1LAG E;  1EYJ A;  4G8N A;  3K1P A;  2F78 A;  3I3V A;  4FIM A;  1XS5 A;  3A29 A;  3IJX B;  4HE0 A;  3BIH A;  3LR1 A;  1EZ9 A;  4WKM A;  2Q2C A;  3Q25 A;  4OFL A;  3RTF B;  1N0T A;  4IO7 A;  2F6G A;  1VDW A;  3MAM A;  1LBB A;  4G8M A;  2Y84 A;  3TEL A;  1TFD A;  1SVX B;  1LEV A;  4FAT A;  2WBD A;  3BIG A;  1NMU A;  4F3B A;  2Q8J A;  3VFJ A;  4EQ7 A;  3KOT A;  3SER A;  1SYH A;  2CMO A;  2Q74 A;  3A09 A;  3SEY A;  2XXK A;  1FQC A;  4X04 A;  4I3E A;  4QSC A;  1OVB A;  4NGU A;  3FV1 A;  2VHA A;  4IO2 A;  5K2Y A;  3FAS A;  2Y7K A;  1FPK A;  2BJJ X;  4N91 A;  3K01 A;  4OVQ A;  1FPB A;  4EDP A;  4NF4 A;  3V5A A;  3HFU A;  3FVO A;  5DTB A;  4MF3 A;  2GRV A;  3EHS A;  4LA9 A;  4R72 A;  1DSN A;  2DSF A;  5F1Q A;  2I0C A;  5LDZ A;  5TPA A;  4GL8 A;  3MP6 A;  4DCY A;  4AB6 A;  1B5I A;  2G93 A;  4EUO A;  4OHN A;  1BKA A;  4TLL B;  5A5X B;  1H45 A;  4PF6 A;  2R9J A;  1BP5 A;  3MUQ A;  3A3U A;  4KYS A;  3QXM A;  1AOV A;  1FQF A;  1MQJ A;  3TCH A;  4TOZ A;  1N76 A;  3SES A;  4H45 A;  5I2K A;  4O8M A;  1YCJ A;  1MPD A;  2YPN A;  4JB7 A;  5I59 A;  1NV7 A;  3D4C A;  4R6H A;  1TWY A;  2R6G E;  1FTM A;  3MC2 A;  1Y3Q A;  5JEI A;  2I58 A;  4KFQ A;  4OES A;  2Y5K A;  3G3G A;  1DK4 A;  4QFO A;  4OVJ A;  4XXU A;  4PC9 A;  4DI3 D;  2CEY A;  4PDD A;  1N3X A;  5AA2 B;  1Y1Z A;  1Y4T A;  1B7Z A;  1QUL A;  4YB7 A;  2Y7R A;  1DCU A;  2OZZ A;  3RT8 A;  1K9Y A;  4ZZA A;  1MDQ A;  3K4U A;  3RLF E;  5DVJ A;  3IAZ A;  1EYI A;  1HSE A;  4M4G A;  4FJP A;  5CBS A;  4PAI A;  4G4P A;  2Q88 A;  1JVX A;  4G68 A;  3RYD A;  3T96 B;  3V89 B;  2PMS A;  2KQZ A;  1P99 A;  3PPQ A;  1YZ0 A;  1Z7M E;  2F6P A;  4JWY A;  1J1N A;  3I6V A;  4P3L A;  1VFD A;  4Q30 B;  4YMB A;  3MVY A;  2THI A;  5KCJ A;  4N6P A;  2RC9 A;  3VLV A;  3GLB A;  4C1T A;  2V25 A;  2VPN A;  1EZP A;  1YYZ A;  1M5C A;  4GXS B;  4NWC A;  3OEK A; 
#chains in the Genus database with same CATH homology
 4PQJ A;  1A40 A;  5I58 B;  4P0G A;  3CFZ A;  4ZEK A;  2O69 A;  3F11 A;  3MQ9 A;  4G68 C;  4C0R A;  2D3I A;  4LVQ A;  5HBC A;  3R26 A;  3CFL A;  1OMP A;  4NF5 B;  3PMX A;  3B6T A;  5BUU A;  4O3B A;  2QMW A;  1O63 A;  3RPW A;  4DXC A;  5JTY A;  3CRB A;  3TTN A;  2DVC A;  2P2A A;  3OO9 A;  1PC3 A;  4F29 A;  4PFT A;  1LB9 A;  1TFA A;  4POX A;  3M8U A;  1Y4C A;  4F39 A;  1LB8 A;  3CR9 A;  3QYT A;  3IX1 A;  4DIG A;  3PD8 A;  3TFL A;  2FA7 A;  4I1D A;  4ND9 A;  1UTH B;  3TTK A;  4I62 A;  4AQ4 A;  5K2X A;  3C31 A;  1MH4 A;  4HCY A;  1OQG A;  1NNK A;  2QS3 A;  5DVI A;  4OEV A;  1SW1 A;  3S9N C;  5ELV A;  1LCT A;  3C33 A;  1EU8 A;  4NF8 B;  2VD2 A;  1ZIU A;  4RPO A;  5H8S A;  1MH3 A;  4F1U A;  4GL0 A;  1I6B A;  4FOR A;  4F1Y A;  1SQY A;  3GBA A;  1B2H A;  1H3D A;  2F7B A;  3IL1 B;  1Y20 A;  3TMG A;  5CMK A;  3PV0 E;  5H8H B;  2ANJ A;  1LST A;  1B0L A;  3IK6 B;  2F36 A;  4GVO A;  3O6I A;  4LZ7 A;  2I0B A;  3JZJ A;  3OSR A;  4PP0 A;  4QRZ A;  2Q89 A;  5CBR A;  4NWD A;  3PD9 A;  5KZT A;  2I4C A;  5F7V A;  5JK4 A;  5A5X A;  1B52 A;  4XTC Q;  3TUS A;  5LOM A;  3LSL A;  3KG2 A;  3S9L C;  2O84 X;  2Z22 A;  3B6W A;  3FJM A;  3IOV A;  3USD A;  3GXA A;  3O6H A;  4OEN A;  1MXV A;  1N3W A;  2I6E A;  3HST A;  1GVC A;  2HAU A;  4KCC A;  1B3L A;  3HV1 A;  1SI0 A;  5IAI A;  2F5X A;  2XXT A;  4ISU A;  4YU0 A;  5DVF A;  1B0H A;  1IUD A;  2Z8E A;  4RK9 A;  3TQW A;  3OEL A;  4DDD A;  3PPO A;  4YB5 A;  5TP9 B;  4R9G A;  1MY4 A;  4WED A;  3O28 A;  1SBP A;  2DYX A;  4YB6 A;  3H3G A;  4ZED A;  4F3G A;  3E3K A;  3U72 A;  1ZBM A;  4LUB A;  3KZG A;  5FHO A;  4AB5 A;  3EHT A;  2RC7 A;  4IO6 A;  3FGS A;  3IOT A;  4LON B;  2F34 A;  1ZLQ A;  1B32 A;  3KSX A;  1NNF A;  1DPP A;  2F7A A;  4TQU Q;  3ILT B;  4E0X A;  2HEU A;  5H8N B;  3RY3 A;  5EYF A;  3KN7 A;  5B7D A;  3FAT A;  4FAJ A;  3DLN A;  1F9B A;  2P1S A;  3OO6 A;  3UGW A;  2H4I A;  3EN3 A;  2ZYK A;  3H6V A;  1VSO A;  3VVD A;  2HZK A;  3A3C A;  3UN6 A;  3U1O A;  1RYO A;  2ONK E;  2X7P A;  4MBP A;  4QFP A;  2Q2A A;  3JYR A;  3FVN A;  3FJ7 A;  1FTK A;  1II5 A;  4TLM B;  2XHD A;  3P7I A;  3FIR A;  3VVE A;  1MY2 A;  3H06 B;  3C35 A;  4Z0I A;  4WXJ A;  3PPR A;  2OWS A;  3ILU B;  1JW1 A;  3R6U A;  1BLF A;  3BBR A;  5EHM A;  2D21 A;  1UTH A;  5I56 B;  1D3K A;  1LLS A;  1I6Q A;  4UAC A;  3O9P A;  5I84 A;  1B3E A;  3EHU A;  2E1S A;  4XKQ A;  1PB8 A;  2A5T B;  2O51 A;  1US5 A;  3MVZ A;  5AA1 A;  3MW0 A;  4NF8 A;  2HAV A;  2VP1 A;  2AL4 A;  3QSL A;  3SEU A;  3CSG A;  3BKI B;  3Q26 A;  2RCB A;  4F18 A;  4RA1 A;  1JVY A;  4IGT A;  4U1Z A;  1RKM A;  4U1O A;  1AIV A;  4EQB A;  1MQG A;  1B3H A;  1SYI A;  3GBB A;  1XVY A;  3PGF A;  2VD3 A;  5HPQ A;  4FE8 A;  3HHF A;  4U2R A;  4O3A A;  5KDT B;  2QS4 A;  2CZL A;  2O1M A;  4ELO A;  3VE1 B;  3K2D A;  3KFM A;  3OO8 A;  3OO7 A;  1URS A;  4M1V A;  1LFG A;  3OEN A;  2NWJ A;  2DQV A;  3MP1 A;  3L6G A;  2ZYN A;  4R75 A;  1Q1K A;  3QUJ A;  2ESN A;  1MXW A;  3IR1 A;  1BIY A;  3DM0 A;  3SDF A;  4I8C A;  2Y7I A;  3UA8 A;  5H8Q B;  4RK2 A;  5DEX B;  1PBQ A;  2PBW A;  5AA2 D;  3H6W A;  1AH5 A;  4BDQ A;  3OOA A;  2DWJ A;  1NKX A;  2DXY A;  1PB9 A;  3OEM A;  3CVG A;  4QFN A;  1QJM A;  1LFI A;  2HFB A;  4H8I A;  1MQD A;  2P0S A;  4PFW A;  3TDJ A;  1O64 A;  3RGY A;  1JEU A;  2XXH A;  3H03 A;  4R2B A;  1UQW A;  5H8F B;  4IB2 A;  3UK4 A;  2HQ0 A;  4NF6 B;  2Z8D A;  4IY5 A;  1YPN A;  4U23 A;  5CRY A;  5FTI A;  3LUY A;  4P0I A;  1P1O A;  2OBG A;  4JWX A;  3MVX A;  2ZYO A;  4X1B A;  2XD2 A;  2WKY A;  2GH9 A;  2D5W A;  2O7I A;  1FTL A;  1WOD A;  3MWB A;  4H65 A;  1YTV A;  1B9J A;  4RYA A;  1B4H A;  1NH8 A;  1D9V A;  3IO6 A;  2W7Y A;  4NTL A;  1MPC A;  1POT A;  1N7W A;  4X48 A;  2E0S A;  3IO4 A;  2DS9 A;  4ZEI A;  4ZEF A;  4FEB A;  5CMC A;  3SKP A;  2G29 A;  2VOZ A;  4XKN A;  4OEU A;  2XXQ A;  3T9V A;  4F2O A;  3OMB A;  1R9L A;  3M3K A;  1M5D A;  1P1Q A;  3DP6 A;  2AL5 A;  2V3T A;  1XC1 A;  3RN8 A;  1O7T A;  4ELQ A;  3AXF A;  1IZ1 A;  3PUY E;  2I3V A;  1ZU0 A;  3IOW A;  4BDO A;  4MFI A;  1B1H A;  5I2N A;  3HPI A;  4JSO A;  4F22 A;  4OQO A;  5BWJ A;  5AA4 A;  3THI A;  1B40 A;  3PMW A;  4OYV A;  3PMV A;  4ECF A;  2NOO A;  2XX9 A;  5ISU A;  1XOC A;  3G7W A;  4LQ2 A;  3KBR A;  2Z8F A;  4RNS A;  4NMY A;  4U4X A;  1GGG A;  4C1U A;  2YJP A;  3ZS6 A;  3N5L A;  3W9V A;  1A7L A;  1WDN A;  1OVT A;  4KR5 A;  4I9D A;  1B7H A;  3U8Q A;  4H67 A;  1PEB A;  5CM6 A;  4G8H A;  1MY0 A;  1CE2 A;  4E0W A;  2UYF A;  1NNP A;  1B4Z A;  4MLV A;  3H7M A;  1QVS A;  4YIC A;  2RIN A;  3O2A A;  4GLI A;  4H1X A;  2RKM A;  2UVH A;  3KOS A;  4QFL A;  4YKI A;  3FV2 A;  4Q8R A;  1UTB B;  3BFT A;  4GOT A;  5KDT A;  3CG1 A;  4LZ5 A;  2O7U A;  4ZS9 A;  2Z23 A;  4IGR A;  4FED A;  3Q29 A;  3OD7 A;  4BDL A;  2ZYM A;  3GZG A;  4X9T A;  3RUM A;  1FQE A;  3CSB A;  3KN3 A;  2ZXT A;  1USY H;  5ITO A;  1GTK A;  4H5G A;  1P1W A;  2XXV A;  3H6U A;  3TKD A;  3TTL A;  4OET A;  5DT6 A;  1MG1 A;  5H8Q A;  1L5T A;  2UVJ A;  2H5Y A;  2X7Q A;  3QIM A;  5ITP A;  3TQL A;  2KLF A;  1ANF A;  2H25 A;  2PYY A;  4HS7 A;  4F3S A;  4YKJ A;  3O66 A;  4BLA A;  1A54 A;  4P11 A;  1HSL A;  4GIZ A;  2F8D A;  2Y7W A;  1LFH A;  1ZKB A;  3V8X B;  1FQD A;  2HXW A;  3MVW A;  4IO5 A;  4KPT A;  4OWD A;  3O97 A;  1USY E;  4KI0 E;  3C34 A;  5H8F A;  1QW0 A;  4JXI A;  1DPE A;  5ICQ A;  3B6Q A;  4BDN A;  5AA2 A;  1LAF E;  1UIU A;  1RYX A;  3G3F A;  2UYE A;  1DTZ A;  3TZA A;  4PFU A;  4HCW A;  1N84 A;  1Y1M A;  5TPA B;  3FZV A;  4F31 B;  2DP8 A;  2ONR A;  4JWO A;  3R7X A;  4EXK A;  2V84 A;  1EH3 A;  2REJ A;  3S9E A;  2XXP A;  2Y7P A;  1MS7 A;  1HSJ A;  3CIJ A;  4JSD A;  4OFJ A;  4N13 A;  3IOU A;  1BTJ A;  1QKA A;  3LC8 A;  4HTG A;  3C32 A;  4GF8 A;  5I59 B;  1XHY A;  3QK6 A;  3M3L A;  3K6U A;  2FNC A;  1AMF A;  2OCU A;  3K6W A;  4BDM A;  3QAX A;  1TXF A;  1LAX A;  3OSQ A;  3VV5 A;  3HHG A;  1CB6 A;  1OLA A;  4DE8 A;  4JDF A;  1B58 A;  3IJO B;  2XXR A;  1LCF A;  2QJE A;  4R9F A;  1QUJ A;  5I58 A;  1POY 1;  2F35 A;  4GXA A;  4RJZ A;  1VE4 A;  4N07 A;  2RC8 A;  4NF5 A;  3T22 A;  4FEC A;  3TEP A;  3FXQ A;  1IXG A;  3ZKK A;  1EZO A;  3MP8 A;  2V3U A;  1MXX A;  3MPK A;  4QFK A;  1Z7N E;  2NVU B;  2QS1 A;  4G68 B;  4YMA A;  1ATG A;  2B3B A;  4LAT A;  2B65 A;  3TCF A;  2I4B A;  5KCJ B;  3SEX A;  3RQT A;  3VXB A;  1GR2 A;  4GD5 A;  1B51 A;  4QSD A;  1PB7 A;  2AIX A;  3CI8 A;  3U92 A;  3TCG A;  5FTH A;  4ONY A;  3HO7 A;  1M5E A;  1N04 A;  4X1D A;  3S4U A;  3ONM A;  1Y3N A;  1UTB A;  1OIB A;  3S2V A;  2GHB A;  4HW8 A;  4RXL A;  1JW5 A;  2XXW A;  1NNT A;  2XXX A;  1R9Q A;  5CMB A;  5JTY B;  1Y9U A;  2DE4 A;  4EF1 A;  5H8H A;  5CC2 A;  2O6A A;  1S50 A;  1UIV A;  3K6X A;  3Q27 A;  1NFT A;  3C9H A;  3KN8 A;  1P1U A;  1H43 A;  1Y3P A;  4JBZ A;  1P1N A;  3UOR A;  3KSJ A;  3E4R A;  3ECR A;  3TTR A;  1DMB A;  4F2Q A;  1MPB A;  2HZL A;  3MPL A;  1SDX A;  1QUK A;  1URD A;  3I5O A;  4H0W A;  3E9X A;  3V83 A;  1B5J A;  1SW2 A;  2I3W A;  4OFO A;  4R6Y A;  4G2Z A;  4ELR A;  2B3F A;  3H6T A;  3E13 X;  3B7D A;  4L17 A;  2O1L A;  5TP9 A;  3U94 A;  1MY1 A;  4LZ8 A;  5FHN A;  2X26 A;  1WVJ A;  3UIF A;  4UA8 A;  3T9H B;  2IA4 A;  1VFE A;  4PFY A;  3T93 B;  1FW0 A;  5TU0 A;  1IXI A;  4ELP A;  2O68 A;  4RPN A;  3FVG A;  3ODB A;  3K00 A;  1FQA A;  4DXU A;  1Q35 A;  3HCQ A;  1ZMG A;  3G3H A;  1D4N A;  2H98 A;  2V93 A;  5I57 B;  1LBC A;  3MJN A;  4PET A;  1PBP A;  4ESW A;  4LP2 B;  3IB2 A;  3VDF A;  5H8N A;  1YAE A;  3L6H A;  5IKB A;  3DEL B;  1SW5 A;  1SD3 A;  2IEE A;  3K02 A;  2F97 A;  4GWO A;  3N6T A;  1JW4 A;  1IQ7 A;  3D4G A;  4OXV A;  2A5S A;  1S9T A;  1JEV A;  4QHQ A;  2H9B A;  2DXR A;  4XKR A;  1A55 A;  2DWI A;  3W9W A;  3VXC A;  4H6D A;  4ZEB A;  4RY1 A;  1JET A;  3FUZ A;  3VVF A;  4KQP A;  4ZE8 A;  1MM7 A;  2ZNU A;  1ELJ A;  1LGB C;  1GV8 A;  3C36 A;  3K0V A;  2DVZ A;  4ZEC A;  3LSX A;  1KWH A;  3KGC A;  3PPP A;  3FVK A;  4Q0C A;  3G3J A;  1B1X A;  4NED A;  5L9O A;  5I56 A;  2H99 A;  3KJT A;  1MQH A;  1B46 A;  4F3P A;  3S9M C;  3K1N A;  3LSF B;  3SEV A;  2QRY A;  2A5T A;  2FYI A;  1B5H A;  4DXB A;  4H5F A;  3N94 A;  1H44 A;  4DZ1 A;  2PT1 A;  3DP8 A;  2R71 A;  2RCA A;  1IIT A;  4ESX A;  3O29 A;  4IO3 A;  3SEW A;  2OLB A;  5CMM A;  3MZ9 A;  2QL3 A;  3JV9 A;  3OXN A;  4OMB A;  4YKK A;  4MH5 A;  3EQ1 A;  2DE2 A;  1QUI A;  2DE3 A;  1LAH E;  1B3F A;  2I49 A;  4GFR A;  1JNF A;  4XKP A;  1MRP A;  4IO4 A;  3RT6 B;  3N6U A;  4QSE A;  4H8J A;  3UP9 A;  3IB1 A;  3K6V A;  3TAJ A;  4YKP A;  2PVU A;  2QS2 A;  2XXI A;  2REG A;  4G77 A;  3U93 A;  1MXU A;  2UVI A;  1AL3 A;  5AA3 A;  3ZSF A;  4U22 A;  1B3G A;  3MBP A;  3H4Z A;  3QUF A;  4OER A;  4F19 A;  4GQO A;  2XXU A;  2RF1 A;  2OJT A;  3PUV E;  2UVG A;  4ZE9 A;  2ZNT A;  4POW A;  2HCA A;  5DEX A;  4KYD A;  2ALU A;  5EHS A;  3SET A;  5DYH A;  4F1V A;  4K3F A;  1FTO A;  2NUV A;  1B05 A;  5L8D A;  3VLU A;  2ABH A;  4YZZ A;  1MM6 A;  3EPE A;  2ZMB A;  1DTG A;  4KYE A;  2PX1 A;  1FQB A;  3TOD A;  2OWT A;  3CG3 A;  1ZJL A;  3WAE A;  2XX8 A;  4U4S A;  4EXL A;  3FJG A;  4R73 A;  4R2F A;  3IOR A;  1T0K A;  4NF6 A;  4YAH X;  4NF4 B;  3FXR A;  3PUZ E;  1URG A;  2VGQ A;  1A99 A;  5I57 A;  1DOT A;  4ZZE A;  4IY6 A;  3ZKL A;  4THI A;  1MDP 1;  4U21 A;  1ZTY A;  3EF7 A;  2PT2 A;  1M5F A;  3MZB A;  3RTW B;  1VR5 A;  2GHA A;  1N7X A;  2F7C A;  3KEI A;  3VLW A;  4Z7E A;  4KHZ E;  2QMX A;  1NL5 A;  4R74 A;  4Q5T A;  5I2K B;  1MXY A;  2ONS A;  1I6A A;  4EF2 A;  3M3F A;  5B70 A;  1S7Y A;  4XIG Q;  3CFX A;  3TPA A;  1XVX A;  4WEP A;  3T66 A;  1I69 A;  1R1N A;  1M5B A;  4PE5 B;  2NXO A;  1PDA A;  5L9M A;  1MXZ A;  1R6Z A;  3W15 C;  2DWA A;  2V3Q A;  3N26 A;  2DWH A;  2YLN A;  5FHM A;  2I48 A;  3T9X B;  1A8E A;  1SI1 A;  5M2V A;  3BFU A;  2M8C A;  2GFE A;  3KJ7 A;  3TTM A;  3PUX E;  2LAO A;  3G3K A;  2XX7 A;  4GRK A;  4DLD A;  4O3C A;  3RNN A;  2UXA A;  3TYH A;  3WAF A;  2Q9T A;  1H76 A;  1IEJ A;  3LBS A;  3PPN A;  5L9S A;  4BDR A;  2QPQ A;  1QKB A;  4NE4 A;  1FTJ A;  4EQ9 A;  1IIW A;  3IB0 A;  1XT8 A;  3MZ1 A;  1MQI A;  4MLQ A;  1D9Y A;  1OLC A;  1IXH A;  4LQ5 A;  4OZ9 A;  3C4M A;  1FCK A;  3G3I A;  3T9U A;  3FD3 A;  1B7U A;  5J1D A;  2XD3 A;  3PUW E;  3Q28 A;  2DOJ A;  1A8F A;  2XXY A;  3O6G A;  1IXC A;  1MY3 A;  3DP4 A;  4KCD A;  5ICT A;  4QF9 A;  2AYS A;  5I2N B;  1SW4 A;  5HM4 B;  4OTE A;  2QSX A;  3HN0 A;  3K1M A;  5CI5 A;  4ZDM A;  5AA4 B;  1JQF A;  2OK2 A;  5AE4 A;  3FXU A;  1OQH A;  1US4 A;  3LSW A;  4R6K A;  1NH7 A;  4DCX A;  1B6H A;  2ZNS A;  3PU5 A;  4KD5 A;  1TT1 A;  1LAG E;  4G8N A;  3K1P A;  2F78 A;  3I3V A;  4FIM A;  1XS5 A;  3IJX B;  3LR1 A;  1EZ9 A;  4WKM A;  2Q2C A;  3Q25 A;  4OFL A;  3RTF B;  1N0T A;  4IO7 A;  2F6G A;  3MAM A;  1LBB A;  4G8M A;  2Y84 A;  3TEL A;  1TFD A;  1SVX B;  4FAT A;  1NMU A;  4F3B A;  2Q8J A;  3VFJ A;  4EQ7 A;  3KOT A;  3SER A;  1SYH A;  2CMO A;  3A09 A;  3SEY A;  1FQC A;  4QSC A;  1OVB A;  3FV1 A;  2VHA A;  4IO2 A;  5K2Y A;  3FAS A;  2Y7K A;  2BJJ X;  3K01 A;  4EDP A;  4NF4 A;  3V5A A;  3FVO A;  5DTB A;  4MF3 A;  2GRV A;  3EHS A;  4LA9 A;  4R72 A;  1DSN A;  2DSF A;  5F1Q A;  2I0C A;  5TPA A;  4GL8 A;  3MP6 A;  4DCY A;  4AB6 A;  1B5I A;  2G93 A;  4EUO A;  4OHN A;  1BKA A;  4TLL B;  5A5X B;  1H45 A;  2R9J A;  1BP5 A;  3MUQ A;  3A3U A;  4KYS A;  3QXM A;  1AOV A;  1FQF A;  1MQJ A;  3TCH A;  4TOZ A;  1N76 A;  3SES A;  5I2K A;  1YCJ A;  1MPD A;  2YPN A;  4JB7 A;  5I59 A;  3D4C A;  4R6H A;  1TWY A;  2R6G E;  1FTM A;  3MC2 A;  1Y3Q A;  5JEI A;  2I58 A;  4KFQ A;  4OES A;  3G3G A;  4QFO A;  4OVJ A;  4XXU A;  1N3X A;  5AA2 B;  1Y1Z A;  1Y4T A;  1B7Z A;  1QUL A;  4YB7 A;  2Y7R A;  2OZZ A;  3RT8 A;  4ZZA A;  1MDQ A;  3K4U A;  3RLF E;  5DVJ A;  3IAZ A;  1HSE A;  4M4G A;  4FJP A;  5CBS A;  4G4P A;  2Q88 A;  1JVX A;  4G68 A;  3T96 B;  3V89 B;  2PMS A;  1P99 A;  3PPQ A;  1Z7M E;  2F6P A;  4JWY A;  1J1N A;  3I6V A;  1VFD A;  4Q30 B;  4YMB A;  3MVY A;  2THI A;  5KCJ A;  4N6P A;  2RC9 A;  3VLV A;  3GLB A;  4C1T A;  2V25 A;  1EZP A;  1M5C A;  4GXS B;  4NWC A;  3OEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...