1B3EA

Human serum transferrin, n-terminal lobe, expressed in pichia pastoris
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
Knots found
sequence length
330
structure length
330
Chain Sequence
KTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDNYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SERUM TRANSFERRIN)
publication title X-ray crystallography and mass spectroscopy reveal that the N-lobe of human transferrin expressed in Pichia pastoris is folded correctly but is glycosylated on serine-32.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Iron transport
total genus 102
structure length 330
sequence length 330
other databases KnotProt 2.0: K
ec nomenclature
pdb deposition date 1998-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b3eA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b3eA02
3FATA 2I0CA 2PX1A 4WEDA 1Y4TA 3R26A 1J1NA 3FJGA 3C32A 1MH3A 5DTBA 4QFLA 4Q5TA 2UYFA 3TCHA 1M5DA 1AIVA 1P1OA 1PDAA 4X1DA 3DELB 4NE4A 4NF8A 1B3LA 4IO3A 2AL5A 2DWAA 4PETA 1H44A 1NNTA 2RCBA 1R1NA 2A5SA 5AA2B 1CE2A 4IO4A 3KN3A 1OLCA 1PBPA 1MG1A 2VP1A 3IOVA 1SW5A 4LONB 4BDNA 3IX1A 3I6VA 3SEYA 2XX8A 4RNSA 1XVXA 3SEVA 3F11A 4F3BA 3VV5A 3T66A 2CZLA 4R74A 2V3QA 3IOTA 3U8QA 2O1LA 3PD9A 5LOMA 2ESNA 3EPEA 3UORA 4X48A 4F3PA 3VFJA 3O6GA 2DVZA 3KN7A 3RPWA 4F31B 2XXYA 3VVDA 3MVXA 4F1UA 5EYFA 4QRZA 1WODA 1MQDA 1UTHA 4IB2A 1R6ZA 4R6KA 4XKQA 3FXQA 5KDTB 3GBBA 2ZXTA 3K6WA 4GF8A 3MQ9A 4NF5A 3KZGA 4LATA 2XXHA 3DP8A 4BDMA 2DQVA 3B6QA 1FTJA 3V5AA 5JK4A 4G68B 1WVJA 4N07A 4F19A 1QKAA 2Z23A 3Q26A 2AIXA 1XVYA 3K6XA 3TMGA 2YJPA 3TYHA 2F78A 2Q2CA 5AA2D 3T9VA 3IOUA 4TLMB 2Y7WA 1FQFA 1FTOA 2QS4A 4O3CA 3G3HA 4NTLA 5I2KB 3M3KA 2O1MA 3THIA 4I8CA 3BBRA 1B05A 2H9BA 3KSJA 4BDOA 3IAZA 4AQ4A 4ELRA 1B4HA 3OO6A 1NL5A 1S50A 1ZBMA 3MPLA 4C1UA 2QSXA 4IO7A 3C31A 3FVOA 4YKJA 2H4IA 2RINA 2I4CA 2IA4A 3TQLA 1AL3A 3H3GA 3K00A 1POY1 2OCUA 2THIA 4RPOA 1M5EA 1UTBA 1LAHE 3Q29A 3K01A 4ZE9A 4NMYA 4BDLA 1N0TA 3PU5A 4GXSB 5DYHA 2OWSA 3WAFA 1UIVA 4FORA 5KCJA 2DSFA 3MUQA 5H8HB 4NF6B 1GGGA 3TTMA 3D4CA 2ZYNA 2DE3A 2O68A 5L9MA 3SEWA 4LZ7A 3T93B 1RYOA 3CG3A 1MY3A 1ZMGA 3O28A 4MFIA 1I6AA 4RY1A 4G8NA 2RCAA 1NFTA 4P0IA 5IKBA 3TZAA 2RC9A 2PVUA 1FW0A 2DWJA 3H03A 4ZEBA 3AXFA 2Z8EA 1SW4A 3TPAA 3T9HB 2XXRA 1MS7A 1B6HA 2GHAA 1UIUA 4LZ8A 3LR1A 3EQ1A 4P11A 4C0RA 3KG2A 1L5TA 3FVNA 2DWIA 4NEDA 3OD7A 3OENA 1HSEA 1SW1A 4KI0E 3TODA 2ZNUA 4H5FA 4OZ9A 1FQCA 4XKPA 1NNFA 2HZLA 3S9NC 1AH5A 2DS9A 1EZ9A 1AOVA 3LBSA 2HFBA 1FCKA 3TTRA 1MRPA 4TQUQ 1R9QA 5A5XA 2D5WA 1I6BA 3OSQA 1PEBA 4FE8A 4DE8A 5H8SA 2UYEA 5F1QA 3MVWA 3RUMA 3HPIA 4BDQA 4DCXA 3U94A 4R2FA 2REGA 4HCYA 1OVTA 1MDP1 4U21A 4PQJA 1XS5A 4PP0A 5BWJA 2XXWA 3CFZA 4LZ5A 3DP6A 4KR5A 3TELA 3HHFA 3RNNA 1MY1A 2XD2A 1USYE 3IO4A 1MXUA 4PFWA 3CG1A 1MM7A 1A99A 1PC3A 2ZYKA 1EZPA 3PUXE 3C33A 3HHGA 4ECFA 3RGYA 3IJXB 4POWA 1MY0A 2R6GE 4NWDA 2PT1A 1OMPA 1SQYA 2F8DA 4R73A 5L9OA 4GRKA 4ZZEA 4YKPA 3QIMA 3N6TA 1Y20A 3P7IA 5H8FB 3C9HA 3EN3A 2R71A 3K6UA 4EUOA 3T96B 1LB9A 3EHUA 4Q30B 5I56B 5H8QB 4YICA 1IXHA 3UGWA 3DLNA 4RA1A 3UA8A 2XXXA 3OO7A 2A5TB 1OQGA 4EF2A 1QJMA 1FTKA 1TT1A 1A40A 5CI5A 3O66A 4MH5A 4DZ1A 3G3JA 1QVSA 3S9EA 1I69A 3IK6B 3V89B 3C36A 4Z0IA 5H8NA 5I57A 3N94A 1M5CA 1BLFA 5DT6A 3FVGA 4YZZA 3BFTA 2Y7KA 3L6HA 3TTLA 2ZNSA 4F29A 3ECRA 4OMBA 3H06B 4QSCA 1MXXA 4KYEA 4TLLB 4EXLA 4ZEDA 2XXQA 3SEUA 4NF4A 2AYSA 2HQ0A 1PB8A 3LC8A 5CC2A 1US5A 3PUZE 3Q25A 3H4ZA 5J1DA 1D4NA 3S9LC 1JQFA 3GZGA 3VLVA 1VFEA 4GL0A 4AB5A 3FASA 1IUDA 3FXRA 5DVJA 3TCFA 1LFIA 3PPQA 3K0VA 4OFOA 1DSNA 1B58A 1JW5A 3OO9A 5TPAA 3QUJA 3S2VA 3TEPA 1NH8A 3O2AA 5TP9A 4P0GA 1ZJLA 3TTKA 4DCYA 3ZKLA 5I59B 4OYVA 3PPOA 5FTHA 1H45A 5AA4A 1TFDA 2QMWA 4THIA 4IO6A 5FTIA 1IXGA 1LBCA 1N3XA 2DE2A 1P1WA 3K1PA 4WKMA 5DEXA 1N7WA 1JW4A 2HAVA 3E4RA 1JNFA 1H76A 4XKNA 3MZ9A 1A8EA 1B3GA 2ANJA 4I62A 1D9YA 3GLBA 4ZZAA 3SEXA 1PBQA 3MC2A 1IQ7A 1N04A 4IGRA 3ZKKA 1OIBA 2O7UA 1A54A 1B7HA 3K6VA 3O9PA 5CMMA 2X26A 4F39A 3JYRA 2Q88A 4IY5A 2OJTA 4IY6A 3U72A 3PV0E 1MQHA 1MQJA 5CMBA 2QRYA 2PMSA 4ZECA 3USDA 3UK4A 4M1VA 3EF7A 3FXUA 2PT2A 4MLQA 1QULA 2DWHA 3TAJA 2B3FA 2Y7PA 4IO5A 3LUYA 4OENA 3KGCA 3PMXA 3CSGA 2PBWA 3E3KA 1SI0A 5BUUA 3VVEA 1LFGA 5CM6A 2E0SA 3FUZA 3K02A 3Q28A 4BLAA 3LSXA 4KPTA 2F5XA 4JSOA 3K1NA 3IOWA 4L17A 3MVZA 1A8FA 4UACA 4IGTA 1NKXA 3QYTA 4C1TA 2QS2A 2GFEA 3FD3A 2Q8JA 1ZKBA 3R6UA 5B7DA 4LVQA 2XXUA 5JEIA 2HCAA 1JEVA 1LSTA 1N7XA 4O3AA 2G93A 5JTYB 1LCTA 3SETA 3UIFA 1D3KA 2ONRA 1USYH 1B52A 1Y1ZA 4PE5B 5CMCA 5ISUA 5F7VA 1GVCA 2QPQA 3V8XB 3O29A 3S9MC 4OXVA 1FQDA 5HBCA 4R72A 5DVIA 2ZYMA 4G2ZA 3OXNA 1RKMA 2UVJA 3W15C 3TUSA 1Z7ME 2RC8A 3FV1A 3BKIB 1B46A 1SDXA 5I2NA 3CIJA 4OHNA 4OVJA 1O64A 3K1MA 1Y3NA 3FVKA 2HEUA 1Z7NE 3M3FA 4GWOA 4QSDA 3C35A 4NF8B 1SD3A 4EQ7A 1P1QA 1RYXA 1B5HA 4YB5A 3MZ1A 4FECA 4OEUA 1I6QA 1FQAA 1MXZA 3KBRA 3OO8A 1ATGA 1QUJA 4G4PA 3G3FA 1NMUA 1XC1A 1B3FA 2V93A 3UN6A 1GTKA 4LQ2A 4I1DA 3TCGA 2DVCA 2F7AA 4YMBA 1Q35A 2GHBA 1B5JA 1B0LA 2I3WA 3KOTA 2FA7A 2D3IA 1WDNA 3M8UA 3DP4A 1CB6A 4POXA 3B7DA 5CRYA 3TDJA 2LAOA 3IL1B 2ZMBA 2XHDA 3I3VA 4X1BA 1B1XA 2RC7A 3O97A 1SI1A 1DMBA 2NOOA 4YAHX 5CBRA 1IEJA 5IAIA 4U2RA 4OQOA 3DM0A 3HCQA 1UTHB 1XOCA 2Z8FA 5AA2A 2QMXA 2XXTA 3CI8A 1MPCA 3IB0A 2ONKE 4NF5B 4Q0CA 3TTNA 3CSBA 3QK6A 4JBZA 4E0WA 4RK2A 3A3CA 2D21A 2O51A 4H0WA 4GL8A 2Y84A 4OFJA 4MBPA 1POTA 4U22A 2OWTA 2ALUA 1ELJA 1LAGE 1H43A 5ICQA 3IR1A 4MF3A 3H7MA 3G3GA 3VE1B 1VSOA 1IXIA 3OEMA 4K3FA 4H67A 4GQOA 3RQTA 1JVYA 3SESA 4I9DA 1M5FA 3GXAA 4QF9A 5KDTA 4Q8RA 4F2OA 2ABHA 1A7LA 1LAXA 4G68C 3N5LA 4PFTA 3KJ7A 2X7QA 2VD2A 1US4A 2B3BA 3MPKA 4DLDA 4KYDA 1B3HA 2R9JA 1KWHA 4ELOA 3OOAA 4OEVA 2O69A 2DP8A 4HCWA 3RTWB 4ESWA 4G68A 1GR2A 2XX9A 2V25A 1YPNA 4OESA 2O84X 4OTEA 1HSJA 1PB7A 3PGFA 4YB7A 4ZE8A 2I6EA 1UTBB 4DDDA 4FIMA 3L6GA 2O7IA 2HAUA 2OLBA 4YB6A 1VE4A 2QJEA 2V3UA 5KCJB 5L8DA 3TKDA 3HV1A 4XXUA 1N84A 4OETA 3RY3A 4LA9A 1QKBA 1LBBA 1Y1MA 1D9VA 2F36A 5AA1A 1B5IA 4F22A 1GV8A 3VXBA 3RLFE 4EF1A 2BJJX 3ZS6A 2XD3A 2G29A 2XX7A 1EU8A 1NH7A 1ZLQA 4WXJA 5I2KA 2DYXA 3MP1A 4G8HA 4G77A 2PYYA 4RXLA 4U4SA 1JVXA 1NNPA 3FJMA 4KFQA 2DE4A 4FJPA 2ZYOA 1B51A 3FIRA 4G8MA 2NXOA 4GVOA 1MDQA 4JSDA 2QS1A 1MPBA 1B9JA 1JEUA 1R9LA 4ZEKA 1Q1KA 1OLAA 2UVGA 1BKAA 1MXWA 1B1HA 4H65A 3SKPA 2HXWA 3D4GA 4XTCQ 2F35A 2H25A 4ELQA 4QFPA 2E1SA 1UQWA 1B40A 1URGA 5H8HA 3ZSFA 4H1XA 5HM4B 2YPNA 2UVHA 4NF6A 4F2QA 3KSXA 2B65A 1T0KA 3H6UA 1EZOA 1LFHA 2QL3A 1B4ZA 3VDFA 2P2AA 1URSA 5A5XB 4R9GA 1F9BA 4EQ9A 2H5YA 4QFOA 2I4BA 4DXUA 3SERA 1IITA 3KFMA 4GLIA 2AL4A 3MW0A 2Z8DA 3MVYA 5HPQA 2QS3A 5AA3A 3E13X 4EDPA 4TOZA 4E0XA 4XKRA 3KN8A 2X7PA 3KOSA 3HO7A 3FZVA 3PMWA 3UP9A 4O3BA 2I0BA 3MAMA 2F97A 1FQBA 2O6AA 3QUFA 4U1OA 3W9WA 4BDRA 3MWBA 2F34A 4H5GA 1XHYA 2RKMA 1FTLA 1MQGA 5ITOA 3H6WA 3EHSA 5I58B 1B3EA 4UA8A 1JETA 4F3SA 3MP8A 3A3UA 2V3TA 4DXCA 4R6YA 1EH3A 1B7UA 4XIGQ 2NUVA 3I5OA 4YKKA 5KZTA 5L9SA 1FQEA 1O7TA 2H98A 4F1YA 1QUIA 1B2HA 3JV9A 2WKYA 3T9UA 3V83A 1MPDA 2I58A 3VLWA 3PD8A 2DXRA 3PPNA 4KCDA 4F3GA 4ESXA 1YTVA 4LQ5A 3W9VA 1IIWA 4JXIA 5H8NB 3GBAA 1P99A 5I57B 4F18A 3WAEA 3TQWA 3MJNA 4LUBA 3T22A 1P1UA 3PPRA 1SW2A 1LGBC 4RK9A 5K2XA 3PUVE 1QUKA 4GXAA 1TWYA 1S9TA 4RPNA 2Y7IA 1YAEA 3KEIA 4HW8A 3E9XA 3PUWE 4H8JA 3MP6A 4M4GA 4NF4B 1MXYA 2ZNTA 4QFKA 2CMOA 4EQBA 5K2YA 3IORA 4OFLA 1A55A 4N13A 4Z7EA 3N26A 5H8FA 5ELVA 2Q89A 3ONMA 3B6WA 2IEEA 3U92A 1LLSA 3K4UA 3MBPA 5H8QA 1AMFA 5I56A 2VHAA 3M3LA 1Y3PA 1DOTA 4ZEFA 3RT6B 3IO6A 2A5TA 2I49A 3LSFB 5TPAB 4QSEA 5TP9B 2I48A 3SDFA 4JB7A 1OQHA 3ILTB 1LCFA 3JZJA 5AA4B 1BIYA 3ILUB 4PFUA 4RYAA 1YCJA 3OMBA 2OBGA 4QHQA 2YLNA 4ND9A 4YU0A 4JWXA 4YKIA 3CVGA 1SYIA 3KJTA 3CFXA 5DEXB 1SYHA 4H8IA 4HS7A 1TFAA 2Q9TA 1NNKA 3QXMA 3G3KA 3U93A 1LB8A 4FATA 3OEKA 3QAXA 3N6UA 2XXIA 2VGQA 2M8CA 3H6VA 3RN8A 1N76A 2W7YA 1JW1A 3PMVA 4R2BA 1URDA 3G3IA 3S4UA 4QFNA 1MXVA 3LSLA 2F6PA 2GH9A 2VOZA 3RT8A 1FTMA 3H6TA 5FHMA 5CMKA 3BFUA 5EHSA 3C34A 2F6GA 3ODBA 5I59A 1SVXB 5DVFA 4U23A 4RJZA 4U4XA 4JWOA 2Y7RA 1TXFA 5EHMA 4ZDMA 3Q27A 5FHNA 4GOTA 2NVUB 2H99A 4GFRA 1MH4A 3HN0A 3IB1A 3FGSA 3K2DA 2V84A 1S7YA 4KYSA 3PPPA 1ZIUA 1BP5A 3CRBA 4FEBA 4PFYA 3IB2A 4FAJA 2DOJA 1XT8A 3CR9A 4OERA 4ZEIA 4GD5A 2OK2A 3CFLA 1HSLA 4ELPA 3OELA 1ZU0A 4X9TA 1OVBA 4YMAA 2Q2AA 3PUYE 5CBSA 4R6HA 1Y3QA 3FV2A 4NWCA 3MZBA 2XXVA 1DTZA 4WEPA 4GIZA 1II5A 3T9XB 1ANFA 3U1OA 5M2VA 1MM6A 3FJ7A 1MY4A 5TU0A 2P1SA 1DPPA 2I3VA 5ITPA 1N3WA 5I84A 1MY2A 4R9FA 2FYIA 2UXAA 4IO2A 1P1NA 3A09A 5I58A 1B7ZA 2GRVA 1O63A 2OZZA 4KCCA 3RTFB 5B70A 4AB6A 1B0HA 2UVIA 1IXCA 4MLVA 4ISUA 1Y9UA 3C4MA 2ONSA 1IZ1A 1ZTYA 1DPEA 4JWYA 5AE4A 4DXBA 4F1VA 4HTGA 3TFLA 5ICTA 5FHOA 2REJA 1DTGA 5I2NB 2NWJA 3IJOB 3O6IA 1SBPA 1Y4CA 2HZKA 4EXKA 1QW0A 1MQIA 3VXCA 2VD3A 1VR5A 1H3DA 5JTYA 4LP2B 2P0SA 1LAFE 4KD5A 2F7BA 4JDFA 3R7XA 3G7WA 3QSLA 1PB9A 4ONYA 4FEDA 4ZS9A 3EHTA 1VFDA 1BTJA 4KQPA 3OSRA 3O6HA 4N6PA 1M5BA 3B6TA 3HSTA 4DIGA 3VVFA 3VLUA 4U1ZA 2RF1A 4KHZE 2Z22A 3LSWA 4OWDA 2KLFA 2DXYA 1B32A 4H6DA 2XXPA 2F7CA 2FNCA 4R75A
chains in the Genus database with same CATH superfamily
5EYHA 3FATA 2I0CA 2PFZA 2PX1A 4WEDA 1Y4TA 3R26A 1J1NA 3FJGA 3C32A 1MH3A 5DTBA 4QFLA 4Q5TA 2OX3A 2UYFA 3TCHA 4G61A 4GWUA 1M5DA 1AIVA 2HHMA 2XWIA 1FPLA 1P1OA 1PDAA 4X1DA 3DELB 4NE4A 1KA0A 1NV3A 4PFBA 2L5VA 4NF8A 1B3LA 4IO3A 2AL5A 1G0IA 2DWAA 4OVPA 4PETA 1H44A 1NNTA 2RCBA 1R1NA 2A5SA 5AA2B 1CE2A 4IO4A 4PGNA 3KN3A 1OLCA 1PBPA 1MG1A 1YYZA 5DW8A 2VP1A 3IOVA 1SW5A 4LONB 4P56A 4BDNA 3IX1A 3I6VA 3SEYA 2XX8A 4RNSA 1XVXA 1DCUA 3SEVA 3F11A 4F3BA 3VV5A 3T66A 1DK4A 2CZLA 4R74A 2XWVA 2V3QA 3IOTA 3U8QA 3A29A 2O1LA 3PD9A 5LOMA 2ESNA 3EPEA 2WYPA 2CZHA 3UORA 4X48A 4X04A 4F3PA 3VFJA 3O6GA 2DVZA 3KN7A 4GX3A 3RPWA 4F31B 1KA1A 1FJ6A 2XXYA 4PGPA 1FPFA 2PFYA 1FPKA 2B4MA 3VVDA 1NV7A 3MVXA 3ISPA 4F1UA 5EYFA 4QRZA 1WODA 1MQDA 4MMPA 1UTHA 4IB2A 1D9QA 1R6ZA 4R6KA 4XKQA 3FXQA 4NN3A 5KDTB 4JVDA 3GBBA 2FHYA 2ZXTA 3K6WA 4GF8A 5T3JA 1IMBA 3MQ9A 4NF5A 3KZGA 1LBWA 4LATA 2XXHA 3DP8A 4BDMA 2DQVA 3B6QA 1FTJA 3E79A 3V5AA 5JK4A 4G68B 1WVJA 4N07A 4F19A 1QKAA 2Z23A 3Q26A 2AIXA 1XVYA 2OWZA 3K6XA 3TMGA 4OANA 2YJPA 3TYHA 4NQ8A 2F78A 2Q2CA 5AA2D 3T9VA 3IOUA 4TLMB 2Y7WA 3FXBA 1FQFA 1FTOA 2QS4A 4O3CA 3G3HA 4NX1A 4GWSA 4NTLA 5I2KB 3M3KA 2O1MA 3THIA 4I8CA 3BBRA 1B05A 2H9BA 3KSJA 4BDOA 3IAZA 4AQ4A 4ELRA 1B4HA 3OO6A 1NL5A 1S50A 1ZBMA 3MPLA 4C1UA 2QSXA 4IO7A 3C31A 2PCRA 3FVOA 4YKJA 2H4IA 2RINA 2I4CA 2IA4A 3ROJA 4PBQA 1AL3A 3H3GA 3K00A 3TQLA 1POY1 2DDKA 5IGAA 2OCUA 2THIA 1FPGA 4RPOA 1M5EA 1UTBA 1LAHE 4IR8A 3Q29A 3K01A 4ZE9A 4GBWA 4NMYA 4BDLA 1N0TA 3PU5A 2ZZWA 4GXSB 5DYHA 2OWSA 3WAFA 1UIVA 4FORA 3MSTA 5KCJA 2KR0A 2DSFA 3MUQA 5H8HB 4NF6B 1GGGA 3D4CA 3TTMA 2ZYNA 2DE3A 2O68A 5L9MA 3SEWA 4LZ7A 3T93B 1RYOA 3CG3A 1MY3A 1ZMGA 3O28A 4MFIA 1I6AA 4RY1A 4G8NA 5I7IA 2RCAA 1NFTA 4P0IA 5IKBA 1RDXA 3TZAA 1FBDA 3PTYA 2RC9A 2PVUA 1FW0A 2DWJA 3H03A 4ZEBA 3AXFA 2Z8EA 4PF6A 1SW4A 3TPAA 4P8BA 3T9HB 2XXRA 1MS7A 1B6HA 2GHAA 1UIUA 4LZ8A 3LR1A 3EQ1A 4P11A 4C0RA 3KG2A 1L5TA 3FVNA 2DWIA 4NEDA 3OD7A 3OENA 1KZ8A 1HSEA 1SW1A 4KI0E 3TODA 2ZNUA 4H5FA 4OZ9A 1FQCA 4XKPA 1NNFA 2HZLA 3S9NC 1AH5A 2DS9A 2B4LA 1EZ9A 1AOVA 3LBSA 2HFBA 1FCKA 3TTRA 1MRPA 4TQUQ 1R9QA 5A5XA 2D5WA 1I6BA 3OSQA 1PEBA 4FE8A 4DE8A 5H8SA 2UYEA 5F1QA 3MVWA 3RUMA 3HPIA 1FBPA 4BDQA 4DCXA 4P47A 3U94A 4N8GA 4R2FA 4DI4B 2REGA 4HCYA 1OVTA 1MDP1 4U21A 4PQJA 4PP0A 1XS5A 5BWJA 2XXWA 3CFZA 5IZ1A 4LZ5A 3DP6A 2HPGA 4KR5A 3TELA 3HHFA 3RNNA 1MY1A 1YZ0A 1NUXA 2XD2A 1USYE 3IO4A 2BJIA 1MXUA 4PFWA 3CG1A 1MM7A 1A99A 1PC3A 2ZYKA 1EZPA 3PUXE 3C33A 3HHGA 4H46A 4ECFA 3RGYA 3IJXB 5EQAA 1G0HA 4POWA 1MY0A 2R6GE 4NWDA 2PT1A 2QVRA 1OMPA 1SQYA 2F8DA 4XFEA 4R73A 5L9OA 4GRKA 4NHBA 4ZZEA 4YKPA 3QIMA 3N6TA 1Y20A 3RPLB 3P7IA 5H8FB 3C9HA 3EN3A 2R71A 3K6UA 4EUOA 3T96B 1LB9A 3EHUA 4Q30B 3LV0A 5I56B 5H8QB 4YICA 1IXHA 3UGWA 3DLNA 4RA1A 4PBHA 1IMFA 3UA8A 2XXXA 3OO7A 1EYJA 2A5TB 1OQGA 4EF2A 1QJMA 1FTKA 1TT1A 1A40A 5CI5A 3O66A 4MH5A 4DZ1A 3G3JA 1QVSA 3S9EA 1I69A 3IK6B 3V89B 1LBXA 3C36A 4Z0IA 5H8NA 5I57A 3N94A 1M5CA 3RYDA 1BLFA 5DT6A 4PCDA 3FVGA 4YZZA 3BFTA 2Y7KA 3L6HA 3TTLA 2ZNSA 4F29A 3ECRA 4OMBA 5F24A 3H06B 5I3SA 4QSCA 1MXXA 4KYEA 4OVSA 4TLLB 4EXLA 4ZEDA 2XXQA 3SEUA 4NF4A 2AYSA 1LBZA 2HQ0A 5ET7A 1PB8A 3LC8A 5CC2A 1US5A 3PUZE 3Q25A 3H4ZA 5J1DA 1D4NA 3S9LC 1BK4A 1JQFA 3GZGA 3VLVA 1VFEA 4GL0A 4AB5A 3FASA 4MX6A 1IUDA 3FXRA 3T1BA 5IM2A 5DVJA 3TCFA 2ZZVA 1LFIA 3B8BA 3PPQA 3K0VA 4OFOA 1DSNA 1B58A 1JW5A 4I40A 2FIXA 3OO9A 5TPAA 3HFUA 3QUJA 3S2VA 3TEPA 1NH8A 3O2AA 5TP9A 4P0GA 4PTKA 1ZJLA 3TTKA 4DCYA 3ZKLA 5I59B 4OYVA 3PPOA 5FTHA 1H45A 3D1RA 5AA4A 1TFDA 2QMWA 4THIA 1IMCA 4GX4A 4IO6A 5FTIA 1IXGA 1LBCA 1N3XA 2DE2A 1P1WA 3K1PA 4WKMA 5DEXA 1N7WA 5LTCA 1JW4A 2HAVA 3E4RA 1JNFA 1H76A 3KBZA 4XKNA 4MCOA 3MZ9A 1A8EA 1B3GA 2ANJA 4I62A 4GWZA 1D9YA 3GLBA 4ZZAA 3SEXA 4GBVA 1PBQA 3MC2A 1IQ7A 1N04A 4IGRA 3ZKKA 2FVZA 1OIBA 2O7UA 1A54A 1B7HA 3K6VA 3O9PA 5CMMA 2X26A 4F39A 3JYRA 2Q88A 4FBPA 4IY5A 2OJTA 4IY6A 3U72A 2CZIA 3PV0E 1MQHA 1MQJA 2QRYA 2PMSA 5CMBA 4ZECA 3USDA 3UK4A 4M1VA 3EF7A 3FXUA 4HE1A 2PT2A 4MLQA 1K9ZA 1QULA 2DWHA 3TAJA 2B3FA 4PAKA 4IO5A 2Y7PA 3LUYA 4OENA 3KGCA 3PMXA 1FBFA 3CSGA 2PBWA 3E3KA 1SI0A 5BUUA 4I3YA 3VVEA 1LFGA 5CM6A 2E0SA 1NV6A 3FUZA 3K02A 2QVVA 3Q28A 4BLAA 3LSXA 4KPTA 2F5XA 4JSOA 3K1NA 3IOWA 4L17A 4KXPA 4P9KA 3MVZA 1A8FA 4UACA 4IGTA 1NKXA 3QYTA 1XI6A 4C1TA 2QS2A 2GFEA 3FD3A 2Q8JA 1ZKBA 3R6UA 5B7DA 4LVQA 2XXUA 5JEIA 2WYKA 2HCAA 4X8RA 1JEVA 1LSTA 5EYGA 1N7XA 4O3AA 2G93A 5JTYB 1LCTA 3SETA 4N6KA 3UIFA 1D3KA 2ONRA 4MNPA 1USYH 1B52A 4AS4A 2P3VA 1Y1ZA 4PE5B 2FIEA 5CMCA 5ISUA 5F7VA 1GVCA 4PFIA 2QPQA 3V8XB 3O29A 4MJOA 3S9MC 2KQZA 2Q8MA 4OXVA 1FQDA 4P3LA 5FBPA 5HBCA 4R72A 5DVIA 4PDDA 2ZYMA 4G2ZA 3OXNA 1RKMA 2UVJA 3W15C 3TUSA 1Z7ME 2RC8A 3FV1A 3BKIB 1B46A 4PE3A 1SDXA 1IMDA 5I2NA 3CIJA 5EQ8A 2XXKA 2XWOA 4DI3D 4OHNA 4OVJA 1O64A 3K1MA 1Y3NA 3FVKA 2HEUA 1Z7NE 3M3FA 4GWOA 4QSDA 3C35A 1NUYA 4NF8B 1SD3A 3SZPA 4MIJA 4EQ7A 1P1QA 1RYXA 1B5HA 4YB5A 3MZ1A 4FECA 4OEUA 1NUZA 1I6QA 1FQAA 1MXZA 3MYUA 3KBRA 3OO8A 1ATGA 1QUJA 4G4PA 2CEYA 3G3FA 1NMUA 1XC1A 1B3FA 2V93A 3UN6A 1GTKA 4LQ2A 4I1DA 3TCGA 2DVCA 1AWBA 2F7AA 4YMBA 1Q35A 2GHBA 1B5JA 1B0LA 2I3WA 3KOTA 2FA7A 2D3IA 1WDNA 3M8UA 3DP4A 1CB6A 4JVIA 4POXA 3B7DA 5CRYA 3TDJA 2LAOA 3IL1B 2ZMBA 1IMAA 4MAGA 3U65A 1FPJA 2XHDA 3I3VA 4X1BA 1B1XA 2RC7A 3IFCA 3O97A 1SI1A 1DMBA 2NOOA 4YAHX 5CBRA 4PF8A 1IEJA 5IAIA 1YXIA 4U2RA 3FBPA 4OQOA 3DM0A 3HCQA 1UTHB 1XOCA 1INPA 2Z8FA 5AA2A 2QMXA 1FSAA 2XXTA 3CI8A 1MPCA 4NGUA 1FBEA 3IB0A 2ONKE 4NF5B 1FTAA 4N81A 4Q0CA 3TTNA 1NV4A 3CSBA 3QK6A 4PAIA 4JBZA 4MNCA 4E0WA 4RK2A 4MEVA 3A3CA 2D21A 2O51A 4H0WA 4GL8A 2Y84A 2CZKA 4OFJA 4MBPA 1POTA 4U22A 2OWTA 2ALUA 1ELJA 1LAGE 1H43A 5ICQA 3IR1A 4MF3A 4GX6A 4HE2A 3H7MA 3G3GA 4OVRA 3VE1B 1VSOA 1IXIA 3OEMA 4K3FA 4H67A 4GQOA 3RQTA 1JVYA 3SESA 5EQ9A 4I9DA 1M5FA 4P1LA 5ET8A 3GXAA 1SPIA 4QF9A 5KDTA 4Q8RA 4F2OA 2ABHA 1A7LA 1LAXA 4G68C 3N5LA 4PFTA 3KJ7A 2X7QA 2VD2A 1US4A 2B3BA 3MPKA 4DLDA 4KYDA 1B3HA 2R9JA 1KWHA 4ELOA 3OOAA 4OEVA 2O69A 2DP8A 4HCWA 2F3DA 3RTWB 4ESWA 4G68A 1GR2A 2XX9A 2V25A 1YPNA 4OESA 2O84X 4OTEA 1HSJA 1PB7A 3PGFA 4YB7A 4ZE8A 2I6EA 1UTBB 4DDDA 4FIMA 3L6GA 1NUWA 2HAUA 2O7IA 2OLBA 3GYYA 5J16A 4YB6A 1VE4A 2QJEA 3IFAA 2V3UA 5KCJB 4OVTA 5L8DA 3TKDA 4N15A 3HV1A 4XXUA 1N84A 4OETA 4NAPA 4LA9A 3RY3A 1QKBA 1LBBA 1Y1MA 1D9VA 2F36A 5AA1A 1B5IA 4F22A 1GV8A 3VXBA 3RLFE 4EF1A 4O7IA 1NI9A 2BJJX 3ZS6A 1FJ9A 2XD3A 2P3NA 2G29A 2XX7A 4N17A 1EU8A 1NH7A 1ZLQA 4WXJA 5I2KA 2DYXA 3MP1A 4G8HA 4G77A 2PYYA 4RXLA 4U4SA 4UABA 1JVXA 1NNPA 3FJMA 4KFQA 2DE4A 4FJPA 2ZYOA 1B51A 3FIRA 4G8MA 3EKIA 4XF5A 2NXOA 4GVOA 1MDQA 4JSDA 2QS1A 1MPBA 1B9JA 1JEUA 1R9LA 4ZEKA 1Q1KA 1OLAA 2UVGA 2ZZXA 1IMEA 1BKAA 1NV1A 1MXWA 1B1HA 4H65A 2VPOA 3SKPA 2HXWA 3D4GA 4H45A 4NF0A 4XTCQ 2F35A 3CHGA 2H25A 4ELQA 4QFPA 2E1SA 1UQWA 1B40A 1URGA 5H8HA 3ZSFA 4H1XA 5HM4B 2YPNA 2UVHA 4NF6A 4O94A 4F2QA 3KSXA 2B65A 1T0KA 3H6UA 1EZOA 1LFHA 2QL3A 1B4ZA 3VDFA 2P2AA 1URSA 5A5XB 4R9GA 1F9BA 4EQ9A 2H5YA 4QFOA 2I4BA 4DXUA 3SERA 1IITA 3KFMA 4GLIA 2AL4A 4OVQA 3MW0A 2Z8DA 3MVYA 5HPQA 2QS3A 2QVUA 3E78A 5AA3A 4HXVA 3E13X 2Y5LA 4EDPA 4TOZA 4E0XA 4XKRA 3KN8A 2X7PA 3KOSA 3HO7A 3FZVA 3LUZA 3PMWA 3UP9A 4O3BA 2I0BA 3MAMA 4OA4A 2F97A 1FQBA 2VT5A 2O6AA 3QUFA 4U1OA 3W9WA 4BDRA 5IZ3B 3MWBA 2WX9A 2F34A 2XA5A 4H5GA 1XHYA 2RKMA 1FTLA 1MQGA 5ITOA 3H6WA 1FPIA 3EHSA 5I58B 1B3EA 4UA8A 1JETA 4F3SA 3MP8A 3A3UA 2V3TA 4DXCA 4R6YA 4MNIA 1EH3A 1VDWA 1B7UA 4XIGQ 2NUVA 2R8TA 3I5OA 4YKKA 5KZTA 5L9SA 1FQEA 1O7TA 2H98A 4F1YA 1QUIA 3T0JA 1B2HA 3JV9A 2WKYA 3T9UA 3KC1A 3V83A 1MPDA 2I58A 3VLWA 3PD8A 2DXRA 1NV5A 4PAFA 3PPNA 1FBHA 4KCDA 4F3GA 4ESXA 1YTVA 4PDHA 4LQ5A 3W9VA 3BIHA 1IIWA 4JXIA 1NV2A 5H8NB 3GBAA 1P99A 4P1EA 5I57B 4F18A 3WAEA 1K9YA 3TQWA 3MJNA 4LUBA 1FBCA 3T22A 1P1UA 3PPRA 1SW2A 1LGBC 4RK9A 5K2XA 3PUVE 1QUKA 4GXAA 1TWYA 1S9TA 4RPNA 2Y7IA 1YAEA 1FPBA 3KEIA 4HW8A 3E9XA 3PUWE 4H8JA 3MP6A 4M4GA 4NF4B 1MXYA 2ZNTA 4QFKA 2CMOA 4EQBA 5K2YA 3IORA 4OFLA 1A55A 4N13A 4O8MA 4Z7EA 3RPLA 3N26A 4I3EA 5H8FA 5ELVA 5I5PA 2Q89A 3ONMA 3B6WA 2IEEA 3U92A 1LLSA 3K4UA 3MBPA 5H8QA 1AMFA 5I56A 2VHAA 2CEXA 5A5LA 3BIGA 4N4UA 4GWWA 3M3LA 1Y3PA 1FPDA 1DOTA 4ZEFA 3RT6B 3IO6A 2A5TA 2I49A 3LSFB 5TPAB 4QSEA 5TP9B 1LEVA 1JP4A 2I48A 3SDFA 4JB7A 1OQHA 3ILTB 1LCFA 4N91A 3JZJA 5AA4B 1BIYA 3B50A 3ILUB 4PFUA 4RYAA 1YCJA 3OMBA 2OBGA 4QHQA 2YLNA 4ND9A 4YU0A 4JWXA 4YKIA 3CVGA 1SYIA 3KJTA 2Q74A 4QBAA 3CFXA 5DEXB 1SYHA 4H8IA 4HS7A 1TFAA 4PC9A 2Q9TA 4HE0A 1NNKA 3QXMA 3G3KA 3U93A 1LB8A 4FATA 3OEKA 3QAXA 3N6UA 2XXIA 2VGQA 3NOHA 2M8CA 3H6VA 3RN8A 1N76A 2W7YA 1JW1A 3PMVA 4R2BA 4XEQA 1RDYA 1URDA 3G3IA 1DBZA 3S4UA 4QFNA 1MXVA 3LSLA 2F6PA 2GH9A 2VOZA 3RT8A 1FTMA 3H6TA 5FHMA 5CMKA 2MKZA 3BFUA 5EHSA 3C34A 2F6GA 3ODBA 2WBBA 5I59A 5IZZA 1SVXB 5DVFA 4U23A 4RJZA 4U4XA 4JWOA 2FBPA 2Y7RA 5ET6A 1TXFA 5EHMA 4ZDMA 3Q27A 5FHNA 4GOTA 2HXRA 2NVUB 2H99A 4GFRA 1MH4A 3HN0A 3IB1A 3FGSA 3K2DA 2V84A 1S7YA 4KYSA 3PPPA 5ET5A 1ZIUA 1BP5A 3CRBA 2V4CA 4FEBA 4PFYA 3IB2A 4FAJA 2DOJA 4GWXA 1XT8A 3CR9A 4OERA 4ZEIA 4GD5A 2OK2A 3CFLA 1HSLA 4ELPA 3OELA 5LDZA 1ZU0A 5EQ7A 1FRPA 4X9TA 1OVBA 4YMAA 2Q2AA 3PUYE 5CBSA 4R6HA 1Y3QA 3FV2A 4NWCA 3MZBA 2XXVA 1DTZA 4WEPA 2XWKA 4GIZA 1EYKA 1LBYA 1II5A 3T9XB 1ANFA 3U1OA 5M2VA 1MM6A 3FJ7A 1MY4A 5TU0A 5IZ3A 2P1SA 1DPPA 2I3VA 5ITPA 1N3WA 5I84A 1MY2A 4N6DA 4R9FA 2FYIA 2UXAA 4IO2A 2F3BA 2GQ1A 1P1NA 1Q9DA 3A09A 1FBGA 5I58A 1B7ZA 2GRVA 1O63A 2OZZA 2WEFA 4KCCA 1CNQA 3RTFB 5B70A 3KC0A 4AB6A 1B0HA 2UVIA 1IXCA 4MLVA 4ISUA 1Y9UA 3C4MA 2ONSA 4QXDA 1IZ1A 4N8YA 5ESYA 1ZTYA 1DPEA 2QFLA 4JWYA 5AE4A 2WBDA 4DXBA 4F1VA 4HTGA 3TFLA 5ICTA 5FHOA 4NG7A 2REJA 1DTGA 5I2NB 2NWJA 4AS5A 3IJOB 3O6IA 1SBPA 1LBVA 1Y4CA 2HZKA 4EXKA 1QW0A 1MQIA 1FPEA 3VXCA 2VD3A 1VR5A 1H3DA 5JTYA 4LP2B 2P0SA 2VPNA 4O7MA 1LAFE 4KD5A 2F7BA 4JDFA 3R7XA 3G7WA 3QSLA 1PB9A 4ONYA 4FEDA 4ZS9A 3EHTA 1VFDA 1EYIA 1BTJA 4KQPA 1QGXA 3OSRA 3O6HA 2Y5KA 4N6PA 1RDZA 1NV0A 1M5BA 3B6TA 4PFRA 3HSTA 4MHFA 4DIGA 3VVFA 3VLUA 4U1ZA 2RF1A 4GWYA 4KHZE 2Z22A 3LSWA 4OWDA 2KLFA 2DXYA 2JJKA 1B32A 4H6DA 4JVCA 2XXPA 4LN5A 2F7CA 2FNCA 4R75A 3QMFA
chains in the Genus database with same CATH topology
3FATA 2I0CA 2PX1A 4WEDA 1Y4TA 3R26A 1J1NA 3FJGA 3C32A 1MH3A 5DTBA 4QFLA 4Q5TA 2UYFA 3TCHA 1M5DA 1AIVA 1P1OA 1PDAA 4X1DA 3DELB 4NE4A 4NF8A 1B3LA 4IO3A 2AL5A 2DWAA 4PETA 1H44A 1NNTA 2RCBA 1R1NA 2A5SA 5AA2B 1CE2A 4IO4A 3KN3A 1OLCA 1PBPA 1MG1A 2VP1A 3IOVA 1SW5A 4LONB 4BDNA 3IX1A 3I6VA 3SEYA 2XX8A 4RNSA 1XVXA 3SEVA 3F11A 4F3BA 3VV5A 3T66A 2CZLA 4R74A 2V3QA 3IOTA 3U8QA 2O1LA 3PD9A 5LOMA 2ESNA 3EPEA 3UORA 4X48A 4F3PA 3VFJA 3O6GA 2DVZA 3KN7A 3RPWA 4F31B 2XXYA 3VVDA 3MVXA 4F1UA 5EYFA 4QRZA 1WODA 1MQDA 1UTHA 4IB2A 1R6ZA 4R6KA 4XKQA 3FXQA 5KDTB 3GBBA 2ZXTA 3K6WA 4GF8A 3MQ9A 4NF5A 3KZGA 4LATA 2XXHA 3DP8A 4BDMA 2DQVA 3B6QA 1FTJA 3V5AA 5JK4A 4G68B 1WVJA 4N07A 4F19A 1QKAA 2Z23A 3Q26A 2AIXA 1XVYA 3K6XA 3TMGA 2YJPA 3TYHA 2F78A 2Q2CA 5AA2D 3T9VA 3IOUA 4TLMB 2Y7WA 1FQFA 1FTOA 2QS4A 4O3CA 3G3HA 4NTLA 5I2KB 3M3KA 2O1MA 3THIA 4I8CA 3BBRA 1B05A 2H9BA 3KSJA 4BDOA 3IAZA 4AQ4A 4ELRA 1B4HA 3OO6A 1NL5A 1S50A 1ZBMA 3MPLA 4C1UA 2QSXA 4IO7A 3C31A 3FVOA 4YKJA 2H4IA 2RINA 2I4CA 2IA4A 3TQLA 1AL3A 3H3GA 3K00A 1POY1 2OCUA 2THIA 4RPOA 1M5EA 1UTBA 1LAHE 3Q29A 3K01A 4ZE9A 4NMYA 4BDLA 1N0TA 3PU5A 4GXSB 5DYHA 2OWSA 3WAFA 1UIVA 4FORA 5KCJA 2DSFA 3MUQA 5H8HB 4NF6B 1GGGA 3TTMA 3D4CA 2ZYNA 2DE3A 2O68A 5L9MA 3SEWA 4LZ7A 3T93B 1RYOA 3CG3A 1MY3A 1ZMGA 3O28A 4MFIA 1I6AA 4RY1A 4G8NA 2RCAA 1NFTA 4P0IA 5IKBA 3TZAA 2RC9A 2PVUA 1FW0A 2DWJA 3H03A 4ZEBA 3AXFA 2Z8EA 1SW4A 3TPAA 3T9HB 2XXRA 1MS7A 1B6HA 2GHAA 1UIUA 4LZ8A 3LR1A 3EQ1A 4P11A 4C0RA 3KG2A 1L5TA 3FVNA 2DWIA 4NEDA 3OD7A 3OENA 1HSEA 1SW1A 4KI0E 3TODA 2ZNUA 4H5FA 4OZ9A 1FQCA 4XKPA 1NNFA 2HZLA 3S9NC 1AH5A 2DS9A 1EZ9A 1AOVA 3LBSA 2HFBA 1FCKA 3TTRA 1MRPA 4TQUQ 1R9QA 5A5XA 2D5WA 1I6BA 3OSQA 1PEBA 4FE8A 4DE8A 5H8SA 2UYEA 5F1QA 3MVWA 3RUMA 3HPIA 4BDQA 4DCXA 3U94A 4R2FA 2REGA 4HCYA 1OVTA 1MDP1 4U21A 4PQJA 1XS5A 4PP0A 5BWJA 2XXWA 3CFZA 4LZ5A 3DP6A 4KR5A 3TELA 3HHFA 3RNNA 1MY1A 2XD2A 1USYE 3IO4A 1MXUA 4PFWA 3CG1A 1MM7A 1A99A 1PC3A 2ZYKA 1EZPA 3PUXE 3C33A 3HHGA 4ECFA 3RGYA 3IJXB 4POWA 1MY0A 2R6GE 4NWDA 2PT1A 1OMPA 1SQYA 2F8DA 4R73A 5L9OA 4GRKA 4ZZEA 4YKPA 3QIMA 3N6TA 1Y20A 3P7IA 5H8FB 3C9HA 3EN3A 2R71A 3K6UA 4EUOA 3T96B 1LB9A 3EHUA 4Q30B 5I56B 5H8QB 4YICA 1IXHA 3UGWA 3DLNA 4RA1A 3UA8A 2XXXA 3OO7A 2A5TB 1OQGA 4EF2A 1QJMA 1FTKA 1TT1A 1A40A 5CI5A 3O66A 4MH5A 4DZ1A 3G3JA 1QVSA 3S9EA 1I69A 3IK6B 3V89B 3C36A 4Z0IA 5H8NA 5I57A 3N94A 1M5CA 1BLFA 5DT6A 3FVGA 4YZZA 3BFTA 2Y7KA 3L6HA 3TTLA 2ZNSA 4F29A 3ECRA 4OMBA 3H06B 4QSCA 1MXXA 4KYEA 4TLLB 4EXLA 4ZEDA 2XXQA 3SEUA 4NF4A 2AYSA 2HQ0A 1PB8A 3LC8A 5CC2A 1US5A 3PUZE 3Q25A 3H4ZA 5J1DA 1D4NA 3S9LC 1JQFA 3GZGA 3VLVA 1VFEA 4GL0A 4AB5A 3FASA 1IUDA 3FXRA 5DVJA 3TCFA 1LFIA 3PPQA 3K0VA 4OFOA 1DSNA 1B58A 1JW5A 3OO9A 5TPAA 3QUJA 3S2VA 3TEPA 1NH8A 3O2AA 5TP9A 4P0GA 1ZJLA 3TTKA 4DCYA 3ZKLA 5I59B 4OYVA 3PPOA 5FTHA 1H45A 5AA4A 1TFDA 2QMWA 4THIA 4IO6A 5FTIA 1IXGA 1LBCA 1N3XA 2DE2A 1P1WA 3K1PA 4WKMA 5DEXA 1N7WA 1JW4A 2HAVA 3E4RA 1JNFA 1H76A 4XKNA 3MZ9A 1A8EA 1B3GA 2ANJA 4I62A 1D9YA 3GLBA 4ZZAA 3SEXA 1PBQA 3MC2A 1IQ7A 1N04A 4IGRA 3ZKKA 1OIBA 2O7UA 1A54A 1B7HA 3K6VA 3O9PA 5CMMA 2X26A 4F39A 3JYRA 2Q88A 4IY5A 2OJTA 4IY6A 3U72A 3PV0E 1MQHA 1MQJA 5CMBA 2QRYA 2PMSA 4ZECA 3USDA 3UK4A 4M1VA 3EF7A 3FXUA 2PT2A 4MLQA 1QULA 2DWHA 3TAJA 2B3FA 2Y7PA 4IO5A 3LUYA 4OENA 3KGCA 3PMXA 3CSGA 2PBWA 3E3KA 1SI0A 5BUUA 3VVEA 1LFGA 5CM6A 2E0SA 3FUZA 3K02A 3Q28A 4BLAA 3LSXA 4KPTA 2F5XA 4JSOA 3K1NA 3IOWA 4L17A 3MVZA 1A8FA 4UACA 4IGTA 1NKXA 3QYTA 4C1TA 2QS2A 2GFEA 3FD3A 2Q8JA 1ZKBA 3R6UA 5B7DA 4LVQA 2XXUA 5JEIA 2HCAA 1JEVA 1LSTA 1N7XA 4O3AA 2G93A 5JTYB 1LCTA 3SETA 3UIFA 1D3KA 2ONRA 1USYH 1B52A 1Y1ZA 4PE5B 5CMCA 5ISUA 5F7VA 1GVCA 2QPQA 3V8XB 3O29A 3S9MC 4OXVA 1FQDA 5HBCA 4R72A 5DVIA 2ZYMA 4G2ZA 3OXNA 1RKMA 2UVJA 3W15C 3TUSA 1Z7ME 2RC8A 3FV1A 3BKIB 1B46A 1SDXA 5I2NA 3CIJA 4OHNA 4OVJA 1O64A 3K1MA 1Y3NA 3FVKA 2HEUA 1Z7NE 3M3FA 4GWOA 4QSDA 3C35A 4NF8B 1SD3A 4EQ7A 1P1QA 1RYXA 1B5HA 4YB5A 3MZ1A 4FECA 4OEUA 1I6QA 1FQAA 1MXZA 3KBRA 3OO8A 1ATGA 1QUJA 4G4PA 3G3FA 1NMUA 1XC1A 1B3FA 2V93A 3UN6A 1GTKA 4LQ2A 4I1DA 3TCGA 2DVCA 2F7AA 4YMBA 1Q35A 2GHBA 1B5JA 1B0LA 2I3WA 3KOTA 2FA7A 2D3IA 1WDNA 3M8UA 3DP4A 1CB6A 4POXA 3B7DA 5CRYA 3TDJA 2LAOA 3IL1B 2ZMBA 2XHDA 3I3VA 4X1BA 1B1XA 2RC7A 3O97A 1SI1A 1DMBA 2NOOA 4YAHX 5CBRA 1IEJA 5IAIA 4U2RA 4OQOA 3DM0A 3HCQA 1UTHB 1XOCA 2Z8FA 5AA2A 2QMXA 2XXTA 3CI8A 1MPCA 3IB0A 2ONKE 4NF5B 4Q0CA 3TTNA 3CSBA 3QK6A 4JBZA 4E0WA 4RK2A 3A3CA 2D21A 2O51A 4H0WA 4GL8A 2Y84A 4OFJA 4MBPA 1POTA 4U22A 2OWTA 2ALUA 1ELJA 1LAGE 1H43A 5ICQA 3IR1A 4MF3A 3H7MA 3G3GA 3VE1B 1VSOA 1IXIA 3OEMA 4K3FA 4H67A 4GQOA 3RQTA 1JVYA 3SESA 4I9DA 1M5FA 3GXAA 4QF9A 5KDTA 4Q8RA 4F2OA 2ABHA 1A7LA 1LAXA 4G68C 3N5LA 4PFTA 3KJ7A 2X7QA 2VD2A 1US4A 2B3BA 3MPKA 4DLDA 4KYDA 1B3HA 2R9JA 1KWHA 4ELOA 3OOAA 4OEVA 2O69A 2DP8A 4HCWA 3RTWB 4ESWA 4G68A 1GR2A 2XX9A 2V25A 1YPNA 4OESA 2O84X 4OTEA 1HSJA 1PB7A 3PGFA 4YB7A 4ZE8A 2I6EA 1UTBB 4DDDA 4FIMA 3L6GA 2O7IA 2HAUA 2OLBA 4YB6A 1VE4A 2QJEA 2V3UA 5KCJB 5L8DA 3TKDA 3HV1A 4XXUA 1N84A 4OETA 3RY3A 4LA9A 1QKBA 1LBBA 1Y1MA 1D9VA 2F36A 5AA1A 1B5IA 4F22A 1GV8A 3VXBA 3RLFE 4EF1A 2BJJX 3ZS6A 2XD3A 2G29A 2XX7A 1EU8A 1NH7A 1ZLQA 4WXJA 5I2KA 2DYXA 3MP1A 4G8HA 4G77A 2PYYA 4RXLA 4U4SA 1JVXA 1NNPA 3FJMA 4KFQA 2DE4A 4FJPA 2ZYOA 1B51A 3FIRA 4G8MA 2NXOA 4GVOA 1MDQA 4JSDA 2QS1A 1MPBA 1B9JA 1JEUA 1R9LA 4ZEKA 1Q1KA 1OLAA 2UVGA 1BKAA 1MXWA 1B1HA 4H65A 3SKPA 2HXWA 3D4GA 4XTCQ 2F35A 2H25A 4ELQA 4QFPA 2E1SA 1UQWA 1B40A 1URGA 5H8HA 3ZSFA 4H1XA 5HM4B 2YPNA 2UVHA 4NF6A 4F2QA 3KSXA 2B65A 1T0KA 3H6UA 1EZOA 1LFHA 2QL3A 1B4ZA 3VDFA 2P2AA 1URSA 5A5XB 4R9GA 1F9BA 4EQ9A 2H5YA 4QFOA 2I4BA 4DXUA 3SERA 1IITA 3KFMA 4GLIA 2AL4A 3MW0A 2Z8DA 3MVYA 5HPQA 2QS3A 5AA3A 3E13X 4EDPA 4TOZA 4E0XA 4XKRA 3KN8A 2X7PA 3KOSA 3HO7A 3FZVA 3PMWA 3UP9A 4O3BA 2I0BA 3MAMA 2F97A 1FQBA 2O6AA 3QUFA 4U1OA 3W9WA 4BDRA 3MWBA 2F34A 4H5GA 1XHYA 2RKMA 1FTLA 1MQGA 5ITOA 3H6WA 3EHSA 5I58B 1B3EA 4UA8A 1JETA 4F3SA 3MP8A 3A3UA 2V3TA 4DXCA 4R6YA 1EH3A 1B7UA 4XIGQ 2NUVA 3I5OA 4YKKA 5KZTA 5L9SA 1FQEA 1O7TA 2H98A 4F1YA 1QUIA 1B2HA 3JV9A 2WKYA 3T9UA 3V83A 1MPDA 2I58A 3VLWA 3PD8A 2DXRA 3PPNA 4KCDA 4F3GA 4ESXA 1YTVA 4LQ5A 3W9VA 1IIWA 4JXIA 5H8NB 3GBAA 1P99A 5I57B 4F18A 3WAEA 3TQWA 3MJNA 4LUBA 3T22A 1P1UA 3PPRA 1SW2A 1LGBC 4RK9A 5K2XA 3PUVE 1QUKA 4GXAA 1TWYA 1S9TA 4RPNA 2Y7IA 1YAEA 3KEIA 4HW8A 3E9XA 3PUWE 4H8JA 3MP6A 4M4GA 4NF4B 1MXYA 2ZNTA 4QFKA 2CMOA 4EQBA 5K2YA 3IORA 4OFLA 1A55A 4N13A 4Z7EA 3N26A 5H8FA 5ELVA 2Q89A 3ONMA 3B6WA 2IEEA 3U92A 1LLSA 3K4UA 3MBPA 5H8QA 1AMFA 5I56A 2VHAA 3M3LA 1Y3PA 1DOTA 4ZEFA 3RT6B 3IO6A 2A5TA 2I49A 3LSFB 5TPAB 4QSEA 5TP9B 2I48A 3SDFA 4JB7A 1OQHA 3ILTB 1LCFA 3JZJA 5AA4B 1BIYA 3ILUB 4PFUA 4RYAA 1YCJA 3OMBA 2OBGA 4QHQA 2YLNA 4ND9A 4YU0A 4JWXA 4YKIA 3CVGA 1SYIA 3KJTA 3CFXA 5DEXB 1SYHA 4H8IA 4HS7A 1TFAA 2Q9TA 1NNKA 3QXMA 3G3KA 3U93A 1LB8A 4FATA 3OEKA 3QAXA 3N6UA 2XXIA 2VGQA 2M8CA 3H6VA 3RN8A 1N76A 2W7YA 1JW1A 3PMVA 4R2BA 1URDA 3G3IA 3S4UA 4QFNA 1MXVA 3LSLA 2F6PA 2GH9A 2VOZA 3RT8A 1FTMA 3H6TA 5FHMA 5CMKA 3BFUA 5EHSA 3C34A 2F6GA 3ODBA 5I59A 1SVXB 5DVFA 4U23A 4RJZA 4U4XA 4JWOA 2Y7RA 1TXFA 5EHMA 4ZDMA 3Q27A 5FHNA 4GOTA 2NVUB 2H99A 4GFRA 1MH4A 3HN0A 3IB1A 3FGSA 3K2DA 2V84A 1S7YA 4KYSA 3PPPA 1ZIUA 1BP5A 3CRBA 4FEBA 4PFYA 3IB2A 4FAJA 2DOJA 1XT8A 3CR9A 4OERA 4ZEIA 4GD5A 2OK2A 3CFLA 1HSLA 4ELPA 3OELA 1ZU0A 4X9TA 1OVBA 4YMAA 2Q2AA 3PUYE 5CBSA 4R6HA 1Y3QA 3FV2A 4NWCA 3MZBA 2XXVA 1DTZA 4WEPA 4GIZA 1II5A 3T9XB 1ANFA 3U1OA 5M2VA 1MM6A 3FJ7A 1MY4A 5TU0A 2P1SA 1DPPA 2I3VA 5ITPA 1N3WA 5I84A 1MY2A 4R9FA 2FYIA 2UXAA 4IO2A 1P1NA 3A09A 5I58A 1B7ZA 2GRVA 1O63A 2OZZA 4KCCA 3RTFB 5B70A 4AB6A 1B0HA 2UVIA 1IXCA 4MLVA 4ISUA 1Y9UA 3C4MA 2ONSA 1IZ1A 1ZTYA 1DPEA 4JWYA 5AE4A 4DXBA 4F1VA 4HTGA 3TFLA 5ICTA 5FHOA 2REJA 1DTGA 5I2NB 2NWJA 3IJOB 3O6IA 1SBPA 1Y4CA 2HZKA 4EXKA 1QW0A 1MQIA 3VXCA 2VD3A 1VR5A 1H3DA 5JTYA 4LP2B 2P0SA 1LAFE 4KD5A 2F7BA 4JDFA 3R7XA 3G7WA 3QSLA 1PB9A 4ONYA 4FEDA 4ZS9A 3EHTA 1VFDA 1BTJA 4KQPA 3OSRA 3O6HA 4N6PA 1M5BA 3B6TA 3HSTA 4DIGA 3VVFA 3VLUA 4U1ZA 2RF1A 4KHZE 2Z22A 3LSWA 4OWDA 2KLFA 2DXYA 1B32A 4H6DA 2XXPA 2F7CA 2FNCA 4R75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAT A;  2I0C A;  2PX1 A;  4WED A;  1Y4T A;  3R26 A;  1J1N A;  3FJG A;  3C32 A;  1MH3 A;  5DTB A;  4QFL A;  4Q5T A;  2UYF A;  3TCH A;  1M5D A;  1AIV A;  1P1O A;  1PDA A;  4X1D A;  3DEL B;  4NE4 A;  4NF8 A;  1B3L A;  4IO3 A;  2AL5 A;  2DWA A;  4PET A;  1H44 A;  1NNT A;  2RCB A;  1R1N A;  2A5S A;  5AA2 B;  1CE2 A;  4IO4 A;  3KN3 A;  1OLC A;  1PBP A;  1MG1 A;  2VP1 A;  3IOV A;  1SW5 A;  4LON B;  4BDN A;  3IX1 A;  3I6V A;  3SEY A;  2XX8 A;  4RNS A;  1XVX A;  3SEV A;  3F11 A;  4F3B A;  3VV5 A;  3T66 A;  2CZL A;  4R74 A;  2V3Q A;  3IOT A;  3U8Q A;  2O1L A;  3PD9 A;  5LOM A;  2ESN A;  3EPE A;  3UOR A;  4X48 A;  4F3P A;  3VFJ A;  3O6G A;  2DVZ A;  3KN7 A;  3RPW A;  4F31 B;  2XXY A;  3VVD A;  3MVX A;  4F1U A;  5EYF A;  4QRZ A;  1WOD A;  1MQD A;  1UTH A;  4IB2 A;  1R6Z A;  4R6K A;  4XKQ A;  3FXQ A;  5KDT B;  3GBB A;  2ZXT A;  3K6W A;  4GF8 A;  3MQ9 A;  4NF5 A;  3KZG A;  4LAT A;  2XXH A;  3DP8 A;  4BDM A;  2DQV A;  3B6Q A;  1FTJ A;  3V5A A;  5JK4 A;  4G68 B;  1WVJ A;  4N07 A;  4F19 A;  1QKA A;  2Z23 A;  3Q26 A;  2AIX A;  1XVY A;  3K6X A;  3TMG A;  2YJP A;  3TYH A;  2F78 A;  2Q2C A;  5AA2 D;  3T9V A;  3IOU A;  4TLM B;  2Y7W A;  1FQF A;  1FTO A;  2QS4 A;  4O3C A;  3G3H A;  4NTL A;  5I2K B;  3M3K A;  2O1M A;  3THI A;  4I8C A;  3BBR A;  1B05 A;  2H9B A;  3KSJ A;  4BDO A;  3IAZ A;  4AQ4 A;  4ELR A;  1B4H A;  3OO6 A;  1NL5 A;  1S50 A;  1ZBM A;  3MPL A;  4C1U A;  2QSX A;  4IO7 A;  3C31 A;  3FVO A;  4YKJ A;  2H4I A;  2RIN A;  2I4C A;  2IA4 A;  3TQL A;  1AL3 A;  3H3G A;  3K00 A;  1POY 1;  2OCU A;  2THI A;  4RPO A;  1M5E A;  1UTB A;  1LAH E;  3Q29 A;  3K01 A;  4ZE9 A;  4NMY A;  4BDL A;  1N0T A;  3PU5 A;  4GXS B;  5DYH A;  2OWS A;  3WAF A;  1UIV A;  4FOR A;  5KCJ A;  2DSF A;  3MUQ A;  5H8H B;  4NF6 B;  1GGG A;  3TTM A;  3D4C A;  2ZYN A;  2DE3 A;  2O68 A;  5L9M A;  3SEW A;  4LZ7 A;  3T93 B;  1RYO A;  3CG3 A;  1MY3 A;  1ZMG A;  3O28 A;  4MFI A;  1I6A A;  4RY1 A;  4G8N A;  2RCA A;  1NFT A;  4P0I A;  5IKB A;  3TZA A;  2RC9 A;  2PVU A;  1FW0 A;  2DWJ A;  3H03 A;  4ZEB A;  3AXF A;  2Z8E A;  1SW4 A;  3TPA A;  3T9H B;  2XXR A;  1MS7 A;  1B6H A;  2GHA A;  1UIU A;  4LZ8 A;  3LR1 A;  3EQ1 A;  4P11 A;  4C0R A;  3KG2 A;  1L5T A;  3FVN A;  2DWI A;  4NED A;  3OD7 A;  3OEN A;  1HSE A;  1SW1 A;  4KI0 E;  3TOD A;  2ZNU A;  4H5F A;  4OZ9 A;  1FQC A;  4XKP A;  1NNF A;  2HZL A;  3S9N C;  1AH5 A;  2DS9 A;  1EZ9 A;  1AOV A;  3LBS A;  2HFB A;  1FCK A;  3TTR A;  1MRP A;  4TQU Q;  1R9Q A;  5A5X A;  2D5W A;  1I6B A;  3OSQ A;  1PEB A;  4FE8 A;  4DE8 A;  5H8S A;  2UYE A;  5F1Q A;  3MVW A;  3RUM A;  3HPI A;  4BDQ A;  4DCX A;  3U94 A;  4R2F A;  2REG A;  4HCY A;  1OVT A;  1MDP 1;  4U21 A;  4PQJ A;  1XS5 A;  4PP0 A;  5BWJ A;  2XXW A;  3CFZ A;  4LZ5 A;  3DP6 A;  4KR5 A;  3TEL A;  3HHF A;  3RNN A;  1MY1 A;  2XD2 A;  1USY E;  3IO4 A;  1MXU A;  4PFW A;  3CG1 A;  1MM7 A;  1A99 A;  1PC3 A;  2ZYK A;  1EZP A;  3PUX E;  3C33 A;  3HHG A;  4ECF A;  3RGY A;  3IJX B;  4POW A;  1MY0 A;  2R6G E;  4NWD A;  2PT1 A;  1OMP A;  1SQY A;  2F8D A;  4R73 A;  5L9O A;  4GRK A;  4ZZE A;  4YKP A;  3QIM A;  3N6T A;  1Y20 A;  3P7I A;  5H8F B;  3C9H A;  3EN3 A;  2R71 A;  3K6U A;  4EUO A;  3T96 B;  1LB9 A;  3EHU A;  4Q30 B;  5I56 B;  5H8Q B;  4YIC A;  1IXH A;  3UGW A;  3DLN A;  4RA1 A;  3UA8 A;  2XXX A;  3OO7 A;  2A5T B;  1OQG A;  4EF2 A;  1QJM A;  1FTK A;  1TT1 A;  1A40 A;  5CI5 A;  3O66 A;  4MH5 A;  4DZ1 A;  3G3J A;  1QVS A;  3S9E A;  1I69 A;  3IK6 B;  3V89 B;  3C36 A;  4Z0I A;  5H8N A;  5I57 A;  3N94 A;  1M5C A;  1BLF A;  5DT6 A;  3FVG A;  4YZZ A;  3BFT A;  2Y7K A;  3L6H A;  3TTL A;  2ZNS A;  4F29 A;  3ECR A;  4OMB A;  3H06 B;  4QSC A;  1MXX A;  4KYE A;  4TLL B;  4EXL A;  4ZED A;  2XXQ A;  3SEU A;  4NF4 A;  2AYS A;  2HQ0 A;  1PB8 A;  3LC8 A;  5CC2 A;  1US5 A;  3PUZ E;  3Q25 A;  3H4Z A;  5J1D A;  1D4N A;  3S9L C;  1JQF A;  3GZG A;  3VLV A;  1VFE A;  4GL0 A;  4AB5 A;  3FAS A;  1IUD A;  3FXR A;  5DVJ A;  3TCF A;  1LFI A;  3PPQ A;  3K0V A;  4OFO A;  1DSN A;  1B58 A;  1JW5 A;  3OO9 A;  5TPA A;  3QUJ A;  3S2V A;  3TEP A;  1NH8 A;  3O2A A;  5TP9 A;  4P0G A;  1ZJL A;  3TTK A;  4DCY A;  3ZKL A;  5I59 B;  4OYV A;  3PPO A;  5FTH A;  1H45 A;  5AA4 A;  1TFD A;  2QMW A;  4THI A;  4IO6 A;  5FTI A;  1IXG A;  1LBC A;  1N3X A;  2DE2 A;  1P1W A;  3K1P A;  4WKM A;  5DEX A;  1N7W A;  1JW4 A;  2HAV A;  3E4R A;  1JNF A;  1H76 A;  4XKN A;  3MZ9 A;  1A8E A;  1B3G A;  2ANJ A;  4I62 A;  1D9Y A;  3GLB A;  4ZZA A;  3SEX A;  1PBQ A;  3MC2 A;  1IQ7 A;  1N04 A;  4IGR A;  3ZKK A;  1OIB A;  2O7U A;  1A54 A;  1B7H A;  3K6V A;  3O9P A;  5CMM A;  2X26 A;  4F39 A;  3JYR A;  2Q88 A;  4IY5 A;  2OJT A;  4IY6 A;  3U72 A;  3PV0 E;  1MQH A;  1MQJ A;  5CMB A;  2QRY A;  2PMS A;  4ZEC A;  3USD A;  3UK4 A;  4M1V A;  3EF7 A;  3FXU A;  2PT2 A;  4MLQ A;  1QUL A;  2DWH A;  3TAJ A;  2B3F A;  2Y7P A;  4IO5 A;  3LUY A;  4OEN A;  3KGC A;  3PMX A;  3CSG A;  2PBW A;  3E3K A;  1SI0 A;  5BUU A;  3VVE A;  1LFG A;  5CM6 A;  2E0S A;  3FUZ A;  3K02 A;  3Q28 A;  4BLA A;  3LSX A;  4KPT A;  2F5X A;  4JSO A;  3K1N A;  3IOW A;  4L17 A;  3MVZ A;  1A8F A;  4UAC A;  4IGT A;  1NKX A;  3QYT A;  4C1T A;  2QS2 A;  2GFE A;  3FD3 A;  2Q8J A;  1ZKB A;  3R6U A;  5B7D A;  4LVQ A;  2XXU A;  5JEI A;  2HCA A;  1JEV A;  1LST A;  1N7X A;  4O3A A;  2G93 A;  5JTY B;  1LCT A;  3SET A;  3UIF A;  1D3K A;  2ONR A;  1USY H;  1B52 A;  1Y1Z A;  4PE5 B;  5CMC A;  5ISU A;  5F7V A;  1GVC A;  2QPQ A;  3V8X B;  3O29 A;  3S9M C;  4OXV A;  1FQD A;  5HBC A;  4R72 A;  5DVI A;  2ZYM A;  4G2Z A;  3OXN A;  1RKM A;  2UVJ A;  3W15 C;  3TUS A;  1Z7M E;  2RC8 A;  3FV1 A;  3BKI B;  1B46 A;  1SDX A;  5I2N A;  3CIJ A;  4OHN A;  4OVJ A;  1O64 A;  3K1M A;  1Y3N A;  3FVK A;  2HEU A;  1Z7N E;  3M3F A;  4GWO A;  4QSD A;  3C35 A;  4NF8 B;  1SD3 A;  4EQ7 A;  1P1Q A;  1RYX A;  1B5H A;  4YB5 A;  3MZ1 A;  4FEC A;  4OEU A;  1I6Q A;  1FQA A;  1MXZ A;  3KBR A;  3OO8 A;  1ATG A;  1QUJ A;  4G4P A;  3G3F A;  1NMU A;  1XC1 A;  1B3F A;  2V93 A;  3UN6 A;  1GTK A;  4LQ2 A;  4I1D A;  3TCG A;  2DVC A;  2F7A A;  4YMB A;  1Q35 A;  2GHB A;  1B5J A;  1B0L A;  2I3W A;  3KOT A;  2FA7 A;  2D3I A;  1WDN A;  3M8U A;  3DP4 A;  1CB6 A;  4POX A;  3B7D A;  5CRY A;  3TDJ A;  2LAO A;  3IL1 B;  2ZMB A;  2XHD A;  3I3V A;  4X1B A;  1B1X A;  2RC7 A;  3O97 A;  1SI1 A;  1DMB A;  2NOO A;  4YAH X;  5CBR A;  1IEJ A;  5IAI A;  4U2R A;  4OQO A;  3DM0 A;  3HCQ A;  1UTH B;  1XOC A;  2Z8F A;  5AA2 A;  2QMX A;  2XXT A;  3CI8 A;  1MPC A;  3IB0 A;  2ONK E;  4NF5 B;  4Q0C A;  3TTN A;  3CSB A;  3QK6 A;  4JBZ A;  4E0W A;  4RK2 A;  3A3C A;  2D21 A;  2O51 A;  4H0W A;  4GL8 A;  2Y84 A;  4OFJ A;  4MBP A;  1POT A;  4U22 A;  2OWT A;  2ALU A;  1ELJ A;  1LAG E;  1H43 A;  5ICQ A;  3IR1 A;  4MF3 A;  3H7M A;  3G3G A;  3VE1 B;  1VSO A;  1IXI A;  3OEM A;  4K3F A;  4H67 A;  4GQO A;  3RQT A;  1JVY A;  3SES A;  4I9D A;  1M5F A;  3GXA A;  4QF9 A;  5KDT A;  4Q8R A;  4F2O A;  2ABH A;  1A7L A;  1LAX A;  4G68 C;  3N5L A;  4PFT A;  3KJ7 A;  2X7Q A;  2VD2 A;  1US4 A;  2B3B A;  3MPK A;  4DLD A;  4KYD A;  1B3H A;  2R9J A;  1KWH A;  4ELO A;  3OOA A;  4OEV A;  2O69 A;  2DP8 A;  4HCW A;  3RTW B;  4ESW A;  4G68 A;  1GR2 A;  2XX9 A;  2V25 A;  1YPN A;  4OES A;  2O84 X;  4OTE A;  1HSJ A;  1PB7 A;  3PGF A;  4YB7 A;  4ZE8 A;  2I6E A;  1UTB B;  4DDD A;  4FIM A;  3L6G A;  2O7I A;  2HAU A;  2OLB A;  4YB6 A;  1VE4 A;  2QJE A;  2V3U A;  5KCJ B;  5L8D A;  3TKD A;  3HV1 A;  4XXU A;  1N84 A;  4OET A;  3RY3 A;  4LA9 A;  1QKB A;  1LBB A;  1Y1M A;  1D9V A;  2F36 A;  5AA1 A;  1B5I A;  4F22 A;  1GV8 A;  3VXB A;  3RLF E;  4EF1 A;  2BJJ X;  3ZS6 A;  2XD3 A;  2G29 A;  2XX7 A;  1EU8 A;  1NH7 A;  1ZLQ A;  4WXJ A;  5I2K A;  2DYX A;  3MP1 A;  4G8H A;  4G77 A;  2PYY A;  4RXL A;  4U4S A;  1JVX A;  1NNP A;  3FJM A;  4KFQ A;  2DE4 A;  4FJP A;  2ZYO A;  1B51 A;  3FIR A;  4G8M A;  2NXO A;  4GVO A;  1MDQ A;  4JSD A;  2QS1 A;  1MPB A;  1B9J A;  1JEU A;  1R9L A;  4ZEK A;  1Q1K A;  1OLA A;  2UVG A;  1BKA A;  1MXW A;  1B1H A;  4H65 A;  3SKP A;  2HXW A;  3D4G A;  4XTC Q;  2F35 A;  2H25 A;  4ELQ A;  4QFP A;  2E1S A;  1UQW A;  1B40 A;  1URG A;  5H8H A;  3ZSF A;  4H1X A;  5HM4 B;  2YPN A;  2UVH A;  4NF6 A;  4F2Q A;  3KSX A;  2B65 A;  1T0K A;  3H6U A;  1EZO A;  1LFH A;  2QL3 A;  1B4Z A;  3VDF A;  2P2A A;  1URS A;  5A5X B;  4R9G A;  1F9B A;  4EQ9 A;  2H5Y A;  4QFO A;  2I4B A;  4DXU A;  3SER A;  1IIT A;  3KFM A;  4GLI A;  2AL4 A;  3MW0 A;  2Z8D A;  3MVY A;  5HPQ A;  2QS3 A;  5AA3 A;  3E13 X;  4EDP A;  4TOZ A;  4E0X A;  4XKR A;  3KN8 A;  2X7P A;  3KOS A;  3HO7 A;  3FZV A;  3PMW A;  3UP9 A;  4O3B A;  2I0B A;  3MAM A;  2F97 A;  1FQB A;  2O6A A;  3QUF A;  4U1O A;  3W9W A;  4BDR A;  3MWB A;  2F34 A;  4H5G A;  1XHY A;  2RKM A;  1FTL A;  1MQG A;  5ITO A;  3H6W A;  3EHS A;  5I58 B;  1B3E A;  4UA8 A;  1JET A;  4F3S A;  3MP8 A;  3A3U A;  2V3T A;  4DXC A;  4R6Y A;  1EH3 A;  1B7U A;  4XIG Q;  2NUV A;  3I5O A;  4YKK A;  5KZT A;  5L9S A;  1FQE A;  1O7T A;  2H98 A;  4F1Y A;  1QUI A;  1B2H A;  3JV9 A;  2WKY A;  3T9U A;  3V83 A;  1MPD A;  2I58 A;  3VLW A;  3PD8 A;  2DXR A;  3PPN A;  4KCD A;  4F3G A;  4ESX A;  1YTV A;  4LQ5 A;  3W9V A;  1IIW A;  4JXI A;  5H8N B;  3GBA A;  1P99 A;  5I57 B;  4F18 A;  3WAE A;  3TQW A;  3MJN A;  4LUB A;  3T22 A;  1P1U A;  3PPR A;  1SW2 A;  1LGB C;  4RK9 A;  5K2X A;  3PUV E;  1QUK A;  4GXA A;  1TWY A;  1S9T A;  4RPN A;  2Y7I A;  1YAE A;  3KEI A;  4HW8 A;  3E9X A;  3PUW E;  4H8J A;  3MP6 A;  4M4G A;  4NF4 B;  1MXY A;  2ZNT A;  4QFK A;  2CMO A;  4EQB A;  5K2Y A;  3IOR A;  4OFL A;  1A55 A;  4N13 A;  4Z7E A;  3N26 A;  5H8F A;  5ELV A;  2Q89 A;  3ONM A;  3B6W A;  2IEE A;  3U92 A;  1LLS A;  3K4U A;  3MBP A;  5H8Q A;  1AMF A;  5I56 A;  2VHA A;  3M3L A;  1Y3P A;  1DOT A;  4ZEF A;  3RT6 B;  3IO6 A;  2A5T A;  2I49 A;  3LSF B;  5TPA B;  4QSE A;  5TP9 B;  2I48 A;  3SDF A;  4JB7 A;  1OQH A;  3ILT B;  1LCF A;  3JZJ A;  5AA4 B;  1BIY A;  3ILU B;  4PFU A;  4RYA A;  1YCJ A;  3OMB A;  2OBG A;  4QHQ A;  2YLN A;  4ND9 A;  4YU0 A;  4JWX A;  4YKI A;  3CVG A;  1SYI A;  3KJT A;  3CFX A;  5DEX B;  1SYH A;  4H8I A;  4HS7 A;  1TFA A;  2Q9T A;  1NNK A;  3QXM A;  3G3K A;  3U93 A;  1LB8 A;  4FAT A;  3OEK A;  3QAX A;  3N6U A;  2XXI A;  2VGQ A;  2M8C A;  3H6V A;  3RN8 A;  1N76 A;  2W7Y A;  1JW1 A;  3PMV A;  4R2B A;  1URD A;  3G3I A;  3S4U A;  4QFN A;  1MXV A;  3LSL A;  2F6P A;  2GH9 A;  2VOZ A;  3RT8 A;  1FTM A;  3H6T A;  5FHM A;  5CMK A;  3BFU A;  5EHS A;  3C34 A;  2F6G A;  3ODB A;  5I59 A;  1SVX B;  5DVF A;  4U23 A;  4RJZ A;  4U4X A;  4JWO A;  2Y7R A;  1TXF A;  5EHM A;  4ZDM A;  3Q27 A;  5FHN A;  4GOT A;  2NVU B;  2H99 A;  4GFR A;  1MH4 A;  3HN0 A;  3IB1 A;  3FGS A;  3K2D A;  2V84 A;  1S7Y A;  4KYS A;  3PPP A;  1ZIU A;  1BP5 A;  3CRB A;  4FEB A;  4PFY A;  3IB2 A;  4FAJ A;  2DOJ A;  1XT8 A;  3CR9 A;  4OER A;  4ZEI A;  4GD5 A;  2OK2 A;  3CFL A;  1HSL A;  4ELP A;  3OEL A;  1ZU0 A;  4X9T A;  1OVB A;  4YMA A;  2Q2A A;  3PUY E;  5CBS A;  4R6H A;  1Y3Q A;  3FV2 A;  4NWC A;  3MZB A;  2XXV A;  1DTZ A;  4WEP A;  4GIZ A;  1II5 A;  3T9X B;  1ANF A;  3U1O A;  5M2V A;  1MM6 A;  3FJ7 A;  1MY4 A;  5TU0 A;  2P1S A;  1DPP A;  2I3V A;  5ITP A;  1N3W A;  5I84 A;  1MY2 A;  4R9F A;  2FYI A;  2UXA A;  4IO2 A;  1P1N A;  3A09 A;  5I58 A;  1B7Z A;  2GRV A;  1O63 A;  2OZZ A;  4KCC A;  3RTF B;  5B70 A;  4AB6 A;  1B0H A;  2UVI A;  1IXC A;  4MLV A;  4ISU A;  1Y9U A;  3C4M A;  2ONS A;  1IZ1 A;  1ZTY A;  1DPE A;  4JWY A;  5AE4 A;  4DXB A;  4F1V A;  4HTG A;  3TFL A;  5ICT A;  5FHO A;  2REJ A;  1DTG A;  5I2N B;  2NWJ A;  3IJO B;  3O6I A;  1SBP A;  1Y4C A;  2HZK A;  4EXK A;  1QW0 A;  1MQI A;  3VXC A;  2VD3 A;  1VR5 A;  1H3D A;  5JTY A;  4LP2 B;  2P0S A;  1LAF E;  4KD5 A;  2F7B A;  4JDF A;  3R7X A;  3G7W A;  3QSL A;  1PB9 A;  4ONY A;  4FED A;  4ZS9 A;  3EHT A;  1VFD A;  1BTJ A;  4KQP A;  3OSR A;  3O6H A;  4N6P A;  1M5B A;  3B6T A;  3HST A;  4DIG A;  3VVF A;  3VLU A;  4U1Z A;  2RF1 A;  4KHZ E;  2Z22 A;  3LSW A;  4OWD A;  2KLF A;  2DXY A;  1B32 A;  4H6D A;  2XXP A;  2F7C A;  2FNC A;  4R75 A; 
#chains in the Genus database with same CATH topology
 5EYH A;  3FAT A;  2I0C A;  2PFZ A;  2PX1 A;  4WED A;  1Y4T A;  3R26 A;  1J1N A;  3FJG A;  3C32 A;  1MH3 A;  5DTB A;  4QFL A;  4Q5T A;  2OX3 A;  2UYF A;  3TCH A;  4G61 A;  4GWU A;  1M5D A;  1AIV A;  2HHM A;  2XWI A;  1FPL A;  1P1O A;  1PDA A;  4X1D A;  3DEL B;  4NE4 A;  1KA0 A;  1NV3 A;  4PFB A;  2L5V A;  4NF8 A;  1B3L A;  4IO3 A;  2AL5 A;  1G0I A;  2DWA A;  4OVP A;  4PET A;  1H44 A;  1NNT A;  2RCB A;  1R1N A;  2A5S A;  5AA2 B;  1CE2 A;  4IO4 A;  4PGN A;  3KN3 A;  1OLC A;  1PBP A;  1MG1 A;  1YYZ A;  5DW8 A;  2VP1 A;  3IOV A;  1SW5 A;  4LON B;  4P56 A;  4BDN A;  3IX1 A;  3I6V A;  3SEY A;  2XX8 A;  4RNS A;  1XVX A;  1DCU A;  3SEV A;  3F11 A;  4F3B A;  3VV5 A;  3T66 A;  1DK4 A;  2CZL A;  4R74 A;  2XWV A;  2V3Q A;  3IOT A;  3U8Q A;  3A29 A;  2O1L A;  3PD9 A;  5LOM A;  2ESN A;  3EPE A;  2WYP A;  2CZH A;  3UOR A;  4X48 A;  4X04 A;  4F3P A;  3VFJ A;  3O6G A;  2DVZ A;  3KN7 A;  4GX3 A;  3RPW A;  4F31 B;  1KA1 A;  1FJ6 A;  2XXY A;  4PGP A;  1FPF A;  2PFY A;  1FPK A;  2B4M A;  3VVD A;  1NV7 A;  3MVX A;  3ISP A;  4F1U A;  5EYF A;  4QRZ A;  1WOD A;  1MQD A;  4MMP A;  1UTH A;  4IB2 A;  1D9Q A;  1R6Z A;  4R6K A;  4XKQ A;  3FXQ A;  4NN3 A;  5KDT B;  4JVD A;  3GBB A;  2FHY A;  2ZXT A;  3K6W A;  4GF8 A;  5T3J A;  1IMB A;  3MQ9 A;  4NF5 A;  3KZG A;  1LBW A;  4LAT A;  2XXH A;  3DP8 A;  4BDM A;  2DQV A;  3B6Q A;  1FTJ A;  3E79 A;  3V5A A;  5JK4 A;  4G68 B;  1WVJ A;  4N07 A;  4F19 A;  1QKA A;  2Z23 A;  3Q26 A;  2AIX A;  1XVY A;  2OWZ A;  3K6X A;  3TMG A;  4OAN A;  2YJP A;  3TYH A;  4NQ8 A;  2F78 A;  2Q2C A;  5AA2 D;  3T9V A;  3IOU A;  4TLM B;  2Y7W A;  3FXB A;  1FQF A;  1FTO A;  2QS4 A;  4O3C A;  3G3H A;  4NX1 A;  4GWS A;  4NTL A;  5I2K B;  3M3K A;  2O1M A;  3THI A;  4I8C A;  3BBR A;  1B05 A;  2H9B A;  3KSJ A;  4BDO A;  3IAZ A;  4AQ4 A;  4ELR A;  1B4H A;  3OO6 A;  1NL5 A;  1S50 A;  1ZBM A;  3MPL A;  4C1U A;  2QSX A;  4IO7 A;  3C31 A;  2PCR A;  3FVO A;  4YKJ A;  2H4I A;  2RIN A;  2I4C A;  2IA4 A;  3ROJ A;  4PBQ A;  1AL3 A;  3H3G A;  3K00 A;  3TQL A;  1POY 1;  2DDK A;  5IGA A;  2OCU A;  2THI A;  1FPG A;  4RPO A;  1M5E A;  1UTB A;  1LAH E;  4IR8 A;  3Q29 A;  3K01 A;  4ZE9 A;  4GBW A;  4NMY A;  4BDL A;  1N0T A;  3PU5 A;  2ZZW A;  4GXS B;  5DYH A;  2OWS A;  3WAF A;  1UIV A;  4FOR A;  3MST A;  5KCJ A;  2KR0 A;  2DSF A;  3MUQ A;  5H8H B;  4NF6 B;  1GGG A;  3D4C A;  3TTM A;  2ZYN A;  2DE3 A;  2O68 A;  5L9M A;  3SEW A;  4LZ7 A;  3T93 B;  1RYO A;  3CG3 A;  1MY3 A;  1ZMG A;  3O28 A;  4MFI A;  1I6A A;  4RY1 A;  4G8N A;  5I7I A;  2RCA A;  1NFT A;  4P0I A;  5IKB A;  1RDX A;  3TZA A;  1FBD A;  3PTY A;  2RC9 A;  2PVU A;  1FW0 A;  2DWJ A;  3H03 A;  4ZEB A;  3AXF A;  2Z8E A;  4PF6 A;  1SW4 A;  3TPA A;  4P8B A;  3T9H B;  2XXR A;  1MS7 A;  1B6H A;  2GHA A;  1UIU A;  4LZ8 A;  3LR1 A;  3EQ1 A;  4P11 A;  4C0R A;  3KG2 A;  1L5T A;  3FVN A;  2DWI A;  4NED A;  3OD7 A;  3OEN A;  1KZ8 A;  1HSE A;  1SW1 A;  4KI0 E;  3TOD A;  2ZNU A;  4H5F A;  4OZ9 A;  1FQC A;  4XKP A;  1NNF A;  2HZL A;  3S9N C;  1AH5 A;  2DS9 A;  2B4L A;  1EZ9 A;  1AOV A;  3LBS A;  2HFB A;  1FCK A;  3TTR A;  1MRP A;  4TQU Q;  1R9Q A;  5A5X A;  2D5W A;  1I6B A;  3OSQ A;  1PEB A;  4FE8 A;  4DE8 A;  5H8S A;  2UYE A;  5F1Q A;  3MVW A;  3RUM A;  3HPI A;  1FBP A;  4BDQ A;  4DCX A;  4P47 A;  3U94 A;  4N8G A;  4R2F A;  4DI4 B;  2REG A;  4HCY A;  1OVT A;  1MDP 1;  4U21 A;  4PQJ A;  4PP0 A;  1XS5 A;  5BWJ A;  2XXW A;  3CFZ A;  5IZ1 A;  4LZ5 A;  3DP6 A;  2HPG A;  4KR5 A;  3TEL A;  3HHF A;  3RNN A;  1MY1 A;  1YZ0 A;  1NUX A;  2XD2 A;  1USY E;  3IO4 A;  2BJI A;  1MXU A;  4PFW A;  3CG1 A;  1MM7 A;  1A99 A;  1PC3 A;  2ZYK A;  1EZP A;  3PUX E;  3C33 A;  3HHG A;  4H46 A;  4ECF A;  3RGY A;  3IJX B;  5EQA A;  1G0H A;  4POW A;  1MY0 A;  2R6G E;  4NWD A;  2PT1 A;  2QVR A;  1OMP A;  1SQY A;  2F8D A;  4XFE A;  4R73 A;  5L9O A;  4GRK A;  4NHB A;  4ZZE A;  4YKP A;  3QIM A;  3N6T A;  1Y20 A;  3RPL B;  3P7I A;  5H8F B;  3C9H A;  3EN3 A;  2R71 A;  3K6U A;  4EUO A;  3T96 B;  1LB9 A;  3EHU A;  4Q30 B;  3LV0 A;  5I56 B;  5H8Q B;  4YIC A;  1IXH A;  3UGW A;  3DLN A;  4RA1 A;  4PBH A;  1IMF A;  3UA8 A;  2XXX A;  3OO7 A;  1EYJ A;  2A5T B;  1OQG A;  4EF2 A;  1QJM A;  1FTK A;  1TT1 A;  1A40 A;  5CI5 A;  3O66 A;  4MH5 A;  4DZ1 A;  3G3J A;  1QVS A;  3S9E A;  1I69 A;  3IK6 B;  3V89 B;  1LBX A;  3C36 A;  4Z0I A;  5H8N A;  5I57 A;  3N94 A;  1M5C A;  3RYD A;  1BLF A;  5DT6 A;  4PCD A;  3FVG A;  4YZZ A;  3BFT A;  2Y7K A;  3L6H A;  3TTL A;  2ZNS A;  4F29 A;  3ECR A;  4OMB A;  5F24 A;  3H06 B;  5I3S A;  4QSC A;  1MXX A;  4KYE A;  4OVS A;  4TLL B;  4EXL A;  4ZED A;  2XXQ A;  3SEU A;  4NF4 A;  2AYS A;  1LBZ A;  2HQ0 A;  5ET7 A;  1PB8 A;  3LC8 A;  5CC2 A;  1US5 A;  3PUZ E;  3Q25 A;  3H4Z A;  5J1D A;  1D4N A;  3S9L C;  1BK4 A;  1JQF A;  3GZG A;  3VLV A;  1VFE A;  4GL0 A;  4AB5 A;  3FAS A;  4MX6 A;  1IUD A;  3FXR A;  3T1B A;  5IM2 A;  5DVJ A;  3TCF A;  2ZZV A;  1LFI A;  3B8B A;  3PPQ A;  3K0V A;  4OFO A;  1DSN A;  1B58 A;  1JW5 A;  4I40 A;  2FIX A;  3OO9 A;  5TPA A;  3HFU A;  3QUJ A;  3S2V A;  3TEP A;  1NH8 A;  3O2A A;  5TP9 A;  4P0G A;  4PTK A;  1ZJL A;  3TTK A;  4DCY A;  3ZKL A;  5I59 B;  4OYV A;  3PPO A;  5FTH A;  1H45 A;  3D1R A;  5AA4 A;  1TFD A;  2QMW A;  4THI A;  1IMC A;  4GX4 A;  4IO6 A;  5FTI A;  1IXG A;  1LBC A;  1N3X A;  2DE2 A;  1P1W A;  3K1P A;  4WKM A;  5DEX A;  1N7W A;  5LTC A;  1JW4 A;  2HAV A;  3E4R A;  1JNF A;  1H76 A;  3KBZ A;  4XKN A;  4MCO A;  3MZ9 A;  1A8E A;  1B3G A;  2ANJ A;  4I62 A;  4GWZ A;  1D9Y A;  3GLB A;  4ZZA A;  3SEX A;  4GBV A;  1PBQ A;  3MC2 A;  1IQ7 A;  1N04 A;  4IGR A;  3ZKK A;  2FVZ A;  1OIB A;  2O7U A;  1A54 A;  1B7H A;  3K6V A;  3O9P A;  5CMM A;  2X26 A;  4F39 A;  3JYR A;  2Q88 A;  4FBP A;  4IY5 A;  2OJT A;  4IY6 A;  3U72 A;  2CZI A;  3PV0 E;  1MQH A;  1MQJ A;  2QRY A;  2PMS A;  5CMB A;  4ZEC A;  3USD A;  3UK4 A;  4M1V A;  3EF7 A;  3FXU A;  4HE1 A;  2PT2 A;  4MLQ A;  1K9Z A;  1QUL A;  2DWH A;  3TAJ A;  2B3F A;  4PAK A;  4IO5 A;  2Y7P A;  3LUY A;  4OEN A;  3KGC A;  3PMX A;  1FBF A;  3CSG A;  2PBW A;  3E3K A;  1SI0 A;  5BUU A;  4I3Y A;  3VVE A;  1LFG A;  5CM6 A;  2E0S A;  1NV6 A;  3FUZ A;  3K02 A;  2QVV A;  3Q28 A;  4BLA A;  3LSX A;  4KPT A;  2F5X A;  4JSO A;  3K1N A;  3IOW A;  4L17 A;  4KXP A;  4P9K A;  3MVZ A;  1A8F A;  4UAC A;  4IGT A;  1NKX A;  3QYT A;  1XI6 A;  4C1T A;  2QS2 A;  2GFE A;  3FD3 A;  2Q8J A;  1ZKB A;  3R6U A;  5B7D A;  4LVQ A;  2XXU A;  5JEI A;  2WYK A;  2HCA A;  4X8R A;  1JEV A;  1LST A;  5EYG A;  1N7X A;  4O3A A;  2G93 A;  5JTY B;  1LCT A;  3SET A;  4N6K A;  3UIF A;  1D3K A;  2ONR A;  4MNP A;  1USY H;  1B52 A;  4AS4 A;  2P3V A;  1Y1Z A;  4PE5 B;  2FIE A;  5CMC A;  5ISU A;  5F7V A;  1GVC A;  4PFI A;  2QPQ A;  3V8X B;  3O29 A;  4MJO A;  3S9M C;  2KQZ A;  2Q8M A;  4OXV A;  1FQD A;  4P3L A;  5FBP A;  5HBC A;  4R72 A;  5DVI A;  4PDD A;  2ZYM A;  4G2Z A;  3OXN A;  1RKM A;  2UVJ A;  3W15 C;  3TUS A;  1Z7M E;  2RC8 A;  3FV1 A;  3BKI B;  1B46 A;  4PE3 A;  1SDX A;  1IMD A;  5I2N A;  3CIJ A;  5EQ8 A;  2XXK A;  2XWO A;  4DI3 D;  4OHN A;  4OVJ A;  1O64 A;  3K1M A;  1Y3N A;  3FVK A;  2HEU A;  1Z7N E;  3M3F A;  4GWO A;  4QSD A;  3C35 A;  1NUY A;  4NF8 B;  1SD3 A;  3SZP A;  4MIJ A;  4EQ7 A;  1P1Q A;  1RYX A;  1B5H A;  4YB5 A;  3MZ1 A;  4FEC A;  4OEU A;  1NUZ A;  1I6Q A;  1FQA A;  1MXZ A;  3MYU A;  3KBR A;  3OO8 A;  1ATG A;  1QUJ A;  4G4P A;  2CEY A;  3G3F A;  1NMU A;  1XC1 A;  1B3F A;  2V93 A;  3UN6 A;  1GTK A;  4LQ2 A;  4I1D A;  3TCG A;  2DVC A;  1AWB A;  2F7A A;  4YMB A;  1Q35 A;  2GHB A;  1B5J A;  1B0L A;  2I3W A;  3KOT A;  2FA7 A;  2D3I A;  1WDN A;  3M8U A;  3DP4 A;  1CB6 A;  4JVI A;  4POX A;  3B7D A;  5CRY A;  3TDJ A;  2LAO A;  3IL1 B;  2ZMB A;  1IMA A;  4MAG A;  3U65 A;  1FPJ A;  2XHD A;  3I3V A;  4X1B A;  1B1X A;  2RC7 A;  3IFC A;  3O97 A;  1SI1 A;  1DMB A;  2NOO A;  4YAH X;  5CBR A;  4PF8 A;  1IEJ A;  5IAI A;  1YXI A;  4U2R A;  3FBP A;  4OQO A;  3DM0 A;  3HCQ A;  1UTH B;  1XOC A;  1INP A;  2Z8F A;  5AA2 A;  2QMX A;  1FSA A;  2XXT A;  3CI8 A;  1MPC A;  4NGU A;  1FBE A;  3IB0 A;  2ONK E;  4NF5 B;  1FTA A;  4N81 A;  4Q0C A;  3TTN A;  1NV4 A;  3CSB A;  3QK6 A;  4PAI A;  4JBZ A;  4MNC A;  4E0W A;  4RK2 A;  4MEV A;  3A3C A;  2D21 A;  2O51 A;  4H0W A;  4GL8 A;  2Y84 A;  2CZK A;  4OFJ A;  4MBP A;  1POT A;  4U22 A;  2OWT A;  2ALU A;  1ELJ A;  1LAG E;  1H43 A;  5ICQ A;  3IR1 A;  4MF3 A;  4GX6 A;  4HE2 A;  3H7M A;  3G3G A;  4OVR A;  3VE1 B;  1VSO A;  1IXI A;  3OEM A;  4K3F A;  4H67 A;  4GQO A;  3RQT A;  1JVY A;  3SES A;  5EQ9 A;  4I9D A;  1M5F A;  4P1L A;  5ET8 A;  3GXA A;  1SPI A;  4QF9 A;  5KDT A;  4Q8R A;  4F2O A;  2ABH A;  1A7L A;  1LAX A;  4G68 C;  3N5L A;  4PFT A;  3KJ7 A;  2X7Q A;  2VD2 A;  1US4 A;  2B3B A;  3MPK A;  4DLD A;  4KYD A;  1B3H A;  2R9J A;  1KWH A;  4ELO A;  3OOA A;  4OEV A;  2O69 A;  2DP8 A;  4HCW A;  2F3D A;  3RTW B;  4ESW A;  4G68 A;  1GR2 A;  2XX9 A;  2V25 A;  1YPN A;  4OES A;  2O84 X;  4OTE A;  1HSJ A;  1PB7 A;  3PGF A;  4YB7 A;  4ZE8 A;  2I6E A;  1UTB B;  4DDD A;  4FIM A;  3L6G A;  1NUW A;  2HAU A;  2O7I A;  2OLB A;  3GYY A;  5J16 A;  4YB6 A;  1VE4 A;  2QJE A;  3IFA A;  2V3U A;  5KCJ B;  4OVT A;  5L8D A;  3TKD A;  4N15 A;  3HV1 A;  4XXU A;  1N84 A;  4OET A;  4NAP A;  4LA9 A;  3RY3 A;  1QKB A;  1LBB A;  1Y1M A;  1D9V A;  2F36 A;  5AA1 A;  1B5I A;  4F22 A;  1GV8 A;  3VXB A;  3RLF E;  4EF1 A;  4O7I A;  1NI9 A;  2BJJ X;  3ZS6 A;  1FJ9 A;  2XD3 A;  2P3N A;  2G29 A;  2XX7 A;  4N17 A;  1EU8 A;  1NH7 A;  1ZLQ A;  4WXJ A;  5I2K A;  2DYX A;  3MP1 A;  4G8H A;  4G77 A;  2PYY A;  4RXL A;  4U4S A;  4UAB A;  1JVX A;  1NNP A;  3FJM A;  4KFQ A;  2DE4 A;  4FJP A;  2ZYO A;  1B51 A;  3FIR A;  4G8M A;  3EKI A;  4XF5 A;  2NXO A;  4GVO A;  1MDQ A;  4JSD A;  2QS1 A;  1MPB A;  1B9J A;  1JEU A;  1R9L A;  4ZEK A;  1Q1K A;  1OLA A;  2UVG A;  2ZZX A;  1IME A;  1BKA A;  1NV1 A;  1MXW A;  1B1H A;  4H65 A;  2VPO A;  3SKP A;  2HXW A;  3D4G A;  4H45 A;  4NF0 A;  4XTC Q;  2F35 A;  3CHG A;  2H25 A;  4ELQ A;  4QFP A;  2E1S A;  1UQW A;  1B40 A;  1URG A;  5H8H A;  3ZSF A;  4H1X A;  5HM4 B;  2YPN A;  2UVH A;  4NF6 A;  4O94 A;  4F2Q A;  3KSX A;  2B65 A;  1T0K A;  3H6U A;  1EZO A;  1LFH A;  2QL3 A;  1B4Z A;  3VDF A;  2P2A A;  1URS A;  5A5X B;  4R9G A;  1F9B A;  4EQ9 A;  2H5Y A;  4QFO A;  2I4B A;  4DXU A;  3SER A;  1IIT A;  3KFM A;  4GLI A;  2AL4 A;  4OVQ A;  3MW0 A;  2Z8D A;  3MVY A;  5HPQ A;  2QS3 A;  2QVU A;  3E78 A;  5AA3 A;  4HXV A;  3E13 X;  2Y5L A;  4EDP A;  4TOZ A;  4E0X A;  4XKR A;  3KN8 A;  2X7P A;  3KOS A;  3HO7 A;  3FZV A;  3LUZ A;  3PMW A;  3UP9 A;  4O3B A;  2I0B A;  3MAM A;  4OA4 A;  2F97 A;  1FQB A;  2VT5 A;  2O6A A;  3QUF A;  4U1O A;  3W9W A;  4BDR A;  5IZ3 B;  3MWB A;  2WX9 A;  2F34 A;  2XA5 A;  4H5G A;  1XHY A;  2RKM A;  1FTL A;  1MQG A;  5ITO A;  3H6W A;  1FPI A;  3EHS A;  5I58 B;  1B3E A;  4UA8 A;  1JET A;  4F3S A;  3MP8 A;  3A3U A;  2V3T A;  4DXC A;  4R6Y A;  4MNI A;  1EH3 A;  1VDW A;  1B7U A;  4XIG Q;  2NUV A;  2R8T A;  3I5O A;  4YKK A;  5KZT A;  5L9S A;  1FQE A;  1O7T A;  2H98 A;  4F1Y A;  1QUI A;  3T0J A;  1B2H A;  3JV9 A;  2WKY A;  3T9U A;  3KC1 A;  3V83 A;  1MPD A;  2I58 A;  3VLW A;  3PD8 A;  2DXR A;  1NV5 A;  4PAF A;  3PPN A;  1FBH A;  4KCD A;  4F3G A;  4ESX A;  1YTV A;  4PDH A;  4LQ5 A;  3W9V A;  3BIH A;  1IIW A;  4JXI A;  1NV2 A;  5H8N B;  3GBA A;  1P99 A;  4P1E A;  5I57 B;  4F18 A;  3WAE A;  1K9Y A;  3TQW A;  3MJN A;  4LUB A;  1FBC A;  3T22 A;  1P1U A;  3PPR A;  1SW2 A;  1LGB C;  4RK9 A;  5K2X A;  3PUV E;  1QUK A;  4GXA A;  1TWY A;  1S9T A;  4RPN A;  2Y7I A;  1YAE A;  1FPB A;  3KEI A;  4HW8 A;  3E9X A;  3PUW E;  4H8J A;  3MP6 A;  4M4G A;  4NF4 B;  1MXY A;  2ZNT A;  4QFK A;  2CMO A;  4EQB A;  5K2Y A;  3IOR A;  4OFL A;  1A55 A;  4N13 A;  4O8M A;  4Z7E A;  3RPL A;  3N26 A;  4I3E A;  5H8F A;  5ELV A;  5I5P A;  2Q89 A;  3ONM A;  3B6W A;  2IEE A;  3U92 A;  1LLS A;  3K4U A;  3MBP A;  5H8Q A;  1AMF A;  5I56 A;  2VHA A;  2CEX A;  5A5L A;  3BIG A;  4N4U A;  4GWW A;  3M3L A;  1Y3P A;  1FPD A;  1DOT A;  4ZEF A;  3RT6 B;  3IO6 A;  2A5T A;  2I49 A;  3LSF B;  5TPA B;  4QSE A;  5TP9 B;  1LEV A;  1JP4 A;  2I48 A;  3SDF A;  4JB7 A;  1OQH A;  3ILT B;  1LCF A;  4N91 A;  3JZJ A;  5AA4 B;  1BIY A;  3B50 A;  3ILU B;  4PFU A;  4RYA A;  1YCJ A;  3OMB A;  2OBG A;  4QHQ A;  2YLN A;  4ND9 A;  4YU0 A;  4JWX A;  4YKI A;  3CVG A;  1SYI A;  3KJT A;  2Q74 A;  4QBA A;  3CFX A;  5DEX B;  1SYH A;  4H8I A;  4HS7 A;  1TFA A;  4PC9 A;  2Q9T A;  4HE0 A;  1NNK A;  3QXM A;  3G3K A;  3U93 A;  1LB8 A;  4FAT A;  3OEK A;  3QAX A;  3N6U A;  2XXI A;  2VGQ A;  3NOH A;  2M8C A;  3H6V A;  3RN8 A;  1N76 A;  2W7Y A;  1JW1 A;  3PMV A;  4R2B A;  4XEQ A;  1RDY A;  1URD A;  3G3I A;  1DBZ A;  3S4U A;  4QFN A;  1MXV A;  3LSL A;  2F6P A;  2GH9 A;  2VOZ A;  3RT8 A;  1FTM A;  3H6T A;  5FHM A;  5CMK A;  2MKZ A;  3BFU A;  5EHS A;  3C34 A;  2F6G A;  3ODB A;  2WBB A;  5I59 A;  5IZZ A;  1SVX B;  5DVF A;  4U23 A;  4RJZ A;  4U4X A;  4JWO A;  2FBP A;  2Y7R A;  5ET6 A;  1TXF A;  5EHM A;  4ZDM A;  3Q27 A;  5FHN A;  4GOT A;  2HXR A;  2NVU B;  2H99 A;  4GFR A;  1MH4 A;  3HN0 A;  3IB1 A;  3FGS A;  3K2D A;  2V84 A;  1S7Y A;  4KYS A;  3PPP A;  5ET5 A;  1ZIU A;  1BP5 A;  3CRB A;  2V4C A;  4FEB A;  4PFY A;  3IB2 A;  4FAJ A;  2DOJ A;  4GWX A;  1XT8 A;  3CR9 A;  4OER A;  4ZEI A;  4GD5 A;  2OK2 A;  3CFL A;  1HSL A;  4ELP A;  3OEL A;  5LDZ A;  1ZU0 A;  5EQ7 A;  1FRP A;  4X9T A;  1OVB A;  4YMA A;  2Q2A A;  3PUY E;  5CBS A;  4R6H A;  1Y3Q A;  3FV2 A;  4NWC A;  3MZB A;  2XXV A;  1DTZ A;  4WEP A;  2XWK A;  4GIZ A;  1EYK A;  1LBY A;  1II5 A;  3T9X B;  1ANF A;  3U1O A;  5M2V A;  1MM6 A;  3FJ7 A;  1MY4 A;  5TU0 A;  5IZ3 A;  2P1S A;  1DPP A;  2I3V A;  5ITP A;  1N3W A;  5I84 A;  1MY2 A;  4N6D A;  4R9F A;  2FYI A;  2UXA A;  4IO2 A;  2F3B A;  2GQ1 A;  1P1N A;  1Q9D A;  3A09 A;  1FBG A;  5I58 A;  1B7Z A;  2GRV A;  1O63 A;  2OZZ A;  2WEF A;  4KCC A;  1CNQ A;  3RTF B;  5B70 A;  3KC0 A;  4AB6 A;  1B0H A;  2UVI A;  1IXC A;  4MLV A;  4ISU A;  1Y9U A;  3C4M A;  2ONS A;  4QXD A;  1IZ1 A;  4N8Y A;  5ESY A;  1ZTY A;  1DPE A;  2QFL A;  4JWY A;  5AE4 A;  2WBD A;  4DXB A;  4F1V A;  4HTG A;  3TFL A;  5ICT A;  5FHO A;  4NG7 A;  2REJ A;  1DTG A;  5I2N B;  2NWJ A;  4AS5 A;  3IJO B;  3O6I A;  1SBP A;  1LBV A;  1Y4C A;  2HZK A;  4EXK A;  1QW0 A;  1MQI A;  1FPE A;  3VXC A;  2VD3 A;  1VR5 A;  1H3D A;  5JTY A;  4LP2 B;  2P0S A;  2VPN A;  4O7M A;  1LAF E;  4KD5 A;  2F7B A;  4JDF A;  3R7X A;  3G7W A;  3QSL A;  1PB9 A;  4ONY A;  4FED A;  4ZS9 A;  3EHT A;  1VFD A;  1EYI A;  1BTJ A;  4KQP A;  1QGX A;  3OSR A;  3O6H A;  2Y5K A;  4N6P A;  1RDZ A;  1NV0 A;  1M5B A;  3B6T A;  4PFR A;  3HST A;  4MHF A;  4DIG A;  3VVF A;  3VLU A;  4U1Z A;  2RF1 A;  4GWY A;  4KHZ E;  2Z22 A;  3LSW A;  4OWD A;  2KLF A;  2DXY A;  2JJK A;  1B32 A;  4H6D A;  4JVC A;  2XXP A;  4LN5 A;  2F7C A;  2FNC A;  4R75 A;  3QMF A; 
#chains in the Genus database with same CATH homology
 3FAT A;  2I0C A;  2PX1 A;  4WED A;  1Y4T A;  3R26 A;  1J1N A;  3FJG A;  3C32 A;  1MH3 A;  5DTB A;  4QFL A;  4Q5T A;  2UYF A;  3TCH A;  1M5D A;  1AIV A;  1P1O A;  1PDA A;  4X1D A;  3DEL B;  4NE4 A;  4NF8 A;  1B3L A;  4IO3 A;  2AL5 A;  2DWA A;  4PET A;  1H44 A;  1NNT A;  2RCB A;  1R1N A;  2A5S A;  5AA2 B;  1CE2 A;  4IO4 A;  3KN3 A;  1OLC A;  1PBP A;  1MG1 A;  2VP1 A;  3IOV A;  1SW5 A;  4LON B;  4BDN A;  3IX1 A;  3I6V A;  3SEY A;  2XX8 A;  4RNS A;  1XVX A;  3SEV A;  3F11 A;  4F3B A;  3VV5 A;  3T66 A;  2CZL A;  4R74 A;  2V3Q A;  3IOT A;  3U8Q A;  2O1L A;  3PD9 A;  5LOM A;  2ESN A;  3EPE A;  3UOR A;  4X48 A;  4F3P A;  3VFJ A;  3O6G A;  2DVZ A;  3KN7 A;  3RPW A;  4F31 B;  2XXY A;  3VVD A;  3MVX A;  4F1U A;  5EYF A;  4QRZ A;  1WOD A;  1MQD A;  1UTH A;  4IB2 A;  1R6Z A;  4R6K A;  4XKQ A;  3FXQ A;  5KDT B;  3GBB A;  2ZXT A;  3K6W A;  4GF8 A;  3MQ9 A;  4NF5 A;  3KZG A;  4LAT A;  2XXH A;  3DP8 A;  4BDM A;  2DQV A;  3B6Q A;  1FTJ A;  3V5A A;  5JK4 A;  4G68 B;  1WVJ A;  4N07 A;  4F19 A;  1QKA A;  2Z23 A;  3Q26 A;  2AIX A;  1XVY A;  3K6X A;  3TMG A;  2YJP A;  3TYH A;  2F78 A;  2Q2C A;  5AA2 D;  3T9V A;  3IOU A;  4TLM B;  2Y7W A;  1FQF A;  1FTO A;  2QS4 A;  4O3C A;  3G3H A;  4NTL A;  5I2K B;  3M3K A;  2O1M A;  3THI A;  4I8C A;  3BBR A;  1B05 A;  2H9B A;  3KSJ A;  4BDO A;  3IAZ A;  4AQ4 A;  4ELR A;  1B4H A;  3OO6 A;  1NL5 A;  1S50 A;  1ZBM A;  3MPL A;  4C1U A;  2QSX A;  4IO7 A;  3C31 A;  3FVO A;  4YKJ A;  2H4I A;  2RIN A;  2I4C A;  2IA4 A;  3TQL A;  1AL3 A;  3H3G A;  3K00 A;  1POY 1;  2OCU A;  2THI A;  4RPO A;  1M5E A;  1UTB A;  1LAH E;  3Q29 A;  3K01 A;  4ZE9 A;  4NMY A;  4BDL A;  1N0T A;  3PU5 A;  4GXS B;  5DYH A;  2OWS A;  3WAF A;  1UIV A;  4FOR A;  5KCJ A;  2DSF A;  3MUQ A;  5H8H B;  4NF6 B;  1GGG A;  3TTM A;  3D4C A;  2ZYN A;  2DE3 A;  2O68 A;  5L9M A;  3SEW A;  4LZ7 A;  3T93 B;  1RYO A;  3CG3 A;  1MY3 A;  1ZMG A;  3O28 A;  4MFI A;  1I6A A;  4RY1 A;  4G8N A;  2RCA A;  1NFT A;  4P0I A;  5IKB A;  3TZA A;  2RC9 A;  2PVU A;  1FW0 A;  2DWJ A;  3H03 A;  4ZEB A;  3AXF A;  2Z8E A;  1SW4 A;  3TPA A;  3T9H B;  2XXR A;  1MS7 A;  1B6H A;  2GHA A;  1UIU A;  4LZ8 A;  3LR1 A;  3EQ1 A;  4P11 A;  4C0R A;  3KG2 A;  1L5T A;  3FVN A;  2DWI A;  4NED A;  3OD7 A;  3OEN A;  1HSE A;  1SW1 A;  4KI0 E;  3TOD A;  2ZNU A;  4H5F A;  4OZ9 A;  1FQC A;  4XKP A;  1NNF A;  2HZL A;  3S9N C;  1AH5 A;  2DS9 A;  1EZ9 A;  1AOV A;  3LBS A;  2HFB A;  1FCK A;  3TTR A;  1MRP A;  4TQU Q;  1R9Q A;  5A5X A;  2D5W A;  1I6B A;  3OSQ A;  1PEB A;  4FE8 A;  4DE8 A;  5H8S A;  2UYE A;  5F1Q A;  3MVW A;  3RUM A;  3HPI A;  4BDQ A;  4DCX A;  3U94 A;  4R2F A;  2REG A;  4HCY A;  1OVT A;  1MDP 1;  4U21 A;  4PQJ A;  1XS5 A;  4PP0 A;  5BWJ A;  2XXW A;  3CFZ A;  4LZ5 A;  3DP6 A;  4KR5 A;  3TEL A;  3HHF A;  3RNN A;  1MY1 A;  2XD2 A;  1USY E;  3IO4 A;  1MXU A;  4PFW A;  3CG1 A;  1MM7 A;  1A99 A;  1PC3 A;  2ZYK A;  1EZP A;  3PUX E;  3C33 A;  3HHG A;  4ECF A;  3RGY A;  3IJX B;  4POW A;  1MY0 A;  2R6G E;  4NWD A;  2PT1 A;  1OMP A;  1SQY A;  2F8D A;  4R73 A;  5L9O A;  4GRK A;  4ZZE A;  4YKP A;  3QIM A;  3N6T A;  1Y20 A;  3P7I A;  5H8F B;  3C9H A;  3EN3 A;  2R71 A;  3K6U A;  4EUO A;  3T96 B;  1LB9 A;  3EHU A;  4Q30 B;  5I56 B;  5H8Q B;  4YIC A;  1IXH A;  3UGW A;  3DLN A;  4RA1 A;  3UA8 A;  2XXX A;  3OO7 A;  2A5T B;  1OQG A;  4EF2 A;  1QJM A;  1FTK A;  1TT1 A;  1A40 A;  5CI5 A;  3O66 A;  4MH5 A;  4DZ1 A;  3G3J A;  1QVS A;  3S9E A;  1I69 A;  3IK6 B;  3V89 B;  3C36 A;  4Z0I A;  5H8N A;  5I57 A;  3N94 A;  1M5C A;  1BLF A;  5DT6 A;  3FVG A;  4YZZ A;  3BFT A;  2Y7K A;  3L6H A;  3TTL A;  2ZNS A;  4F29 A;  3ECR A;  4OMB A;  3H06 B;  4QSC A;  1MXX A;  4KYE A;  4TLL B;  4EXL A;  4ZED A;  2XXQ A;  3SEU A;  4NF4 A;  2AYS A;  2HQ0 A;  1PB8 A;  3LC8 A;  5CC2 A;  1US5 A;  3PUZ E;  3Q25 A;  3H4Z A;  5J1D A;  1D4N A;  3S9L C;  1JQF A;  3GZG A;  3VLV A;  1VFE A;  4GL0 A;  4AB5 A;  3FAS A;  1IUD A;  3FXR A;  5DVJ A;  3TCF A;  1LFI A;  3PPQ A;  3K0V A;  4OFO A;  1DSN A;  1B58 A;  1JW5 A;  3OO9 A;  5TPA A;  3QUJ A;  3S2V A;  3TEP A;  1NH8 A;  3O2A A;  5TP9 A;  4P0G A;  1ZJL A;  3TTK A;  4DCY A;  3ZKL A;  5I59 B;  4OYV A;  3PPO A;  5FTH A;  1H45 A;  5AA4 A;  1TFD A;  2QMW A;  4THI A;  4IO6 A;  5FTI A;  1IXG A;  1LBC A;  1N3X A;  2DE2 A;  1P1W A;  3K1P A;  4WKM A;  5DEX A;  1N7W A;  1JW4 A;  2HAV A;  3E4R A;  1JNF A;  1H76 A;  4XKN A;  3MZ9 A;  1A8E A;  1B3G A;  2ANJ A;  4I62 A;  1D9Y A;  3GLB A;  4ZZA A;  3SEX A;  1PBQ A;  3MC2 A;  1IQ7 A;  1N04 A;  4IGR A;  3ZKK A;  1OIB A;  2O7U A;  1A54 A;  1B7H A;  3K6V A;  3O9P A;  5CMM A;  2X26 A;  4F39 A;  3JYR A;  2Q88 A;  4IY5 A;  2OJT A;  4IY6 A;  3U72 A;  3PV0 E;  1MQH A;  1MQJ A;  5CMB A;  2QRY A;  2PMS A;  4ZEC A;  3USD A;  3UK4 A;  4M1V A;  3EF7 A;  3FXU A;  2PT2 A;  4MLQ A;  1QUL A;  2DWH A;  3TAJ A;  2B3F A;  2Y7P A;  4IO5 A;  3LUY A;  4OEN A;  3KGC A;  3PMX A;  3CSG A;  2PBW A;  3E3K A;  1SI0 A;  5BUU A;  3VVE A;  1LFG A;  5CM6 A;  2E0S A;  3FUZ A;  3K02 A;  3Q28 A;  4BLA A;  3LSX A;  4KPT A;  2F5X A;  4JSO A;  3K1N A;  3IOW A;  4L17 A;  3MVZ A;  1A8F A;  4UAC A;  4IGT A;  1NKX A;  3QYT A;  4C1T A;  2QS2 A;  2GFE A;  3FD3 A;  2Q8J A;  1ZKB A;  3R6U A;  5B7D A;  4LVQ A;  2XXU A;  5JEI A;  2HCA A;  1JEV A;  1LST A;  1N7X A;  4O3A A;  2G93 A;  5JTY B;  1LCT A;  3SET A;  3UIF A;  1D3K A;  2ONR A;  1USY H;  1B52 A;  1Y1Z A;  4PE5 B;  5CMC A;  5ISU A;  5F7V A;  1GVC A;  2QPQ A;  3V8X B;  3O29 A;  3S9M C;  4OXV A;  1FQD A;  5HBC A;  4R72 A;  5DVI A;  2ZYM A;  4G2Z A;  3OXN A;  1RKM A;  2UVJ A;  3W15 C;  3TUS A;  1Z7M E;  2RC8 A;  3FV1 A;  3BKI B;  1B46 A;  1SDX A;  5I2N A;  3CIJ A;  4OHN A;  4OVJ A;  1O64 A;  3K1M A;  1Y3N A;  3FVK A;  2HEU A;  1Z7N E;  3M3F A;  4GWO A;  4QSD A;  3C35 A;  4NF8 B;  1SD3 A;  4EQ7 A;  1P1Q A;  1RYX A;  1B5H A;  4YB5 A;  3MZ1 A;  4FEC A;  4OEU A;  1I6Q A;  1FQA A;  1MXZ A;  3KBR A;  3OO8 A;  1ATG A;  1QUJ A;  4G4P A;  3G3F A;  1NMU A;  1XC1 A;  1B3F A;  2V93 A;  3UN6 A;  1GTK A;  4LQ2 A;  4I1D A;  3TCG A;  2DVC A;  2F7A A;  4YMB A;  1Q35 A;  2GHB A;  1B5J A;  1B0L A;  2I3W A;  3KOT A;  2FA7 A;  2D3I A;  1WDN A;  3M8U A;  3DP4 A;  1CB6 A;  4POX A;  3B7D A;  5CRY A;  3TDJ A;  2LAO A;  3IL1 B;  2ZMB A;  2XHD A;  3I3V A;  4X1B A;  1B1X A;  2RC7 A;  3O97 A;  1SI1 A;  1DMB A;  2NOO A;  4YAH X;  5CBR A;  1IEJ A;  5IAI A;  4U2R A;  4OQO A;  3DM0 A;  3HCQ A;  1UTH B;  1XOC A;  2Z8F A;  5AA2 A;  2QMX A;  2XXT A;  3CI8 A;  1MPC A;  3IB0 A;  2ONK E;  4NF5 B;  4Q0C A;  3TTN A;  3CSB A;  3QK6 A;  4JBZ A;  4E0W A;  4RK2 A;  3A3C A;  2D21 A;  2O51 A;  4H0W A;  4GL8 A;  2Y84 A;  4OFJ A;  4MBP A;  1POT A;  4U22 A;  2OWT A;  2ALU A;  1ELJ A;  1LAG E;  1H43 A;  5ICQ A;  3IR1 A;  4MF3 A;  3H7M A;  3G3G A;  3VE1 B;  1VSO A;  1IXI A;  3OEM A;  4K3F A;  4H67 A;  4GQO A;  3RQT A;  1JVY A;  3SES A;  4I9D A;  1M5F A;  3GXA A;  4QF9 A;  5KDT A;  4Q8R A;  4F2O A;  2ABH A;  1A7L A;  1LAX A;  4G68 C;  3N5L A;  4PFT A;  3KJ7 A;  2X7Q A;  2VD2 A;  1US4 A;  2B3B A;  3MPK A;  4DLD A;  4KYD A;  1B3H A;  2R9J A;  1KWH A;  4ELO A;  3OOA A;  4OEV A;  2O69 A;  2DP8 A;  4HCW A;  3RTW B;  4ESW A;  4G68 A;  1GR2 A;  2XX9 A;  2V25 A;  1YPN A;  4OES A;  2O84 X;  4OTE A;  1HSJ A;  1PB7 A;  3PGF A;  4YB7 A;  4ZE8 A;  2I6E A;  1UTB B;  4DDD A;  4FIM A;  3L6G A;  2O7I A;  2HAU A;  2OLB A;  4YB6 A;  1VE4 A;  2QJE A;  2V3U A;  5KCJ B;  5L8D A;  3TKD A;  3HV1 A;  4XXU A;  1N84 A;  4OET A;  3RY3 A;  4LA9 A;  1QKB A;  1LBB A;  1Y1M A;  1D9V A;  2F36 A;  5AA1 A;  1B5I A;  4F22 A;  1GV8 A;  3VXB A;  3RLF E;  4EF1 A;  2BJJ X;  3ZS6 A;  2XD3 A;  2G29 A;  2XX7 A;  1EU8 A;  1NH7 A;  1ZLQ A;  4WXJ A;  5I2K A;  2DYX A;  3MP1 A;  4G8H A;  4G77 A;  2PYY A;  4RXL A;  4U4S A;  1JVX A;  1NNP A;  3FJM A;  4KFQ A;  2DE4 A;  4FJP A;  2ZYO A;  1B51 A;  3FIR A;  4G8M A;  2NXO A;  4GVO A;  1MDQ A;  4JSD A;  2QS1 A;  1MPB A;  1B9J A;  1JEU A;  1R9L A;  4ZEK A;  1Q1K A;  1OLA A;  2UVG A;  1BKA A;  1MXW A;  1B1H A;  4H65 A;  3SKP A;  2HXW A;  3D4G A;  4XTC Q;  2F35 A;  2H25 A;  4ELQ A;  4QFP A;  2E1S A;  1UQW A;  1B40 A;  1URG A;  5H8H A;  3ZSF A;  4H1X A;  5HM4 B;  2YPN A;  2UVH A;  4NF6 A;  4F2Q A;  3KSX A;  2B65 A;  1T0K A;  3H6U A;  1EZO A;  1LFH A;  2QL3 A;  1B4Z A;  3VDF A;  2P2A A;  1URS A;  5A5X B;  4R9G A;  1F9B A;  4EQ9 A;  2H5Y A;  4QFO A;  2I4B A;  4DXU A;  3SER A;  1IIT A;  3KFM A;  4GLI A;  2AL4 A;  3MW0 A;  2Z8D A;  3MVY A;  5HPQ A;  2QS3 A;  5AA3 A;  3E13 X;  4EDP A;  4TOZ A;  4E0X A;  4XKR A;  3KN8 A;  2X7P A;  3KOS A;  3HO7 A;  3FZV A;  3PMW A;  3UP9 A;  4O3B A;  2I0B A;  3MAM A;  2F97 A;  1FQB A;  2O6A A;  3QUF A;  4U1O A;  3W9W A;  4BDR A;  3MWB A;  2F34 A;  4H5G A;  1XHY A;  2RKM A;  1FTL A;  1MQG A;  5ITO A;  3H6W A;  3EHS A;  5I58 B;  1B3E A;  4UA8 A;  1JET A;  4F3S A;  3MP8 A;  3A3U A;  2V3T A;  4DXC A;  4R6Y A;  1EH3 A;  1B7U A;  4XIG Q;  2NUV A;  3I5O A;  4YKK A;  5KZT A;  5L9S A;  1FQE A;  1O7T A;  2H98 A;  4F1Y A;  1QUI A;  1B2H A;  3JV9 A;  2WKY A;  3T9U A;  3V83 A;  1MPD A;  2I58 A;  3VLW A;  3PD8 A;  2DXR A;  3PPN A;  4KCD A;  4F3G A;  4ESX A;  1YTV A;  4LQ5 A;  3W9V A;  1IIW A;  4JXI A;  5H8N B;  3GBA A;  1P99 A;  5I57 B;  4F18 A;  3WAE A;  3TQW A;  3MJN A;  4LUB A;  3T22 A;  1P1U A;  3PPR A;  1SW2 A;  1LGB C;  4RK9 A;  5K2X A;  3PUV E;  1QUK A;  4GXA A;  1TWY A;  1S9T A;  4RPN A;  2Y7I A;  1YAE A;  3KEI A;  4HW8 A;  3E9X A;  3PUW E;  4H8J A;  3MP6 A;  4M4G A;  4NF4 B;  1MXY A;  2ZNT A;  4QFK A;  2CMO A;  4EQB A;  5K2Y A;  3IOR A;  4OFL A;  1A55 A;  4N13 A;  4Z7E A;  3N26 A;  5H8F A;  5ELV A;  2Q89 A;  3ONM A;  3B6W A;  2IEE A;  3U92 A;  1LLS A;  3K4U A;  3MBP A;  5H8Q A;  1AMF A;  5I56 A;  2VHA A;  3M3L A;  1Y3P A;  1DOT A;  4ZEF A;  3RT6 B;  3IO6 A;  2A5T A;  2I49 A;  3LSF B;  5TPA B;  4QSE A;  5TP9 B;  2I48 A;  3SDF A;  4JB7 A;  1OQH A;  3ILT B;  1LCF A;  3JZJ A;  5AA4 B;  1BIY A;  3ILU B;  4PFU A;  4RYA A;  1YCJ A;  3OMB A;  2OBG A;  4QHQ A;  2YLN A;  4ND9 A;  4YU0 A;  4JWX A;  4YKI A;  3CVG A;  1SYI A;  3KJT A;  3CFX A;  5DEX B;  1SYH A;  4H8I A;  4HS7 A;  1TFA A;  2Q9T A;  1NNK A;  3QXM A;  3G3K A;  3U93 A;  1LB8 A;  4FAT A;  3OEK A;  3QAX A;  3N6U A;  2XXI A;  2VGQ A;  2M8C A;  3H6V A;  3RN8 A;  1N76 A;  2W7Y A;  1JW1 A;  3PMV A;  4R2B A;  1URD A;  3G3I A;  3S4U A;  4QFN A;  1MXV A;  3LSL A;  2F6P A;  2GH9 A;  2VOZ A;  3RT8 A;  1FTM A;  3H6T A;  5FHM A;  5CMK A;  3BFU A;  5EHS A;  3C34 A;  2F6G A;  3ODB A;  5I59 A;  1SVX B;  5DVF A;  4U23 A;  4RJZ A;  4U4X A;  4JWO A;  2Y7R A;  1TXF A;  5EHM A;  4ZDM A;  3Q27 A;  5FHN A;  4GOT A;  2NVU B;  2H99 A;  4GFR A;  1MH4 A;  3HN0 A;  3IB1 A;  3FGS A;  3K2D A;  2V84 A;  1S7Y A;  4KYS A;  3PPP A;  1ZIU A;  1BP5 A;  3CRB A;  4FEB A;  4PFY A;  3IB2 A;  4FAJ A;  2DOJ A;  1XT8 A;  3CR9 A;  4OER A;  4ZEI A;  4GD5 A;  2OK2 A;  3CFL A;  1HSL A;  4ELP A;  3OEL A;  1ZU0 A;  4X9T A;  1OVB A;  4YMA A;  2Q2A A;  3PUY E;  5CBS A;  4R6H A;  1Y3Q A;  3FV2 A;  4NWC A;  3MZB A;  2XXV A;  1DTZ A;  4WEP A;  4GIZ A;  1II5 A;  3T9X B;  1ANF A;  3U1O A;  5M2V A;  1MM6 A;  3FJ7 A;  1MY4 A;  5TU0 A;  2P1S A;  1DPP A;  2I3V A;  5ITP A;  1N3W A;  5I84 A;  1MY2 A;  4R9F A;  2FYI A;  2UXA A;  4IO2 A;  1P1N A;  3A09 A;  5I58 A;  1B7Z A;  2GRV A;  1O63 A;  2OZZ A;  4KCC A;  3RTF B;  5B70 A;  4AB6 A;  1B0H A;  2UVI A;  1IXC A;  4MLV A;  4ISU A;  1Y9U A;  3C4M A;  2ONS A;  1IZ1 A;  1ZTY A;  1DPE A;  4JWY A;  5AE4 A;  4DXB A;  4F1V A;  4HTG A;  3TFL A;  5ICT A;  5FHO A;  2REJ A;  1DTG A;  5I2N B;  2NWJ A;  3IJO B;  3O6I A;  1SBP A;  1Y4C A;  2HZK A;  4EXK A;  1QW0 A;  1MQI A;  3VXC A;  2VD3 A;  1VR5 A;  1H3D A;  5JTY A;  4LP2 B;  2P0S A;  1LAF E;  4KD5 A;  2F7B A;  4JDF A;  3R7X A;  3G7W A;  3QSL A;  1PB9 A;  4ONY A;  4FED A;  4ZS9 A;  3EHT A;  1VFD A;  1BTJ A;  4KQP A;  3OSR A;  3O6H A;  4N6P A;  1M5B A;  3B6T A;  3HST A;  4DIG A;  3VVF A;  3VLU A;  4U1Z A;  2RF1 A;  4KHZ E;  2Z22 A;  3LSW A;  4OWD A;  2KLF A;  2DXY A;  1B32 A;  4H6D A;  2XXP A;  2F7C A;  2FNC A;  4R75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...