1B3EA

Human serum transferrin, n-terminal lobe, expressed in pichia pastoris
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
Knots found
sequence length
330
structure length
330
Chain Sequence
KTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDNYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Iron transport
molecule keywords PROTEIN (SERUM TRANSFERRIN)
publication title X-ray crystallography and mass spectroscopy reveal that the N-lobe of human transferrin expressed in Pichia pastoris is folded correctly but is glycosylated on serine-32.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 330
sequence length 330
other databases KnotProt 2.0: K
ec nomenclature
pdb deposition date 1998-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b3eA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b3eA02
4OTEA 3K6XA 3TCHA 3FJMA 1Y20A 4F1VA 1CE2A 4LA9A 3TMGA 4H8JA 4H6DA 2NVUB 5ISUA 2XD2A 2XXWA 4NE4A 2Y7IA 3N5LA 3OSQA 4OXVA 4GLIA 4XKQA 4NF5A 3SDFA 4OETA 4I9DA 2D21A 2I0BA 1EZOA 2LAOA 5I59A 1VSOA 1PBQA 2V3UA 2UVJA 1DMBA 2XD3A 2B65A 1DPEA 1MM6A 1M5EA 4UA8A 1JW5A 1JQFA 5DYHA 5AA2B 1IUDA 1D9YA 2ZYNA 3OXNA 3DP6A 5CBSA 2Q8JA 2V93A 1A99A 3C31A 4GRKA 5JTYA 2XXUA 3VXBA 4LZ8A 1MM7A 1QUKA 3MWBA 3G3GA 3N6UA 1MXXA 2DQVA 1AOVA 3QYTA 3KZGA 5ITPA 1FTKA 3OEMA 4LVQA 5FHNA 1LAFE 1HSJA 4WKMA 2I4BA 3S9LC 4IO6A 3K1PA 1SW5A 3RQTA 3EHSA 5AA4B 2M8CA 4YB7A 1B7UA 4EUOA 4YMBA 1XC1A 1FW0A 1MDP1 1UTBA 4G68C 2ZNTA 3IB1A 2G93A 1B7HA 4RPNA 1Y3PA 4WEDA 3GBBA 2UVGA 4IO5A 1TFDA 4F29A 4DCXA 2BJJX 2PT2A 3EHTA 2KLFA 3KG2A 1O7TA 3WAFA 1VR5A 3IJXB 4DE8A 3MZ1A 4QFLA 1NMUA 2XXYA 3QIMA 4THIA 4ZZEA 1DSNA 2FA7A 5L9SA 3ODBA 3G3KA 2O51A 3PMWA 3K00A 3E3KA 3MAMA 1UTHA 3VVEA 4HS7A 5L9MA 2P1SA 3PD9A 3IL1B 3TCFA 4U1OA 3SEUA 4BDNA 1B5JA 4ELOA 2XXHA 3K0VA 5KCJB 3QUFA 1Y4TA 2YJPA 2Z8DA 4H1XA 4BDOA 5I2KB 3TDJA 1GGGA 3Q29A 1QUIA 4F31B 3HSTA 3ZKKA 2XXQA 3BFTA 3SKPA 4FE8A 3RNNA 3FASA 2GRVA 1TXFA 2Q89A 4DXBA 1B5HA 4FIMA 3E9XA 5HM4B 3OO7A 3TZAA 3PU5A 1BIYA 3W9VA 3VFJA 2CMOA 1II5A 4LP2B 1MPCA 4Q5TA 1B2HA 4GD5A 1MXZA 5I56A 4ZDMA 1Y1MA 2VD3A 1N3WA 4KPTA 1Z7NE 2XXRA 3DP8A 5FHMA 4NF4B 4P0IA 2GHAA 3KOSA 2XXPA 2IA4A 1P1UA 4GOTA 3BFUA 3IOUA 4ND9A 3LSFB 5F1QA 2NUVA 2PYYA 4H0WA 3N6TA 3QSLA 1IIWA 1O64A 4E0XA 5J1DA 2I4CA 3OO9A 4HCWA 1P1QA 5LOMA 3VV5A 4YB6A 3PD8A 4QFPA 3UK4A 1B3HA 3PMXA 1MG1A 2UYEA 2I3WA 3DM0A 1B58A 5HPQA 1MXWA 2XXTA 4YKKA 3IK6B 2DXYA 4G4PA 3MW0A 5AA2A 4RY1A 1P1OA 2PT1A 4GFRA 4F3SA 3KJ7A 1B4ZA 2HCAA 2H9BA 3H06B 1BKAA 1QVSA 4YU0A 4BLAA 4C1TA 3I6VA 5I2NB 2DE3A 2P0SA 2XXXA 1QUJA 1LFGA 3MC2A 4FAJA 3U72A 1POTA 4WEPA 3MPKA 3O6GA 1LAGE 4U4SA 3S2VA 1M5FA 2E0SA 5CMBA 3OO6A 3FZVA 4LUBA 4ZEFA 1R1NA 3K6WA 2RC9A 4ESXA 2O69A 5F7VA 3VLWA 1R9QA 2UYFA 5AA3A 5K2YA 3AXFA 4XKNA 3MVWA 1HSLA 3OENA 3SEWA 2H25A 3T9UA 1MDQA 5I57B 1MRPA 2ALUA 4POXA 1B3FA 1Y9UA 3JYRA 4IY6A 3LR1A 3RY3A 1SW2A 2O6AA 3FUZA 3PMVA 3KFMA 3FVKA 3LUYA 4GF8A 2VD2A 1SI1A 3PUVE 1N7XA 4QFKA 1M5BA 2PVUA 1GVCA 1F9BA 5H8HB 3B6WA 1B3LA 4R9GA 4ZEKA 2ZMBA 3IX1A 4JXIA 1XVYA 3Q28A 2F6GA 4HW8A 1URGA 1H44A 3FV2A 4ECFA 3K6UA 4IB2A 3VVDA 3H6UA 3RUMA 4QF9A 4P0GA 4C0RA 3SESA 3U8QA 3SETA 3CG3A 2F7CA 2O1LA 3R26A 3TELA 5KCJA 2QSXA 1FQEA 5I58B 4H5GA 5I2KA 2B3BA 4LATA 1MPBA 2OLBA 4XIGQ 2H4IA 1URDA 2O84X 2Y7PA 4H67A 4RA1A 3FVNA 4YB5A 4RPOA 1IQ7A 1D4NA 5CM6A 4GL0A 3K01A 3O6HA 1FCKA 2ESNA 1MQGA 2DWAA 4ZEDA 4PE5B 3L6GA 3VE1B 4KHZE 2Q88A 5A5XB 3PUWE 2DYXA 4OHNA 3C9HA 3HV1A 1LCFA 4Q8RA 3DLNA 3LSXA 1XHYA 5DEXB 3TCGA 4NF4A 3KGCA 4I8CA 2Y84A 4G8MA 4ELPA 2F5XA 5BUUA 4QFNA 1OLCA 3O6IA 3TTNA 1JNFA 5DVFA 3MP8A 1ZKBA 1ELJA 1MH3A 1PEBA 2F35A 4DXCA 4F1YA 3S4UA 1UIUA 4F3BA 2RC8A 4ZE9A 4PFUA 3RT6B 3IOTA 5ICTA 3Q26A 4H65A 3W9WA 3N26A 5TPAB 5DVIA 1NFTA 1B3GA 4ESWA 4JDFA 1A8EA 1MS7A 1ZBMA 4NWCA 4AB6A 1TWYA 3IB0A 1JW4A 4LQ5A 3I5OA 1SVXB 1USYE 2QS3A 3PUYE 4U4XA 1M5DA 3CVGA 4JSOA 1RKMA 1RYXA 2ZYKA 4JWXA 1A8FA 2NWJA 2UXAA 1DOTA 1N84A 3H6WA 2DXRA 1NH7A 2Z8EA 1MH4A 3PPPA 3ILUB 3IB2A 3A3UA 4BDMA 3TTKA 1Q35A 3VDFA 3SEXA 4ELQA 2GFEA 5DVJA 2XXIA 4ELRA 3GBAA 1T0KA 5H8NB 1B7ZA 1ZJLA 2HAVA 4QFOA 3EF7A 1N7WA 5DTBA 2FNCA 3KOTA 1EH3A 1B46A 3G3IA 4NWDA 5DT6A 1N0TA 4OEVA 4U21A 1USYH 4O3AA 5I57A 2QS1A 2RINA 2QL3A 5CC2A 3MP6A 4DZ1A 4OEUA 2H99A 1VFDA 3FVGA 4EQBA 2DP8A 3KSXA 4DLDA 3FVOA 4JB7A 2PMSA 2HAUA 3MPLA 1JW1A 1FTMA 3K1MA 4Z0IA 2ANJA 3MZ9A 4NEDA 2V3QA 1IXGA 2GH9A 2P2AA 2HZKA 3KN7A 4XXUA 5TP9B 5CI5A 5H8HA 3QAXA 1WVJA 4KQPA 1MXYA 3H4ZA 3TKDA 5L9OA 1IZ1A 5L8DA 2HQ0A 4H5FA 3OO8A 1JEUA 2PBWA 1LLSA 2CZLA 4KFQA 1SW4A 2OBGA 1LFHA 4F3PA 1LB9A 4XTCQ 1BTJA 4GL8A 4N07A 4TLLB 2X26A 4N6PA 3CI8A 2F7AA 1IEJA 2I58A 4EXKA 5JEIA 3E13X 1SD3A 2F7BA 3F11A 4M1VA 3P7IA 4GQOA 4O3BA 2Z22A 2Z23A 2IEEA 1MPDA 3LSLA 1JEVA 1D9VA 5H8QB 1OQHA 5CMKA 1PBPA 5KDTB 2E1SA 1LBCA 1NL5A 3TFLA 1A40A 2QPQA 3V89B 3UP9A 1UQWA 3PPOA 3KJTA 4R6HA 1FQAA 3FXRA 4G2ZA 4MLQA 4YKPA 2ZYOA 2F78A 2Q2CA 5ICQA 2Q2AA 2FYIA 3CR9A 3UA8A 4QSDA 3FGSA 5ITOA 4DXUA 3O66A 1US5A 4U1ZA 3A09A 4DCYA 2D3IA 5DEXA 5JK4A 1S9TA 3CSBA 2QJEA 1S50A 3TEPA 3M3FA 5I59B 1URSA 5CMCA 3RLFE 3V8XB 3JV9A 4MBPA 3OMBA 2DE4A 2AYSA 1QJMA 2NXOA 5EYFA 3SERA 2RKMA 3S9EA 3VLVA 2VOZA 5TPAA 1MY2A 1M5CA 5CBRA 1GTKA 2R6GE 4L17A 2A5TB 1B9JA 4K3FA 5IKBA 4F39A 1NNTA 4GWOA 1PB9A 1MXVA 3TPAA 2A5SA 4LZ5A 1B32A 1A54A 4IGTA 5CRYA 3OEKA 4XKRA 3T9XB 3IJOB 1B5IA 1A55A 4NF8B 1B52A 2PX1A 4JWOA 4ZZAA 1I69A 2I3VA 1BLFA 4HTGA 5AA4A 4LQ2A 4P11A 2Y7WA 4PETA 3QXMA 3DP4A 4KYEA 1DPPA 2REGA 1OVTA 4OZ9A 3PPNA 5FTIA 4OFOA 4QHQA 3IO6A 3TTLA 3ZS6A 4MF3A 1YTVA 3LSWA 4F1UA 4YMAA 5HBCA 3GLBA 1Y1ZA 3FXQA 1DTZA 4FJPA 3VVFA 1IXCA 3B6QA 2UVIA 1MQJA 3V5AA 5FTHA 5IAIA 3IO4A 4E0WA 2DOJA 4RYAA 2I49A 3MP1A 4BDLA 1ZMGA 4FEDA 1B05A 2OZZA 1B1HA 2OWTA 3KEIA 4FEBA 3IORA 4IO3A 2ABHA 2DS9A 3RN8A 3CIJA 1D3KA 1FTOA 2HZLA 4JSDA 1UTHB 2Y7RA 4Q30B 1SI0A 3JZJA 1SDXA 4H8IA 3PV0E 3FXUA 4F3GA 3TQWA 3H6VA 2ONKE 4QSEA 3W15C 1I6QA 1Y3QA 1FQFA 3C4MA 3IOVA 4PQJA 4IGRA 2R71A 3IOWA 2DWJA 4F18A 3Q25A 3K4UA 1NNFA 4UACA 4LZ7A 3KN3A 3TTRA 4MFIA 1TT1A 1MY4A 3CG1A 1POY1 3O9PA 1OMPA 1B3EA 1AMFA 5H8QA 3HHFA 1AL3A 2NOOA 4TOZA 1PC3A 1H76A 4U2RA 2V3TA 3E4RA 4FECA 1J1NA 1LCTA 1FQCA 1Z7ME 4Z7EA 1ZLQA 4PFTA 2QMXA 1AH5A 1PB7A 3O29A 4ZECA 1SW1A 2UVHA 3IR1A 5B70A 4OYVA 2RCBA 3ECRA 2YLNA 2OK2A 1B40A 4NF6B 4BDQA 4ZS9A 3M8UA 1SQYA 4C1UA 4TLMB 1LSTA 3S9MC 2VGQA 3CSGA 5EHSA 1B1XA 1NKXA 4PFYA 1EZPA 1XOCA 5KZTA 4FORA 3GZGA 3CFZA 3U94A 3EN3A 1SYHA 2OWSA 4XKPA 2A5TA 3G3FA 1H45A 3LBSA 1R9LA 2WKYA 4FATA 5I2NA 3RT8A 1MQHA 2GHBA 4BDRA 2THIA 4U23A 1QKAA 4AQ4A 3MZBA 2OCUA 2XXVA 3OOAA 4YKIA 3FJGA 1SBPA 4GXSB 2I6EA 1GR2A 4X48A 1N76A 4NF8A 3K02A 3T22A 3KN8A 4X1DA 3M3KA 2QMWA 3BBRA 3FD3A 1YAEA 3H3GA 2AIXA 3CFXA 1FTJA 1H43A 3H6TA 1NNPA 3R6UA 4F19A 1SYIA 3R7XA 4R6YA 3T9HB 1DTGA 3O2AA 3MVXA 2VHAA 2O7IA 1XS5A 4R2BA 5H8FB 1FQBA 4OFJA 1B0HA 4KCDA 5BWJA 4IO2A 3K6VA 1OVBA 3UN6A 1FTLA 3B7DA 3FATA 4R72A 4KYSA 5H8SA 1QULA 2H98A 4G8HA 1Y4CA 4F2OA 1Q1KA 3MBPA 4R73A 1LAXA 3G3HA 3ZSFA 4ZEIA 4ZEBA 4OENA 4NMYA 4KD5A 4OMBA 4DIGA 4F22A 1P1WA 3B6TA 4GXAA 2OJTA 3DELB 3UORA 3FIRA 4R2FA 3PUXE 4F2QA 1XVXA 1EZ9A 2F36A 1AIVA 2F34A 3HO7A 1GV8A 3LC8A 3TUSA 4AB5A 4G8NA 3SEYA 1S7YA 3MQ9A 3TQLA 1BP5A 4KYDA 1LGBC 1MQIA 3PPRA 3MJNA 3V83A 1P1NA 5I58A 2V84A 4OVJA 2YPNA 4EXLA 2ONSA 4R6KA 3EHUA 1ATGA 2XHDA 3CRBA 3KSJA 4JBZA 1VFEA 4G68B 1HSEA 1CB6A 4I1DA 3RGYA 4EQ9A 3Q27A 1P99A 3H03A 2RC7A 4PP0A 1L5TA 5M2VA 3H7MA 1IXHA 2RF1A 4NTLA 2HFBA 3VLUA 1NH8A 1ZIUA 4HCYA 1OQGA 3BKIB 3FJ7A 2B3FA 4POWA 2XX8A 5A5XA 5AA2D 2RCAA 3D4GA 3ILTB 1MY0A 1ANFA 4YAHX 3A3CA 4NF5B 3PPQA 4OESA 2F6PA 3WAEA 2V25A 2QS4A 3ONMA 3TODA 1I6AA 2ZXTA 5AA1A 3O28A 4OERA 2Y7KA 3RTWB 4RNSA 4M4GA 4LONB 3HCQA 2DE2A 5ELVA 5EHMA 4NF6A 2AL5A 2I0CA 3O97A 2HXWA 4JWYA 4EDPA 1R6ZA 3OD7A 4OWDA 4YICA 1IITA 4GIZA 4EF1A 4IO4A 3PGFA 4O3CA 4TQUQ 3S9NC 5JTYB 3T96B 1WODA 3FV1A 3RPWA 1MY1A 2H5YA 2AL4A 2ONRA 5CMMA 3TTMA 3T93B 1B4HA 3TYHA 2HEUA 4R74A 3CFLA 1ZTYA 1YPNA 1A7LA 5TU0A 3HHGA 2ZYMA 3MVZA 1XT8A 1JETA 3EPEA 5K2XA 3GXAA 4I62A 1US4A 1UTBB 3C33A 4YKJA 1LAHE 5H8NA 3G3JA 4IY5A 5AE4A 3OELA 2D5WA 2O68A 3OSRA 3TAJA 3T9VA 4R9FA 1I6BA 4Q0CA 2ZNSA 3M3LA 1QW0A 2REJA 3C34A 3I3VA 3U1OA 2DVCA 1EU8A 2DSFA 5FHOA 2F97A 4MLVA 4RJZA 3C32A 2QS2A 2QRYA 4IO7A 4WXJA 1JVYA 2VP1A 3N94A 4KI0E 1N3XA 2F8DA 1B51A 1MY3A 5H8FA 1VE4A 1LB8A 4ZE8A 4RXLA 1ZU0A 1NNKA 1KWHA 4X9TA 3PUZE 2W7YA 1IXIA 3QK6A 3C35A 3T66A 4QRZA 3K1NA 4KCCA 5TP9A 1LFIA 3QUJA 2O1MA 1MXUA 4OFLA 4QSCA 3KBRA 4MH5A 3IAZA 3THIA 2ZNUA 2O7UA 1TFAA 1PDAA 2Q9TA 2X7QA 4N13A 3C36A 3USDA 1YCJA 1WDNA 2DVZA 2I48A 3RTFB 2G29A 4DDDA 1B0LA 3HPIA 1H3DA 4OQOA 2X7PA 4EF2A 4RK9A 3ZKLA 4R75A 3SEVA 1LBBA 3U92A 3HN0A 1PB8A 1OLAA 1QKBA 1MQDA 4X1BA 1RYOA 3UIFA 3MUQA 2Z8FA 1N04A 3K2DA 3MVYA 5I84A 1O63A 2DWIA 4KR5A 4YZZA 3VXCA 3U93A 1OIBA 1UIVA 3EQ1A 4U22A 1B6HA 3D4CA 2DWHA 4EQ7A 5B7DA 1FQDA 4GVOA 4G77A 4G68A 4PFWA 4ISUA 1JVXA 1Y3NA 3G7WA 5I56B 4RK2A 3UGWA 2R9JA 4ONYA 2XX9A 3L6HA 2XX7A 5KDTA
chains in the Genus database with same CATH superfamily
4OTEA 3K6XA 3TCHA 2HXRA 3FJMA 1Y20A 4F1VA 1CE2A 4LA9A 3TMGA 4H8JA 4UABA 3IFAA 4H6DA 2NVUB 5ISUA 2V4CA 2XD2A 2XXWA 4NE4A 2Y7IA 2FIEA 3N5LA 3OSQA 1SPIA 4OXVA 4N8GA 5I3SA 4GLIA 4XKQA 4NF5A 3SDFA 4OETA 4KXPA 1XI6A 2VPOA 4I9DA 2D21A 2I0BA 1EZOA 2LAOA 5I59A 1VSOA 1PBQA 2V3UA 4OANA 2UVJA 1DMBA 2XD3A 4X04A 2B65A 1DPEA 1MM6A 1M5EA 4UA8A 1JW5A 1JQFA 5DYHA 5AA2B 1AWBA 1IUDA 1D9YA 2ZYNA 3OXNA 3DP6A 5CBSA 2Q8JA 2V93A 2WX9A 1A99A 3C31A 4GRKA 5JTYA 2XXUA 3VXBA 4LZ8A 1MM7A 5J16A 1QUKA 3MWBA 3G3GA 3N6UA 1IMFA 1MXXA 2DQVA 1AOVA 3QYTA 3E78A 3KZGA 5ITPA 1FTKA 5EYGA 3OEMA 4LVQA 5FHNA 1LAFE 1HSJA 4WKMA 2I4BA 3D1RA 3S9LC 3SZPA 4IO6A 3K1PA 1SW5A 4GBVA 3RQTA 3EHSA 5AA4B 2M8CA 4YB7A 1INPA 3A29A 1B7UA 4EUOA 4YMBA 1XC1A 4MHFA 1FW0A 1MDP1 3MYUA 1UTBA 4G68C 2ZNTA 4MEVA 3IB1A 2G93A 1B7HA 4RPNA 1Y3PA 4WEDA 3GBBA 2Q8MA 2UVGA 4IO5A 1TFDA 4F29A 4DCXA 2BJJX 4PBHA 2PT2A 3GYYA 3EHTA 2KLFA 3KG2A 1O7TA 3WAFA 5T3JA 2BJIA 1VR5A 3IJXB 4DE8A 1NV3A 3MZ1A 4QFLA 1NMUA 2XXYA 3QIMA 4THIA 1NV6A 4ZZEA 1DSNA 2FA7A 5L9SA 3ODBA 3G3KA 2O51A 3PMWA 3K00A 3E3KA 4AS4A 1FPDA 3MAMA 1UTHA 3VVEA 4HS7A 2P1SA 3PD9A 3IL1B 5L9MA 4PF8A 3ISPA 1LBWA 3TCFA 4U1OA 3SEUA 4BDNA 1B5JA 4ELOA 2XXHA 3K0VA 5KCJB 3QUFA 1Y4TA 2YJPA 4HE2A 2Z8DA 4H1XA 4BDOA 4MNIA 5I2KB 3TDJA 1GGGA 3Q29A 1QUIA 4F31B 3HSTA 4NQ8A 3ZKKA 4NN3A 2XXQA 3BFTA 4O8MA 4QBAA 3SKPA 4FE8A 3RNNA 4GX3A 3FASA 5ESYA 2GRVA 1FPJA 1TXFA 4OVPA 2Q89A 4DXBA 1B5HA 4FIMA 4MAGA 3E9XA 5HM4B 3OO7A 3TZAA 3PU5A 1BIYA 3W9VA 4G61A 3VFJA 2CMOA 1II5A 4LP2B 1MPCA 4Q5TA 1B2HA 4GD5A 2XWVA 1MXZA 5I56A 4ZDMA 1Y1MA 1LBZA 4PAIA 2VD3A 1N3WA 4KPTA 1Z7NE 2XXRA 4MMPA 3DP8A 5FHMA 4GWZA 4NF4B 4P0IA 2GHAA 3KOSA 2XXPA 2HHMA 4OVQA 2IA4A 1P1UA 4MJOA 4GOTA 2Y5KA 3BFUA 2OX3A 3IOUA 4ND9A 3LSFB 5F1QA 2NUVA 2PYYA 4OVRA 4H0WA 4PDDA 3N6TA 3QSLA 1IIWA 1O64A 4E0XA 5J1DA 2I4CA 3OO9A 4HCWA 1P1QA 5LOMA 3VV5A 4YB6A 3PD8A 4QFPA 2F3BA 1B3HA 3UK4A 3PMXA 1MG1A 2UYEA 2I3WA 1FJ6A 4P8BA 1FPFA 3DM0A 1B58A 5HPQA 1MXWA 3MSTA 2XXTA 4NG7A 4YKKA 3IK6B 2DXYA 4FBPA 4G4PA 3FBPA 4X8RA 3MW0A 4RY1A 1P1OA 2PT1A 5AA2A 4GFRA 4F3SA 3KJ7A 1B4ZA 2HCAA 1K9ZA 2H9BA 3H06B 1BKAA 1QVSA 4YU0A 4BLAA 4C1TA 3I6VA 5I2NB 2DE3A 2P0SA 4AS5A 2XXXA 1QUJA 1LFGA 3MC2A 4FAJA 3U72A 1POTA 4WEPA 3MPKA 3O6GA 1LAGE 4U4SA 1M5FA 2E0SA 5CMBA 3S2VA 3OO6A 3FZVA 1NV2A 4LUBA 4ZEFA 1R1NA 3K6WA 2RC9A 4ESXA 2O69A 2HPGA 4GBWA 2WBBA 5F7VA 3VLWA 1R9QA 3B50A 2UYFA 5AA3A 5K2YA 3AXFA 4N6KA 3MVWA 4XKNA 1HSLA 4I3YA 3OENA 3SEWA 2H25A 3T9UA 1MDQA 5I57B 2ZZVA 1MRPA 4O7IA 2ALUA 4POXA 1B3FA 2CEXA 4DI4B 1Y9UA 3JYRA 4IY6A 1IMDA 3LR1A 4HXVA 3RY3A 2XWIA 4MNCA 4XF5A 2GQ1A 1SW2A 2O6AA 4PGPA 3FUZA 3PMVA 3KFMA 3FVKA 3LUYA 4GF8A 2CZHA 2VD2A 1SI1A 3PUVE 1N7XA 2XXKA 4QFKA 1M5BA 2PVUA 1GVCA 3CHGA 1F9BA 5H8HB 3B6WA 1B3LA 4R9GA 5EQ8A 4P47A 1BK4A 4ZEKA 2ZMBA 3IX1A 4JXIA 1XVYA 3Q28A 2F6GA 3IFCA 1FBHA 1URGA 4HW8A 1H44A 3FV2A 4HE0A 4ECFA 3K6UA 4HE1A 4IB2A 3VVDA 2WBDA 3H6UA 4N17A 2KQZA 3RUMA 5IM2A 4QF9A 4P0GA 4C0RA 3SESA 3U8QA 3SETA 3CG3A 2F7CA 2O1LA 3R26A 3TELA 5KCJA 2QSXA 2XWKA 1FQEA 1KA1A 1K9YA 4H45A 5I58B 4H5GA 5I2KA 2B3BA 4NF0A 4LATA 1MPBA 2OLBA 4XIGQ 2H4IA 1URDA 2O84X 2Y7PA 4H67A 4RA1A 2P3NA 3FVNA 4YB5A 4RPOA 1IQ7A 1D4NA 5CM6A 4GL0A 3K01A 3O6HA 3FXBA 3ROJA 1NV1A 1FCKA 2ESNA 5EQAA 1MQGA 2DWAA 4ZEDA 4PE5B 3L6GA 3VE1B 4KHZE 2Q88A 5A5XB 3PUWE 2DYXA 4OHNA 3C9HA 3HV1A 1KA0A 1LCFA 4Q8RA 3DLNA 4P1EA 4XFEA 3LSXA 1XHYA 2OWZA 4NGUA 5DEXB 3TCGA 4NF4A 2ZZWA 3KGCA 4I8CA 2Y84A 4G8MA 4ELPA 2F5XA 5BUUA 4QFNA 1OLCA 3O6IA 2WYPA 3TTNA 1JNFA 5DVFA 3MP8A 1ZKBA 1ELJA 1MH3A 1PEBA 2F35A 4GWWA 1NV5A 4DXCA 4F1YA 3S4UA 4P3LA 1UIUA 4F3BA 2RC8A 4ZE9A 2WEFA 4GX4A 4PFUA 3RT6B 3IOTA 5ICTA 3Q26A 4H65A 3W9WA 3N26A 5A5LA 5TPAB 5DVIA 1NFTA 1B3GA 4ESWA 4JDFA 1A8EA 1MS7A 1ZBMA 4NWCA 4AB6A 1TWYA 3IB0A 1JW4A 4LQ5A 3I5OA 1SVXB 1USYE 2QS3A 3PUYE 4U4XA 1M5DA 3CVGA 4JSOA 1RKMA 1RYXA 2ZYKA 4JWXA 4JVCA 3RPLB 1A8FA 2NWJA 2UXAA 1DOTA 1N84A 3H6WA 2CZKA 2DXRA 2B4LA 1NH7A 2Z8EA 1MH4A 3PPPA 3ILUB 3IB2A 3A3UA 4PFIA 4BDMA 1G0IA 3TTKA 1Q35A 3VDFA 4QXDA 3SEXA 3T0JA 4ELQA 5LDZA 2GFEA 5DVJA 3RYDA 2XXIA 4ELRA 2QVRA 3GBAA 1T0KA 5H8NB 1B7ZA 1ZJLA 2HAVA 4QFOA 4PGNA 3EF7A 1N7WA 5DTBA 1YZ0A 2FNCA 3KOTA 2JJKA 1EH3A 1B46A 3G3IA 4NWDA 5DT6A 1N0TA 1FPLA 4OEVA 4U21A 1USYH 4O3AA 5I57A 2QS1A 2RINA 2QL3A 5CC2A 4PAKA 3MP6A 4DZ1A 4OEUA 2H99A 2FVZA 1VFDA 3FVGA 4EQBA 2DP8A 3KSXA 4DLDA 3FVOA 4JB7A 2PMSA 2HAUA 3MPLA 1JW1A 1FTMA 1LBXA 3K1MA 4Z0IA 2ANJA 3MZ9A 4NEDA 2V3QA 1IXGA 2GH9A 2P2AA 2HZKA 3KN7A 4XXUA 5TP9B 5CI5A 5H8HA 3QAXA 1FTAA 1WVJA 4KQPA 1MXYA 1YXIA 3H4ZA 3TKDA 5L9OA 1IZ1A 5L8DA 2HQ0A 4H5FA 3OO8A 1JEUA 2PBWA 3KC0A 1LLSA 2CZLA 4KFQA 1SW4A 2OBGA 5IZ3B 4N4UA 1LFHA 4F3PA 1LB9A 4XTCQ 1BTJA 4GL8A 4N07A 1FPIA 4GX6A 4TLLB 3BIHA 2X26A 4N6PA 3CI8A 2F7AA 1IEJA 2B4MA 2I58A 4EXKA 5JEIA 3E13X 1SD3A 2F7BA 3F11A 4M1VA 4OVTA 3P7IA 4GQOA 4O3BA 2Z22A 3LV0A 2Z23A 2IEEA 1MPDA 3LSLA 1QGXA 1JEVA 1D9VA 5H8QB 3U65A 1OQHA 5CMKA 1PBPA 5KDTB 2E1SA 1LBCA 1NL5A 3TFLA 1D9QA 1A40A 2QPQA 3V89B 3UP9A 1UQWA 3PPOA 3KJTA 4R6HA 1FQAA 3FXRA 4G2ZA 2Y5LA 1FPBA 4MLQA 4YKPA 2ZYOA 2F78A 2Q2CA 3B8BA 5ICQA 2Q2AA 2FYIA 3CR9A 3UA8A 4QSDA 3FGSA 5ITOA 4DXUA 3O66A 1US5A 4U1ZA 3A09A 4DCYA 2D3IA 5DEXA 2L5VA 2VPNA 5JK4A 1S9TA 2XWOA 3CSBA 2QJEA 1S50A 3TEPA 1Q9DA 1VDWA 3M3FA 5I59B 1URSA 5CMCA 3RLFE 3V8XB 3JV9A 4MBPA 3OMBA 1DCUA 3HFUA 2DE4A 2AYSA 1LBYA 1QJMA 5IGAA 2NXOA 5EYFA 3SERA 2RKMA 5I7IA 3S9EA 3VLVA 2VOZA 5TPAA 1MY2A 1M5CA 4LN5A 5CBRA 1GTKA 2R6GE 4L17A 2A5TB 1B9JA 4K3FA 5IKBA 4F39A 1NNTA 4GWOA 1PB9A 1MXVA 3TPAA 2A5SA 4LZ5A 3RPLA 2DDKA 1B32A 1A54A 4IGTA 3BIGA 5CRYA 3OEKA 4XKRA 3T9XB 3IJOB 1B5IA 1A55A 4NF8B 1B52A 2PX1A 4JWOA 4ZZAA 5EQ7A 1I69A 2I3VA 1BLFA 4HTGA 5AA4A 4LQ2A 4P11A 2Y7WA 4PETA 3QXMA 2QVVA 3DP4A 4KYEA 1RDZA 1RDYA 1DPPA 2REGA 1OVTA 4OZ9A 3PPNA 5FTIA 4OFOA 4PAFA 4QHQA 3IO6A 3TTLA 3ZS6A 4MF3A 1YTVA 3LSWA 4F1UA 4YMAA 1DK4A 5HBCA 3GLBA 4N91A 1Y1ZA 3FXQA 1DTZA 4FJPA 3VVFA 1IXCA 3B6QA 2UVIA 1MQJA 4PCDA 3V5AA 5FTHA 5IAIA 3IO4A 4E0WA 2DOJA 4RYAA 2I49A 1G0HA 3MP1A 4BDLA 1ZMGA 1FPKA 4FEDA 1B05A 2OZZA 5ET5A 1B1HA 1FSAA 2OWTA 3KEIA 4FEBA 3IORA 4IO3A 2ABHA 2DS9A 3RN8A 3CIJA 1D3KA 1FTOA 2HZLA 3E79A 1NI9A 4JSDA 1UTHB 2Y7RA 4Q30B 1SI0A 3JZJA 4MIJA 1SDXA 4H8IA 1JP4A 3PV0E 4PFBA 4OVSA 4O7MA 3FXUA 4F3GA 3TQWA 3H6VA 1NUWA 2ONKE 4QSEA 3W15C 4MX6A 1I6QA 1Y3QA 1FQFA 3C4MA 4XEQA 3IOVA 5IZ3A 5ET8A 1IMAA 5DW8A 4PQJA 4IGRA 2R71A 3IOWA 2DWJA 4F18A 3Q25A 3K4UA 1NNFA 4I3EA 4UACA 4LZ7A 2KR0A 3KN3A 1IMBA 3TTRA 4MFIA 1TT1A 1MY4A 3CG1A 1POY1 3O9PA 1OMPA 1B3EA 1AMFA 4I40A 5H8QA 3HHFA 1AL3A 2NOOA 4TOZA 1PC3A 1H76A 4U2RA 2V3TA 3E4RA 4FECA 1J1NA 4P56A 1LCTA 1FQCA 1Z7ME 4Z7EA 1ZLQA 4PFTA 2QMXA 4GWYA 1AH5A 1PB7A 4H46A 4O94A 3O29A 4ZECA 1SW1A 2UVHA 3IR1A 5B70A 4OYVA 2RCBA 4PDHA 3ECRA 2YLNA 2OK2A 1B40A 4NF6B 4P9KA 1FRPA 4BDQA 3M8UA 4ZS9A 1SQYA 4NX1A 4C1UA 4TLMB 1LSTA 4GWSA 2F3DA 3S9MC 2VGQA 3CSGA 5EHSA 1B1XA 1NKXA 4NAPA 2PFYA 4PFYA 1EZPA 3KC1A 1XOCA 5KZTA 4FORA 4MNPA 3GZGA 3CFZA 3LUZA 3U94A 3EN3A 1SYHA 2OWSA 1FBFA 1IMEA 4XKPA 2A5TA 3G3FA 1H45A 3LBSA 1R9LA 1NV0A 2WKYA 4N6DA 4FATA 5I2NA 3RT8A 1MQHA 4N15A 2GHBA 4BDRA 2THIA 4N8YA 4U23A 1QKAA 4AQ4A 3MZBA 2OCUA 2XXVA 3OOAA 4YKIA 3FJGA 1SBPA 4GXSB 2I6EA 1GR2A 4X48A 5F24A 1N76A 4NF8A 3K02A 3KN8A 3T22A 4X1DA 3M3KA 2QMWA 3BBRA 3FD3A 1YAEA 3H3GA 2AIXA 3CFXA 1FTJA 1H43A 2ZZXA 2MKZA 3H6TA 1NNPA 3R6UA 1FBCA 1SYIA 4F19A 3R7XA 4R6YA 3T9HB 1DTGA 4PTKA 3O2AA 3MVXA 2VHAA 2O7IA 1XS5A 4PC9A 4R2BA 5H8FB 1FQBA 4OFJA 2FBPA 4DI3D 1B0HA 4KCDA 2PCRA 5BWJA 4IO2A 3K6VA 1OVBA 3UN6A 1FTLA 3B7DA 3FATA 4R72A 4KYSA 5IZZA 5H8SA 1QULA 2H98A 4P1LA 4G8HA 1Y4CA 2XA5A 3KBZA 5ET7A 4F2OA 1Q1KA 3MBPA 4MCOA 4R73A 1LAXA 1FBDA 3G3HA 3ZSFA 4ZEIA 4ZEBA 4OENA 4NMYA 5EQ9A 4KD5A 4OMBA 4DIGA 4F22A 1P1WA 3B6TA 4GXAA 2OJTA 3DELB 3UORA 3FIRA 4R2FA 3PUXE 4F2QA 1XVXA 1NV7A 1DBZA 1EZ9A 2F36A 1AIVA 2WYKA 2F34A 3HO7A 1GV8A 3LC8A 3TUSA 4AB5A 4G8NA 5I5PA 3SEYA 1S7YA 3MQ9A 3TQLA 3T1BA 1BP5A 4KYDA 1LGBC 1MQIA 3PPRA 3MJNA 3V83A 1P1NA 1EYKA 5I58A 2V84A 4OVJA 2YPNA 4PFRA 4EXLA 4OA4A 2ONSA 4R6KA 2PFZA 3EHUA 1ATGA 2XHDA 3CRBA 3KSJA 4JBZA 1VFEA 4G68B 1HSEA 1CB6A 4I1DA 3RGYA 1FPGA 2CEYA 4EQ9A 3Q27A 1P99A 2P3VA 4GWUA 1CNQA 3H03A 2RC7A 3EKIA 4PBQA 4PP0A 1L5TA 5M2VA 2FIXA 3H7MA 1IXHA 2RF1A 4NTLA 1NUYA 2HFBA 3VLUA 1NH8A 1KZ8A 1ZIUA 4HCYA 1OQGA 3BKIB 3FJ7A 2B3FA 4POWA 2XX8A 5A5XA 5AA2D 2RCAA 3D4GA 1FBPA 3ILTB 5FBPA 1MY0A 3NOHA 1ANFA 4JVDA 4YAHX 3A3CA 4NF5B 3PPQA 4OESA 4JVIA 2F6PA 3WAEA 2V25A 2QS4A 3ONMA 3TODA 1I6AA 2ZXTA 5AA1A 3O28A 4OERA 2Y7KA 3RTWB 2FHYA 4RNSA 4IR8A 4M4GA 4LONB 3HCQA 4NHBA 2DE2A 5ELVA 1FJ9A 5EHMA 4NF6A 4GWXA 2AL5A 2I0CA 3O97A 2HXWA 4JWYA 4EDPA 1R6ZA 3OD7A 4OWDA 4YICA 1IITA 4GIZA 1YYZA 4EF1A 4IO4A 3PGFA 1EYJA 4O3CA 4TQUQ 3S9NC 5JTYB 3T96B 1WODA 3FV1A 3RPWA 1MY1A 3PTYA 2H5YA 2AL4A 2ONRA 5CMMA 2CZIA 1FBEA 3TTMA 3T93B 1B4HA 2R8TA 3TYHA 2HEUA 4R74A 3CFLA 1ZTYA 1YPNA 1A7LA 5TU0A 3HHGA 2ZYMA 3QMFA 3MVZA 1XT8A 1JETA 3EPEA 5K2XA 1IMCA 1FBGA 3GXAA 4I62A 1US4A 1UTBB 3C33A 4YKJA 1LAHE 5H8NA 3G3JA 4IY5A 5AE4A 3OELA 2D5WA 4PF6A 2O68A 3OSRA 4PE3A 2VT5A 5EYHA 3TAJA 3T9VA 4R9FA 1I6BA 4Q0CA 2ZNSA 3M3LA 1QW0A 2REJA 3C34A 3I3VA 3U1OA 2DVCA 1EYIA 1EU8A 2DSFA 5FHOA 2F97A 5LTCA 4MLVA 4RJZA 3C32A 2QS2A 2QRYA 4IO7A 1JVYA 2VP1A 3N94A 4WXJA 4KI0E 1N3XA 2F8DA 1B51A 1MY3A 5H8FA 1VE4A 1LB8A 4ZE8A 4RXLA 1ZU0A 1NNKA 1KWHA 4X9TA 3PUZE 2W7YA 1IXIA 3QK6A 5ET6A 3C35A 2Q74A 3T66A 4QRZA 3K1NA 4KCCA 5TP9A 1LFIA 3QUJA 2O1MA 1MXUA 4OFLA 4QSCA 3KBRA 4MH5A 3IAZA 3THIA 2ZNUA 2O7UA 1TFAA 1PDAA 2Q9TA 2X7QA 4N13A 3C36A 3USDA 1YCJA 1WDNA 2DVZA 2I48A 3RTFB 2G29A 4DDDA 1B0LA 3HPIA 1H3DA 4OQOA 2X7PA 4EF2A 4RK9A 3ZKLA 4R75A 3SEVA 1LBBA 3U92A 3HN0A 1PB8A 1NV4A 1OLAA 1QKBA 1MQDA 4X1BA 1RYOA 3UIFA 3MUQA 1NUXA 2Z8FA 1N04A 3K2DA 3MVYA 2QVUA 5I84A 1O63A 2DWIA 4KR5A 1NUZA 4N81A 4YZZA 3VXCA 1OIBA 1UIVA 3EQ1A 5IZ1A 3U93A 4U22A 1B6HA 3D4CA 2DWHA 4EQ7A 1LEVA 1FQDA 5B7DA 2QFLA 4GVOA 4G77A 4G68A 4PFWA 4ISUA 1FPEA 1JVXA 1Y3NA 3G7WA 5I56B 4RK2A 3UGWA 2R9JA 4ONYA 2XX9A 1RDXA 3L6HA 2XX7A 5KDTA 1LBVA
chains in the Genus database with same CATH topology
4OTEA 3K6XA 3TCHA 3FJMA 1Y20A 4F1VA 1CE2A 4LA9A 3TMGA 4H8JA 4H6DA 2NVUB 5ISUA 2XD2A 2XXWA 4NE4A 2Y7IA 3N5LA 3OSQA 4OXVA 4GLIA 4XKQA 4NF5A 3SDFA 4OETA 4I9DA 2D21A 2I0BA 1EZOA 2LAOA 5I59A 1VSOA 1PBQA 2V3UA 2UVJA 1DMBA 2XD3A 2B65A 1DPEA 1MM6A 1M5EA 4UA8A 1JW5A 1JQFA 5DYHA 5AA2B 1IUDA 1D9YA 2ZYNA 3OXNA 3DP6A 5CBSA 2Q8JA 2V93A 1A99A 3C31A 4GRKA 5JTYA 2XXUA 3VXBA 4LZ8A 1MM7A 1QUKA 3MWBA 3G3GA 3N6UA 1MXXA 2DQVA 1AOVA 3QYTA 3KZGA 5ITPA 1FTKA 3OEMA 4LVQA 5FHNA 1LAFE 1HSJA 4WKMA 2I4BA 3S9LC 4IO6A 3K1PA 1SW5A 3RQTA 3EHSA 5AA4B 2M8CA 4YB7A 1B7UA 4EUOA 4YMBA 1XC1A 1FW0A 1MDP1 1UTBA 4G68C 2ZNTA 3IB1A 2G93A 1B7HA 4RPNA 1Y3PA 4WEDA 3GBBA 2UVGA 4IO5A 1TFDA 4F29A 4DCXA 2BJJX 2PT2A 3EHTA 2KLFA 3KG2A 1O7TA 3WAFA 1VR5A 3IJXB 4DE8A 3MZ1A 4QFLA 1NMUA 2XXYA 3QIMA 4THIA 4ZZEA 1DSNA 2FA7A 5L9SA 3ODBA 3G3KA 2O51A 3PMWA 3K00A 3E3KA 3MAMA 1UTHA 3VVEA 4HS7A 5L9MA 2P1SA 3PD9A 3IL1B 3TCFA 4U1OA 3SEUA 4BDNA 1B5JA 4ELOA 2XXHA 3K0VA 5KCJB 3QUFA 1Y4TA 2YJPA 2Z8DA 4H1XA 4BDOA 5I2KB 3TDJA 1GGGA 3Q29A 1QUIA 4F31B 3HSTA 3ZKKA 2XXQA 3BFTA 3SKPA 4FE8A 3RNNA 3FASA 2GRVA 1TXFA 2Q89A 4DXBA 1B5HA 4FIMA 3E9XA 5HM4B 3OO7A 3TZAA 3PU5A 1BIYA 3W9VA 3VFJA 2CMOA 1II5A 4LP2B 1MPCA 4Q5TA 1B2HA 4GD5A 1MXZA 5I56A 4ZDMA 1Y1MA 2VD3A 1N3WA 4KPTA 1Z7NE 2XXRA 3DP8A 5FHMA 4NF4B 4P0IA 2GHAA 3KOSA 2XXPA 2IA4A 1P1UA 4GOTA 3BFUA 3IOUA 4ND9A 3LSFB 5F1QA 2NUVA 2PYYA 4H0WA 3N6TA 3QSLA 1IIWA 1O64A 4E0XA 5J1DA 2I4CA 3OO9A 4HCWA 1P1QA 5LOMA 3VV5A 4YB6A 3PD8A 4QFPA 3UK4A 1B3HA 3PMXA 1MG1A 2UYEA 2I3WA 3DM0A 1B58A 5HPQA 1MXWA 2XXTA 4YKKA 3IK6B 2DXYA 4G4PA 3MW0A 5AA2A 4RY1A 1P1OA 2PT1A 4GFRA 4F3SA 3KJ7A 1B4ZA 2HCAA 2H9BA 3H06B 1BKAA 1QVSA 4YU0A 4BLAA 4C1TA 3I6VA 5I2NB 2DE3A 2P0SA 2XXXA 1QUJA 1LFGA 3MC2A 4FAJA 3U72A 1POTA 4WEPA 3MPKA 3O6GA 1LAGE 4U4SA 3S2VA 1M5FA 2E0SA 5CMBA 3OO6A 3FZVA 4LUBA 4ZEFA 1R1NA 3K6WA 2RC9A 4ESXA 2O69A 5F7VA 3VLWA 1R9QA 2UYFA 5AA3A 5K2YA 3AXFA 4XKNA 3MVWA 1HSLA 3OENA 3SEWA 2H25A 3T9UA 1MDQA 5I57B 1MRPA 2ALUA 4POXA 1B3FA 1Y9UA 3JYRA 4IY6A 3LR1A 3RY3A 1SW2A 2O6AA 3FUZA 3PMVA 3KFMA 3FVKA 3LUYA 4GF8A 2VD2A 1SI1A 3PUVE 1N7XA 4QFKA 1M5BA 2PVUA 1GVCA 1F9BA 5H8HB 3B6WA 1B3LA 4R9GA 4ZEKA 2ZMBA 3IX1A 4JXIA 1XVYA 3Q28A 2F6GA 4HW8A 1URGA 1H44A 3FV2A 4ECFA 3K6UA 4IB2A 3VVDA 3H6UA 3RUMA 4QF9A 4P0GA 4C0RA 3SESA 3U8QA 3SETA 3CG3A 2F7CA 2O1LA 3R26A 3TELA 5KCJA 2QSXA 1FQEA 5I58B 4H5GA 5I2KA 2B3BA 4LATA 1MPBA 2OLBA 4XIGQ 2H4IA 1URDA 2O84X 2Y7PA 4H67A 4RA1A 3FVNA 4YB5A 4RPOA 1IQ7A 1D4NA 5CM6A 4GL0A 3K01A 3O6HA 1FCKA 2ESNA 1MQGA 2DWAA 4ZEDA 4PE5B 3L6GA 3VE1B 4KHZE 2Q88A 5A5XB 3PUWE 2DYXA 4OHNA 3C9HA 3HV1A 1LCFA 4Q8RA 3DLNA 3LSXA 1XHYA 5DEXB 3TCGA 4NF4A 3KGCA 4I8CA 2Y84A 4G8MA 4ELPA 2F5XA 5BUUA 4QFNA 1OLCA 3O6IA 3TTNA 1JNFA 5DVFA 3MP8A 1ZKBA 1ELJA 1MH3A 1PEBA 2F35A 4DXCA 4F1YA 3S4UA 1UIUA 4F3BA 2RC8A 4ZE9A 4PFUA 3RT6B 3IOTA 5ICTA 3Q26A 4H65A 3W9WA 3N26A 5TPAB 5DVIA 1NFTA 1B3GA 4ESWA 4JDFA 1A8EA 1MS7A 1ZBMA 4NWCA 4AB6A 1TWYA 3IB0A 1JW4A 4LQ5A 3I5OA 1SVXB 1USYE 2QS3A 3PUYE 4U4XA 1M5DA 3CVGA 4JSOA 1RKMA 1RYXA 2ZYKA 4JWXA 1A8FA 2NWJA 2UXAA 1DOTA 1N84A 3H6WA 2DXRA 1NH7A 2Z8EA 1MH4A 3PPPA 3ILUB 3IB2A 3A3UA 4BDMA 3TTKA 1Q35A 3VDFA 3SEXA 4ELQA 2GFEA 5DVJA 2XXIA 4ELRA 3GBAA 1T0KA 5H8NB 1B7ZA 1ZJLA 2HAVA 4QFOA 3EF7A 1N7WA 5DTBA 2FNCA 3KOTA 1EH3A 1B46A 3G3IA 4NWDA 5DT6A 1N0TA 4OEVA 4U21A 1USYH 4O3AA 5I57A 2QS1A 2RINA 2QL3A 5CC2A 3MP6A 4DZ1A 4OEUA 2H99A 1VFDA 3FVGA 4EQBA 2DP8A 3KSXA 4DLDA 3FVOA 4JB7A 2PMSA 2HAUA 3MPLA 1JW1A 1FTMA 3K1MA 4Z0IA 2ANJA 3MZ9A 4NEDA 2V3QA 1IXGA 2GH9A 2P2AA 2HZKA 3KN7A 4XXUA 5TP9B 5CI5A 5H8HA 3QAXA 1WVJA 4KQPA 1MXYA 3H4ZA 3TKDA 5L9OA 1IZ1A 5L8DA 2HQ0A 4H5FA 3OO8A 1JEUA 2PBWA 1LLSA 2CZLA 4KFQA 1SW4A 2OBGA 1LFHA 4F3PA 1LB9A 4XTCQ 1BTJA 4GL8A 4N07A 4TLLB 2X26A 4N6PA 3CI8A 2F7AA 1IEJA 2I58A 4EXKA 5JEIA 3E13X 1SD3A 2F7BA 3F11A 4M1VA 3P7IA 4GQOA 4O3BA 2Z22A 2Z23A 2IEEA 1MPDA 3LSLA 1JEVA 1D9VA 5H8QB 1OQHA 5CMKA 1PBPA 5KDTB 2E1SA 1LBCA 1NL5A 3TFLA 1A40A 2QPQA 3V89B 3UP9A 1UQWA 3PPOA 3KJTA 4R6HA 1FQAA 3FXRA 4G2ZA 4MLQA 4YKPA 2ZYOA 2F78A 2Q2CA 5ICQA 2Q2AA 2FYIA 3CR9A 3UA8A 4QSDA 3FGSA 5ITOA 4DXUA 3O66A 1US5A 4U1ZA 3A09A 4DCYA 2D3IA 5DEXA 5JK4A 1S9TA 3CSBA 2QJEA 1S50A 3TEPA 3M3FA 5I59B 1URSA 5CMCA 3RLFE 3V8XB 3JV9A 4MBPA 3OMBA 2DE4A 2AYSA 1QJMA 2NXOA 5EYFA 3SERA 2RKMA 3S9EA 3VLVA 2VOZA 5TPAA 1MY2A 1M5CA 5CBRA 1GTKA 2R6GE 4L17A 2A5TB 1B9JA 4K3FA 5IKBA 4F39A 1NNTA 4GWOA 1PB9A 1MXVA 3TPAA 2A5SA 4LZ5A 1B32A 1A54A 4IGTA 5CRYA 3OEKA 4XKRA 3T9XB 3IJOB 1B5IA 1A55A 4NF8B 1B52A 2PX1A 4JWOA 4ZZAA 1I69A 2I3VA 1BLFA 4HTGA 5AA4A 4LQ2A 4P11A 2Y7WA 4PETA 3QXMA 3DP4A 4KYEA 1DPPA 2REGA 1OVTA 4OZ9A 3PPNA 5FTIA 4OFOA 4QHQA 3IO6A 3TTLA 3ZS6A 4MF3A 1YTVA 3LSWA 4F1UA 4YMAA 5HBCA 3GLBA 1Y1ZA 3FXQA 1DTZA 4FJPA 3VVFA 1IXCA 3B6QA 2UVIA 1MQJA 3V5AA 5FTHA 5IAIA 3IO4A 4E0WA 2DOJA 4RYAA 2I49A 3MP1A 4BDLA 1ZMGA 4FEDA 1B05A 2OZZA 1B1HA 2OWTA 3KEIA 4FEBA 3IORA 4IO3A 2ABHA 2DS9A 3RN8A 3CIJA 1D3KA 1FTOA 2HZLA 4JSDA 1UTHB 2Y7RA 4Q30B 1SI0A 3JZJA 1SDXA 4H8IA 3PV0E 3FXUA 4F3GA 3TQWA 3H6VA 2ONKE 4QSEA 3W15C 1I6QA 1Y3QA 1FQFA 3C4MA 3IOVA 4PQJA 4IGRA 2R71A 3IOWA 2DWJA 4F18A 3Q25A 3K4UA 1NNFA 4UACA 4LZ7A 3KN3A 3TTRA 4MFIA 1TT1A 1MY4A 3CG1A 1POY1 3O9PA 1OMPA 1B3EA 1AMFA 5H8QA 3HHFA 1AL3A 2NOOA 4TOZA 1PC3A 1H76A 4U2RA 2V3TA 3E4RA 4FECA 1J1NA 1LCTA 1FQCA 1Z7ME 4Z7EA 1ZLQA 4PFTA 2QMXA 1AH5A 1PB7A 3O29A 4ZECA 1SW1A 2UVHA 3IR1A 5B70A 4OYVA 2RCBA 3ECRA 2YLNA 2OK2A 1B40A 4NF6B 4BDQA 4ZS9A 3M8UA 1SQYA 4C1UA 4TLMB 1LSTA 3S9MC 2VGQA 3CSGA 5EHSA 1B1XA 1NKXA 4PFYA 1EZPA 1XOCA 5KZTA 4FORA 3GZGA 3CFZA 3U94A 3EN3A 1SYHA 2OWSA 4XKPA 2A5TA 3G3FA 1H45A 3LBSA 1R9LA 2WKYA 4FATA 5I2NA 3RT8A 1MQHA 2GHBA 4BDRA 2THIA 4U23A 1QKAA 4AQ4A 3MZBA 2OCUA 2XXVA 3OOAA 4YKIA 3FJGA 1SBPA 4GXSB 2I6EA 1GR2A 4X48A 1N76A 4NF8A 3K02A 3T22A 3KN8A 4X1DA 3M3KA 2QMWA 3BBRA 3FD3A 1YAEA 3H3GA 2AIXA 3CFXA 1FTJA 1H43A 3H6TA 1NNPA 3R6UA 4F19A 1SYIA 3R7XA 4R6YA 3T9HB 1DTGA 3O2AA 3MVXA 2VHAA 2O7IA 1XS5A 4R2BA 5H8FB 1FQBA 4OFJA 1B0HA 4KCDA 5BWJA 4IO2A 3K6VA 1OVBA 3UN6A 1FTLA 3B7DA 3FATA 4R72A 4KYSA 5H8SA 1QULA 2H98A 4G8HA 1Y4CA 4F2OA 1Q1KA 3MBPA 4R73A 1LAXA 3G3HA 3ZSFA 4ZEIA 4ZEBA 4OENA 4NMYA 4KD5A 4OMBA 4DIGA 4F22A 1P1WA 3B6TA 4GXAA 2OJTA 3DELB 3UORA 3FIRA 4R2FA 3PUXE 4F2QA 1XVXA 1EZ9A 2F36A 1AIVA 2F34A 3HO7A 1GV8A 3LC8A 3TUSA 4AB5A 4G8NA 3SEYA 1S7YA 3MQ9A 3TQLA 1BP5A 4KYDA 1LGBC 1MQIA 3PPRA 3MJNA 3V83A 1P1NA 5I58A 2V84A 4OVJA 2YPNA 4EXLA 2ONSA 4R6KA 3EHUA 1ATGA 2XHDA 3CRBA 3KSJA 4JBZA 1VFEA 4G68B 1HSEA 1CB6A 4I1DA 3RGYA 4EQ9A 3Q27A 1P99A 3H03A 2RC7A 4PP0A 1L5TA 5M2VA 3H7MA 1IXHA 2RF1A 4NTLA 2HFBA 3VLUA 1NH8A 1ZIUA 4HCYA 1OQGA 3BKIB 3FJ7A 2B3FA 4POWA 2XX8A 5A5XA 5AA2D 2RCAA 3D4GA 3ILTB 1MY0A 1ANFA 4YAHX 3A3CA 4NF5B 3PPQA 4OESA 2F6PA 3WAEA 2V25A 2QS4A 3ONMA 3TODA 1I6AA 2ZXTA 5AA1A 3O28A 4OERA 2Y7KA 3RTWB 4RNSA 4M4GA 4LONB 3HCQA 2DE2A 5ELVA 5EHMA 4NF6A 2AL5A 2I0CA 3O97A 2HXWA 4JWYA 4EDPA 1R6ZA 3OD7A 4OWDA 4YICA 1IITA 4GIZA 4EF1A 4IO4A 3PGFA 4O3CA 4TQUQ 3S9NC 5JTYB 3T96B 1WODA 3FV1A 3RPWA 1MY1A 2H5YA 2AL4A 2ONRA 5CMMA 3TTMA 3T93B 1B4HA 3TYHA 2HEUA 4R74A 3CFLA 1ZTYA 1YPNA 1A7LA 5TU0A 3HHGA 2ZYMA 3MVZA 1XT8A 1JETA 3EPEA 5K2XA 3GXAA 4I62A 1US4A 1UTBB 3C33A 4YKJA 1LAHE 5H8NA 3G3JA 4IY5A 5AE4A 3OELA 2D5WA 2O68A 3OSRA 3TAJA 3T9VA 4R9FA 1I6BA 4Q0CA 2ZNSA 3M3LA 1QW0A 2REJA 3C34A 3I3VA 3U1OA 2DVCA 1EU8A 2DSFA 5FHOA 2F97A 4MLVA 4RJZA 3C32A 2QS2A 2QRYA 4IO7A 4WXJA 1JVYA 2VP1A 3N94A 4KI0E 1N3XA 2F8DA 1B51A 1MY3A 5H8FA 1VE4A 1LB8A 4ZE8A 4RXLA 1ZU0A 1NNKA 1KWHA 4X9TA 3PUZE 2W7YA 1IXIA 3QK6A 3C35A 3T66A 4QRZA 3K1NA 4KCCA 5TP9A 1LFIA 3QUJA 2O1MA 1MXUA 4OFLA 4QSCA 3KBRA 4MH5A 3IAZA 3THIA 2ZNUA 2O7UA 1TFAA 1PDAA 2Q9TA 2X7QA 4N13A 3C36A 3USDA 1YCJA 1WDNA 2DVZA 2I48A 3RTFB 2G29A 4DDDA 1B0LA 3HPIA 1H3DA 4OQOA 2X7PA 4EF2A 4RK9A 3ZKLA 4R75A 3SEVA 1LBBA 3U92A 3HN0A 1PB8A 1OLAA 1QKBA 1MQDA 4X1BA 1RYOA 3UIFA 3MUQA 2Z8FA 1N04A 3K2DA 3MVYA 5I84A 1O63A 2DWIA 4KR5A 4YZZA 3VXCA 3U93A 1OIBA 1UIVA 3EQ1A 4U22A 1B6HA 3D4CA 2DWHA 4EQ7A 5B7DA 1FQDA 4GVOA 4G77A 4G68A 4PFWA 4ISUA 1JVXA 1Y3NA 3G7WA 5I56B 4RK2A 3UGWA 2R9JA 4ONYA 2XX9A 3L6HA 2XX7A 5KDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OTE A;  3K6X A;  3TCH A;  3FJM A;  1Y20 A;  4F1V A;  1CE2 A;  4LA9 A;  3TMG A;  4H8J A;  4H6D A;  2NVU B;  5ISU A;  2XD2 A;  2XXW A;  4NE4 A;  2Y7I A;  3N5L A;  3OSQ A;  4OXV A;  4GLI A;  4XKQ A;  4NF5 A;  3SDF A;  4OET A;  4I9D A;  2D21 A;  2I0B A;  1EZO A;  2LAO A;  5I59 A;  1VSO A;  1PBQ A;  2V3U A;  2UVJ A;  1DMB A;  2XD3 A;  2B65 A;  1DPE A;  1MM6 A;  1M5E A;  4UA8 A;  1JW5 A;  1JQF A;  5DYH A;  5AA2 B;  1IUD A;  1D9Y A;  2ZYN A;  3OXN A;  3DP6 A;  5CBS A;  2Q8J A;  2V93 A;  1A99 A;  3C31 A;  4GRK A;  5JTY A;  2XXU A;  3VXB A;  4LZ8 A;  1MM7 A;  1QUK A;  3MWB A;  3G3G A;  3N6U A;  1MXX A;  2DQV A;  1AOV A;  3QYT A;  3KZG A;  5ITP A;  1FTK A;  3OEM A;  4LVQ A;  5FHN A;  1LAF E;  1HSJ A;  4WKM A;  2I4B A;  3S9L C;  4IO6 A;  3K1P A;  1SW5 A;  3RQT A;  3EHS A;  5AA4 B;  2M8C A;  4YB7 A;  1B7U A;  4EUO A;  4YMB A;  1XC1 A;  1FW0 A;  1MDP 1;  1UTB A;  4G68 C;  2ZNT A;  3IB1 A;  2G93 A;  1B7H A;  4RPN A;  1Y3P A;  4WED A;  3GBB A;  2UVG A;  4IO5 A;  1TFD A;  4F29 A;  4DCX A;  2BJJ X;  2PT2 A;  3EHT A;  2KLF A;  3KG2 A;  1O7T A;  3WAF A;  1VR5 A;  3IJX B;  4DE8 A;  3MZ1 A;  4QFL A;  1NMU A;  2XXY A;  3QIM A;  4THI A;  4ZZE A;  1DSN A;  2FA7 A;  5L9S A;  3ODB A;  3G3K A;  2O51 A;  3PMW A;  3K00 A;  3E3K A;  3MAM A;  1UTH A;  3VVE A;  4HS7 A;  5L9M A;  2P1S A;  3PD9 A;  3IL1 B;  3TCF A;  4U1O A;  3SEU A;  4BDN A;  1B5J A;  4ELO A;  2XXH A;  3K0V A;  5KCJ B;  3QUF A;  1Y4T A;  2YJP A;  2Z8D A;  4H1X A;  4BDO A;  5I2K B;  3TDJ A;  1GGG A;  3Q29 A;  1QUI A;  4F31 B;  3HST A;  3ZKK A;  2XXQ A;  3BFT A;  3SKP A;  4FE8 A;  3RNN A;  3FAS A;  2GRV A;  1TXF A;  2Q89 A;  4DXB A;  1B5H A;  4FIM A;  3E9X A;  5HM4 B;  3OO7 A;  3TZA A;  3PU5 A;  1BIY A;  3W9V A;  3VFJ A;  2CMO A;  1II5 A;  4LP2 B;  1MPC A;  4Q5T A;  1B2H A;  4GD5 A;  1MXZ A;  5I56 A;  4ZDM A;  1Y1M A;  2VD3 A;  1N3W A;  4KPT A;  1Z7N E;  2XXR A;  3DP8 A;  5FHM A;  4NF4 B;  4P0I A;  2GHA A;  3KOS A;  2XXP A;  2IA4 A;  1P1U A;  4GOT A;  3BFU A;  3IOU A;  4ND9 A;  3LSF B;  5F1Q A;  2NUV A;  2PYY A;  4H0W A;  3N6T A;  3QSL A;  1IIW A;  1O64 A;  4E0X A;  5J1D A;  2I4C A;  3OO9 A;  4HCW A;  1P1Q A;  5LOM A;  3VV5 A;  4YB6 A;  3PD8 A;  4QFP A;  3UK4 A;  1B3H A;  3PMX A;  1MG1 A;  2UYE A;  2I3W A;  3DM0 A;  1B58 A;  5HPQ A;  1MXW A;  2XXT A;  4YKK A;  3IK6 B;  2DXY A;  4G4P A;  3MW0 A;  5AA2 A;  4RY1 A;  1P1O A;  2PT1 A;  4GFR A;  4F3S A;  3KJ7 A;  1B4Z A;  2HCA A;  2H9B A;  3H06 B;  1BKA A;  1QVS A;  4YU0 A;  4BLA A;  4C1T A;  3I6V A;  5I2N B;  2DE3 A;  2P0S A;  2XXX A;  1QUJ A;  1LFG A;  3MC2 A;  4FAJ A;  3U72 A;  1POT A;  4WEP A;  3MPK A;  3O6G A;  1LAG E;  4U4S A;  3S2V A;  1M5F A;  2E0S A;  5CMB A;  3OO6 A;  3FZV A;  4LUB A;  4ZEF A;  1R1N A;  3K6W A;  2RC9 A;  4ESX A;  2O69 A;  5F7V A;  3VLW A;  1R9Q A;  2UYF A;  5AA3 A;  5K2Y A;  3AXF A;  4XKN A;  3MVW A;  1HSL A;  3OEN A;  3SEW A;  2H25 A;  3T9U A;  1MDQ A;  5I57 B;  1MRP A;  2ALU A;  4POX A;  1B3F A;  1Y9U A;  3JYR A;  4IY6 A;  3LR1 A;  3RY3 A;  1SW2 A;  2O6A A;  3FUZ A;  3PMV A;  3KFM A;  3FVK A;  3LUY A;  4GF8 A;  2VD2 A;  1SI1 A;  3PUV E;  1N7X A;  4QFK A;  1M5B A;  2PVU A;  1GVC A;  1F9B A;  5H8H B;  3B6W A;  1B3L A;  4R9G A;  4ZEK A;  2ZMB A;  3IX1 A;  4JXI A;  1XVY A;  3Q28 A;  2F6G A;  4HW8 A;  1URG A;  1H44 A;  3FV2 A;  4ECF A;  3K6U A;  4IB2 A;  3VVD A;  3H6U A;  3RUM A;  4QF9 A;  4P0G A;  4C0R A;  3SES A;  3U8Q A;  3SET A;  3CG3 A;  2F7C A;  2O1L A;  3R26 A;  3TEL A;  5KCJ A;  2QSX A;  1FQE A;  5I58 B;  4H5G A;  5I2K A;  2B3B A;  4LAT A;  1MPB A;  2OLB A;  4XIG Q;  2H4I A;  1URD A;  2O84 X;  2Y7P A;  4H67 A;  4RA1 A;  3FVN A;  4YB5 A;  4RPO A;  1IQ7 A;  1D4N A;  5CM6 A;  4GL0 A;  3K01 A;  3O6H A;  1FCK A;  2ESN A;  1MQG A;  2DWA A;  4ZED A;  4PE5 B;  3L6G A;  3VE1 B;  4KHZ E;  2Q88 A;  5A5X B;  3PUW E;  2DYX A;  4OHN A;  3C9H A;  3HV1 A;  1LCF A;  4Q8R A;  3DLN A;  3LSX A;  1XHY A;  5DEX B;  3TCG A;  4NF4 A;  3KGC A;  4I8C A;  2Y84 A;  4G8M A;  4ELP A;  2F5X A;  5BUU A;  4QFN A;  1OLC A;  3O6I A;  3TTN A;  1JNF A;  5DVF A;  3MP8 A;  1ZKB A;  1ELJ A;  1MH3 A;  1PEB A;  2F35 A;  4DXC A;  4F1Y A;  3S4U A;  1UIU A;  4F3B A;  2RC8 A;  4ZE9 A;  4PFU A;  3RT6 B;  3IOT A;  5ICT A;  3Q26 A;  4H65 A;  3W9W A;  3N26 A;  5TPA B;  5DVI A;  1NFT A;  1B3G A;  4ESW A;  4JDF A;  1A8E A;  1MS7 A;  1ZBM A;  4NWC A;  4AB6 A;  1TWY A;  3IB0 A;  1JW4 A;  4LQ5 A;  3I5O A;  1SVX B;  1USY E;  2QS3 A;  3PUY E;  4U4X A;  1M5D A;  3CVG A;  4JSO A;  1RKM A;  1RYX A;  2ZYK A;  4JWX A;  1A8F A;  2NWJ A;  2UXA A;  1DOT A;  1N84 A;  3H6W A;  2DXR A;  1NH7 A;  2Z8E A;  1MH4 A;  3PPP A;  3ILU B;  3IB2 A;  3A3U A;  4BDM A;  3TTK A;  1Q35 A;  3VDF A;  3SEX A;  4ELQ A;  2GFE A;  5DVJ A;  2XXI A;  4ELR A;  3GBA A;  1T0K A;  5H8N B;  1B7Z A;  1ZJL A;  2HAV A;  4QFO A;  3EF7 A;  1N7W A;  5DTB A;  2FNC A;  3KOT A;  1EH3 A;  1B46 A;  3G3I A;  4NWD A;  5DT6 A;  1N0T A;  4OEV A;  4U21 A;  1USY H;  4O3A A;  5I57 A;  2QS1 A;  2RIN A;  2QL3 A;  5CC2 A;  3MP6 A;  4DZ1 A;  4OEU A;  2H99 A;  1VFD A;  3FVG A;  4EQB A;  2DP8 A;  3KSX A;  4DLD A;  3FVO A;  4JB7 A;  2PMS A;  2HAU A;  3MPL A;  1JW1 A;  1FTM A;  3K1M A;  4Z0I A;  2ANJ A;  3MZ9 A;  4NED A;  2V3Q A;  1IXG A;  2GH9 A;  2P2A A;  2HZK A;  3KN7 A;  4XXU A;  5TP9 B;  5CI5 A;  5H8H A;  3QAX A;  1WVJ A;  4KQP A;  1MXY A;  3H4Z A;  3TKD A;  5L9O A;  1IZ1 A;  5L8D A;  2HQ0 A;  4H5F A;  3OO8 A;  1JEU A;  2PBW A;  1LLS A;  2CZL A;  4KFQ A;  1SW4 A;  2OBG A;  1LFH A;  4F3P A;  1LB9 A;  4XTC Q;  1BTJ A;  4GL8 A;  4N07 A;  4TLL B;  2X26 A;  4N6P A;  3CI8 A;  2F7A A;  1IEJ A;  2I58 A;  4EXK A;  5JEI A;  3E13 X;  1SD3 A;  2F7B A;  3F11 A;  4M1V A;  3P7I A;  4GQO A;  4O3B A;  2Z22 A;  2Z23 A;  2IEE A;  1MPD A;  3LSL A;  1JEV A;  1D9V A;  5H8Q B;  1OQH A;  5CMK A;  1PBP A;  5KDT B;  2E1S A;  1LBC A;  1NL5 A;  3TFL A;  1A40 A;  2QPQ A;  3V89 B;  3UP9 A;  1UQW A;  3PPO A;  3KJT A;  4R6H A;  1FQA A;  3FXR A;  4G2Z A;  4MLQ A;  4YKP A;  2ZYO A;  2F78 A;  2Q2C A;  5ICQ A;  2Q2A A;  2FYI A;  3CR9 A;  3UA8 A;  4QSD A;  3FGS A;  5ITO A;  4DXU A;  3O66 A;  1US5 A;  4U1Z A;  3A09 A;  4DCY A;  2D3I A;  5DEX A;  5JK4 A;  1S9T A;  3CSB A;  2QJE A;  1S50 A;  3TEP A;  3M3F A;  5I59 B;  1URS A;  5CMC A;  3RLF E;  3V8X B;  3JV9 A;  4MBP A;  3OMB A;  2DE4 A;  2AYS A;  1QJM A;  2NXO A;  5EYF A;  3SER A;  2RKM A;  3S9E A;  3VLV A;  2VOZ A;  5TPA A;  1MY2 A;  1M5C A;  5CBR A;  1GTK A;  2R6G E;  4L17 A;  2A5T B;  1B9J A;  4K3F A;  5IKB A;  4F39 A;  1NNT A;  4GWO A;  1PB9 A;  1MXV A;  3TPA A;  2A5S A;  4LZ5 A;  1B32 A;  1A54 A;  4IGT A;  5CRY A;  3OEK A;  4XKR A;  3T9X B;  3IJO B;  1B5I A;  1A55 A;  4NF8 B;  1B52 A;  2PX1 A;  4JWO A;  4ZZA A;  1I69 A;  2I3V A;  1BLF A;  4HTG A;  5AA4 A;  4LQ2 A;  4P11 A;  2Y7W A;  4PET A;  3QXM A;  3DP4 A;  4KYE A;  1DPP A;  2REG A;  1OVT A;  4OZ9 A;  3PPN A;  5FTI A;  4OFO A;  4QHQ A;  3IO6 A;  3TTL A;  3ZS6 A;  4MF3 A;  1YTV A;  3LSW A;  4F1U A;  4YMA A;  5HBC A;  3GLB A;  1Y1Z A;  3FXQ A;  1DTZ A;  4FJP A;  3VVF A;  1IXC A;  3B6Q A;  2UVI A;  1MQJ A;  3V5A A;  5FTH A;  5IAI A;  3IO4 A;  4E0W A;  2DOJ A;  4RYA A;  2I49 A;  3MP1 A;  4BDL A;  1ZMG A;  4FED A;  1B05 A;  2OZZ A;  1B1H A;  2OWT A;  3KEI A;  4FEB A;  3IOR A;  4IO3 A;  2ABH A;  2DS9 A;  3RN8 A;  3CIJ A;  1D3K A;  1FTO A;  2HZL A;  4JSD A;  1UTH B;  2Y7R A;  4Q30 B;  1SI0 A;  3JZJ A;  1SDX A;  4H8I A;  3PV0 E;  3FXU A;  4F3G A;  3TQW A;  3H6V A;  2ONK E;  4QSE A;  3W15 C;  1I6Q A;  1Y3Q A;  1FQF A;  3C4M A;  3IOV A;  4PQJ A;  4IGR A;  2R71 A;  3IOW A;  2DWJ A;  4F18 A;  3Q25 A;  3K4U A;  1NNF A;  4UAC A;  4LZ7 A;  3KN3 A;  3TTR A;  4MFI A;  1TT1 A;  1MY4 A;  3CG1 A;  1POY 1;  3O9P A;  1OMP A;  1B3E A;  1AMF A;  5H8Q A;  3HHF A;  1AL3 A;  2NOO A;  4TOZ A;  1PC3 A;  1H76 A;  4U2R A;  2V3T A;  3E4R A;  4FEC A;  1J1N A;  1LCT A;  1FQC A;  1Z7M E;  4Z7E A;  1ZLQ A;  4PFT A;  2QMX A;  1AH5 A;  1PB7 A;  3O29 A;  4ZEC A;  1SW1 A;  2UVH A;  3IR1 A;  5B70 A;  4OYV A;  2RCB A;  3ECR A;  2YLN A;  2OK2 A;  1B40 A;  4NF6 B;  4BDQ A;  4ZS9 A;  3M8U A;  1SQY A;  4C1U A;  4TLM B;  1LST A;  3S9M C;  2VGQ A;  3CSG A;  5EHS A;  1B1X A;  1NKX A;  4PFY A;  1EZP A;  1XOC A;  5KZT A;  4FOR A;  3GZG A;  3CFZ A;  3U94 A;  3EN3 A;  1SYH A;  2OWS A;  4XKP A;  2A5T A;  3G3F A;  1H45 A;  3LBS A;  1R9L A;  2WKY A;  4FAT A;  5I2N A;  3RT8 A;  1MQH A;  2GHB A;  4BDR A;  2THI A;  4U23 A;  1QKA A;  4AQ4 A;  3MZB A;  2OCU A;  2XXV A;  3OOA A;  4YKI A;  3FJG A;  1SBP A;  4GXS B;  2I6E A;  1GR2 A;  4X48 A;  1N76 A;  4NF8 A;  3K02 A;  3T22 A;  3KN8 A;  4X1D A;  3M3K A;  2QMW A;  3BBR A;  3FD3 A;  1YAE A;  3H3G A;  2AIX A;  3CFX A;  1FTJ A;  1H43 A;  3H6T A;  1NNP A;  3R6U A;  4F19 A;  1SYI A;  3R7X A;  4R6Y A;  3T9H B;  1DTG A;  3O2A A;  3MVX A;  2VHA A;  2O7I A;  1XS5 A;  4R2B A;  5H8F B;  1FQB A;  4OFJ A;  1B0H A;  4KCD A;  5BWJ A;  4IO2 A;  3K6V A;  1OVB A;  3UN6 A;  1FTL A;  3B7D A;  3FAT A;  4R72 A;  4KYS A;  5H8S A;  1QUL A;  2H98 A;  4G8H A;  1Y4C A;  4F2O A;  1Q1K A;  3MBP A;  4R73 A;  1LAX A;  3G3H A;  3ZSF A;  4ZEI A;  4ZEB A;  4OEN A;  4NMY A;  4KD5 A;  4OMB A;  4DIG A;  4F22 A;  1P1W A;  3B6T A;  4GXA A;  2OJT A;  3DEL B;  3UOR A;  3FIR A;  4R2F A;  3PUX E;  4F2Q A;  1XVX A;  1EZ9 A;  2F36 A;  1AIV A;  2F34 A;  3HO7 A;  1GV8 A;  3LC8 A;  3TUS A;  4AB5 A;  4G8N A;  3SEY A;  1S7Y A;  3MQ9 A;  3TQL A;  1BP5 A;  4KYD A;  1LGB C;  1MQI A;  3PPR A;  3MJN A;  3V83 A;  1P1N A;  5I58 A;  2V84 A;  4OVJ A;  2YPN A;  4EXL A;  2ONS A;  4R6K A;  3EHU A;  1ATG A;  2XHD A;  3CRB A;  3KSJ A;  4JBZ A;  1VFE A;  4G68 B;  1HSE A;  1CB6 A;  4I1D A;  3RGY A;  4EQ9 A;  3Q27 A;  1P99 A;  3H03 A;  2RC7 A;  4PP0 A;  1L5T A;  5M2V A;  3H7M A;  1IXH A;  2RF1 A;  4NTL A;  2HFB A;  3VLU A;  1NH8 A;  1ZIU A;  4HCY A;  1OQG A;  3BKI B;  3FJ7 A;  2B3F A;  4POW A;  2XX8 A;  5A5X A;  5AA2 D;  2RCA A;  3D4G A;  3ILT B;  1MY0 A;  1ANF A;  4YAH X;  3A3C A;  4NF5 B;  3PPQ A;  4OES A;  2F6P A;  3WAE A;  2V25 A;  2QS4 A;  3ONM A;  3TOD A;  1I6A A;  2ZXT A;  5AA1 A;  3O28 A;  4OER A;  2Y7K A;  3RTW B;  4RNS A;  4M4G A;  4LON B;  3HCQ A;  2DE2 A;  5ELV A;  5EHM A;  4NF6 A;  2AL5 A;  2I0C A;  3O97 A;  2HXW A;  4JWY A;  4EDP A;  1R6Z A;  3OD7 A;  4OWD A;  4YIC A;  1IIT A;  4GIZ A;  4EF1 A;  4IO4 A;  3PGF A;  4O3C A;  4TQU Q;  3S9N C;  5JTY B;  3T96 B;  1WOD A;  3FV1 A;  3RPW A;  1MY1 A;  2H5Y A;  2AL4 A;  2ONR A;  5CMM A;  3TTM A;  3T93 B;  1B4H A;  3TYH A;  2HEU A;  4R74 A;  3CFL A;  1ZTY A;  1YPN A;  1A7L A;  5TU0 A;  3HHG A;  2ZYM A;  3MVZ A;  1XT8 A;  1JET A;  3EPE A;  5K2X A;  3GXA A;  4I62 A;  1US4 A;  1UTB B;  3C33 A;  4YKJ A;  1LAH E;  5H8N A;  3G3J A;  4IY5 A;  5AE4 A;  3OEL A;  2D5W A;  2O68 A;  3OSR A;  3TAJ A;  3T9V A;  4R9F A;  1I6B A;  4Q0C A;  2ZNS A;  3M3L A;  1QW0 A;  2REJ A;  3C34 A;  3I3V A;  3U1O A;  2DVC A;  1EU8 A;  2DSF A;  5FHO A;  2F97 A;  4MLV A;  4RJZ A;  3C32 A;  2QS2 A;  2QRY A;  4IO7 A;  4WXJ A;  1JVY A;  2VP1 A;  3N94 A;  4KI0 E;  1N3X A;  2F8D A;  1B51 A;  1MY3 A;  5H8F A;  1VE4 A;  1LB8 A;  4ZE8 A;  4RXL A;  1ZU0 A;  1NNK A;  1KWH A;  4X9T A;  3PUZ E;  2W7Y A;  1IXI A;  3QK6 A;  3C35 A;  3T66 A;  4QRZ A;  3K1N A;  4KCC A;  5TP9 A;  1LFI A;  3QUJ A;  2O1M A;  1MXU A;  4OFL A;  4QSC A;  3KBR A;  4MH5 A;  3IAZ A;  3THI A;  2ZNU A;  2O7U A;  1TFA A;  1PDA A;  2Q9T A;  2X7Q A;  4N13 A;  3C36 A;  3USD A;  1YCJ A;  1WDN A;  2DVZ A;  2I48 A;  3RTF B;  2G29 A;  4DDD A;  1B0L A;  3HPI A;  1H3D A;  4OQO A;  2X7P A;  4EF2 A;  4RK9 A;  3ZKL A;  4R75 A;  3SEV A;  1LBB A;  3U92 A;  3HN0 A;  1PB8 A;  1OLA A;  1QKB A;  1MQD A;  4X1B A;  1RYO A;  3UIF A;  3MUQ A;  2Z8F A;  1N04 A;  3K2D A;  3MVY A;  5I84 A;  1O63 A;  2DWI A;  4KR5 A;  4YZZ A;  3VXC A;  3U93 A;  1OIB A;  1UIV A;  3EQ1 A;  4U22 A;  1B6H A;  3D4C A;  2DWH A;  4EQ7 A;  5B7D A;  1FQD A;  4GVO A;  4G77 A;  4G68 A;  4PFW A;  4ISU A;  1JVX A;  1Y3N A;  3G7W A;  5I56 B;  4RK2 A;  3UGW A;  2R9J A;  4ONY A;  2XX9 A;  3L6H A;  2XX7 A;  5KDT A; 
#chains in the Genus database with same CATH topology
 4OTE A;  3K6X A;  3TCH A;  2HXR A;  3FJM A;  1Y20 A;  4F1V A;  1CE2 A;  4LA9 A;  3TMG A;  4H8J A;  4UAB A;  3IFA A;  4H6D A;  2NVU B;  5ISU A;  2V4C A;  2XD2 A;  2XXW A;  4NE4 A;  2Y7I A;  2FIE A;  3N5L A;  3OSQ A;  1SPI A;  4OXV A;  4N8G A;  5I3S A;  4GLI A;  4XKQ A;  4NF5 A;  3SDF A;  4OET A;  4KXP A;  1XI6 A;  2VPO A;  4I9D A;  2D21 A;  2I0B A;  1EZO A;  2LAO A;  5I59 A;  1VSO A;  1PBQ A;  2V3U A;  4OAN A;  2UVJ A;  1DMB A;  2XD3 A;  4X04 A;  2B65 A;  1DPE A;  1MM6 A;  1M5E A;  4UA8 A;  1JW5 A;  1JQF A;  5DYH A;  5AA2 B;  1AWB A;  1IUD A;  1D9Y A;  2ZYN A;  3OXN A;  3DP6 A;  5CBS A;  2Q8J A;  2V93 A;  2WX9 A;  1A99 A;  3C31 A;  4GRK A;  5JTY A;  2XXU A;  3VXB A;  4LZ8 A;  1MM7 A;  5J16 A;  1QUK A;  3MWB A;  3G3G A;  3N6U A;  1IMF A;  1MXX A;  2DQV A;  1AOV A;  3QYT A;  3E78 A;  3KZG A;  5ITP A;  1FTK A;  5EYG A;  3OEM A;  4LVQ A;  5FHN A;  1LAF E;  1HSJ A;  4WKM A;  2I4B A;  3D1R A;  3S9L C;  3SZP A;  4IO6 A;  3K1P A;  1SW5 A;  4GBV A;  3RQT A;  3EHS A;  5AA4 B;  2M8C A;  4YB7 A;  1INP A;  3A29 A;  1B7U A;  4EUO A;  4YMB A;  1XC1 A;  4MHF A;  1FW0 A;  1MDP 1;  3MYU A;  1UTB A;  4G68 C;  2ZNT A;  4MEV A;  3IB1 A;  2G93 A;  1B7H A;  4RPN A;  1Y3P A;  4WED A;  3GBB A;  2Q8M A;  2UVG A;  4IO5 A;  1TFD A;  4F29 A;  4DCX A;  2BJJ X;  4PBH A;  2PT2 A;  3GYY A;  3EHT A;  2KLF A;  3KG2 A;  1O7T A;  3WAF A;  5T3J A;  2BJI A;  1VR5 A;  3IJX B;  4DE8 A;  1NV3 A;  3MZ1 A;  4QFL A;  1NMU A;  2XXY A;  3QIM A;  4THI A;  1NV6 A;  4ZZE A;  1DSN A;  2FA7 A;  5L9S A;  3ODB A;  3G3K A;  2O51 A;  3PMW A;  3K00 A;  3E3K A;  4AS4 A;  1FPD A;  3MAM A;  1UTH A;  3VVE A;  4HS7 A;  2P1S A;  3PD9 A;  3IL1 B;  5L9M A;  4PF8 A;  3ISP A;  1LBW A;  3TCF A;  4U1O A;  3SEU A;  4BDN A;  1B5J A;  4ELO A;  2XXH A;  3K0V A;  5KCJ B;  3QUF A;  1Y4T A;  2YJP A;  4HE2 A;  2Z8D A;  4H1X A;  4BDO A;  4MNI A;  5I2K B;  3TDJ A;  1GGG A;  3Q29 A;  1QUI A;  4F31 B;  3HST A;  4NQ8 A;  3ZKK A;  4NN3 A;  2XXQ A;  3BFT A;  4O8M A;  4QBA A;  3SKP A;  4FE8 A;  3RNN A;  4GX3 A;  3FAS A;  5ESY A;  2GRV A;  1FPJ A;  1TXF A;  4OVP A;  2Q89 A;  4DXB A;  1B5H A;  4FIM A;  4MAG A;  3E9X A;  5HM4 B;  3OO7 A;  3TZA A;  3PU5 A;  1BIY A;  3W9V A;  4G61 A;  3VFJ A;  2CMO A;  1II5 A;  4LP2 B;  1MPC A;  4Q5T A;  1B2H A;  4GD5 A;  2XWV A;  1MXZ A;  5I56 A;  4ZDM A;  1Y1M A;  1LBZ A;  4PAI A;  2VD3 A;  1N3W A;  4KPT A;  1Z7N E;  2XXR A;  4MMP A;  3DP8 A;  5FHM A;  4GWZ A;  4NF4 B;  4P0I A;  2GHA A;  3KOS A;  2XXP A;  2HHM A;  4OVQ A;  2IA4 A;  1P1U A;  4MJO A;  4GOT A;  2Y5K A;  3BFU A;  2OX3 A;  3IOU A;  4ND9 A;  3LSF B;  5F1Q A;  2NUV A;  2PYY A;  4OVR A;  4H0W A;  4PDD A;  3N6T A;  3QSL A;  1IIW A;  1O64 A;  4E0X A;  5J1D A;  2I4C A;  3OO9 A;  4HCW A;  1P1Q A;  5LOM A;  3VV5 A;  4YB6 A;  3PD8 A;  4QFP A;  2F3B A;  1B3H A;  3UK4 A;  3PMX A;  1MG1 A;  2UYE A;  2I3W A;  1FJ6 A;  4P8B A;  1FPF A;  3DM0 A;  1B58 A;  5HPQ A;  1MXW A;  3MST A;  2XXT A;  4NG7 A;  4YKK A;  3IK6 B;  2DXY A;  4FBP A;  4G4P A;  3FBP A;  4X8R A;  3MW0 A;  4RY1 A;  1P1O A;  2PT1 A;  5AA2 A;  4GFR A;  4F3S A;  3KJ7 A;  1B4Z A;  2HCA A;  1K9Z A;  2H9B A;  3H06 B;  1BKA A;  1QVS A;  4YU0 A;  4BLA A;  4C1T A;  3I6V A;  5I2N B;  2DE3 A;  2P0S A;  4AS5 A;  2XXX A;  1QUJ A;  1LFG A;  3MC2 A;  4FAJ A;  3U72 A;  1POT A;  4WEP A;  3MPK A;  3O6G A;  1LAG E;  4U4S A;  1M5F A;  2E0S A;  5CMB A;  3S2V A;  3OO6 A;  3FZV A;  1NV2 A;  4LUB A;  4ZEF A;  1R1N A;  3K6W A;  2RC9 A;  4ESX A;  2O69 A;  2HPG A;  4GBW A;  2WBB A;  5F7V A;  3VLW A;  1R9Q A;  3B50 A;  2UYF A;  5AA3 A;  5K2Y A;  3AXF A;  4N6K A;  3MVW A;  4XKN A;  1HSL A;  4I3Y A;  3OEN A;  3SEW A;  2H25 A;  3T9U A;  1MDQ A;  5I57 B;  2ZZV A;  1MRP A;  4O7I A;  2ALU A;  4POX A;  1B3F A;  2CEX A;  4DI4 B;  1Y9U A;  3JYR A;  4IY6 A;  1IMD A;  3LR1 A;  4HXV A;  3RY3 A;  2XWI A;  4MNC A;  4XF5 A;  2GQ1 A;  1SW2 A;  2O6A A;  4PGP A;  3FUZ A;  3PMV A;  3KFM A;  3FVK A;  3LUY A;  4GF8 A;  2CZH A;  2VD2 A;  1SI1 A;  3PUV E;  1N7X A;  2XXK A;  4QFK A;  1M5B A;  2PVU A;  1GVC A;  3CHG A;  1F9B A;  5H8H B;  3B6W A;  1B3L A;  4R9G A;  5EQ8 A;  4P47 A;  1BK4 A;  4ZEK A;  2ZMB A;  3IX1 A;  4JXI A;  1XVY A;  3Q28 A;  2F6G A;  3IFC A;  1FBH A;  1URG A;  4HW8 A;  1H44 A;  3FV2 A;  4HE0 A;  4ECF A;  3K6U A;  4HE1 A;  4IB2 A;  3VVD A;  2WBD A;  3H6U A;  4N17 A;  2KQZ A;  3RUM A;  5IM2 A;  4QF9 A;  4P0G A;  4C0R A;  3SES A;  3U8Q A;  3SET A;  3CG3 A;  2F7C A;  2O1L A;  3R26 A;  3TEL A;  5KCJ A;  2QSX A;  2XWK A;  1FQE A;  1KA1 A;  1K9Y A;  4H45 A;  5I58 B;  4H5G A;  5I2K A;  2B3B A;  4NF0 A;  4LAT A;  1MPB A;  2OLB A;  4XIG Q;  2H4I A;  1URD A;  2O84 X;  2Y7P A;  4H67 A;  4RA1 A;  2P3N A;  3FVN A;  4YB5 A;  4RPO A;  1IQ7 A;  1D4N A;  5CM6 A;  4GL0 A;  3K01 A;  3O6H A;  3FXB A;  3ROJ A;  1NV1 A;  1FCK A;  2ESN A;  5EQA A;  1MQG A;  2DWA A;  4ZED A;  4PE5 B;  3L6G A;  3VE1 B;  4KHZ E;  2Q88 A;  5A5X B;  3PUW E;  2DYX A;  4OHN A;  3C9H A;  3HV1 A;  1KA0 A;  1LCF A;  4Q8R A;  3DLN A;  4P1E A;  4XFE A;  3LSX A;  1XHY A;  2OWZ A;  4NGU A;  5DEX B;  3TCG A;  4NF4 A;  2ZZW A;  3KGC A;  4I8C A;  2Y84 A;  4G8M A;  4ELP A;  2F5X A;  5BUU A;  4QFN A;  1OLC A;  3O6I A;  2WYP A;  3TTN A;  1JNF A;  5DVF A;  3MP8 A;  1ZKB A;  1ELJ A;  1MH3 A;  1PEB A;  2F35 A;  4GWW A;  1NV5 A;  4DXC A;  4F1Y A;  3S4U A;  4P3L A;  1UIU A;  4F3B A;  2RC8 A;  4ZE9 A;  2WEF A;  4GX4 A;  4PFU A;  3RT6 B;  3IOT A;  5ICT A;  3Q26 A;  4H65 A;  3W9W A;  3N26 A;  5A5L A;  5TPA B;  5DVI A;  1NFT A;  1B3G A;  4ESW A;  4JDF A;  1A8E A;  1MS7 A;  1ZBM A;  4NWC A;  4AB6 A;  1TWY A;  3IB0 A;  1JW4 A;  4LQ5 A;  3I5O A;  1SVX B;  1USY E;  2QS3 A;  3PUY E;  4U4X A;  1M5D A;  3CVG A;  4JSO A;  1RKM A;  1RYX A;  2ZYK A;  4JWX A;  4JVC A;  3RPL B;  1A8F A;  2NWJ A;  2UXA A;  1DOT A;  1N84 A;  3H6W A;  2CZK A;  2DXR A;  2B4L A;  1NH7 A;  2Z8E A;  1MH4 A;  3PPP A;  3ILU B;  3IB2 A;  3A3U A;  4PFI A;  4BDM A;  1G0I A;  3TTK A;  1Q35 A;  3VDF A;  4QXD A;  3SEX A;  3T0J A;  4ELQ A;  5LDZ A;  2GFE A;  5DVJ A;  3RYD A;  2XXI A;  4ELR A;  2QVR A;  3GBA A;  1T0K A;  5H8N B;  1B7Z A;  1ZJL A;  2HAV A;  4QFO A;  4PGN A;  3EF7 A;  1N7W A;  5DTB A;  1YZ0 A;  2FNC A;  3KOT A;  2JJK A;  1EH3 A;  1B46 A;  3G3I A;  4NWD A;  5DT6 A;  1N0T A;  1FPL A;  4OEV A;  4U21 A;  1USY H;  4O3A A;  5I57 A;  2QS1 A;  2RIN A;  2QL3 A;  5CC2 A;  4PAK A;  3MP6 A;  4DZ1 A;  4OEU A;  2H99 A;  2FVZ A;  1VFD A;  3FVG A;  4EQB A;  2DP8 A;  3KSX A;  4DLD A;  3FVO A;  4JB7 A;  2PMS A;  2HAU A;  3MPL A;  1JW1 A;  1FTM A;  1LBX A;  3K1M A;  4Z0I A;  2ANJ A;  3MZ9 A;  4NED A;  2V3Q A;  1IXG A;  2GH9 A;  2P2A A;  2HZK A;  3KN7 A;  4XXU A;  5TP9 B;  5CI5 A;  5H8H A;  3QAX A;  1FTA A;  1WVJ A;  4KQP A;  1MXY A;  1YXI A;  3H4Z A;  3TKD A;  5L9O A;  1IZ1 A;  5L8D A;  2HQ0 A;  4H5F A;  3OO8 A;  1JEU A;  2PBW A;  3KC0 A;  1LLS A;  2CZL A;  4KFQ A;  1SW4 A;  2OBG A;  5IZ3 B;  4N4U A;  1LFH A;  4F3P A;  1LB9 A;  4XTC Q;  1BTJ A;  4GL8 A;  4N07 A;  1FPI A;  4GX6 A;  4TLL B;  3BIH A;  2X26 A;  4N6P A;  3CI8 A;  2F7A A;  1IEJ A;  2B4M A;  2I58 A;  4EXK A;  5JEI A;  3E13 X;  1SD3 A;  2F7B A;  3F11 A;  4M1V A;  4OVT A;  3P7I A;  4GQO A;  4O3B A;  2Z22 A;  3LV0 A;  2Z23 A;  2IEE A;  1MPD A;  3LSL A;  1QGX A;  1JEV A;  1D9V A;  5H8Q B;  3U65 A;  1OQH A;  5CMK A;  1PBP A;  5KDT B;  2E1S A;  1LBC A;  1NL5 A;  3TFL A;  1D9Q A;  1A40 A;  2QPQ A;  3V89 B;  3UP9 A;  1UQW A;  3PPO A;  3KJT A;  4R6H A;  1FQA A;  3FXR A;  4G2Z A;  2Y5L A;  1FPB A;  4MLQ A;  4YKP A;  2ZYO A;  2F78 A;  2Q2C A;  3B8B A;  5ICQ A;  2Q2A A;  2FYI A;  3CR9 A;  3UA8 A;  4QSD A;  3FGS A;  5ITO A;  4DXU A;  3O66 A;  1US5 A;  4U1Z A;  3A09 A;  4DCY A;  2D3I A;  5DEX A;  2L5V A;  2VPN A;  5JK4 A;  1S9T A;  2XWO A;  3CSB A;  2QJE A;  1S50 A;  3TEP A;  1Q9D A;  1VDW A;  3M3F A;  5I59 B;  1URS A;  5CMC A;  3RLF E;  3V8X B;  3JV9 A;  4MBP A;  3OMB A;  1DCU A;  3HFU A;  2DE4 A;  2AYS A;  1LBY A;  1QJM A;  5IGA A;  2NXO A;  5EYF A;  3SER A;  2RKM A;  5I7I A;  3S9E A;  3VLV A;  2VOZ A;  5TPA A;  1MY2 A;  1M5C A;  4LN5 A;  5CBR A;  1GTK A;  2R6G E;  4L17 A;  2A5T B;  1B9J A;  4K3F A;  5IKB A;  4F39 A;  1NNT A;  4GWO A;  1PB9 A;  1MXV A;  3TPA A;  2A5S A;  4LZ5 A;  3RPL A;  2DDK A;  1B32 A;  1A54 A;  4IGT A;  3BIG A;  5CRY A;  3OEK A;  4XKR A;  3T9X B;  3IJO B;  1B5I A;  1A55 A;  4NF8 B;  1B52 A;  2PX1 A;  4JWO A;  4ZZA A;  5EQ7 A;  1I69 A;  2I3V A;  1BLF A;  4HTG A;  5AA4 A;  4LQ2 A;  4P11 A;  2Y7W A;  4PET A;  3QXM A;  2QVV A;  3DP4 A;  4KYE A;  1RDZ A;  1RDY A;  1DPP A;  2REG A;  1OVT A;  4OZ9 A;  3PPN A;  5FTI A;  4OFO A;  4PAF A;  4QHQ A;  3IO6 A;  3TTL A;  3ZS6 A;  4MF3 A;  1YTV A;  3LSW A;  4F1U A;  4YMA A;  1DK4 A;  5HBC A;  3GLB A;  4N91 A;  1Y1Z A;  3FXQ A;  1DTZ A;  4FJP A;  3VVF A;  1IXC A;  3B6Q A;  2UVI A;  1MQJ A;  4PCD A;  3V5A A;  5FTH A;  5IAI A;  3IO4 A;  4E0W A;  2DOJ A;  4RYA A;  2I49 A;  1G0H A;  3MP1 A;  4BDL A;  1ZMG A;  1FPK A;  4FED A;  1B05 A;  2OZZ A;  5ET5 A;  1B1H A;  1FSA A;  2OWT A;  3KEI A;  4FEB A;  3IOR A;  4IO3 A;  2ABH A;  2DS9 A;  3RN8 A;  3CIJ A;  1D3K A;  1FTO A;  2HZL A;  3E79 A;  1NI9 A;  4JSD A;  1UTH B;  2Y7R A;  4Q30 B;  1SI0 A;  3JZJ A;  4MIJ A;  1SDX A;  4H8I A;  1JP4 A;  3PV0 E;  4PFB A;  4OVS A;  4O7M A;  3FXU A;  4F3G A;  3TQW A;  3H6V A;  1NUW A;  2ONK E;  4QSE A;  3W15 C;  4MX6 A;  1I6Q A;  1Y3Q A;  1FQF A;  3C4M A;  4XEQ A;  3IOV A;  5IZ3 A;  5ET8 A;  1IMA A;  5DW8 A;  4PQJ A;  4IGR A;  2R71 A;  3IOW A;  2DWJ A;  4F18 A;  3Q25 A;  3K4U A;  1NNF A;  4I3E A;  4UAC A;  4LZ7 A;  2KR0 A;  3KN3 A;  1IMB A;  3TTR A;  4MFI A;  1TT1 A;  1MY4 A;  3CG1 A;  1POY 1;  3O9P A;  1OMP A;  1B3E A;  1AMF A;  4I40 A;  5H8Q A;  3HHF A;  1AL3 A;  2NOO A;  4TOZ A;  1PC3 A;  1H76 A;  4U2R A;  2V3T A;  3E4R A;  4FEC A;  1J1N A;  4P56 A;  1LCT A;  1FQC A;  1Z7M E;  4Z7E A;  1ZLQ A;  4PFT A;  2QMX A;  4GWY A;  1AH5 A;  1PB7 A;  4H46 A;  4O94 A;  3O29 A;  4ZEC A;  1SW1 A;  2UVH A;  3IR1 A;  5B70 A;  4OYV A;  2RCB A;  4PDH A;  3ECR A;  2YLN A;  2OK2 A;  1B40 A;  4NF6 B;  4P9K A;  1FRP A;  4BDQ A;  3M8U A;  4ZS9 A;  1SQY A;  4NX1 A;  4C1U A;  4TLM B;  1LST A;  4GWS A;  2F3D A;  3S9M C;  2VGQ A;  3CSG A;  5EHS A;  1B1X A;  1NKX A;  4NAP A;  2PFY A;  4PFY A;  1EZP A;  3KC1 A;  1XOC A;  5KZT A;  4FOR A;  4MNP A;  3GZG A;  3CFZ A;  3LUZ A;  3U94 A;  3EN3 A;  1SYH A;  2OWS A;  1FBF A;  1IME A;  4XKP A;  2A5T A;  3G3F A;  1H45 A;  3LBS A;  1R9L A;  1NV0 A;  2WKY A;  4N6D A;  4FAT A;  5I2N A;  3RT8 A;  1MQH A;  4N15 A;  2GHB A;  4BDR A;  2THI A;  4N8Y A;  4U23 A;  1QKA A;  4AQ4 A;  3MZB A;  2OCU A;  2XXV A;  3OOA A;  4YKI A;  3FJG A;  1SBP A;  4GXS B;  2I6E A;  1GR2 A;  4X48 A;  5F24 A;  1N76 A;  4NF8 A;  3K02 A;  3KN8 A;  3T22 A;  4X1D A;  3M3K A;  2QMW A;  3BBR A;  3FD3 A;  1YAE A;  3H3G A;  2AIX A;  3CFX A;  1FTJ A;  1H43 A;  2ZZX A;  2MKZ A;  3H6T A;  1NNP A;  3R6U A;  1FBC A;  1SYI A;  4F19 A;  3R7X A;  4R6Y A;  3T9H B;  1DTG A;  4PTK A;  3O2A A;  3MVX A;  2VHA A;  2O7I A;  1XS5 A;  4PC9 A;  4R2B A;  5H8F B;  1FQB A;  4OFJ A;  2FBP A;  4DI3 D;  1B0H A;  4KCD A;  2PCR A;  5BWJ A;  4IO2 A;  3K6V A;  1OVB A;  3UN6 A;  1FTL A;  3B7D A;  3FAT A;  4R72 A;  4KYS A;  5IZZ A;  5H8S A;  1QUL A;  2H98 A;  4P1L A;  4G8H A;  1Y4C A;  2XA5 A;  3KBZ A;  5ET7 A;  4F2O A;  1Q1K A;  3MBP A;  4MCO A;  4R73 A;  1LAX A;  1FBD A;  3G3H A;  3ZSF A;  4ZEI A;  4ZEB A;  4OEN A;  4NMY A;  5EQ9 A;  4KD5 A;  4OMB A;  4DIG A;  4F22 A;  1P1W A;  3B6T A;  4GXA A;  2OJT A;  3DEL B;  3UOR A;  3FIR A;  4R2F A;  3PUX E;  4F2Q A;  1XVX A;  1NV7 A;  1DBZ A;  1EZ9 A;  2F36 A;  1AIV A;  2WYK A;  2F34 A;  3HO7 A;  1GV8 A;  3LC8 A;  3TUS A;  4AB5 A;  4G8N A;  5I5P A;  3SEY A;  1S7Y A;  3MQ9 A;  3TQL A;  3T1B A;  1BP5 A;  4KYD A;  1LGB C;  1MQI A;  3PPR A;  3MJN A;  3V83 A;  1P1N A;  1EYK A;  5I58 A;  2V84 A;  4OVJ A;  2YPN A;  4PFR A;  4EXL A;  4OA4 A;  2ONS A;  4R6K A;  2PFZ A;  3EHU A;  1ATG A;  2XHD A;  3CRB A;  3KSJ A;  4JBZ A;  1VFE A;  4G68 B;  1HSE A;  1CB6 A;  4I1D A;  3RGY A;  1FPG A;  2CEY A;  4EQ9 A;  3Q27 A;  1P99 A;  2P3V A;  4GWU A;  1CNQ A;  3H03 A;  2RC7 A;  3EKI A;  4PBQ A;  4PP0 A;  1L5T A;  5M2V A;  2FIX A;  3H7M A;  1IXH A;  2RF1 A;  4NTL A;  1NUY A;  2HFB A;  3VLU A;  1NH8 A;  1KZ8 A;  1ZIU A;  4HCY A;  1OQG A;  3BKI B;  3FJ7 A;  2B3F A;  4POW A;  2XX8 A;  5A5X A;  5AA2 D;  2RCA A;  3D4G A;  1FBP A;  3ILT B;  5FBP A;  1MY0 A;  3NOH A;  1ANF A;  4JVD A;  4YAH X;  3A3C A;  4NF5 B;  3PPQ A;  4OES A;  4JVI A;  2F6P A;  3WAE A;  2V25 A;  2QS4 A;  3ONM A;  3TOD A;  1I6A A;  2ZXT A;  5AA1 A;  3O28 A;  4OER A;  2Y7K A;  3RTW B;  2FHY A;  4RNS A;  4IR8 A;  4M4G A;  4LON B;  3HCQ A;  4NHB A;  2DE2 A;  5ELV A;  1FJ9 A;  5EHM A;  4NF6 A;  4GWX A;  2AL5 A;  2I0C A;  3O97 A;  2HXW A;  4JWY A;  4EDP A;  1R6Z A;  3OD7 A;  4OWD A;  4YIC A;  1IIT A;  4GIZ A;  1YYZ A;  4EF1 A;  4IO4 A;  3PGF A;  1EYJ A;  4O3C A;  4TQU Q;  3S9N C;  5JTY B;  3T96 B;  1WOD A;  3FV1 A;  3RPW A;  1MY1 A;  3PTY A;  2H5Y A;  2AL4 A;  2ONR A;  5CMM A;  2CZI A;  1FBE A;  3TTM A;  3T93 B;  1B4H A;  2R8T A;  3TYH A;  2HEU A;  4R74 A;  3CFL A;  1ZTY A;  1YPN A;  1A7L A;  5TU0 A;  3HHG A;  2ZYM A;  3QMF A;  3MVZ A;  1XT8 A;  1JET A;  3EPE A;  5K2X A;  1IMC A;  1FBG A;  3GXA A;  4I62 A;  1US4 A;  1UTB B;  3C33 A;  4YKJ A;  1LAH E;  5H8N A;  3G3J A;  4IY5 A;  5AE4 A;  3OEL A;  2D5W A;  4PF6 A;  2O68 A;  3OSR A;  4PE3 A;  2VT5 A;  5EYH A;  3TAJ A;  3T9V A;  4R9F A;  1I6B A;  4Q0C A;  2ZNS A;  3M3L A;  1QW0 A;  2REJ A;  3C34 A;  3I3V A;  3U1O A;  2DVC A;  1EYI A;  1EU8 A;  2DSF A;  5FHO A;  2F97 A;  5LTC A;  4MLV A;  4RJZ A;  3C32 A;  2QS2 A;  2QRY A;  4IO7 A;  1JVY A;  2VP1 A;  3N94 A;  4WXJ A;  4KI0 E;  1N3X A;  2F8D A;  1B51 A;  1MY3 A;  5H8F A;  1VE4 A;  1LB8 A;  4ZE8 A;  4RXL A;  1ZU0 A;  1NNK A;  1KWH A;  4X9T A;  3PUZ E;  2W7Y A;  1IXI A;  3QK6 A;  5ET6 A;  3C35 A;  2Q74 A;  3T66 A;  4QRZ A;  3K1N A;  4KCC A;  5TP9 A;  1LFI A;  3QUJ A;  2O1M A;  1MXU A;  4OFL A;  4QSC A;  3KBR A;  4MH5 A;  3IAZ A;  3THI A;  2ZNU A;  2O7U A;  1TFA A;  1PDA A;  2Q9T A;  2X7Q A;  4N13 A;  3C36 A;  3USD A;  1YCJ A;  1WDN A;  2DVZ A;  2I48 A;  3RTF B;  2G29 A;  4DDD A;  1B0L A;  3HPI A;  1H3D A;  4OQO A;  2X7P A;  4EF2 A;  4RK9 A;  3ZKL A;  4R75 A;  3SEV A;  1LBB A;  3U92 A;  3HN0 A;  1PB8 A;  1NV4 A;  1OLA A;  1QKB A;  1MQD A;  4X1B A;  1RYO A;  3UIF A;  3MUQ A;  1NUX A;  2Z8F A;  1N04 A;  3K2D A;  3MVY A;  2QVU A;  5I84 A;  1O63 A;  2DWI A;  4KR5 A;  1NUZ A;  4N81 A;  4YZZ A;  3VXC A;  1OIB A;  1UIV A;  3EQ1 A;  5IZ1 A;  3U93 A;  4U22 A;  1B6H A;  3D4C A;  2DWH A;  4EQ7 A;  1LEV A;  1FQD A;  5B7D A;  2QFL A;  4GVO A;  4G77 A;  4G68 A;  4PFW A;  4ISU A;  1FPE A;  1JVX A;  1Y3N A;  3G7W A;  5I56 B;  4RK2 A;  3UGW A;  2R9J A;  4ONY A;  2XX9 A;  1RDX A;  3L6H A;  2XX7 A;  5KDT A;  1LBV A; 
#chains in the Genus database with same CATH homology
 4OTE A;  3K6X A;  3TCH A;  3FJM A;  1Y20 A;  4F1V A;  1CE2 A;  4LA9 A;  3TMG A;  4H8J A;  4H6D A;  2NVU B;  5ISU A;  2XD2 A;  2XXW A;  4NE4 A;  2Y7I A;  3N5L A;  3OSQ A;  4OXV A;  4GLI A;  4XKQ A;  4NF5 A;  3SDF A;  4OET A;  4I9D A;  2D21 A;  2I0B A;  1EZO A;  2LAO A;  5I59 A;  1VSO A;  1PBQ A;  2V3U A;  2UVJ A;  1DMB A;  2XD3 A;  2B65 A;  1DPE A;  1MM6 A;  1M5E A;  4UA8 A;  1JW5 A;  1JQF A;  5DYH A;  5AA2 B;  1IUD A;  1D9Y A;  2ZYN A;  3OXN A;  3DP6 A;  5CBS A;  2Q8J A;  2V93 A;  1A99 A;  3C31 A;  4GRK A;  5JTY A;  2XXU A;  3VXB A;  4LZ8 A;  1MM7 A;  1QUK A;  3MWB A;  3G3G A;  3N6U A;  1MXX A;  2DQV A;  1AOV A;  3QYT A;  3KZG A;  5ITP A;  1FTK A;  3OEM A;  4LVQ A;  5FHN A;  1LAF E;  1HSJ A;  4WKM A;  2I4B A;  3S9L C;  4IO6 A;  3K1P A;  1SW5 A;  3RQT A;  3EHS A;  5AA4 B;  2M8C A;  4YB7 A;  1B7U A;  4EUO A;  4YMB A;  1XC1 A;  1FW0 A;  1MDP 1;  1UTB A;  4G68 C;  2ZNT A;  3IB1 A;  2G93 A;  1B7H A;  4RPN A;  1Y3P A;  4WED A;  3GBB A;  2UVG A;  4IO5 A;  1TFD A;  4F29 A;  4DCX A;  2BJJ X;  2PT2 A;  3EHT A;  2KLF A;  3KG2 A;  1O7T A;  3WAF A;  1VR5 A;  3IJX B;  4DE8 A;  3MZ1 A;  4QFL A;  1NMU A;  2XXY A;  3QIM A;  4THI A;  4ZZE A;  1DSN A;  2FA7 A;  5L9S A;  3ODB A;  3G3K A;  2O51 A;  3PMW A;  3K00 A;  3E3K A;  3MAM A;  1UTH A;  3VVE A;  4HS7 A;  5L9M A;  2P1S A;  3PD9 A;  3IL1 B;  3TCF A;  4U1O A;  3SEU A;  4BDN A;  1B5J A;  4ELO A;  2XXH A;  3K0V A;  5KCJ B;  3QUF A;  1Y4T A;  2YJP A;  2Z8D A;  4H1X A;  4BDO A;  5I2K B;  3TDJ A;  1GGG A;  3Q29 A;  1QUI A;  4F31 B;  3HST A;  3ZKK A;  2XXQ A;  3BFT A;  3SKP A;  4FE8 A;  3RNN A;  3FAS A;  2GRV A;  1TXF A;  2Q89 A;  4DXB A;  1B5H A;  4FIM A;  3E9X A;  5HM4 B;  3OO7 A;  3TZA A;  3PU5 A;  1BIY A;  3W9V A;  3VFJ A;  2CMO A;  1II5 A;  4LP2 B;  1MPC A;  4Q5T A;  1B2H A;  4GD5 A;  1MXZ A;  5I56 A;  4ZDM A;  1Y1M A;  2VD3 A;  1N3W A;  4KPT A;  1Z7N E;  2XXR A;  3DP8 A;  5FHM A;  4NF4 B;  4P0I A;  2GHA A;  3KOS A;  2XXP A;  2IA4 A;  1P1U A;  4GOT A;  3BFU A;  3IOU A;  4ND9 A;  3LSF B;  5F1Q A;  2NUV A;  2PYY A;  4H0W A;  3N6T A;  3QSL A;  1IIW A;  1O64 A;  4E0X A;  5J1D A;  2I4C A;  3OO9 A;  4HCW A;  1P1Q A;  5LOM A;  3VV5 A;  4YB6 A;  3PD8 A;  4QFP A;  3UK4 A;  1B3H A;  3PMX A;  1MG1 A;  2UYE A;  2I3W A;  3DM0 A;  1B58 A;  5HPQ A;  1MXW A;  2XXT A;  4YKK A;  3IK6 B;  2DXY A;  4G4P A;  3MW0 A;  5AA2 A;  4RY1 A;  1P1O A;  2PT1 A;  4GFR A;  4F3S A;  3KJ7 A;  1B4Z A;  2HCA A;  2H9B A;  3H06 B;  1BKA A;  1QVS A;  4YU0 A;  4BLA A;  4C1T A;  3I6V A;  5I2N B;  2DE3 A;  2P0S A;  2XXX A;  1QUJ A;  1LFG A;  3MC2 A;  4FAJ A;  3U72 A;  1POT A;  4WEP A;  3MPK A;  3O6G A;  1LAG E;  4U4S A;  3S2V A;  1M5F A;  2E0S A;  5CMB A;  3OO6 A;  3FZV A;  4LUB A;  4ZEF A;  1R1N A;  3K6W A;  2RC9 A;  4ESX A;  2O69 A;  5F7V A;  3VLW A;  1R9Q A;  2UYF A;  5AA3 A;  5K2Y A;  3AXF A;  4XKN A;  3MVW A;  1HSL A;  3OEN A;  3SEW A;  2H25 A;  3T9U A;  1MDQ A;  5I57 B;  1MRP A;  2ALU A;  4POX A;  1B3F A;  1Y9U A;  3JYR A;  4IY6 A;  3LR1 A;  3RY3 A;  1SW2 A;  2O6A A;  3FUZ A;  3PMV A;  3KFM A;  3FVK A;  3LUY A;  4GF8 A;  2VD2 A;  1SI1 A;  3PUV E;  1N7X A;  4QFK A;  1M5B A;  2PVU A;  1GVC A;  1F9B A;  5H8H B;  3B6W A;  1B3L A;  4R9G A;  4ZEK A;  2ZMB A;  3IX1 A;  4JXI A;  1XVY A;  3Q28 A;  2F6G A;  4HW8 A;  1URG A;  1H44 A;  3FV2 A;  4ECF A;  3K6U A;  4IB2 A;  3VVD A;  3H6U A;  3RUM A;  4QF9 A;  4P0G A;  4C0R A;  3SES A;  3U8Q A;  3SET A;  3CG3 A;  2F7C A;  2O1L A;  3R26 A;  3TEL A;  5KCJ A;  2QSX A;  1FQE A;  5I58 B;  4H5G A;  5I2K A;  2B3B A;  4LAT A;  1MPB A;  2OLB A;  4XIG Q;  2H4I A;  1URD A;  2O84 X;  2Y7P A;  4H67 A;  4RA1 A;  3FVN A;  4YB5 A;  4RPO A;  1IQ7 A;  1D4N A;  5CM6 A;  4GL0 A;  3K01 A;  3O6H A;  1FCK A;  2ESN A;  1MQG A;  2DWA A;  4ZED A;  4PE5 B;  3L6G A;  3VE1 B;  4KHZ E;  2Q88 A;  5A5X B;  3PUW E;  2DYX A;  4OHN A;  3C9H A;  3HV1 A;  1LCF A;  4Q8R A;  3DLN A;  3LSX A;  1XHY A;  5DEX B;  3TCG A;  4NF4 A;  3KGC A;  4I8C A;  2Y84 A;  4G8M A;  4ELP A;  2F5X A;  5BUU A;  4QFN A;  1OLC A;  3O6I A;  3TTN A;  1JNF A;  5DVF A;  3MP8 A;  1ZKB A;  1ELJ A;  1MH3 A;  1PEB A;  2F35 A;  4DXC A;  4F1Y A;  3S4U A;  1UIU A;  4F3B A;  2RC8 A;  4ZE9 A;  4PFU A;  3RT6 B;  3IOT A;  5ICT A;  3Q26 A;  4H65 A;  3W9W A;  3N26 A;  5TPA B;  5DVI A;  1NFT A;  1B3G A;  4ESW A;  4JDF A;  1A8E A;  1MS7 A;  1ZBM A;  4NWC A;  4AB6 A;  1TWY A;  3IB0 A;  1JW4 A;  4LQ5 A;  3I5O A;  1SVX B;  1USY E;  2QS3 A;  3PUY E;  4U4X A;  1M5D A;  3CVG A;  4JSO A;  1RKM A;  1RYX A;  2ZYK A;  4JWX A;  1A8F A;  2NWJ A;  2UXA A;  1DOT A;  1N84 A;  3H6W A;  2DXR A;  1NH7 A;  2Z8E A;  1MH4 A;  3PPP A;  3ILU B;  3IB2 A;  3A3U A;  4BDM A;  3TTK A;  1Q35 A;  3VDF A;  3SEX A;  4ELQ A;  2GFE A;  5DVJ A;  2XXI A;  4ELR A;  3GBA A;  1T0K A;  5H8N B;  1B7Z A;  1ZJL A;  2HAV A;  4QFO A;  3EF7 A;  1N7W A;  5DTB A;  2FNC A;  3KOT A;  1EH3 A;  1B46 A;  3G3I A;  4NWD A;  5DT6 A;  1N0T A;  4OEV A;  4U21 A;  1USY H;  4O3A A;  5I57 A;  2QS1 A;  2RIN A;  2QL3 A;  5CC2 A;  3MP6 A;  4DZ1 A;  4OEU A;  2H99 A;  1VFD A;  3FVG A;  4EQB A;  2DP8 A;  3KSX A;  4DLD A;  3FVO A;  4JB7 A;  2PMS A;  2HAU A;  3MPL A;  1JW1 A;  1FTM A;  3K1M A;  4Z0I A;  2ANJ A;  3MZ9 A;  4NED A;  2V3Q A;  1IXG A;  2GH9 A;  2P2A A;  2HZK A;  3KN7 A;  4XXU A;  5TP9 B;  5CI5 A;  5H8H A;  3QAX A;  1WVJ A;  4KQP A;  1MXY A;  3H4Z A;  3TKD A;  5L9O A;  1IZ1 A;  5L8D A;  2HQ0 A;  4H5F A;  3OO8 A;  1JEU A;  2PBW A;  1LLS A;  2CZL A;  4KFQ A;  1SW4 A;  2OBG A;  1LFH A;  4F3P A;  1LB9 A;  4XTC Q;  1BTJ A;  4GL8 A;  4N07 A;  4TLL B;  2X26 A;  4N6P A;  3CI8 A;  2F7A A;  1IEJ A;  2I58 A;  4EXK A;  5JEI A;  3E13 X;  1SD3 A;  2F7B A;  3F11 A;  4M1V A;  3P7I A;  4GQO A;  4O3B A;  2Z22 A;  2Z23 A;  2IEE A;  1MPD A;  3LSL A;  1JEV A;  1D9V A;  5H8Q B;  1OQH A;  5CMK A;  1PBP A;  5KDT B;  2E1S A;  1LBC A;  1NL5 A;  3TFL A;  1A40 A;  2QPQ A;  3V89 B;  3UP9 A;  1UQW A;  3PPO A;  3KJT A;  4R6H A;  1FQA A;  3FXR A;  4G2Z A;  4MLQ A;  4YKP A;  2ZYO A;  2F78 A;  2Q2C A;  5ICQ A;  2Q2A A;  2FYI A;  3CR9 A;  3UA8 A;  4QSD A;  3FGS A;  5ITO A;  4DXU A;  3O66 A;  1US5 A;  4U1Z A;  3A09 A;  4DCY A;  2D3I A;  5DEX A;  5JK4 A;  1S9T A;  3CSB A;  2QJE A;  1S50 A;  3TEP A;  3M3F A;  5I59 B;  1URS A;  5CMC A;  3RLF E;  3V8X B;  3JV9 A;  4MBP A;  3OMB A;  2DE4 A;  2AYS A;  1QJM A;  2NXO A;  5EYF A;  3SER A;  2RKM A;  3S9E A;  3VLV A;  2VOZ A;  5TPA A;  1MY2 A;  1M5C A;  5CBR A;  1GTK A;  2R6G E;  4L17 A;  2A5T B;  1B9J A;  4K3F A;  5IKB A;  4F39 A;  1NNT A;  4GWO A;  1PB9 A;  1MXV A;  3TPA A;  2A5S A;  4LZ5 A;  1B32 A;  1A54 A;  4IGT A;  5CRY A;  3OEK A;  4XKR A;  3T9X B;  3IJO B;  1B5I A;  1A55 A;  4NF8 B;  1B52 A;  2PX1 A;  4JWO A;  4ZZA A;  1I69 A;  2I3V A;  1BLF A;  4HTG A;  5AA4 A;  4LQ2 A;  4P11 A;  2Y7W A;  4PET A;  3QXM A;  3DP4 A;  4KYE A;  1DPP A;  2REG A;  1OVT A;  4OZ9 A;  3PPN A;  5FTI A;  4OFO A;  4QHQ A;  3IO6 A;  3TTL A;  3ZS6 A;  4MF3 A;  1YTV A;  3LSW A;  4F1U A;  4YMA A;  5HBC A;  3GLB A;  1Y1Z A;  3FXQ A;  1DTZ A;  4FJP A;  3VVF A;  1IXC A;  3B6Q A;  2UVI A;  1MQJ A;  3V5A A;  5FTH A;  5IAI A;  3IO4 A;  4E0W A;  2DOJ A;  4RYA A;  2I49 A;  3MP1 A;  4BDL A;  1ZMG A;  4FED A;  1B05 A;  2OZZ A;  1B1H A;  2OWT A;  3KEI A;  4FEB A;  3IOR A;  4IO3 A;  2ABH A;  2DS9 A;  3RN8 A;  3CIJ A;  1D3K A;  1FTO A;  2HZL A;  4JSD A;  1UTH B;  2Y7R A;  4Q30 B;  1SI0 A;  3JZJ A;  1SDX A;  4H8I A;  3PV0 E;  3FXU A;  4F3G A;  3TQW A;  3H6V A;  2ONK E;  4QSE A;  3W15 C;  1I6Q A;  1Y3Q A;  1FQF A;  3C4M A;  3IOV A;  4PQJ A;  4IGR A;  2R71 A;  3IOW A;  2DWJ A;  4F18 A;  3Q25 A;  3K4U A;  1NNF A;  4UAC A;  4LZ7 A;  3KN3 A;  3TTR A;  4MFI A;  1TT1 A;  1MY4 A;  3CG1 A;  1POY 1;  3O9P A;  1OMP A;  1B3E A;  1AMF A;  5H8Q A;  3HHF A;  1AL3 A;  2NOO A;  4TOZ A;  1PC3 A;  1H76 A;  4U2R A;  2V3T A;  3E4R A;  4FEC A;  1J1N A;  1LCT A;  1FQC A;  1Z7M E;  4Z7E A;  1ZLQ A;  4PFT A;  2QMX A;  1AH5 A;  1PB7 A;  3O29 A;  4ZEC A;  1SW1 A;  2UVH A;  3IR1 A;  5B70 A;  4OYV A;  2RCB A;  3ECR A;  2YLN A;  2OK2 A;  1B40 A;  4NF6 B;  4BDQ A;  4ZS9 A;  3M8U A;  1SQY A;  4C1U A;  4TLM B;  1LST A;  3S9M C;  2VGQ A;  3CSG A;  5EHS A;  1B1X A;  1NKX A;  4PFY A;  1EZP A;  1XOC A;  5KZT A;  4FOR A;  3GZG A;  3CFZ A;  3U94 A;  3EN3 A;  1SYH A;  2OWS A;  4XKP A;  2A5T A;  3G3F A;  1H45 A;  3LBS A;  1R9L A;  2WKY A;  4FAT A;  5I2N A;  3RT8 A;  1MQH A;  2GHB A;  4BDR A;  2THI A;  4U23 A;  1QKA A;  4AQ4 A;  3MZB A;  2OCU A;  2XXV A;  3OOA A;  4YKI A;  3FJG A;  1SBP A;  4GXS B;  2I6E A;  1GR2 A;  4X48 A;  1N76 A;  4NF8 A;  3K02 A;  3T22 A;  3KN8 A;  4X1D A;  3M3K A;  2QMW A;  3BBR A;  3FD3 A;  1YAE A;  3H3G A;  2AIX A;  3CFX A;  1FTJ A;  1H43 A;  3H6T A;  1NNP A;  3R6U A;  4F19 A;  1SYI A;  3R7X A;  4R6Y A;  3T9H B;  1DTG A;  3O2A A;  3MVX A;  2VHA A;  2O7I A;  1XS5 A;  4R2B A;  5H8F B;  1FQB A;  4OFJ A;  1B0H A;  4KCD A;  5BWJ A;  4IO2 A;  3K6V A;  1OVB A;  3UN6 A;  1FTL A;  3B7D A;  3FAT A;  4R72 A;  4KYS A;  5H8S A;  1QUL A;  2H98 A;  4G8H A;  1Y4C A;  4F2O A;  1Q1K A;  3MBP A;  4R73 A;  1LAX A;  3G3H A;  3ZSF A;  4ZEI A;  4ZEB A;  4OEN A;  4NMY A;  4KD5 A;  4OMB A;  4DIG A;  4F22 A;  1P1W A;  3B6T A;  4GXA A;  2OJT A;  3DEL B;  3UOR A;  3FIR A;  4R2F A;  3PUX E;  4F2Q A;  1XVX A;  1EZ9 A;  2F36 A;  1AIV A;  2F34 A;  3HO7 A;  1GV8 A;  3LC8 A;  3TUS A;  4AB5 A;  4G8N A;  3SEY A;  1S7Y A;  3MQ9 A;  3TQL A;  1BP5 A;  4KYD A;  1LGB C;  1MQI A;  3PPR A;  3MJN A;  3V83 A;  1P1N A;  5I58 A;  2V84 A;  4OVJ A;  2YPN A;  4EXL A;  2ONS A;  4R6K A;  3EHU A;  1ATG A;  2XHD A;  3CRB A;  3KSJ A;  4JBZ A;  1VFE A;  4G68 B;  1HSE A;  1CB6 A;  4I1D A;  3RGY A;  4EQ9 A;  3Q27 A;  1P99 A;  3H03 A;  2RC7 A;  4PP0 A;  1L5T A;  5M2V A;  3H7M A;  1IXH A;  2RF1 A;  4NTL A;  2HFB A;  3VLU A;  1NH8 A;  1ZIU A;  4HCY A;  1OQG A;  3BKI B;  3FJ7 A;  2B3F A;  4POW A;  2XX8 A;  5A5X A;  5AA2 D;  2RCA A;  3D4G A;  3ILT B;  1MY0 A;  1ANF A;  4YAH X;  3A3C A;  4NF5 B;  3PPQ A;  4OES A;  2F6P A;  3WAE A;  2V25 A;  2QS4 A;  3ONM A;  3TOD A;  1I6A A;  2ZXT A;  5AA1 A;  3O28 A;  4OER A;  2Y7K A;  3RTW B;  4RNS A;  4M4G A;  4LON B;  3HCQ A;  2DE2 A;  5ELV A;  5EHM A;  4NF6 A;  2AL5 A;  2I0C A;  3O97 A;  2HXW A;  4JWY A;  4EDP A;  1R6Z A;  3OD7 A;  4OWD A;  4YIC A;  1IIT A;  4GIZ A;  4EF1 A;  4IO4 A;  3PGF A;  4O3C A;  4TQU Q;  3S9N C;  5JTY B;  3T96 B;  1WOD A;  3FV1 A;  3RPW A;  1MY1 A;  2H5Y A;  2AL4 A;  2ONR A;  5CMM A;  3TTM A;  3T93 B;  1B4H A;  3TYH A;  2HEU A;  4R74 A;  3CFL A;  1ZTY A;  1YPN A;  1A7L A;  5TU0 A;  3HHG A;  2ZYM A;  3MVZ A;  1XT8 A;  1JET A;  3EPE A;  5K2X A;  3GXA A;  4I62 A;  1US4 A;  1UTB B;  3C33 A;  4YKJ A;  1LAH E;  5H8N A;  3G3J A;  4IY5 A;  5AE4 A;  3OEL A;  2D5W A;  2O68 A;  3OSR A;  3TAJ A;  3T9V A;  4R9F A;  1I6B A;  4Q0C A;  2ZNS A;  3M3L A;  1QW0 A;  2REJ A;  3C34 A;  3I3V A;  3U1O A;  2DVC A;  1EU8 A;  2DSF A;  5FHO A;  2F97 A;  4MLV A;  4RJZ A;  3C32 A;  2QS2 A;  2QRY A;  4IO7 A;  4WXJ A;  1JVY A;  2VP1 A;  3N94 A;  4KI0 E;  1N3X A;  2F8D A;  1B51 A;  1MY3 A;  5H8F A;  1VE4 A;  1LB8 A;  4ZE8 A;  4RXL A;  1ZU0 A;  1NNK A;  1KWH A;  4X9T A;  3PUZ E;  2W7Y A;  1IXI A;  3QK6 A;  3C35 A;  3T66 A;  4QRZ A;  3K1N A;  4KCC A;  5TP9 A;  1LFI A;  3QUJ A;  2O1M A;  1MXU A;  4OFL A;  4QSC A;  3KBR A;  4MH5 A;  3IAZ A;  3THI A;  2ZNU A;  2O7U A;  1TFA A;  1PDA A;  2Q9T A;  2X7Q A;  4N13 A;  3C36 A;  3USD A;  1YCJ A;  1WDN A;  2DVZ A;  2I48 A;  3RTF B;  2G29 A;  4DDD A;  1B0L A;  3HPI A;  1H3D A;  4OQO A;  2X7P A;  4EF2 A;  4RK9 A;  3ZKL A;  4R75 A;  3SEV A;  1LBB A;  3U92 A;  3HN0 A;  1PB8 A;  1OLA A;  1QKB A;  1MQD A;  4X1B A;  1RYO A;  3UIF A;  3MUQ A;  2Z8F A;  1N04 A;  3K2D A;  3MVY A;  5I84 A;  1O63 A;  2DWI A;  4KR5 A;  4YZZ A;  3VXC A;  3U93 A;  1OIB A;  1UIV A;  3EQ1 A;  4U22 A;  1B6H A;  3D4C A;  2DWH A;  4EQ7 A;  5B7D A;  1FQD A;  4GVO A;  4G77 A;  4G68 A;  4PFW A;  4ISU A;  1JVX A;  1Y3N A;  3G7W A;  5I56 B;  4RK2 A;  3UGW A;  2R9J A;  4ONY A;  2XX9 A;  3L6H A;  2XX7 A;  5KDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...