1B3EA

Human serum transferrin, n-terminal lobe, expressed in pichia pastoris
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
Knots found
sequence length
330
structure length
330
Chain Sequence
KTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDNYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallography and mass spectroscopy reveal that the N-lobe of human transferrin expressed in Pichia pastoris is folded correctly but is glycosylated on serine-32.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Iron transport
molecule keywords PROTEIN (SERUM TRANSFERRIN)
total genus 102
structure length 330
sequence length 330
other databases KnotProt 2.0: K
ec nomenclature
pdb deposition date 1998-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b3eA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b3eA02
1LFIA 3Q26A 4R6HA 4N13A 2RF1A 3C31A 2F7CA 1H44A 1M5DA 1WDNA 1N84A 4QSEA 1D3KA 5ISUA 5IKBA 1FW0A 1UTBA 4FECA 4OFOA 3F11A 4R2FA 3KBRA 3IB2A 3CG3A 1MY1A 3PPOA 4YB5A 4DCXA 3HN0A 4KYEA 1SW4A 4F39A 1QJMA 3LSXA 2ONKE 2DQVA 4ZS9A 3BFTA 3TTRA 2G93A 1I6AA 2UVGA 4JDFA 4KI0E 1GGGA 4YAHX 5I58A 1PB8A 4RYAA 3IOUA 2AL4A 2ONSA 3EHUA 3KN7A 4G8MA 4GD5A 3USDA 5KCJB 4F3SA 3OO8A 1EZOA 1D9YA 4R75A 1UTBB 2XXXA 4OXVA 4KD5A 1I6BA 4PFTA 2PX1A 3SETA 1B0LA 4XIGQ 1LAXA 2RC8A 1SDXA 3I6VA 4ONYA 4JWYA 1MH3A 4KYSA 4EQ7A 1AL3A 3S4UA 1O64A 3HHFA 2Z8DA 1OQHA 3S9LC 1BIYA 3CFXA 1ZJLA 1VE4A 3OD7A 4R6YA 4FEDA 5F7VA 1TFAA 3IK6B 1BLFA 1JEUA 1IQ7A 2AL5A 2Z8FA 3FVOA 3E4RA 5DYHA 3PGFA 4ESXA 3KGCA 4XKNA 3RQTA 4BDRA 1XT8A 2YJPA 3OELA 4F3BA 4TLLB 4THIA 3OENA 2RINA 2WKYA 2F6GA 1R1NA 4H6DA 4RPOA 3T22A 3GZGA 3O6GA 1P1OA 1B46A 1HSJA 3PPPA 4RPNA 4BDMA 3U1OA 1MPDA 1MPCA 1NNTA 1H43A 3K6VA 1P99A 2QS4A 5K2XA 5CRYA 1MY0A 2O7UA 5L8DA 3JYRA 1B05A 3H03A 3JZJA 3SESA 3THIA 2O7IA 3K1PA 3WAEA 3IB0A 5CMMA 3VLWA 4YMAA 4UACA 1LFGA 4YKKA 2RCBA 5AA1A 3MAMA 2E0SA 2VD2A 1UTHA 3G3GA 1FQEA 1B7HA 2X7QA 3MVYA 2FYIA 1M5BA 3H6WA 3RPWA 1N3XA 1OMPA 1YCJA 4QFOA 1A7LA 3PUYE 2Y7PA 1DTGA 3VVDA 5ITPA 1II5A 3CI8A 4F19A 2O6AA 5HM4B 1XOCA 3PMXA 5F1QA 3MW0A 1ZIUA 3TQLA 3WAFA 5KDTA 5TU0A 3CR9A 3PMWA 3W9WA 4IGTA 2ABHA 4IY6A 5HPQA 5JEIA 3MZBA 3G7WA 3PUZE 1LCTA 1NNPA 4X48A 1US5A 3TYHA 3ZSFA 1S50A 4IO7A 2XXIA 2D21A 1FTKA 2V93A 2R6GE 1FQAA 2F35A 2VHAA 3FVKA 3N94A 4JWXA 2R71A 3EPEA 1Y3QA 3KJ7A 2Q89A 3K6UA 4OZ9A 3V5AA 4OFJA 1FQFA 4U22A 3S2VA 4F18A 1XVYA 1FQBA 1B52A 2H25A 3PUVE 4GQOA 3SERA 3O6IA 3CIJA 4PP0A 4C0RA 4YMBA 1NL5A 2XXUA 2A5TB 1Y9UA 2V25A 4LQ2A 3VDFA 1M5EA 2XXYA 3KOTA 1Y20A 4YB7A 1EZPA 1QKAA 4XKPA 3UA8A 4N07A 2DWHA 3HCQA 1S7YA 3G3KA 3ONMA 3MVZA 4KHZE 3SKPA 3CVGA 4O3AA 1SW2A 1UIUA 4EF1A 4JB7A 1MM6A 2R9JA 3K01A 1ZMGA 3OOAA 4G77A 4XTCQ 5CMBA 3KSJA 2D3IA 3TEPA 4GF8A 1USYH 1A40A 1LFHA 4OQOA 4BLAA 4G8HA 3PU5A 3PUWE 4MF3A 4LZ7A 4WKMA 4BDQA 3QYTA 2GFEA 3QXMA 4MH5A 1NMUA 1TXFA 1R9QA 3FJMA 1NKXA 3OEMA 1NH7A 2Q9TA 2QS3A 4NF4B 4OVJA 3V83A 2UYEA 2XXWA 1AMFA 3C4MA 1JW1A 1O7TA 1GR2A 3ZKKA 2OBGA 2CZLA 3VXBA 5AA2D 1P1WA 2P1SA 3RY3A 3Q29A 2XD3A 3K1NA 1TFDA 1Y4TA 1YAEA 1OVBA 3IOWA 4G68B 4QRZA 1I69A 4LP2B 3E3KA 3MPLA 4H5GA 4NF4A 3GLBA 3KZGA 4HCWA 4R2BA 3FIRA 1SBPA 3V8XB 2V3TA 1B1XA 3TPAA 4R9GA 1SYIA 1URSA 3H6TA 3T9VA 5A5XB 4I8CA 2ANJA 1MXYA 2UVIA 1USYE 3FXRA 3H7MA 4NF8B 3FV2A 4OEVA 4EXLA 1QKBA 2HAUA 3MJNA 3ZKLA 4HTGA 2W7YA 2UVHA 1SVXB 3C34A 4GWOA 4EXKA 4OTEA 5H8QB 3TKDA 1YPNA 4Q8RA 1B32A 3QIMA 5JTYA 3FJ7A 2XX8A 4JSOA 1SQYA 4FE8A 4LONB 2Q2CA 4OWDA 4P11A 1MDQA 1POTA 5ICQA 1BTJA 1IXIA 4GXAA 2O51A 1N7XA 1IXHA 2REGA 1LSTA 2B3FA 3I5OA 4ZE8A 4QSCA 1QUIA 2I58A 3RTFB 2LAOA 2OWTA 2GHAA 3TAJA 3PD9A 1DPEA 5FHOA 5LOMA 1H3DA 4LVQA 4QFPA 1AIVA 2OJTA 2OLBA 4XXUA 4HS7A 3CSBA 5TP9A 4X1BA 4F2QA 4KPTA 2OCUA 2X26A 1B40A 1VFDA 3MZ1A 1B3EA 4NWCA 4M1VA 4NF6B 5CC2A 1OLAA 3RN8A 3KG2A 4YKIA 4PFYA 5I57B 2NXOA 2DS9A 3SEXA 1MQHA 4QHQA 1L5TA 2F78A 2NOOA 2Z23A 4GL8A 4WEDA 5I57A 2I0BA 2Y7IA 1JNFA 5EHSA 4QFKA 1B7ZA 4EUOA 3E13X 3KN8A 2F34A 4ELPA 1Y3NA 3JV9A 1NH8A 1URDA 4EQ9A 1PBQA 1VFEA 3K00A 1QULA 1A55A 4NF6A 1MRPA 3OMBA 4YB6A 4ZEFA 5L9MA 4AB6A 4Z0IA 1ELJA 3H3GA 3KSXA 3EF7A 3EQ1A 2O84X 3ILTB 4R73A 2Q2AA 3RNNA 1T0KA 3CFLA 1LCFA 1B58A 3OO9A 3IOTA 4GXSB 2F8DA 2Y7KA 2V3QA 2O69A 4ND9A 3SDFA 3V89B 5IAIA 2A5TA 2QL3A 2ZYOA 4C1UA 4IB2A 4FEBA 4KQPA 4IO6A 4GOTA 4WXJA 4F31B 5I2NB 4N6PA 1VR5A 4QFLA 3O2AA 3B6TA 3ILUB 4IO5A 3BFUA 1FTOA 3RUMA 2PBWA 4RNSA 1B3LA 4X1DA 4HW8A 1OIBA 4EQBA 3O66A 3ODBA 3B6WA 4Q30B 1FCKA 2HZKA 2DVCA 1JVXA 4F3PA 1Z7NE 4H8IA 1MXUA 2Y7WA 3MWBA 2UVJA 4ELRA 3KFMA 5I2NA 4JXIA 3LR1A 4NF8A 3ZS6A 1LBCA 3H6UA 4O3BA 1US4A 3MC2A 5B70A 3PV0E 1CE2A 3PPQA 3U8QA 1MQGA 2H4IA 2A5SA 4ZDMA 3FXUA 3AXFA 3M3LA 2AIXA 2HAVA 4KCCA 4BDNA 1LAFE 1KWHA 2NWJA 3KJTA 4F1YA 1B5JA 4ZEIA 3O9PA 2XXHA 2GRVA 1FTJA 3HHGA 3T9UA 3IJXB 3UK4A 3UORA 3L6HA 4O3CA 4G68A 3TUSA 3C36A 1JW4A 2FA7A 2QMXA 1Y1ZA 5CMCA 4EF2A 4EDPA 1YTVA 2Q8JA 1MS7A 1Z7ME 2M8CA 3TTMA 2ZNSA 1H45A 2YLNA 4DIGA 2XXTA 1IITA 2BJJX 1JVYA 5B7DA 2I3WA 3VVEA 3CFZA 1EU8A 3O97A 3R7XA 1LLSA 2OWSA 3EHSA 4LZ8A 4OYVA 3DM0A 1NFTA 4H0WA 3BKIB 3E9XA 2H99A 3K6XA 1ZBMA 1MM7A 3N26A 5JTYB 1B6HA 1UQWA 2F5XA 5AE4A 1O63A 3U94A 4YICA 2VGQA 1FTLA 2XD2A 3H06B 3M3FA 4PE5B 4U4XA 5DVFA 4PFWA 3Q28A 1MQIA 5CBRA 2XXRA 2QJEA 1NNFA 3PD8A 3SEWA 5DT6A 2ALUA 4DCYA 5ELVA 3CG1A 4TQUQ 3MQ9A 2H9BA 4MLQA 5I59A 1LB9A 1SW1A 4IO3A 5KDTB 4IO2A 1IZ1A 3OEKA 4NF5B 4E0XA 1FTMA 2I4BA 2O1MA 4JSDA 2YPNA 4R72A 1QUJA 3BBRA 1EH3A 3FGSA 1M5CA 2PT2A 1ZLQA 4GL0A 4LQ5A 3TTLA 3TDJA 3HPIA 3K1MA 3IO4A 3MVXA 3DP8A 2G29A 4LZ5A 1MXXA 1UTHB 1SW5A 3MZ9A 4R6KA 2UYFA 3HV1A 1FQCA 2F6PA 2PVUA 1OLCA 3KOSA 2CMOA 5DVIA 2HQ0A 4JWOA 5ICTA 2PT1A 1MXWA 4RK9A 5J1DA 4ISUA 2ONRA 3IO6A 4ZZAA 1IXCA 4P0GA 2Y7RA 4DDDA 3T66A 1ATGA 1A8EA 4TLMB 5DEXB 4TOZA 1DMBA 5FTHA 5M2VA 4FIMA 5K2YA 2VP1A 1B2HA 1CB6A 1N76A 2H98A 2QPQA 1DTZA 3EN3A 3M8UA 1B4ZA 3OO6A 4OHNA 5TPAB 1B3GA 3TTKA 4NTLA 1RYXA 3MUQA 4POXA 3MP1A 1FQDA 1H76A 1P1QA 4LA9A 2RKMA 5TPAA 3TODA 2I49A 2ZXTA 1MXVA 2ZYKA 4FATA 5KCJA 1RYOA 1GVCA 1MDP1 4MBPA 1Y3PA 5AA4A 1HSLA 3ECRA 3KEIA 4YU0A 4ZEDA 3MBPA 4I62A 4YKJA 4ZEKA 4DLDA 4FJPA 5AA4B 1A99A 1OVTA 4NE4A 3S9EA 1JQFA 1ZU0A 1WODA 4RY1A 4LUBA 2DSFA 2XXPA 1P1NA 5ITOA 3SEYA 3C33A 4Q5TA 2ZYMA 1ZTYA 1MXZA 4MFIA 1BP5A 3QUFA 3LC8A 4KYDA 4OETA 3MP8A 4GIZA 3TZAA 4I9DA 3TFLA 3FVNA 1DPPA 1GTKA 3OXNA 1B9JA 4RK2A 1LAHE 3HSTA 4U4SA 3UGWA 3QSLA 5JK4A 4NWDA 1ZKBA 1N7WA 1MQDA 2V84A 3C9HA 3DELB 3O6HA 1M5FA 3B7DA 1LB8A 4IY5A 4Q0CA 5FHMA 1D4NA 2NVUB 3VV5A 1QW0A 2I48A 3RTWB 1B4HA 3FASA 2Y84A 4GRKA 5A5XA 1A8FA 2PMSA 3K2DA 2ZMBA 4P0IA 2ZNTA 5TP9B 3TMGA 3UIFA 4PFUA 1EZ9A 1IUDA 3T93B 3T9XB 3W9VA 5H8QA 2DE2A 4H65A 2HCAA 4ELOA 3FV1A 2REJA 5H8HB 3LUYA 1J1NA 4DZ1A 5L9OA 2Q88A 1R9LA 1SI0A 1MY2A 1B51A 5I56B 1JEVA 1WVJA 1BKAA 2QS2A 1B5HA 3IR1A 5DEXA 1SYHA 3OSRA 3TCGA 2KLFA 2QS1A 3D4GA 4ESWA 1S9TA 4AQ4A 1DSNA 3DP4A 3PPRA 4DXCA 4AB5A 2FNCA 4GVOA 3H6VA 2DXYA 3TELA 4F2OA 1UIVA 4BDLA 1B1HA 5FTIA 5I2KB 4FAJA 5H8NB 3TCFA 3G3HA 1OQGA 1DOTA 4ZEBA 3HO7A 3U93A 4RJZA 1NNKA 4XKRA 3RT8A 5BUUA 1N0TA 2B65A 5CI5A 4QFNA 1PBPA 4I1DA 4LATA 5CBSA 1MH4A 5DTBA 2XX7A 2PYYA 3FXQA 5H8FA 4U21A 3CSGA 4OEUA 2HXWA 4OENA 2DYXA 2XXQA 5I84A 2ZNUA 3VLUA 3FATA 2NUVA 4ZE9A 3LSLA 4IGRA 3TQWA 3TTNA 3GBBA 5CM6A 3MPKA 4C1TA 5I56A 5HBCA 3O28A 1I6QA 3MP6A 3IORA 4U1OA 1R6ZA 3EHTA 4U1ZA 1Q1KA 1QUKA 1QVSA 3O29A 2UXAA 3LSWA 2E1SA 4G4PA 4G68C 3UN6A 2P0SA 1MY4A 4WEPA 1VSOA 2IA4A 2RC7A 3PMVA 1GV8A 4F1UA 4F22A 3RT6B 1B7UA 2DE3A 1TWYA 1IEJA 2F7AA 3CRBA 3IL1B 3K6WA 3R6UA 3G3JA 4R9FA 3T9HB 3VE1B 4OFLA 2DP8A 2QSXA 5H8SA 3M3KA 3FJGA 4OESA 2F97A 2OZZA 4YKPA 2DOJA 4DXUA 1A54A 3I3VA 5AA3A 4QF9A 1P1UA 3G3IA 3QAXA 5BWJA 3GXAA 3LSFB 3S9NC 1F9BA 1PC3A 4OMBA 4ZECA 2X7PA 2DE4A 4U2RA 2DWIA 2THIA 3DP6A 4Z7EA 2GH9A 1LBBA 1JETA 1B0HA 1MG1A 1Q35A 4PETA 3U92A 5FHNA 1N3WA 2Z22A 2VOZA 5DVJA 4ECFA 2DWJA 3A09A 4DXBA 2HFBA 4PQJA 4OERA 2VD3A 3GBAA 4GLIA 5KZTA 1PB7A 2B3BA 3RGYA 1ANFA 1B5IA 1URGA 2IEEA 4H67A 3A3CA 4KFQA 4F1VA 3FZVA 1AOVA 3C35A 1POY1 1TT1A 3OSQA 5EYFA 3K0VA 5AA2A 2I3VA 3IOVA 1Y4CA 4R74A 5L9SA 2H5YA 5CMKA 3IJOB 4G2ZA 1PEBA 1XHYA 2AYSA 1IXGA 1LAGE 2RC9A 2ZYNA 3PPNA 4H1XA 1PB9A 4U23A 4YZZA 5H8FB 1XS5A 2OK2A 2P2AA 5I58B 3LBSA 3IX1A 2XX9A 3N6UA 3MVWA 3DLNA 2D5WA 5AA2B 4DE8A 3VXCA 2F7BA 4MLVA 3QUJA 4H5FA 2GHBA 1MY3A 2V3UA 3B6QA 3G3FA 2Z8EA 3L6GA 4HCYA 4QSDA 3H4ZA 1MQJA 2I4CA 3P7IA 3N6TA 3OO7A 4XKQA 3U72A 3Q27A 3C32A 1B3HA 1IIWA 1HSEA 2I0CA 2DVZA 3R26A 4FORA 5EHMA 2QMWA 3SEVA 2DXRA 3FD3A 2ESNA 4IO4A 4X9TA 3RLFE 3TCHA 1RKMA 3VVFA 3D4CA 3Q25A 2RCAA 2XHDA 3W15C 3FVGA 4JBZA 1Y1MA 2O68A 2F36A 5H8HA 4ZZEA 3IAZA 2HZLA 4NMYA 1PDAA 1JW5A 2QRYA 2XXVA 4UA8A 4F3GA 1B3FA 3K02A 2O1LA 3KN3A 4NF5A 4F29A 4KCDA 4GFRA 4BDOA 3FUZA 4RXLA 5H8NA 3VLVA 5I2KA 1D9VA 4M4GA 5I59B 3S9MC 2HEUA 3K4UA 4POWA 1SI1A 1AH5A 1MPBA 1XVXA 1N04A 3UP9A 3T96B 1XC1A 3QK6A 4G8NA 2I6EA 4K3FA 1SD3A 3IB1A 3PUXE 4KR5A 4E0WA 4ELQA 3A3UA 4H8JA 4NEDA 3VFJA 4L17A 3SEUA 2DWAA 3N5LA 1LGBC 4RA1A
chains in the Genus database with same CATH superfamily
4R6HA 4QSEA 4GBWA 5ISUA 5IKBA 4YB5A 1DBZA 1FBDA 1MY1A 4KYEA 4PDDA 2UVGA 1GGGA 4YAHX 1PB8A 2AL4A 3EHUA 4GD5A 1EZOA 4F3SA 1D9YA 4OXVA 4KD5A 4PFTA 3SETA 2RC8A 4KYSA 4EQ7A 2Z8DA 4GWYA 3S9LC 1BIYA 1DCUA 1TFAA 1JEUA 5DYHA 3LV0A 5T3JA 3E4RA 1IMBA 4TLLB 4H6DA 3O6GA 1P1OA 1HSJA 4BDMA 1NNTA 5K2XA 1MY0A 5L8DA 1B05A 1LFGA 4YKKA 1EYJA 3G3GA 2FYIA 2WBBA 1N3XA 4PTKA 1A7LA 1DTGA 3VVDA 1II5A 3E79A 4IY6A 3G7WA 1S50A 4IO7A 2XXIA 2R6GE 2F35A 2Q89A 3V5AA 3S2VA 1NUYA 3SERA 3O6IA 3CIJA 4PP0A 2A5TB 2V25A 4LQ2A 4H46A 1M5EA 2XXYA 1EZPA 1QKAA 3UA8A 3ONMA 4JVIA 3SKPA 1UIUA 4PDHA 4JB7A 3TEPA 4I3EA 1USYH 1A40A 1LFHA 4G8HA 3PUWE 4WKMA 3QYTA 4OVJA 1AMFA 1JW1A 2OBGA 2CZLA 3T0JA 5AA2D 2XD3A 4X8RA 1FBFA 1I69A 3E3KA 4NF4A 1SYIA 3T9VA 4I8CA 2UVIA 3FV2A 3MJNA 4EXKA 3TKDA 1YPNA 1B32A 4JSOA 1FPBA 4LONB 1POTA 1IXIA 2REGA 4ZE8A 4QSCA 3TAJA 5FHOA 5LOMA 1H3DA 1AIVA 4XXUA 3CSBA 2Y5KA 3KC1A 4NWCA 3KG2A 2DDKA 4PFYA 2NXOA 3SEXA 1MQHA 4QHQA 1L5TA 2F78A 5I57A 2FIXA 3KC0A 4ELPA 3JV9A 1URDA 4EQ9A 1FBEA 3KSXA 3EF7A 3ILTB 2Q2AA 3CFLA 3SDFA 2ZYOA 2QL3A 4C1UA 2B4MA 4FEBA 4IO6A 4GOTA 5I2NB 1VR5A 3B6TA 4N6DA 3RUMA 2CZIA 2PBWA 1B3LA 5FBPA 2FBPA 2DVCA 4H8IA 2PCRA 1MXUA 4ELRA 3KFMA 4JXIA 4O3BA 1US4A 1YXIA 1MQGA 4N8GA 3AXFA 3M3LA 2HAVA 3KJTA 1B5JA 3O9PA 3IJXB 4MMPA 4DI4B 4G68A 3C36A 1JW4A 2Q8JA 1MS7A 1H45A 2WBDA 4DIGA 5B7DA 2BJJX 1LLSA 2OWSA 3EHSA 4OVPA 4H0WA 1UQWA 5AE4A 1O63A 4YICA 5DVFA 1FTLA 2OX3A 3M3FA 1FBGA 1YZ0A 1MQIA 2XXRA 3SEWA 2ALUA 3MQ9A 2H9BA 4MLQA 4KXPA 1NUZA 4NF5B 1FTMA 4GL0A 4LQ5A 2PT2A 1ZLQA 3HPIA 3MVXA 3IO4A 5EYHA 3MZ9A 2UYFA 3HV1A 2F6PA 5DVIA 1MXWA 2ONRA 4ZZAA 1IXCA 4P0GA 4TLMB 5FTHA 5M2VA 4FIMA 2VT5A 1CB6A 2H98A 2QPQA 4NTLA 1RYXA 5TPAA 2ZXTA 2ZYKA 1MDP1 1RDZA 4MBPA 2Y5LA 1HSLA 5AA4B 1A99A 1OVTA 4NE4A 1JQFA 2GQ1A 4LUBA 2XXPA 5ITOA 4MFIA 3QUFA 4OETA 3FVNA 3OXNA 4RK2A 4NN3A 3HSTA 5JK4A 1NI9A 1ZKBA 3C9HA 1LB8A 3VV5A 2NVUB 1INPA 1QW0A 1A8FA 2ZNTA 2DE2A 1EYIA 4P1EA 4G61A 4DZ1A 1SI0A 1JEVA 3IR1A 3D4GA 3DP4A 2FVZA 3TELA 2DXYA 5H8NB 1OQGA 2V4CA 3U93A 3RT8A 5CI5A 1MH4A 2QVUA 2HXWA 4OENA 5I84A 3VLUA 2NUVA 3TTNA 3MP6A 3IORA 1Q1KA 4G68C 2E1SA 2P0SA 1B7UA 2DE3A 3CRBA 3R6UA 2QSXA 5H8SA 3M3KA 2F97A 4QF9A 3LSFB 2DE4A 4U2RA 2THIA 4Z7EA 2GH9A 4MCOA 2Z22A 2VOZA 2VD3A 4GLIA 2B3BA 2Q8MA 1ANFA 1B5IA 2XWKA 5AA2A 3IOVA 1Y4CA 3IJOB 1XHYA 5H8FB 2P2AA 1LBXA 5I3SA 1FJ9A 1IMEA 3MVWA 4DE8A 3VXCA 2F7BA 1AWBA 4H5FA 3B6QA 4NG7A 3C32A 2DVZA 4FORA 4MX6A 4IO4A 3Q25A 2F36A 3IAZA 4PFBA 4NF5A 3FUZA 4RXLA 5H8NA 4M4GA 5I59B 3S9MC 3K4UA 1SI1A 1XVXA 1XC1A 2HPGA 3PUXE 3IB1A 4E0WA 4NEDA 4XEQA 1FPDA 1NV4A 1LFIA 2F7CA 1H44A 1WDNA 1NV1A 3F11A 3KBRA 4F39A 4O7IA 3LSXA 2DQVA 4ZS9A 2BJIA 1I6AA 4KI0E 4P1LA 4RYAA 1NV5A 4P56A 1RDXA 1LAXA 3I6VA 4ONYA 4JWYA 1MH3A 3S4UA 3HHFA 3CFXA 1ZJLA 3OD7A 4OA4A 1BLFA 2AL5A 1IQ7A 4BDRA 2RINA 2F6GA 4RPOA 4HE0A 3E78A 1H43A 3K6VA 1P99A 3JYRA 3H03A 3WAEA 4O7MA 4YMAA 2F3BA 3IB0A 2RCBA 3QMFA 1UTHA 3MVYA 2P3NA 3H6WA 4QFOA 1FJ6A 4GX3A 5ITPA 3CI8A 2O6AA 4IR8A 1XOCA 5F1QA 3TQLA 1LBWA 2VHAA 1KZ8A 4JWXA 2R71A 1Y3QA 4OZ9A 4F18A 4OFJA 1FQFA 2H25A 4GQOA 4YMBA 1NL5A 4OVRA 1Y9UA 3KOTA 4XKPA 4N07A 2DWHA 1S7YA 2FIEA 4EF1A 2R9JA 3K01A 5CMBA 3KBZA 2D3IA 3KSJA 5I7IA 4BLAA 3PU5A 4LZ7A 4BDQA 4MH5A 3FJMA 1NKXA 4NF4B 3C4MA 4HXVA 3VXBA 1RDYA 4LP2B 2JJKA 4H5GA 4HCWA 1SBPA 4R9GA 1URSA 4EXLA 1USYE 4NF8B 3ZKLA 1JP4A 3C34A 4Q8RA 5JTYA 3QIMA 4P11A 2O51A 1QUIA 2LAOA 2GHAA 5ET5A 4LVQA 4X1BA 1B40A 1FPGA 1VFDA 4YKIA 4AS5A 1JNFA 5EHSA 4QFKA 1NV2A 2F34A 1PBQA 4ZEFA 4NF6A 1T0KA 3EQ1A 1LCFA 3IOTA 4GXSB 2Y7KA 2V3QA 3V89B 5KCJB 2A5TA 4N6KA 2HHMA 4PE3A 3ILUB 4IO5A 3BFUA 1OIBA 1LBVA 3O66A 3ODBA 1JVXA 1Z7NE 2UVJA 4PF6A 2XA5A 5ET8A 5B70A 3PV0E 1CE2A 2QVRA 3PPQA 4I40A 2A5SA 1LAFE 1KWHA 2NWJA 2GRVA 3UORA 3TUSA 1NV3A 2FA7A 2QMXA 4EDPA 2OWZA 2YLNA 3IFCA 1IITA 3VVEA 3O97A 1NFTA 3E9XA 2H99A 1ZBMA 1MM7A 1YYZA 5JTYB 4MJOA 2F5XA 5KZTA 4U4XA 2XD2A 4DCYA 5ELVA 1LB9A 4PGNA 1IZ1A 5EQ9A 2I4BA 2O1MA 4JSDA 5A5LA 4R72A 1SW5A 4R6KA 2Q74A 3KOSA 2PT1A 4RK9A 5J1DA 2Y7RA 3T1BA 3T66A 1A8EA 1N76A 5HPQA 1DTZA 4OHNA 1B3GA 3MUQA 3MP1A 3TODA 2I49A 5KCJA 4FATA 4JVCA 1GVCA 4YU0A 5IZ1A 2CZHA 4ZEDA 3MBPA 4YKJA 4FJPA 2KQZA 3IFAA 4NF0A 3SEYA 1FBPA 2ZYMA 1ZTYA 1MXZA 3LC8A 4KYDA 4I9DA 1GTKA 3UGWA 1LEVA 3QSLA 5EQ8A 1G0HA 3DELB 1MQDA 3O6HA 4IY5A 4GRKA 3K2DA 3UIFA 3T93B 4I3YA 4H65A 2Q88A 1R9LA 1B5HA 3TCGA 2QS1A 4ESWA 1S9TA 1DSNA 3PPRA 4XFEA 2FNCA 1UIVA 1B1HA 5I2KB 5BUUA 4RJZA 1N0TA 4QFNA 4I1DA 2VPNA 4LATA 2XX7A 5H8FA 3FXQA 4U21A 4GWSA 4OEUA 3TQWA 3GBBA 5CM6A 5I56A 5HBCA 3O28A 1I6QA 5ET6A 4HE1A 4U1ZA 1QUKA 3UN6A 1VSOA 4F1UA 3RT6B 4R9FA 2F7AA 4MHFA 5LDZA 4OFLA 2DP8A 2OZZA 4YKPA 3I3VA 3RPLB 5BWJA 1F9BA 1PC3A 2DWIA 1Q35A 5FHNA 5DVJA 2DWJA 4OERA 3GBAA 1PB7A 4H67A 4XF5A 5EYFA 3K0VA 4R74A 5L9SA 5EQAA 2B4LA 1PEBA 2RC9A 3BIGA 1XS5A 2VPOA 2GHBA 4HCYA 3H4ZA 1MQJA 3P7IA 5IGAA 3FD3A 3RLFE 2RCAA 4JBZA 1JW5A 2XXVA 1B3FA 2O1LA 5I2KA 2HEUA 4POWA 1MPBA 4K3FA 2I6EA 4NHBA 4ELQA 1DK4A 4L17A 4N91A 4PCDA 2MKZA 3N5LA 4QSDA 1LGBC 4RA1A 3TZAA 3Q26A 3C31A 1N84A 5LTCA 4OFOA 3CG3A 4DCXA 3PPOA 3HN0A 1QJMA 3TTRA 4JDFA 1EYKA 4G8MA 3KN7A 3ROJA 1UTBB 2XXXA 1B0LA 4XIGQ 1FPFA 1SDXA 1OQHA 3RQTA 4F3BA 4THIA 1D9QA 3T22A 3GZGA 3U1OA 4PF8A 1MPDA 3FBPA 2QS4A 5CRYA 3SESA 2O7IA 1KA0A 5AA1A 3MAMA 2E0SA 1FQEA 2X7QA 4QBAA 1M5BA 1OMPA 3PUYE 4F19A 5HM4B 3MW0A 1ZIUA 3W9WA 3MZBA 2D21A 2V93A 3FVKA 3KJ7A 3K6UA 4MAGA 1FQBA 4C0RA 2XXUA 2XWOA 4YB7A 3BIHA 3HCQA 3G3KA 3MVZA 3CVGA 1SW2A 3OOAA 4G77A 4GF8A 4OQOA 4MF3A 2GFEA 3QXMA 1R9QA 3OEMA 1IMCA 1NH7A 2QS3A 3V83A 2UYEA 4GBVA 2P1SA 3Q29A 1TFDA 1Y4TA 3IOWA 1OVBA 3U65A 3MPLA 3GLBA 3KZGA 3FIRA 2V3TA 1B1XA 2ZZXA 3H6TA 2ANJA 1MXYA 2WYPA 1QKBA 2HAUA 2W7YA 2UVHA 1SVXB 4OTEA 4FE8A 4OWDA 2Q2CA 1BTJA 4GXAA 1IXHA 2B3FA 3RTFB 2QFLA 4QFPA 2OJTA 2OLBA 5TP9A 4HS7A 4F2QA 2OCUA 2X26A 4P47A 4NF6B 5CC2A 3RN8A 2NOOA 4WEDA 4GL8A 2Y7IA 1B7ZA 2KR0A 4EUOA 3E13X 2R8TA 2CEXA 3K00A 4YB6A 1QULA 1A55A 1MRPA 4Z0IA 4R73A 2F8DA 4ND9A 5IAIA 4IB2A 4KQPA 4WXJA 4N6PA 3O2AA 4RNSA 4Q30B 1FCKA 5I2NA 3MC2A 3FXBA 5I5PA 3U8QA 2H4IA 2AIXA 4KCCA 4ZEIA 5IZZA 3T9UA 4O3CA 3ISPA 1Y1ZA 5CMCA 4EF2A 1YTVA 5IZ3B 3TTMA 1JVYA 2I3WA 2ZZVA 1EU8A 4MNIA 4LZ8A 3DM0A 3PTYA 3N26A 1B6HA 4PE5B 1FTAA 4PFWA 5DT6A 3CG1A 1SW1A 4P9KA 4P8BA 1FPJA 1IMAA 4E0XA 2YPNA 3TDJA 3DP8A 2G29A 1MXXA 1FQCA 2PVUA 2HQ0A 5ICTA 4ISUA 4DDDA 2QVVA 1DMBA 5K2YA 3M8UA 4POXA 1H76A 1P1QA 4LA9A 3A29A 1RYOA 1NV6A 1Y3PA 3ECRA 3S9EA 4PC9A 4RY1A 1FBCA 3C33A 4Q5TA 1BP5A 3EKIA 3MP8A 4GIZA 4PGPA 1FPKA 4DI3D 2XWIA 5A5XB 1M5FA 3LUZA 1B4HA 2Y84A 5TP9B 2ZMBA 4PFUA 3W9VA 4ELOA 3FV1A 2REJA 5H8HB 3LUYA 1MY2A 1B51A 5I56B 5DEXA 1SYHA 2KLFA 4AQ4A 4GVOA 5FTIA 4ZEBA 3HO7A 2B65A 5DTBA 2PYYA 2DYXA 2XXQA 1KA1A 3FATA 4ZE9A 3LSLA 4IGRA 4N81A 3MPKA 1K9YA 1R6ZA 3EHTA 3O29A 1QVSA 2UXAA 3LSWA 1MY4A 2IA4A 3PMVA 1TWYA 1IEJA 3T9HB 3G3JA 3VE1B 4QXDA 3FJGA 4OESA 2DOJA 4DXUA 1FPIA 1P1UA 5ESYA 3S9NC 4OMBA 4ZECA 1NV7A 1LBBA 1JETA 1B0HA 1MG1A 3U92A 1N3WA 3A09A 2P3VA 4DXBA 4PQJA 5ET7A 3RGYA 4F1VA 4KFQA 3C35A 1TT1A 1FPLA 1BK4A 2H5YA 5CMKA 1IXGA 2ZYNA 3LBSA 3IX1A 4O8MA 3N6UA 4PAKA 5EYGA 1IMDA 3DLNA 5AA2B 2F3DA 1MY3A 2V3UA 3L6GA 2Z8EA 4PAFA 2I4CA 3U72A 3Q27A 2I0CA 5EHMA 3USDA 3SEVA 2QMWA 3VVFA 2ESNA 3W15C 2XHDA 1LBZA 1Y1MA 2O68A 2HZLA 2QRYA 3B50A 4UA8A 3K02A 3KN3A 3CHGA 4F29A 4BDOA 4GFRA 3VLVA 1D9VA 4H45A 4N15A 1N04A 4F2OA 3QK6A 4GWZA 1SD3A 2DWAA 4N13A 2RF1A 1M5DA 1FRPA 1D3KA 1FW0A 1UTBA 4FECA 4R2FA 3IB2A 1SW4A 2ONKE 3BFTA 4GWUA 2G93A 5I58A 3IOUA 2ONSA 3OO8A 4R75A 1I6BA 2PX1A 1LBYA 1AL3A 1O64A 1VE4A 4R6YA 4FEDA 5F7VA 3IK6B 2Z8FA 3FVOA 3PGFA 4ESXA 3HFUA 3KGCA 4XKNA 1XT8A 2YJPA 3OELA 3OENA 2WKYA 1R1NA 1B46A 3PPPA 4RPNA 1MPCA 4NQ8A 4FBPA 2O7UA 3THIA 3JZJA 3K1PA 3VLWA 5CMMA 4UACA 2VD2A 1B7HA 1QGXA 2L5VA 3RPWA 1YCJA 2Y7PA 3PMXA 3WAFA 5KDTA 5TU0A 3CR9A 3PMWA 4IGTA 2ABHA 5JEIA 3PUZE 1LCTA 1NNPA 4X48A 1US5A 3TYHA 3ZSFA 1FTKA 1FQAA 3N94A 3EPEA 3MYUA 4MNCA 4U22A 1XVYA 1B52A 3PUVE 3VDFA 1Y20A 2HXRA 4KHZE 1NUWA 4O3AA 1MM6A 1ZMGA 4XTCQ 1G0IA 1NMUA 1TXFA 2Q9TA 2XXWA 1O7TA 1GR2A 1SPIA 3ZKKA 1P1WA 3RY3A 4PBHA 3K1NA 1YAEA 4QRZA 4G68B 4R2BA 3V8XB 3B8BA 3TPAA 2PFYA 3H7MA 3FXRA 4OEVA 4HTGA 4GWOA 5H8QB 1IMFA 3FJ7A 2XX8A 1SQYA 4N17A 1MDQA 4PAIA 5ICQA 4HE2A 1N7XA 1LSTA 3I5OA 2I58A 2OWTA 3PD9A 1DPEA 1VDWA 5EQ7A 4KPTA 3MZ1A 1B3EA 4M1VA 1OLAA 5I57B 4JVDA 4OVSA 2DS9A 2Z23A 2I0BA 4OVTA 3KN8A 1Y3NA 1NH8A 1VFEA 4AB6A 5L9MA 3OMBA 5J16A 1ELJA 3H3GA 3RNNA 2O84X 1B58A 3OO9A 2O69A 4F31B 4MIJA 4QFLA 2CZKA 4UABA 1FTOA 4X1DA 4HW8A 4EQBA 3B6WA 2HZKA 4F3PA 2Y7WA 3MWBA 3RPLA 3LR1A 4NF8A 3ZS6A 1LBCA 3H6UA 5IZ3A 4ZDMA 3FXUA 1K9ZA 4BDNA 4O94A 4F1YA 2XXHA 3HHGA 1FTJA 3UK4A 3L6HA 1Z7ME 2M8CA 2ZNSA 2XXTA 3CFZA 4GX6A 3R7XA 4PBQA 3RYDA 4OYVA 3BKIB 3K6XA 2WEFA 3U94A 2VGQA 3H06B 5CBRA 3Q28A 2QJEA 1NNFA 3PD8A 1NUXA 4GWWA 4TQUQ 5I59A 5DW8A 4IO3A 5KDTB 4IO2A 3OEKA 1QUJA 3BBRA 1EH3A 3FGSA 1M5CA 3TTLA 3K1MA 4LZ5A 1UTHB 1OLCA 2CMOA 4JWOA 3IO6A 1ATGA 5DEXB 4TOZA 2VP1A 1FBHA 1FSAA 1B2HA 2PFZA 5TPAB 3EN3A 3OO6A 1B4ZA 5IM2A 4NX1A 3TTKA 1FQDA 2RKMA 1MXVA 5AA4A 3KEIA 4ZEKA 4I62A 4DLDA 1ZU0A 1WODA 2DSFA 4PFIA 1P1NA 4NGUA 3TFLA 1DPPA 3D1RA 1B9JA 2WYKA 1LAHE 4U4SA 2WX9A 4NWDA 1N7WA 2V84A 4Q0CA 1NV0A 3B7DA 5FHMA 4AS4A 1D4NA 2I48A 3RTWB 4PFRA 5A5XA 3FASA 2PMSA 4P0IA 3TMGA 1EZ9A 1IUDA 3T9XB 5H8QA 4MNPA 2HCAA 4X04A 1J1NA 2CEYA 5L9OA 1FPEA 1WVJA 2QS2A 3OSRA 4NAPA 4DXCA 4LN5A 2FHYA 4AB5A 3H6VA 4BDLA 4FAJA 3TCFA 3G3HA 1DOTA 4OVQA 4XKRA 1NNKA 3NOHA 2XXKA 1PBPA 5CBSA 3CSGA 2ZNUA 4C1TA 4U1OA 4G4PA 4WEPA 1CNQA 4F22A 2RC7A 1GV8A 4P3LA 3IL1B 3K6WA 2XWVA 5AA3A 1A54A 3QAXA 3G3IA 3GXAA 2X7PA 3DP6A 4PETA 4ECFA 2HFBA 1XI6A 1AOVA 1URGA 2IEEA 3A3CA 3FZVA 4GWXA 1POY1 3OSQA 2I3VA 2ZZWA 3MSTA 4G2ZA 2AYSA 1LAGE 3PPNA 4H1XA 4U23A 3SEUA 1PB9A 4YZZA 2OK2A 5I58B 4MEVA 2XX9A 2D5WA 5F24A 4MLVA 3QUJA 3G3FA 3N6TA 3OO7A 4XKQA 1B3HA 1IIWA 1HSEA 3R26A 4F3GA 2DXRA 4X9TA 3TCHA 4OANA 1RKMA 3D4CA 3GYYA 3FVGA 5H8HA 4ZZEA 4GX4A 4NMYA 1PDAA 4KCDA 4N4UA 1Q9DA 1AH5A 4N8YA 3UP9A 3T96B 4G8NA 4KR5A 3A3UA 4H8JA 3VFJA 3SZPA 1BKAA
chains in the Genus database with same CATH topology
1LFIA 3Q26A 4R6HA 4N13A 2RF1A 3C31A 2F7CA 1H44A 1M5DA 1WDNA 1N84A 4QSEA 1D3KA 5ISUA 5IKBA 1FW0A 1UTBA 4FECA 4OFOA 3F11A 4R2FA 3KBRA 3IB2A 3CG3A 1MY1A 3PPOA 4YB5A 4DCXA 3HN0A 4KYEA 1SW4A 4F39A 1QJMA 3LSXA 2ONKE 2DQVA 4ZS9A 3BFTA 3TTRA 2G93A 1I6AA 2UVGA 4JDFA 4KI0E 1GGGA 4YAHX 5I58A 1PB8A 4RYAA 3IOUA 2AL4A 2ONSA 3EHUA 3KN7A 4G8MA 4GD5A 3USDA 5KCJB 4F3SA 3OO8A 1EZOA 1D9YA 4R75A 1UTBB 2XXXA 4OXVA 4KD5A 1I6BA 4PFTA 2PX1A 3SETA 1B0LA 4XIGQ 1LAXA 2RC8A 1SDXA 3I6VA 4ONYA 4JWYA 1MH3A 4KYSA 4EQ7A 1AL3A 3S4UA 1O64A 3HHFA 2Z8DA 1OQHA 3S9LC 1BIYA 3CFXA 1ZJLA 1VE4A 3OD7A 4R6YA 4FEDA 5F7VA 1TFAA 3IK6B 1BLFA 1JEUA 1IQ7A 2AL5A 2Z8FA 3FVOA 3E4RA 5DYHA 3PGFA 4ESXA 3KGCA 4XKNA 3RQTA 4BDRA 1XT8A 2YJPA 3OELA 4F3BA 4TLLB 4THIA 3OENA 2RINA 2WKYA 2F6GA 1R1NA 4H6DA 4RPOA 3T22A 3GZGA 3O6GA 1P1OA 1B46A 1HSJA 3PPPA 4RPNA 4BDMA 3U1OA 1MPDA 1MPCA 1NNTA 1H43A 3K6VA 1P99A 2QS4A 5K2XA 5CRYA 1MY0A 2O7UA 5L8DA 3JYRA 1B05A 3H03A 3JZJA 3SESA 3THIA 2O7IA 3K1PA 3WAEA 3IB0A 5CMMA 3VLWA 4YMAA 4UACA 1LFGA 4YKKA 2RCBA 5AA1A 3MAMA 2E0SA 2VD2A 1UTHA 3G3GA 1FQEA 1B7HA 2X7QA 3MVYA 2FYIA 1M5BA 3H6WA 3RPWA 1N3XA 1OMPA 1YCJA 4QFOA 1A7LA 3PUYE 2Y7PA 1DTGA 3VVDA 5ITPA 1II5A 3CI8A 4F19A 2O6AA 5HM4B 1XOCA 3PMXA 5F1QA 3MW0A 1ZIUA 3TQLA 3WAFA 5KDTA 5TU0A 3CR9A 3PMWA 3W9WA 4IGTA 2ABHA 4IY6A 5HPQA 5JEIA 3MZBA 3G7WA 3PUZE 1LCTA 1NNPA 4X48A 1US5A 3TYHA 3ZSFA 1S50A 4IO7A 2XXIA 2D21A 1FTKA 2V93A 2R6GE 1FQAA 2F35A 2VHAA 3FVKA 3N94A 4JWXA 2R71A 3EPEA 1Y3QA 3KJ7A 2Q89A 3K6UA 4OZ9A 3V5AA 4OFJA 1FQFA 4U22A 3S2VA 4F18A 1XVYA 1FQBA 1B52A 2H25A 3PUVE 4GQOA 3SERA 3O6IA 3CIJA 4PP0A 4C0RA 4YMBA 1NL5A 2XXUA 2A5TB 1Y9UA 2V25A 4LQ2A 3VDFA 1M5EA 2XXYA 3KOTA 1Y20A 4YB7A 1EZPA 1QKAA 4XKPA 3UA8A 4N07A 2DWHA 3HCQA 1S7YA 3G3KA 3ONMA 3MVZA 4KHZE 3SKPA 3CVGA 4O3AA 1SW2A 1UIUA 4EF1A 4JB7A 1MM6A 2R9JA 3K01A 1ZMGA 3OOAA 4G77A 4XTCQ 5CMBA 3KSJA 2D3IA 3TEPA 4GF8A 1USYH 1A40A 1LFHA 4OQOA 4BLAA 4G8HA 3PU5A 3PUWE 4MF3A 4LZ7A 4WKMA 4BDQA 3QYTA 2GFEA 3QXMA 4MH5A 1NMUA 1TXFA 1R9QA 3FJMA 1NKXA 3OEMA 1NH7A 2Q9TA 2QS3A 4NF4B 4OVJA 3V83A 2UYEA 2XXWA 1AMFA 3C4MA 1JW1A 1O7TA 1GR2A 3ZKKA 2OBGA 2CZLA 3VXBA 5AA2D 1P1WA 2P1SA 3RY3A 3Q29A 2XD3A 3K1NA 1TFDA 1Y4TA 1YAEA 1OVBA 3IOWA 4G68B 4QRZA 1I69A 4LP2B 3E3KA 3MPLA 4H5GA 4NF4A 3GLBA 3KZGA 4HCWA 4R2BA 3FIRA 1SBPA 3V8XB 2V3TA 1B1XA 3TPAA 4R9GA 1SYIA 1URSA 3H6TA 3T9VA 5A5XB 4I8CA 2ANJA 1MXYA 2UVIA 1USYE 3FXRA 3H7MA 4NF8B 3FV2A 4OEVA 4EXLA 1QKBA 2HAUA 3MJNA 3ZKLA 4HTGA 2W7YA 2UVHA 1SVXB 3C34A 4GWOA 4EXKA 4OTEA 5H8QB 3TKDA 1YPNA 4Q8RA 1B32A 3QIMA 5JTYA 3FJ7A 2XX8A 4JSOA 1SQYA 4FE8A 4LONB 2Q2CA 4OWDA 4P11A 1MDQA 1POTA 5ICQA 1BTJA 1IXIA 4GXAA 2O51A 1N7XA 1IXHA 2REGA 1LSTA 2B3FA 3I5OA 4ZE8A 4QSCA 1QUIA 2I58A 3RTFB 2LAOA 2OWTA 2GHAA 3TAJA 3PD9A 1DPEA 5FHOA 5LOMA 1H3DA 4LVQA 4QFPA 1AIVA 2OJTA 2OLBA 4XXUA 4HS7A 3CSBA 5TP9A 4X1BA 4F2QA 4KPTA 2OCUA 2X26A 1B40A 1VFDA 3MZ1A 1B3EA 4NWCA 4M1VA 4NF6B 5CC2A 1OLAA 3RN8A 3KG2A 4YKIA 4PFYA 5I57B 2NXOA 2DS9A 3SEXA 1MQHA 4QHQA 1L5TA 2F78A 2NOOA 2Z23A 4GL8A 4WEDA 5I57A 2I0BA 2Y7IA 1JNFA 5EHSA 4QFKA 1B7ZA 4EUOA 3E13X 3KN8A 2F34A 4ELPA 1Y3NA 3JV9A 1NH8A 1URDA 4EQ9A 1PBQA 1VFEA 3K00A 1QULA 1A55A 4NF6A 1MRPA 3OMBA 4YB6A 4ZEFA 5L9MA 4AB6A 4Z0IA 1ELJA 3H3GA 3KSXA 3EF7A 3EQ1A 2O84X 3ILTB 4R73A 2Q2AA 3RNNA 1T0KA 3CFLA 1LCFA 1B58A 3OO9A 3IOTA 4GXSB 2F8DA 2Y7KA 2V3QA 2O69A 4ND9A 3SDFA 3V89B 5IAIA 2A5TA 2QL3A 2ZYOA 4C1UA 4IB2A 4FEBA 4KQPA 4IO6A 4GOTA 4WXJA 4F31B 5I2NB 4N6PA 1VR5A 4QFLA 3O2AA 3B6TA 3ILUB 4IO5A 3BFUA 1FTOA 3RUMA 2PBWA 4RNSA 1B3LA 4X1DA 4HW8A 1OIBA 4EQBA 3O66A 3ODBA 3B6WA 4Q30B 1FCKA 2HZKA 2DVCA 1JVXA 4F3PA 1Z7NE 4H8IA 1MXUA 2Y7WA 3MWBA 2UVJA 4ELRA 3KFMA 5I2NA 4JXIA 3LR1A 4NF8A 3ZS6A 1LBCA 3H6UA 4O3BA 1US4A 3MC2A 5B70A 3PV0E 1CE2A 3PPQA 3U8QA 1MQGA 2H4IA 2A5SA 4ZDMA 3FXUA 3AXFA 3M3LA 2AIXA 2HAVA 4KCCA 4BDNA 1LAFE 1KWHA 2NWJA 3KJTA 4F1YA 1B5JA 4ZEIA 3O9PA 2XXHA 2GRVA 1FTJA 3HHGA 3T9UA 3IJXB 3UK4A 3UORA 3L6HA 4O3CA 4G68A 3TUSA 3C36A 1JW4A 2FA7A 2QMXA 1Y1ZA 5CMCA 4EF2A 4EDPA 1YTVA 2Q8JA 1MS7A 1Z7ME 2M8CA 3TTMA 2ZNSA 1H45A 2YLNA 4DIGA 2XXTA 1IITA 2BJJX 1JVYA 5B7DA 2I3WA 3VVEA 3CFZA 1EU8A 3O97A 3R7XA 1LLSA 2OWSA 3EHSA 4LZ8A 4OYVA 3DM0A 1NFTA 4H0WA 3BKIB 3E9XA 2H99A 3K6XA 1ZBMA 1MM7A 3N26A 5JTYB 1B6HA 1UQWA 2F5XA 5AE4A 1O63A 3U94A 4YICA 2VGQA 1FTLA 2XD2A 3H06B 3M3FA 4PE5B 4U4XA 5DVFA 4PFWA 3Q28A 1MQIA 5CBRA 2XXRA 2QJEA 1NNFA 3PD8A 3SEWA 5DT6A 2ALUA 4DCYA 5ELVA 3CG1A 4TQUQ 3MQ9A 2H9BA 4MLQA 5I59A 1LB9A 1SW1A 4IO3A 5KDTB 4IO2A 1IZ1A 3OEKA 4NF5B 4E0XA 1FTMA 2I4BA 2O1MA 4JSDA 2YPNA 4R72A 1QUJA 3BBRA 1EH3A 3FGSA 1M5CA 2PT2A 1ZLQA 4GL0A 4LQ5A 3TTLA 3TDJA 3HPIA 3K1MA 3IO4A 3MVXA 3DP8A 2G29A 4LZ5A 1MXXA 1UTHB 1SW5A 3MZ9A 4R6KA 2UYFA 3HV1A 1FQCA 2F6PA 2PVUA 1OLCA 3KOSA 2CMOA 5DVIA 2HQ0A 4JWOA 5ICTA 2PT1A 1MXWA 4RK9A 5J1DA 4ISUA 2ONRA 3IO6A 4ZZAA 1IXCA 4P0GA 2Y7RA 4DDDA 3T66A 1ATGA 1A8EA 4TLMB 5DEXB 4TOZA 1DMBA 5FTHA 5M2VA 4FIMA 5K2YA 2VP1A 1B2HA 1CB6A 1N76A 2H98A 2QPQA 1DTZA 3EN3A 3M8UA 1B4ZA 3OO6A 4OHNA 5TPAB 1B3GA 3TTKA 4NTLA 1RYXA 3MUQA 4POXA 3MP1A 1FQDA 1H76A 1P1QA 4LA9A 2RKMA 5TPAA 3TODA 2I49A 2ZXTA 1MXVA 2ZYKA 4FATA 5KCJA 1RYOA 1GVCA 1MDP1 4MBPA 1Y3PA 5AA4A 1HSLA 3ECRA 3KEIA 4YU0A 4ZEDA 3MBPA 4I62A 4YKJA 4ZEKA 4DLDA 4FJPA 5AA4B 1A99A 1OVTA 4NE4A 3S9EA 1JQFA 1ZU0A 1WODA 4RY1A 4LUBA 2DSFA 2XXPA 1P1NA 5ITOA 3SEYA 3C33A 4Q5TA 2ZYMA 1ZTYA 1MXZA 4MFIA 1BP5A 3QUFA 3LC8A 4KYDA 4OETA 3MP8A 4GIZA 3TZAA 4I9DA 3TFLA 3FVNA 1DPPA 1GTKA 3OXNA 1B9JA 4RK2A 1LAHE 3HSTA 4U4SA 3UGWA 3QSLA 5JK4A 4NWDA 1ZKBA 1N7WA 1MQDA 2V84A 3C9HA 3DELB 3O6HA 1M5FA 3B7DA 1LB8A 4IY5A 4Q0CA 5FHMA 1D4NA 2NVUB 3VV5A 1QW0A 2I48A 3RTWB 1B4HA 3FASA 2Y84A 4GRKA 5A5XA 1A8FA 2PMSA 3K2DA 2ZMBA 4P0IA 2ZNTA 5TP9B 3TMGA 3UIFA 4PFUA 1EZ9A 1IUDA 3T93B 3T9XB 3W9VA 5H8QA 2DE2A 4H65A 2HCAA 4ELOA 3FV1A 2REJA 5H8HB 3LUYA 1J1NA 4DZ1A 5L9OA 2Q88A 1R9LA 1SI0A 1MY2A 1B51A 5I56B 1JEVA 1WVJA 1BKAA 2QS2A 1B5HA 3IR1A 5DEXA 1SYHA 3OSRA 3TCGA 2KLFA 2QS1A 3D4GA 4ESWA 1S9TA 4AQ4A 1DSNA 3DP4A 3PPRA 4DXCA 4AB5A 2FNCA 4GVOA 3H6VA 2DXYA 3TELA 4F2OA 1UIVA 4BDLA 1B1HA 5FTIA 5I2KB 4FAJA 5H8NB 3TCFA 3G3HA 1OQGA 1DOTA 4ZEBA 3HO7A 3U93A 4RJZA 1NNKA 4XKRA 3RT8A 5BUUA 1N0TA 2B65A 5CI5A 4QFNA 1PBPA 4I1DA 4LATA 5CBSA 1MH4A 5DTBA 2XX7A 2PYYA 3FXQA 5H8FA 4U21A 3CSGA 4OEUA 2HXWA 4OENA 2DYXA 2XXQA 5I84A 2ZNUA 3VLUA 3FATA 2NUVA 4ZE9A 3LSLA 4IGRA 3TQWA 3TTNA 3GBBA 5CM6A 3MPKA 4C1TA 5I56A 5HBCA 3O28A 1I6QA 3MP6A 3IORA 4U1OA 1R6ZA 3EHTA 4U1ZA 1Q1KA 1QUKA 1QVSA 3O29A 2UXAA 3LSWA 2E1SA 4G4PA 4G68C 3UN6A 2P0SA 1MY4A 4WEPA 1VSOA 2IA4A 2RC7A 3PMVA 1GV8A 4F1UA 4F22A 3RT6B 1B7UA 2DE3A 1TWYA 1IEJA 2F7AA 3CRBA 3IL1B 3K6WA 3R6UA 3G3JA 4R9FA 3T9HB 3VE1B 4OFLA 2DP8A 2QSXA 5H8SA 3M3KA 3FJGA 4OESA 2F97A 2OZZA 4YKPA 2DOJA 4DXUA 1A54A 3I3VA 5AA3A 4QF9A 1P1UA 3G3IA 3QAXA 5BWJA 3GXAA 3LSFB 3S9NC 1F9BA 1PC3A 4OMBA 4ZECA 2X7PA 2DE4A 4U2RA 2DWIA 2THIA 3DP6A 4Z7EA 2GH9A 1LBBA 1JETA 1B0HA 1MG1A 1Q35A 4PETA 3U92A 5FHNA 1N3WA 2Z22A 2VOZA 5DVJA 4ECFA 2DWJA 3A09A 4DXBA 2HFBA 4PQJA 4OERA 2VD3A 3GBAA 4GLIA 5KZTA 1PB7A 2B3BA 3RGYA 1ANFA 1B5IA 1URGA 2IEEA 4H67A 3A3CA 4KFQA 4F1VA 3FZVA 1AOVA 3C35A 1POY1 1TT1A 3OSQA 5EYFA 3K0VA 5AA2A 2I3VA 3IOVA 1Y4CA 4R74A 5L9SA 2H5YA 5CMKA 3IJOB 4G2ZA 1PEBA 1XHYA 2AYSA 1IXGA 1LAGE 2RC9A 2ZYNA 3PPNA 4H1XA 1PB9A 4U23A 4YZZA 5H8FB 1XS5A 2OK2A 2P2AA 5I58B 3LBSA 3IX1A 2XX9A 3N6UA 3MVWA 3DLNA 2D5WA 5AA2B 4DE8A 3VXCA 2F7BA 4MLVA 3QUJA 4H5FA 2GHBA 1MY3A 2V3UA 3B6QA 3G3FA 2Z8EA 3L6GA 4HCYA 4QSDA 3H4ZA 1MQJA 2I4CA 3P7IA 3N6TA 3OO7A 4XKQA 3U72A 3Q27A 3C32A 1B3HA 1IIWA 1HSEA 2I0CA 2DVZA 3R26A 4FORA 5EHMA 2QMWA 3SEVA 2DXRA 3FD3A 2ESNA 4IO4A 4X9TA 3RLFE 3TCHA 1RKMA 3VVFA 3D4CA 3Q25A 2RCAA 2XHDA 3W15C 3FVGA 4JBZA 1Y1MA 2O68A 2F36A 5H8HA 4ZZEA 3IAZA 2HZLA 4NMYA 1PDAA 1JW5A 2QRYA 2XXVA 4UA8A 4F3GA 1B3FA 3K02A 2O1LA 3KN3A 4NF5A 4F29A 4KCDA 4GFRA 4BDOA 3FUZA 4RXLA 5H8NA 3VLVA 5I2KA 1D9VA 4M4GA 5I59B 3S9MC 2HEUA 3K4UA 4POWA 1SI1A 1AH5A 1MPBA 1XVXA 1N04A 3UP9A 3T96B 1XC1A 3QK6A 4G8NA 2I6EA 4K3FA 1SD3A 3IB1A 3PUXE 4KR5A 4E0WA 4ELQA 3A3UA 4H8JA 4NEDA 3VFJA 4L17A 3SEUA 2DWAA 3N5LA 1LGBC 4RA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LFI A;  3Q26 A;  4R6H A;  4N13 A;  2RF1 A;  3C31 A;  2F7C A;  1H44 A;  1M5D A;  1WDN A;  1N84 A;  4QSE A;  1D3K A;  5ISU A;  5IKB A;  1FW0 A;  1UTB A;  4FEC A;  4OFO A;  3F11 A;  4R2F A;  3KBR A;  3IB2 A;  3CG3 A;  1MY1 A;  3PPO A;  4YB5 A;  4DCX A;  3HN0 A;  4KYE A;  1SW4 A;  4F39 A;  1QJM A;  3LSX A;  2ONK E;  2DQV A;  4ZS9 A;  3BFT A;  3TTR A;  2G93 A;  1I6A A;  2UVG A;  4JDF A;  4KI0 E;  1GGG A;  4YAH X;  5I58 A;  1PB8 A;  4RYA A;  3IOU A;  2AL4 A;  2ONS A;  3EHU A;  3KN7 A;  4G8M A;  4GD5 A;  3USD A;  5KCJ B;  4F3S A;  3OO8 A;  1EZO A;  1D9Y A;  4R75 A;  1UTB B;  2XXX A;  4OXV A;  4KD5 A;  1I6B A;  4PFT A;  2PX1 A;  3SET A;  1B0L A;  4XIG Q;  1LAX A;  2RC8 A;  1SDX A;  3I6V A;  4ONY A;  4JWY A;  1MH3 A;  4KYS A;  4EQ7 A;  1AL3 A;  3S4U A;  1O64 A;  3HHF A;  2Z8D A;  1OQH A;  3S9L C;  1BIY A;  3CFX A;  1ZJL A;  1VE4 A;  3OD7 A;  4R6Y A;  4FED A;  5F7V A;  1TFA A;  3IK6 B;  1BLF A;  1JEU A;  1IQ7 A;  2AL5 A;  2Z8F A;  3FVO A;  3E4R A;  5DYH A;  3PGF A;  4ESX A;  3KGC A;  4XKN A;  3RQT A;  4BDR A;  1XT8 A;  2YJP A;  3OEL A;  4F3B A;  4TLL B;  4THI A;  3OEN A;  2RIN A;  2WKY A;  2F6G A;  1R1N A;  4H6D A;  4RPO A;  3T22 A;  3GZG A;  3O6G A;  1P1O A;  1B46 A;  1HSJ A;  3PPP A;  4RPN A;  4BDM A;  3U1O A;  1MPD A;  1MPC A;  1NNT A;  1H43 A;  3K6V A;  1P99 A;  2QS4 A;  5K2X A;  5CRY A;  1MY0 A;  2O7U A;  5L8D A;  3JYR A;  1B05 A;  3H03 A;  3JZJ A;  3SES A;  3THI A;  2O7I A;  3K1P A;  3WAE A;  3IB0 A;  5CMM A;  3VLW A;  4YMA A;  4UAC A;  1LFG A;  4YKK A;  2RCB A;  5AA1 A;  3MAM A;  2E0S A;  2VD2 A;  1UTH A;  3G3G A;  1FQE A;  1B7H A;  2X7Q A;  3MVY A;  2FYI A;  1M5B A;  3H6W A;  3RPW A;  1N3X A;  1OMP A;  1YCJ A;  4QFO A;  1A7L A;  3PUY E;  2Y7P A;  1DTG A;  3VVD A;  5ITP A;  1II5 A;  3CI8 A;  4F19 A;  2O6A A;  5HM4 B;  1XOC A;  3PMX A;  5F1Q A;  3MW0 A;  1ZIU A;  3TQL A;  3WAF A;  5KDT A;  5TU0 A;  3CR9 A;  3PMW A;  3W9W A;  4IGT A;  2ABH A;  4IY6 A;  5HPQ A;  5JEI A;  3MZB A;  3G7W A;  3PUZ E;  1LCT A;  1NNP A;  4X48 A;  1US5 A;  3TYH A;  3ZSF A;  1S50 A;  4IO7 A;  2XXI A;  2D21 A;  1FTK A;  2V93 A;  2R6G E;  1FQA A;  2F35 A;  2VHA A;  3FVK A;  3N94 A;  4JWX A;  2R71 A;  3EPE A;  1Y3Q A;  3KJ7 A;  2Q89 A;  3K6U A;  4OZ9 A;  3V5A A;  4OFJ A;  1FQF A;  4U22 A;  3S2V A;  4F18 A;  1XVY A;  1FQB A;  1B52 A;  2H25 A;  3PUV E;  4GQO A;  3SER A;  3O6I A;  3CIJ A;  4PP0 A;  4C0R A;  4YMB A;  1NL5 A;  2XXU A;  2A5T B;  1Y9U A;  2V25 A;  4LQ2 A;  3VDF A;  1M5E A;  2XXY A;  3KOT A;  1Y20 A;  4YB7 A;  1EZP A;  1QKA A;  4XKP A;  3UA8 A;  4N07 A;  2DWH A;  3HCQ A;  1S7Y A;  3G3K A;  3ONM A;  3MVZ A;  4KHZ E;  3SKP A;  3CVG A;  4O3A A;  1SW2 A;  1UIU A;  4EF1 A;  4JB7 A;  1MM6 A;  2R9J A;  3K01 A;  1ZMG A;  3OOA A;  4G77 A;  4XTC Q;  5CMB A;  3KSJ A;  2D3I A;  3TEP A;  4GF8 A;  1USY H;  1A40 A;  1LFH A;  4OQO A;  4BLA A;  4G8H A;  3PU5 A;  3PUW E;  4MF3 A;  4LZ7 A;  4WKM A;  4BDQ A;  3QYT A;  2GFE A;  3QXM A;  4MH5 A;  1NMU A;  1TXF A;  1R9Q A;  3FJM A;  1NKX A;  3OEM A;  1NH7 A;  2Q9T A;  2QS3 A;  4NF4 B;  4OVJ A;  3V83 A;  2UYE A;  2XXW A;  1AMF A;  3C4M A;  1JW1 A;  1O7T A;  1GR2 A;  3ZKK A;  2OBG A;  2CZL A;  3VXB A;  5AA2 D;  1P1W A;  2P1S A;  3RY3 A;  3Q29 A;  2XD3 A;  3K1N A;  1TFD A;  1Y4T A;  1YAE A;  1OVB A;  3IOW A;  4G68 B;  4QRZ A;  1I69 A;  4LP2 B;  3E3K A;  3MPL A;  4H5G A;  4NF4 A;  3GLB A;  3KZG A;  4HCW A;  4R2B A;  3FIR A;  1SBP A;  3V8X B;  2V3T A;  1B1X A;  3TPA A;  4R9G A;  1SYI A;  1URS A;  3H6T A;  3T9V A;  5A5X B;  4I8C A;  2ANJ A;  1MXY A;  2UVI A;  1USY E;  3FXR A;  3H7M A;  4NF8 B;  3FV2 A;  4OEV A;  4EXL A;  1QKB A;  2HAU A;  3MJN A;  3ZKL A;  4HTG A;  2W7Y A;  2UVH A;  1SVX B;  3C34 A;  4GWO A;  4EXK A;  4OTE A;  5H8Q B;  3TKD A;  1YPN A;  4Q8R A;  1B32 A;  3QIM A;  5JTY A;  3FJ7 A;  2XX8 A;  4JSO A;  1SQY A;  4FE8 A;  4LON B;  2Q2C A;  4OWD A;  4P11 A;  1MDQ A;  1POT A;  5ICQ A;  1BTJ A;  1IXI A;  4GXA A;  2O51 A;  1N7X A;  1IXH A;  2REG A;  1LST A;  2B3F A;  3I5O A;  4ZE8 A;  4QSC A;  1QUI A;  2I58 A;  3RTF B;  2LAO A;  2OWT A;  2GHA A;  3TAJ A;  3PD9 A;  1DPE A;  5FHO A;  5LOM A;  1H3D A;  4LVQ A;  4QFP A;  1AIV A;  2OJT A;  2OLB A;  4XXU A;  4HS7 A;  3CSB A;  5TP9 A;  4X1B A;  4F2Q A;  4KPT A;  2OCU A;  2X26 A;  1B40 A;  1VFD A;  3MZ1 A;  1B3E A;  4NWC A;  4M1V A;  4NF6 B;  5CC2 A;  1OLA A;  3RN8 A;  3KG2 A;  4YKI A;  4PFY A;  5I57 B;  2NXO A;  2DS9 A;  3SEX A;  1MQH A;  4QHQ A;  1L5T A;  2F78 A;  2NOO A;  2Z23 A;  4GL8 A;  4WED A;  5I57 A;  2I0B A;  2Y7I A;  1JNF A;  5EHS A;  4QFK A;  1B7Z A;  4EUO A;  3E13 X;  3KN8 A;  2F34 A;  4ELP A;  1Y3N A;  3JV9 A;  1NH8 A;  1URD A;  4EQ9 A;  1PBQ A;  1VFE A;  3K00 A;  1QUL A;  1A55 A;  4NF6 A;  1MRP A;  3OMB A;  4YB6 A;  4ZEF A;  5L9M A;  4AB6 A;  4Z0I A;  1ELJ A;  3H3G A;  3KSX A;  3EF7 A;  3EQ1 A;  2O84 X;  3ILT B;  4R73 A;  2Q2A A;  3RNN A;  1T0K A;  3CFL A;  1LCF A;  1B58 A;  3OO9 A;  3IOT A;  4GXS B;  2F8D A;  2Y7K A;  2V3Q A;  2O69 A;  4ND9 A;  3SDF A;  3V89 B;  5IAI A;  2A5T A;  2QL3 A;  2ZYO A;  4C1U A;  4IB2 A;  4FEB A;  4KQP A;  4IO6 A;  4GOT A;  4WXJ A;  4F31 B;  5I2N B;  4N6P A;  1VR5 A;  4QFL A;  3O2A A;  3B6T A;  3ILU B;  4IO5 A;  3BFU A;  1FTO A;  3RUM A;  2PBW A;  4RNS A;  1B3L A;  4X1D A;  4HW8 A;  1OIB A;  4EQB A;  3O66 A;  3ODB A;  3B6W A;  4Q30 B;  1FCK A;  2HZK A;  2DVC A;  1JVX A;  4F3P A;  1Z7N E;  4H8I A;  1MXU A;  2Y7W A;  3MWB A;  2UVJ A;  4ELR A;  3KFM A;  5I2N A;  4JXI A;  3LR1 A;  4NF8 A;  3ZS6 A;  1LBC A;  3H6U A;  4O3B A;  1US4 A;  3MC2 A;  5B70 A;  3PV0 E;  1CE2 A;  3PPQ A;  3U8Q A;  1MQG A;  2H4I A;  2A5S A;  4ZDM A;  3FXU A;  3AXF A;  3M3L A;  2AIX A;  2HAV A;  4KCC A;  4BDN A;  1LAF E;  1KWH A;  2NWJ A;  3KJT A;  4F1Y A;  1B5J A;  4ZEI A;  3O9P A;  2XXH A;  2GRV A;  1FTJ A;  3HHG A;  3T9U A;  3IJX B;  3UK4 A;  3UOR A;  3L6H A;  4O3C A;  4G68 A;  3TUS A;  3C36 A;  1JW4 A;  2FA7 A;  2QMX A;  1Y1Z A;  5CMC A;  4EF2 A;  4EDP A;  1YTV A;  2Q8J A;  1MS7 A;  1Z7M E;  2M8C A;  3TTM A;  2ZNS A;  1H45 A;  2YLN A;  4DIG A;  2XXT A;  1IIT A;  2BJJ X;  1JVY A;  5B7D A;  2I3W A;  3VVE A;  3CFZ A;  1EU8 A;  3O97 A;  3R7X A;  1LLS A;  2OWS A;  3EHS A;  4LZ8 A;  4OYV A;  3DM0 A;  1NFT A;  4H0W A;  3BKI B;  3E9X A;  2H99 A;  3K6X A;  1ZBM A;  1MM7 A;  3N26 A;  5JTY B;  1B6H A;  1UQW A;  2F5X A;  5AE4 A;  1O63 A;  3U94 A;  4YIC A;  2VGQ A;  1FTL A;  2XD2 A;  3H06 B;  3M3F A;  4PE5 B;  4U4X A;  5DVF A;  4PFW A;  3Q28 A;  1MQI A;  5CBR A;  2XXR A;  2QJE A;  1NNF A;  3PD8 A;  3SEW A;  5DT6 A;  2ALU A;  4DCY A;  5ELV A;  3CG1 A;  4TQU Q;  3MQ9 A;  2H9B A;  4MLQ A;  5I59 A;  1LB9 A;  1SW1 A;  4IO3 A;  5KDT B;  4IO2 A;  1IZ1 A;  3OEK A;  4NF5 B;  4E0X A;  1FTM A;  2I4B A;  2O1M A;  4JSD A;  2YPN A;  4R72 A;  1QUJ A;  3BBR A;  1EH3 A;  3FGS A;  1M5C A;  2PT2 A;  1ZLQ A;  4GL0 A;  4LQ5 A;  3TTL A;  3TDJ A;  3HPI A;  3K1M A;  3IO4 A;  3MVX A;  3DP8 A;  2G29 A;  4LZ5 A;  1MXX A;  1UTH B;  1SW5 A;  3MZ9 A;  4R6K A;  2UYF A;  3HV1 A;  1FQC A;  2F6P A;  2PVU A;  1OLC A;  3KOS A;  2CMO A;  5DVI A;  2HQ0 A;  4JWO A;  5ICT A;  2PT1 A;  1MXW A;  4RK9 A;  5J1D A;  4ISU A;  2ONR A;  3IO6 A;  4ZZA A;  1IXC A;  4P0G A;  2Y7R A;  4DDD A;  3T66 A;  1ATG A;  1A8E A;  4TLM B;  5DEX B;  4TOZ A;  1DMB A;  5FTH A;  5M2V A;  4FIM A;  5K2Y A;  2VP1 A;  1B2H A;  1CB6 A;  1N76 A;  2H98 A;  2QPQ A;  1DTZ A;  3EN3 A;  3M8U A;  1B4Z A;  3OO6 A;  4OHN A;  5TPA B;  1B3G A;  3TTK A;  4NTL A;  1RYX A;  3MUQ A;  4POX A;  3MP1 A;  1FQD A;  1H76 A;  1P1Q A;  4LA9 A;  2RKM A;  5TPA A;  3TOD A;  2I49 A;  2ZXT A;  1MXV A;  2ZYK A;  4FAT A;  5KCJ A;  1RYO A;  1GVC A;  1MDP 1;  4MBP A;  1Y3P A;  5AA4 A;  1HSL A;  3ECR A;  3KEI A;  4YU0 A;  4ZED A;  3MBP A;  4I62 A;  4YKJ A;  4ZEK A;  4DLD A;  4FJP A;  5AA4 B;  1A99 A;  1OVT A;  4NE4 A;  3S9E A;  1JQF A;  1ZU0 A;  1WOD A;  4RY1 A;  4LUB A;  2DSF A;  2XXP A;  1P1N A;  5ITO A;  3SEY A;  3C33 A;  4Q5T A;  2ZYM A;  1ZTY A;  1MXZ A;  4MFI A;  1BP5 A;  3QUF A;  3LC8 A;  4KYD A;  4OET A;  3MP8 A;  4GIZ A;  3TZA A;  4I9D A;  3TFL A;  3FVN A;  1DPP A;  1GTK A;  3OXN A;  1B9J A;  4RK2 A;  1LAH E;  3HST A;  4U4S A;  3UGW A;  3QSL A;  5JK4 A;  4NWD A;  1ZKB A;  1N7W A;  1MQD A;  2V84 A;  3C9H A;  3DEL B;  3O6H A;  1M5F A;  3B7D A;  1LB8 A;  4IY5 A;  4Q0C A;  5FHM A;  1D4N A;  2NVU B;  3VV5 A;  1QW0 A;  2I48 A;  3RTW B;  1B4H A;  3FAS A;  2Y84 A;  4GRK A;  5A5X A;  1A8F A;  2PMS A;  3K2D A;  2ZMB A;  4P0I A;  2ZNT A;  5TP9 B;  3TMG A;  3UIF A;  4PFU A;  1EZ9 A;  1IUD A;  3T93 B;  3T9X B;  3W9V A;  5H8Q A;  2DE2 A;  4H65 A;  2HCA A;  4ELO A;  3FV1 A;  2REJ A;  5H8H B;  3LUY A;  1J1N A;  4DZ1 A;  5L9O A;  2Q88 A;  1R9L A;  1SI0 A;  1MY2 A;  1B51 A;  5I56 B;  1JEV A;  1WVJ A;  1BKA A;  2QS2 A;  1B5H A;  3IR1 A;  5DEX A;  1SYH A;  3OSR A;  3TCG A;  2KLF A;  2QS1 A;  3D4G A;  4ESW A;  1S9T A;  4AQ4 A;  1DSN A;  3DP4 A;  3PPR A;  4DXC A;  4AB5 A;  2FNC A;  4GVO A;  3H6V A;  2DXY A;  3TEL A;  4F2O A;  1UIV A;  4BDL A;  1B1H A;  5FTI A;  5I2K B;  4FAJ A;  5H8N B;  3TCF A;  3G3H A;  1OQG A;  1DOT A;  4ZEB A;  3HO7 A;  3U93 A;  4RJZ A;  1NNK A;  4XKR A;  3RT8 A;  5BUU A;  1N0T A;  2B65 A;  5CI5 A;  4QFN A;  1PBP A;  4I1D A;  4LAT A;  5CBS A;  1MH4 A;  5DTB A;  2XX7 A;  2PYY A;  3FXQ A;  5H8F A;  4U21 A;  3CSG A;  4OEU A;  2HXW A;  4OEN A;  2DYX A;  2XXQ A;  5I84 A;  2ZNU A;  3VLU A;  3FAT A;  2NUV A;  4ZE9 A;  3LSL A;  4IGR A;  3TQW A;  3TTN A;  3GBB A;  5CM6 A;  3MPK A;  4C1T A;  5I56 A;  5HBC A;  3O28 A;  1I6Q A;  3MP6 A;  3IOR A;  4U1O A;  1R6Z A;  3EHT A;  4U1Z A;  1Q1K A;  1QUK A;  1QVS A;  3O29 A;  2UXA A;  3LSW A;  2E1S A;  4G4P A;  4G68 C;  3UN6 A;  2P0S A;  1MY4 A;  4WEP A;  1VSO A;  2IA4 A;  2RC7 A;  3PMV A;  1GV8 A;  4F1U A;  4F22 A;  3RT6 B;  1B7U A;  2DE3 A;  1TWY A;  1IEJ A;  2F7A A;  3CRB A;  3IL1 B;  3K6W A;  3R6U A;  3G3J A;  4R9F A;  3T9H B;  3VE1 B;  4OFL A;  2DP8 A;  2QSX A;  5H8S A;  3M3K A;  3FJG A;  4OES A;  2F97 A;  2OZZ A;  4YKP A;  2DOJ A;  4DXU A;  1A54 A;  3I3V A;  5AA3 A;  4QF9 A;  1P1U A;  3G3I A;  3QAX A;  5BWJ A;  3GXA A;  3LSF B;  3S9N C;  1F9B A;  1PC3 A;  4OMB A;  4ZEC A;  2X7P A;  2DE4 A;  4U2R A;  2DWI A;  2THI A;  3DP6 A;  4Z7E A;  2GH9 A;  1LBB A;  1JET A;  1B0H A;  1MG1 A;  1Q35 A;  4PET A;  3U92 A;  5FHN A;  1N3W A;  2Z22 A;  2VOZ A;  5DVJ A;  4ECF A;  2DWJ A;  3A09 A;  4DXB A;  2HFB A;  4PQJ A;  4OER A;  2VD3 A;  3GBA A;  4GLI A;  5KZT A;  1PB7 A;  2B3B A;  3RGY A;  1ANF A;  1B5I A;  1URG A;  2IEE A;  4H67 A;  3A3C A;  4KFQ A;  4F1V A;  3FZV A;  1AOV A;  3C35 A;  1POY 1;  1TT1 A;  3OSQ A;  5EYF A;  3K0V A;  5AA2 A;  2I3V A;  3IOV A;  1Y4C A;  4R74 A;  5L9S A;  2H5Y A;  5CMK A;  3IJO B;  4G2Z A;  1PEB A;  1XHY A;  2AYS A;  1IXG A;  1LAG E;  2RC9 A;  2ZYN A;  3PPN A;  4H1X A;  1PB9 A;  4U23 A;  4YZZ A;  5H8F B;  1XS5 A;  2OK2 A;  2P2A A;  5I58 B;  3LBS A;  3IX1 A;  2XX9 A;  3N6U A;  3MVW A;  3DLN A;  2D5W A;  5AA2 B;  4DE8 A;  3VXC A;  2F7B A;  4MLV A;  3QUJ A;  4H5F A;  2GHB A;  1MY3 A;  2V3U A;  3B6Q A;  3G3F A;  2Z8E A;  3L6G A;  4HCY A;  4QSD A;  3H4Z A;  1MQJ A;  2I4C A;  3P7I A;  3N6T A;  3OO7 A;  4XKQ A;  3U72 A;  3Q27 A;  3C32 A;  1B3H A;  1IIW A;  1HSE A;  2I0C A;  2DVZ A;  3R26 A;  4FOR A;  5EHM A;  2QMW A;  3SEV A;  2DXR A;  3FD3 A;  2ESN A;  4IO4 A;  4X9T A;  3RLF E;  3TCH A;  1RKM A;  3VVF A;  3D4C A;  3Q25 A;  2RCA A;  2XHD A;  3W15 C;  3FVG A;  4JBZ A;  1Y1M A;  2O68 A;  2F36 A;  5H8H A;  4ZZE A;  3IAZ A;  2HZL A;  4NMY A;  1PDA A;  1JW5 A;  2QRY A;  2XXV A;  4UA8 A;  4F3G A;  1B3F A;  3K02 A;  2O1L A;  3KN3 A;  4NF5 A;  4F29 A;  4KCD A;  4GFR A;  4BDO A;  3FUZ A;  4RXL A;  5H8N A;  3VLV A;  5I2K A;  1D9V A;  4M4G A;  5I59 B;  3S9M C;  2HEU A;  3K4U A;  4POW A;  1SI1 A;  1AH5 A;  1MPB A;  1XVX A;  1N04 A;  3UP9 A;  3T96 B;  1XC1 A;  3QK6 A;  4G8N A;  2I6E A;  4K3F A;  1SD3 A;  3IB1 A;  3PUX E;  4KR5 A;  4E0W A;  4ELQ A;  3A3U A;  4H8J A;  4NED A;  3VFJ A;  4L17 A;  3SEU A;  2DWA A;  3N5L A;  1LGB C;  4RA1 A; 
#chains in the Genus database with same CATH topology
 4R6H A;  4QSE A;  4GBW A;  5ISU A;  5IKB A;  4YB5 A;  1DBZ A;  1FBD A;  1MY1 A;  4KYE A;  4PDD A;  2UVG A;  1GGG A;  4YAH X;  1PB8 A;  2AL4 A;  3EHU A;  4GD5 A;  1EZO A;  4F3S A;  1D9Y A;  4OXV A;  4KD5 A;  4PFT A;  3SET A;  2RC8 A;  4KYS A;  4EQ7 A;  2Z8D A;  4GWY A;  3S9L C;  1BIY A;  1DCU A;  1TFA A;  1JEU A;  5DYH A;  3LV0 A;  5T3J A;  3E4R A;  1IMB A;  4TLL B;  4H6D A;  3O6G A;  1P1O A;  1HSJ A;  4BDM A;  1NNT A;  5K2X A;  1MY0 A;  5L8D A;  1B05 A;  1LFG A;  4YKK A;  1EYJ A;  3G3G A;  2FYI A;  2WBB A;  1N3X A;  4PTK A;  1A7L A;  1DTG A;  3VVD A;  1II5 A;  3E79 A;  4IY6 A;  3G7W A;  1S50 A;  4IO7 A;  2XXI A;  2R6G E;  2F35 A;  2Q89 A;  3V5A A;  3S2V A;  1NUY A;  3SER A;  3O6I A;  3CIJ A;  4PP0 A;  2A5T B;  2V25 A;  4LQ2 A;  4H46 A;  1M5E A;  2XXY A;  1EZP A;  1QKA A;  3UA8 A;  3ONM A;  4JVI A;  3SKP A;  1UIU A;  4PDH A;  4JB7 A;  3TEP A;  4I3E A;  1USY H;  1A40 A;  1LFH A;  4G8H A;  3PUW E;  4WKM A;  3QYT A;  4OVJ A;  1AMF A;  1JW1 A;  2OBG A;  2CZL A;  3T0J A;  5AA2 D;  2XD3 A;  4X8R A;  1FBF A;  1I69 A;  3E3K A;  4NF4 A;  1SYI A;  3T9V A;  4I8C A;  2UVI A;  3FV2 A;  3MJN A;  4EXK A;  3TKD A;  1YPN A;  1B32 A;  4JSO A;  1FPB A;  4LON B;  1POT A;  1IXI A;  2REG A;  4ZE8 A;  4QSC A;  3TAJ A;  5FHO A;  5LOM A;  1H3D A;  1AIV A;  4XXU A;  3CSB A;  2Y5K A;  3KC1 A;  4NWC A;  3KG2 A;  2DDK A;  4PFY A;  2NXO A;  3SEX A;  1MQH A;  4QHQ A;  1L5T A;  2F78 A;  5I57 A;  2FIX A;  3KC0 A;  4ELP A;  3JV9 A;  1URD A;  4EQ9 A;  1FBE A;  3KSX A;  3EF7 A;  3ILT B;  2Q2A A;  3CFL A;  3SDF A;  2ZYO A;  2QL3 A;  4C1U A;  2B4M A;  4FEB A;  4IO6 A;  4GOT A;  5I2N B;  1VR5 A;  3B6T A;  4N6D A;  3RUM A;  2CZI A;  2PBW A;  1B3L A;  5FBP A;  2FBP A;  2DVC A;  4H8I A;  2PCR A;  1MXU A;  4ELR A;  3KFM A;  4JXI A;  4O3B A;  1US4 A;  1YXI A;  1MQG A;  4N8G A;  3AXF A;  3M3L A;  2HAV A;  3KJT A;  1B5J A;  3O9P A;  3IJX B;  4MMP A;  4DI4 B;  4G68 A;  3C36 A;  1JW4 A;  2Q8J A;  1MS7 A;  1H45 A;  2WBD A;  4DIG A;  5B7D A;  2BJJ X;  1LLS A;  2OWS A;  3EHS A;  4OVP A;  4H0W A;  1UQW A;  5AE4 A;  1O63 A;  4YIC A;  5DVF A;  1FTL A;  2OX3 A;  3M3F A;  1FBG A;  1YZ0 A;  1MQI A;  2XXR A;  3SEW A;  2ALU A;  3MQ9 A;  2H9B A;  4MLQ A;  4KXP A;  1NUZ A;  4NF5 B;  1FTM A;  4GL0 A;  4LQ5 A;  2PT2 A;  1ZLQ A;  3HPI A;  3MVX A;  3IO4 A;  5EYH A;  3MZ9 A;  2UYF A;  3HV1 A;  2F6P A;  5DVI A;  1MXW A;  2ONR A;  4ZZA A;  1IXC A;  4P0G A;  4TLM B;  5FTH A;  5M2V A;  4FIM A;  2VT5 A;  1CB6 A;  2H98 A;  2QPQ A;  4NTL A;  1RYX A;  5TPA A;  2ZXT A;  2ZYK A;  1MDP 1;  1RDZ A;  4MBP A;  2Y5L A;  1HSL A;  5AA4 B;  1A99 A;  1OVT A;  4NE4 A;  1JQF A;  2GQ1 A;  4LUB A;  2XXP A;  5ITO A;  4MFI A;  3QUF A;  4OET A;  3FVN A;  3OXN A;  4RK2 A;  4NN3 A;  3HST A;  5JK4 A;  1NI9 A;  1ZKB A;  3C9H A;  1LB8 A;  3VV5 A;  2NVU B;  1INP A;  1QW0 A;  1A8F A;  2ZNT A;  2DE2 A;  1EYI A;  4P1E A;  4G61 A;  4DZ1 A;  1SI0 A;  1JEV A;  3IR1 A;  3D4G A;  3DP4 A;  2FVZ A;  3TEL A;  2DXY A;  5H8N B;  1OQG A;  2V4C A;  3U93 A;  3RT8 A;  5CI5 A;  1MH4 A;  2QVU A;  2HXW A;  4OEN A;  5I84 A;  3VLU A;  2NUV A;  3TTN A;  3MP6 A;  3IOR A;  1Q1K A;  4G68 C;  2E1S A;  2P0S A;  1B7U A;  2DE3 A;  3CRB A;  3R6U A;  2QSX A;  5H8S A;  3M3K A;  2F97 A;  4QF9 A;  3LSF B;  2DE4 A;  4U2R A;  2THI A;  4Z7E A;  2GH9 A;  4MCO A;  2Z22 A;  2VOZ A;  2VD3 A;  4GLI A;  2B3B A;  2Q8M A;  1ANF A;  1B5I A;  2XWK A;  5AA2 A;  3IOV A;  1Y4C A;  3IJO B;  1XHY A;  5H8F B;  2P2A A;  1LBX A;  5I3S A;  1FJ9 A;  1IME A;  3MVW A;  4DE8 A;  3VXC A;  2F7B A;  1AWB A;  4H5F A;  3B6Q A;  4NG7 A;  3C32 A;  2DVZ A;  4FOR A;  4MX6 A;  4IO4 A;  3Q25 A;  2F36 A;  3IAZ A;  4PFB A;  4NF5 A;  3FUZ A;  4RXL A;  5H8N A;  4M4G A;  5I59 B;  3S9M C;  3K4U A;  1SI1 A;  1XVX A;  1XC1 A;  2HPG A;  3PUX E;  3IB1 A;  4E0W A;  4NED A;  4XEQ A;  1FPD A;  1NV4 A;  1LFI A;  2F7C A;  1H44 A;  1WDN A;  1NV1 A;  3F11 A;  3KBR A;  4F39 A;  4O7I A;  3LSX A;  2DQV A;  4ZS9 A;  2BJI A;  1I6A A;  4KI0 E;  4P1L A;  4RYA A;  1NV5 A;  4P56 A;  1RDX A;  1LAX A;  3I6V A;  4ONY A;  4JWY A;  1MH3 A;  3S4U A;  3HHF A;  3CFX A;  1ZJL A;  3OD7 A;  4OA4 A;  1BLF A;  2AL5 A;  1IQ7 A;  4BDR A;  2RIN A;  2F6G A;  4RPO A;  4HE0 A;  3E78 A;  1H43 A;  3K6V A;  1P99 A;  3JYR A;  3H03 A;  3WAE A;  4O7M A;  4YMA A;  2F3B A;  3IB0 A;  2RCB A;  3QMF A;  1UTH A;  3MVY A;  2P3N A;  3H6W A;  4QFO A;  1FJ6 A;  4GX3 A;  5ITP A;  3CI8 A;  2O6A A;  4IR8 A;  1XOC A;  5F1Q A;  3TQL A;  1LBW A;  2VHA A;  1KZ8 A;  4JWX A;  2R71 A;  1Y3Q A;  4OZ9 A;  4F18 A;  4OFJ A;  1FQF A;  2H25 A;  4GQO A;  4YMB A;  1NL5 A;  4OVR A;  1Y9U A;  3KOT A;  4XKP A;  4N07 A;  2DWH A;  1S7Y A;  2FIE A;  4EF1 A;  2R9J A;  3K01 A;  5CMB A;  3KBZ A;  2D3I A;  3KSJ A;  5I7I A;  4BLA A;  3PU5 A;  4LZ7 A;  4BDQ A;  4MH5 A;  3FJM A;  1NKX A;  4NF4 B;  3C4M A;  4HXV A;  3VXB A;  1RDY A;  4LP2 B;  2JJK A;  4H5G A;  4HCW A;  1SBP A;  4R9G A;  1URS A;  4EXL A;  1USY E;  4NF8 B;  3ZKL A;  1JP4 A;  3C34 A;  4Q8R A;  5JTY A;  3QIM A;  4P11 A;  2O51 A;  1QUI A;  2LAO A;  2GHA A;  5ET5 A;  4LVQ A;  4X1B A;  1B40 A;  1FPG A;  1VFD A;  4YKI A;  4AS5 A;  1JNF A;  5EHS A;  4QFK A;  1NV2 A;  2F34 A;  1PBQ A;  4ZEF A;  4NF6 A;  1T0K A;  3EQ1 A;  1LCF A;  3IOT A;  4GXS B;  2Y7K A;  2V3Q A;  3V89 B;  5KCJ B;  2A5T A;  4N6K A;  2HHM A;  4PE3 A;  3ILU B;  4IO5 A;  3BFU A;  1OIB A;  1LBV A;  3O66 A;  3ODB A;  1JVX A;  1Z7N E;  2UVJ A;  4PF6 A;  2XA5 A;  5ET8 A;  5B70 A;  3PV0 E;  1CE2 A;  2QVR A;  3PPQ A;  4I40 A;  2A5S A;  1LAF E;  1KWH A;  2NWJ A;  2GRV A;  3UOR A;  3TUS A;  1NV3 A;  2FA7 A;  2QMX A;  4EDP A;  2OWZ A;  2YLN A;  3IFC A;  1IIT A;  3VVE A;  3O97 A;  1NFT A;  3E9X A;  2H99 A;  1ZBM A;  1MM7 A;  1YYZ A;  5JTY B;  4MJO A;  2F5X A;  5KZT A;  4U4X A;  2XD2 A;  4DCY A;  5ELV A;  1LB9 A;  4PGN A;  1IZ1 A;  5EQ9 A;  2I4B A;  2O1M A;  4JSD A;  5A5L A;  4R72 A;  1SW5 A;  4R6K A;  2Q74 A;  3KOS A;  2PT1 A;  4RK9 A;  5J1D A;  2Y7R A;  3T1B A;  3T66 A;  1A8E A;  1N76 A;  5HPQ A;  1DTZ A;  4OHN A;  1B3G A;  3MUQ A;  3MP1 A;  3TOD A;  2I49 A;  5KCJ A;  4FAT A;  4JVC A;  1GVC A;  4YU0 A;  5IZ1 A;  2CZH A;  4ZED A;  3MBP A;  4YKJ A;  4FJP A;  2KQZ A;  3IFA A;  4NF0 A;  3SEY A;  1FBP A;  2ZYM A;  1ZTY A;  1MXZ A;  3LC8 A;  4KYD A;  4I9D A;  1GTK A;  3UGW A;  1LEV A;  3QSL A;  5EQ8 A;  1G0H A;  3DEL B;  1MQD A;  3O6H A;  4IY5 A;  4GRK A;  3K2D A;  3UIF A;  3T93 B;  4I3Y A;  4H65 A;  2Q88 A;  1R9L A;  1B5H A;  3TCG A;  2QS1 A;  4ESW A;  1S9T A;  1DSN A;  3PPR A;  4XFE A;  2FNC A;  1UIV A;  1B1H A;  5I2K B;  5BUU A;  4RJZ A;  1N0T A;  4QFN A;  4I1D A;  2VPN A;  4LAT A;  2XX7 A;  5H8F A;  3FXQ A;  4U21 A;  4GWS A;  4OEU A;  3TQW A;  3GBB A;  5CM6 A;  5I56 A;  5HBC A;  3O28 A;  1I6Q A;  5ET6 A;  4HE1 A;  4U1Z A;  1QUK A;  3UN6 A;  1VSO A;  4F1U A;  3RT6 B;  4R9F A;  2F7A A;  4MHF A;  5LDZ A;  4OFL A;  2DP8 A;  2OZZ A;  4YKP A;  3I3V A;  3RPL B;  5BWJ A;  1F9B A;  1PC3 A;  2DWI A;  1Q35 A;  5FHN A;  5DVJ A;  2DWJ A;  4OER A;  3GBA A;  1PB7 A;  4H67 A;  4XF5 A;  5EYF A;  3K0V A;  4R74 A;  5L9S A;  5EQA A;  2B4L A;  1PEB A;  2RC9 A;  3BIG A;  1XS5 A;  2VPO A;  2GHB A;  4HCY A;  3H4Z A;  1MQJ A;  3P7I A;  5IGA A;  3FD3 A;  3RLF E;  2RCA A;  4JBZ A;  1JW5 A;  2XXV A;  1B3F A;  2O1L A;  5I2K A;  2HEU A;  4POW A;  1MPB A;  4K3F A;  2I6E A;  4NHB A;  4ELQ A;  1DK4 A;  4L17 A;  4N91 A;  4PCD A;  2MKZ A;  3N5L A;  4QSD A;  1LGB C;  4RA1 A;  3TZA A;  3Q26 A;  3C31 A;  1N84 A;  5LTC A;  4OFO A;  3CG3 A;  4DCX A;  3PPO A;  3HN0 A;  1QJM A;  3TTR A;  4JDF A;  1EYK A;  4G8M A;  3KN7 A;  3ROJ A;  1UTB B;  2XXX A;  1B0L A;  4XIG Q;  1FPF A;  1SDX A;  1OQH A;  3RQT A;  4F3B A;  4THI A;  1D9Q A;  3T22 A;  3GZG A;  3U1O A;  4PF8 A;  1MPD A;  3FBP A;  2QS4 A;  5CRY A;  3SES A;  2O7I A;  1KA0 A;  5AA1 A;  3MAM A;  2E0S A;  1FQE A;  2X7Q A;  4QBA A;  1M5B A;  1OMP A;  3PUY E;  4F19 A;  5HM4 B;  3MW0 A;  1ZIU A;  3W9W A;  3MZB A;  2D21 A;  2V93 A;  3FVK A;  3KJ7 A;  3K6U A;  4MAG A;  1FQB A;  4C0R A;  2XXU A;  2XWO A;  4YB7 A;  3BIH A;  3HCQ A;  3G3K A;  3MVZ A;  3CVG A;  1SW2 A;  3OOA A;  4G77 A;  4GF8 A;  4OQO A;  4MF3 A;  2GFE A;  3QXM A;  1R9Q A;  3OEM A;  1IMC A;  1NH7 A;  2QS3 A;  3V83 A;  2UYE A;  4GBV A;  2P1S A;  3Q29 A;  1TFD A;  1Y4T A;  3IOW A;  1OVB A;  3U65 A;  3MPL A;  3GLB A;  3KZG A;  3FIR A;  2V3T A;  1B1X A;  2ZZX A;  3H6T A;  2ANJ A;  1MXY A;  2WYP A;  1QKB A;  2HAU A;  2W7Y A;  2UVH A;  1SVX B;  4OTE A;  4FE8 A;  4OWD A;  2Q2C A;  1BTJ A;  4GXA A;  1IXH A;  2B3F A;  3RTF B;  2QFL A;  4QFP A;  2OJT A;  2OLB A;  5TP9 A;  4HS7 A;  4F2Q A;  2OCU A;  2X26 A;  4P47 A;  4NF6 B;  5CC2 A;  3RN8 A;  2NOO A;  4WED A;  4GL8 A;  2Y7I A;  1B7Z A;  2KR0 A;  4EUO A;  3E13 X;  2R8T A;  2CEX A;  3K00 A;  4YB6 A;  1QUL A;  1A55 A;  1MRP A;  4Z0I A;  4R73 A;  2F8D A;  4ND9 A;  5IAI A;  4IB2 A;  4KQP A;  4WXJ A;  4N6P A;  3O2A A;  4RNS A;  4Q30 B;  1FCK A;  5I2N A;  3MC2 A;  3FXB A;  5I5P A;  3U8Q A;  2H4I A;  2AIX A;  4KCC A;  4ZEI A;  5IZZ A;  3T9U A;  4O3C A;  3ISP A;  1Y1Z A;  5CMC A;  4EF2 A;  1YTV A;  5IZ3 B;  3TTM A;  1JVY A;  2I3W A;  2ZZV A;  1EU8 A;  4MNI A;  4LZ8 A;  3DM0 A;  3PTY A;  3N26 A;  1B6H A;  4PE5 B;  1FTA A;  4PFW A;  5DT6 A;  3CG1 A;  1SW1 A;  4P9K A;  4P8B A;  1FPJ A;  1IMA A;  4E0X A;  2YPN A;  3TDJ A;  3DP8 A;  2G29 A;  1MXX A;  1FQC A;  2PVU A;  2HQ0 A;  5ICT A;  4ISU A;  4DDD A;  2QVV A;  1DMB A;  5K2Y A;  3M8U A;  4POX A;  1H76 A;  1P1Q A;  4LA9 A;  3A29 A;  1RYO A;  1NV6 A;  1Y3P A;  3ECR A;  3S9E A;  4PC9 A;  4RY1 A;  1FBC A;  3C33 A;  4Q5T A;  1BP5 A;  3EKI A;  3MP8 A;  4GIZ A;  4PGP A;  1FPK A;  4DI3 D;  2XWI A;  5A5X B;  1M5F A;  3LUZ A;  1B4H A;  2Y84 A;  5TP9 B;  2ZMB A;  4PFU A;  3W9V A;  4ELO A;  3FV1 A;  2REJ A;  5H8H B;  3LUY A;  1MY2 A;  1B51 A;  5I56 B;  5DEX A;  1SYH A;  2KLF A;  4AQ4 A;  4GVO A;  5FTI A;  4ZEB A;  3HO7 A;  2B65 A;  5DTB A;  2PYY A;  2DYX A;  2XXQ A;  1KA1 A;  3FAT A;  4ZE9 A;  3LSL A;  4IGR A;  4N81 A;  3MPK A;  1K9Y A;  1R6Z A;  3EHT A;  3O29 A;  1QVS A;  2UXA A;  3LSW A;  1MY4 A;  2IA4 A;  3PMV A;  1TWY A;  1IEJ A;  3T9H B;  3G3J A;  3VE1 B;  4QXD A;  3FJG A;  4OES A;  2DOJ A;  4DXU A;  1FPI A;  1P1U A;  5ESY A;  3S9N C;  4OMB A;  4ZEC A;  1NV7 A;  1LBB A;  1JET A;  1B0H A;  1MG1 A;  3U92 A;  1N3W A;  3A09 A;  2P3V A;  4DXB A;  4PQJ A;  5ET7 A;  3RGY A;  4F1V A;  4KFQ A;  3C35 A;  1TT1 A;  1FPL A;  1BK4 A;  2H5Y A;  5CMK A;  1IXG A;  2ZYN A;  3LBS A;  3IX1 A;  4O8M A;  3N6U A;  4PAK A;  5EYG A;  1IMD A;  3DLN A;  5AA2 B;  2F3D A;  1MY3 A;  2V3U A;  3L6G A;  2Z8E A;  4PAF A;  2I4C A;  3U72 A;  3Q27 A;  2I0C A;  5EHM A;  3USD A;  3SEV A;  2QMW A;  3VVF A;  2ESN A;  3W15 C;  2XHD A;  1LBZ A;  1Y1M A;  2O68 A;  2HZL A;  2QRY A;  3B50 A;  4UA8 A;  3K02 A;  3KN3 A;  3CHG A;  4F29 A;  4BDO A;  4GFR A;  3VLV A;  1D9V A;  4H45 A;  4N15 A;  1N04 A;  4F2O A;  3QK6 A;  4GWZ A;  1SD3 A;  2DWA A;  4N13 A;  2RF1 A;  1M5D A;  1FRP A;  1D3K A;  1FW0 A;  1UTB A;  4FEC A;  4R2F A;  3IB2 A;  1SW4 A;  2ONK E;  3BFT A;  4GWU A;  2G93 A;  5I58 A;  3IOU A;  2ONS A;  3OO8 A;  4R75 A;  1I6B A;  2PX1 A;  1LBY A;  1AL3 A;  1O64 A;  1VE4 A;  4R6Y A;  4FED A;  5F7V A;  3IK6 B;  2Z8F A;  3FVO A;  3PGF A;  4ESX A;  3HFU A;  3KGC A;  4XKN A;  1XT8 A;  2YJP A;  3OEL A;  3OEN A;  2WKY A;  1R1N A;  1B46 A;  3PPP A;  4RPN A;  1MPC A;  4NQ8 A;  4FBP A;  2O7U A;  3THI A;  3JZJ A;  3K1P A;  3VLW A;  5CMM A;  4UAC A;  2VD2 A;  1B7H A;  1QGX A;  2L5V A;  3RPW A;  1YCJ A;  2Y7P A;  3PMX A;  3WAF A;  5KDT A;  5TU0 A;  3CR9 A;  3PMW A;  4IGT A;  2ABH A;  5JEI A;  3PUZ E;  1LCT A;  1NNP A;  4X48 A;  1US5 A;  3TYH A;  3ZSF A;  1FTK A;  1FQA A;  3N94 A;  3EPE A;  3MYU A;  4MNC A;  4U22 A;  1XVY A;  1B52 A;  3PUV E;  3VDF A;  1Y20 A;  2HXR A;  4KHZ E;  1NUW A;  4O3A A;  1MM6 A;  1ZMG A;  4XTC Q;  1G0I A;  1NMU A;  1TXF A;  2Q9T A;  2XXW A;  1O7T A;  1GR2 A;  1SPI A;  3ZKK A;  1P1W A;  3RY3 A;  4PBH A;  3K1N A;  1YAE A;  4QRZ A;  4G68 B;  4R2B A;  3V8X B;  3B8B A;  3TPA A;  2PFY A;  3H7M A;  3FXR A;  4OEV A;  4HTG A;  4GWO A;  5H8Q B;  1IMF A;  3FJ7 A;  2XX8 A;  1SQY A;  4N17 A;  1MDQ A;  4PAI A;  5ICQ A;  4HE2 A;  1N7X A;  1LST A;  3I5O A;  2I58 A;  2OWT A;  3PD9 A;  1DPE A;  1VDW A;  5EQ7 A;  4KPT A;  3MZ1 A;  1B3E A;  4M1V A;  1OLA A;  5I57 B;  4JVD A;  4OVS A;  2DS9 A;  2Z23 A;  2I0B A;  4OVT A;  3KN8 A;  1Y3N A;  1NH8 A;  1VFE A;  4AB6 A;  5L9M A;  3OMB A;  5J16 A;  1ELJ A;  3H3G A;  3RNN A;  2O84 X;  1B58 A;  3OO9 A;  2O69 A;  4F31 B;  4MIJ A;  4QFL A;  2CZK A;  4UAB A;  1FTO A;  4X1D A;  4HW8 A;  4EQB A;  3B6W A;  2HZK A;  4F3P A;  2Y7W A;  3MWB A;  3RPL A;  3LR1 A;  4NF8 A;  3ZS6 A;  1LBC A;  3H6U A;  5IZ3 A;  4ZDM A;  3FXU A;  1K9Z A;  4BDN A;  4O94 A;  4F1Y A;  2XXH A;  3HHG A;  1FTJ A;  3UK4 A;  3L6H A;  1Z7M E;  2M8C A;  2ZNS A;  2XXT A;  3CFZ A;  4GX6 A;  3R7X A;  4PBQ A;  3RYD A;  4OYV A;  3BKI B;  3K6X A;  2WEF A;  3U94 A;  2VGQ A;  3H06 B;  5CBR A;  3Q28 A;  2QJE A;  1NNF A;  3PD8 A;  1NUX A;  4GWW A;  4TQU Q;  5I59 A;  5DW8 A;  4IO3 A;  5KDT B;  4IO2 A;  3OEK A;  1QUJ A;  3BBR A;  1EH3 A;  3FGS A;  1M5C A;  3TTL A;  3K1M A;  4LZ5 A;  1UTH B;  1OLC A;  2CMO A;  4JWO A;  3IO6 A;  1ATG A;  5DEX B;  4TOZ A;  2VP1 A;  1FBH A;  1FSA A;  1B2H A;  2PFZ A;  5TPA B;  3EN3 A;  3OO6 A;  1B4Z A;  5IM2 A;  4NX1 A;  3TTK A;  1FQD A;  2RKM A;  1MXV A;  5AA4 A;  3KEI A;  4ZEK A;  4I62 A;  4DLD A;  1ZU0 A;  1WOD A;  2DSF A;  4PFI A;  1P1N A;  4NGU A;  3TFL A;  1DPP A;  3D1R A;  1B9J A;  2WYK A;  1LAH E;  4U4S A;  2WX9 A;  4NWD A;  1N7W A;  2V84 A;  4Q0C A;  1NV0 A;  3B7D A;  5FHM A;  4AS4 A;  1D4N A;  2I48 A;  3RTW B;  4PFR A;  5A5X A;  3FAS A;  2PMS A;  4P0I A;  3TMG A;  1EZ9 A;  1IUD A;  3T9X B;  5H8Q A;  4MNP A;  2HCA A;  4X04 A;  1J1N A;  2CEY A;  5L9O A;  1FPE A;  1WVJ A;  2QS2 A;  3OSR A;  4NAP A;  4DXC A;  4LN5 A;  2FHY A;  4AB5 A;  3H6V A;  4BDL A;  4FAJ A;  3TCF A;  3G3H A;  1DOT A;  4OVQ A;  4XKR A;  1NNK A;  3NOH A;  2XXK A;  1PBP A;  5CBS A;  3CSG A;  2ZNU A;  4C1T A;  4U1O A;  4G4P A;  4WEP A;  1CNQ A;  4F22 A;  2RC7 A;  1GV8 A;  4P3L A;  3IL1 B;  3K6W A;  2XWV A;  5AA3 A;  1A54 A;  3QAX A;  3G3I A;  3GXA A;  2X7P A;  3DP6 A;  4PET A;  4ECF A;  2HFB A;  1XI6 A;  1AOV A;  1URG A;  2IEE A;  3A3C A;  3FZV A;  4GWX A;  1POY 1;  3OSQ A;  2I3V A;  2ZZW A;  3MST A;  4G2Z A;  2AYS A;  1LAG E;  3PPN A;  4H1X A;  4U23 A;  3SEU A;  1PB9 A;  4YZZ A;  2OK2 A;  5I58 B;  4MEV A;  2XX9 A;  2D5W A;  5F24 A;  4MLV A;  3QUJ A;  3G3F A;  3N6T A;  3OO7 A;  4XKQ A;  1B3H A;  1IIW A;  1HSE A;  3R26 A;  4F3G A;  2DXR A;  4X9T A;  3TCH A;  4OAN A;  1RKM A;  3D4C A;  3GYY A;  3FVG A;  5H8H A;  4ZZE A;  4GX4 A;  4NMY A;  1PDA A;  4KCD A;  4N4U A;  1Q9D A;  1AH5 A;  4N8Y A;  3UP9 A;  3T96 B;  4G8N A;  4KR5 A;  3A3U A;  4H8J A;  3VFJ A;  3SZP A;  1BKA A; 
#chains in the Genus database with same CATH homology
 1LFI A;  3Q26 A;  4R6H A;  4N13 A;  2RF1 A;  3C31 A;  2F7C A;  1H44 A;  1M5D A;  1WDN A;  1N84 A;  4QSE A;  1D3K A;  5ISU A;  5IKB A;  1FW0 A;  1UTB A;  4FEC A;  4OFO A;  3F11 A;  4R2F A;  3KBR A;  3IB2 A;  3CG3 A;  1MY1 A;  3PPO A;  4YB5 A;  4DCX A;  3HN0 A;  4KYE A;  1SW4 A;  4F39 A;  1QJM A;  3LSX A;  2ONK E;  2DQV A;  4ZS9 A;  3BFT A;  3TTR A;  2G93 A;  1I6A A;  2UVG A;  4JDF A;  4KI0 E;  1GGG A;  4YAH X;  5I58 A;  1PB8 A;  4RYA A;  3IOU A;  2AL4 A;  2ONS A;  3EHU A;  3KN7 A;  4G8M A;  4GD5 A;  3USD A;  5KCJ B;  4F3S A;  3OO8 A;  1EZO A;  1D9Y A;  4R75 A;  1UTB B;  2XXX A;  4OXV A;  4KD5 A;  1I6B A;  4PFT A;  2PX1 A;  3SET A;  1B0L A;  4XIG Q;  1LAX A;  2RC8 A;  1SDX A;  3I6V A;  4ONY A;  4JWY A;  1MH3 A;  4KYS A;  4EQ7 A;  1AL3 A;  3S4U A;  1O64 A;  3HHF A;  2Z8D A;  1OQH A;  3S9L C;  1BIY A;  3CFX A;  1ZJL A;  1VE4 A;  3OD7 A;  4R6Y A;  4FED A;  5F7V A;  1TFA A;  3IK6 B;  1BLF A;  1JEU A;  1IQ7 A;  2AL5 A;  2Z8F A;  3FVO A;  3E4R A;  5DYH A;  3PGF A;  4ESX A;  3KGC A;  4XKN A;  3RQT A;  4BDR A;  1XT8 A;  2YJP A;  3OEL A;  4F3B A;  4TLL B;  4THI A;  3OEN A;  2RIN A;  2WKY A;  2F6G A;  1R1N A;  4H6D A;  4RPO A;  3T22 A;  3GZG A;  3O6G A;  1P1O A;  1B46 A;  1HSJ A;  3PPP A;  4RPN A;  4BDM A;  3U1O A;  1MPD A;  1MPC A;  1NNT A;  1H43 A;  3K6V A;  1P99 A;  2QS4 A;  5K2X A;  5CRY A;  1MY0 A;  2O7U A;  5L8D A;  3JYR A;  1B05 A;  3H03 A;  3JZJ A;  3SES A;  3THI A;  2O7I A;  3K1P A;  3WAE A;  3IB0 A;  5CMM A;  3VLW A;  4YMA A;  4UAC A;  1LFG A;  4YKK A;  2RCB A;  5AA1 A;  3MAM A;  2E0S A;  2VD2 A;  1UTH A;  3G3G A;  1FQE A;  1B7H A;  2X7Q A;  3MVY A;  2FYI A;  1M5B A;  3H6W A;  3RPW A;  1N3X A;  1OMP A;  1YCJ A;  4QFO A;  1A7L A;  3PUY E;  2Y7P A;  1DTG A;  3VVD A;  5ITP A;  1II5 A;  3CI8 A;  4F19 A;  2O6A A;  5HM4 B;  1XOC A;  3PMX A;  5F1Q A;  3MW0 A;  1ZIU A;  3TQL A;  3WAF A;  5KDT A;  5TU0 A;  3CR9 A;  3PMW A;  3W9W A;  4IGT A;  2ABH A;  4IY6 A;  5HPQ A;  5JEI A;  3MZB A;  3G7W A;  3PUZ E;  1LCT A;  1NNP A;  4X48 A;  1US5 A;  3TYH A;  3ZSF A;  1S50 A;  4IO7 A;  2XXI A;  2D21 A;  1FTK A;  2V93 A;  2R6G E;  1FQA A;  2F35 A;  2VHA A;  3FVK A;  3N94 A;  4JWX A;  2R71 A;  3EPE A;  1Y3Q A;  3KJ7 A;  2Q89 A;  3K6U A;  4OZ9 A;  3V5A A;  4OFJ A;  1FQF A;  4U22 A;  3S2V A;  4F18 A;  1XVY A;  1FQB A;  1B52 A;  2H25 A;  3PUV E;  4GQO A;  3SER A;  3O6I A;  3CIJ A;  4PP0 A;  4C0R A;  4YMB A;  1NL5 A;  2XXU A;  2A5T B;  1Y9U A;  2V25 A;  4LQ2 A;  3VDF A;  1M5E A;  2XXY A;  3KOT A;  1Y20 A;  4YB7 A;  1EZP A;  1QKA A;  4XKP A;  3UA8 A;  4N07 A;  2DWH A;  3HCQ A;  1S7Y A;  3G3K A;  3ONM A;  3MVZ A;  4KHZ E;  3SKP A;  3CVG A;  4O3A A;  1SW2 A;  1UIU A;  4EF1 A;  4JB7 A;  1MM6 A;  2R9J A;  3K01 A;  1ZMG A;  3OOA A;  4G77 A;  4XTC Q;  5CMB A;  3KSJ A;  2D3I A;  3TEP A;  4GF8 A;  1USY H;  1A40 A;  1LFH A;  4OQO A;  4BLA A;  4G8H A;  3PU5 A;  3PUW E;  4MF3 A;  4LZ7 A;  4WKM A;  4BDQ A;  3QYT A;  2GFE A;  3QXM A;  4MH5 A;  1NMU A;  1TXF A;  1R9Q A;  3FJM A;  1NKX A;  3OEM A;  1NH7 A;  2Q9T A;  2QS3 A;  4NF4 B;  4OVJ A;  3V83 A;  2UYE A;  2XXW A;  1AMF A;  3C4M A;  1JW1 A;  1O7T A;  1GR2 A;  3ZKK A;  2OBG A;  2CZL A;  3VXB A;  5AA2 D;  1P1W A;  2P1S A;  3RY3 A;  3Q29 A;  2XD3 A;  3K1N A;  1TFD A;  1Y4T A;  1YAE A;  1OVB A;  3IOW A;  4G68 B;  4QRZ A;  1I69 A;  4LP2 B;  3E3K A;  3MPL A;  4H5G A;  4NF4 A;  3GLB A;  3KZG A;  4HCW A;  4R2B A;  3FIR A;  1SBP A;  3V8X B;  2V3T A;  1B1X A;  3TPA A;  4R9G A;  1SYI A;  1URS A;  3H6T A;  3T9V A;  5A5X B;  4I8C A;  2ANJ A;  1MXY A;  2UVI A;  1USY E;  3FXR A;  3H7M A;  4NF8 B;  3FV2 A;  4OEV A;  4EXL A;  1QKB A;  2HAU A;  3MJN A;  3ZKL A;  4HTG A;  2W7Y A;  2UVH A;  1SVX B;  3C34 A;  4GWO A;  4EXK A;  4OTE A;  5H8Q B;  3TKD A;  1YPN A;  4Q8R A;  1B32 A;  3QIM A;  5JTY A;  3FJ7 A;  2XX8 A;  4JSO A;  1SQY A;  4FE8 A;  4LON B;  2Q2C A;  4OWD A;  4P11 A;  1MDQ A;  1POT A;  5ICQ A;  1BTJ A;  1IXI A;  4GXA A;  2O51 A;  1N7X A;  1IXH A;  2REG A;  1LST A;  2B3F A;  3I5O A;  4ZE8 A;  4QSC A;  1QUI A;  2I58 A;  3RTF B;  2LAO A;  2OWT A;  2GHA A;  3TAJ A;  3PD9 A;  1DPE A;  5FHO A;  5LOM A;  1H3D A;  4LVQ A;  4QFP A;  1AIV A;  2OJT A;  2OLB A;  4XXU A;  4HS7 A;  3CSB A;  5TP9 A;  4X1B A;  4F2Q A;  4KPT A;  2OCU A;  2X26 A;  1B40 A;  1VFD A;  3MZ1 A;  1B3E A;  4NWC A;  4M1V A;  4NF6 B;  5CC2 A;  1OLA A;  3RN8 A;  3KG2 A;  4YKI A;  4PFY A;  5I57 B;  2NXO A;  2DS9 A;  3SEX A;  1MQH A;  4QHQ A;  1L5T A;  2F78 A;  2NOO A;  2Z23 A;  4GL8 A;  4WED A;  5I57 A;  2I0B A;  2Y7I A;  1JNF A;  5EHS A;  4QFK A;  1B7Z A;  4EUO A;  3E13 X;  3KN8 A;  2F34 A;  4ELP A;  1Y3N A;  3JV9 A;  1NH8 A;  1URD A;  4EQ9 A;  1PBQ A;  1VFE A;  3K00 A;  1QUL A;  1A55 A;  4NF6 A;  1MRP A;  3OMB A;  4YB6 A;  4ZEF A;  5L9M A;  4AB6 A;  4Z0I A;  1ELJ A;  3H3G A;  3KSX A;  3EF7 A;  3EQ1 A;  2O84 X;  3ILT B;  4R73 A;  2Q2A A;  3RNN A;  1T0K A;  3CFL A;  1LCF A;  1B58 A;  3OO9 A;  3IOT A;  4GXS B;  2F8D A;  2Y7K A;  2V3Q A;  2O69 A;  4ND9 A;  3SDF A;  3V89 B;  5IAI A;  2A5T A;  2QL3 A;  2ZYO A;  4C1U A;  4IB2 A;  4FEB A;  4KQP A;  4IO6 A;  4GOT A;  4WXJ A;  4F31 B;  5I2N B;  4N6P A;  1VR5 A;  4QFL A;  3O2A A;  3B6T A;  3ILU B;  4IO5 A;  3BFU A;  1FTO A;  3RUM A;  2PBW A;  4RNS A;  1B3L A;  4X1D A;  4HW8 A;  1OIB A;  4EQB A;  3O66 A;  3ODB A;  3B6W A;  4Q30 B;  1FCK A;  2HZK A;  2DVC A;  1JVX A;  4F3P A;  1Z7N E;  4H8I A;  1MXU A;  2Y7W A;  3MWB A;  2UVJ A;  4ELR A;  3KFM A;  5I2N A;  4JXI A;  3LR1 A;  4NF8 A;  3ZS6 A;  1LBC A;  3H6U A;  4O3B A;  1US4 A;  3MC2 A;  5B70 A;  3PV0 E;  1CE2 A;  3PPQ A;  3U8Q A;  1MQG A;  2H4I A;  2A5S A;  4ZDM A;  3FXU A;  3AXF A;  3M3L A;  2AIX A;  2HAV A;  4KCC A;  4BDN A;  1LAF E;  1KWH A;  2NWJ A;  3KJT A;  4F1Y A;  1B5J A;  4ZEI A;  3O9P A;  2XXH A;  2GRV A;  1FTJ A;  3HHG A;  3T9U A;  3IJX B;  3UK4 A;  3UOR A;  3L6H A;  4O3C A;  4G68 A;  3TUS A;  3C36 A;  1JW4 A;  2FA7 A;  2QMX A;  1Y1Z A;  5CMC A;  4EF2 A;  4EDP A;  1YTV A;  2Q8J A;  1MS7 A;  1Z7M E;  2M8C A;  3TTM A;  2ZNS A;  1H45 A;  2YLN A;  4DIG A;  2XXT A;  1IIT A;  2BJJ X;  1JVY A;  5B7D A;  2I3W A;  3VVE A;  3CFZ A;  1EU8 A;  3O97 A;  3R7X A;  1LLS A;  2OWS A;  3EHS A;  4LZ8 A;  4OYV A;  3DM0 A;  1NFT A;  4H0W A;  3BKI B;  3E9X A;  2H99 A;  3K6X A;  1ZBM A;  1MM7 A;  3N26 A;  5JTY B;  1B6H A;  1UQW A;  2F5X A;  5AE4 A;  1O63 A;  3U94 A;  4YIC A;  2VGQ A;  1FTL A;  2XD2 A;  3H06 B;  3M3F A;  4PE5 B;  4U4X A;  5DVF A;  4PFW A;  3Q28 A;  1MQI A;  5CBR A;  2XXR A;  2QJE A;  1NNF A;  3PD8 A;  3SEW A;  5DT6 A;  2ALU A;  4DCY A;  5ELV A;  3CG1 A;  4TQU Q;  3MQ9 A;  2H9B A;  4MLQ A;  5I59 A;  1LB9 A;  1SW1 A;  4IO3 A;  5KDT B;  4IO2 A;  1IZ1 A;  3OEK A;  4NF5 B;  4E0X A;  1FTM A;  2I4B A;  2O1M A;  4JSD A;  2YPN A;  4R72 A;  1QUJ A;  3BBR A;  1EH3 A;  3FGS A;  1M5C A;  2PT2 A;  1ZLQ A;  4GL0 A;  4LQ5 A;  3TTL A;  3TDJ A;  3HPI A;  3K1M A;  3IO4 A;  3MVX A;  3DP8 A;  2G29 A;  4LZ5 A;  1MXX A;  1UTH B;  1SW5 A;  3MZ9 A;  4R6K A;  2UYF A;  3HV1 A;  1FQC A;  2F6P A;  2PVU A;  1OLC A;  3KOS A;  2CMO A;  5DVI A;  2HQ0 A;  4JWO A;  5ICT A;  2PT1 A;  1MXW A;  4RK9 A;  5J1D A;  4ISU A;  2ONR A;  3IO6 A;  4ZZA A;  1IXC A;  4P0G A;  2Y7R A;  4DDD A;  3T66 A;  1ATG A;  1A8E A;  4TLM B;  5DEX B;  4TOZ A;  1DMB A;  5FTH A;  5M2V A;  4FIM A;  5K2Y A;  2VP1 A;  1B2H A;  1CB6 A;  1N76 A;  2H98 A;  2QPQ A;  1DTZ A;  3EN3 A;  3M8U A;  1B4Z A;  3OO6 A;  4OHN A;  5TPA B;  1B3G A;  3TTK A;  4NTL A;  1RYX A;  3MUQ A;  4POX A;  3MP1 A;  1FQD A;  1H76 A;  1P1Q A;  4LA9 A;  2RKM A;  5TPA A;  3TOD A;  2I49 A;  2ZXT A;  1MXV A;  2ZYK A;  4FAT A;  5KCJ A;  1RYO A;  1GVC A;  1MDP 1;  4MBP A;  1Y3P A;  5AA4 A;  1HSL A;  3ECR A;  3KEI A;  4YU0 A;  4ZED A;  3MBP A;  4I62 A;  4YKJ A;  4ZEK A;  4DLD A;  4FJP A;  5AA4 B;  1A99 A;  1OVT A;  4NE4 A;  3S9E A;  1JQF A;  1ZU0 A;  1WOD A;  4RY1 A;  4LUB A;  2DSF A;  2XXP A;  1P1N A;  5ITO A;  3SEY A;  3C33 A;  4Q5T A;  2ZYM A;  1ZTY A;  1MXZ A;  4MFI A;  1BP5 A;  3QUF A;  3LC8 A;  4KYD A;  4OET A;  3MP8 A;  4GIZ A;  3TZA A;  4I9D A;  3TFL A;  3FVN A;  1DPP A;  1GTK A;  3OXN A;  1B9J A;  4RK2 A;  1LAH E;  3HST A;  4U4S A;  3UGW A;  3QSL A;  5JK4 A;  4NWD A;  1ZKB A;  1N7W A;  1MQD A;  2V84 A;  3C9H A;  3DEL B;  3O6H A;  1M5F A;  3B7D A;  1LB8 A;  4IY5 A;  4Q0C A;  5FHM A;  1D4N A;  2NVU B;  3VV5 A;  1QW0 A;  2I48 A;  3RTW B;  1B4H A;  3FAS A;  2Y84 A;  4GRK A;  5A5X A;  1A8F A;  2PMS A;  3K2D A;  2ZMB A;  4P0I A;  2ZNT A;  5TP9 B;  3TMG A;  3UIF A;  4PFU A;  1EZ9 A;  1IUD A;  3T93 B;  3T9X B;  3W9V A;  5H8Q A;  2DE2 A;  4H65 A;  2HCA A;  4ELO A;  3FV1 A;  2REJ A;  5H8H B;  3LUY A;  1J1N A;  4DZ1 A;  5L9O A;  2Q88 A;  1R9L A;  1SI0 A;  1MY2 A;  1B51 A;  5I56 B;  1JEV A;  1WVJ A;  1BKA A;  2QS2 A;  1B5H A;  3IR1 A;  5DEX A;  1SYH A;  3OSR A;  3TCG A;  2KLF A;  2QS1 A;  3D4G A;  4ESW A;  1S9T A;  4AQ4 A;  1DSN A;  3DP4 A;  3PPR A;  4DXC A;  4AB5 A;  2FNC A;  4GVO A;  3H6V A;  2DXY A;  3TEL A;  4F2O A;  1UIV A;  4BDL A;  1B1H A;  5FTI A;  5I2K B;  4FAJ A;  5H8N B;  3TCF A;  3G3H A;  1OQG A;  1DOT A;  4ZEB A;  3HO7 A;  3U93 A;  4RJZ A;  1NNK A;  4XKR A;  3RT8 A;  5BUU A;  1N0T A;  2B65 A;  5CI5 A;  4QFN A;  1PBP A;  4I1D A;  4LAT A;  5CBS A;  1MH4 A;  5DTB A;  2XX7 A;  2PYY A;  3FXQ A;  5H8F A;  4U21 A;  3CSG A;  4OEU A;  2HXW A;  4OEN A;  2DYX A;  2XXQ A;  5I84 A;  2ZNU A;  3VLU A;  3FAT A;  2NUV A;  4ZE9 A;  3LSL A;  4IGR A;  3TQW A;  3TTN A;  3GBB A;  5CM6 A;  3MPK A;  4C1T A;  5I56 A;  5HBC A;  3O28 A;  1I6Q A;  3MP6 A;  3IOR A;  4U1O A;  1R6Z A;  3EHT A;  4U1Z A;  1Q1K A;  1QUK A;  1QVS A;  3O29 A;  2UXA A;  3LSW A;  2E1S A;  4G4P A;  4G68 C;  3UN6 A;  2P0S A;  1MY4 A;  4WEP A;  1VSO A;  2IA4 A;  2RC7 A;  3PMV A;  1GV8 A;  4F1U A;  4F22 A;  3RT6 B;  1B7U A;  2DE3 A;  1TWY A;  1IEJ A;  2F7A A;  3CRB A;  3IL1 B;  3K6W A;  3R6U A;  3G3J A;  4R9F A;  3T9H B;  3VE1 B;  4OFL A;  2DP8 A;  2QSX A;  5H8S A;  3M3K A;  3FJG A;  4OES A;  2F97 A;  2OZZ A;  4YKP A;  2DOJ A;  4DXU A;  1A54 A;  3I3V A;  5AA3 A;  4QF9 A;  1P1U A;  3G3I A;  3QAX A;  5BWJ A;  3GXA A;  3LSF B;  3S9N C;  1F9B A;  1PC3 A;  4OMB A;  4ZEC A;  2X7P A;  2DE4 A;  4U2R A;  2DWI A;  2THI A;  3DP6 A;  4Z7E A;  2GH9 A;  1LBB A;  1JET A;  1B0H A;  1MG1 A;  1Q35 A;  4PET A;  3U92 A;  5FHN A;  1N3W A;  2Z22 A;  2VOZ A;  5DVJ A;  4ECF A;  2DWJ A;  3A09 A;  4DXB A;  2HFB A;  4PQJ A;  4OER A;  2VD3 A;  3GBA A;  4GLI A;  5KZT A;  1PB7 A;  2B3B A;  3RGY A;  1ANF A;  1B5I A;  1URG A;  2IEE A;  4H67 A;  3A3C A;  4KFQ A;  4F1V A;  3FZV A;  1AOV A;  3C35 A;  1POY 1;  1TT1 A;  3OSQ A;  5EYF A;  3K0V A;  5AA2 A;  2I3V A;  3IOV A;  1Y4C A;  4R74 A;  5L9S A;  2H5Y A;  5CMK A;  3IJO B;  4G2Z A;  1PEB A;  1XHY A;  2AYS A;  1IXG A;  1LAG E;  2RC9 A;  2ZYN A;  3PPN A;  4H1X A;  1PB9 A;  4U23 A;  4YZZ A;  5H8F B;  1XS5 A;  2OK2 A;  2P2A A;  5I58 B;  3LBS A;  3IX1 A;  2XX9 A;  3N6U A;  3MVW A;  3DLN A;  2D5W A;  5AA2 B;  4DE8 A;  3VXC A;  2F7B A;  4MLV A;  3QUJ A;  4H5F A;  2GHB A;  1MY3 A;  2V3U A;  3B6Q A;  3G3F A;  2Z8E A;  3L6G A;  4HCY A;  4QSD A;  3H4Z A;  1MQJ A;  2I4C A;  3P7I A;  3N6T A;  3OO7 A;  4XKQ A;  3U72 A;  3Q27 A;  3C32 A;  1B3H A;  1IIW A;  1HSE A;  2I0C A;  2DVZ A;  3R26 A;  4FOR A;  5EHM A;  2QMW A;  3SEV A;  2DXR A;  3FD3 A;  2ESN A;  4IO4 A;  4X9T A;  3RLF E;  3TCH A;  1RKM A;  3VVF A;  3D4C A;  3Q25 A;  2RCA A;  2XHD A;  3W15 C;  3FVG A;  4JBZ A;  1Y1M A;  2O68 A;  2F36 A;  5H8H A;  4ZZE A;  3IAZ A;  2HZL A;  4NMY A;  1PDA A;  1JW5 A;  2QRY A;  2XXV A;  4UA8 A;  4F3G A;  1B3F A;  3K02 A;  2O1L A;  3KN3 A;  4NF5 A;  4F29 A;  4KCD A;  4GFR A;  4BDO A;  3FUZ A;  4RXL A;  5H8N A;  3VLV A;  5I2K A;  1D9V A;  4M4G A;  5I59 B;  3S9M C;  2HEU A;  3K4U A;  4POW A;  1SI1 A;  1AH5 A;  1MPB A;  1XVX A;  1N04 A;  3UP9 A;  3T96 B;  1XC1 A;  3QK6 A;  4G8N A;  2I6E A;  4K3F A;  1SD3 A;  3IB1 A;  3PUX E;  4KR5 A;  4E0W A;  4ELQ A;  3A3U A;  4H8J A;  4NED A;  3VFJ A;  4L17 A;  3SEU A;  2DWA A;  3N5L A;  1LGB C;  4RA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...