1B3EA

Human serum transferrin, n-terminal lobe, expressed in pichia pastoris
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
Knots found
sequence length
330
structure length
330
Chain Sequence
KTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDNYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallography and mass spectroscopy reveal that the N-lobe of human transferrin expressed in Pichia pastoris is folded correctly but is glycosylated on serine-32.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Iron transport
molecule keywords PROTEIN (SERUM TRANSFERRIN)
total genus 102
structure length 330
sequence length 330
other databases KnotProt 2.0: K
ec nomenclature
pdb deposition date 1998-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b3eA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b3eA02
1LSTA 3KG2A 4EUOA 1Q35A 1CB6A 2V93A 1JEUA 5KDTB 1HSJA 1POTA 1URDA 2B65A 2H5YA 2QS3A 4ELPA 3O28A 2NUVA 3LBSA 1IITA 1EH3A 1NFTA 3OELA 1N0TA 1A40A 5HBCA 1D9VA 5K2XA 1Y1MA 1WVJA 4PQJA 4UA8A 3IJOB 3PV0E 1NNTA 1P1UA 1VR5A 2XX9A 4LZ5A 2B3FA 2ONRA 3UN6A 4EF1A 2ZYNA 3ZKKA 1OQHA 2PT2A 3IOVA 3RPWA 3T9VA 2RINA 2Q9TA 3PPPA 1H44A 3DELB 1LAHE 3DP4A 1H3DA 2OK2A 2YPNA 3L6GA 3R26A 2RC9A 4G4PA 1Y3NA 5H8FA 3RT8A 3SDFA 3VVEA 3ONMA 5TU0A 1Y3PA 1Z7NE 4LQ5A 3S9LC 3K02A 3GLBA 2Y7IA 3TZAA 4NWCA 2X7PA 4H1XA 3VLUA 2P0SA 3CFZA 4EXLA 2A5TB 2UVGA 2H98A 3QAXA 3C35A 1Y3QA 4X1DA 3RQTA 5LOMA 5BWJA 3RUMA 4PFUA 1I6QA 3V89B 4F22A 4GF8A 4R6HA 3D4GA 4OEUA 4NWDA 4YKPA 1NNFA 4I62A 5JTYA 1IXCA 5KCJB 3AXFA 1GGGA 1B4HA 2GHBA 2IEEA 3JV9A 4IB2A 5DVFA 3FVGA 1QULA 4K3FA 3TFLA 1JVYA 4JSOA 1B32A 1OLAA 3USDA 4BDMA 1JETA 1GV8A 5AA2A 2NWJA 4OHNA 5H8FB 1QUKA 1LFIA 1VSOA 2F36A 3MVXA 3FXUA 4I1DA 4LATA 4LONB 4OTEA 2DS9A 4JWOA 3RY3A 3OOAA 3KJ7A 3H6UA 1KWHA 5J1DA 3O6GA 1B3GA 3QUFA 4BDOA 1IQ7A 2VOZA 5TP9A 3RT6B 3PUVE 3T9XB 2UYFA 1MH4A 4OXVA 1UTBA 4F39A 2DYXA 1B1HA 1RYOA 2XXTA 5EHMA 1FQFA 4OEVA 3MP8A 4E0WA 4RK2A 4ZEKA 4ZE9A 1OLCA 1MXVA 4ELQA 5CC2A 3G3IA 2FA7A 1MPCA 4KPTA 3VVFA 1EZPA 1BTJA 3HSTA 1DSNA 1SYIA 1UTBB 2HZLA 4GOTA 4GL8A 4I8CA 1SW2A 3Q28A 2ANJA 1UTHA 2F78A 1O63A 1AIVA 1MDQA 1LBCA 4OETA 1TT1A 1LAGE 3KGCA 3CG3A 3I3VA 5CMMA 5DYHA 1R6ZA 2I3VA 4IO2A 1B3LA 2HAVA 4GFRA 4P0IA 2Y7WA 4H8IA 4KYDA 1M5EA 2DQVA 3G3GA 4OESA 3EPEA 4TLLB 3W15C 3A3CA 2F7BA 2ZYMA 1SQYA 3FVKA 1GR2A 1ZBMA 2HXWA 5KCJA 2XXYA 1SI0A 2OLBA 4ESWA 3GBAA 1S7YA 4GXSB 4R9FA 4IO6A 1I69A 3S9MC 5B70A 1F9BA 4MBPA 1P1OA 3MZBA 2VP1A 5AA4A 4QF9A 1B05A 2ZNUA 4NEDA 2PYYA 4OQOA 5H8HB 4GD5A 5TPAA 3WAFA 3S9NC 3HV1A 1PB9A 4O3AA 5CI5A 3E4RA 4I9DA 3OO9A 1FQDA 4KFQA 4FATA 3MAMA 2REGA 1QW0A 3VXCA 1N04A 1S50A 3G3FA 4F2QA 2DE3A 4IO4A 1LBBA 2ALUA 3SEUA 1MQIA 1WODA 2RCBA 1BKAA 1IXGA 3RN8A 4DZ1A 2F5XA 4WKMA 1EZ9A 2P1SA 2A5SA 2F8DA 1P99A 5ELVA 3C31A 3CG1A 3K01A 1XT8A 1US5A 1IXHA 4ZEDA 1B2HA 3TODA 2I0CA 3CI8A 2F97A 4MFIA 5I2NA 4WEDA 1MY0A 1XS5A 3SEXA 1P1NA 3PUXE 2I49A 3G3KA 1SW5A 3L6HA 1B6HA 2G93A 2XD2A 1MY4A 3O66A 3QSLA 2OCUA 4H6DA 4IGTA 3C34A 4NF4A 4DXBA 5AA1A 3FGSA 5I58A 3A3UA 1Q1KA 4M1VA 4KHZE 3TTKA 4FAJA 4EF2A 2PMSA 2VD3A 3KSJA 4XKRA 5K2YA 4BDRA 1S9TA 4DCYA 4HS7A 4X48A 2QS4A 4KQPA 3B6WA 3LSFB 4YB5A 2WKYA 1A8EA 4OFJA 1B58A 1BP5A 3FVOA 4FEBA 4KD5A 5H8QA 3CR9A 5L9MA 4WEPA 1I6BA 3TMGA 3VLWA 5JK4A 3OD7A 3CSBA 3LSLA 1AL3A 2REJA 3N6UA 1HSEA 3TCHA 3K1NA 1SW1A 1EU8A 4GQOA 3KN8A 1ZU0A 3B6TA 1IXIA 4IY5A 3FIRA 4G68C 4THIA 4G2ZA 4FECA 3OO7A 4RXLA 4U22A 2XD3A 4G68A 3OO6A 5F7VA 2O7IA 2QMXA 3C33A 1FQCA 2OBGA 2RC7A 2ZNSA 2XXVA 2HZKA 2O51A 3I5OA 4JXIA 1MM7A 3FXRA 1R9QA 1US4A 4YZZA 3T66A 4H8JA 3UP9A 5AE4A 1YAEA 3M8UA 4GLIA 2I48A 3IX1A 4YB7A 3PGFA 2AL4A 4OWDA 3BBRA 1PBQA 3B6QA 4XTCQ 5DVIA 2DWJA 1VFDA 3U93A 2DWHA 3IOWA 4Q30B 3D4CA 3IO6A 4FORA 5EYFA 3MVZA 2LAOA 3CFXA 3EHTA 1M5FA 3FZVA 3T96B 4JB7A 2V3UA 4R72A 4U23A 5AA3A 3HHGA 4DXUA 5I84A 1LB9A 1PBPA 3K4UA 2QJEA 2XXHA 3O9PA 1Y20A 5DT6A 2W7YA 1B3EA 1MG1A 2CMOA 1B5JA 2O1LA 1SD3A 1B51A 4XXUA 4KR5A 3K6XA 1DTZA 1XVYA 1RYXA 3IOUA 5CM6A 4P11A 3KZGA 2Q2CA 4O3CA 1MQJA 1MH3A 3TCFA 2B3BA 1MXZA 2PT1A 3IL1B 3M3LA 4R6KA 3SEVA 5FHMA 5FTIA 4M4GA 2V25A 4POWA 3MC2A 3PPOA 1NMUA 3PD9A 5H8NA 3H6VA 2ESNA 4R73A 2PVUA 3M3FA 3K6UA 4RA1A 3TTLA 2E1SA 1PC3A 1R9LA 2FYIA 3H7MA 3W9VA 2NXOA 1Y1ZA 4EQBA 2RC8A 4ECFA 3T22A 4P0GA 1GTKA 3OEMA 2CZLA 4NE4A 3KFMA 3O6IA 5CRYA 1ZMGA 3SETA 1A55A 4LVQA 3RGYA 3IO4A 5HPQA 2NVUB 1PEBA 3TAJA 1TXFA 1JW1A 3OO8A 3PPQA 2Y7RA 4EDPA 3R7XA 1OIBA 2Q8JA 4RK9A 3V8XB 3IB0A 2HEUA 1AMFA 1FW0A 3QXMA 4G8MA 5CMKA 4H0WA 4YMBA 2UVHA 4IO5A 4H67A 1II5A 3IB2A 4OZ9A 4Q0CA 3UORA 4F31B 5H8NB 3QUJA 3FXQA 1YCJA 1NH7A 3RLFE 4NTLA 2XXPA 4QFLA 1LAFE 4Q5TA 5H8QB 4ZEBA 4EXKA 3K6VA 1MQDA 4JSDA 4BDLA 3HCQA 3IK6B 3MP6A 3KN3A 4MH5A 2R9JA 4PFWA 1POY1 4PP0A 2M8CA 1Z7ME 2ABHA 4YAHX 5EHSA 1B0HA 3KSXA 3N6TA 1H76A 4MLVA 3RTWB 2VD2A 4NF5A 1M5CA 1USYE 4NMYA 1UTHB 1UIUA 3U8QA 4UACA 1FTLA 3H03A 3C36A 1SI1A 4N6PA 3OXNA 4OMBA 4QHQA 1MY1A 3MPLA 4FJPA 3VLVA 1VE4A 4DXCA 3EF7A 2OWSA 4ZECA 1RKMA 1N3WA 3Q25A 1P1WA 5KDTA 4YKIA 1JW5A 5I2NB 1IZ1A 1FTKA 2X7QA 4YU0A 1DTGA 3FJMA 3K1MA 3QYTA 1FTOA 4OYVA 5CMCA 3K0VA 1N84A 3N26A 3PUYE 4LZ7A 5ITOA 3SERA 3O97A 1B3HA 2UVJA 2V84A 4H65A 4OVJA 4ZZEA 4JDFA 5ISUA 4RPOA 1LCFA 3FV1A 4NF5B 2F7CA 3H6WA 2AIXA 2DSFA 3MPKA 4R2BA 3S4UA 2QS2A 3LC8A 4QFKA 1B0LA 4U4XA 1IEJA 3PMVA 4G8HA 1YTVA 2XX8A 4OFOA 4YKKA 3BKIB 3THIA 5CBSA 2AYSA 4QFPA 1B5HA 3TTRA 2DVZA 3U72A 3IJXB 1DPEA 4ISUA 3SEYA 1TWYA 1LAXA 3MQ9A 5H8HA 5TPAB 3UA8A 4GRKA 3V5AA 1M5DA 1ZIUA 3JYRA 5DEXB 5I56B 3Q29A 2VGQA 4F19A 2QMWA 5CMBA 2ONSA 5I59B 1M5BA 1MY2A 4DDDA 3H06B 2XHDA 3S2VA 1IIWA 4ZDMA 4NF6B 4PFTA 4C1TA 4ZE8A 4Q8RA 4GVOA 2IA4A 2VHAA 1QJMA 2AL5A 2OWTA 2UVIA 2XXWA 1LB8A 2ZNTA 3BFTA 3CVGA 4R74A 1GVCA 5ITPA 5L9OA 4YB6A 1B9JA 1B52A 1T0KA 1R1NA 1SVXB 4QFNA 3V83A 1O7TA 3FJGA 4GWOA 4JWYA 4R9GA 3ILUB 4YKJA 3G7WA 4F1UA 3LSXA 2ONKE 3T93B 2Y7KA 1MPDA 1YPNA 3QIMA 3ZS6A 4DIGA 1ANFA 5DVJA 4C0RA 5JEIA 3EN3A 3CSGA 3N5LA 3LUYA 2D3IA 4LZ8A 3GXAA 4ONYA 4HTGA 4QSDA 1XOCA 2O68A 2H4IA 2F6PA 4XKQA 3FV2A 4ND9A 5M2VA 4C1UA 2I3WA 3QK6A 5H8SA 4ELOA 1H43A 2GH9A 2QSXA 5AA4B 2QS1A 2ZYOA 3HPIA 5KZTA 2E0SA 2RKMA 1TFAA 4F1VA 3TEPA 3EHUA 3VDFA 2O84X 4JBZA 3E9XA 3TQLA 3ECRA 3S9EA 4F3SA 5AA2B 3VVDA 1FTMA 1MM6A 2Q2AA 4MLQA 1OVBA 2OJTA 1XC1A 2XXUA 3FVNA 1FCKA 4IY6A 5FHOA 1MXXA 1L5TA 1DPPA 2YLNA 3PUWE 4X9TA 1MPBA 2QL3A 4N13A 3H4ZA 2I4BA 1LFHA 2OZZA 5L8DA 1VFEA 5DEXA 4GIZA 2DXRA 1LFGA 4XIGQ 1B7ZA 1B3FA 3E3KA 3SEWA 3MWBA 3PD8A 2FNCA 4IO3A 3GBBA 3I6VA 4X1BA 3KJTA 1NNPA 1IUDA 2Y7PA 3DP8A 4L17A 3IORA 4KYEA 1B7UA 4ZEFA 3P7IA 4PFYA 3IAZA 2GHAA 2RF1A 2HFBA 2UYEA 2V3QA 4KCCA 1DMBA 3UK4A 3MVYA 4TLMB 5A5XA 2HCAA 3PUZE 1PDAA 2I6EA 4F3PA 1MQHA 1MRPA 3HN0A 3PPNA 1ATGA 2O6AA 3OSRA 4AB5A 5CBRA 4TQUQ 1ZTYA 3H3GA 4Z0IA 4LUBA 4WXJA 4LA9A 3BFUA 2HAUA 3FJ7A 5AA2D 3Q26A 5I2KA 2Z22A 1SW4A 1FQBA 1N3XA 1DOTA 2HQ0A 3IOTA 4PE5B 3DLNA 4TOZA 1UIVA 3TPAA 4F3GA 5TP9B 2NOOA 1A99A 3K1PA 2I0BA 1UQWA 3T9HB 5IKBA 1B4ZA 4XKNA 1AOVA 1HSLA 4OFLA 3SESA 3CRBA 2G29A 1B1XA 3UGWA 1A8FA 4F2OA 2ZYKA 2O1MA 2F6GA 3H6TA 4XKPA 3VE1B 3PMXA 3VXBA 1CE2A 2F35A 4NF6A 2P2AA 4ZEIA 3R6UA 4PETA 2H99A 3MUQA 4QFOA 3GZGA 5FTHA 4F18A 1A7LA 1MXWA 1JEVA 1JVXA 1OVTA 1XHYA 4F3BA 5I56A 1OMPA 1NL5A 2A5TA 1B7HA 3HHFA 2O7UA 1B40A 3TTNA 4Z7EA 3W9WA 4ESXA 1N7XA 2DWIA 4N07A 3IR1A 3CIJA 4RPNA 4HW8A 1URGA 1OQGA 4KI0E 1WDNA 3CFLA 4H5FA 4LQ2A 4MF3A 4G68B 2THIA 4G77A 5FHNA 3EHSA 1JW4A 2BJJX 3EQ1A 3MP1A 4FEDA 2H9BA 4RYAA 1PB7A 3O6HA 4G8NA 2D21A 4GL0A 4U4SA 4EQ7A 1PB8A 4DE8A 3M3KA 1ZLQA 2Z23A 2KLFA 4OERA 2Q88A 3B7DA 5L9SA 3TYHA 5A5XB 3HO7A 1BLFA 3TKDA 1D4NA 2DVCA 1LCTA 4POXA 2DWAA 1SDXA 5IAIA 3FATA 1QVSA 1O64A 3MZ1A 3WAEA 4ZS9A 2I58A 1QUIA 4ZZAA 4H5GA 1Y4TA 2PX1A 3MBPA 3KEIA 1LLSA 1QKAA 3G3HA 1MXYA 3F11A 3LR1A 1BIYA 3KN7A 4NF8B 5ICQA 4U2RA 3ZKLA 4BDNA 4AQ4A 3JZJA 3O2AA 1JNFA 1Y9UA 4RNSA 3VFJA 3U92A 4BDQA 3OENA 2XXQA 5I57A 1D3KA 1NKXA 1URSA 1XVXA 2DXYA 2GRVA 2YJPA 3K00A 1NH8A 3N94A 4JWXA 4NF8A 4F29A 3TUSA 3MVWA 3E13X 4YICA 2RCAA 3K2DA 3VV5A 3RNNA 1N76A 3KOTA 4KCDA 2GFEA 3DP6A 2XX7A 3A09A 1FTJA 2XXIA 3ILTB 4RJZA 2Z8EA 5F1QA 3ZSFA 2D5WA 2PBWA 4QSCA 1NNKA 2O69A 3TCGA 1ELJA 1ZJLA 3SKPA 3G3JA 3MJNA 3K6WA 3MZ9A 4R75A 2Z8FA 1JQFA 4RY1A 4FE8A 3TQWA 4R2FA 3FUZA 4O3BA 1MS7A 1P1QA 1A54A 3FD3A 3PU5A 1USYH 3OEKA 1N7WA 3C32A 4IO7A 3TELA 4E0XA 3TTMA 4ELRA 1QKBA 5ICTA 3Q27A 5JTYB 1I6AA 5I59A 1B5IA 1Y4CA 1SYHA 3IB1A 3T9UA 2QPQA 4DCXA 1ZKBA 3OSQA 5BUUA 1LGBC 1FQEA 5DTBA 2F7AA 2QRYA 1H45A 4EQ9A 4QSEA 1AH5A 1D9YA 4LP2B 1EZOA 2Y84A 3C9HA 2DE2A 4U1ZA 4HCYA 1SBPA 1J1NA 5HM4B 2Z8DA 2X26A 2DP8A 3PMWA 2Q89A 2I4CA 3O29A 4HCWA 3RTFB 2F34A 4OENA 1MDP1 3C4MA 3TDJA 3U94A 1B46A 4F1YA 4YMAA 5I57B 4QRZA 4KYSA 3KBRA 2XXXA 5B7DA 2R71A 4FIMA 2ZXTA 1MXUA 1MY3A 2XXRA 4AB6A 4R6YA 1MQGA 2H25A 3KOSA 3ODBA 3MW0A 5I58B 3LSWA 4NF4B 1QUJA 2ZMBA 4U1OA 3UIFA 4GXAA 3OMBA 2DE4A 2V3TA 2R6GE 3PPRA 4IGRA 4U21A 3U1OA 1TFDA 2DOJA 3DM0A 4BLAA 2UXAA 5I2KB 4DLDA 3FASA 1FQAA
chains in the Genus database with same CATH superfamily
3KG2A 1Q35A 2V93A 5FBPA 2H5YA 3O28A 1IITA 1EH3A 2QFLA 4UA8A 5F24A 3IJOB 2RINA 1H44A 1LAHE 3DP4A 1Y3NA 4G61A 3VVEA 5TU0A 4LQ5A 3GLBA 4NWCA 2P0SA 4X1DA 4OVSA 3RQTA 4PFUA 4F22A 4R6HA 2VT5A 4NWDA 5DVFA 1GGGA 2IEEA 1EYJA 3FVGA 1QULA 2Q8MA 5H8FB 1VSOA 3MVXA 4JWOA 3OOAA 4GX6A 5J1DA 3RT6B 3T9XB 1MH4A 4OXVA 4ZEKA 1MXVA 3G3IA 4I3EA 1BTJA 3HSTA 1DSNA 1SW2A 2F78A 1O63A 1AIVA 4UABA 2I3VA 4GFRA 4NHBA 4H8IA 1M5EA 2DQVA 4OESA 3EPEA 3A3CA 1FPDA 1GR2A 1ZBMA 2HXWA 1VDWA 3SZPA 3S9MC 1I69A 4QF9A 5H8HB 2ZNUA 4NEDA 2PYYA 4P1LA 3WAFA 4GD5A 1PB9A 4DI3D 4I9DA 3OO9A 1N04A 4IO4A 1LBBA 1WODA 1BKAA 1IXGA 2F5XA 4ZEDA 3CI8A 1XS5A 2G93A 4IGTA 5L9SA 3A3UA 5IZ3A 4FAJA 5IM2A 4XKRA 2XWOA 4BDRA 4DCYA 4OANA 3E79A 4HS7A 4KQPA 2WKYA 4GWXA 5H8QA 4FEBA 3VLWA 3TMGA 3LSLA 2REJA 3TCHA 1NV7A 4GQOA 1ZU0A 4IY5A 1NV2A 3FIRA 4G2ZA 3OO7A 4RXLA 4G68A 3OO6A 1G0IA 1FQCA 2ZNSA 4JXIA 3T66A 3FXRA 2V4CA 3M8UA 2I48A 3PGFA 2AL4A 5AA4B 1PBQA 4XTCQ 4FORA 5EYFA 3CFXA 3FZVA 4PAFA 5DT6A 4NGUA 1B3EA 1MG1A 4XXUA 4KR5A 3K6XA 1DTZA 1RYXA 2Q2CA 3M3LA 2V25A 4R73A 2PVUA 3QMFA 1JP4A 2RC8A 4ECFA 4P0GA 1GTKA 3OEMA 1DBZA 4NE4A 1ZMGA 1A55A 5HPQA 3TAJA 2Y7RA 4RK9A 3QXMA 4H0WA 2UVHA 4F31B 2FVZA 3FXQA 1YCJA 1EYIA 2XXKA 2XXPA 5H8QB 4BDLA 3MP6A 3KN3A 4PFWA 3N6TA 2VD2A 3FXBA 4NMYA 3C36A 4QHQA 1MY1A 3EF7A 1N3WA 1P1WA 4YKIA 4YU0A 1DTGA 4ESXA 4OYVA 2UVJA 3GYYA 4JDFA 2F7CA 2CZKA 3T0JA 5ET5A 1B0LA 4OFOA 3BKIB 3TTRA 3MYUA 3RPLB 4OVRA 1LAXA 3MQ9A 5DEXB 3Q29A 4F19A 4DDDA 2XHDA 4ZDMA 4Q8RA 4H46A 4N91A 1GVCA 5ITPA 4PDDA 1R1NA 3V83A 1O7TA 4GWOA 3KBZA 3ILUB 4XFEA 4YKJA 3G7WA 2ONKE 3QIMA 3B8BA 4LZ8A 4QSDA 2F6PA 2P3NA 5H8SA 2E0SA 3EHUA 2O84X 3S9EA 1MM6A 1XC1A 3FVNA 5FHOA 4MAGA 3H4ZA 4GIZA 2DXRA 1LFGA 1B3FA 4JVCA 2FNCA 4PFIA 2CEXA 4ZEFA 2WYKA 3IAZA 2GHAA 1DMBA 3IFCA 3T1BA 4JVIA 1MQHA 3RYDA 3OSRA 4Z0IA 5I2KA 3Q26A 2P3VA 1UIVA 4X04A 3T9HB 1FBFA 3SESA 3CRBA 3LV0A 4F2OA 3PMXA 1CE2A 1BK4A 2P2AA 2VPOA 3R6UA 2H99A 4QFOA 3GZGA 5FTHA 1JEVA 4MMPA 1OMPA 1B7HA 2DWIA 3CIJA 2B4LA 2THIA 5IZZA 3EQ1A 4FEDA 1PB7A 4G8NA 4GL0A 2D21A 4DE8A 2KLFA 1SDXA 3MZ1A 4IR8A 4ZZAA 2XWKA 4HE1A 3MBPA 3G3HA 1MXYA 4HE0A 4BDNA 4AQ4A 4RNSA 4JVDA 3VFJA 3U92A 1D3KA 1URSA 2DXYA 3N94A 4NF8A 3E13X 4RJZA 2Z8EA 4QSCA 3SKPA 3PTYA 4R2FA 3PU5A 1N7WA 1XI6A 3TELA 3Q27A 1LBXA 1LGBC 5DTBA 1AH5A 4LP2B 4U1ZA 2DE2A 4XEQA 1SBPA 2Z8DA 2DP8A 4NAPA 4F1YA 4HCWA 2FBPA 2F34A 4YMAA 1B46A 4KYSA 5EQ7A 2R71A 5IZ3B 4R6YA 4PTKA 5I3SA 4NF4B 4GXAA 1FBGA 4DLDA 2DOJA 3ZKKA 1FQAA 1LSTA 5KDTB 3IFAA 2NUVA 3KC1A 5K2XA 1Y1MA 1WVJA 4PQJA 2ZYNA 2PT2A 3RPWA 3T9VA 2OK2A 1FPIA 1Z7NE 4H1XA 4PDHA 2QVVA 5BWJA 1I6QA 4GF8A 3D4GA 5KCJB 4IB2A 1JVYA 1B32A 2F36A 4LATA 3FXUA 3RY3A 3O6GA 3NOHA 4F39A 2DYXA 1RYOA 4E0WA 3MP8A 5CC2A 2FA7A 4GL8A 2ANJA 1UTHA 4MCOA 1IMCA 1MDQA 5CMMA 1R6ZA 3G3GA 2ZYMA 3FVKA 4ESWA 3GBAA 4IO6A 5B70A 5AA4A 3HV1A 4O3AA 4GX4A 4N4UA 3CHGA 1FQDA 4KFQA 2REGA 3E78A 1MQIA 2Q74A 2RCBA 4DZ1A 1EZ9A 2A5SA 2F8DA 3CG1A 1B2HA 4WEDA 3SEXA 3G3KA 1SW5A 3L6HA 1B6HA 2XD2A 3QSLA 1MY4A 4H6DA 4DXBA 3LUZA 5K2YA 1S9TA 3B6WA 4AS4A 1I6BA 3OD7A 4PAKA 3N6UA 3K1NA 3KN8A 5IGAA 3B6TA 1IXIA 4THIA 4G68C 1Q9DA 2O7IA 3C33A 2XXVA 2HZKA 2O51A 1MM7A 5AE4A 1R9QA 1YAEA 4XF5A 3U93A 2DWJA 2DWHA 3D4CA 4U23A 4R72A 2QJEA 1IMAA 2W7YA 4NF0A 4OVQA 4P11A 1MQJA 1MH3A 2B3BA 1MXZA 3IL1B 3MC2A 3PPOA 3PD9A 3H6VA 4GX3A 3M3FA 1R9LA 4EQBA 1FBHA 3T22A 2CZLA 4GWYA 3SETA 3IO4A 4MX6A 3V8XB 2HEUA 1FW0A 4YMBA 4H67A 1II5A 4OZ9A 4P1EA 3UORA 3RLFE 1FPBA 1QGXA 4QFLA 4ZEBA 4EXKA 3K6VA 1SPIA 4MH5A 1POY1 1Z7ME 4YAHX 4MLVA 1H76A 1USYE 3U8QA 4UACA 4N6PA 3OXNA 3MPLA 3Q25A 5I2NB 2X7QA 3VXCA 3FJMA 1FTOA 3K0VA 1N84A 3O97A 4ZZEA 1LCFA 2DSFA 4MIJA 4R2BA 2QS2A 3LC8A 4QFKA 4F3PA 3PMVA 4G8HA 1YTVA 2XX8A 4YKKA 1B5HA 3U72A 3SEYA 1TWYA 5TPAB 3UA8A 3JYRA 2QMWA 5I59B 1MY2A 1LEVA 4I3YA 3HFUA 4GVOA 1QJMA 2AL5A 2XXWA 4R74A 4NQ8A 4OA4A 4YB6A 3FJGA 1FRPA 4R9GA 2Y7KA 1YPNA 4DIGA 4C0RA 3CSGA 3GXAA 1XOCA 2O68A 3FV2A 2PFYA 2I3WA 3QK6A 1H43A 2QS1A 3HPIA 1FBCA 2RKMA 2QVUA 3A29A 1FTMA 4IY6A 1L5TA 1MXXA 4X9TA 1MPBA 2QL3A 4N13A 5L8DA 1B7ZA 3SEWA 3GBBA 1YYZA 2ZZVA 4X1BA 1NNPA 3DP8A 3P7IA 1EYKA 2RF1A 2V3QA 4KCCA 5EYHA 5A5XA 3EKIA 2HCAA 3PUZE 2I6EA 3PPNA 1ATGA 5CBRA 4PAIA 5AA2D 3FJ7A 1SW4A 1DOTA 3IOTA 1NUYA 4PE5B 3DLNA 4P56A 3TPAA 2NOOA 1B4ZA 1HSLA 2F6GA 4XKPA 3VE1B 3VXBA 2F35A 2GQ1A 4PGPA 4PETA 1A7LA 2WBDA 5I56A 1OVTA 4F3BA 1NL5A 3W9WA 1KA1A 4MHFA 4N07A 3IR1A 4HW8A 1OQGA 4KI0E 1WDNA 4H5FA 1FJ9A 5EQ9A 1JW4A 1PB8A 1G0HA 4OERA 2Q88A 3B7DA 1BLFA 1FPGA 3TKDA 4N8GA 1D4NA 2DVCA 4POXA 2DWAA 1IMEA 4ZS9A 2VPNA 4H5GA 4MEVA 5LOMA 3LR1A 4NF8B 3KN7A 2FIEA 4GWUA 4BDQA 2CZIA 2XXQA 5I57A 2GRVA 1NH8A 3MVWA 4YICA 2BJIA 2RCAA 3VV5A 3RNNA 3KOTA 2GFEA 3A09A 2XXIA 3ZSFA 1NNKA 1ZJLA 3MZ9A 2Z8FA 1JQFA 1NV5A 3TQWA 3FD3A 1USYH 4IO7A 3C32A 4E0XA 1NV6A 1QKBA 1I6AA 1B5IA 4DCXA 3OSQA 5LDZA 1FQEA 2F7AA 2QRYA 1H45A 1EZOA 4HCYA 3PMWA 2Q89A 2I4CA 3TDJA 4OENA 1MDP1 5I57B 3KBRA 2XXXA 2Y5KA 4FIMA 2ZXTA 4AB6A 2XXRA 3KOSA 3ODBA 2DE4A 3PPRA 2OWZA 4U21A 4IGRA 3DM0A 1JEUA 1URDA 4ELPA 1NFTA 5A5LA 1N0TA 1A40A 5HBCA 1D9VA 3PV0E 1VR5A 2XX9A 2B3FA 2ONRA 3UN6A 4EF1A 1OQHA 3IOVA 5I7IA 3ZKLA 2YPNA 3R26A 4PC9A 3RT8A 3SDFA 3S9LC 3ONMA 1Y3PA 4EXLA 3VLUA 4N81A 1NV0A 2A5TB 2H98A 2UVGA 3QAXA 1RDYA 3V89B 1NNFA 4I62A 5JTYA 1IXCA 2GHBA 3JV9A 1NUWA 4K3FA 3USDA 1CNQA 5AA2A 1QUKA 1LFIA 4OTEA 2DS9A 4N8YA 3QUFA 5LTCA 1IQ7A 1B1HA 1FQFA 4RK2A 3VVFA 1UTBB 3Q28A 2R8TA 1TT1A 1LAGE 5DYHA 1AWBA 2HAVA 4P0IA 4KYDA 3ISPA 4TLLB 3W15C 4PFBA 5KCJA 1KA0A 2OLBA 4GXSB 1S7YA 4R9FA 3MZBA 3S9NC 2XWIA 1FBDA 3E4RA 1S50A 3G3FA 4F2QA 3D1RA 2DE3A 4FBPA 2ALUA 3SEUA 3RN8A 4PE3A 1FBEA 4WKMA 2P1SA 5ELVA 3K01A 3TODA 2F97A 1MY0A 3O66A 2OCUA 4NF4A 4DI4B 4KHZE 3TTKA 4EF2A 1FSAA 3KSJA 3ROJA 3LSFB 4YB5A 1A8EA 4KD5A 1BP5A 5L9MA 4WEPA 4GWWA 1AL3A 1EU8A 1K9ZA 4PF8A 2XD3A 1D9QA 5F7VA 2QMXA 2RC7A 3I5OA 4YZZA 1US4A 3UP9A 4H8JA 4YB7A 3B6QA 1FPLA 1VFDA 2L5VA 3MVZA 3EHTA 1M5FA 4JB7A 2V3UA 5AA3A 4DXUA 5I84A 1PBPA 3K4UA 2CMOA 5CM6A 3KZGA 3TCFA 4R6KA 5H8NA 4N6DA 3K6UA 4RA1A 3TTLA 2FYIA 1IMBA 1Y1ZA 3KFMA 2OX3A 2Y5LA 3O6IA 5CRYA 2QVRA 4LVQA 3BIHA 4MJOA 4PF6A 1JW1A 3PPQA 1K9YA 4EDPA 3R7XA 1OIBA 2Q8JA 4G8MA 1AMFA 5CMKA 3IB2A 4Q0CA 3QUJA 1MQDA 4JSDA 4P8BA 3IK6B 2CZHA 4PP0A 4NX1A 1UIUA 4O8MA 1SI1A 4OMBA 4FJPA 4AS5A 5KDTA 1JW5A 1IZ1A 3K1MA 3N26A 4LZ7A 5ITOA 3SERA 1B3HA 2ZZXA 2V84A 4H65A 5ISUA 4RPOA 3FV1A 4NF5B 1INPA 2AIXA 3MPKA 3S4UA 4O7IA 2WEFA 4U4XA 3U1OA 3THIA 2AYSA 4QFPA 3IJXB 4ISUA 5H8HA 3V5AA 4GRKA 1M5DA 1ZIUA 1NV3A 5CMBA 3S2VA 1IIWA 2IA4A 2VHAA 2UVIA 3BFTA 1LB8A 5L9OA 2MKZA 1SVXB 4QFNA 3LSXA 1NV4A 1MPDA 3ZS6A 1RDZA 1ANFA 1LBWA 5JEIA 3EN3A 3LUYA 2D3IA 5M2VA 2H4IA 4XKQA 4C1UA 1YXIA 2ZYOA 3TEPA 3VDFA 4JBZA 3E9XA 3ECRA 4F3SA 5AA2B 2Q2AA 2OJTA 1FCKA 1DPPA 3PUWE 2I4BA 1LFHA 1VFEA 5DEXA 2KQZA 4XIGQ 3E3KA 3PD8A 4IO3A 4L17A 3IORA 2HFBA 2UYEA 3MVYA 2DDKA 5I5PA 1PDAA 4MNCA 1FPEA 1ZTYA 3H3GA 4LUBA 4LA9A 2HAUA 4GWSA 2Z22A 4PBQA 1N3XA 5TP9B 1A99A 4MNPA 3K1PA 5IKBA 4XKNA 4OFLA 3UGWA 2O1MA 3H6TA 4ZEIA 3MUQA 4F18A 1MXWA 1B40A 3TTNA 4Z7EA 1N7XA 4RPNA 1URGA 3CFLA 4LQ2A 3EHSA 3MP1A 2H9BA 4RYAA 3O6HA 4EQ7A 3M3KA 1ZLQA 2Z23A 2XWVA 3TYHA 5IAIA 3FATA 1O64A 1QUIA 2PX1A 3KEIA 1LLSA 3F11A 1BIYA 5ICQA 4U2RA 1JNFA 1Y9UA 1FPKA 1NKXA 3K00A 3TUSA 4NN3A 4P9KA 4QBAA 4KCDA 2FIXA 2XX7A 5F1QA 2O69A 3TCGA 5ET8A 2F3DA 4RY1A 4ELRA 5ICTA 3IB1A 1SYHA 2QPQA 1ZKBA 4QSEA 1D9YA 2Y84A 3KC0A 2X26A 3RTFB 3O29A 3U94A 3C4MA 3FBPA 4QRZA 1MXUA 1MY3A 1MQGA 2H25A 3MSTA 3LSWA 1RDXA 1QUJA 2ZMBA 3BIGA 4MNIA 1TFDA 2UXAA 3FASA 4EUOA 1LBVA 1CB6A 1HSJA 1POTA 2B65A 2QS3A 1NUXA 3LBSA 3OELA 1NNTA 1P1UA 4PBHA 4LZ5A 5A5XB 2Q9TA 3PPPA 3DELB 4G4PA 1H3DA 3L6GA 2RC9A 3K02A 3TZAA 2Y7IA 2X7PA 4QXDA 3CFZA 3C35A 1Y3QA 3RUMA 1NI9A 4LN5A 4OEUA 2HPGA 4YKPA 3AXFA 1B4HA 3TFLA 4JSOA 1OLAA 4BDMA 1JETA 1GV8A 2NWJA 4OHNA 4LONB 4I1DA 2ZZWA 3KJ7A 3H6UA 1KWHA 1B3GA 4BDOA 2VOZA 5TP9A 3PUVE 3U65A 2UYFA 1UTBA 2XXTA 5EHMA 4OEVA 4ZE9A 1OLCA 4ELQA 4KPTA 1MPCA 1EZPA 4I8CA 1SYIA 2HZLA 4GOTA 1LBCA 4P47A 4GWZA 4OETA 3KGCA 3CG3A 3I3VA 4IO2A 1B3LA 2WX9A 2Y7WA 1IMFA 2F7BA 4HE2A 1SQYA 2CEYA 2XXYA 1SI0A 1YZ0A 1F9BA 4MBPA 1P1OA 2VP1A 2WYPA 1B05A 5TPAA 4OQOA 4N15A 5CI5A 4KXPA 4FATA 3MAMA 1QW0A 1NV1A 5ET7A 4NG7A 1P99A 3C31A 1XT8A 1US5A 1IXHA 2I0CA 4MFIA 5I2NA 1FPFA 2PFZA 1P1NA 3PUXE 2I49A 3C34A 5AA1A 3FGSA 5I58A 1Q1KA 4M1VA 2PCRA 2PMSA 2VD3A 5EYGA 4X48A 2QS4A 5EQ8A 4P3LA 2XA5A 4OFJA 2KR0A 1B58A 3FVOA 3CR9A 5JK4A 3CSBA 4GBWA 1HSEA 1SW1A 4OVTA 3RPLA 4FECA 4U22A 2OBGA 4O7MA 5ET6A 4GLIA 3IX1A 4OWDA 3BBRA 5DVIA 3IOWA 4Q30B 3IO6A 2LAOA 3T96B 3HHGA 1LB9A 2XXHA 3O9PA 1Y20A 1B5JA 2O1LA 1SD3A 1B51A 3IOUA 1XVYA 4O3CA 1FJ6A 3B50A 2PT1A 3SEVA 5FHMA 4M4GA 4POWA 1LBYA 1NMUA 2ESNA 2E1SA 1PC3A 3H7MA 3W9VA 2NXOA 3RGYA 2NVUB 1PEBA 1TXFA 3OO8A 3IB0A 4IO5A 5H8NB 1NH7A 1KZ8A 4NTLA 1LAFE 4Q5TA 3HCQA 2R9JA 2M8CA 2ABHA 5EHSA 1B0HA 3KSXA 3RTWB 4NF5A 1M5CA 5T3JA 1UTHB 1FTLA 3H03A 4DXCA 3VLVA 1VE4A 2OWSA 4ZECA 1RKMA 1FTKA 5FTIA 3QYTA 5CMCA 3PUYE 4OVJA 3H6WA 2FHYA 4PFRA 2HHMA 1IEJA 4N6KA 5CBSA 2DVZA 1DPEA 5I56B 2VGQA 2ONSA 1M5BA 3H06B 4NF6B 4PFTA 4C1TA 4ZE8A 2OWTA 2ZNTA 3CVGA 1T0KA 1B9JA 1B52A 4JWYA 1NUZA 4F1UA 3T93B 3N5LA 4ONYA 4HTGA 1FBPA 4ELOA 4ND9A 2QSXA 2GH9A 5KZTA 1TFAA 4F1VA 3TQLA 3VVDA 4MLQA 1OVBA 2XXUA 2YLNA 2OZZA 5J16A 3MWBA 1DCUA 3I6VA 3KJTA 1IUDA 2Y7PA 2F3BA 1B7UA 4KYEA 5DW8A 4PFYA 3UK4A 4TLMB 4HXVA 2B4MA 1MRPA 3HN0A 4AB5A 2O6AA 1IMDA 4TQUQ 4WXJA 3BFUA 1FQBA 4TOZA 2HQ0A 4F3GA 2I0BA 1UQWA 5IZ1A 1AOVA 5H8FA 2G29A 1B1XA 1A8FA 2ZYKA 4OVPA 4H45A 4NF6A 5ESYA 1JVXA 1XHYA 4X8RA 2A5TA 3HHFA 2O7UA 4N17A 4MF3A 4G68B 4G77A 5FHNA 2HXRA 2BJJX 4U4SA 5EQAA 3HO7A 1LCTA 4O94A 1QVSA 3WAEA 2I58A 1Y4TA 1QKAA 4PCDA 3JZJA 3O2AA 3OENA 1XVXA 2YJPA 2JJKA 1FPJA 4JWXA 4F29A 3K2DA 1N76A 1DK4A 3DP6A 1FTJA 3ILTB 2D5WA 2PBWA 4GBVA 1ELJA 4I40A 3G3JA 3MJNA 3K6WA 4R75A 4FE8A 3FUZA 4O3BA 1MS7A 1P1QA 1A54A 3OEKA 3TTMA 5JTYB 5I59A 1Y4CA 4PGNA 3T9UA 1LBZA 5BUUA 4EQ9A 3C9HA 5HM4B 1J1NA 5B7DA 3MW0A 5I58B 2WBBA 1FTAA 4U1OA 3UIFA 3OMBA 2V3TA 2R6GE 4BLAA 5I2KB 5DVJA
chains in the Genus database with same CATH topology
1LSTA 3KG2A 4EUOA 1Q35A 1CB6A 2V93A 1JEUA 5KDTB 1HSJA 1POTA 1URDA 2B65A 2H5YA 2QS3A 4ELPA 3O28A 2NUVA 3LBSA 1IITA 1EH3A 1NFTA 3OELA 1N0TA 1A40A 5HBCA 1D9VA 5K2XA 1Y1MA 1WVJA 4PQJA 4UA8A 3IJOB 3PV0E 1NNTA 1P1UA 1VR5A 2XX9A 4LZ5A 2B3FA 2ONRA 3UN6A 4EF1A 2ZYNA 3ZKKA 1OQHA 2PT2A 3IOVA 3RPWA 3T9VA 2RINA 2Q9TA 3PPPA 1H44A 3DELB 1LAHE 3DP4A 1H3DA 2OK2A 2YPNA 3L6GA 3R26A 2RC9A 4G4PA 1Y3NA 5H8FA 3RT8A 3SDFA 3VVEA 3ONMA 5TU0A 1Y3PA 1Z7NE 4LQ5A 3S9LC 3K02A 3GLBA 2Y7IA 3TZAA 4NWCA 2X7PA 4H1XA 3VLUA 2P0SA 3CFZA 4EXLA 2A5TB 2UVGA 2H98A 3QAXA 3C35A 1Y3QA 4X1DA 3RQTA 5LOMA 5BWJA 3RUMA 4PFUA 1I6QA 3V89B 4F22A 4GF8A 4R6HA 3D4GA 4OEUA 4NWDA 4YKPA 1NNFA 4I62A 5JTYA 1IXCA 5KCJB 3AXFA 1GGGA 1B4HA 2GHBA 2IEEA 3JV9A 4IB2A 5DVFA 3FVGA 1QULA 4K3FA 3TFLA 1JVYA 4JSOA 1B32A 1OLAA 3USDA 4BDMA 1JETA 1GV8A 5AA2A 2NWJA 4OHNA 5H8FB 1QUKA 1LFIA 1VSOA 2F36A 3MVXA 3FXUA 4I1DA 4LATA 4LONB 4OTEA 2DS9A 4JWOA 3RY3A 3OOAA 3KJ7A 3H6UA 1KWHA 5J1DA 3O6GA 1B3GA 3QUFA 4BDOA 1IQ7A 2VOZA 5TP9A 3RT6B 3PUVE 3T9XB 2UYFA 1MH4A 4OXVA 1UTBA 4F39A 2DYXA 1B1HA 1RYOA 2XXTA 5EHMA 1FQFA 4OEVA 3MP8A 4E0WA 4RK2A 4ZEKA 4ZE9A 1OLCA 1MXVA 4ELQA 5CC2A 3G3IA 2FA7A 1MPCA 4KPTA 3VVFA 1EZPA 1BTJA 3HSTA 1DSNA 1SYIA 1UTBB 2HZLA 4GOTA 4GL8A 4I8CA 1SW2A 3Q28A 2ANJA 1UTHA 2F78A 1O63A 1AIVA 1MDQA 1LBCA 4OETA 1TT1A 1LAGE 3KGCA 3CG3A 3I3VA 5CMMA 5DYHA 1R6ZA 2I3VA 4IO2A 1B3LA 2HAVA 4GFRA 4P0IA 2Y7WA 4H8IA 4KYDA 1M5EA 2DQVA 3G3GA 4OESA 3EPEA 4TLLB 3W15C 3A3CA 2F7BA 2ZYMA 1SQYA 3FVKA 1GR2A 1ZBMA 2HXWA 5KCJA 2XXYA 1SI0A 2OLBA 4ESWA 3GBAA 1S7YA 4GXSB 4R9FA 4IO6A 1I69A 3S9MC 5B70A 1F9BA 4MBPA 1P1OA 3MZBA 2VP1A 5AA4A 4QF9A 1B05A 2ZNUA 4NEDA 2PYYA 4OQOA 5H8HB 4GD5A 5TPAA 3WAFA 3S9NC 3HV1A 1PB9A 4O3AA 5CI5A 3E4RA 4I9DA 3OO9A 1FQDA 4KFQA 4FATA 3MAMA 2REGA 1QW0A 3VXCA 1N04A 1S50A 3G3FA 4F2QA 2DE3A 4IO4A 1LBBA 2ALUA 3SEUA 1MQIA 1WODA 2RCBA 1BKAA 1IXGA 3RN8A 4DZ1A 2F5XA 4WKMA 1EZ9A 2P1SA 2A5SA 2F8DA 1P99A 5ELVA 3C31A 3CG1A 3K01A 1XT8A 1US5A 1IXHA 4ZEDA 1B2HA 3TODA 2I0CA 3CI8A 2F97A 4MFIA 5I2NA 4WEDA 1MY0A 1XS5A 3SEXA 1P1NA 3PUXE 2I49A 3G3KA 1SW5A 3L6HA 1B6HA 2G93A 2XD2A 1MY4A 3O66A 3QSLA 2OCUA 4H6DA 4IGTA 3C34A 4NF4A 4DXBA 5AA1A 3FGSA 5I58A 3A3UA 1Q1KA 4M1VA 4KHZE 3TTKA 4FAJA 4EF2A 2PMSA 2VD3A 3KSJA 4XKRA 5K2YA 4BDRA 1S9TA 4DCYA 4HS7A 4X48A 2QS4A 4KQPA 3B6WA 3LSFB 4YB5A 2WKYA 1A8EA 4OFJA 1B58A 1BP5A 3FVOA 4FEBA 4KD5A 5H8QA 3CR9A 5L9MA 4WEPA 1I6BA 3TMGA 3VLWA 5JK4A 3OD7A 3CSBA 3LSLA 1AL3A 2REJA 3N6UA 1HSEA 3TCHA 3K1NA 1SW1A 1EU8A 4GQOA 3KN8A 1ZU0A 3B6TA 1IXIA 4IY5A 3FIRA 4G68C 4THIA 4G2ZA 4FECA 3OO7A 4RXLA 4U22A 2XD3A 4G68A 3OO6A 5F7VA 2O7IA 2QMXA 3C33A 1FQCA 2OBGA 2RC7A 2ZNSA 2XXVA 2HZKA 2O51A 3I5OA 4JXIA 1MM7A 3FXRA 1R9QA 1US4A 4YZZA 3T66A 4H8JA 3UP9A 5AE4A 1YAEA 3M8UA 4GLIA 2I48A 3IX1A 4YB7A 3PGFA 2AL4A 4OWDA 3BBRA 1PBQA 3B6QA 4XTCQ 5DVIA 2DWJA 1VFDA 3U93A 2DWHA 3IOWA 4Q30B 3D4CA 3IO6A 4FORA 5EYFA 3MVZA 2LAOA 3CFXA 3EHTA 1M5FA 3FZVA 3T96B 4JB7A 2V3UA 4R72A 4U23A 5AA3A 3HHGA 4DXUA 5I84A 1LB9A 1PBPA 3K4UA 2QJEA 2XXHA 3O9PA 1Y20A 5DT6A 2W7YA 1B3EA 1MG1A 2CMOA 1B5JA 2O1LA 1SD3A 1B51A 4XXUA 4KR5A 3K6XA 1DTZA 1XVYA 1RYXA 3IOUA 5CM6A 4P11A 3KZGA 2Q2CA 4O3CA 1MQJA 1MH3A 3TCFA 2B3BA 1MXZA 2PT1A 3IL1B 3M3LA 4R6KA 3SEVA 5FHMA 5FTIA 4M4GA 2V25A 4POWA 3MC2A 3PPOA 1NMUA 3PD9A 5H8NA 3H6VA 2ESNA 4R73A 2PVUA 3M3FA 3K6UA 4RA1A 3TTLA 2E1SA 1PC3A 1R9LA 2FYIA 3H7MA 3W9VA 2NXOA 1Y1ZA 4EQBA 2RC8A 4ECFA 3T22A 4P0GA 1GTKA 3OEMA 2CZLA 4NE4A 3KFMA 3O6IA 5CRYA 1ZMGA 3SETA 1A55A 4LVQA 3RGYA 3IO4A 5HPQA 2NVUB 1PEBA 3TAJA 1TXFA 1JW1A 3OO8A 3PPQA 2Y7RA 4EDPA 3R7XA 1OIBA 2Q8JA 4RK9A 3V8XB 3IB0A 2HEUA 1AMFA 1FW0A 3QXMA 4G8MA 5CMKA 4H0WA 4YMBA 2UVHA 4IO5A 4H67A 1II5A 3IB2A 4OZ9A 4Q0CA 3UORA 4F31B 5H8NB 3QUJA 3FXQA 1YCJA 1NH7A 3RLFE 4NTLA 2XXPA 4QFLA 1LAFE 4Q5TA 5H8QB 4ZEBA 4EXKA 3K6VA 1MQDA 4JSDA 4BDLA 3HCQA 3IK6B 3MP6A 3KN3A 4MH5A 2R9JA 4PFWA 1POY1 4PP0A 2M8CA 1Z7ME 2ABHA 4YAHX 5EHSA 1B0HA 3KSXA 3N6TA 1H76A 4MLVA 3RTWB 2VD2A 4NF5A 1M5CA 1USYE 4NMYA 1UTHB 1UIUA 3U8QA 4UACA 1FTLA 3H03A 3C36A 1SI1A 4N6PA 3OXNA 4OMBA 4QHQA 1MY1A 3MPLA 4FJPA 3VLVA 1VE4A 4DXCA 3EF7A 2OWSA 4ZECA 1RKMA 1N3WA 3Q25A 1P1WA 5KDTA 4YKIA 1JW5A 5I2NB 1IZ1A 1FTKA 2X7QA 4YU0A 1DTGA 3FJMA 3K1MA 3QYTA 1FTOA 4OYVA 5CMCA 3K0VA 1N84A 3N26A 3PUYE 4LZ7A 5ITOA 3SERA 3O97A 1B3HA 2UVJA 2V84A 4H65A 4OVJA 4ZZEA 4JDFA 5ISUA 4RPOA 1LCFA 3FV1A 4NF5B 2F7CA 3H6WA 2AIXA 2DSFA 3MPKA 4R2BA 3S4UA 2QS2A 3LC8A 4QFKA 1B0LA 4U4XA 1IEJA 3PMVA 4G8HA 1YTVA 2XX8A 4OFOA 4YKKA 3BKIB 3THIA 5CBSA 2AYSA 4QFPA 1B5HA 3TTRA 2DVZA 3U72A 3IJXB 1DPEA 4ISUA 3SEYA 1TWYA 1LAXA 3MQ9A 5H8HA 5TPAB 3UA8A 4GRKA 3V5AA 1M5DA 1ZIUA 3JYRA 5DEXB 5I56B 3Q29A 2VGQA 4F19A 2QMWA 5CMBA 2ONSA 5I59B 1M5BA 1MY2A 4DDDA 3H06B 2XHDA 3S2VA 1IIWA 4ZDMA 4NF6B 4PFTA 4C1TA 4ZE8A 4Q8RA 4GVOA 2IA4A 2VHAA 1QJMA 2AL5A 2OWTA 2UVIA 2XXWA 1LB8A 2ZNTA 3BFTA 3CVGA 4R74A 1GVCA 5ITPA 5L9OA 4YB6A 1B9JA 1B52A 1T0KA 1R1NA 1SVXB 4QFNA 3V83A 1O7TA 3FJGA 4GWOA 4JWYA 4R9GA 3ILUB 4YKJA 3G7WA 4F1UA 3LSXA 2ONKE 3T93B 2Y7KA 1MPDA 1YPNA 3QIMA 3ZS6A 4DIGA 1ANFA 5DVJA 4C0RA 5JEIA 3EN3A 3CSGA 3N5LA 3LUYA 2D3IA 4LZ8A 3GXAA 4ONYA 4HTGA 4QSDA 1XOCA 2O68A 2H4IA 2F6PA 4XKQA 3FV2A 4ND9A 5M2VA 4C1UA 2I3WA 3QK6A 5H8SA 4ELOA 1H43A 2GH9A 2QSXA 5AA4B 2QS1A 2ZYOA 3HPIA 5KZTA 2E0SA 2RKMA 1TFAA 4F1VA 3TEPA 3EHUA 3VDFA 2O84X 4JBZA 3E9XA 3TQLA 3ECRA 3S9EA 4F3SA 5AA2B 3VVDA 1FTMA 1MM6A 2Q2AA 4MLQA 1OVBA 2OJTA 1XC1A 2XXUA 3FVNA 1FCKA 4IY6A 5FHOA 1MXXA 1L5TA 1DPPA 2YLNA 3PUWE 4X9TA 1MPBA 2QL3A 4N13A 3H4ZA 2I4BA 1LFHA 2OZZA 5L8DA 1VFEA 5DEXA 4GIZA 2DXRA 1LFGA 4XIGQ 1B7ZA 1B3FA 3E3KA 3SEWA 3MWBA 3PD8A 2FNCA 4IO3A 3GBBA 3I6VA 4X1BA 3KJTA 1NNPA 1IUDA 2Y7PA 3DP8A 4L17A 3IORA 4KYEA 1B7UA 4ZEFA 3P7IA 4PFYA 3IAZA 2GHAA 2RF1A 2HFBA 2UYEA 2V3QA 4KCCA 1DMBA 3UK4A 3MVYA 4TLMB 5A5XA 2HCAA 3PUZE 1PDAA 2I6EA 4F3PA 1MQHA 1MRPA 3HN0A 3PPNA 1ATGA 2O6AA 3OSRA 4AB5A 5CBRA 4TQUQ 1ZTYA 3H3GA 4Z0IA 4LUBA 4WXJA 4LA9A 3BFUA 2HAUA 3FJ7A 5AA2D 3Q26A 5I2KA 2Z22A 1SW4A 1FQBA 1N3XA 1DOTA 2HQ0A 3IOTA 4PE5B 3DLNA 4TOZA 1UIVA 3TPAA 4F3GA 5TP9B 2NOOA 1A99A 3K1PA 2I0BA 1UQWA 3T9HB 5IKBA 1B4ZA 4XKNA 1AOVA 1HSLA 4OFLA 3SESA 3CRBA 2G29A 1B1XA 3UGWA 1A8FA 4F2OA 2ZYKA 2O1MA 2F6GA 3H6TA 4XKPA 3VE1B 3PMXA 3VXBA 1CE2A 2F35A 4NF6A 2P2AA 4ZEIA 3R6UA 4PETA 2H99A 3MUQA 4QFOA 3GZGA 5FTHA 4F18A 1A7LA 1MXWA 1JEVA 1JVXA 1OVTA 1XHYA 4F3BA 5I56A 1OMPA 1NL5A 2A5TA 1B7HA 3HHFA 2O7UA 1B40A 3TTNA 4Z7EA 3W9WA 4ESXA 1N7XA 2DWIA 4N07A 3IR1A 3CIJA 4RPNA 4HW8A 1URGA 1OQGA 4KI0E 1WDNA 3CFLA 4H5FA 4LQ2A 4MF3A 4G68B 2THIA 4G77A 5FHNA 3EHSA 1JW4A 2BJJX 3EQ1A 3MP1A 4FEDA 2H9BA 4RYAA 1PB7A 3O6HA 4G8NA 2D21A 4GL0A 4U4SA 4EQ7A 1PB8A 4DE8A 3M3KA 1ZLQA 2Z23A 2KLFA 4OERA 2Q88A 3B7DA 5L9SA 3TYHA 5A5XB 3HO7A 1BLFA 3TKDA 1D4NA 2DVCA 1LCTA 4POXA 2DWAA 1SDXA 5IAIA 3FATA 1QVSA 1O64A 3MZ1A 3WAEA 4ZS9A 2I58A 1QUIA 4ZZAA 4H5GA 1Y4TA 2PX1A 3MBPA 3KEIA 1LLSA 1QKAA 3G3HA 1MXYA 3F11A 3LR1A 1BIYA 3KN7A 4NF8B 5ICQA 4U2RA 3ZKLA 4BDNA 4AQ4A 3JZJA 3O2AA 1JNFA 1Y9UA 4RNSA 3VFJA 3U92A 4BDQA 3OENA 2XXQA 5I57A 1D3KA 1NKXA 1URSA 1XVXA 2DXYA 2GRVA 2YJPA 3K00A 1NH8A 3N94A 4JWXA 4NF8A 4F29A 3TUSA 3MVWA 3E13X 4YICA 2RCAA 3K2DA 3VV5A 3RNNA 1N76A 3KOTA 4KCDA 2GFEA 3DP6A 2XX7A 3A09A 1FTJA 2XXIA 3ILTB 4RJZA 2Z8EA 5F1QA 3ZSFA 2D5WA 2PBWA 4QSCA 1NNKA 2O69A 3TCGA 1ELJA 1ZJLA 3SKPA 3G3JA 3MJNA 3K6WA 3MZ9A 4R75A 2Z8FA 1JQFA 4RY1A 4FE8A 3TQWA 4R2FA 3FUZA 4O3BA 1MS7A 1P1QA 1A54A 3FD3A 3PU5A 1USYH 3OEKA 1N7WA 3C32A 4IO7A 3TELA 4E0XA 3TTMA 4ELRA 1QKBA 5ICTA 3Q27A 5JTYB 1I6AA 5I59A 1B5IA 1Y4CA 1SYHA 3IB1A 3T9UA 2QPQA 4DCXA 1ZKBA 3OSQA 5BUUA 1LGBC 1FQEA 5DTBA 2F7AA 2QRYA 1H45A 4EQ9A 4QSEA 1AH5A 1D9YA 4LP2B 1EZOA 2Y84A 3C9HA 2DE2A 4U1ZA 4HCYA 1SBPA 1J1NA 5HM4B 2Z8DA 2X26A 2DP8A 3PMWA 2Q89A 2I4CA 3O29A 4HCWA 3RTFB 2F34A 4OENA 1MDP1 3C4MA 3TDJA 3U94A 1B46A 4F1YA 4YMAA 5I57B 4QRZA 4KYSA 3KBRA 2XXXA 5B7DA 2R71A 4FIMA 2ZXTA 1MXUA 1MY3A 2XXRA 4AB6A 4R6YA 1MQGA 2H25A 3KOSA 3ODBA 3MW0A 5I58B 3LSWA 4NF4B 1QUJA 2ZMBA 4U1OA 3UIFA 4GXAA 3OMBA 2DE4A 2V3TA 2R6GE 3PPRA 4IGRA 4U21A 3U1OA 1TFDA 2DOJA 3DM0A 4BLAA 2UXAA 5I2KB 4DLDA 3FASA 1FQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LST A;  3KG2 A;  4EUO A;  1Q35 A;  1CB6 A;  2V93 A;  1JEU A;  5KDT B;  1HSJ A;  1POT A;  1URD A;  2B65 A;  2H5Y A;  2QS3 A;  4ELP A;  3O28 A;  2NUV A;  3LBS A;  1IIT A;  1EH3 A;  1NFT A;  3OEL A;  1N0T A;  1A40 A;  5HBC A;  1D9V A;  5K2X A;  1Y1M A;  1WVJ A;  4PQJ A;  4UA8 A;  3IJO B;  3PV0 E;  1NNT A;  1P1U A;  1VR5 A;  2XX9 A;  4LZ5 A;  2B3F A;  2ONR A;  3UN6 A;  4EF1 A;  2ZYN A;  3ZKK A;  1OQH A;  2PT2 A;  3IOV A;  3RPW A;  3T9V A;  2RIN A;  2Q9T A;  3PPP A;  1H44 A;  3DEL B;  1LAH E;  3DP4 A;  1H3D A;  2OK2 A;  2YPN A;  3L6G A;  3R26 A;  2RC9 A;  4G4P A;  1Y3N A;  5H8F A;  3RT8 A;  3SDF A;  3VVE A;  3ONM A;  5TU0 A;  1Y3P A;  1Z7N E;  4LQ5 A;  3S9L C;  3K02 A;  3GLB A;  2Y7I A;  3TZA A;  4NWC A;  2X7P A;  4H1X A;  3VLU A;  2P0S A;  3CFZ A;  4EXL A;  2A5T B;  2UVG A;  2H98 A;  3QAX A;  3C35 A;  1Y3Q A;  4X1D A;  3RQT A;  5LOM A;  5BWJ A;  3RUM A;  4PFU A;  1I6Q A;  3V89 B;  4F22 A;  4GF8 A;  4R6H A;  3D4G A;  4OEU A;  4NWD A;  4YKP A;  1NNF A;  4I62 A;  5JTY A;  1IXC A;  5KCJ B;  3AXF A;  1GGG A;  1B4H A;  2GHB A;  2IEE A;  3JV9 A;  4IB2 A;  5DVF A;  3FVG A;  1QUL A;  4K3F A;  3TFL A;  1JVY A;  4JSO A;  1B32 A;  1OLA A;  3USD A;  4BDM A;  1JET A;  1GV8 A;  5AA2 A;  2NWJ A;  4OHN A;  5H8F B;  1QUK A;  1LFI A;  1VSO A;  2F36 A;  3MVX A;  3FXU A;  4I1D A;  4LAT A;  4LON B;  4OTE A;  2DS9 A;  4JWO A;  3RY3 A;  3OOA A;  3KJ7 A;  3H6U A;  1KWH A;  5J1D A;  3O6G A;  1B3G A;  3QUF A;  4BDO A;  1IQ7 A;  2VOZ A;  5TP9 A;  3RT6 B;  3PUV E;  3T9X B;  2UYF A;  1MH4 A;  4OXV A;  1UTB A;  4F39 A;  2DYX A;  1B1H A;  1RYO A;  2XXT A;  5EHM A;  1FQF A;  4OEV A;  3MP8 A;  4E0W A;  4RK2 A;  4ZEK A;  4ZE9 A;  1OLC A;  1MXV A;  4ELQ A;  5CC2 A;  3G3I A;  2FA7 A;  1MPC A;  4KPT A;  3VVF A;  1EZP A;  1BTJ A;  3HST A;  1DSN A;  1SYI A;  1UTB B;  2HZL A;  4GOT A;  4GL8 A;  4I8C A;  1SW2 A;  3Q28 A;  2ANJ A;  1UTH A;  2F78 A;  1O63 A;  1AIV A;  1MDQ A;  1LBC A;  4OET A;  1TT1 A;  1LAG E;  3KGC A;  3CG3 A;  3I3V A;  5CMM A;  5DYH A;  1R6Z A;  2I3V A;  4IO2 A;  1B3L A;  2HAV A;  4GFR A;  4P0I A;  2Y7W A;  4H8I A;  4KYD A;  1M5E A;  2DQV A;  3G3G A;  4OES A;  3EPE A;  4TLL B;  3W15 C;  3A3C A;  2F7B A;  2ZYM A;  1SQY A;  3FVK A;  1GR2 A;  1ZBM A;  2HXW A;  5KCJ A;  2XXY A;  1SI0 A;  2OLB A;  4ESW A;  3GBA A;  1S7Y A;  4GXS B;  4R9F A;  4IO6 A;  1I69 A;  3S9M C;  5B70 A;  1F9B A;  4MBP A;  1P1O A;  3MZB A;  2VP1 A;  5AA4 A;  4QF9 A;  1B05 A;  2ZNU A;  4NED A;  2PYY A;  4OQO A;  5H8H B;  4GD5 A;  5TPA A;  3WAF A;  3S9N C;  3HV1 A;  1PB9 A;  4O3A A;  5CI5 A;  3E4R A;  4I9D A;  3OO9 A;  1FQD A;  4KFQ A;  4FAT A;  3MAM A;  2REG A;  1QW0 A;  3VXC A;  1N04 A;  1S50 A;  3G3F A;  4F2Q A;  2DE3 A;  4IO4 A;  1LBB A;  2ALU A;  3SEU A;  1MQI A;  1WOD A;  2RCB A;  1BKA A;  1IXG A;  3RN8 A;  4DZ1 A;  2F5X A;  4WKM A;  1EZ9 A;  2P1S A;  2A5S A;  2F8D A;  1P99 A;  5ELV A;  3C31 A;  3CG1 A;  3K01 A;  1XT8 A;  1US5 A;  1IXH A;  4ZED A;  1B2H A;  3TOD A;  2I0C A;  3CI8 A;  2F97 A;  4MFI A;  5I2N A;  4WED A;  1MY0 A;  1XS5 A;  3SEX A;  1P1N A;  3PUX E;  2I49 A;  3G3K A;  1SW5 A;  3L6H A;  1B6H A;  2G93 A;  2XD2 A;  1MY4 A;  3O66 A;  3QSL A;  2OCU A;  4H6D A;  4IGT A;  3C34 A;  4NF4 A;  4DXB A;  5AA1 A;  3FGS A;  5I58 A;  3A3U A;  1Q1K A;  4M1V A;  4KHZ E;  3TTK A;  4FAJ A;  4EF2 A;  2PMS A;  2VD3 A;  3KSJ A;  4XKR A;  5K2Y A;  4BDR A;  1S9T A;  4DCY A;  4HS7 A;  4X48 A;  2QS4 A;  4KQP A;  3B6W A;  3LSF B;  4YB5 A;  2WKY A;  1A8E A;  4OFJ A;  1B58 A;  1BP5 A;  3FVO A;  4FEB A;  4KD5 A;  5H8Q A;  3CR9 A;  5L9M A;  4WEP A;  1I6B A;  3TMG A;  3VLW A;  5JK4 A;  3OD7 A;  3CSB A;  3LSL A;  1AL3 A;  2REJ A;  3N6U A;  1HSE A;  3TCH A;  3K1N A;  1SW1 A;  1EU8 A;  4GQO A;  3KN8 A;  1ZU0 A;  3B6T A;  1IXI A;  4IY5 A;  3FIR A;  4G68 C;  4THI A;  4G2Z A;  4FEC A;  3OO7 A;  4RXL A;  4U22 A;  2XD3 A;  4G68 A;  3OO6 A;  5F7V A;  2O7I A;  2QMX A;  3C33 A;  1FQC A;  2OBG A;  2RC7 A;  2ZNS A;  2XXV A;  2HZK A;  2O51 A;  3I5O A;  4JXI A;  1MM7 A;  3FXR A;  1R9Q A;  1US4 A;  4YZZ A;  3T66 A;  4H8J A;  3UP9 A;  5AE4 A;  1YAE A;  3M8U A;  4GLI A;  2I48 A;  3IX1 A;  4YB7 A;  3PGF A;  2AL4 A;  4OWD A;  3BBR A;  1PBQ A;  3B6Q A;  4XTC Q;  5DVI A;  2DWJ A;  1VFD A;  3U93 A;  2DWH A;  3IOW A;  4Q30 B;  3D4C A;  3IO6 A;  4FOR A;  5EYF A;  3MVZ A;  2LAO A;  3CFX A;  3EHT A;  1M5F A;  3FZV A;  3T96 B;  4JB7 A;  2V3U A;  4R72 A;  4U23 A;  5AA3 A;  3HHG A;  4DXU A;  5I84 A;  1LB9 A;  1PBP A;  3K4U A;  2QJE A;  2XXH A;  3O9P A;  1Y20 A;  5DT6 A;  2W7Y A;  1B3E A;  1MG1 A;  2CMO A;  1B5J A;  2O1L A;  1SD3 A;  1B51 A;  4XXU A;  4KR5 A;  3K6X A;  1DTZ A;  1XVY A;  1RYX A;  3IOU A;  5CM6 A;  4P11 A;  3KZG A;  2Q2C A;  4O3C A;  1MQJ A;  1MH3 A;  3TCF A;  2B3B A;  1MXZ A;  2PT1 A;  3IL1 B;  3M3L A;  4R6K A;  3SEV A;  5FHM A;  5FTI A;  4M4G A;  2V25 A;  4POW A;  3MC2 A;  3PPO A;  1NMU A;  3PD9 A;  5H8N A;  3H6V A;  2ESN A;  4R73 A;  2PVU A;  3M3F A;  3K6U A;  4RA1 A;  3TTL A;  2E1S A;  1PC3 A;  1R9L A;  2FYI A;  3H7M A;  3W9V A;  2NXO A;  1Y1Z A;  4EQB A;  2RC8 A;  4ECF A;  3T22 A;  4P0G A;  1GTK A;  3OEM A;  2CZL A;  4NE4 A;  3KFM A;  3O6I A;  5CRY A;  1ZMG A;  3SET A;  1A55 A;  4LVQ A;  3RGY A;  3IO4 A;  5HPQ A;  2NVU B;  1PEB A;  3TAJ A;  1TXF A;  1JW1 A;  3OO8 A;  3PPQ A;  2Y7R A;  4EDP A;  3R7X A;  1OIB A;  2Q8J A;  4RK9 A;  3V8X B;  3IB0 A;  2HEU A;  1AMF A;  1FW0 A;  3QXM A;  4G8M A;  5CMK A;  4H0W A;  4YMB A;  2UVH A;  4IO5 A;  4H67 A;  1II5 A;  3IB2 A;  4OZ9 A;  4Q0C A;  3UOR A;  4F31 B;  5H8N B;  3QUJ A;  3FXQ A;  1YCJ A;  1NH7 A;  3RLF E;  4NTL A;  2XXP A;  4QFL A;  1LAF E;  4Q5T A;  5H8Q B;  4ZEB A;  4EXK A;  3K6V A;  1MQD A;  4JSD A;  4BDL A;  3HCQ A;  3IK6 B;  3MP6 A;  3KN3 A;  4MH5 A;  2R9J A;  4PFW A;  1POY 1;  4PP0 A;  2M8C A;  1Z7M E;  2ABH A;  4YAH X;  5EHS A;  1B0H A;  3KSX A;  3N6T A;  1H76 A;  4MLV A;  3RTW B;  2VD2 A;  4NF5 A;  1M5C A;  1USY E;  4NMY A;  1UTH B;  1UIU A;  3U8Q A;  4UAC A;  1FTL A;  3H03 A;  3C36 A;  1SI1 A;  4N6P A;  3OXN A;  4OMB A;  4QHQ A;  1MY1 A;  3MPL A;  4FJP A;  3VLV A;  1VE4 A;  4DXC A;  3EF7 A;  2OWS A;  4ZEC A;  1RKM A;  1N3W A;  3Q25 A;  1P1W A;  5KDT A;  4YKI A;  1JW5 A;  5I2N B;  1IZ1 A;  1FTK A;  2X7Q A;  4YU0 A;  1DTG A;  3FJM A;  3K1M A;  3QYT A;  1FTO A;  4OYV A;  5CMC A;  3K0V A;  1N84 A;  3N26 A;  3PUY E;  4LZ7 A;  5ITO A;  3SER A;  3O97 A;  1B3H A;  2UVJ A;  2V84 A;  4H65 A;  4OVJ A;  4ZZE A;  4JDF A;  5ISU A;  4RPO A;  1LCF A;  3FV1 A;  4NF5 B;  2F7C A;  3H6W A;  2AIX A;  2DSF A;  3MPK A;  4R2B A;  3S4U A;  2QS2 A;  3LC8 A;  4QFK A;  1B0L A;  4U4X A;  1IEJ A;  3PMV A;  4G8H A;  1YTV A;  2XX8 A;  4OFO A;  4YKK A;  3BKI B;  3THI A;  5CBS A;  2AYS A;  4QFP A;  1B5H A;  3TTR A;  2DVZ A;  3U72 A;  3IJX B;  1DPE A;  4ISU A;  3SEY A;  1TWY A;  1LAX A;  3MQ9 A;  5H8H A;  5TPA B;  3UA8 A;  4GRK A;  3V5A A;  1M5D A;  1ZIU A;  3JYR A;  5DEX B;  5I56 B;  3Q29 A;  2VGQ A;  4F19 A;  2QMW A;  5CMB A;  2ONS A;  5I59 B;  1M5B A;  1MY2 A;  4DDD A;  3H06 B;  2XHD A;  3S2V A;  1IIW A;  4ZDM A;  4NF6 B;  4PFT A;  4C1T A;  4ZE8 A;  4Q8R A;  4GVO A;  2IA4 A;  2VHA A;  1QJM A;  2AL5 A;  2OWT A;  2UVI A;  2XXW A;  1LB8 A;  2ZNT A;  3BFT A;  3CVG A;  4R74 A;  1GVC A;  5ITP A;  5L9O A;  4YB6 A;  1B9J A;  1B52 A;  1T0K A;  1R1N A;  1SVX B;  4QFN A;  3V83 A;  1O7T A;  3FJG A;  4GWO A;  4JWY A;  4R9G A;  3ILU B;  4YKJ A;  3G7W A;  4F1U A;  3LSX A;  2ONK E;  3T93 B;  2Y7K A;  1MPD A;  1YPN A;  3QIM A;  3ZS6 A;  4DIG A;  1ANF A;  5DVJ A;  4C0R A;  5JEI A;  3EN3 A;  3CSG A;  3N5L A;  3LUY A;  2D3I A;  4LZ8 A;  3GXA A;  4ONY A;  4HTG A;  4QSD A;  1XOC A;  2O68 A;  2H4I A;  2F6P A;  4XKQ A;  3FV2 A;  4ND9 A;  5M2V A;  4C1U A;  2I3W A;  3QK6 A;  5H8S A;  4ELO A;  1H43 A;  2GH9 A;  2QSX A;  5AA4 B;  2QS1 A;  2ZYO A;  3HPI A;  5KZT A;  2E0S A;  2RKM A;  1TFA A;  4F1V A;  3TEP A;  3EHU A;  3VDF A;  2O84 X;  4JBZ A;  3E9X A;  3TQL A;  3ECR A;  3S9E A;  4F3S A;  5AA2 B;  3VVD A;  1FTM A;  1MM6 A;  2Q2A A;  4MLQ A;  1OVB A;  2OJT A;  1XC1 A;  2XXU A;  3FVN A;  1FCK A;  4IY6 A;  5FHO A;  1MXX A;  1L5T A;  1DPP A;  2YLN A;  3PUW E;  4X9T A;  1MPB A;  2QL3 A;  4N13 A;  3H4Z A;  2I4B A;  1LFH A;  2OZZ A;  5L8D A;  1VFE A;  5DEX A;  4GIZ A;  2DXR A;  1LFG A;  4XIG Q;  1B7Z A;  1B3F A;  3E3K A;  3SEW A;  3MWB A;  3PD8 A;  2FNC A;  4IO3 A;  3GBB A;  3I6V A;  4X1B A;  3KJT A;  1NNP A;  1IUD A;  2Y7P A;  3DP8 A;  4L17 A;  3IOR A;  4KYE A;  1B7U A;  4ZEF A;  3P7I A;  4PFY A;  3IAZ A;  2GHA A;  2RF1 A;  2HFB A;  2UYE A;  2V3Q A;  4KCC A;  1DMB A;  3UK4 A;  3MVY A;  4TLM B;  5A5X A;  2HCA A;  3PUZ E;  1PDA A;  2I6E A;  4F3P A;  1MQH A;  1MRP A;  3HN0 A;  3PPN A;  1ATG A;  2O6A A;  3OSR A;  4AB5 A;  5CBR A;  4TQU Q;  1ZTY A;  3H3G A;  4Z0I A;  4LUB A;  4WXJ A;  4LA9 A;  3BFU A;  2HAU A;  3FJ7 A;  5AA2 D;  3Q26 A;  5I2K A;  2Z22 A;  1SW4 A;  1FQB A;  1N3X A;  1DOT A;  2HQ0 A;  3IOT A;  4PE5 B;  3DLN A;  4TOZ A;  1UIV A;  3TPA A;  4F3G A;  5TP9 B;  2NOO A;  1A99 A;  3K1P A;  2I0B A;  1UQW A;  3T9H B;  5IKB A;  1B4Z A;  4XKN A;  1AOV A;  1HSL A;  4OFL A;  3SES A;  3CRB A;  2G29 A;  1B1X A;  3UGW A;  1A8F A;  4F2O A;  2ZYK A;  2O1M A;  2F6G A;  3H6T A;  4XKP A;  3VE1 B;  3PMX A;  3VXB A;  1CE2 A;  2F35 A;  4NF6 A;  2P2A A;  4ZEI A;  3R6U A;  4PET A;  2H99 A;  3MUQ A;  4QFO A;  3GZG A;  5FTH A;  4F18 A;  1A7L A;  1MXW A;  1JEV A;  1JVX A;  1OVT A;  1XHY A;  4F3B A;  5I56 A;  1OMP A;  1NL5 A;  2A5T A;  1B7H A;  3HHF A;  2O7U A;  1B40 A;  3TTN A;  4Z7E A;  3W9W A;  4ESX A;  1N7X A;  2DWI A;  4N07 A;  3IR1 A;  3CIJ A;  4RPN A;  4HW8 A;  1URG A;  1OQG A;  4KI0 E;  1WDN A;  3CFL A;  4H5F A;  4LQ2 A;  4MF3 A;  4G68 B;  2THI A;  4G77 A;  5FHN A;  3EHS A;  1JW4 A;  2BJJ X;  3EQ1 A;  3MP1 A;  4FED A;  2H9B A;  4RYA A;  1PB7 A;  3O6H A;  4G8N A;  2D21 A;  4GL0 A;  4U4S A;  4EQ7 A;  1PB8 A;  4DE8 A;  3M3K A;  1ZLQ A;  2Z23 A;  2KLF A;  4OER A;  2Q88 A;  3B7D A;  5L9S A;  3TYH A;  5A5X B;  3HO7 A;  1BLF A;  3TKD A;  1D4N A;  2DVC A;  1LCT A;  4POX A;  2DWA A;  1SDX A;  5IAI A;  3FAT A;  1QVS A;  1O64 A;  3MZ1 A;  3WAE A;  4ZS9 A;  2I58 A;  1QUI A;  4ZZA A;  4H5G A;  1Y4T A;  2PX1 A;  3MBP A;  3KEI A;  1LLS A;  1QKA A;  3G3H A;  1MXY A;  3F11 A;  3LR1 A;  1BIY A;  3KN7 A;  4NF8 B;  5ICQ A;  4U2R A;  3ZKL A;  4BDN A;  4AQ4 A;  3JZJ A;  3O2A A;  1JNF A;  1Y9U A;  4RNS A;  3VFJ A;  3U92 A;  4BDQ A;  3OEN A;  2XXQ A;  5I57 A;  1D3K A;  1NKX A;  1URS A;  1XVX A;  2DXY A;  2GRV A;  2YJP A;  3K00 A;  1NH8 A;  3N94 A;  4JWX A;  4NF8 A;  4F29 A;  3TUS A;  3MVW A;  3E13 X;  4YIC A;  2RCA A;  3K2D A;  3VV5 A;  3RNN A;  1N76 A;  3KOT A;  4KCD A;  2GFE A;  3DP6 A;  2XX7 A;  3A09 A;  1FTJ A;  2XXI A;  3ILT B;  4RJZ A;  2Z8E A;  5F1Q A;  3ZSF A;  2D5W A;  2PBW A;  4QSC A;  1NNK A;  2O69 A;  3TCG A;  1ELJ A;  1ZJL A;  3SKP A;  3G3J A;  3MJN A;  3K6W A;  3MZ9 A;  4R75 A;  2Z8F A;  1JQF A;  4RY1 A;  4FE8 A;  3TQW A;  4R2F A;  3FUZ A;  4O3B A;  1MS7 A;  1P1Q A;  1A54 A;  3FD3 A;  3PU5 A;  1USY H;  3OEK A;  1N7W A;  3C32 A;  4IO7 A;  3TEL A;  4E0X A;  3TTM A;  4ELR A;  1QKB A;  5ICT A;  3Q27 A;  5JTY B;  1I6A A;  5I59 A;  1B5I A;  1Y4C A;  1SYH A;  3IB1 A;  3T9U A;  2QPQ A;  4DCX A;  1ZKB A;  3OSQ A;  5BUU A;  1LGB C;  1FQE A;  5DTB A;  2F7A A;  2QRY A;  1H45 A;  4EQ9 A;  4QSE A;  1AH5 A;  1D9Y A;  4LP2 B;  1EZO A;  2Y84 A;  3C9H A;  2DE2 A;  4U1Z A;  4HCY A;  1SBP A;  1J1N A;  5HM4 B;  2Z8D A;  2X26 A;  2DP8 A;  3PMW A;  2Q89 A;  2I4C A;  3O29 A;  4HCW A;  3RTF B;  2F34 A;  4OEN A;  1MDP 1;  3C4M A;  3TDJ A;  3U94 A;  1B46 A;  4F1Y A;  4YMA A;  5I57 B;  4QRZ A;  4KYS A;  3KBR A;  2XXX A;  5B7D A;  2R71 A;  4FIM A;  2ZXT A;  1MXU A;  1MY3 A;  2XXR A;  4AB6 A;  4R6Y A;  1MQG A;  2H25 A;  3KOS A;  3ODB A;  3MW0 A;  5I58 B;  3LSW A;  4NF4 B;  1QUJ A;  2ZMB A;  4U1O A;  3UIF A;  4GXA A;  3OMB A;  2DE4 A;  2V3T A;  2R6G E;  3PPR A;  4IGR A;  4U21 A;  3U1O A;  1TFD A;  2DOJ A;  3DM0 A;  4BLA A;  2UXA A;  5I2K B;  4DLD A;  3FAS A;  1FQA A; 
#chains in the Genus database with same CATH topology
 3KG2 A;  1Q35 A;  2V93 A;  5FBP A;  2H5Y A;  3O28 A;  1IIT A;  1EH3 A;  2QFL A;  4UA8 A;  5F24 A;  3IJO B;  2RIN A;  1H44 A;  1LAH E;  3DP4 A;  1Y3N A;  4G61 A;  3VVE A;  5TU0 A;  4LQ5 A;  3GLB A;  4NWC A;  2P0S A;  4X1D A;  4OVS A;  3RQT A;  4PFU A;  4F22 A;  4R6H A;  2VT5 A;  4NWD A;  5DVF A;  1GGG A;  2IEE A;  1EYJ A;  3FVG A;  1QUL A;  2Q8M A;  5H8F B;  1VSO A;  3MVX A;  4JWO A;  3OOA A;  4GX6 A;  5J1D A;  3RT6 B;  3T9X B;  1MH4 A;  4OXV A;  4ZEK A;  1MXV A;  3G3I A;  4I3E A;  1BTJ A;  3HST A;  1DSN A;  1SW2 A;  2F78 A;  1O63 A;  1AIV A;  4UAB A;  2I3V A;  4GFR A;  4NHB A;  4H8I A;  1M5E A;  2DQV A;  4OES A;  3EPE A;  3A3C A;  1FPD A;  1GR2 A;  1ZBM A;  2HXW A;  1VDW A;  3SZP A;  3S9M C;  1I69 A;  4QF9 A;  5H8H B;  2ZNU A;  4NED A;  2PYY A;  4P1L A;  3WAF A;  4GD5 A;  1PB9 A;  4DI3 D;  4I9D A;  3OO9 A;  1N04 A;  4IO4 A;  1LBB A;  1WOD A;  1BKA A;  1IXG A;  2F5X A;  4ZED A;  3CI8 A;  1XS5 A;  2G93 A;  4IGT A;  5L9S A;  3A3U A;  5IZ3 A;  4FAJ A;  5IM2 A;  4XKR A;  2XWO A;  4BDR A;  4DCY A;  4OAN A;  3E79 A;  4HS7 A;  4KQP A;  2WKY A;  4GWX A;  5H8Q A;  4FEB A;  3VLW A;  3TMG A;  3LSL A;  2REJ A;  3TCH A;  1NV7 A;  4GQO A;  1ZU0 A;  4IY5 A;  1NV2 A;  3FIR A;  4G2Z A;  3OO7 A;  4RXL A;  4G68 A;  3OO6 A;  1G0I A;  1FQC A;  2ZNS A;  4JXI A;  3T66 A;  3FXR A;  2V4C A;  3M8U A;  2I48 A;  3PGF A;  2AL4 A;  5AA4 B;  1PBQ A;  4XTC Q;  4FOR A;  5EYF A;  3CFX A;  3FZV A;  4PAF A;  5DT6 A;  4NGU A;  1B3E A;  1MG1 A;  4XXU A;  4KR5 A;  3K6X A;  1DTZ A;  1RYX A;  2Q2C A;  3M3L A;  2V25 A;  4R73 A;  2PVU A;  3QMF A;  1JP4 A;  2RC8 A;  4ECF A;  4P0G A;  1GTK A;  3OEM A;  1DBZ A;  4NE4 A;  1ZMG A;  1A55 A;  5HPQ A;  3TAJ A;  2Y7R A;  4RK9 A;  3QXM A;  4H0W A;  2UVH A;  4F31 B;  2FVZ A;  3FXQ A;  1YCJ A;  1EYI A;  2XXK A;  2XXP A;  5H8Q B;  4BDL A;  3MP6 A;  3KN3 A;  4PFW A;  3N6T A;  2VD2 A;  3FXB A;  4NMY A;  3C36 A;  4QHQ A;  1MY1 A;  3EF7 A;  1N3W A;  1P1W A;  4YKI A;  4YU0 A;  1DTG A;  4ESX A;  4OYV A;  2UVJ A;  3GYY A;  4JDF A;  2F7C A;  2CZK A;  3T0J A;  5ET5 A;  1B0L A;  4OFO A;  3BKI B;  3TTR A;  3MYU A;  3RPL B;  4OVR A;  1LAX A;  3MQ9 A;  5DEX B;  3Q29 A;  4F19 A;  4DDD A;  2XHD A;  4ZDM A;  4Q8R A;  4H46 A;  4N91 A;  1GVC A;  5ITP A;  4PDD A;  1R1N A;  3V83 A;  1O7T A;  4GWO A;  3KBZ A;  3ILU B;  4XFE A;  4YKJ A;  3G7W A;  2ONK E;  3QIM A;  3B8B A;  4LZ8 A;  4QSD A;  2F6P A;  2P3N A;  5H8S A;  2E0S A;  3EHU A;  2O84 X;  3S9E A;  1MM6 A;  1XC1 A;  3FVN A;  5FHO A;  4MAG A;  3H4Z A;  4GIZ A;  2DXR A;  1LFG A;  1B3F A;  4JVC A;  2FNC A;  4PFI A;  2CEX A;  4ZEF A;  2WYK A;  3IAZ A;  2GHA A;  1DMB A;  3IFC A;  3T1B A;  4JVI A;  1MQH A;  3RYD A;  3OSR A;  4Z0I A;  5I2K A;  3Q26 A;  2P3V A;  1UIV A;  4X04 A;  3T9H B;  1FBF A;  3SES A;  3CRB A;  3LV0 A;  4F2O A;  3PMX A;  1CE2 A;  1BK4 A;  2P2A A;  2VPO A;  3R6U A;  2H99 A;  4QFO A;  3GZG A;  5FTH A;  1JEV A;  4MMP A;  1OMP A;  1B7H A;  2DWI A;  3CIJ A;  2B4L A;  2THI A;  5IZZ A;  3EQ1 A;  4FED A;  1PB7 A;  4G8N A;  4GL0 A;  2D21 A;  4DE8 A;  2KLF A;  1SDX A;  3MZ1 A;  4IR8 A;  4ZZA A;  2XWK A;  4HE1 A;  3MBP A;  3G3H A;  1MXY A;  4HE0 A;  4BDN A;  4AQ4 A;  4RNS A;  4JVD A;  3VFJ A;  3U92 A;  1D3K A;  1URS A;  2DXY A;  3N94 A;  4NF8 A;  3E13 X;  4RJZ A;  2Z8E A;  4QSC A;  3SKP A;  3PTY A;  4R2F A;  3PU5 A;  1N7W A;  1XI6 A;  3TEL A;  3Q27 A;  1LBX A;  1LGB C;  5DTB A;  1AH5 A;  4LP2 B;  4U1Z A;  2DE2 A;  4XEQ A;  1SBP A;  2Z8D A;  2DP8 A;  4NAP A;  4F1Y A;  4HCW A;  2FBP A;  2F34 A;  4YMA A;  1B46 A;  4KYS A;  5EQ7 A;  2R71 A;  5IZ3 B;  4R6Y A;  4PTK A;  5I3S A;  4NF4 B;  4GXA A;  1FBG A;  4DLD A;  2DOJ A;  3ZKK A;  1FQA A;  1LST A;  5KDT B;  3IFA A;  2NUV A;  3KC1 A;  5K2X A;  1Y1M A;  1WVJ A;  4PQJ A;  2ZYN A;  2PT2 A;  3RPW A;  3T9V A;  2OK2 A;  1FPI A;  1Z7N E;  4H1X A;  4PDH A;  2QVV A;  5BWJ A;  1I6Q A;  4GF8 A;  3D4G A;  5KCJ B;  4IB2 A;  1JVY A;  1B32 A;  2F36 A;  4LAT A;  3FXU A;  3RY3 A;  3O6G A;  3NOH A;  4F39 A;  2DYX A;  1RYO A;  4E0W A;  3MP8 A;  5CC2 A;  2FA7 A;  4GL8 A;  2ANJ A;  1UTH A;  4MCO A;  1IMC A;  1MDQ A;  5CMM A;  1R6Z A;  3G3G A;  2ZYM A;  3FVK A;  4ESW A;  3GBA A;  4IO6 A;  5B70 A;  5AA4 A;  3HV1 A;  4O3A A;  4GX4 A;  4N4U A;  3CHG A;  1FQD A;  4KFQ A;  2REG A;  3E78 A;  1MQI A;  2Q74 A;  2RCB A;  4DZ1 A;  1EZ9 A;  2A5S A;  2F8D A;  3CG1 A;  1B2H A;  4WED A;  3SEX A;  3G3K A;  1SW5 A;  3L6H A;  1B6H A;  2XD2 A;  3QSL A;  1MY4 A;  4H6D A;  4DXB A;  3LUZ A;  5K2Y A;  1S9T A;  3B6W A;  4AS4 A;  1I6B A;  3OD7 A;  4PAK A;  3N6U A;  3K1N A;  3KN8 A;  5IGA A;  3B6T A;  1IXI A;  4THI A;  4G68 C;  1Q9D A;  2O7I A;  3C33 A;  2XXV A;  2HZK A;  2O51 A;  1MM7 A;  5AE4 A;  1R9Q A;  1YAE A;  4XF5 A;  3U93 A;  2DWJ A;  2DWH A;  3D4C A;  4U23 A;  4R72 A;  2QJE A;  1IMA A;  2W7Y A;  4NF0 A;  4OVQ A;  4P11 A;  1MQJ A;  1MH3 A;  2B3B A;  1MXZ A;  3IL1 B;  3MC2 A;  3PPO A;  3PD9 A;  3H6V A;  4GX3 A;  3M3F A;  1R9L A;  4EQB A;  1FBH A;  3T22 A;  2CZL A;  4GWY A;  3SET A;  3IO4 A;  4MX6 A;  3V8X B;  2HEU A;  1FW0 A;  4YMB A;  4H67 A;  1II5 A;  4OZ9 A;  4P1E A;  3UOR A;  3RLF E;  1FPB A;  1QGX A;  4QFL A;  4ZEB A;  4EXK A;  3K6V A;  1SPI A;  4MH5 A;  1POY 1;  1Z7M E;  4YAH X;  4MLV A;  1H76 A;  1USY E;  3U8Q A;  4UAC A;  4N6P A;  3OXN A;  3MPL A;  3Q25 A;  5I2N B;  2X7Q A;  3VXC A;  3FJM A;  1FTO A;  3K0V A;  1N84 A;  3O97 A;  4ZZE A;  1LCF A;  2DSF A;  4MIJ A;  4R2B A;  2QS2 A;  3LC8 A;  4QFK A;  4F3P A;  3PMV A;  4G8H A;  1YTV A;  2XX8 A;  4YKK A;  1B5H A;  3U72 A;  3SEY A;  1TWY A;  5TPA B;  3UA8 A;  3JYR A;  2QMW A;  5I59 B;  1MY2 A;  1LEV A;  4I3Y A;  3HFU A;  4GVO A;  1QJM A;  2AL5 A;  2XXW A;  4R74 A;  4NQ8 A;  4OA4 A;  4YB6 A;  3FJG A;  1FRP A;  4R9G A;  2Y7K A;  1YPN A;  4DIG A;  4C0R A;  3CSG A;  3GXA A;  1XOC A;  2O68 A;  3FV2 A;  2PFY A;  2I3W A;  3QK6 A;  1H43 A;  2QS1 A;  3HPI A;  1FBC A;  2RKM A;  2QVU A;  3A29 A;  1FTM A;  4IY6 A;  1L5T A;  1MXX A;  4X9T A;  1MPB A;  2QL3 A;  4N13 A;  5L8D A;  1B7Z A;  3SEW A;  3GBB A;  1YYZ A;  2ZZV A;  4X1B A;  1NNP A;  3DP8 A;  3P7I A;  1EYK A;  2RF1 A;  2V3Q A;  4KCC A;  5EYH A;  5A5X A;  3EKI A;  2HCA A;  3PUZ E;  2I6E A;  3PPN A;  1ATG A;  5CBR A;  4PAI A;  5AA2 D;  3FJ7 A;  1SW4 A;  1DOT A;  3IOT A;  1NUY A;  4PE5 B;  3DLN A;  4P56 A;  3TPA A;  2NOO A;  1B4Z A;  1HSL A;  2F6G A;  4XKP A;  3VE1 B;  3VXB A;  2F35 A;  2GQ1 A;  4PGP A;  4PET A;  1A7L A;  2WBD A;  5I56 A;  1OVT A;  4F3B A;  1NL5 A;  3W9W A;  1KA1 A;  4MHF A;  4N07 A;  3IR1 A;  4HW8 A;  1OQG A;  4KI0 E;  1WDN A;  4H5F A;  1FJ9 A;  5EQ9 A;  1JW4 A;  1PB8 A;  1G0H A;  4OER A;  2Q88 A;  3B7D A;  1BLF A;  1FPG A;  3TKD A;  4N8G A;  1D4N A;  2DVC A;  4POX A;  2DWA A;  1IME A;  4ZS9 A;  2VPN A;  4H5G A;  4MEV A;  5LOM A;  3LR1 A;  4NF8 B;  3KN7 A;  2FIE A;  4GWU A;  4BDQ A;  2CZI A;  2XXQ A;  5I57 A;  2GRV A;  1NH8 A;  3MVW A;  4YIC A;  2BJI A;  2RCA A;  3VV5 A;  3RNN A;  3KOT A;  2GFE A;  3A09 A;  2XXI A;  3ZSF A;  1NNK A;  1ZJL A;  3MZ9 A;  2Z8F A;  1JQF A;  1NV5 A;  3TQW A;  3FD3 A;  1USY H;  4IO7 A;  3C32 A;  4E0X A;  1NV6 A;  1QKB A;  1I6A A;  1B5I A;  4DCX A;  3OSQ A;  5LDZ A;  1FQE A;  2F7A A;  2QRY A;  1H45 A;  1EZO A;  4HCY A;  3PMW A;  2Q89 A;  2I4C A;  3TDJ A;  4OEN A;  1MDP 1;  5I57 B;  3KBR A;  2XXX A;  2Y5K A;  4FIM A;  2ZXT A;  4AB6 A;  2XXR A;  3KOS A;  3ODB A;  2DE4 A;  3PPR A;  2OWZ A;  4U21 A;  4IGR A;  3DM0 A;  1JEU A;  1URD A;  4ELP A;  1NFT A;  5A5L A;  1N0T A;  1A40 A;  5HBC A;  1D9V A;  3PV0 E;  1VR5 A;  2XX9 A;  2B3F A;  2ONR A;  3UN6 A;  4EF1 A;  1OQH A;  3IOV A;  5I7I A;  3ZKL A;  2YPN A;  3R26 A;  4PC9 A;  3RT8 A;  3SDF A;  3S9L C;  3ONM A;  1Y3P A;  4EXL A;  3VLU A;  4N81 A;  1NV0 A;  2A5T B;  2H98 A;  2UVG A;  3QAX A;  1RDY A;  3V89 B;  1NNF A;  4I62 A;  5JTY A;  1IXC A;  2GHB A;  3JV9 A;  1NUW A;  4K3F A;  3USD A;  1CNQ A;  5AA2 A;  1QUK A;  1LFI A;  4OTE A;  2DS9 A;  4N8Y A;  3QUF A;  5LTC A;  1IQ7 A;  1B1H A;  1FQF A;  4RK2 A;  3VVF A;  1UTB B;  3Q28 A;  2R8T A;  1TT1 A;  1LAG E;  5DYH A;  1AWB A;  2HAV A;  4P0I A;  4KYD A;  3ISP A;  4TLL B;  3W15 C;  4PFB A;  5KCJ A;  1KA0 A;  2OLB A;  4GXS B;  1S7Y A;  4R9F A;  3MZB A;  3S9N C;  2XWI A;  1FBD A;  3E4R A;  1S50 A;  3G3F A;  4F2Q A;  3D1R A;  2DE3 A;  4FBP A;  2ALU A;  3SEU A;  3RN8 A;  4PE3 A;  1FBE A;  4WKM A;  2P1S A;  5ELV A;  3K01 A;  3TOD A;  2F97 A;  1MY0 A;  3O66 A;  2OCU A;  4NF4 A;  4DI4 B;  4KHZ E;  3TTK A;  4EF2 A;  1FSA A;  3KSJ A;  3ROJ A;  3LSF B;  4YB5 A;  1A8E A;  4KD5 A;  1BP5 A;  5L9M A;  4WEP A;  4GWW A;  1AL3 A;  1EU8 A;  1K9Z A;  4PF8 A;  2XD3 A;  1D9Q A;  5F7V A;  2QMX A;  2RC7 A;  3I5O A;  4YZZ A;  1US4 A;  3UP9 A;  4H8J A;  4YB7 A;  3B6Q A;  1FPL A;  1VFD A;  2L5V A;  3MVZ A;  3EHT A;  1M5F A;  4JB7 A;  2V3U A;  5AA3 A;  4DXU A;  5I84 A;  1PBP A;  3K4U A;  2CMO A;  5CM6 A;  3KZG A;  3TCF A;  4R6K A;  5H8N A;  4N6D A;  3K6U A;  4RA1 A;  3TTL A;  2FYI A;  1IMB A;  1Y1Z A;  3KFM A;  2OX3 A;  2Y5L A;  3O6I A;  5CRY A;  2QVR A;  4LVQ A;  3BIH A;  4MJO A;  4PF6 A;  1JW1 A;  3PPQ A;  1K9Y A;  4EDP A;  3R7X A;  1OIB A;  2Q8J A;  4G8M A;  1AMF A;  5CMK A;  3IB2 A;  4Q0C A;  3QUJ A;  1MQD A;  4JSD A;  4P8B A;  3IK6 B;  2CZH A;  4PP0 A;  4NX1 A;  1UIU A;  4O8M A;  1SI1 A;  4OMB A;  4FJP A;  4AS5 A;  5KDT A;  1JW5 A;  1IZ1 A;  3K1M A;  3N26 A;  4LZ7 A;  5ITO A;  3SER A;  1B3H A;  2ZZX A;  2V84 A;  4H65 A;  5ISU A;  4RPO A;  3FV1 A;  4NF5 B;  1INP A;  2AIX A;  3MPK A;  3S4U A;  4O7I A;  2WEF A;  4U4X A;  3U1O A;  3THI A;  2AYS A;  4QFP A;  3IJX B;  4ISU A;  5H8H A;  3V5A A;  4GRK A;  1M5D A;  1ZIU A;  1NV3 A;  5CMB A;  3S2V A;  1IIW A;  2IA4 A;  2VHA A;  2UVI A;  3BFT A;  1LB8 A;  5L9O A;  2MKZ A;  1SVX B;  4QFN A;  3LSX A;  1NV4 A;  1MPD A;  3ZS6 A;  1RDZ A;  1ANF A;  1LBW A;  5JEI A;  3EN3 A;  3LUY A;  2D3I A;  5M2V A;  2H4I A;  4XKQ A;  4C1U A;  1YXI A;  2ZYO A;  3TEP A;  3VDF A;  4JBZ A;  3E9X A;  3ECR A;  4F3S A;  5AA2 B;  2Q2A A;  2OJT A;  1FCK A;  1DPP A;  3PUW E;  2I4B A;  1LFH A;  1VFE A;  5DEX A;  2KQZ A;  4XIG Q;  3E3K A;  3PD8 A;  4IO3 A;  4L17 A;  3IOR A;  2HFB A;  2UYE A;  3MVY A;  2DDK A;  5I5P A;  1PDA A;  4MNC A;  1FPE A;  1ZTY A;  3H3G A;  4LUB A;  4LA9 A;  2HAU A;  4GWS A;  2Z22 A;  4PBQ A;  1N3X A;  5TP9 B;  1A99 A;  4MNP A;  3K1P A;  5IKB A;  4XKN A;  4OFL A;  3UGW A;  2O1M A;  3H6T A;  4ZEI A;  3MUQ A;  4F18 A;  1MXW A;  1B40 A;  3TTN A;  4Z7E A;  1N7X A;  4RPN A;  1URG A;  3CFL A;  4LQ2 A;  3EHS A;  3MP1 A;  2H9B A;  4RYA A;  3O6H A;  4EQ7 A;  3M3K A;  1ZLQ A;  2Z23 A;  2XWV A;  3TYH A;  5IAI A;  3FAT A;  1O64 A;  1QUI A;  2PX1 A;  3KEI A;  1LLS A;  3F11 A;  1BIY A;  5ICQ A;  4U2R A;  1JNF A;  1Y9U A;  1FPK A;  1NKX A;  3K00 A;  3TUS A;  4NN3 A;  4P9K A;  4QBA A;  4KCD A;  2FIX A;  2XX7 A;  5F1Q A;  2O69 A;  3TCG A;  5ET8 A;  2F3D A;  4RY1 A;  4ELR A;  5ICT A;  3IB1 A;  1SYH A;  2QPQ A;  1ZKB A;  4QSE A;  1D9Y A;  2Y84 A;  3KC0 A;  2X26 A;  3RTF B;  3O29 A;  3U94 A;  3C4M A;  3FBP A;  4QRZ A;  1MXU A;  1MY3 A;  1MQG A;  2H25 A;  3MST A;  3LSW A;  1RDX A;  1QUJ A;  2ZMB A;  3BIG A;  4MNI A;  1TFD A;  2UXA A;  3FAS A;  4EUO A;  1LBV A;  1CB6 A;  1HSJ A;  1POT A;  2B65 A;  2QS3 A;  1NUX A;  3LBS A;  3OEL A;  1NNT A;  1P1U A;  4PBH A;  4LZ5 A;  5A5X B;  2Q9T A;  3PPP A;  3DEL B;  4G4P A;  1H3D A;  3L6G A;  2RC9 A;  3K02 A;  3TZA A;  2Y7I A;  2X7P A;  4QXD A;  3CFZ A;  3C35 A;  1Y3Q A;  3RUM A;  1NI9 A;  4LN5 A;  4OEU A;  2HPG A;  4YKP A;  3AXF A;  1B4H A;  3TFL A;  4JSO A;  1OLA A;  4BDM A;  1JET A;  1GV8 A;  2NWJ A;  4OHN A;  4LON B;  4I1D A;  2ZZW A;  3KJ7 A;  3H6U A;  1KWH A;  1B3G A;  4BDO A;  2VOZ A;  5TP9 A;  3PUV E;  3U65 A;  2UYF A;  1UTB A;  2XXT A;  5EHM A;  4OEV A;  4ZE9 A;  1OLC A;  4ELQ A;  4KPT A;  1MPC A;  1EZP A;  4I8C A;  1SYI A;  2HZL A;  4GOT A;  1LBC A;  4P47 A;  4GWZ A;  4OET A;  3KGC A;  3CG3 A;  3I3V A;  4IO2 A;  1B3L A;  2WX9 A;  2Y7W A;  1IMF A;  2F7B A;  4HE2 A;  1SQY A;  2CEY A;  2XXY A;  1SI0 A;  1YZ0 A;  1F9B A;  4MBP A;  1P1O A;  2VP1 A;  2WYP A;  1B05 A;  5TPA A;  4OQO A;  4N15 A;  5CI5 A;  4KXP A;  4FAT A;  3MAM A;  1QW0 A;  1NV1 A;  5ET7 A;  4NG7 A;  1P99 A;  3C31 A;  1XT8 A;  1US5 A;  1IXH A;  2I0C A;  4MFI A;  5I2N A;  1FPF A;  2PFZ A;  1P1N A;  3PUX E;  2I49 A;  3C34 A;  5AA1 A;  3FGS A;  5I58 A;  1Q1K A;  4M1V A;  2PCR A;  2PMS A;  2VD3 A;  5EYG A;  4X48 A;  2QS4 A;  5EQ8 A;  4P3L A;  2XA5 A;  4OFJ A;  2KR0 A;  1B58 A;  3FVO A;  3CR9 A;  5JK4 A;  3CSB A;  4GBW A;  1HSE A;  1SW1 A;  4OVT A;  3RPL A;  4FEC A;  4U22 A;  2OBG A;  4O7M A;  5ET6 A;  4GLI A;  3IX1 A;  4OWD A;  3BBR A;  5DVI A;  3IOW A;  4Q30 B;  3IO6 A;  2LAO A;  3T96 B;  3HHG A;  1LB9 A;  2XXH A;  3O9P A;  1Y20 A;  1B5J A;  2O1L A;  1SD3 A;  1B51 A;  3IOU A;  1XVY A;  4O3C A;  1FJ6 A;  3B50 A;  2PT1 A;  3SEV A;  5FHM A;  4M4G A;  4POW A;  1LBY A;  1NMU A;  2ESN A;  2E1S A;  1PC3 A;  3H7M A;  3W9V A;  2NXO A;  3RGY A;  2NVU B;  1PEB A;  1TXF A;  3OO8 A;  3IB0 A;  4IO5 A;  5H8N B;  1NH7 A;  1KZ8 A;  4NTL A;  1LAF E;  4Q5T A;  3HCQ A;  2R9J A;  2M8C A;  2ABH A;  5EHS A;  1B0H A;  3KSX A;  3RTW B;  4NF5 A;  1M5C A;  5T3J A;  1UTH B;  1FTL A;  3H03 A;  4DXC A;  3VLV A;  1VE4 A;  2OWS A;  4ZEC A;  1RKM A;  1FTK A;  5FTI A;  3QYT A;  5CMC A;  3PUY E;  4OVJ A;  3H6W A;  2FHY A;  4PFR A;  2HHM A;  1IEJ A;  4N6K A;  5CBS A;  2DVZ A;  1DPE A;  5I56 B;  2VGQ A;  2ONS A;  1M5B A;  3H06 B;  4NF6 B;  4PFT A;  4C1T A;  4ZE8 A;  2OWT A;  2ZNT A;  3CVG A;  1T0K A;  1B9J A;  1B52 A;  4JWY A;  1NUZ A;  4F1U A;  3T93 B;  3N5L A;  4ONY A;  4HTG A;  1FBP A;  4ELO A;  4ND9 A;  2QSX A;  2GH9 A;  5KZT A;  1TFA A;  4F1V A;  3TQL A;  3VVD A;  4MLQ A;  1OVB A;  2XXU A;  2YLN A;  2OZZ A;  5J16 A;  3MWB A;  1DCU A;  3I6V A;  3KJT A;  1IUD A;  2Y7P A;  2F3B A;  1B7U A;  4KYE A;  5DW8 A;  4PFY A;  3UK4 A;  4TLM B;  4HXV A;  2B4M A;  1MRP A;  3HN0 A;  4AB5 A;  2O6A A;  1IMD A;  4TQU Q;  4WXJ A;  3BFU A;  1FQB A;  4TOZ A;  2HQ0 A;  4F3G A;  2I0B A;  1UQW A;  5IZ1 A;  1AOV A;  5H8F A;  2G29 A;  1B1X A;  1A8F A;  2ZYK A;  4OVP A;  4H45 A;  4NF6 A;  5ESY A;  1JVX A;  1XHY A;  4X8R A;  2A5T A;  3HHF A;  2O7U A;  4N17 A;  4MF3 A;  4G68 B;  4G77 A;  5FHN A;  2HXR A;  2BJJ X;  4U4S A;  5EQA A;  3HO7 A;  1LCT A;  4O94 A;  1QVS A;  3WAE A;  2I58 A;  1Y4T A;  1QKA A;  4PCD A;  3JZJ A;  3O2A A;  3OEN A;  1XVX A;  2YJP A;  2JJK A;  1FPJ A;  4JWX A;  4F29 A;  3K2D A;  1N76 A;  1DK4 A;  3DP6 A;  1FTJ A;  3ILT B;  2D5W A;  2PBW A;  4GBV A;  1ELJ A;  4I40 A;  3G3J A;  3MJN A;  3K6W A;  4R75 A;  4FE8 A;  3FUZ A;  4O3B A;  1MS7 A;  1P1Q A;  1A54 A;  3OEK A;  3TTM A;  5JTY B;  5I59 A;  1Y4C A;  4PGN A;  3T9U A;  1LBZ A;  5BUU A;  4EQ9 A;  3C9H A;  5HM4 B;  1J1N A;  5B7D A;  3MW0 A;  5I58 B;  2WBB A;  1FTA A;  4U1O A;  3UIF A;  3OMB A;  2V3T A;  2R6G E;  4BLA A;  5I2K B;  5DVJ A; 
#chains in the Genus database with same CATH homology
 1LST A;  3KG2 A;  4EUO A;  1Q35 A;  1CB6 A;  2V93 A;  1JEU A;  5KDT B;  1HSJ A;  1POT A;  1URD A;  2B65 A;  2H5Y A;  2QS3 A;  4ELP A;  3O28 A;  2NUV A;  3LBS A;  1IIT A;  1EH3 A;  1NFT A;  3OEL A;  1N0T A;  1A40 A;  5HBC A;  1D9V A;  5K2X A;  1Y1M A;  1WVJ A;  4PQJ A;  4UA8 A;  3IJO B;  3PV0 E;  1NNT A;  1P1U A;  1VR5 A;  2XX9 A;  4LZ5 A;  2B3F A;  2ONR A;  3UN6 A;  4EF1 A;  2ZYN A;  3ZKK A;  1OQH A;  2PT2 A;  3IOV A;  3RPW A;  3T9V A;  2RIN A;  2Q9T A;  3PPP A;  1H44 A;  3DEL B;  1LAH E;  3DP4 A;  1H3D A;  2OK2 A;  2YPN A;  3L6G A;  3R26 A;  2RC9 A;  4G4P A;  1Y3N A;  5H8F A;  3RT8 A;  3SDF A;  3VVE A;  3ONM A;  5TU0 A;  1Y3P A;  1Z7N E;  4LQ5 A;  3S9L C;  3K02 A;  3GLB A;  2Y7I A;  3TZA A;  4NWC A;  2X7P A;  4H1X A;  3VLU A;  2P0S A;  3CFZ A;  4EXL A;  2A5T B;  2UVG A;  2H98 A;  3QAX A;  3C35 A;  1Y3Q A;  4X1D A;  3RQT A;  5LOM A;  5BWJ A;  3RUM A;  4PFU A;  1I6Q A;  3V89 B;  4F22 A;  4GF8 A;  4R6H A;  3D4G A;  4OEU A;  4NWD A;  4YKP A;  1NNF A;  4I62 A;  5JTY A;  1IXC A;  5KCJ B;  3AXF A;  1GGG A;  1B4H A;  2GHB A;  2IEE A;  3JV9 A;  4IB2 A;  5DVF A;  3FVG A;  1QUL A;  4K3F A;  3TFL A;  1JVY A;  4JSO A;  1B32 A;  1OLA A;  3USD A;  4BDM A;  1JET A;  1GV8 A;  5AA2 A;  2NWJ A;  4OHN A;  5H8F B;  1QUK A;  1LFI A;  1VSO A;  2F36 A;  3MVX A;  3FXU A;  4I1D A;  4LAT A;  4LON B;  4OTE A;  2DS9 A;  4JWO A;  3RY3 A;  3OOA A;  3KJ7 A;  3H6U A;  1KWH A;  5J1D A;  3O6G A;  1B3G A;  3QUF A;  4BDO A;  1IQ7 A;  2VOZ A;  5TP9 A;  3RT6 B;  3PUV E;  3T9X B;  2UYF A;  1MH4 A;  4OXV A;  1UTB A;  4F39 A;  2DYX A;  1B1H A;  1RYO A;  2XXT A;  5EHM A;  1FQF A;  4OEV A;  3MP8 A;  4E0W A;  4RK2 A;  4ZEK A;  4ZE9 A;  1OLC A;  1MXV A;  4ELQ A;  5CC2 A;  3G3I A;  2FA7 A;  1MPC A;  4KPT A;  3VVF A;  1EZP A;  1BTJ A;  3HST A;  1DSN A;  1SYI A;  1UTB B;  2HZL A;  4GOT A;  4GL8 A;  4I8C A;  1SW2 A;  3Q28 A;  2ANJ A;  1UTH A;  2F78 A;  1O63 A;  1AIV A;  1MDQ A;  1LBC A;  4OET A;  1TT1 A;  1LAG E;  3KGC A;  3CG3 A;  3I3V A;  5CMM A;  5DYH A;  1R6Z A;  2I3V A;  4IO2 A;  1B3L A;  2HAV A;  4GFR A;  4P0I A;  2Y7W A;  4H8I A;  4KYD A;  1M5E A;  2DQV A;  3G3G A;  4OES A;  3EPE A;  4TLL B;  3W15 C;  3A3C A;  2F7B A;  2ZYM A;  1SQY A;  3FVK A;  1GR2 A;  1ZBM A;  2HXW A;  5KCJ A;  2XXY A;  1SI0 A;  2OLB A;  4ESW A;  3GBA A;  1S7Y A;  4GXS B;  4R9F A;  4IO6 A;  1I69 A;  3S9M C;  5B70 A;  1F9B A;  4MBP A;  1P1O A;  3MZB A;  2VP1 A;  5AA4 A;  4QF9 A;  1B05 A;  2ZNU A;  4NED A;  2PYY A;  4OQO A;  5H8H B;  4GD5 A;  5TPA A;  3WAF A;  3S9N C;  3HV1 A;  1PB9 A;  4O3A A;  5CI5 A;  3E4R A;  4I9D A;  3OO9 A;  1FQD A;  4KFQ A;  4FAT A;  3MAM A;  2REG A;  1QW0 A;  3VXC A;  1N04 A;  1S50 A;  3G3F A;  4F2Q A;  2DE3 A;  4IO4 A;  1LBB A;  2ALU A;  3SEU A;  1MQI A;  1WOD A;  2RCB A;  1BKA A;  1IXG A;  3RN8 A;  4DZ1 A;  2F5X A;  4WKM A;  1EZ9 A;  2P1S A;  2A5S A;  2F8D A;  1P99 A;  5ELV A;  3C31 A;  3CG1 A;  3K01 A;  1XT8 A;  1US5 A;  1IXH A;  4ZED A;  1B2H A;  3TOD A;  2I0C A;  3CI8 A;  2F97 A;  4MFI A;  5I2N A;  4WED A;  1MY0 A;  1XS5 A;  3SEX A;  1P1N A;  3PUX E;  2I49 A;  3G3K A;  1SW5 A;  3L6H A;  1B6H A;  2G93 A;  2XD2 A;  1MY4 A;  3O66 A;  3QSL A;  2OCU A;  4H6D A;  4IGT A;  3C34 A;  4NF4 A;  4DXB A;  5AA1 A;  3FGS A;  5I58 A;  3A3U A;  1Q1K A;  4M1V A;  4KHZ E;  3TTK A;  4FAJ A;  4EF2 A;  2PMS A;  2VD3 A;  3KSJ A;  4XKR A;  5K2Y A;  4BDR A;  1S9T A;  4DCY A;  4HS7 A;  4X48 A;  2QS4 A;  4KQP A;  3B6W A;  3LSF B;  4YB5 A;  2WKY A;  1A8E A;  4OFJ A;  1B58 A;  1BP5 A;  3FVO A;  4FEB A;  4KD5 A;  5H8Q A;  3CR9 A;  5L9M A;  4WEP A;  1I6B A;  3TMG A;  3VLW A;  5JK4 A;  3OD7 A;  3CSB A;  3LSL A;  1AL3 A;  2REJ A;  3N6U A;  1HSE A;  3TCH A;  3K1N A;  1SW1 A;  1EU8 A;  4GQO A;  3KN8 A;  1ZU0 A;  3B6T A;  1IXI A;  4IY5 A;  3FIR A;  4G68 C;  4THI A;  4G2Z A;  4FEC A;  3OO7 A;  4RXL A;  4U22 A;  2XD3 A;  4G68 A;  3OO6 A;  5F7V A;  2O7I A;  2QMX A;  3C33 A;  1FQC A;  2OBG A;  2RC7 A;  2ZNS A;  2XXV A;  2HZK A;  2O51 A;  3I5O A;  4JXI A;  1MM7 A;  3FXR A;  1R9Q A;  1US4 A;  4YZZ A;  3T66 A;  4H8J A;  3UP9 A;  5AE4 A;  1YAE A;  3M8U A;  4GLI A;  2I48 A;  3IX1 A;  4YB7 A;  3PGF A;  2AL4 A;  4OWD A;  3BBR A;  1PBQ A;  3B6Q A;  4XTC Q;  5DVI A;  2DWJ A;  1VFD A;  3U93 A;  2DWH A;  3IOW A;  4Q30 B;  3D4C A;  3IO6 A;  4FOR A;  5EYF A;  3MVZ A;  2LAO A;  3CFX A;  3EHT A;  1M5F A;  3FZV A;  3T96 B;  4JB7 A;  2V3U A;  4R72 A;  4U23 A;  5AA3 A;  3HHG A;  4DXU A;  5I84 A;  1LB9 A;  1PBP A;  3K4U A;  2QJE A;  2XXH A;  3O9P A;  1Y20 A;  5DT6 A;  2W7Y A;  1B3E A;  1MG1 A;  2CMO A;  1B5J A;  2O1L A;  1SD3 A;  1B51 A;  4XXU A;  4KR5 A;  3K6X A;  1DTZ A;  1XVY A;  1RYX A;  3IOU A;  5CM6 A;  4P11 A;  3KZG A;  2Q2C A;  4O3C A;  1MQJ A;  1MH3 A;  3TCF A;  2B3B A;  1MXZ A;  2PT1 A;  3IL1 B;  3M3L A;  4R6K A;  3SEV A;  5FHM A;  5FTI A;  4M4G A;  2V25 A;  4POW A;  3MC2 A;  3PPO A;  1NMU A;  3PD9 A;  5H8N A;  3H6V A;  2ESN A;  4R73 A;  2PVU A;  3M3F A;  3K6U A;  4RA1 A;  3TTL A;  2E1S A;  1PC3 A;  1R9L A;  2FYI A;  3H7M A;  3W9V A;  2NXO A;  1Y1Z A;  4EQB A;  2RC8 A;  4ECF A;  3T22 A;  4P0G A;  1GTK A;  3OEM A;  2CZL A;  4NE4 A;  3KFM A;  3O6I A;  5CRY A;  1ZMG A;  3SET A;  1A55 A;  4LVQ A;  3RGY A;  3IO4 A;  5HPQ A;  2NVU B;  1PEB A;  3TAJ A;  1TXF A;  1JW1 A;  3OO8 A;  3PPQ A;  2Y7R A;  4EDP A;  3R7X A;  1OIB A;  2Q8J A;  4RK9 A;  3V8X B;  3IB0 A;  2HEU A;  1AMF A;  1FW0 A;  3QXM A;  4G8M A;  5CMK A;  4H0W A;  4YMB A;  2UVH A;  4IO5 A;  4H67 A;  1II5 A;  3IB2 A;  4OZ9 A;  4Q0C A;  3UOR A;  4F31 B;  5H8N B;  3QUJ A;  3FXQ A;  1YCJ A;  1NH7 A;  3RLF E;  4NTL A;  2XXP A;  4QFL A;  1LAF E;  4Q5T A;  5H8Q B;  4ZEB A;  4EXK A;  3K6V A;  1MQD A;  4JSD A;  4BDL A;  3HCQ A;  3IK6 B;  3MP6 A;  3KN3 A;  4MH5 A;  2R9J A;  4PFW A;  1POY 1;  4PP0 A;  2M8C A;  1Z7M E;  2ABH A;  4YAH X;  5EHS A;  1B0H A;  3KSX A;  3N6T A;  1H76 A;  4MLV A;  3RTW B;  2VD2 A;  4NF5 A;  1M5C A;  1USY E;  4NMY A;  1UTH B;  1UIU A;  3U8Q A;  4UAC A;  1FTL A;  3H03 A;  3C36 A;  1SI1 A;  4N6P A;  3OXN A;  4OMB A;  4QHQ A;  1MY1 A;  3MPL A;  4FJP A;  3VLV A;  1VE4 A;  4DXC A;  3EF7 A;  2OWS A;  4ZEC A;  1RKM A;  1N3W A;  3Q25 A;  1P1W A;  5KDT A;  4YKI A;  1JW5 A;  5I2N B;  1IZ1 A;  1FTK A;  2X7Q A;  4YU0 A;  1DTG A;  3FJM A;  3K1M A;  3QYT A;  1FTO A;  4OYV A;  5CMC A;  3K0V A;  1N84 A;  3N26 A;  3PUY E;  4LZ7 A;  5ITO A;  3SER A;  3O97 A;  1B3H A;  2UVJ A;  2V84 A;  4H65 A;  4OVJ A;  4ZZE A;  4JDF A;  5ISU A;  4RPO A;  1LCF A;  3FV1 A;  4NF5 B;  2F7C A;  3H6W A;  2AIX A;  2DSF A;  3MPK A;  4R2B A;  3S4U A;  2QS2 A;  3LC8 A;  4QFK A;  1B0L A;  4U4X A;  1IEJ A;  3PMV A;  4G8H A;  1YTV A;  2XX8 A;  4OFO A;  4YKK A;  3BKI B;  3THI A;  5CBS A;  2AYS A;  4QFP A;  1B5H A;  3TTR A;  2DVZ A;  3U72 A;  3IJX B;  1DPE A;  4ISU A;  3SEY A;  1TWY A;  1LAX A;  3MQ9 A;  5H8H A;  5TPA B;  3UA8 A;  4GRK A;  3V5A A;  1M5D A;  1ZIU A;  3JYR A;  5DEX B;  5I56 B;  3Q29 A;  2VGQ A;  4F19 A;  2QMW A;  5CMB A;  2ONS A;  5I59 B;  1M5B A;  1MY2 A;  4DDD A;  3H06 B;  2XHD A;  3S2V A;  1IIW A;  4ZDM A;  4NF6 B;  4PFT A;  4C1T A;  4ZE8 A;  4Q8R A;  4GVO A;  2IA4 A;  2VHA A;  1QJM A;  2AL5 A;  2OWT A;  2UVI A;  2XXW A;  1LB8 A;  2ZNT A;  3BFT A;  3CVG A;  4R74 A;  1GVC A;  5ITP A;  5L9O A;  4YB6 A;  1B9J A;  1B52 A;  1T0K A;  1R1N A;  1SVX B;  4QFN A;  3V83 A;  1O7T A;  3FJG A;  4GWO A;  4JWY A;  4R9G A;  3ILU B;  4YKJ A;  3G7W A;  4F1U A;  3LSX A;  2ONK E;  3T93 B;  2Y7K A;  1MPD A;  1YPN A;  3QIM A;  3ZS6 A;  4DIG A;  1ANF A;  5DVJ A;  4C0R A;  5JEI A;  3EN3 A;  3CSG A;  3N5L A;  3LUY A;  2D3I A;  4LZ8 A;  3GXA A;  4ONY A;  4HTG A;  4QSD A;  1XOC A;  2O68 A;  2H4I A;  2F6P A;  4XKQ A;  3FV2 A;  4ND9 A;  5M2V A;  4C1U A;  2I3W A;  3QK6 A;  5H8S A;  4ELO A;  1H43 A;  2GH9 A;  2QSX A;  5AA4 B;  2QS1 A;  2ZYO A;  3HPI A;  5KZT A;  2E0S A;  2RKM A;  1TFA A;  4F1V A;  3TEP A;  3EHU A;  3VDF A;  2O84 X;  4JBZ A;  3E9X A;  3TQL A;  3ECR A;  3S9E A;  4F3S A;  5AA2 B;  3VVD A;  1FTM A;  1MM6 A;  2Q2A A;  4MLQ A;  1OVB A;  2OJT A;  1XC1 A;  2XXU A;  3FVN A;  1FCK A;  4IY6 A;  5FHO A;  1MXX A;  1L5T A;  1DPP A;  2YLN A;  3PUW E;  4X9T A;  1MPB A;  2QL3 A;  4N13 A;  3H4Z A;  2I4B A;  1LFH A;  2OZZ A;  5L8D A;  1VFE A;  5DEX A;  4GIZ A;  2DXR A;  1LFG A;  4XIG Q;  1B7Z A;  1B3F A;  3E3K A;  3SEW A;  3MWB A;  3PD8 A;  2FNC A;  4IO3 A;  3GBB A;  3I6V A;  4X1B A;  3KJT A;  1NNP A;  1IUD A;  2Y7P A;  3DP8 A;  4L17 A;  3IOR A;  4KYE A;  1B7U A;  4ZEF A;  3P7I A;  4PFY A;  3IAZ A;  2GHA A;  2RF1 A;  2HFB A;  2UYE A;  2V3Q A;  4KCC A;  1DMB A;  3UK4 A;  3MVY A;  4TLM B;  5A5X A;  2HCA A;  3PUZ E;  1PDA A;  2I6E A;  4F3P A;  1MQH A;  1MRP A;  3HN0 A;  3PPN A;  1ATG A;  2O6A A;  3OSR A;  4AB5 A;  5CBR A;  4TQU Q;  1ZTY A;  3H3G A;  4Z0I A;  4LUB A;  4WXJ A;  4LA9 A;  3BFU A;  2HAU A;  3FJ7 A;  5AA2 D;  3Q26 A;  5I2K A;  2Z22 A;  1SW4 A;  1FQB A;  1N3X A;  1DOT A;  2HQ0 A;  3IOT A;  4PE5 B;  3DLN A;  4TOZ A;  1UIV A;  3TPA A;  4F3G A;  5TP9 B;  2NOO A;  1A99 A;  3K1P A;  2I0B A;  1UQW A;  3T9H B;  5IKB A;  1B4Z A;  4XKN A;  1AOV A;  1HSL A;  4OFL A;  3SES A;  3CRB A;  2G29 A;  1B1X A;  3UGW A;  1A8F A;  4F2O A;  2ZYK A;  2O1M A;  2F6G A;  3H6T A;  4XKP A;  3VE1 B;  3PMX A;  3VXB A;  1CE2 A;  2F35 A;  4NF6 A;  2P2A A;  4ZEI A;  3R6U A;  4PET A;  2H99 A;  3MUQ A;  4QFO A;  3GZG A;  5FTH A;  4F18 A;  1A7L A;  1MXW A;  1JEV A;  1JVX A;  1OVT A;  1XHY A;  4F3B A;  5I56 A;  1OMP A;  1NL5 A;  2A5T A;  1B7H A;  3HHF A;  2O7U A;  1B40 A;  3TTN A;  4Z7E A;  3W9W A;  4ESX A;  1N7X A;  2DWI A;  4N07 A;  3IR1 A;  3CIJ A;  4RPN A;  4HW8 A;  1URG A;  1OQG A;  4KI0 E;  1WDN A;  3CFL A;  4H5F A;  4LQ2 A;  4MF3 A;  4G68 B;  2THI A;  4G77 A;  5FHN A;  3EHS A;  1JW4 A;  2BJJ X;  3EQ1 A;  3MP1 A;  4FED A;  2H9B A;  4RYA A;  1PB7 A;  3O6H A;  4G8N A;  2D21 A;  4GL0 A;  4U4S A;  4EQ7 A;  1PB8 A;  4DE8 A;  3M3K A;  1ZLQ A;  2Z23 A;  2KLF A;  4OER A;  2Q88 A;  3B7D A;  5L9S A;  3TYH A;  5A5X B;  3HO7 A;  1BLF A;  3TKD A;  1D4N A;  2DVC A;  1LCT A;  4POX A;  2DWA A;  1SDX A;  5IAI A;  3FAT A;  1QVS A;  1O64 A;  3MZ1 A;  3WAE A;  4ZS9 A;  2I58 A;  1QUI A;  4ZZA A;  4H5G A;  1Y4T A;  2PX1 A;  3MBP A;  3KEI A;  1LLS A;  1QKA A;  3G3H A;  1MXY A;  3F11 A;  3LR1 A;  1BIY A;  3KN7 A;  4NF8 B;  5ICQ A;  4U2R A;  3ZKL A;  4BDN A;  4AQ4 A;  3JZJ A;  3O2A A;  1JNF A;  1Y9U A;  4RNS A;  3VFJ A;  3U92 A;  4BDQ A;  3OEN A;  2XXQ A;  5I57 A;  1D3K A;  1NKX A;  1URS A;  1XVX A;  2DXY A;  2GRV A;  2YJP A;  3K00 A;  1NH8 A;  3N94 A;  4JWX A;  4NF8 A;  4F29 A;  3TUS A;  3MVW A;  3E13 X;  4YIC A;  2RCA A;  3K2D A;  3VV5 A;  3RNN A;  1N76 A;  3KOT A;  4KCD A;  2GFE A;  3DP6 A;  2XX7 A;  3A09 A;  1FTJ A;  2XXI A;  3ILT B;  4RJZ A;  2Z8E A;  5F1Q A;  3ZSF A;  2D5W A;  2PBW A;  4QSC A;  1NNK A;  2O69 A;  3TCG A;  1ELJ A;  1ZJL A;  3SKP A;  3G3J A;  3MJN A;  3K6W A;  3MZ9 A;  4R75 A;  2Z8F A;  1JQF A;  4RY1 A;  4FE8 A;  3TQW A;  4R2F A;  3FUZ A;  4O3B A;  1MS7 A;  1P1Q A;  1A54 A;  3FD3 A;  3PU5 A;  1USY H;  3OEK A;  1N7W A;  3C32 A;  4IO7 A;  3TEL A;  4E0X A;  3TTM A;  4ELR A;  1QKB A;  5ICT A;  3Q27 A;  5JTY B;  1I6A A;  5I59 A;  1B5I A;  1Y4C A;  1SYH A;  3IB1 A;  3T9U A;  2QPQ A;  4DCX A;  1ZKB A;  3OSQ A;  5BUU A;  1LGB C;  1FQE A;  5DTB A;  2F7A A;  2QRY A;  1H45 A;  4EQ9 A;  4QSE A;  1AH5 A;  1D9Y A;  4LP2 B;  1EZO A;  2Y84 A;  3C9H A;  2DE2 A;  4U1Z A;  4HCY A;  1SBP A;  1J1N A;  5HM4 B;  2Z8D A;  2X26 A;  2DP8 A;  3PMW A;  2Q89 A;  2I4C A;  3O29 A;  4HCW A;  3RTF B;  2F34 A;  4OEN A;  1MDP 1;  3C4M A;  3TDJ A;  3U94 A;  1B46 A;  4F1Y A;  4YMA A;  5I57 B;  4QRZ A;  4KYS A;  3KBR A;  2XXX A;  5B7D A;  2R71 A;  4FIM A;  2ZXT A;  1MXU A;  1MY3 A;  2XXR A;  4AB6 A;  4R6Y A;  1MQG A;  2H25 A;  3KOS A;  3ODB A;  3MW0 A;  5I58 B;  3LSW A;  4NF4 B;  1QUJ A;  2ZMB A;  4U1O A;  3UIF A;  4GXA A;  3OMB A;  2DE4 A;  2V3T A;  2R6G E;  3PPR A;  4IGR A;  4U21 A;  3U1O A;  1TFD A;  2DOJ A;  3DM0 A;  4BLA A;  2UXA A;  5I2K B;  4DLD A;  3FAS A;  1FQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...