2F97A

Effector binding domain of benm (crystals generated from high ph conditions)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
216
Chain Sequence
EKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator benM
publication title Oligomerization of BenM, a LysR-type transcriptional regulator: structural basis for the aggregation of proteins in this family.
pubmed doi rcsb
source organism Acinetobacter baylyi
total genus 72
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f97A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f97A02
4BDLA 1B7HA 1MY3A 4F29A 4EF1A 5AA4A 3N6UA 4HW8A 4MLVA 3RLFE 3DM0A 3F11A 2DWAA 2XXIA 4ZZEA 3TQLA 1EZPA 3TTLA 4DCYA 3S9EA 3G3KA 2QL3A 2REJA 2I0CA 3HCQA 3SEXA 4M1VA 1H44A 1ZBMA 1O64A 5I58A 3K0VA 2ZNTA 4IGTA 4F1YA 3MQ9A 4H5FA 3MPLA 1XC1A 4MFIA 2F97A 4ZS9A 4O3CA 3TEPA 3MZ9A 3C32A 5DYHA 4F19A 1SW1A 1HSJA 1B40A 3D4GA 3CR9A 4PFUA 2UVIA 1QUKA 3O97A 2QMWA 5KDTB 3K6VA 1XHYA 3IB0A 2I4BA 1Y4TA 3M3FA 2NOOA 1N3WA 3A3UA 2Z23A 3QXMA 4FJPA 3SERA 1MQGA 3MBPA 1NNTA 3M8UA 1Y4CA 2XD3A 3G3JA 3CG3A 2Z8EA 3VV5A 3H6UA 3IO6A 3KSJA 2F5XA 2ZMBA 4POWA 4QFKA 1HSEA 4RNSA 5AA4B 2UVGA 5FHNA 3IK6B 4U22A 4BDMA 1AL3A 4WEPA 5ICQA 3RQTA 2D3IA 2VOZA 4U4SA 4PQJA 2HAUA 3O6IA 4YAHX 1S50A 5H8HB 5CMBA 3TCFA 4U4XA 4EQ7A 1ZJLA 3PMVA 3B6QA 4OESA 2QSXA 3T9VA 1EZ9A 5KCJB 2FYIA 3OELA 3OO6A 3ECRA 1MXVA 3CFXA 1LB9A 2XX8A 3SESA 3BBRA 3HHGA 3TFLA 1AOVA 1LB8A 2G29A 5TP9B 3QUFA 4X1BA 3OXNA 4F2QA 2QMXA 3O6GA 3ILTB 1MPBA 2QPQA 3VVDA 3K6UA 3MPKA 2Y7KA 2VGQA 4XXUA 3TZAA 5CMMA 2DWHA 5IKBA 1Y3QA 3MVXA 1JEUA 3N94A 2X26A 2VD3A 4ELQA 2D21A 5H8NB 4C0RA 3KOSA 4O3AA 5CMKA 3WAFA 4DXCA 4Q8RA 3LSLA 4H67A 3EHSA 3I5OA 4KYEA 1FCKA 4ESWA 1URSA 4JWOA 3MAMA 1IEJA 4JSDA 4G8MA 2OWSA 4G4PA 2QRYA 3OSQA 3M3KA 4F22A 3G3FA 3LR1A 4NF6A 1ELJA 5TPAB 4NTLA 1MQDA 4GRKA 4NWCA 1UTHA 2HXWA 1IZ1A 4FE8A 4EXLA 1FTOA 1NNFA 3RTWB 4WKMA 1N7XA 1B5IA 2O51A 1P1UA 5DT6A 3GBAA 1URGA 3H03A 3MW0A 2H9BA 2GFEA 2XXUA 2B65A 2O6AA 2Z22A 1PB8A 4IY5A 3H6WA 4NF8A 3IAZA 3FATA 3OMBA 1QJMA 4E0WA 1MXWA 2F7CA 2F7AA 2DE3A 2YPNA 2XXHA 3TYHA 4RK9A 3ONMA 3E4RA 2F6PA 5AA2D 3OSRA 1WDNA 3TTRA 1Z7NE 4NF6B 2AYSA 1MQJA 3TTNA 3IOVA 3VXCA 5I57B 2RF1A 3ZKKA 3TTMA 1B3GA 2NUVA 1HSLA 2FNCA 2X7PA 1D4NA 3R6UA 3FZVA 2QS2A 5AA2A 3PD8A 1LAGE 1LSTA 4AB5A 1ATGA 4N6PA 1M5DA 3IO4A 3O66A 5AA3A 1OQHA 1MM6A 4YICA 1B3HA 1N84A 1YCJA 2XX9A 4U1OA 3RY3A 2KLFA 3RN8A 3PUZE 3C4MA 3N6TA 1QVSA 3HO7A 2OJTA 3FJMA 1VE4A 3CRBA 5TU0A 4THIA 2DS9A 4H8JA 2V3TA 4HCYA 4FEBA 4RK2A 5CRYA 3OO9A 4KR5A 4G8HA 3H6VA 3ZS6A 3FXQA 4LZ5A 4TOZA 2Q89A 2XXYA 2R9JA 4Q30B 1FQDA 3KN8A 2O69A 3L6GA 4LQ2A 3EF7A 4F31B 3FJ7A 1MXUA 1JW4A 2OK2A 4EUOA 2RINA 2RC7A 4OMBA 1BP5A 1CB6A 1JEVA 3G3IA 4TQUQ 1MG1A 3TUSA 3DP6A 5ICTA 1B0LA 2Q8JA 1N76A 1QKAA 1RYOA 1XS5A 5JTYB 3M3LA 3TCHA 5AA1A 1QUIA 1LBCA 4ZEIA 2DVCA 4G2ZA 2V3UA 1MQHA 3ZKLA 3BFTA 2VD2A 1FQBA 1FTKA 3IOUA 3VLVA 1J1NA 1D9VA 1II5A 4ZDMA 3FJGA 4FECA 3S9MC 2ZXTA 3TKDA 2UXAA 4IO4A 5CBRA 3T9HB 2CZLA 3VVEA 2F6GA 1LAXA 1O63A 1POTA 2OLBA 4QRZA 4Q0CA 4DLDA 4GFRA 3HV1A 2RCBA 3K01A 3VVFA 1SDXA 2ZYKA 5BUUA 2O84X 3FV1A 3PPOA 2H25A 1H43A 2VP1A 4YB6A 1ZIUA 1UIVA 1H45A 1L5TA 5I59B 3U94A 1BKAA 3IB2A 3HPIA 4OETA 2RC9A 5K2YA 4BDNA 1OVBA 3O2AA 3S4UA 3KG2A 1GVCA 5KDTA 4KCDA 2CMOA 1M5FA 1T0KA 5JK4A 1B5JA 3SKPA 2R6GE 3MVYA 4GIZA 3C36A 5L9OA 5DVIA 2Y7IA 4GF8A 1DPEA 1M5CA 1Y20A 3O29A 2GH9A 2DXRA 4KYSA 3TDJA 3H3GA 1XOCA 4ESXA 5H8HA 1LCTA 2P0SA 2Y84A 2Y7PA 4IO3A 4GXAA 4G8NA 4N13A 3R7XA 5H8QA 1KWHA 1MY4A 3MVWA 3U1OA 4IO7A 3B7DA 3ODBA 1LFGA 5KCJA 1B4HA 1N3XA 3K6XA 3OENA 1B2HA 3IB1A 5TP9A 3V5AA 3OEKA 4ONYA 3FIRA 3SEUA 1R9LA 3FXUA 4H1XA 3IJXB 4WEDA 4UA8A 1R9QA 5J1DA 3C9HA 1JVXA 2OCUA 3OD7A 3AXFA 1TFAA 4AQ4A 1Z7ME 4LA9A 4FIMA 2FA7A 1PC3A 4JBZA 4EQ9A 4R2BA 3KJ7A 1ZLQA 1SW2A 3OOAA 5A5XA 2HCAA 3T9XB 3RGYA 2RKMA 5H8NA 3TCGA 1R1NA 1URDA 1B1HA 1IXHA 1SW5A 3KEIA 4H8IA 1LAHE 4F1VA 3K00A 5H8QB 3FASA 3JYRA 4XKQA 5L9MA 3PPQA 1BIYA 1BLFA 1XT8A 4ELOA 4GL0A 2LAOA 2I3VA 3SEYA 1VFEA 3VDFA 4ZE8A 1FTMA 4YZZA 5TPAA 1PBPA 4IY6A 1P1NA 1MQIA 4GXSB 1S9TA 4PFYA 3KSXA 4NF4A 3T93B 3V89B 1ZU0A 4PETA 1UIUA 2O1MA 2HEUA 1D9YA 2Q9TA 1I69A 5LOMA 1OQGA 5A5XB 3VLWA 3FUZA 3CG1A 3HN0A 2XXWA 1MS7A 4RYAA 4QHQA 4NF5B 4DDDA 1SD3A 3I3VA 1GGGA 1P1WA 1VFDA 1IXIA 2I58A 3RT6B 3K02A 2H98A 3THIA 3UA8A 3FVOA 1USYH 3Q27A 1A8EA 1MPDA 2OZZA 3EHUA 3IORA 2O7UA 1FQEA 2I0BA 4R73A 5I57A 2HQ0A 1TWYA 1B3FA 1XVYA 1OVTA 3HHFA 3KN7A 4Z7EA 1MY2A 4NF4B 3KJTA 4ISUA 4QFNA 4GOTA 1P1QA 1JETA 3EPEA 2THIA 4TLLB 2GHAA 4XKPA 1YTVA 2Q88A 3DP8A 3RUMA 3T66A 3QSLA 4I8CA 4ZEDA 3H6TA 4LVQA 1USYE 2QJEA 2AL5A 2Y7WA 3E13X 2ABHA 4ZE9A 1IXGA 4OERA 4Z0IA 3SDFA 1EZOA 4F3GA 4LONB 1B9JA 5EHSA 3PPNA 3DP4A 5F7VA 3P7IA 4YKIA 3KFMA 3E3KA 3FD3A 4RPNA 1Q35A 1IQ7A 1ZMGA 5I56B 3PPPA 2DXYA 3VXBA 1M5EA 1B05A 3UGWA 2Q2CA 2F78A 3S9NC 4GL8A 2DOJA 5ITOA 3ILUB 1NKXA 3V8XB 4RXLA 3O9PA 1A99A 4R9GA 4TLMB 2HFBA 2M8CA 4QFLA 1Y9UA 4G68A 4XIGQ 5JTYA 4EQBA 3LSXA 3UP9A 4RY1A 1GV8A 2DSFA 1SVXB 1B58A 3UK4A 1NNPA 1WVJA 2IA4A 3MP8A 2DE4A 4YMAA 4KD5A 5FHMA 3W9WA 1SQYA 3S9LC 2R71A 1PEBA 4R6YA 4ZEKA 3PGFA 3G3GA 2DP8A 1N0TA 3WAEA 3H4ZA 1I6BA 3I6VA 4DE8A 5I2KB 1A40A 4FATA 4QF9A 5ELVA 4F3SA 3GBBA 1VSOA 3LSWA 4HS7A 3PMWA 5I59A 2PVUA 2NWJA 4YMBA 4GD5A 3O28A 5JEIA 3KZGA 4G68B 4OEUA 4OENA 5M2VA 4PFWA 4OVJA 2AIXA 1DSNA 4OFOA 1Y3NA 2PT2A 2XHDA 3SEWA 1MDQA 3VE1B 1F9BA 3SEVA 1SYIA 2QS1A 3W15C 1N7WA 2UYEA 4JWXA 1JVYA 2RCAA 2XXRA 2I48A 5FTHA 3CVGA 1DTZA 4PFTA 2O1LA 2F36A 1Q1KA 3HSTA 1MY1A 5K2XA 2YLNA 2QS4A 4RA1A 1SBPA 4HCWA 3FGSA 2BJJX 4ZZAA 3IL1B 4AB6A 1PBQA 4ECFA 4NE4A 4LP2B 1CE2A 1IXCA 2NXOA 2DWIA 2B3BA 3CFZA 2H5YA 4DZ1A 3U92A 4R75A 3Q25A 4P0IA 4KFQA 1B6HA 3TQWA 3TAJA 4C1UA 1B7UA 1MY0A 4I9DA 3K1MA 2ZYMA 4OYVA 1B3EA 1OLAA 1PB9A 4UACA 3PU5A 2ZYNA 2PMSA 4PP0A 3C33A 4IGRA 1WODA 1MPCA 4P11A 3TTKA 2ESNA 1QUJA 3OO8A 2H4IA 1NMUA 3A3CA 2XXPA 3RNNA 3W9VA 5I2NB 2UYFA 5DEXA 3DELB 2PYYA 3D4CA 1AH5A 1FTLA 4R2FA 4WXJA 4OWDA 4KQPA 1AMFA 4YKKA 4H5GA 3FVKA 1B7ZA 4DCXA 4ELPA 3V83A 4QSEA 4FEDA 4ND9A 1TFDA 3TMGA 5DTBA 2XXQA 3K2DA 3RPWA 1MDP1 4H0WA 3O6HA 3FV2A 4QFPA 2B3FA 4XKNA 4X48A 3KN3A 3JZJA 4P0GA 4XKRA 4K3FA 3PD9A 3OEMA 5H8FB 1H3DA 3CSGA 4XTCQ 4ZECA 3MZBA 4OEVA 5I84A 4Q5TA 4MF3A 1OMPA 2UVHA 4NMYA 1UTBB 2E0SA 2I4CA 3B6WA 2WKYA 1FQAA 5CM6A 3BKIB 1LBBA 5KZTA 2V93A 3RT8A 2XD2A 3KGCA 5DEXB 1MH3A 4F2OA 1H76A 1VR5A 1LLSA 1LFHA 2W7YA 3T9UA 1JQFA 3IR1A 4NF5A 1IUDA 5B70A 2OBGA 2P1SA 3USDA 4BDQA 5L8DA 4KYDA 2OWTA 3PUYE 2F35A 5ITPA 5EYFA 2I6EA 2O7IA 2VHAA 4YU0A 2GHBA 1DOTA 3MP6A 4I1DA 1SW4A 3C34A 4YKJA 1OIBA 3QAXA 2GRVA 4QFOA 5I58B 2DQVA 3LC8A 2I3WA 1P1OA 5FTIA 2H99A 3GZGA 4QSDA 1S7YA 2P2AA 4IO5A 5DVFA 4G77A 1P99A 3T96B 4YB5A 1JW5A 1SI1A 4IO6A 2I49A 1GTKA 4GQOA 4OZ9A 4G68C 2NVUB 1NL5A 2G93A 1AIVA 1R6ZA 3LSFB 2DE2A 1B0HA 3MVZA 2ZNUA 3QK6A 1EH3A 5IAIA 2UVJA 4ZEBA 2X7QA 2ZYOA 1B32A 3VFJA 5CBSA 4JXIA 1DTGA 3K1NA 4GLIA 1SYHA 3CSBA 5I56A 4H6DA 4KCCA 3KOTA 3E9XA 4OHNA 3PUVE 4H65A 3PMXA 4L17A 4LZ7A 2XX7A 1YAEA 2Z8DA 2DVZA 1TT1A 4R72A 5AE4A 5B7DA 1B5HA 2F34A 4BDOA 4NEDA 2Y7RA 2XXVA 4LQ5A 2PBWA 2F7BA 3TELA 3EHTA 3FVNA 1LFIA 3U8QA 4EXKA 1NNKA 3MP1A 1O7TA 3A09A 4R6HA 1ZKBA 1B4ZA 3VLUA 1ANFA 4KI0E 4KPTA 4PE5B 4RJZA 2V3QA 3PUXE 4F3PA 3OO7A 3QUJA 4YKPA 1GR2A 1POY1 1TXFA 4N07A 3N26A 2A5TA 1N04A 5HBCA 3ZSFA 1MRPA 1PB7A 4X9TA 5ISUA 3LBSA 4YB7A 2V84A 4U2RA 1US4A 1IIWA 2HZLA 1LCFA 4IB2A 4POXA 4F3BA 1DMBA 4GWOA 1B52A 5CMCA 3K4UA 1FQCA 2F8DA 4JWYA 4LZ8A 4EF2A 5F1QA 3KBRA 4BLAA 5HM4B 1NH8A 5I2KA 2HAVA 3PUWE 3PV0E 3TPAA 3C35A 3UN6A 3CI8A 3RTFB 5HPQA 4OTEA 3R26A 4X1DA 1MXYA 1UTHB 3MUQA 4ZEFA 3GXAA 2PX1A 3H06B 3QIMA 4DIGA 4DXBA 4QSCA 1A54A 4BDRA 2DYXA 1US5A 5FHOA 3CIJA 3JV9A 4R6KA 1PDAA 2HZKA 1UQWA 5BWJA 2A5TB 4HTGA 3IX1A 3PPRA 2QS3A 3S2VA 4NF8B 3N5LA 4LATA 1MM7A 1LGBC 1LAFE 1B3LA 2YJPA 4IO2A 1B51A 4R74A 1MH4A 3U72A 2XXXA 3G3HA 4I62A 2ONKE 4JSOA 4FORA 3MZ1A 3UORA 1FTJA 2Z8FA 2AL4A 3B6TA 4MLQA 1A55A 1B46A 4FAJA 1FW0A 2E1SA 1QW0A 3CFLA 1A8FA 1ZTYA 1JW1A 1YPNA 4JDFA 1JNFA 3QYTA 2V25A 1MXXA 1SI0A 3MJNA 1I6AA 5EHMA 3H7MA 3DLNA 3Q29A 4MBPA 3BFUA 5AA2B 1FQFA 1IITA 4EDPA 1M5BA 4ELRA 4GVOA 3EQ1A 2ALUA 3TODA 2ONSA 3C31A 3U93A 4F39A 1OLCA 4F1UA 4U21A 3IJOB 3K6WA 4OFLA 5DVJA 3MWBA 4E0XA 5I2NA 3Q26A 1NFTA 1QKBA 2DWJA 4U1ZA 4F18A 2ZNSA 2ANJA 1QULA 4NWDA 1BTJA 3UIFA 5H8SA 3G7WA 1Y1MA 3GLBA 4KHZE 4U23A 2Q2AA 4MH5A 2A5SA 4M4GA 4O3BA 1EU8A 2D5WA 4OQOA 4OXVA 3T22A 3FVGA 1MXZA 4JB7A 1NH7A 1B1XA 2ONRA 5CC2A 1A7LA 3EN3A 4R9FA 3K1PA 3IOTA 2XXTA 3Q28A 5H8FA 2PT1A 3LUYA 1RYXA 4RPOA 1Y3PA 4DXUA 1XVXA 1RKMA 2O68A 3L6HA 3MC2A 5L9SA 1I6QA 2RC8A 3FXRA 4OFJA 1UTBA 1Y1ZA 1D3KA 4C1TA 3SETA 2REGA 4LUBA 2IEEA 1DPPA 3IOWA 5CI5A
chains in the Genus database with same CATH superfamily
4BDLA 1B7HA 1MY3A 4F29A 4NF0A 4EF1A 5AA4A 2CZIA 3N6UA 4HW8A 4MLVA 3RLFE 1XI6A 3DM0A 2DWAA 2XXIA 3F11A 4ZZEA 3TQLA 1EZPA 3TTLA 4DCYA 3S9EA 3G3KA 2QL3A 2REJA 2I0CA 3HCQA 3SEXA 1FPLA 4M1VA 1H44A 1FPGA 4JVCA 1ZBMA 1O64A 5I58A 3K0VA 2ZNTA 4IGTA 4F1YA 3MQ9A 4H5FA 1NUXA 3MPLA 1XC1A 1EYIA 4MFIA 1LBXA 2F97A 4MIJA 4ZS9A 1FBFA 4O3CA 3TEPA 3MZ9A 3C32A 5DYHA 4F19A 1SW1A 1HSJA 1B40A 3D4GA 3CR9A 3E79A 4PFUA 2UVIA 1QUKA 3O97A 2QMWA 5KDTB 3K6VA 1XHYA 3IB0A 2I4BA 1Y4TA 3M3FA 5IZ1A 2NOOA 1N3WA 3A3UA 2Z23A 3QXMA 1NV3A 4FJPA 3SERA 1MQGA 3MBPA 1NNTA 3M8UA 1Y4CA 2XD3A 3G3JA 3CG3A 2Z8EA 3VV5A 3H6UA 3IO6A 3KSJA 2F5XA 2ZMBA 4POWA 4QFKA 1HSEA 4RNSA 5AA4B 2UVGA 5FHNA 3IK6B 4U22A 4BDMA 1LEVA 1AL3A 4WEPA 5ICQA 3RQTA 2D3IA 2VOZA 1NV6A 4U4SA 5IZ3B 4PQJA 2HAUA 3O6IA 4IR8A 4YAHX 1S50A 5H8HB 5CMBA 3TCFA 4U4XA 4EQ7A 1ZJLA 3PMVA 3B6QA 4OESA 2F3DA 2QSXA 3T9VA 1EZ9A 5KCJB 4N8YA 2FYIA 3OELA 3OO6A 3ECRA 1MXVA 2BJIA 1SPIA 3CFXA 1LB9A 2XX8A 3SESA 3BBRA 3HHGA 3TFLA 1AOVA 1LB8A 2G29A 5TP9B 3QUFA 4X1BA 3OXNA 4F2QA 2QMXA 2PFZA 3O6GA 3ILTB 1MPBA 2QPQA 2Q74A 3KC0A 3VVDA 3K6UA 4O7IA 3MPKA 2Y7KA 2QVUA 2VGQA 4XXUA 3TZAA 5CMMA 2DWHA 1INPA 5IKBA 1Y3QA 1FBPA 3MVXA 4GWYA 4NHBA 1JEUA 1QGXA 3N94A 2X26A 2VD3A 4ELQA 2D21A 5H8NB 4C0RA 3KOSA 4O3AA 5CMKA 1NUZA 3WAFA 4DXCA 4Q8RA 3LSLA 4H67A 3EHSA 3I5OA 5EQ8A 2FIEA 4KYEA 1FCKA 4ESWA 1URSA 4PF8A 4JWOA 3MAMA 1IEJA 4JSDA 4G8MA 2OWSA 4G4PA 2QRYA 3OSQA 3M3KA 4F22A 3G3FA 3LR1A 4NF6A 3GYYA 1ELJA 5TPAB 4NTLA 1MQDA 4GRKA 4NWCA 1UTHA 2HXWA 1VDWA 5EYGA 1IZ1A 4FE8A 4EXLA 1FTOA 3A29A 1NNFA 3RTWB 4WKMA 1NV2A 3KC1A 1N7XA 1B5IA 4O8MA 2O51A 1P1UA 5DT6A 3GBAA 1URGA 3H03A 3MW0A 2H9BA 1YZ0A 2GFEA 2XXUA 2B65A 4DI4B 2O6AA 2Z22A 1PB8A 4IY5A 3H6WA 4NF8A 3IAZA 2R8TA 4PAIA 3FATA 3OMBA 1QJMA 4E0WA 1MXWA 2F7CA 4GX6A 2F7AA 2DE3A 2YPNA 2WBBA 2XXHA 3HFUA 1NI9A 3TYHA 4RK9A 3ONMA 3E4RA 2F6PA 4AS4A 5AA2D 3OSRA 4DI3D 1WDNA 3TTRA 1Z7NE 4NF6B 2AYSA 4OVRA 1MQJA 3TTNA 3IOVA 3VXCA 5I57B 2RF1A 1FBEA 3ZKKA 3U65A 3TTMA 1B3GA 5FBPA 2NUVA 1HSLA 2FNCA 2X7PA 1D4NA 4X8RA 3R6UA 1FBCA 3FZVA 2QS2A 5AA2A 3PD8A 1LAGE 1LSTA 4AB5A 1ATGA 4N6PA 1M5DA 3IO4A 3O66A 2CZHA 5AA3A 1OQHA 1MM6A 3FXBA 4YICA 1B3HA 1N84A 1YCJA 2XX9A 4GWSA 4U1OA 4MNPA 3RY3A 2KLFA 3RN8A 2Q8MA 3PUZE 3C4MA 3N6TA 1QVSA 3HO7A 2OJTA 3FJMA 1VE4A 5ET6A 3CRBA 5TU0A 4THIA 2DS9A 1RDYA 4H8JA 2V3TA 4HCYA 4FEBA 4RK2A 5CRYA 4P56A 3OO9A 4MMPA 4KR5A 4G8HA 2CZKA 3H6VA 3ZS6A 3FXQA 4LZ5A 4TOZA 2Q89A 2XXYA 2R9JA 4Q30B 1FQDA 3KN8A 2XXKA 2O69A 4PBHA 3L6GA 4LQ2A 3EF7A 1EYKA 3FJ7A 4F31B 1MXUA 1JW4A 2OK2A 4EUOA 2RINA 2RC7A 4OMBA 1BP5A 1CB6A 1JEVA 3G3IA 4TQUQ 1FPKA 1MG1A 3TUSA 2XWOA 3DP6A 5ICTA 1B0LA 2Q8JA 1N76A 1QKAA 1RYOA 1XS5A 5JTYB 3M3LA 4FBPA 3TCHA 5AA1A 1QUIA 1LBVA 1LBCA 4ZEIA 2DVCA 4G2ZA 2V3UA 1MQHA 3ZKLA 3BFTA 4GWUA 2VD2A 1FQBA 1FTKA 3IOUA 3VLVA 1J1NA 1D9VA 1II5A 4ZDMA 3FJGA 4FECA 3S9MC 2ZXTA 3TKDA 2UXAA 4IO4A 5CBRA 3T9HB 2F3BA 2PCRA 2CZLA 3VVEA 2F6GA 1LAXA 1FBGA 1O63A 1POTA 1YYZA 2OLBA 4QRZA 4Q0CA 4DLDA 4GFRA 4P3LA 3HV1A 2RCBA 3K01A 3VVFA 1SDXA 2ZYKA 5BUUA 2O84X 3FV1A 3PPOA 2H25A 1H43A 2VP1A 4YB6A 1ZIUA 1UIVA 1H45A 4GBVA 1L5TA 5I59B 3U94A 1BKAA 3IB2A 3HPIA 4OETA 2RC9A 5K2YA 4BDNA 1OVBA 4PF6A 4N17A 3O2AA 3S4UA 3KG2A 1GVCA 5EQ9A 5KDTA 1DCUA 4KCDA 2CMOA 1M5FA 1T0KA 5JK4A 1IMAA 1B5JA 3SKPA 2R6GE 3MVYA 4GIZA 3C36A 4AS5A 5L9OA 5DVIA 2Y7IA 4GF8A 1DPEA 3ROJA 1M5CA 1Y20A 3O29A 2GH9A 2DXRA 1JP4A 2WYKA 3KBZA 4KYSA 5IZ3A 3TDJA 3LUZA 5DW8A 3H3GA 1XOCA 4ESXA 5H8HA 1LCTA 2P0SA 2Y84A 4LN5A 2Y7PA 4IO3A 4GXAA 4G8NA 4N13A 3R7XA 5H8QA 1NUYA 4N81A 3T1BA 1KWHA 1MY4A 5ET5A 3MVWA 3U1OA 4IO7A 3B7DA 4P1LA 4PGNA 3ODBA 1LFGA 5KCJA 1B4HA 1N3XA 3K6XA 3OENA 4N4UA 5I5PA 1B2HA 3IB1A 4GX3A 4O94A 4H45A 5TP9A 3E78A 2GQ1A 4NX1A 1EYJA 3V5AA 3OEKA 4ONYA 3FIRA 3SEUA 1R9LA 3FXUA 4H1XA 3IJXB 4WEDA 4UA8A 1R9QA 5J1DA 3C9HA 1JVXA 2OCUA 3OD7A 3AXFA 1TFAA 4AQ4A 1Z7ME 4LA9A 4FIMA 4X04A 4NGUA 2FA7A 3D1RA 3MSTA 1PC3A 4JBZA 4EQ9A 4R2BA 3KJ7A 1ZLQA 1SW2A 3OOAA 5A5XA 2HCAA 3T9XB 3RGYA 1FJ6A 2RKMA 5H8NA 3RPLA 3TCGA 1R1NA 1URDA 1B1HA 1IXHA 1SW5A 3KEIA 4H8IA 5EQ7A 1LAHE 4F1VA 3K00A 5H8QB 1NV4A 3FASA 4QBAA 3JYRA 4XKQA 5L9MA 3PPQA 1BIYA 1BLFA 1NV1A 1XT8A 4ELOA 4GL0A 4P9KA 2LAOA 2I3VA 3SEYA 4PC9A 1VFEA 3VDFA 4ZE8A 1FTMA 4YZZA 5TPAA 1PBPA 2FIXA 4IY6A 1P1NA 1MQIA 4GXSB 1S9TA 4PFYA 3KSXA 4NF4A 3T93B 3V89B 1ZU0A 4PETA 5IM2A 3IFAA 1UIUA 2O1MA 2HEUA 2CEXA 1D9YA 2Q9TA 1I69A 5LOMA 5IZZA 1OQGA 5A5XB 3VLWA 2DDKA 3FUZA 4NG7A 3CG1A 2PFYA 3RPLB 3HN0A 2XXWA 1MS7A 2HPGA 4RYAA 4QHQA 4OVPA 4NF5B 4DDDA 2B4MA 1SD3A 3I3VA 1GGGA 1P1WA 1VFDA 1IXIA 2I58A 3RT6B 3K02A 1IMFA 2H98A 3THIA 3UA8A 3FVOA 2VPOA 1USYH 3Q27A 2VPNA 1A8EA 1MPDA 2OZZA 3EHUA 3IORA 2O7UA 1FQEA 2I0BA 4R73A 5I57A 2HQ0A 2OWZA 1TWYA 1B3FA 1XVYA 1OVTA 3HHFA 3KN7A 4Z7EA 1MY2A 4NF4B 3KJTA 4ISUA 4QFNA 4GOTA 1P1QA 1JETA 1K9ZA 3LV0A 3EPEA 2THIA 4TLLB 2GHAA 4XKPA 1YTVA 2Q88A 3DP8A 1G0HA 3T0JA 3RUMA 3T66A 3QSLA 4I8CA 4ZEDA 3H6TA 4LVQA 1USYE 2QJEA 2AL5A 2Y7WA 3E13X 1G0IA 1KA1A 4MNIA 2ABHA 4ZE9A 1IXGA 4OERA 4Z0IA 3SDFA 1EZOA 3SZPA 4F3GA 4PCDA 4LONB 1B9JA 5EHSA 3PPNA 3DP4A 5F7VA 2CEYA 3P7IA 4YKIA 4MHFA 3KFMA 3E3KA 3FD3A 2XA5A 4PTKA 4RPNA 1Q35A 1IQ7A 1ZMGA 5I56B 3PPPA 2DXYA 3VXBA 1M5EA 1B05A 2WBDA 3UGWA 2Q2CA 2F78A 1KZ8A 3S9NC 4GL8A 1FBDA 1FBHA 2DOJA 4HE0A 4PDDA 5ITOA 2ZZVA 3ILUB 4N8GA 1NKXA 3V8XB 4RXLA 4OANA 1AWBA 3O9PA 1A99A 4R9GA 4TLMB 2HFBA 2M8CA 4QFLA 1Y9UA 4G68A 4XIGQ 5JTYA 4EQBA 3LSXA 3UP9A 4RY1A 1GV8A 2DSFA 4N6DA 1SVXB 1B58A 3UK4A 1NNPA 3BIGA 1WVJA 4NQ8A 2MKZA 2IA4A 3MP8A 2DE4A 4YMAA 4KD5A 1YXIA 5FHMA 2Y5KA 5IGAA 5F24A 3W9WA 1SQYA 3MYUA 2OX3A 4OVSA 3S9LC 2R71A 4OVQA 1PEBA 4R6YA 1DBZA 4ZEKA 3PGFA 4G61A 3G3GA 2WEFA 2DP8A 1N0TA 3WAEA 3H4ZA 1I6BA 4O7MA 3I6VA 2XWIA 4DE8A 1IMBA 5I2KB 1A40A 4FATA 4QF9A 1FPBA 5ELVA 4F3SA 3GBBA 1VSOA 3LSWA 4HS7A 3PMWA 5I59A 2PVUA 2NWJA 4YMBA 4GD5A 3O28A 1KA0A 4HE1A 5JEIA 3KZGA 4G68B 4OEUA 1IMEA 4OENA 5M2VA 4PFWA 4OVJA 2AIXA 1DSNA 4OFOA 1Y3NA 2PT2A 2XHDA 3SEWA 1MDQA 5LDZA 3VE1B 1F9BA 4JVIA 3SEVA 1SYIA 2QS1A 3W15C 1N7WA 2UYEA 3B50A 4N6KA 4JWXA 1JVYA 2RCAA 2XXRA 2I48A 5FTHA 3CVGA 1DTZA 4PFTA 2FBPA 2O1LA 2F36A 1Q1KA 3HSTA 1MY1A 5K2XA 2KQZA 2WX9A 2FVZA 3NOHA 2YLNA 2QS4A 1LBZA 4RA1A 1SBPA 4HCWA 3FGSA 2BJJX 4ZZAA 3IL1B 4AB6A 1LBYA 1RDXA 1PBQA 3B8BA 1DK4A 4ECFA 4NE4A 4LP2B 1CE2A 1IXCA 2NXOA 2DWIA 3EKIA 5ET8A 2B3BA 3CFZA 2H5YA 4DZ1A 3U92A 2KR0A 4R75A 3Q25A 4P0IA 4KFQA 1B6HA 3TQWA 3TAJA 4C1UA 1B7UA 1MY0A 1FPEA 4I9DA 4PAFA 1RDZA 3K1MA 2ZYMA 4OYVA 1B3EA 1OLAA 1PB9A 4UACA 4MX6A 3PU5A 2ZYNA 2PMSA 4PP0A 3C33A 4IGRA 1WODA 2FHYA 1MPCA 4P11A 3TTKA 2ESNA 1QUJA 3OO8A 1D9QA 2H4IA 1NMUA 3ISPA 3A3CA 2V4CA 2XXPA 3RNNA 3W9VA 5I2NB 2UYFA 5DEXA 3DELB 2PYYA 3D4CA 1AH5A 1FTLA 1LBWA 4R2FA 4WXJA 4OWDA 4KQPA 4I40A 1AMFA 1FSAA 4YKKA 4H5GA 3FVKA 2VT5A 1B7ZA 4DCXA 4ELPA 3V83A 4QSEA 4FEDA 4ND9A 1Q9DA 1TFDA 3TMGA 5DTBA 2XXQA 3K2DA 3RPWA 1MDP1 4H0WA 3O6HA 3FV2A 4QFPA 2B3FA 4XKNA 4X48A 2WYPA 3KN3A 3JZJA 4P0GA 4XKRA 4K3FA 3PD9A 3OEMA 5H8FB 1H3DA 3CSGA 4XTCQ 2L5VA 4ZECA 3MZBA 4OEVA 4I3YA 4I3EA 5I84A 4Q5TA 1FPJA 4MJOA 4MF3A 1OMPA 2UVHA 4NMYA 1UTBB 2E0SA 4UABA 4JVDA 2I4CA 3B6WA 4XEQA 5I7IA 2WKYA 1FQAA 5CM6A 3BKIB 1LBBA 5KZTA 2V93A 3RT8A 2XD2A 3KGCA 5DEXB 1MH3A 4XF5A 4F2OA 1H76A 4NAPA 1VR5A 1LLSA 1LFHA 2W7YA 3T9UA 1JQFA 3IR1A 4NF5A 2P3VA 1IUDA 5T3JA 5B70A 2OBGA 2P1SA 3USDA 4BDQA 5L8DA 4KYDA 4MAGA 2OWTA 3PUYE 2F35A 5ITPA 4H46A 5EYFA 2I6EA 2O7IA 2VHAA 4YU0A 2GHBA 1DOTA 3MP6A 4I1DA 1SW4A 3C34A 1K9YA 4YKJA 1OIBA 3QAXA 2GRVA 4QFOA 5I58B 2DQVA 2Y5LA 1FRPA 4GBWA 3LC8A 2I3WA 1P1OA 5FTIA 4PFIA 2H99A 3GZGA 4PE3A 4QSDA 1S7YA 2P2AA 4IO5A 5DVFA 4G77A 4PAKA 4XFEA 1P99A 3T96B 4YB5A 1JW5A 1SI1A 4IO6A 2I49A 1GTKA 4N91A 1CNQA 4GQOA 4OZ9A 4G68C 2NVUB 1NL5A 2G93A 1AIVA 1R6ZA 4MCOA 5EQAA 3LSFB 2DE2A 1B0HA 3MVZA 2ZNUA 3QK6A 1EH3A 5IAIA 2UVJA 4ZEBA 2X7QA 2ZYOA 1B32A 3VFJA 5CBSA 4JXIA 1DTGA 4PFBA 3K1NA 4GLIA 1SYHA 3CSBA 5I56A 1FJ9A 4H6DA 4KCCA 3KOTA 3E9XA 4OHNA 3PUVE 4H65A 3PMXA 4L17A 4LZ7A 2XX7A 1YAEA 1FTAA 2Z8DA 2DVZA 1TT1A 4R72A 5AE4A 5B7DA 1B5HA 2F34A 4BDOA 4NEDA 2HXRA 4PDHA 2Y7RA 2XXVA 4LQ5A 2PBWA 2F7BA 1BK4A 3TELA 1FPDA 5I3SA 3EHTA 3FVNA 1LFIA 3U8QA 4EXKA 1NNKA 3MP1A 1O7TA 3A09A 4R6HA 1ZKBA 1B4ZA 4P1EA 3VLUA 1ANFA 4KI0E 4KPTA 4PE5B 4RJZA 2V3QA 3PUXE 4F3PA 3QMFA 3OO7A 3QUJA 4YKPA 1GR2A 1POY1 1TXFA 4N07A 3N26A 2A5TA 1N04A 5HBCA 3ZSFA 1MRPA 1PB7A 4X9TA 1IMCA 5ISUA 3LBSA 2QVRA 4YB7A 2V84A 4U2RA 1US4A 1IIWA 2HZLA 1LCFA 4IB2A 4POXA 4F3BA 1DMBA 4GWOA 1B52A 4OVTA 5CMCA 3K4UA 1FQCA 4PGPA 2F8DA 2HHMA 4JWYA 1FPIA 4LZ8A 4EF2A 5F1QA 3KBRA 4BLAA 2XWVA 5HM4B 4KXPA 1NH8A 5I2KA 4P8BA 2HAVA 3PUWE 3PV0E 3TPAA 3C35A 3UN6A 3CI8A 3RTFB 5HPQA 4OTEA 3R26A 4X1DA 1MXYA 1NV5A 1UTHB 3MUQA 4ZEFA 3GXAA 2PX1A 3H06B 3QIMA 4DIGA 4DXBA 4QSCA 1A54A 4BDRA 2DYXA 1US5A 5LTCA 5FHOA 3CIJA 3JV9A 4R6KA 1FPFA 1PDAA 5ESYA 4MEVA 3BIHA 2HZKA 1NUWA 3CHGA 1UQWA 4GWWA 5BWJA 2A5TB 4HTGA 2QVVA 3IX1A 3PPRA 2QS3A 3S2VA 4NF8B 3N5LA 4N15A 4LATA 1MM7A 5ET7A 1LGBC 1LAFE 1B3LA 2YJPA 4IO2A 1B51A 4R74A 2P3NA 1MH4A 3U72A 2XXXA 5EYHA 3G3HA 4HE2A 4I62A 2ONKE 4JSOA 4FORA 3MZ1A 4P47A 4HXVA 3UORA 1FTJA 2Z8FA 2AL4A 3B6TA 4MLQA 1A55A 1B46A 4FAJA 1FW0A 2E1SA 4GX4A 1QW0A 3CFLA 1A8FA 1ZTYA 1JW1A 4MNCA 1YPNA 4JDFA 1JNFA 3QYTA 2V25A 1MXXA 4PFRA 1SI0A 3MJNA 1I6AA 5EHMA 3H7MA 3DLNA 3Q29A 4MBPA 3BFUA 5AA2B 2QFLA 1FQFA 1IITA 4EDPA 1M5BA 4ELRA 4GVOA 1IMDA 3EQ1A 2ALUA 3TODA 2ONSA 3C31A 3U93A 4F39A 1OLCA 4F1UA 4U21A 3IJOB 3K6WA 4OFLA 5DVJA 4OA4A 3MWBA 2ZZXA 4E0XA 5I2NA 3Q26A 1NFTA 1QKBA 2DWJA 4U1ZA 4F18A 2ZNSA 2ANJA 1QULA 4NWDA 1BTJA 3UIFA 5H8SA 3G7WA 1Y1MA 3GLBA 4KHZE 4U23A 2Q2AA 4MH5A 2A5SA 4M4GA 4O3BA 1EU8A 2D5WA 1NV0A 4OQOA 4OXVA 3T22A 3FVGA 1MXZA 2ZZWA 3RYDA 2B4LA 4QXDA 4JB7A 1NH7A 1B1XA 2ONRA 5CC2A 1A7LA 3EN3A 4R9FA 3K1PA 3IOTA 2XXTA 3Q28A 5H8FA 2PT1A 3LUYA 1RYXA 4RPOA 1Y3PA 4DXUA 1XVXA 3FBPA 1RKMA 5J16A 2O68A 4GWXA 3L6HA 4PBQA 3IFCA 3MC2A 5L9SA 3PTYA 5A5LA 1I6QA 2RC8A 3FXRA 4OFJA 1UTBA 1Y1ZA 1D3KA 4C1TA 2XWKA 3SETA 2REGA 2JJKA 4LUBA 1NV7A 2IEEA 1DPPA 4NN3A 3IOWA 4GWZA 5CI5A
chains in the Genus database with same CATH topology
4BDLA 1B7HA 1MY3A 4F29A 4EF1A 5AA4A 3N6UA 4HW8A 4MLVA 3RLFE 3DM0A 3F11A 2DWAA 2XXIA 4ZZEA 3TQLA 1EZPA 3TTLA 4DCYA 3S9EA 3G3KA 2QL3A 2REJA 2I0CA 3HCQA 3SEXA 4M1VA 1H44A 1ZBMA 1O64A 5I58A 3K0VA 2ZNTA 4IGTA 4F1YA 3MQ9A 4H5FA 3MPLA 1XC1A 4MFIA 2F97A 4ZS9A 4O3CA 3TEPA 3MZ9A 3C32A 5DYHA 4F19A 1SW1A 1HSJA 1B40A 3D4GA 3CR9A 4PFUA 2UVIA 1QUKA 3O97A 2QMWA 5KDTB 3K6VA 1XHYA 3IB0A 2I4BA 1Y4TA 3M3FA 2NOOA 1N3WA 3A3UA 2Z23A 3QXMA 4FJPA 3SERA 1MQGA 3MBPA 1NNTA 3M8UA 1Y4CA 2XD3A 3G3JA 3CG3A 2Z8EA 3VV5A 3H6UA 3IO6A 3KSJA 2F5XA 2ZMBA 4POWA 4QFKA 1HSEA 4RNSA 5AA4B 2UVGA 5FHNA 3IK6B 4U22A 4BDMA 1AL3A 4WEPA 5ICQA 3RQTA 2D3IA 2VOZA 4U4SA 4PQJA 2HAUA 3O6IA 4YAHX 1S50A 5H8HB 5CMBA 3TCFA 4U4XA 4EQ7A 1ZJLA 3PMVA 3B6QA 4OESA 2QSXA 3T9VA 1EZ9A 5KCJB 2FYIA 3OELA 3OO6A 3ECRA 1MXVA 3CFXA 1LB9A 2XX8A 3SESA 3BBRA 3HHGA 3TFLA 1AOVA 1LB8A 2G29A 5TP9B 3QUFA 4X1BA 3OXNA 4F2QA 2QMXA 3O6GA 3ILTB 1MPBA 2QPQA 3VVDA 3K6UA 3MPKA 2Y7KA 2VGQA 4XXUA 3TZAA 5CMMA 2DWHA 5IKBA 1Y3QA 3MVXA 1JEUA 3N94A 2X26A 2VD3A 4ELQA 2D21A 5H8NB 4C0RA 3KOSA 4O3AA 5CMKA 3WAFA 4DXCA 4Q8RA 3LSLA 4H67A 3EHSA 3I5OA 4KYEA 1FCKA 4ESWA 1URSA 4JWOA 3MAMA 1IEJA 4JSDA 4G8MA 2OWSA 4G4PA 2QRYA 3OSQA 3M3KA 4F22A 3G3FA 3LR1A 4NF6A 1ELJA 5TPAB 4NTLA 1MQDA 4GRKA 4NWCA 1UTHA 2HXWA 1IZ1A 4FE8A 4EXLA 1FTOA 1NNFA 3RTWB 4WKMA 1N7XA 1B5IA 2O51A 1P1UA 5DT6A 3GBAA 1URGA 3H03A 3MW0A 2H9BA 2GFEA 2XXUA 2B65A 2O6AA 2Z22A 1PB8A 4IY5A 3H6WA 4NF8A 3IAZA 3FATA 3OMBA 1QJMA 4E0WA 1MXWA 2F7CA 2F7AA 2DE3A 2YPNA 2XXHA 3TYHA 4RK9A 3ONMA 3E4RA 2F6PA 5AA2D 3OSRA 1WDNA 3TTRA 1Z7NE 4NF6B 2AYSA 1MQJA 3TTNA 3IOVA 3VXCA 5I57B 2RF1A 3ZKKA 3TTMA 1B3GA 2NUVA 1HSLA 2FNCA 2X7PA 1D4NA 3R6UA 3FZVA 2QS2A 5AA2A 3PD8A 1LAGE 1LSTA 4AB5A 1ATGA 4N6PA 1M5DA 3IO4A 3O66A 5AA3A 1OQHA 1MM6A 4YICA 1B3HA 1N84A 1YCJA 2XX9A 4U1OA 3RY3A 2KLFA 3RN8A 3PUZE 3C4MA 3N6TA 1QVSA 3HO7A 2OJTA 3FJMA 1VE4A 3CRBA 5TU0A 4THIA 2DS9A 4H8JA 2V3TA 4HCYA 4FEBA 4RK2A 5CRYA 3OO9A 4KR5A 4G8HA 3H6VA 3ZS6A 3FXQA 4LZ5A 4TOZA 2Q89A 2XXYA 2R9JA 4Q30B 1FQDA 3KN8A 2O69A 3L6GA 4LQ2A 3EF7A 4F31B 3FJ7A 1MXUA 1JW4A 2OK2A 4EUOA 2RINA 2RC7A 4OMBA 1BP5A 1CB6A 1JEVA 3G3IA 4TQUQ 1MG1A 3TUSA 3DP6A 5ICTA 1B0LA 2Q8JA 1N76A 1QKAA 1RYOA 1XS5A 5JTYB 3M3LA 3TCHA 5AA1A 1QUIA 1LBCA 4ZEIA 2DVCA 4G2ZA 2V3UA 1MQHA 3ZKLA 3BFTA 2VD2A 1FQBA 1FTKA 3IOUA 3VLVA 1J1NA 1D9VA 1II5A 4ZDMA 3FJGA 4FECA 3S9MC 2ZXTA 3TKDA 2UXAA 4IO4A 5CBRA 3T9HB 2CZLA 3VVEA 2F6GA 1LAXA 1O63A 1POTA 2OLBA 4QRZA 4Q0CA 4DLDA 4GFRA 3HV1A 2RCBA 3K01A 3VVFA 1SDXA 2ZYKA 5BUUA 2O84X 3FV1A 3PPOA 2H25A 1H43A 2VP1A 4YB6A 1ZIUA 1UIVA 1H45A 1L5TA 5I59B 3U94A 1BKAA 3IB2A 3HPIA 4OETA 2RC9A 5K2YA 4BDNA 1OVBA 3O2AA 3S4UA 3KG2A 1GVCA 5KDTA 4KCDA 2CMOA 1M5FA 1T0KA 5JK4A 1B5JA 3SKPA 2R6GE 3MVYA 4GIZA 3C36A 5L9OA 5DVIA 2Y7IA 4GF8A 1DPEA 1M5CA 1Y20A 3O29A 2GH9A 2DXRA 4KYSA 3TDJA 3H3GA 1XOCA 4ESXA 5H8HA 1LCTA 2P0SA 2Y84A 2Y7PA 4IO3A 4GXAA 4G8NA 4N13A 3R7XA 5H8QA 1KWHA 1MY4A 3MVWA 3U1OA 4IO7A 3B7DA 3ODBA 1LFGA 5KCJA 1B4HA 1N3XA 3K6XA 3OENA 1B2HA 3IB1A 5TP9A 3V5AA 3OEKA 4ONYA 3FIRA 3SEUA 1R9LA 3FXUA 4H1XA 3IJXB 4WEDA 4UA8A 1R9QA 5J1DA 3C9HA 1JVXA 2OCUA 3OD7A 3AXFA 1TFAA 4AQ4A 1Z7ME 4LA9A 4FIMA 2FA7A 1PC3A 4JBZA 4EQ9A 4R2BA 3KJ7A 1ZLQA 1SW2A 3OOAA 5A5XA 2HCAA 3T9XB 3RGYA 2RKMA 5H8NA 3TCGA 1R1NA 1URDA 1B1HA 1IXHA 1SW5A 3KEIA 4H8IA 1LAHE 4F1VA 3K00A 5H8QB 3FASA 3JYRA 4XKQA 5L9MA 3PPQA 1BIYA 1BLFA 1XT8A 4ELOA 4GL0A 2LAOA 2I3VA 3SEYA 1VFEA 3VDFA 4ZE8A 1FTMA 4YZZA 5TPAA 1PBPA 4IY6A 1P1NA 1MQIA 4GXSB 1S9TA 4PFYA 3KSXA 4NF4A 3T93B 3V89B 1ZU0A 4PETA 1UIUA 2O1MA 2HEUA 1D9YA 2Q9TA 1I69A 5LOMA 1OQGA 5A5XB 3VLWA 3FUZA 3CG1A 3HN0A 2XXWA 1MS7A 4RYAA 4QHQA 4NF5B 4DDDA 1SD3A 3I3VA 1GGGA 1P1WA 1VFDA 1IXIA 2I58A 3RT6B 3K02A 2H98A 3THIA 3UA8A 3FVOA 1USYH 3Q27A 1A8EA 1MPDA 2OZZA 3EHUA 3IORA 2O7UA 1FQEA 2I0BA 4R73A 5I57A 2HQ0A 1TWYA 1B3FA 1XVYA 1OVTA 3HHFA 3KN7A 4Z7EA 1MY2A 4NF4B 3KJTA 4ISUA 4QFNA 4GOTA 1P1QA 1JETA 3EPEA 2THIA 4TLLB 2GHAA 4XKPA 1YTVA 2Q88A 3DP8A 3RUMA 3T66A 3QSLA 4I8CA 4ZEDA 3H6TA 4LVQA 1USYE 2QJEA 2AL5A 2Y7WA 3E13X 2ABHA 4ZE9A 1IXGA 4OERA 4Z0IA 3SDFA 1EZOA 4F3GA 4LONB 1B9JA 5EHSA 3PPNA 3DP4A 5F7VA 3P7IA 4YKIA 3KFMA 3E3KA 3FD3A 4RPNA 1Q35A 1IQ7A 1ZMGA 5I56B 3PPPA 2DXYA 3VXBA 1M5EA 1B05A 3UGWA 2Q2CA 2F78A 3S9NC 4GL8A 2DOJA 5ITOA 3ILUB 1NKXA 3V8XB 4RXLA 3O9PA 1A99A 4R9GA 4TLMB 2HFBA 2M8CA 4QFLA 1Y9UA 4G68A 4XIGQ 5JTYA 4EQBA 3LSXA 3UP9A 4RY1A 1GV8A 2DSFA 1SVXB 1B58A 3UK4A 1NNPA 1WVJA 2IA4A 3MP8A 2DE4A 4YMAA 4KD5A 5FHMA 3W9WA 1SQYA 3S9LC 2R71A 1PEBA 4R6YA 4ZEKA 3PGFA 3G3GA 2DP8A 1N0TA 3WAEA 3H4ZA 1I6BA 3I6VA 4DE8A 5I2KB 1A40A 4FATA 4QF9A 5ELVA 4F3SA 3GBBA 1VSOA 3LSWA 4HS7A 3PMWA 5I59A 2PVUA 2NWJA 4YMBA 4GD5A 3O28A 5JEIA 3KZGA 4G68B 4OEUA 4OENA 5M2VA 4PFWA 4OVJA 2AIXA 1DSNA 4OFOA 1Y3NA 2PT2A 2XHDA 3SEWA 1MDQA 3VE1B 1F9BA 3SEVA 1SYIA 2QS1A 3W15C 1N7WA 2UYEA 4JWXA 1JVYA 2RCAA 2XXRA 2I48A 5FTHA 3CVGA 1DTZA 4PFTA 2O1LA 2F36A 1Q1KA 3HSTA 1MY1A 5K2XA 2YLNA 2QS4A 4RA1A 1SBPA 4HCWA 3FGSA 2BJJX 4ZZAA 3IL1B 4AB6A 1PBQA 4ECFA 4NE4A 4LP2B 1CE2A 1IXCA 2NXOA 2DWIA 2B3BA 3CFZA 2H5YA 4DZ1A 3U92A 4R75A 3Q25A 4P0IA 4KFQA 1B6HA 3TQWA 3TAJA 4C1UA 1B7UA 1MY0A 4I9DA 3K1MA 2ZYMA 4OYVA 1B3EA 1OLAA 1PB9A 4UACA 3PU5A 2ZYNA 2PMSA 4PP0A 3C33A 4IGRA 1WODA 1MPCA 4P11A 3TTKA 2ESNA 1QUJA 3OO8A 2H4IA 1NMUA 3A3CA 2XXPA 3RNNA 3W9VA 5I2NB 2UYFA 5DEXA 3DELB 2PYYA 3D4CA 1AH5A 1FTLA 4R2FA 4WXJA 4OWDA 4KQPA 1AMFA 4YKKA 4H5GA 3FVKA 1B7ZA 4DCXA 4ELPA 3V83A 4QSEA 4FEDA 4ND9A 1TFDA 3TMGA 5DTBA 2XXQA 3K2DA 3RPWA 1MDP1 4H0WA 3O6HA 3FV2A 4QFPA 2B3FA 4XKNA 4X48A 3KN3A 3JZJA 4P0GA 4XKRA 4K3FA 3PD9A 3OEMA 5H8FB 1H3DA 3CSGA 4XTCQ 4ZECA 3MZBA 4OEVA 5I84A 4Q5TA 4MF3A 1OMPA 2UVHA 4NMYA 1UTBB 2E0SA 2I4CA 3B6WA 2WKYA 1FQAA 5CM6A 3BKIB 1LBBA 5KZTA 2V93A 3RT8A 2XD2A 3KGCA 5DEXB 1MH3A 4F2OA 1H76A 1VR5A 1LLSA 1LFHA 2W7YA 3T9UA 1JQFA 3IR1A 4NF5A 1IUDA 5B70A 2OBGA 2P1SA 3USDA 4BDQA 5L8DA 4KYDA 2OWTA 3PUYE 2F35A 5ITPA 5EYFA 2I6EA 2O7IA 2VHAA 4YU0A 2GHBA 1DOTA 3MP6A 4I1DA 1SW4A 3C34A 4YKJA 1OIBA 3QAXA 2GRVA 4QFOA 5I58B 2DQVA 3LC8A 2I3WA 1P1OA 5FTIA 2H99A 3GZGA 4QSDA 1S7YA 2P2AA 4IO5A 5DVFA 4G77A 1P99A 3T96B 4YB5A 1JW5A 1SI1A 4IO6A 2I49A 1GTKA 4GQOA 4OZ9A 4G68C 2NVUB 1NL5A 2G93A 1AIVA 1R6ZA 3LSFB 2DE2A 1B0HA 3MVZA 2ZNUA 3QK6A 1EH3A 5IAIA 2UVJA 4ZEBA 2X7QA 2ZYOA 1B32A 3VFJA 5CBSA 4JXIA 1DTGA 3K1NA 4GLIA 1SYHA 3CSBA 5I56A 4H6DA 4KCCA 3KOTA 3E9XA 4OHNA 3PUVE 4H65A 3PMXA 4L17A 4LZ7A 2XX7A 1YAEA 2Z8DA 2DVZA 1TT1A 4R72A 5AE4A 5B7DA 1B5HA 2F34A 4BDOA 4NEDA 2Y7RA 2XXVA 4LQ5A 2PBWA 2F7BA 3TELA 3EHTA 3FVNA 1LFIA 3U8QA 4EXKA 1NNKA 3MP1A 1O7TA 3A09A 4R6HA 1ZKBA 1B4ZA 3VLUA 1ANFA 4KI0E 4KPTA 4PE5B 4RJZA 2V3QA 3PUXE 4F3PA 3OO7A 3QUJA 4YKPA 1GR2A 1POY1 1TXFA 4N07A 3N26A 2A5TA 1N04A 5HBCA 3ZSFA 1MRPA 1PB7A 4X9TA 5ISUA 3LBSA 4YB7A 2V84A 4U2RA 1US4A 1IIWA 2HZLA 1LCFA 4IB2A 4POXA 4F3BA 1DMBA 4GWOA 1B52A 5CMCA 3K4UA 1FQCA 2F8DA 4JWYA 4LZ8A 4EF2A 5F1QA 3KBRA 4BLAA 5HM4B 1NH8A 5I2KA 2HAVA 3PUWE 3PV0E 3TPAA 3C35A 3UN6A 3CI8A 3RTFB 5HPQA 4OTEA 3R26A 4X1DA 1MXYA 1UTHB 3MUQA 4ZEFA 3GXAA 2PX1A 3H06B 3QIMA 4DIGA 4DXBA 4QSCA 1A54A 4BDRA 2DYXA 1US5A 5FHOA 3CIJA 3JV9A 4R6KA 1PDAA 2HZKA 1UQWA 5BWJA 2A5TB 4HTGA 3IX1A 3PPRA 2QS3A 3S2VA 4NF8B 3N5LA 4LATA 1MM7A 1LGBC 1LAFE 1B3LA 2YJPA 4IO2A 1B51A 4R74A 1MH4A 3U72A 2XXXA 3G3HA 4I62A 2ONKE 4JSOA 4FORA 3MZ1A 3UORA 1FTJA 2Z8FA 2AL4A 3B6TA 4MLQA 1A55A 1B46A 4FAJA 1FW0A 2E1SA 1QW0A 3CFLA 1A8FA 1ZTYA 1JW1A 1YPNA 4JDFA 1JNFA 3QYTA 2V25A 1MXXA 1SI0A 3MJNA 1I6AA 5EHMA 3H7MA 3DLNA 3Q29A 4MBPA 3BFUA 5AA2B 1FQFA 1IITA 4EDPA 1M5BA 4ELRA 4GVOA 3EQ1A 2ALUA 3TODA 2ONSA 3C31A 3U93A 4F39A 1OLCA 4F1UA 4U21A 3IJOB 3K6WA 4OFLA 5DVJA 3MWBA 4E0XA 5I2NA 3Q26A 1NFTA 1QKBA 2DWJA 4U1ZA 4F18A 2ZNSA 2ANJA 1QULA 4NWDA 1BTJA 3UIFA 5H8SA 3G7WA 1Y1MA 3GLBA 4KHZE 4U23A 2Q2AA 4MH5A 2A5SA 4M4GA 4O3BA 1EU8A 2D5WA 4OQOA 4OXVA 3T22A 3FVGA 1MXZA 4JB7A 1NH7A 1B1XA 2ONRA 5CC2A 1A7LA 3EN3A 4R9FA 3K1PA 3IOTA 2XXTA 3Q28A 5H8FA 2PT1A 3LUYA 1RYXA 4RPOA 1Y3PA 4DXUA 1XVXA 1RKMA 2O68A 3L6HA 3MC2A 5L9SA 1I6QA 2RC8A 3FXRA 4OFJA 1UTBA 1Y1ZA 1D3KA 4C1TA 3SETA 2REGA 4LUBA 2IEEA 1DPPA 3IOWA 5CI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BDL A;  1B7H A;  1MY3 A;  4F29 A;  4EF1 A;  5AA4 A;  3N6U A;  4HW8 A;  4MLV A;  3RLF E;  3DM0 A;  3F11 A;  2DWA A;  2XXI A;  4ZZE A;  3TQL A;  1EZP A;  3TTL A;  4DCY A;  3S9E A;  3G3K A;  2QL3 A;  2REJ A;  2I0C A;  3HCQ A;  3SEX A;  4M1V A;  1H44 A;  1ZBM A;  1O64 A;  5I58 A;  3K0V A;  2ZNT A;  4IGT A;  4F1Y A;  3MQ9 A;  4H5F A;  3MPL A;  1XC1 A;  4MFI A;  2F97 A;  4ZS9 A;  4O3C A;  3TEP A;  3MZ9 A;  3C32 A;  5DYH A;  4F19 A;  1SW1 A;  1HSJ A;  1B40 A;  3D4G A;  3CR9 A;  4PFU A;  2UVI A;  1QUK A;  3O97 A;  2QMW A;  5KDT B;  3K6V A;  1XHY A;  3IB0 A;  2I4B A;  1Y4T A;  3M3F A;  2NOO A;  1N3W A;  3A3U A;  2Z23 A;  3QXM A;  4FJP A;  3SER A;  1MQG A;  3MBP A;  1NNT A;  3M8U A;  1Y4C A;  2XD3 A;  3G3J A;  3CG3 A;  2Z8E A;  3VV5 A;  3H6U A;  3IO6 A;  3KSJ A;  2F5X A;  2ZMB A;  4POW A;  4QFK A;  1HSE A;  4RNS A;  5AA4 B;  2UVG A;  5FHN A;  3IK6 B;  4U22 A;  4BDM A;  1AL3 A;  4WEP A;  5ICQ A;  3RQT A;  2D3I A;  2VOZ A;  4U4S A;  4PQJ A;  2HAU A;  3O6I A;  4YAH X;  1S50 A;  5H8H B;  5CMB A;  3TCF A;  4U4X A;  4EQ7 A;  1ZJL A;  3PMV A;  3B6Q A;  4OES A;  2QSX A;  3T9V A;  1EZ9 A;  5KCJ B;  2FYI A;  3OEL A;  3OO6 A;  3ECR A;  1MXV A;  3CFX A;  1LB9 A;  2XX8 A;  3SES A;  3BBR A;  3HHG A;  3TFL A;  1AOV A;  1LB8 A;  2G29 A;  5TP9 B;  3QUF A;  4X1B A;  3OXN A;  4F2Q A;  2QMX A;  3O6G A;  3ILT B;  1MPB A;  2QPQ A;  3VVD A;  3K6U A;  3MPK A;  2Y7K A;  2VGQ A;  4XXU A;  3TZA A;  5CMM A;  2DWH A;  5IKB A;  1Y3Q A;  3MVX A;  1JEU A;  3N94 A;  2X26 A;  2VD3 A;  4ELQ A;  2D21 A;  5H8N B;  4C0R A;  3KOS A;  4O3A A;  5CMK A;  3WAF A;  4DXC A;  4Q8R A;  3LSL A;  4H67 A;  3EHS A;  3I5O A;  4KYE A;  1FCK A;  4ESW A;  1URS A;  4JWO A;  3MAM A;  1IEJ A;  4JSD A;  4G8M A;  2OWS A;  4G4P A;  2QRY A;  3OSQ A;  3M3K A;  4F22 A;  3G3F A;  3LR1 A;  4NF6 A;  1ELJ A;  5TPA B;  4NTL A;  1MQD A;  4GRK A;  4NWC A;  1UTH A;  2HXW A;  1IZ1 A;  4FE8 A;  4EXL A;  1FTO A;  1NNF A;  3RTW B;  4WKM A;  1N7X A;  1B5I A;  2O51 A;  1P1U A;  5DT6 A;  3GBA A;  1URG A;  3H03 A;  3MW0 A;  2H9B A;  2GFE A;  2XXU A;  2B65 A;  2O6A A;  2Z22 A;  1PB8 A;  4IY5 A;  3H6W A;  4NF8 A;  3IAZ A;  3FAT A;  3OMB A;  1QJM A;  4E0W A;  1MXW A;  2F7C A;  2F7A A;  2DE3 A;  2YPN A;  2XXH A;  3TYH A;  4RK9 A;  3ONM A;  3E4R A;  2F6P A;  5AA2 D;  3OSR A;  1WDN A;  3TTR A;  1Z7N E;  4NF6 B;  2AYS A;  1MQJ A;  3TTN A;  3IOV A;  3VXC A;  5I57 B;  2RF1 A;  3ZKK A;  3TTM A;  1B3G A;  2NUV A;  1HSL A;  2FNC A;  2X7P A;  1D4N A;  3R6U A;  3FZV A;  2QS2 A;  5AA2 A;  3PD8 A;  1LAG E;  1LST A;  4AB5 A;  1ATG A;  4N6P A;  1M5D A;  3IO4 A;  3O66 A;  5AA3 A;  1OQH A;  1MM6 A;  4YIC A;  1B3H A;  1N84 A;  1YCJ A;  2XX9 A;  4U1O A;  3RY3 A;  2KLF A;  3RN8 A;  3PUZ E;  3C4M A;  3N6T A;  1QVS A;  3HO7 A;  2OJT A;  3FJM A;  1VE4 A;  3CRB A;  5TU0 A;  4THI A;  2DS9 A;  4H8J A;  2V3T A;  4HCY A;  4FEB A;  4RK2 A;  5CRY A;  3OO9 A;  4KR5 A;  4G8H A;  3H6V A;  3ZS6 A;  3FXQ A;  4LZ5 A;  4TOZ A;  2Q89 A;  2XXY A;  2R9J A;  4Q30 B;  1FQD A;  3KN8 A;  2O69 A;  3L6G A;  4LQ2 A;  3EF7 A;  4F31 B;  3FJ7 A;  1MXU A;  1JW4 A;  2OK2 A;  4EUO A;  2RIN A;  2RC7 A;  4OMB A;  1BP5 A;  1CB6 A;  1JEV A;  3G3I A;  4TQU Q;  1MG1 A;  3TUS A;  3DP6 A;  5ICT A;  1B0L A;  2Q8J A;  1N76 A;  1QKA A;  1RYO A;  1XS5 A;  5JTY B;  3M3L A;  3TCH A;  5AA1 A;  1QUI A;  1LBC A;  4ZEI A;  2DVC A;  4G2Z A;  2V3U A;  1MQH A;  3ZKL A;  3BFT A;  2VD2 A;  1FQB A;  1FTK A;  3IOU A;  3VLV A;  1J1N A;  1D9V A;  1II5 A;  4ZDM A;  3FJG A;  4FEC A;  3S9M C;  2ZXT A;  3TKD A;  2UXA A;  4IO4 A;  5CBR A;  3T9H B;  2CZL A;  3VVE A;  2F6G A;  1LAX A;  1O63 A;  1POT A;  2OLB A;  4QRZ A;  4Q0C A;  4DLD A;  4GFR A;  3HV1 A;  2RCB A;  3K01 A;  3VVF A;  1SDX A;  2ZYK A;  5BUU A;  2O84 X;  3FV1 A;  3PPO A;  2H25 A;  1H43 A;  2VP1 A;  4YB6 A;  1ZIU A;  1UIV A;  1H45 A;  1L5T A;  5I59 B;  3U94 A;  1BKA A;  3IB2 A;  3HPI A;  4OET A;  2RC9 A;  5K2Y A;  4BDN A;  1OVB A;  3O2A A;  3S4U A;  3KG2 A;  1GVC A;  5KDT A;  4KCD A;  2CMO A;  1M5F A;  1T0K A;  5JK4 A;  1B5J A;  3SKP A;  2R6G E;  3MVY A;  4GIZ A;  3C36 A;  5L9O A;  5DVI A;  2Y7I A;  4GF8 A;  1DPE A;  1M5C A;  1Y20 A;  3O29 A;  2GH9 A;  2DXR A;  4KYS A;  3TDJ A;  3H3G A;  1XOC A;  4ESX A;  5H8H A;  1LCT A;  2P0S A;  2Y84 A;  2Y7P A;  4IO3 A;  4GXA A;  4G8N A;  4N13 A;  3R7X A;  5H8Q A;  1KWH A;  1MY4 A;  3MVW A;  3U1O A;  4IO7 A;  3B7D A;  3ODB A;  1LFG A;  5KCJ A;  1B4H A;  1N3X A;  3K6X A;  3OEN A;  1B2H A;  3IB1 A;  5TP9 A;  3V5A A;  3OEK A;  4ONY A;  3FIR A;  3SEU A;  1R9L A;  3FXU A;  4H1X A;  3IJX B;  4WED A;  4UA8 A;  1R9Q A;  5J1D A;  3C9H A;  1JVX A;  2OCU A;  3OD7 A;  3AXF A;  1TFA A;  4AQ4 A;  1Z7M E;  4LA9 A;  4FIM A;  2FA7 A;  1PC3 A;  4JBZ A;  4EQ9 A;  4R2B A;  3KJ7 A;  1ZLQ A;  1SW2 A;  3OOA A;  5A5X A;  2HCA A;  3T9X B;  3RGY A;  2RKM A;  5H8N A;  3TCG A;  1R1N A;  1URD A;  1B1H A;  1IXH A;  1SW5 A;  3KEI A;  4H8I A;  1LAH E;  4F1V A;  3K00 A;  5H8Q B;  3FAS A;  3JYR A;  4XKQ A;  5L9M A;  3PPQ A;  1BIY A;  1BLF A;  1XT8 A;  4ELO A;  4GL0 A;  2LAO A;  2I3V A;  3SEY A;  1VFE A;  3VDF A;  4ZE8 A;  1FTM A;  4YZZ A;  5TPA A;  1PBP A;  4IY6 A;  1P1N A;  1MQI A;  4GXS B;  1S9T A;  4PFY A;  3KSX A;  4NF4 A;  3T93 B;  3V89 B;  1ZU0 A;  4PET A;  1UIU A;  2O1M A;  2HEU A;  1D9Y A;  2Q9T A;  1I69 A;  5LOM A;  1OQG A;  5A5X B;  3VLW A;  3FUZ A;  3CG1 A;  3HN0 A;  2XXW A;  1MS7 A;  4RYA A;  4QHQ A;  4NF5 B;  4DDD A;  1SD3 A;  3I3V A;  1GGG A;  1P1W A;  1VFD A;  1IXI A;  2I58 A;  3RT6 B;  3K02 A;  2H98 A;  3THI A;  3UA8 A;  3FVO A;  1USY H;  3Q27 A;  1A8E A;  1MPD A;  2OZZ A;  3EHU A;  3IOR A;  2O7U A;  1FQE A;  2I0B A;  4R73 A;  5I57 A;  2HQ0 A;  1TWY A;  1B3F A;  1XVY A;  1OVT A;  3HHF A;  3KN7 A;  4Z7E A;  1MY2 A;  4NF4 B;  3KJT A;  4ISU A;  4QFN A;  4GOT A;  1P1Q A;  1JET A;  3EPE A;  2THI A;  4TLL B;  2GHA A;  4XKP A;  1YTV A;  2Q88 A;  3DP8 A;  3RUM A;  3T66 A;  3QSL A;  4I8C A;  4ZED A;  3H6T A;  4LVQ A;  1USY E;  2QJE A;  2AL5 A;  2Y7W A;  3E13 X;  2ABH A;  4ZE9 A;  1IXG A;  4OER A;  4Z0I A;  3SDF A;  1EZO A;  4F3G A;  4LON B;  1B9J A;  5EHS A;  3PPN A;  3DP4 A;  5F7V A;  3P7I A;  4YKI A;  3KFM A;  3E3K A;  3FD3 A;  4RPN A;  1Q35 A;  1IQ7 A;  1ZMG A;  5I56 B;  3PPP A;  2DXY A;  3VXB A;  1M5E A;  1B05 A;  3UGW A;  2Q2C A;  2F78 A;  3S9N C;  4GL8 A;  2DOJ A;  5ITO A;  3ILU B;  1NKX A;  3V8X B;  4RXL A;  3O9P A;  1A99 A;  4R9G A;  4TLM B;  2HFB A;  2M8C A;  4QFL A;  1Y9U A;  4G68 A;  4XIG Q;  5JTY A;  4EQB A;  3LSX A;  3UP9 A;  4RY1 A;  1GV8 A;  2DSF A;  1SVX B;  1B58 A;  3UK4 A;  1NNP A;  1WVJ A;  2IA4 A;  3MP8 A;  2DE4 A;  4YMA A;  4KD5 A;  5FHM A;  3W9W A;  1SQY A;  3S9L C;  2R71 A;  1PEB A;  4R6Y A;  4ZEK A;  3PGF A;  3G3G A;  2DP8 A;  1N0T A;  3WAE A;  3H4Z A;  1I6B A;  3I6V A;  4DE8 A;  5I2K B;  1A40 A;  4FAT A;  4QF9 A;  5ELV A;  4F3S A;  3GBB A;  1VSO A;  3LSW A;  4HS7 A;  3PMW A;  5I59 A;  2PVU A;  2NWJ A;  4YMB A;  4GD5 A;  3O28 A;  5JEI A;  3KZG A;  4G68 B;  4OEU A;  4OEN A;  5M2V A;  4PFW A;  4OVJ A;  2AIX A;  1DSN A;  4OFO A;  1Y3N A;  2PT2 A;  2XHD A;  3SEW A;  1MDQ A;  3VE1 B;  1F9B A;  3SEV A;  1SYI A;  2QS1 A;  3W15 C;  1N7W A;  2UYE A;  4JWX A;  1JVY A;  2RCA A;  2XXR A;  2I48 A;  5FTH A;  3CVG A;  1DTZ A;  4PFT A;  2O1L A;  2F36 A;  1Q1K A;  3HST A;  1MY1 A;  5K2X A;  2YLN A;  2QS4 A;  4RA1 A;  1SBP A;  4HCW A;  3FGS A;  2BJJ X;  4ZZA A;  3IL1 B;  4AB6 A;  1PBQ A;  4ECF A;  4NE4 A;  4LP2 B;  1CE2 A;  1IXC A;  2NXO A;  2DWI A;  2B3B A;  3CFZ A;  2H5Y A;  4DZ1 A;  3U92 A;  4R75 A;  3Q25 A;  4P0I A;  4KFQ A;  1B6H A;  3TQW A;  3TAJ A;  4C1U A;  1B7U A;  1MY0 A;  4I9D A;  3K1M A;  2ZYM A;  4OYV A;  1B3E A;  1OLA A;  1PB9 A;  4UAC A;  3PU5 A;  2ZYN A;  2PMS A;  4PP0 A;  3C33 A;  4IGR A;  1WOD A;  1MPC A;  4P11 A;  3TTK A;  2ESN A;  1QUJ A;  3OO8 A;  2H4I A;  1NMU A;  3A3C A;  2XXP A;  3RNN A;  3W9V A;  5I2N B;  2UYF A;  5DEX A;  3DEL B;  2PYY A;  3D4C A;  1AH5 A;  1FTL A;  4R2F A;  4WXJ A;  4OWD A;  4KQP A;  1AMF A;  4YKK A;  4H5G A;  3FVK A;  1B7Z A;  4DCX A;  4ELP A;  3V83 A;  4QSE A;  4FED A;  4ND9 A;  1TFD A;  3TMG A;  5DTB A;  2XXQ A;  3K2D A;  3RPW A;  1MDP 1;  4H0W A;  3O6H A;  3FV2 A;  4QFP A;  2B3F A;  4XKN A;  4X48 A;  3KN3 A;  3JZJ A;  4P0G A;  4XKR A;  4K3F A;  3PD9 A;  3OEM A;  5H8F B;  1H3D A;  3CSG A;  4XTC Q;  4ZEC A;  3MZB A;  4OEV A;  5I84 A;  4Q5T A;  4MF3 A;  1OMP A;  2UVH A;  4NMY A;  1UTB B;  2E0S A;  2I4C A;  3B6W A;  2WKY A;  1FQA A;  5CM6 A;  3BKI B;  1LBB A;  5KZT A;  2V93 A;  3RT8 A;  2XD2 A;  3KGC A;  5DEX B;  1MH3 A;  4F2O A;  1H76 A;  1VR5 A;  1LLS A;  1LFH A;  2W7Y A;  3T9U A;  1JQF A;  3IR1 A;  4NF5 A;  1IUD A;  5B70 A;  2OBG A;  2P1S A;  3USD A;  4BDQ A;  5L8D A;  4KYD A;  2OWT A;  3PUY E;  2F35 A;  5ITP A;  5EYF A;  2I6E A;  2O7I A;  2VHA A;  4YU0 A;  2GHB A;  1DOT A;  3MP6 A;  4I1D A;  1SW4 A;  3C34 A;  4YKJ A;  1OIB A;  3QAX A;  2GRV A;  4QFO A;  5I58 B;  2DQV A;  3LC8 A;  2I3W A;  1P1O A;  5FTI A;  2H99 A;  3GZG A;  4QSD A;  1S7Y A;  2P2A A;  4IO5 A;  5DVF A;  4G77 A;  1P99 A;  3T96 B;  4YB5 A;  1JW5 A;  1SI1 A;  4IO6 A;  2I49 A;  1GTK A;  4GQO A;  4OZ9 A;  4G68 C;  2NVU B;  1NL5 A;  2G93 A;  1AIV A;  1R6Z A;  3LSF B;  2DE2 A;  1B0H A;  3MVZ A;  2ZNU A;  3QK6 A;  1EH3 A;  5IAI A;  2UVJ A;  4ZEB A;  2X7Q A;  2ZYO A;  1B32 A;  3VFJ A;  5CBS A;  4JXI A;  1DTG A;  3K1N A;  4GLI A;  1SYH A;  3CSB A;  5I56 A;  4H6D A;  4KCC A;  3KOT A;  3E9X A;  4OHN A;  3PUV E;  4H65 A;  3PMX A;  4L17 A;  4LZ7 A;  2XX7 A;  1YAE A;  2Z8D A;  2DVZ A;  1TT1 A;  4R72 A;  5AE4 A;  5B7D A;  1B5H A;  2F34 A;  4BDO A;  4NED A;  2Y7R A;  2XXV A;  4LQ5 A;  2PBW A;  2F7B A;  3TEL A;  3EHT A;  3FVN A;  1LFI A;  3U8Q A;  4EXK A;  1NNK A;  3MP1 A;  1O7T A;  3A09 A;  4R6H A;  1ZKB A;  1B4Z A;  3VLU A;  1ANF A;  4KI0 E;  4KPT A;  4PE5 B;  4RJZ A;  2V3Q A;  3PUX E;  4F3P A;  3OO7 A;  3QUJ A;  4YKP A;  1GR2 A;  1POY 1;  1TXF A;  4N07 A;  3N26 A;  2A5T A;  1N04 A;  5HBC A;  3ZSF A;  1MRP A;  1PB7 A;  4X9T A;  5ISU A;  3LBS A;  4YB7 A;  2V84 A;  4U2R A;  1US4 A;  1IIW A;  2HZL A;  1LCF A;  4IB2 A;  4POX A;  4F3B A;  1DMB A;  4GWO A;  1B52 A;  5CMC A;  3K4U A;  1FQC A;  2F8D A;  4JWY A;  4LZ8 A;  4EF2 A;  5F1Q A;  3KBR A;  4BLA A;  5HM4 B;  1NH8 A;  5I2K A;  2HAV A;  3PUW E;  3PV0 E;  3TPA A;  3C35 A;  3UN6 A;  3CI8 A;  3RTF B;  5HPQ A;  4OTE A;  3R26 A;  4X1D A;  1MXY A;  1UTH B;  3MUQ A;  4ZEF A;  3GXA A;  2PX1 A;  3H06 B;  3QIM A;  4DIG A;  4DXB A;  4QSC A;  1A54 A;  4BDR A;  2DYX A;  1US5 A;  5FHO A;  3CIJ A;  3JV9 A;  4R6K A;  1PDA A;  2HZK A;  1UQW A;  5BWJ A;  2A5T B;  4HTG A;  3IX1 A;  3PPR A;  2QS3 A;  3S2V A;  4NF8 B;  3N5L A;  4LAT A;  1MM7 A;  1LGB C;  1LAF E;  1B3L A;  2YJP A;  4IO2 A;  1B51 A;  4R74 A;  1MH4 A;  3U72 A;  2XXX A;  3G3H A;  4I62 A;  2ONK E;  4JSO A;  4FOR A;  3MZ1 A;  3UOR A;  1FTJ A;  2Z8F A;  2AL4 A;  3B6T A;  4MLQ A;  1A55 A;  1B46 A;  4FAJ A;  1FW0 A;  2E1S A;  1QW0 A;  3CFL A;  1A8F A;  1ZTY A;  1JW1 A;  1YPN A;  4JDF A;  1JNF A;  3QYT A;  2V25 A;  1MXX A;  1SI0 A;  3MJN A;  1I6A A;  5EHM A;  3H7M A;  3DLN A;  3Q29 A;  4MBP A;  3BFU A;  5AA2 B;  1FQF A;  1IIT A;  4EDP A;  1M5B A;  4ELR A;  4GVO A;  3EQ1 A;  2ALU A;  3TOD A;  2ONS A;  3C31 A;  3U93 A;  4F39 A;  1OLC A;  4F1U A;  4U21 A;  3IJO B;  3K6W A;  4OFL A;  5DVJ A;  3MWB A;  4E0X A;  5I2N A;  3Q26 A;  1NFT A;  1QKB A;  2DWJ A;  4U1Z A;  4F18 A;  2ZNS A;  2ANJ A;  1QUL A;  4NWD A;  1BTJ A;  3UIF A;  5H8S A;  3G7W A;  1Y1M A;  3GLB A;  4KHZ E;  4U23 A;  2Q2A A;  4MH5 A;  2A5S A;  4M4G A;  4O3B A;  1EU8 A;  2D5W A;  4OQO A;  4OXV A;  3T22 A;  3FVG A;  1MXZ A;  4JB7 A;  1NH7 A;  1B1X A;  2ONR A;  5CC2 A;  1A7L A;  3EN3 A;  4R9F A;  3K1P A;  3IOT A;  2XXT A;  3Q28 A;  5H8F A;  2PT1 A;  3LUY A;  1RYX A;  4RPO A;  1Y3P A;  4DXU A;  1XVX A;  1RKM A;  2O68 A;  3L6H A;  3MC2 A;  5L9S A;  1I6Q A;  2RC8 A;  3FXR A;  4OFJ A;  1UTB A;  1Y1Z A;  1D3K A;  4C1T A;  3SET A;  2REG A;  4LUB A;  2IEE A;  1DPP A;  3IOW A;  5CI5 A; 
#chains in the Genus database with same CATH topology
 4BDL A;  1B7H A;  1MY3 A;  4F29 A;  4NF0 A;  4EF1 A;  5AA4 A;  2CZI A;  3N6U A;  4HW8 A;  4MLV A;  3RLF E;  1XI6 A;  3DM0 A;  2DWA A;  2XXI A;  3F11 A;  4ZZE A;  3TQL A;  1EZP A;  3TTL A;  4DCY A;  3S9E A;  3G3K A;  2QL3 A;  2REJ A;  2I0C A;  3HCQ A;  3SEX A;  1FPL A;  4M1V A;  1H44 A;  1FPG A;  4JVC A;  1ZBM A;  1O64 A;  5I58 A;  3K0V A;  2ZNT A;  4IGT A;  4F1Y A;  3MQ9 A;  4H5F A;  1NUX A;  3MPL A;  1XC1 A;  1EYI A;  4MFI A;  1LBX A;  2F97 A;  4MIJ A;  4ZS9 A;  1FBF A;  4O3C A;  3TEP A;  3MZ9 A;  3C32 A;  5DYH A;  4F19 A;  1SW1 A;  1HSJ A;  1B40 A;  3D4G A;  3CR9 A;  3E79 A;  4PFU A;  2UVI A;  1QUK A;  3O97 A;  2QMW A;  5KDT B;  3K6V A;  1XHY A;  3IB0 A;  2I4B A;  1Y4T A;  3M3F A;  5IZ1 A;  2NOO A;  1N3W A;  3A3U A;  2Z23 A;  3QXM A;  1NV3 A;  4FJP A;  3SER A;  1MQG A;  3MBP A;  1NNT A;  3M8U A;  1Y4C A;  2XD3 A;  3G3J A;  3CG3 A;  2Z8E A;  3VV5 A;  3H6U A;  3IO6 A;  3KSJ A;  2F5X A;  2ZMB A;  4POW A;  4QFK A;  1HSE A;  4RNS A;  5AA4 B;  2UVG A;  5FHN A;  3IK6 B;  4U22 A;  4BDM A;  1LEV A;  1AL3 A;  4WEP A;  5ICQ A;  3RQT A;  2D3I A;  2VOZ A;  1NV6 A;  4U4S A;  5IZ3 B;  4PQJ A;  2HAU A;  3O6I A;  4IR8 A;  4YAH X;  1S50 A;  5H8H B;  5CMB A;  3TCF A;  4U4X A;  4EQ7 A;  1ZJL A;  3PMV A;  3B6Q A;  4OES A;  2F3D A;  2QSX A;  3T9V A;  1EZ9 A;  5KCJ B;  4N8Y A;  2FYI A;  3OEL A;  3OO6 A;  3ECR A;  1MXV A;  2BJI A;  1SPI A;  3CFX A;  1LB9 A;  2XX8 A;  3SES A;  3BBR A;  3HHG A;  3TFL A;  1AOV A;  1LB8 A;  2G29 A;  5TP9 B;  3QUF A;  4X1B A;  3OXN A;  4F2Q A;  2QMX A;  2PFZ A;  3O6G A;  3ILT B;  1MPB A;  2QPQ A;  2Q74 A;  3KC0 A;  3VVD A;  3K6U A;  4O7I A;  3MPK A;  2Y7K A;  2QVU A;  2VGQ A;  4XXU A;  3TZA A;  5CMM A;  2DWH A;  1INP A;  5IKB A;  1Y3Q A;  1FBP A;  3MVX A;  4GWY A;  4NHB A;  1JEU A;  1QGX A;  3N94 A;  2X26 A;  2VD3 A;  4ELQ A;  2D21 A;  5H8N B;  4C0R A;  3KOS A;  4O3A A;  5CMK A;  1NUZ A;  3WAF A;  4DXC A;  4Q8R A;  3LSL A;  4H67 A;  3EHS A;  3I5O A;  5EQ8 A;  2FIE A;  4KYE A;  1FCK A;  4ESW A;  1URS A;  4PF8 A;  4JWO A;  3MAM A;  1IEJ A;  4JSD A;  4G8M A;  2OWS A;  4G4P A;  2QRY A;  3OSQ A;  3M3K A;  4F22 A;  3G3F A;  3LR1 A;  4NF6 A;  3GYY A;  1ELJ A;  5TPA B;  4NTL A;  1MQD A;  4GRK A;  4NWC A;  1UTH A;  2HXW A;  1VDW A;  5EYG A;  1IZ1 A;  4FE8 A;  4EXL A;  1FTO A;  3A29 A;  1NNF A;  3RTW B;  4WKM A;  1NV2 A;  3KC1 A;  1N7X A;  1B5I A;  4O8M A;  2O51 A;  1P1U A;  5DT6 A;  3GBA A;  1URG A;  3H03 A;  3MW0 A;  2H9B A;  1YZ0 A;  2GFE A;  2XXU A;  2B65 A;  4DI4 B;  2O6A A;  2Z22 A;  1PB8 A;  4IY5 A;  3H6W A;  4NF8 A;  3IAZ A;  2R8T A;  4PAI A;  3FAT A;  3OMB A;  1QJM A;  4E0W A;  1MXW A;  2F7C A;  4GX6 A;  2F7A A;  2DE3 A;  2YPN A;  2WBB A;  2XXH A;  3HFU A;  1NI9 A;  3TYH A;  4RK9 A;  3ONM A;  3E4R A;  2F6P A;  4AS4 A;  5AA2 D;  3OSR A;  4DI3 D;  1WDN A;  3TTR A;  1Z7N E;  4NF6 B;  2AYS A;  4OVR A;  1MQJ A;  3TTN A;  3IOV A;  3VXC A;  5I57 B;  2RF1 A;  1FBE A;  3ZKK A;  3U65 A;  3TTM A;  1B3G A;  5FBP A;  2NUV A;  1HSL A;  2FNC A;  2X7P A;  1D4N A;  4X8R A;  3R6U A;  1FBC A;  3FZV A;  2QS2 A;  5AA2 A;  3PD8 A;  1LAG E;  1LST A;  4AB5 A;  1ATG A;  4N6P A;  1M5D A;  3IO4 A;  3O66 A;  2CZH A;  5AA3 A;  1OQH A;  1MM6 A;  3FXB A;  4YIC A;  1B3H A;  1N84 A;  1YCJ A;  2XX9 A;  4GWS A;  4U1O A;  4MNP A;  3RY3 A;  2KLF A;  3RN8 A;  2Q8M A;  3PUZ E;  3C4M A;  3N6T A;  1QVS A;  3HO7 A;  2OJT A;  3FJM A;  1VE4 A;  5ET6 A;  3CRB A;  5TU0 A;  4THI A;  2DS9 A;  1RDY A;  4H8J A;  2V3T A;  4HCY A;  4FEB A;  4RK2 A;  5CRY A;  4P56 A;  3OO9 A;  4MMP A;  4KR5 A;  4G8H A;  2CZK A;  3H6V A;  3ZS6 A;  3FXQ A;  4LZ5 A;  4TOZ A;  2Q89 A;  2XXY A;  2R9J A;  4Q30 B;  1FQD A;  3KN8 A;  2XXK A;  2O69 A;  4PBH A;  3L6G A;  4LQ2 A;  3EF7 A;  1EYK A;  3FJ7 A;  4F31 B;  1MXU A;  1JW4 A;  2OK2 A;  4EUO A;  2RIN A;  2RC7 A;  4OMB A;  1BP5 A;  1CB6 A;  1JEV A;  3G3I A;  4TQU Q;  1FPK A;  1MG1 A;  3TUS A;  2XWO A;  3DP6 A;  5ICT A;  1B0L A;  2Q8J A;  1N76 A;  1QKA A;  1RYO A;  1XS5 A;  5JTY B;  3M3L A;  4FBP A;  3TCH A;  5AA1 A;  1QUI A;  1LBV A;  1LBC A;  4ZEI A;  2DVC A;  4G2Z A;  2V3U A;  1MQH A;  3ZKL A;  3BFT A;  4GWU A;  2VD2 A;  1FQB A;  1FTK A;  3IOU A;  3VLV A;  1J1N A;  1D9V A;  1II5 A;  4ZDM A;  3FJG A;  4FEC A;  3S9M C;  2ZXT A;  3TKD A;  2UXA A;  4IO4 A;  5CBR A;  3T9H B;  2F3B A;  2PCR A;  2CZL A;  3VVE A;  2F6G A;  1LAX A;  1FBG A;  1O63 A;  1POT A;  1YYZ A;  2OLB A;  4QRZ A;  4Q0C A;  4DLD A;  4GFR A;  4P3L A;  3HV1 A;  2RCB A;  3K01 A;  3VVF A;  1SDX A;  2ZYK A;  5BUU A;  2O84 X;  3FV1 A;  3PPO A;  2H25 A;  1H43 A;  2VP1 A;  4YB6 A;  1ZIU A;  1UIV A;  1H45 A;  4GBV A;  1L5T A;  5I59 B;  3U94 A;  1BKA A;  3IB2 A;  3HPI A;  4OET A;  2RC9 A;  5K2Y A;  4BDN A;  1OVB A;  4PF6 A;  4N17 A;  3O2A A;  3S4U A;  3KG2 A;  1GVC A;  5EQ9 A;  5KDT A;  1DCU A;  4KCD A;  2CMO A;  1M5F A;  1T0K A;  5JK4 A;  1IMA A;  1B5J A;  3SKP A;  2R6G E;  3MVY A;  4GIZ A;  3C36 A;  4AS5 A;  5L9O A;  5DVI A;  2Y7I A;  4GF8 A;  1DPE A;  3ROJ A;  1M5C A;  1Y20 A;  3O29 A;  2GH9 A;  2DXR A;  1JP4 A;  2WYK A;  3KBZ A;  4KYS A;  5IZ3 A;  3TDJ A;  3LUZ A;  5DW8 A;  3H3G A;  1XOC A;  4ESX A;  5H8H A;  1LCT A;  2P0S A;  2Y84 A;  4LN5 A;  2Y7P A;  4IO3 A;  4GXA A;  4G8N A;  4N13 A;  3R7X A;  5H8Q A;  1NUY A;  4N81 A;  3T1B A;  1KWH A;  1MY4 A;  5ET5 A;  3MVW A;  3U1O A;  4IO7 A;  3B7D A;  4P1L A;  4PGN A;  3ODB A;  1LFG A;  5KCJ A;  1B4H A;  1N3X A;  3K6X A;  3OEN A;  4N4U A;  5I5P A;  1B2H A;  3IB1 A;  4GX3 A;  4O94 A;  4H45 A;  5TP9 A;  3E78 A;  2GQ1 A;  4NX1 A;  1EYJ A;  3V5A A;  3OEK A;  4ONY A;  3FIR A;  3SEU A;  1R9L A;  3FXU A;  4H1X A;  3IJX B;  4WED A;  4UA8 A;  1R9Q A;  5J1D A;  3C9H A;  1JVX A;  2OCU A;  3OD7 A;  3AXF A;  1TFA A;  4AQ4 A;  1Z7M E;  4LA9 A;  4FIM A;  4X04 A;  4NGU A;  2FA7 A;  3D1R A;  3MST A;  1PC3 A;  4JBZ A;  4EQ9 A;  4R2B A;  3KJ7 A;  1ZLQ A;  1SW2 A;  3OOA A;  5A5X A;  2HCA A;  3T9X B;  3RGY A;  1FJ6 A;  2RKM A;  5H8N A;  3RPL A;  3TCG A;  1R1N A;  1URD A;  1B1H A;  1IXH A;  1SW5 A;  3KEI A;  4H8I A;  5EQ7 A;  1LAH E;  4F1V A;  3K00 A;  5H8Q B;  1NV4 A;  3FAS A;  4QBA A;  3JYR A;  4XKQ A;  5L9M A;  3PPQ A;  1BIY A;  1BLF A;  1NV1 A;  1XT8 A;  4ELO A;  4GL0 A;  4P9K A;  2LAO A;  2I3V A;  3SEY A;  4PC9 A;  1VFE A;  3VDF A;  4ZE8 A;  1FTM A;  4YZZ A;  5TPA A;  1PBP A;  2FIX A;  4IY6 A;  1P1N A;  1MQI A;  4GXS B;  1S9T A;  4PFY A;  3KSX A;  4NF4 A;  3T93 B;  3V89 B;  1ZU0 A;  4PET A;  5IM2 A;  3IFA A;  1UIU A;  2O1M A;  2HEU A;  2CEX A;  1D9Y A;  2Q9T A;  1I69 A;  5LOM A;  5IZZ A;  1OQG A;  5A5X B;  3VLW A;  2DDK A;  3FUZ A;  4NG7 A;  3CG1 A;  2PFY A;  3RPL B;  3HN0 A;  2XXW A;  1MS7 A;  2HPG A;  4RYA A;  4QHQ A;  4OVP A;  4NF5 B;  4DDD A;  2B4M A;  1SD3 A;  3I3V A;  1GGG A;  1P1W A;  1VFD A;  1IXI A;  2I58 A;  3RT6 B;  3K02 A;  1IMF A;  2H98 A;  3THI A;  3UA8 A;  3FVO A;  2VPO A;  1USY H;  3Q27 A;  2VPN A;  1A8E A;  1MPD A;  2OZZ A;  3EHU A;  3IOR A;  2O7U A;  1FQE A;  2I0B A;  4R73 A;  5I57 A;  2HQ0 A;  2OWZ A;  1TWY A;  1B3F A;  1XVY A;  1OVT A;  3HHF A;  3KN7 A;  4Z7E A;  1MY2 A;  4NF4 B;  3KJT A;  4ISU A;  4QFN A;  4GOT A;  1P1Q A;  1JET A;  1K9Z A;  3LV0 A;  3EPE A;  2THI A;  4TLL B;  2GHA A;  4XKP A;  1YTV A;  2Q88 A;  3DP8 A;  1G0H A;  3T0J A;  3RUM A;  3T66 A;  3QSL A;  4I8C A;  4ZED A;  3H6T A;  4LVQ A;  1USY E;  2QJE A;  2AL5 A;  2Y7W A;  3E13 X;  1G0I A;  1KA1 A;  4MNI A;  2ABH A;  4ZE9 A;  1IXG A;  4OER A;  4Z0I A;  3SDF A;  1EZO A;  3SZP A;  4F3G A;  4PCD A;  4LON B;  1B9J A;  5EHS A;  3PPN A;  3DP4 A;  5F7V A;  2CEY A;  3P7I A;  4YKI A;  4MHF A;  3KFM A;  3E3K A;  3FD3 A;  2XA5 A;  4PTK A;  4RPN A;  1Q35 A;  1IQ7 A;  1ZMG A;  5I56 B;  3PPP A;  2DXY A;  3VXB A;  1M5E A;  1B05 A;  2WBD A;  3UGW A;  2Q2C A;  2F78 A;  1KZ8 A;  3S9N C;  4GL8 A;  1FBD A;  1FBH A;  2DOJ A;  4HE0 A;  4PDD A;  5ITO A;  2ZZV A;  3ILU B;  4N8G A;  1NKX A;  3V8X B;  4RXL A;  4OAN A;  1AWB A;  3O9P A;  1A99 A;  4R9G A;  4TLM B;  2HFB A;  2M8C A;  4QFL A;  1Y9U A;  4G68 A;  4XIG Q;  5JTY A;  4EQB A;  3LSX A;  3UP9 A;  4RY1 A;  1GV8 A;  2DSF A;  4N6D A;  1SVX B;  1B58 A;  3UK4 A;  1NNP A;  3BIG A;  1WVJ A;  4NQ8 A;  2MKZ A;  2IA4 A;  3MP8 A;  2DE4 A;  4YMA A;  4KD5 A;  1YXI A;  5FHM A;  2Y5K A;  5IGA A;  5F24 A;  3W9W A;  1SQY A;  3MYU A;  2OX3 A;  4OVS A;  3S9L C;  2R71 A;  4OVQ A;  1PEB A;  4R6Y A;  1DBZ A;  4ZEK A;  3PGF A;  4G61 A;  3G3G A;  2WEF A;  2DP8 A;  1N0T A;  3WAE A;  3H4Z A;  1I6B A;  4O7M A;  3I6V A;  2XWI A;  4DE8 A;  1IMB A;  5I2K B;  1A40 A;  4FAT A;  4QF9 A;  1FPB A;  5ELV A;  4F3S A;  3GBB A;  1VSO A;  3LSW A;  4HS7 A;  3PMW A;  5I59 A;  2PVU A;  2NWJ A;  4YMB A;  4GD5 A;  3O28 A;  1KA0 A;  4HE1 A;  5JEI A;  3KZG A;  4G68 B;  4OEU A;  1IME A;  4OEN A;  5M2V A;  4PFW A;  4OVJ A;  2AIX A;  1DSN A;  4OFO A;  1Y3N A;  2PT2 A;  2XHD A;  3SEW A;  1MDQ A;  5LDZ A;  3VE1 B;  1F9B A;  4JVI A;  3SEV A;  1SYI A;  2QS1 A;  3W15 C;  1N7W A;  2UYE A;  3B50 A;  4N6K A;  4JWX A;  1JVY A;  2RCA A;  2XXR A;  2I48 A;  5FTH A;  3CVG A;  1DTZ A;  4PFT A;  2FBP A;  2O1L A;  2F36 A;  1Q1K A;  3HST A;  1MY1 A;  5K2X A;  2KQZ A;  2WX9 A;  2FVZ A;  3NOH A;  2YLN A;  2QS4 A;  1LBZ A;  4RA1 A;  1SBP A;  4HCW A;  3FGS A;  2BJJ X;  4ZZA A;  3IL1 B;  4AB6 A;  1LBY A;  1RDX A;  1PBQ A;  3B8B A;  1DK4 A;  4ECF A;  4NE4 A;  4LP2 B;  1CE2 A;  1IXC A;  2NXO A;  2DWI A;  3EKI A;  5ET8 A;  2B3B A;  3CFZ A;  2H5Y A;  4DZ1 A;  3U92 A;  2KR0 A;  4R75 A;  3Q25 A;  4P0I A;  4KFQ A;  1B6H A;  3TQW A;  3TAJ A;  4C1U A;  1B7U A;  1MY0 A;  1FPE A;  4I9D A;  4PAF A;  1RDZ A;  3K1M A;  2ZYM A;  4OYV A;  1B3E A;  1OLA A;  1PB9 A;  4UAC A;  4MX6 A;  3PU5 A;  2ZYN A;  2PMS A;  4PP0 A;  3C33 A;  4IGR A;  1WOD A;  2FHY A;  1MPC A;  4P11 A;  3TTK A;  2ESN A;  1QUJ A;  3OO8 A;  1D9Q A;  2H4I A;  1NMU A;  3ISP A;  3A3C A;  2V4C A;  2XXP A;  3RNN A;  3W9V A;  5I2N B;  2UYF A;  5DEX A;  3DEL B;  2PYY A;  3D4C A;  1AH5 A;  1FTL A;  1LBW A;  4R2F A;  4WXJ A;  4OWD A;  4KQP A;  4I40 A;  1AMF A;  1FSA A;  4YKK A;  4H5G A;  3FVK A;  2VT5 A;  1B7Z A;  4DCX A;  4ELP A;  3V83 A;  4QSE A;  4FED A;  4ND9 A;  1Q9D A;  1TFD A;  3TMG A;  5DTB A;  2XXQ A;  3K2D A;  3RPW A;  1MDP 1;  4H0W A;  3O6H A;  3FV2 A;  4QFP A;  2B3F A;  4XKN A;  4X48 A;  2WYP A;  3KN3 A;  3JZJ A;  4P0G A;  4XKR A;  4K3F A;  3PD9 A;  3OEM A;  5H8F B;  1H3D A;  3CSG A;  4XTC Q;  2L5V A;  4ZEC A;  3MZB A;  4OEV A;  4I3Y A;  4I3E A;  5I84 A;  4Q5T A;  1FPJ A;  4MJO A;  4MF3 A;  1OMP A;  2UVH A;  4NMY A;  1UTB B;  2E0S A;  4UAB A;  4JVD A;  2I4C A;  3B6W A;  4XEQ A;  5I7I A;  2WKY A;  1FQA A;  5CM6 A;  3BKI B;  1LBB A;  5KZT A;  2V93 A;  3RT8 A;  2XD2 A;  3KGC A;  5DEX B;  1MH3 A;  4XF5 A;  4F2O A;  1H76 A;  4NAP A;  1VR5 A;  1LLS A;  1LFH A;  2W7Y A;  3T9U A;  1JQF A;  3IR1 A;  4NF5 A;  2P3V A;  1IUD A;  5T3J A;  5B70 A;  2OBG A;  2P1S A;  3USD A;  4BDQ A;  5L8D A;  4KYD A;  4MAG A;  2OWT A;  3PUY E;  2F35 A;  5ITP A;  4H46 A;  5EYF A;  2I6E A;  2O7I A;  2VHA A;  4YU0 A;  2GHB A;  1DOT A;  3MP6 A;  4I1D A;  1SW4 A;  3C34 A;  1K9Y A;  4YKJ A;  1OIB A;  3QAX A;  2GRV A;  4QFO A;  5I58 B;  2DQV A;  2Y5L A;  1FRP A;  4GBW A;  3LC8 A;  2I3W A;  1P1O A;  5FTI A;  4PFI A;  2H99 A;  3GZG A;  4PE3 A;  4QSD A;  1S7Y A;  2P2A A;  4IO5 A;  5DVF A;  4G77 A;  4PAK A;  4XFE A;  1P99 A;  3T96 B;  4YB5 A;  1JW5 A;  1SI1 A;  4IO6 A;  2I49 A;  1GTK A;  4N91 A;  1CNQ A;  4GQO A;  4OZ9 A;  4G68 C;  2NVU B;  1NL5 A;  2G93 A;  1AIV A;  1R6Z A;  4MCO A;  5EQA A;  3LSF B;  2DE2 A;  1B0H A;  3MVZ A;  2ZNU A;  3QK6 A;  1EH3 A;  5IAI A;  2UVJ A;  4ZEB A;  2X7Q A;  2ZYO A;  1B32 A;  3VFJ A;  5CBS A;  4JXI A;  1DTG A;  4PFB A;  3K1N A;  4GLI A;  1SYH A;  3CSB A;  5I56 A;  1FJ9 A;  4H6D A;  4KCC A;  3KOT A;  3E9X A;  4OHN A;  3PUV E;  4H65 A;  3PMX A;  4L17 A;  4LZ7 A;  2XX7 A;  1YAE A;  1FTA A;  2Z8D A;  2DVZ A;  1TT1 A;  4R72 A;  5AE4 A;  5B7D A;  1B5H A;  2F34 A;  4BDO A;  4NED A;  2HXR A;  4PDH A;  2Y7R A;  2XXV A;  4LQ5 A;  2PBW A;  2F7B A;  1BK4 A;  3TEL A;  1FPD A;  5I3S A;  3EHT A;  3FVN A;  1LFI A;  3U8Q A;  4EXK A;  1NNK A;  3MP1 A;  1O7T A;  3A09 A;  4R6H A;  1ZKB A;  1B4Z A;  4P1E A;  3VLU A;  1ANF A;  4KI0 E;  4KPT A;  4PE5 B;  4RJZ A;  2V3Q A;  3PUX E;  4F3P A;  3QMF A;  3OO7 A;  3QUJ A;  4YKP A;  1GR2 A;  1POY 1;  1TXF A;  4N07 A;  3N26 A;  2A5T A;  1N04 A;  5HBC A;  3ZSF A;  1MRP A;  1PB7 A;  4X9T A;  1IMC A;  5ISU A;  3LBS A;  2QVR A;  4YB7 A;  2V84 A;  4U2R A;  1US4 A;  1IIW A;  2HZL A;  1LCF A;  4IB2 A;  4POX A;  4F3B A;  1DMB A;  4GWO A;  1B52 A;  4OVT A;  5CMC A;  3K4U A;  1FQC A;  4PGP A;  2F8D A;  2HHM A;  4JWY A;  1FPI A;  4LZ8 A;  4EF2 A;  5F1Q A;  3KBR A;  4BLA A;  2XWV A;  5HM4 B;  4KXP A;  1NH8 A;  5I2K A;  4P8B A;  2HAV A;  3PUW E;  3PV0 E;  3TPA A;  3C35 A;  3UN6 A;  3CI8 A;  3RTF B;  5HPQ A;  4OTE A;  3R26 A;  4X1D A;  1MXY A;  1NV5 A;  1UTH B;  3MUQ A;  4ZEF A;  3GXA A;  2PX1 A;  3H06 B;  3QIM A;  4DIG A;  4DXB A;  4QSC A;  1A54 A;  4BDR A;  2DYX A;  1US5 A;  5LTC A;  5FHO A;  3CIJ A;  3JV9 A;  4R6K A;  1FPF A;  1PDA A;  5ESY A;  4MEV A;  3BIH A;  2HZK A;  1NUW A;  3CHG A;  1UQW A;  4GWW A;  5BWJ A;  2A5T B;  4HTG A;  2QVV A;  3IX1 A;  3PPR A;  2QS3 A;  3S2V A;  4NF8 B;  3N5L A;  4N15 A;  4LAT A;  1MM7 A;  5ET7 A;  1LGB C;  1LAF E;  1B3L A;  2YJP A;  4IO2 A;  1B51 A;  4R74 A;  2P3N A;  1MH4 A;  3U72 A;  2XXX A;  5EYH A;  3G3H A;  4HE2 A;  4I62 A;  2ONK E;  4JSO A;  4FOR A;  3MZ1 A;  4P47 A;  4HXV A;  3UOR A;  1FTJ A;  2Z8F A;  2AL4 A;  3B6T A;  4MLQ A;  1A55 A;  1B46 A;  4FAJ A;  1FW0 A;  2E1S A;  4GX4 A;  1QW0 A;  3CFL A;  1A8F A;  1ZTY A;  1JW1 A;  4MNC A;  1YPN A;  4JDF A;  1JNF A;  3QYT A;  2V25 A;  1MXX A;  4PFR A;  1SI0 A;  3MJN A;  1I6A A;  5EHM A;  3H7M A;  3DLN A;  3Q29 A;  4MBP A;  3BFU A;  5AA2 B;  2QFL A;  1FQF A;  1IIT A;  4EDP A;  1M5B A;  4ELR A;  4GVO A;  1IMD A;  3EQ1 A;  2ALU A;  3TOD A;  2ONS A;  3C31 A;  3U93 A;  4F39 A;  1OLC A;  4F1U A;  4U21 A;  3IJO B;  3K6W A;  4OFL A;  5DVJ A;  4OA4 A;  3MWB A;  2ZZX A;  4E0X A;  5I2N A;  3Q26 A;  1NFT A;  1QKB A;  2DWJ A;  4U1Z A;  4F18 A;  2ZNS A;  2ANJ A;  1QUL A;  4NWD A;  1BTJ A;  3UIF A;  5H8S A;  3G7W A;  1Y1M A;  3GLB A;  4KHZ E;  4U23 A;  2Q2A A;  4MH5 A;  2A5S A;  4M4G A;  4O3B A;  1EU8 A;  2D5W A;  1NV0 A;  4OQO A;  4OXV A;  3T22 A;  3FVG A;  1MXZ A;  2ZZW A;  3RYD A;  2B4L A;  4QXD A;  4JB7 A;  1NH7 A;  1B1X A;  2ONR A;  5CC2 A;  1A7L A;  3EN3 A;  4R9F A;  3K1P A;  3IOT A;  2XXT A;  3Q28 A;  5H8F A;  2PT1 A;  3LUY A;  1RYX A;  4RPO A;  1Y3P A;  4DXU A;  1XVX A;  3FBP A;  1RKM A;  5J16 A;  2O68 A;  4GWX A;  3L6H A;  4PBQ A;  3IFC A;  3MC2 A;  5L9S A;  3PTY A;  5A5L A;  1I6Q A;  2RC8 A;  3FXR A;  4OFJ A;  1UTB A;  1Y1Z A;  1D3K A;  4C1T A;  2XWK A;  3SET A;  2REG A;  2JJK A;  4LUB A;  1NV7 A;  2IEE A;  1DPP A;  4NN3 A;  3IOW A;  4GWZ A;  5CI5 A; 
#chains in the Genus database with same CATH homology
 4BDL A;  1B7H A;  1MY3 A;  4F29 A;  4EF1 A;  5AA4 A;  3N6U A;  4HW8 A;  4MLV A;  3RLF E;  3DM0 A;  3F11 A;  2DWA A;  2XXI A;  4ZZE A;  3TQL A;  1EZP A;  3TTL A;  4DCY A;  3S9E A;  3G3K A;  2QL3 A;  2REJ A;  2I0C A;  3HCQ A;  3SEX A;  4M1V A;  1H44 A;  1ZBM A;  1O64 A;  5I58 A;  3K0V A;  2ZNT A;  4IGT A;  4F1Y A;  3MQ9 A;  4H5F A;  3MPL A;  1XC1 A;  4MFI A;  2F97 A;  4ZS9 A;  4O3C A;  3TEP A;  3MZ9 A;  3C32 A;  5DYH A;  4F19 A;  1SW1 A;  1HSJ A;  1B40 A;  3D4G A;  3CR9 A;  4PFU A;  2UVI A;  1QUK A;  3O97 A;  2QMW A;  5KDT B;  3K6V A;  1XHY A;  3IB0 A;  2I4B A;  1Y4T A;  3M3F A;  2NOO A;  1N3W A;  3A3U A;  2Z23 A;  3QXM A;  4FJP A;  3SER A;  1MQG A;  3MBP A;  1NNT A;  3M8U A;  1Y4C A;  2XD3 A;  3G3J A;  3CG3 A;  2Z8E A;  3VV5 A;  3H6U A;  3IO6 A;  3KSJ A;  2F5X A;  2ZMB A;  4POW A;  4QFK A;  1HSE A;  4RNS A;  5AA4 B;  2UVG A;  5FHN A;  3IK6 B;  4U22 A;  4BDM A;  1AL3 A;  4WEP A;  5ICQ A;  3RQT A;  2D3I A;  2VOZ A;  4U4S A;  4PQJ A;  2HAU A;  3O6I A;  4YAH X;  1S50 A;  5H8H B;  5CMB A;  3TCF A;  4U4X A;  4EQ7 A;  1ZJL A;  3PMV A;  3B6Q A;  4OES A;  2QSX A;  3T9V A;  1EZ9 A;  5KCJ B;  2FYI A;  3OEL A;  3OO6 A;  3ECR A;  1MXV A;  3CFX A;  1LB9 A;  2XX8 A;  3SES A;  3BBR A;  3HHG A;  3TFL A;  1AOV A;  1LB8 A;  2G29 A;  5TP9 B;  3QUF A;  4X1B A;  3OXN A;  4F2Q A;  2QMX A;  3O6G A;  3ILT B;  1MPB A;  2QPQ A;  3VVD A;  3K6U A;  3MPK A;  2Y7K A;  2VGQ A;  4XXU A;  3TZA A;  5CMM A;  2DWH A;  5IKB A;  1Y3Q A;  3MVX A;  1JEU A;  3N94 A;  2X26 A;  2VD3 A;  4ELQ A;  2D21 A;  5H8N B;  4C0R A;  3KOS A;  4O3A A;  5CMK A;  3WAF A;  4DXC A;  4Q8R A;  3LSL A;  4H67 A;  3EHS A;  3I5O A;  4KYE A;  1FCK A;  4ESW A;  1URS A;  4JWO A;  3MAM A;  1IEJ A;  4JSD A;  4G8M A;  2OWS A;  4G4P A;  2QRY A;  3OSQ A;  3M3K A;  4F22 A;  3G3F A;  3LR1 A;  4NF6 A;  1ELJ A;  5TPA B;  4NTL A;  1MQD A;  4GRK A;  4NWC A;  1UTH A;  2HXW A;  1IZ1 A;  4FE8 A;  4EXL A;  1FTO A;  1NNF A;  3RTW B;  4WKM A;  1N7X A;  1B5I A;  2O51 A;  1P1U A;  5DT6 A;  3GBA A;  1URG A;  3H03 A;  3MW0 A;  2H9B A;  2GFE A;  2XXU A;  2B65 A;  2O6A A;  2Z22 A;  1PB8 A;  4IY5 A;  3H6W A;  4NF8 A;  3IAZ A;  3FAT A;  3OMB A;  1QJM A;  4E0W A;  1MXW A;  2F7C A;  2F7A A;  2DE3 A;  2YPN A;  2XXH A;  3TYH A;  4RK9 A;  3ONM A;  3E4R A;  2F6P A;  5AA2 D;  3OSR A;  1WDN A;  3TTR A;  1Z7N E;  4NF6 B;  2AYS A;  1MQJ A;  3TTN A;  3IOV A;  3VXC A;  5I57 B;  2RF1 A;  3ZKK A;  3TTM A;  1B3G A;  2NUV A;  1HSL A;  2FNC A;  2X7P A;  1D4N A;  3R6U A;  3FZV A;  2QS2 A;  5AA2 A;  3PD8 A;  1LAG E;  1LST A;  4AB5 A;  1ATG A;  4N6P A;  1M5D A;  3IO4 A;  3O66 A;  5AA3 A;  1OQH A;  1MM6 A;  4YIC A;  1B3H A;  1N84 A;  1YCJ A;  2XX9 A;  4U1O A;  3RY3 A;  2KLF A;  3RN8 A;  3PUZ E;  3C4M A;  3N6T A;  1QVS A;  3HO7 A;  2OJT A;  3FJM A;  1VE4 A;  3CRB A;  5TU0 A;  4THI A;  2DS9 A;  4H8J A;  2V3T A;  4HCY A;  4FEB A;  4RK2 A;  5CRY A;  3OO9 A;  4KR5 A;  4G8H A;  3H6V A;  3ZS6 A;  3FXQ A;  4LZ5 A;  4TOZ A;  2Q89 A;  2XXY A;  2R9J A;  4Q30 B;  1FQD A;  3KN8 A;  2O69 A;  3L6G A;  4LQ2 A;  3EF7 A;  4F31 B;  3FJ7 A;  1MXU A;  1JW4 A;  2OK2 A;  4EUO A;  2RIN A;  2RC7 A;  4OMB A;  1BP5 A;  1CB6 A;  1JEV A;  3G3I A;  4TQU Q;  1MG1 A;  3TUS A;  3DP6 A;  5ICT A;  1B0L A;  2Q8J A;  1N76 A;  1QKA A;  1RYO A;  1XS5 A;  5JTY B;  3M3L A;  3TCH A;  5AA1 A;  1QUI A;  1LBC A;  4ZEI A;  2DVC A;  4G2Z A;  2V3U A;  1MQH A;  3ZKL A;  3BFT A;  2VD2 A;  1FQB A;  1FTK A;  3IOU A;  3VLV A;  1J1N A;  1D9V A;  1II5 A;  4ZDM A;  3FJG A;  4FEC A;  3S9M C;  2ZXT A;  3TKD A;  2UXA A;  4IO4 A;  5CBR A;  3T9H B;  2CZL A;  3VVE A;  2F6G A;  1LAX A;  1O63 A;  1POT A;  2OLB A;  4QRZ A;  4Q0C A;  4DLD A;  4GFR A;  3HV1 A;  2RCB A;  3K01 A;  3VVF A;  1SDX A;  2ZYK A;  5BUU A;  2O84 X;  3FV1 A;  3PPO A;  2H25 A;  1H43 A;  2VP1 A;  4YB6 A;  1ZIU A;  1UIV A;  1H45 A;  1L5T A;  5I59 B;  3U94 A;  1BKA A;  3IB2 A;  3HPI A;  4OET A;  2RC9 A;  5K2Y A;  4BDN A;  1OVB A;  3O2A A;  3S4U A;  3KG2 A;  1GVC A;  5KDT A;  4KCD A;  2CMO A;  1M5F A;  1T0K A;  5JK4 A;  1B5J A;  3SKP A;  2R6G E;  3MVY A;  4GIZ A;  3C36 A;  5L9O A;  5DVI A;  2Y7I A;  4GF8 A;  1DPE A;  1M5C A;  1Y20 A;  3O29 A;  2GH9 A;  2DXR A;  4KYS A;  3TDJ A;  3H3G A;  1XOC A;  4ESX A;  5H8H A;  1LCT A;  2P0S A;  2Y84 A;  2Y7P A;  4IO3 A;  4GXA A;  4G8N A;  4N13 A;  3R7X A;  5H8Q A;  1KWH A;  1MY4 A;  3MVW A;  3U1O A;  4IO7 A;  3B7D A;  3ODB A;  1LFG A;  5KCJ A;  1B4H A;  1N3X A;  3K6X A;  3OEN A;  1B2H A;  3IB1 A;  5TP9 A;  3V5A A;  3OEK A;  4ONY A;  3FIR A;  3SEU A;  1R9L A;  3FXU A;  4H1X A;  3IJX B;  4WED A;  4UA8 A;  1R9Q A;  5J1D A;  3C9H A;  1JVX A;  2OCU A;  3OD7 A;  3AXF A;  1TFA A;  4AQ4 A;  1Z7M E;  4LA9 A;  4FIM A;  2FA7 A;  1PC3 A;  4JBZ A;  4EQ9 A;  4R2B A;  3KJ7 A;  1ZLQ A;  1SW2 A;  3OOA A;  5A5X A;  2HCA A;  3T9X B;  3RGY A;  2RKM A;  5H8N A;  3TCG A;  1R1N A;  1URD A;  1B1H A;  1IXH A;  1SW5 A;  3KEI A;  4H8I A;  1LAH E;  4F1V A;  3K00 A;  5H8Q B;  3FAS A;  3JYR A;  4XKQ A;  5L9M A;  3PPQ A;  1BIY A;  1BLF A;  1XT8 A;  4ELO A;  4GL0 A;  2LAO A;  2I3V A;  3SEY A;  1VFE A;  3VDF A;  4ZE8 A;  1FTM A;  4YZZ A;  5TPA A;  1PBP A;  4IY6 A;  1P1N A;  1MQI A;  4GXS B;  1S9T A;  4PFY A;  3KSX A;  4NF4 A;  3T93 B;  3V89 B;  1ZU0 A;  4PET A;  1UIU A;  2O1M A;  2HEU A;  1D9Y A;  2Q9T A;  1I69 A;  5LOM A;  1OQG A;  5A5X B;  3VLW A;  3FUZ A;  3CG1 A;  3HN0 A;  2XXW A;  1MS7 A;  4RYA A;  4QHQ A;  4NF5 B;  4DDD A;  1SD3 A;  3I3V A;  1GGG A;  1P1W A;  1VFD A;  1IXI A;  2I58 A;  3RT6 B;  3K02 A;  2H98 A;  3THI A;  3UA8 A;  3FVO A;  1USY H;  3Q27 A;  1A8E A;  1MPD A;  2OZZ A;  3EHU A;  3IOR A;  2O7U A;  1FQE A;  2I0B A;  4R73 A;  5I57 A;  2HQ0 A;  1TWY A;  1B3F A;  1XVY A;  1OVT A;  3HHF A;  3KN7 A;  4Z7E A;  1MY2 A;  4NF4 B;  3KJT A;  4ISU A;  4QFN A;  4GOT A;  1P1Q A;  1JET A;  3EPE A;  2THI A;  4TLL B;  2GHA A;  4XKP A;  1YTV A;  2Q88 A;  3DP8 A;  3RUM A;  3T66 A;  3QSL A;  4I8C A;  4ZED A;  3H6T A;  4LVQ A;  1USY E;  2QJE A;  2AL5 A;  2Y7W A;  3E13 X;  2ABH A;  4ZE9 A;  1IXG A;  4OER A;  4Z0I A;  3SDF A;  1EZO A;  4F3G A;  4LON B;  1B9J A;  5EHS A;  3PPN A;  3DP4 A;  5F7V A;  3P7I A;  4YKI A;  3KFM A;  3E3K A;  3FD3 A;  4RPN A;  1Q35 A;  1IQ7 A;  1ZMG A;  5I56 B;  3PPP A;  2DXY A;  3VXB A;  1M5E A;  1B05 A;  3UGW A;  2Q2C A;  2F78 A;  3S9N C;  4GL8 A;  2DOJ A;  5ITO A;  3ILU B;  1NKX A;  3V8X B;  4RXL A;  3O9P A;  1A99 A;  4R9G A;  4TLM B;  2HFB A;  2M8C A;  4QFL A;  1Y9U A;  4G68 A;  4XIG Q;  5JTY A;  4EQB A;  3LSX A;  3UP9 A;  4RY1 A;  1GV8 A;  2DSF A;  1SVX B;  1B58 A;  3UK4 A;  1NNP A;  1WVJ A;  2IA4 A;  3MP8 A;  2DE4 A;  4YMA A;  4KD5 A;  5FHM A;  3W9W A;  1SQY A;  3S9L C;  2R71 A;  1PEB A;  4R6Y A;  4ZEK A;  3PGF A;  3G3G A;  2DP8 A;  1N0T A;  3WAE A;  3H4Z A;  1I6B A;  3I6V A;  4DE8 A;  5I2K B;  1A40 A;  4FAT A;  4QF9 A;  5ELV A;  4F3S A;  3GBB A;  1VSO A;  3LSW A;  4HS7 A;  3PMW A;  5I59 A;  2PVU A;  2NWJ A;  4YMB A;  4GD5 A;  3O28 A;  5JEI A;  3KZG A;  4G68 B;  4OEU A;  4OEN A;  5M2V A;  4PFW A;  4OVJ A;  2AIX A;  1DSN A;  4OFO A;  1Y3N A;  2PT2 A;  2XHD A;  3SEW A;  1MDQ A;  3VE1 B;  1F9B A;  3SEV A;  1SYI A;  2QS1 A;  3W15 C;  1N7W A;  2UYE A;  4JWX A;  1JVY A;  2RCA A;  2XXR A;  2I48 A;  5FTH A;  3CVG A;  1DTZ A;  4PFT A;  2O1L A;  2F36 A;  1Q1K A;  3HST A;  1MY1 A;  5K2X A;  2YLN A;  2QS4 A;  4RA1 A;  1SBP A;  4HCW A;  3FGS A;  2BJJ X;  4ZZA A;  3IL1 B;  4AB6 A;  1PBQ A;  4ECF A;  4NE4 A;  4LP2 B;  1CE2 A;  1IXC A;  2NXO A;  2DWI A;  2B3B A;  3CFZ A;  2H5Y A;  4DZ1 A;  3U92 A;  4R75 A;  3Q25 A;  4P0I A;  4KFQ A;  1B6H A;  3TQW A;  3TAJ A;  4C1U A;  1B7U A;  1MY0 A;  4I9D A;  3K1M A;  2ZYM A;  4OYV A;  1B3E A;  1OLA A;  1PB9 A;  4UAC A;  3PU5 A;  2ZYN A;  2PMS A;  4PP0 A;  3C33 A;  4IGR A;  1WOD A;  1MPC A;  4P11 A;  3TTK A;  2ESN A;  1QUJ A;  3OO8 A;  2H4I A;  1NMU A;  3A3C A;  2XXP A;  3RNN A;  3W9V A;  5I2N B;  2UYF A;  5DEX A;  3DEL B;  2PYY A;  3D4C A;  1AH5 A;  1FTL A;  4R2F A;  4WXJ A;  4OWD A;  4KQP A;  1AMF A;  4YKK A;  4H5G A;  3FVK A;  1B7Z A;  4DCX A;  4ELP A;  3V83 A;  4QSE A;  4FED A;  4ND9 A;  1TFD A;  3TMG A;  5DTB A;  2XXQ A;  3K2D A;  3RPW A;  1MDP 1;  4H0W A;  3O6H A;  3FV2 A;  4QFP A;  2B3F A;  4XKN A;  4X48 A;  3KN3 A;  3JZJ A;  4P0G A;  4XKR A;  4K3F A;  3PD9 A;  3OEM A;  5H8F B;  1H3D A;  3CSG A;  4XTC Q;  4ZEC A;  3MZB A;  4OEV A;  5I84 A;  4Q5T A;  4MF3 A;  1OMP A;  2UVH A;  4NMY A;  1UTB B;  2E0S A;  2I4C A;  3B6W A;  2WKY A;  1FQA A;  5CM6 A;  3BKI B;  1LBB A;  5KZT A;  2V93 A;  3RT8 A;  2XD2 A;  3KGC A;  5DEX B;  1MH3 A;  4F2O A;  1H76 A;  1VR5 A;  1LLS A;  1LFH A;  2W7Y A;  3T9U A;  1JQF A;  3IR1 A;  4NF5 A;  1IUD A;  5B70 A;  2OBG A;  2P1S A;  3USD A;  4BDQ A;  5L8D A;  4KYD A;  2OWT A;  3PUY E;  2F35 A;  5ITP A;  5EYF A;  2I6E A;  2O7I A;  2VHA A;  4YU0 A;  2GHB A;  1DOT A;  3MP6 A;  4I1D A;  1SW4 A;  3C34 A;  4YKJ A;  1OIB A;  3QAX A;  2GRV A;  4QFO A;  5I58 B;  2DQV A;  3LC8 A;  2I3W A;  1P1O A;  5FTI A;  2H99 A;  3GZG A;  4QSD A;  1S7Y A;  2P2A A;  4IO5 A;  5DVF A;  4G77 A;  1P99 A;  3T96 B;  4YB5 A;  1JW5 A;  1SI1 A;  4IO6 A;  2I49 A;  1GTK A;  4GQO A;  4OZ9 A;  4G68 C;  2NVU B;  1NL5 A;  2G93 A;  1AIV A;  1R6Z A;  3LSF B;  2DE2 A;  1B0H A;  3MVZ A;  2ZNU A;  3QK6 A;  1EH3 A;  5IAI A;  2UVJ A;  4ZEB A;  2X7Q A;  2ZYO A;  1B32 A;  3VFJ A;  5CBS A;  4JXI A;  1DTG A;  3K1N A;  4GLI A;  1SYH A;  3CSB A;  5I56 A;  4H6D A;  4KCC A;  3KOT A;  3E9X A;  4OHN A;  3PUV E;  4H65 A;  3PMX A;  4L17 A;  4LZ7 A;  2XX7 A;  1YAE A;  2Z8D A;  2DVZ A;  1TT1 A;  4R72 A;  5AE4 A;  5B7D A;  1B5H A;  2F34 A;  4BDO A;  4NED A;  2Y7R A;  2XXV A;  4LQ5 A;  2PBW A;  2F7B A;  3TEL A;  3EHT A;  3FVN A;  1LFI A;  3U8Q A;  4EXK A;  1NNK A;  3MP1 A;  1O7T A;  3A09 A;  4R6H A;  1ZKB A;  1B4Z A;  3VLU A;  1ANF A;  4KI0 E;  4KPT A;  4PE5 B;  4RJZ A;  2V3Q A;  3PUX E;  4F3P A;  3OO7 A;  3QUJ A;  4YKP A;  1GR2 A;  1POY 1;  1TXF A;  4N07 A;  3N26 A;  2A5T A;  1N04 A;  5HBC A;  3ZSF A;  1MRP A;  1PB7 A;  4X9T A;  5ISU A;  3LBS A;  4YB7 A;  2V84 A;  4U2R A;  1US4 A;  1IIW A;  2HZL A;  1LCF A;  4IB2 A;  4POX A;  4F3B A;  1DMB A;  4GWO A;  1B52 A;  5CMC A;  3K4U A;  1FQC A;  2F8D A;  4JWY A;  4LZ8 A;  4EF2 A;  5F1Q A;  3KBR A;  4BLA A;  5HM4 B;  1NH8 A;  5I2K A;  2HAV A;  3PUW E;  3PV0 E;  3TPA A;  3C35 A;  3UN6 A;  3CI8 A;  3RTF B;  5HPQ A;  4OTE A;  3R26 A;  4X1D A;  1MXY A;  1UTH B;  3MUQ A;  4ZEF A;  3GXA A;  2PX1 A;  3H06 B;  3QIM A;  4DIG A;  4DXB A;  4QSC A;  1A54 A;  4BDR A;  2DYX A;  1US5 A;  5FHO A;  3CIJ A;  3JV9 A;  4R6K A;  1PDA A;  2HZK A;  1UQW A;  5BWJ A;  2A5T B;  4HTG A;  3IX1 A;  3PPR A;  2QS3 A;  3S2V A;  4NF8 B;  3N5L A;  4LAT A;  1MM7 A;  1LGB C;  1LAF E;  1B3L A;  2YJP A;  4IO2 A;  1B51 A;  4R74 A;  1MH4 A;  3U72 A;  2XXX A;  3G3H A;  4I62 A;  2ONK E;  4JSO A;  4FOR A;  3MZ1 A;  3UOR A;  1FTJ A;  2Z8F A;  2AL4 A;  3B6T A;  4MLQ A;  1A55 A;  1B46 A;  4FAJ A;  1FW0 A;  2E1S A;  1QW0 A;  3CFL A;  1A8F A;  1ZTY A;  1JW1 A;  1YPN A;  4JDF A;  1JNF A;  3QYT A;  2V25 A;  1MXX A;  1SI0 A;  3MJN A;  1I6A A;  5EHM A;  3H7M A;  3DLN A;  3Q29 A;  4MBP A;  3BFU A;  5AA2 B;  1FQF A;  1IIT A;  4EDP A;  1M5B A;  4ELR A;  4GVO A;  3EQ1 A;  2ALU A;  3TOD A;  2ONS A;  3C31 A;  3U93 A;  4F39 A;  1OLC A;  4F1U A;  4U21 A;  3IJO B;  3K6W A;  4OFL A;  5DVJ A;  3MWB A;  4E0X A;  5I2N A;  3Q26 A;  1NFT A;  1QKB A;  2DWJ A;  4U1Z A;  4F18 A;  2ZNS A;  2ANJ A;  1QUL A;  4NWD A;  1BTJ A;  3UIF A;  5H8S A;  3G7W A;  1Y1M A;  3GLB A;  4KHZ E;  4U23 A;  2Q2A A;  4MH5 A;  2A5S A;  4M4G A;  4O3B A;  1EU8 A;  2D5W A;  4OQO A;  4OXV A;  3T22 A;  3FVG A;  1MXZ A;  4JB7 A;  1NH7 A;  1B1X A;  2ONR A;  5CC2 A;  1A7L A;  3EN3 A;  4R9F A;  3K1P A;  3IOT A;  2XXT A;  3Q28 A;  5H8F A;  2PT1 A;  3LUY A;  1RYX A;  4RPO A;  1Y3P A;  4DXU A;  1XVX A;  1RKM A;  2O68 A;  3L6H A;  3MC2 A;  5L9S A;  1I6Q A;  2RC8 A;  3FXR A;  4OFJ A;  1UTB A;  1Y1Z A;  1D3K A;  4C1T A;  3SET A;  2REG A;  4LUB A;  2IEE A;  1DPP A;  3IOW A;  5CI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...