2F97A

Effector binding domain of benm (crystals generated from high ph conditions)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
216
Chain Sequence
EKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oligomerization of BenM, a LysR-type transcriptional regulator: structural basis for the aggregation of proteins in this family.
pubmed doi rcsb
source organism Acinetobacter baylyi
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator benM
total genus 72
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f97A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f97A02
1MXVA 1Z7ME 1P99A 1B32A 1HSEA 2ONSA 3MPKA 3MZ1A 3HPIA 1IQ7A 1BLFA 1MY2A 1OIBA 1UIVA 1D4NA 3D4CA 4KCDA 1POTA 2DP8A 4QF9A 3TQWA 3U94A 2DWHA 3KGCA 3UIFA 2XXVA 1OMPA 4QFOA 3T9VA 1LCTA 3OD7A 1B51A 3M8UA 3HHFA 3PPPA 4U22A 2OWTA 4U2RA 4C1TA 5TP9A 2XXWA 1JW5A 4IO4A 5DEXA 2AYSA 2I3WA 3TTNA 3GXAA 4RYAA 1MQJA 3FV1A 4H8JA 2XXPA 2XXHA 3PPRA 4U1ZA 5AA4B 2DVZA 4O3AA 4QFLA 4WEPA 4IO3A 1GTKA 2D21A 3FUZA 3O6IA 3N5LA 1JEUA 4QFPA 4R6HA 4XXUA 5F7VA 5ISUA 3O2AA 4TOZA 1Z7NE 2F36A 4GL0A 4H67A 1IXGA 3MAMA 2D3IA 3IX1A 4R6YA 3O66A 1FCKA 1NL5A 3FIRA 4OFLA 4DZ1A 2PVUA 2UVHA 4OENA 3TPAA 3W9WA 4XKNA 2G29A 5L9SA 1MXWA 4GIZA 2O84X 4I1DA 1XS5A 3IB2A 1N84A 1URDA 3I3VA 1MXUA 1FW0A 2F78A 3VLVA 4DE8A 1LAHE 4JWXA 2F6GA 2V25A 3U92A 4R9GA 3TFLA 1VSOA 2F97A 2I4BA 3U72A 5I84A 4IGRA 4PFUA 3TDJA 3F11A 4KQPA 4NF5B 3KFMA 3G3HA 4GOTA 1PB8A 4FATA 4OXVA 4FIMA 1UTBA 1Y4TA 1LFIA 3RPWA 1UTHA 2HZLA 2RC8A 3LR1A 4ECFA 1KWHA 2D5WA 2FYIA 3C9HA 2R71A 1ANFA 2GRVA 4N13A 4RA1A 3O6HA 1B3EA 1B3HA 1IXIA 2DWAA 2F7AA 2H5YA 1UQWA 3LC8A 4QHQA 1M5EA 3N6TA 2DVCA 4LVQA 1EZOA 1N76A 1M5BA 3K6WA 3RLFE 3SDFA 4C0RA 1M5FA 5I56A 2KLFA 3R7XA 3LSWA 2VOZA 3KN7A 1MH3A 3LBSA 4F1VA 2V93A 3PU5A 3SESA 4QRZA 2F8DA 3E13X 3MUQA 4YMBA 4ZEDA 4O3BA 3C33A 2PT2A 3K01A 5DVJA 1XVXA 4XKQA 1H3DA 4NE4A 2I49A 4ZS9A 3TCHA 1US5A 2V3TA 3ONMA 4H1XA 1B6HA 1HSLA 1MY3A 3LSLA 3OO9A 1XC1A 3K6XA 1BTJA 5TPAB 3T9HB 2NVUB 4XKPA 2ONRA 4YB6A 1MQDA 2Y7RA 5EYFA 2PMSA 1Q1KA 3CIJA 4H65A 5DTBA 2V84A 3W9VA 2W7YA 4X48A 5I2NA 2Y7WA 1TT1A 4FECA 4G77A 3FVNA 4R73A 1M5DA 4HCYA 3O28A 3PD9A 1I6QA 2Y84A 3RY3A 2B3BA 1FTJA 2IA4A 3N94A 4MBPA 2OJTA 4U21A 1B5JA 1Q35A 1B5IA 1MPCA 2Z23A 3SERA 2NOOA 4BDNA 5I57B 3QXMA 1ZMGA 4ZEKA 5ICQA 5AA4A 1LFHA 1B0LA 1EH3A 5I2KA 2Q9TA 5J1DA 4YMAA 2UVJA 3GZGA 3H3GA 4M4GA 1Y3NA 3IORA 2A5TB 1EZ9A 1VE4A 2HFBA 5L9OA 2VGQA 1USYH 4ONYA 3FJ7A 4GXSB 2XXIA 1LAXA 2HAUA 3K00A 2RC9A 1MY0A 1TWYA 3HV1A 3HHGA 3OSQA 5ICTA 3P7IA 1JVYA 2F6PA 2RINA 4ZEBA 2AL5A 1B3LA 2ZYNA 2AIXA 4DDDA 1A7LA 1B4HA 2OBGA 3CR9A 4ND9A 4LZ8A 1URGA 1MS7A 1WDNA 4GF8A 3Q26A 4NF5A 2ZYOA 5JTYB 3QYTA 5FHOA 5CMCA 3M3KA 2GHAA 1QUJA 4JXIA 1O64A 3E3KA 1B1HA 5AE4A 1NNFA 3MBPA 3RTWB 4PFTA 1JETA 1MY4A 5DVFA 4LZ7A 1B58A 1IZ1A 4OVJA 2Z22A 1AOVA 5DYHA 4PFWA 3BBRA 1MG1A 1QKBA 1B0HA 3CFZA 3S9EA 4YAHX 3TCFA 3MVZA 1B3GA 4OEUA 1S9TA 1P1WA 1RYOA 1SBPA 3O9PA 4KYDA 5I59B 3L6HA 1GR2A 3WAEA 3E4RA 3TTLA 2FNCA 4GWOA 3TYHA 4DCYA 2HEUA 4OERA 3C31A 3VE1B 3RT8A 5CBRA 1CE2A 3AXFA 1XOCA 3HN0A 3K6UA 2H9BA 3KBRA 3PMVA 4JBZA 5TP9B 5I58B 2H25A 3FZVA 1OVTA 1B52A 1Y4CA 2ZYMA 1B7UA 3H03A 1FTKA 2DSFA 3KOTA 4RXLA 1ATGA 1R9LA 5HBCA 4Q5TA 4DXBA 4ELOA 2PYYA 4O3CA 2QS4A 4AB6A 4LQ5A 2HCAA 4KYSA 1DTGA 3MVYA 4QSCA 5HPQA 4ELRA 3JYRA 4DCXA 3UN6A 2O1MA 3K2DA 1NKXA 3TZAA 1IUDA 1SI1A 3RNNA 1MXYA 1LBBA 4AQ4A 5I59A 1OLCA 3EHTA 3K1PA 2O69A 1FQAA 2OZZA 4LP2B 1P1QA 4MLQA 3SEXA 5AA1A 3G7WA 5CI5A 4YZZA 4YB7A 4U23A 1LBCA 2LAOA 4EXKA 3A3CA 1MM7A 3DP4A 3MP8A 3MP6A 1IITA 4MLVA 4F31B 2H98A 3FV2A 3A3UA 3IR1A 3LSFB 3TUSA 1I69A 3HCQA 1O7TA 3KEIA 3PV0E 1LGBC 3LSXA 4K3FA 5H8QB 2IEEA 1Y1ZA 2QS2A 5I2NB 1QUKA 3B7DA 2B65A 3DP6A 2VD2A 3GLBA 4U1OA 4DXCA 1UTBB 2B3FA 3MQ9A 3UGWA 3SETA 4OFOA 1IXCA 3PMXA 3ECRA 1B9JA 4FE8A 4I8CA 4L17A 4F1YA 2ZXTA 2I4CA 4ESWA 3PGFA 1MQGA 1MM6A 1XT8A 3E9XA 3OOAA 3Q29A 4XTCQ 2R9JA 4YKKA 4F3GA 3K4UA 3W15C 1JQFA 1IXHA 1B05A 3CFLA 3H6WA 4X9TA 2HAVA 3T9UA 3VXBA 4Z7EA 1URSA 5FHNA 1B7ZA 1B4ZA 1MQIA 1LAFE 4Q30B 4YKPA 3V8XB 1FQDA 4ZZEA 3MZBA 2RF1A 1N3WA 3IOVA 3K6VA 3R26A 3EF7A 4GL8A 4IY5A 1NH8A 4IY6A 3OEKA 5H8FA 4MF3A 4PETA 4E0XA 3MP1A 1NNKA 3CRBA 1RKMA 3TKDA 4ZE9A 3FATA 1FTLA 4OETA 1M5CA 1OQHA 2O7IA 3KG2A 4G8MA 4FEDA 2O68A 2REJA 4QFKA 4YKIA 3MVWA 4LUBA 3CG1A 3H06B 4OHNA 2ONKE 2P2AA 4HW8A 4H8IA 1SI0A 1FQFA 4H6DA 3UP9A 5CM6A 3KZGA 1ZKBA 3I6VA 3OO8A 2XXXA 1SW1A 2E1SA 4NF8A 3FXQA 4R6KA 3QIMA 1PDAA 3OEMA 4ZDMA 5FTHA 3DELB 1MY1A 4IO2A 3LUYA 2VD3A 4EDPA 4KCCA 4C1UA 1BKAA 1A99A 1DPPA 1S7YA 4I9DA 3VVFA 3R6UA 4DXUA 3RN8A 4KI0E 3BFTA 3G3KA 5A5XB 3G3IA 4OESA 4LONB 2Q89A 4IO7A 5B70A 1J1NA 1SVXB 2O6AA 2XX7A 1B40A 3OO6A 1VFEA 2ESNA 1NH7A 4LA9A 3CG3A 3SEYA 3IJXB 1LLSA 4QSDA 4NF6A 4WEDA 4ESXA 2I0BA 1FQEA 4NF8B 5I2KB 3TODA 3OELA 2I48A 3K1MA 4HS7A 4N07A 4R72A 1N7XA 5L9MA 3U93A 4DIGA 5I58A 1T0KA 1XVYA 4U4SA 4PP0A 2DXYA 1LB8A 1D9YA 5H8HB 3VVEA 3SEUA 3QUJA 3FXRA 4LQ2A 3N26A 1VFDA 1GVCA 3PUWE 3T93B 4JWYA 4ISUA 4PQJA 1D3KA 2P1SA 3C35A 4Z0IA 4BLAA 1JW1A 2Z8DA 3O97A 1ELJA 5ELVA 1MXXA 5H8QA 3UORA 4NMYA 1FTOA 3VXCA 4BDQA 1QVSA 3DP8A 4F3PA 2I3VA 1A55A 2RC7A 4KHZE 2I58A 3KOSA 3UK4A 1R6ZA 1POY1 1LSTA 1NNTA 2XD2A 3B6WA 3PUZE 4R2BA 5DEXB 1IIWA 2HQ0A 4R9FA 3CSGA 3IOWA 5F1QA 2Y7PA 3B6TA 1ZIUA 3JZJA 2P0SA 4OWDA 3T22A 1AIVA 3PPOA 5H8HA 2GFEA 3EN3A 3S2VA 3TMGA 1OLAA 2F7CA 1A54A 3K1NA 1A40A 3T96B 1YPNA 2CMOA 1Y20A 4H5GA 1MH4A 2CZLA 1BP5A 4TLLB 3KN8A 2OWSA 2UYFA 4GQOA 5H8NA 5FTIA 3SEVA 2O51A 3Q28A 2VP1A 1O63A 5KCJB 1SW4A 3ILTB 3IOUA 4M1VA 3V89B 2REGA 5ITPA 3MC2A 3O6GA 2NXOA 4DLDA 5CMMA 3FJGA 3TTKA 4G68C 4FEBA 2ABHA 2O7UA 1A8FA 2Q2AA 2QS3A 3G3JA 4EF1A 1LAGE 2DXRA 5H8FB 2R6GE 1S50A 4NWCA 2THIA 3PUVE 1N04A 1I6BA 3QK6A 1WODA 2Q88A 2RCAA 3K02A 3M3FA 2XXRA 4LATA 1CB6A 4RPNA 2DQVA 4NWDA 4E0WA 4ZEFA 3MW0A 1LCFA 3IO4A 5AA2B 1IEJA 4R2FA 1XHYA 3JV9A 3MJNA 1AH5A 1TXFA 4G68B 3TTRA 2O1LA 4OZ9A 2DWIA 3TEPA 3TELA 4XKRA 4RPOA 4YB5A 4F3BA 5AA3A 3L6GA 1DTZA 1P1OA 3KJTA 2OK2A 3RTFB 2VHAA 1A8EA 1YCJA 3H7MA 3FD3A 1AMFA 1JNFA 2V3UA 1FTMA 2Y7IA 4POXA 4THIA 3USDA 2RCBA 3QAXA 1H43A 2X7QA 3OSRA 4H5FA 1ZJLA 2ZNTA 4NF6B 3Q25A 4PE5B 3VLWA 1FQBA 4ZE8A 5AA2D 3TAJA 3ODBA 4ELQA 5IAIA 4RK9A 1SW5A 3FVKA 2PX1A 5L8DA 1JW4A 1OVBA 2RKMA 3S9NC 4IO6A 3IOTA 4OFJA 2F35A 3N6UA 4RNSA 3OMBA 4YKJA 4NTLA 4EF2A 5BUUA 4G8NA 3U1OA 1ZTYA 1B2HA 3H4ZA 1DPEA 4F2QA 1N0TA 1YTVA 2UVGA 3H6TA 3KSJA 4KR5A 4JSOA 2XXTA 4UA8A 5CRYA 4QSEA 3S4UA 3U8QA 3CSBA 3EPEA 3HSTA 1OQGA 4BDLA 3VV5A 1MDQA 2A5SA 2ZNSA 3PUYE 4F29A 4EQBA 3FVOA 2QSXA 2FA7A 2XD3A 2XX9A 2XXUA 4F39A 3I5OA 3VVDA 3WAFA 2X7PA 1GV8A 5KDTB 4RK2A 2QPQA 3MWBA 1SQYA 2QL3A 2PBWA 2DOJA 2DE2A 1TFAA 2ZNUA 2DE4A 3IO6A 3KSXA 3RT6B 3QSLA 4BDRA 1H76A 2E0SA 2UYEA 3VLUA 2QMWA 1VR5A 4POWA 2X26A 1AL3A 4R74A 1PB7A 4WKMA 5K2YA 2DS9A 2G93A 4HTGA 5FHMA 3PUXE 4LZ5A 5H8SA 1BIYA 1QUIA 2A5TA 1PB9A 4FJPA 4G4PA 1B7HA 3FGSA 3S9LC 1MDP1 1Y3QA 4X1DA 3CFXA 4R75A 3DM0A 1YAEA 1HSJA 3FVGA 3CI8A 3ZSFA 1Y1MA 3MZ9A 1DSNA 2UVIA 5JK4A 2XHDA 4GFRA 1ZLQA 4RJZA 5KDTA 4F18A 3THIA 3KN3A 4FAJA 2GH9A 2F5XA 4IO5A 4NF4A 4Q8RA 5KCJA 1UTHB 2ANJA 3ZKKA 4KD5A 2QS1A 3GBBA 1H44A 1NFTA 3IAZA 4GLIA 4P0GA 2I6EA 1I6AA 4EQ9A 4H0WA 2BJJX 3OXNA 4EQ7A 5JTYA 5CMBA 3B6QA 2NWJA 3SKPA 1ZU0A 1NMUA 2HXWA 3OO7A 2V3QA 3S9MC 1USYE 1R9QA 1LB9A 4GD5A 5CC2A 4G68A 4OMBA 1B5HA 2YJPA 1SDXA 2HZKA 1L5TA 3UA8A 2QJEA 2GHBA 3A09A 5I56B 4JWOA 3V83A 1SD3A 3IJOB 2ALUA 1NNPA 1D9VA 2OCUA 2ZYKA 2UXAA 3C36A 3D4GA 4GRKA 4HCWA 5A5XA 4N6PA 4Q0CA 5JEIA 4OQOA 4WXJA 3IK6B 5K2XA 1PEBA 3TTMA 1PBQA 4JSDA 3T66A 1QW0A 4NF4B 2F7BA 4GVOA 1SYIA 2Q8JA 3K0VA 2YPNA 4F2OA 5M2VA 2DWJA 3TCGA 4OEVA 4F3SA 2H99A 3V5AA 2PT1A 2WKYA 1N7WA 1GGGA 3CVGA 1P1UA 1Y9UA 4XIGQ 1DOTA 2XXYA 3PPQA 3EQ1A 5ITOA 2YLNA 2Z8EA 4I62A 3VDFA 1EZPA 3QUFA 4JB7A 1F9BA 1B1XA 2QRYA 4G8HA 4YICA 5EHSA 3IB0A 3C32A 1B46A 1II5A 1QULA 2Z8FA 3ILUB 4EXLA 4ZECA 5TU0A 1PC3A 1P1NA 5IKBA 3MVXA 3TQLA 1US4A 3VFJA 4YU0A 1MQHA 2M8CA 4NEDA 4OYVA 3DLNA 3PMWA 4P11A 3RUMA 3C34A 4OTEA 3SEWA 3T9XB 4G2ZA 4IGTA 1Y3PA 3EHUA 3KJ7A 4FORA 4PFYA 2I0CA 3ZKLA 3G3FA 4KFQA 4F22A 2H4IA 1MRPA 4X1BA 3O29A 3IL1B 2DYXA 1R1NA 3M3LA 1LFGA 2QMXA 1MPDA 3IB1A 4KYEA 3BKIB 3FASA 4MFIA 4TLMB 4AB5A 1UIUA 4BDOA 4TQUQ 3Q27A 1JVXA 3H6UA 2Q2CA 4MH5A 3C4MA 1QJMA 4UACA 1H45A 5H8NB 3FJMA 2ZMBA 1WVJA 1PBPA 1SW2A 1FQCA 2OLBA 3HO7A 4ZEIA 3RQTA 3G3GA 5CMKA 4ZZAA 1N3XA 1SYHA 5KZTA 5DVIA 5EHMA 4F1UA 4RY1A 4GXAA 1B3FA 2XX8A 2NUVA 2XXQA 3EHSA 3MPLA 5DT6A 4U4XA 3ZS6A 1MXZA 1RYXA 4P0IA 3RGYA 4KPTA 2AL4A 1QKAA 4ELPA 4EUOA 5CBSA 4IB2A 3GBAA 3OENA 5B7DA 1TFDA 4QFNA 2Y7KA 5AA2A 5HM4B 1MPBA 3PD8A 5TPAA 4F19A 5BWJA 1DMBA 1ZBMA 3H6VA 3PPNA 1EU8A 3BFUA 4JDFA 2DE3A 5I57A 3FXUA 1JEVA 4BDMA 2F34A 5LOMA
chains in the Genus database with same CATH superfamily
2CZIA 1NV4A 1Z7ME 3MPKA 4JB7A 1OIBA 2PCRA 4F1YA 3U94A 3KGCA 1OMPA 4X8RA 4H46A 3OD7A 2WBBA 2OWTA 4U2RA 1JW5A 2I3WA 3TTNA 4JVIA 1MQJA 1DCUA 4H8JA 2XXHA 3PPRA 4U1ZA 5AA4B 4WEPA 2D21A 4QFPA 2XWIA 4H67A 4R6YA 3O66A 1FCKA 2CEXA 2UVHA 4NX1A 4GIZA 4DI3D 3IB2A 1URDA 2QVRA 1MXUA 2F78A 4PF8A 1LAHE 5I3SA 3E79A 1LBZA 3TFLA 3U72A 4PFUA 3TDJA 4MNPA 3LR1A 2R71A 1ANFA 4RA1A 2NWJA 1IXIA 2H5YA 4QHQA 1FRPA 3K6WA 1M5FA 3R7XA 2VOZA 4QRZA 4YMBA 2I49A 3ONMA 2V3TA 4H1XA 4OVPA 1XC1A 1BTJA 5TPAB 1QGXA 2ONRA 3LUZA 1MQDA 1NI9A 5I2NA 2Y7WA 1I6QA 3RY3A 2IA4A 1EYKA 1Q35A 5I57B 2Z23A 2NOOA 1ZMGA 1EH3A 5I2KA 5J1DA 3GZGA 5L9OA 1LAXA 2RC9A 3HHGA 5ICTA 3P7IA 3E78A 2RINA 2AL5A 1B4HA 4ND9A 3CR9A 4HE0A 2ZYOA 1B1HA 1JETA 1MY4A 1B58A 4MCOA 5ET5A 1B0HA 3S9EA 3MVZA 3L6HA 4MEVA 4PAIA 3TTLA 2FNCA 2HEUA 3AXFA 1XOCA 3PMVA 2R8TA 4JBZA 1KZ8A 1B52A 1Y4CA 3KOTA 3H03A 4ELOA 2PYYA 4O3CA 2QS4A 4KYSA 3K2DA 1NKXA 3TZAA 1IUDA 1SI1A 1FQAA 5AA1A 5CI5A 2LAOA 3MP8A 3MP6A 4IR8A 1IITA 2H98A 3FV2A 1VDWA 3TUSA 1O7TA 5H8QB 2IEEA 3B7DA 3DP6A 3SETA 3PMXA 2ZXTA 2I4CA 4ESWA 2R9JA 3K4UA 3W15C 1JQFA 1IXHA 1B05A 2HAVA 2F3BA 1MQIA 1LAFE 4YKPA 1AWBA 4GWSA 3R26A 3EF7A 4IY5A 1NH8A 4IY6A 3OEKA 4PE3A 3MP1A 3CRBA 3KG2A 4FEDA 2O68A 2REJA 5LTCA 3T1BA 3H06B 2ONKE 2P2AA 3KZGA 4XFEA 2E1SA 1LBYA 1MY1A 4C1UA 1BKAA 3RN8A 4KI0E 3G3KA 2ZZXA 2XWOA 1J1NA 2O6AA 2XX7A 1B40A 5I7IA 5T3JA 2I0BA 3TODA 4R72A 2I48A 4N07A 1XVYA 1LB8A 5H8HB 3SEUA 3QUJA 3PUWE 1RDYA 4O8MA 1ELJA 1FTOA 2RC7A 4KHZE 2I58A 3PUZE 3IFCA 1ZIUA 3JZJA 2P0SA 1AIVA 2GFEA 3EN3A 3S2VA 3TMGA 1OLAA 3K1NA 2CMOA 2CZKA 4GQOA 2O51A 3Q28A 3IOUA 1FPKA 3O6GA 2ABHA 2THIA 1N04A 1I6BA 5I58A 2RCAA 2XXRA 4NWDA 4XF5A 1LCFA 3IO4A 1IEJA 5IZZA 3TEPA 4F3BA 1DTZA 2OK2A 1FTMA 4THIA 2WBDA 4NF6B 4H5FA 3Q25A 4ZE8A 3TAJA 4ELQA 3PTYA 1JW4A 1OVBA 2RKMA 3IOTA 4NTLA 1B2HA 4F2QA 4KR5A 2XXTA 5AA2D 3HSTA 4P3LA 4O7IA 1MDQA 3PUYE 2FA7A 5KDTB 3SZPA 1SQYA 2QL3A 1TFAA 1H76A 2E0SA 2QMWA 5K2YA 1AL3A 4R74A 5FHMA 1QUIA 2A5TA 4FJPA 1B7HA 1FBHA 3MZ9A 1DSNA 3KN3A 4MAGA 4NF4A 4Q8RA 1UTHB 3ZKKA 3GBBA 3RPLB 1NMUA 2ZZVA 4G68A 4OA4A 5I56B 2HZKA 3V83A 2B4MA 2GHBA 4K3FA 2ALUA 5ET7A 4N6PA 5JEIA 1PBQA 2XA5A 4F3SA 2DWJA 2PT1A 1GGGA 1P1UA 4XIGQ 4N8YA 5ITOA 4I62A 1IMCA 2QRYA 4PFRA 3IB0A 3ILUB 4ZECA 1P1NA 1FBPA 1CNQA 1MQHA 4OYVA 3DLNA 3T9XB 4IGTA 1Y3PA 3EHUA 3KJ7A 3ZKLA 3G3FA 4F22A 1LFGA 1MPDA 4TLMB 2CEYA 3FXBA 3H6UA 4MH5A 2JJKA 3FJMA 1PBPA 2OLBA 1FQCA 1B3FA 2NUVA 3ZS6A 1RYXA 2AL4A 4IB2A 1TFDA 5HM4B 4DI4B 3H6VA 2DE3A 1JEVA 3TCHA 2ONSA 1HSEA 4G68B 3HPIA 1MY2A 2DP8A 3TQWA 3UIFA 2XXVA 3HHFA 1FPLA 3LV0A 4C1TA 2AYSA 4OANA 3FV1A 1INPA 4O3AA 4QFLA 2B4LA 1JEUA 3N5LA 4R6HA 4PDDA 5F7VA 5ISUA 2F36A 4GL0A 4HE1A 1NL5A 4OFLA 4DZ1A 2PVUA 3TPAA 4OENA 4XKNA 1MXWA 5EYGA 2F6GA 2V25A 4R9GA 4NF5B 4GOTA 4FATA 1LFIA 5IM2A 1B3HA 4NG7A 5A5LA 4LVQA 2DVCA 1EZOA 1N76A 4C0RA 3SDFA 4P47A 3KN7A 2HPGA 3SESA 4ZEDA 3MUQA 4O3BA 2PT2A 3K01A 1FJ9A 4NE4A 4ZS9A 1US5A 1B6HA 1LBWA 1MY3A 3LSLA 3OO9A 2PFYA 2Y7RA 5EYFA 3W9VA 2W7YA 1TT1A 4FECA 4G77A 4R73A 3O28A 4HE2A 1MPCA 4BDNA 4MJOA 2Q9TA 3H3GA 1Y3NA 2A5TB 3FJ7A 1MY0A 1TWYA 3OSQA 1JVYA 2F6PA 1IMFA 2AIXA 1A7LA 1URGA 1MS7A 4GF8A 1NUZA 5JTYB 4NF5A 3QYTA 3M3KA 3E3KA 1NNFA 3MBPA 4LZ7A 4PDHA 4OVJA 2Z22A 3ISPA 3CFZA 1S9TA 1P1WA 4PFBA 4KYDA 1GR2A 1NV2A 3E4RA 3WAEA 4GWOA 3TYHA 4DCYA 1CE2A 3KBRA 2H9BA 2H25A 4AS4A 1FPGA 1OVTA 2ZYMA 3T93B 1ATGA 4DXBA 1EYJA 3MVYA 3JYRA 2O1MA 1MXYA 5I59A 1OLCA 2O69A 2OZZA 4LP2B 4YZZA 3DP4A 4MLVA 4NQ8A 4F31B 3IR1A 1LGBC 1Y1ZA 4DXCA 1UTBB 3ECRA 1B9JA 4L17A 1XT8A 3Q29A 3OOAA 4XTCQ 4HW8A 3H6WA 4Z7EA 1NV6A 5FHNA 4Q30B 3IOVA 5H8FA 1NNKA 2GQ1A 1FTLA 3FATA 3RTWB 1M5CA 1OQHA 2O7IA 4G8MA 4YKIA 1IMAA 4LUBA 1DK4A 4H6DA 2FHYA 5CM6A 4H45A 1G0HA 2Q8MA 3FXQA 4R6KA 1PDAA 2OWZA 3OEMA 5ET6A 3DELB 4IO2A 3LUYA 3RPLA 3R6UA 3BFTA 3G3IA 4OESA 4IO7A 4N81A 1VFEA 2ESNA 4LA9A 1RDXA 1LLSA 4QSDA 4WEDA 5I2KB 1N7XA 5L9MA 1KA0A 4U4SA 4PP0A 4LQ2A 1GVCA 4JWYA 4PQJA 4NN3A 5H8QA 4BLAA 3DP8A 3UK4A 1POY1 1LSTA 3B6WA 1IIWA 2HQ0A 2Y7PA 3T22A 4OWDA 2F7CA 2CZLA 4GX6A 1BP5A 2OWSA 2UYFA 4PCDA 1NV5A 4N8GA 5FTIA 2REGA 5ITPA 3MC2A 4LN5A 4PAFA 3G3JA 5H8FB 4NWCA 3PUVE 3QK6A 1WODA 4LATA 3K02A 4RPNA 4E0WA 4P1LA 3MJNA 5EYHA 4XKRA 3KJTA 1YCJA 3FD3A 1JNFA 2Y7IA 4GWYA 4PAKA 4POXA 3QAXA 3BIGA 4RK9A 1FTAA 3S9NC 4IO6A 4RNSA 3OMBA 4PBQA 1YTVA 3KSJA 4UA8A 3S4UA 3U8QA 3CSBA 3EPEA 1OQGA 3VV5A 1NUYA 2A5SA 3FVOA 4PFIA 3WAFA 2QPQA 2ZNUA 3MSTA 3QSLA 2UYEA 3VLUA 1VR5A 4WKMA 5H8SA 1PB9A 3S9LC 1MDP1 4X1DA 3CFXA 1HSJA 3CI8A 5JK4A 2UVIA 3KC0A 1ZLQA 4FAJA 5KCJA 4EQ9A 2KQZA 4EQ7A 1JP4A 3SKPA 1ZU0A 2HXWA 3OO7A 3S9MC 4GD5A 5CC2A 3D4GA 4JVDA 5A5XA 4WXJA 3IK6B 1PEBA 1QW0A 2F7BA 4GVOA 2YPNA 4F2OA 3TCGA 4OEVA 1N7WA 1KA1A 3B50A 1EZPA 1B1XA 4I3EA 5EHSA 4O94A 3C32A 1B46A 1FBDA 3VFJA 4P11A 3RUMA 3SEWA 4OTEA 5EQ9A 2H4IA 3O29A 1YZ0A 4HXVA 5I5PA 2DYXA 4GX3A 4AB5A 2F3DA 3FASA 1UIUA 4BDOA 3C4MA 1QJMA 4AS5A 2ZMBA 1SW2A 3HO7A 3G3GA 1N3XA 5EHMA 4GWUA 4RY1A 5DT6A 1MXZA 4P0IA 4ELPA 3OENA 2Y7KA 1MPBA 3PPNA 3BFUA 1NV1A 1MXVA 1P99A 3MZ1A 4KCDA 2WYKA 1LBVA 4QFOA 3T9VA 2HXRA 3M8UA 2QVVA 2XXWA 5TP9A 4RYAA 2XXPA 4IO3A 3FUZA 3O6IA 4XXUA 3O2AA 1IXGA 3MAMA 1BK4A 2D3IA 3IX1A 3FIRA 4GWWA 2O84X 1N84A 3I3VA 1FW0A 3VLVA 4DE8A 4JWXA 1VSOA 2I4BA 3B8BA 3F11A 3KFMA 1FPBA 1PB8A 4I3YA 1UTBA 1Y4TA 4XEQA 1UTHA 2HZLA 1KWHA 2D5WA 3C9HA 2Q74A 2GRVA 4N13A 1B3EA 3LC8A 3N6TA 5EQ8A 3BIHA 5I56A 2KLFA 3LSWA 1MH3A 2F8DA 1Q9DA 4OVSA 3A29A 1FBCA 3T9HB 2NVUB 5DTBA 1Q1KA 2V84A 4X48A 4HCYA 3PD9A 1FPJA 1FTJA 3N94A 4MBPA 2OJTA 1B5IA 3SERA 3QXMA 5DW8A 1LFHA 4ZEKA 5AA4A 1B0LA 2UVJA 1SPIA 3IORA 1VE4A 1D9QA 1IMDA 2P3VA 2HAUA 3HV1A 1NV7A 1EYIA 4ZEBA 1IMBA 4LZ8A 1WDNA 3Q26A 4JXIA 5EQ7A 1O64A 5AE4A 5DVFA 1AOVA 5DYHA 4PFWA 3BBRA 1MG1A 1QKBA 3TCFA 2QFLA 1RYOA 1SBPA 5I59B 4QXDA 4PC9A 3C31A 3VE1B 3RT8A 3HN0A 3K6UA 5I58B 3FZVA 1B7UA 3U92A 2WX9A 4Q5TA 4GX4A 4LQ5A 2HCAA 1DTGA 4QSCA 2MKZA 2WYPA 3RNNA 3K1PA 3EHTA 4MLQA 3SEXA 1LBCA 3A3CA 3KEIA 3PV0E 5I2NB 3GLBA 3MQ9A 1IXCA 3KBZA 4FE8A 4I8CA 4MX6A 1MQGA 3E9XA 4F3GA 5LOMA 3CFLA 4X9TA 3T9UA 3VXBA 1URSA 1B7ZA 1B4ZA 1FQDA 4ZZEA 3MZBA 2RF1A 3K6VA 4MF3A 4PETA 4E0XA 4ZE9A 4OETA 3MVWA 3CG1A 3MYUA 1SI0A 1FQFA 3UP9A 3I6VA 2XXXA 3U65A 4NF8A 3QIMA 2FBPA 4KCCA 1A99A 1DPPA 4LONB 5B70A 1SVXB 3OO6A 2FVZA 1NH7A 3IJXB 2Y5KA 4NF6A 1FQEA 3K1MA 4HS7A 1T0KA 2DXYA 1D3KA 2P1SA 3C35A 5ELVA 1MXXA 4NMYA 3VXCA 4BDQA 1A55A 1R6ZA 5DEXB 1FPIA 4R9FA 3CSGA 3QMFA 3PPOA 2Y5LA 3T96B 1YPNA 4H5GA 4TLLB 3KN8A 5H8NA 1O63A 5KCJB 2VPOA 1SW4A 3V89B 4M1VA 4DLDA 3FJGA 1LBXA 4G68C 1LEVA 2O7UA 2Q2AA 2QS3A 4FEBA 4EF1A 2DXRA 1S50A 2Q88A 4PTKA 1CB6A 1NV0A 2DQVA 4ZEFA 1XI6A 5AA2B 1XHYA 3JV9A 1AH5A 1TXFA 4OZ9A 2DWIA 4YB5A 5AA3A 2XWVA 1P1OA 1YYZA 3RTFB 3H7MA 1A8EA 1AMFA 2V3UA 2KR0A 1H43A 2ZNTA 3VLWA 5IAIA 1SW5A 2PX1A 5L8DA 4YKJA 3U1OA 3H4ZA 1N0TA 2UVGA 3H6TA 5CRYA 4JSOA 4BDLA 3CHGA 3IFAA 5LDZA 4F29A 2ZNSA 4EQBA 2XXUA 3I5OA 3VVDA 2X7PA 1GV8A 3T0JA 2DE2A 2DE4A 3IO6A 3KSXA 2HHMA 1YXIA 1NUWA 1PB7A 2DS9A 2G93A 4HTGA 5HPQA 1Y3QA 5IGAA 3ZSFA 1Y1MA 4GFRA 2BJIA 4RJZA 4F18A 2GH9A 4IO5A 2ANJA 1FPEA 4KD5A 2QS1A 4GLIA 4P0GA 2I6EA 1I6AA 5JTYA 4H0WA 3OXNA 5CMBA 4I40A 4P8BA 1USYE 1LB9A 1B5HA 2YJPA 3UA8A 1L5TA 2QJEA 4PF6A 4JWOA 1SD3A 3IJOB 1NNPA 4Q0CA 4OQOA 3TTMA 4OVTA 3T66A 4NGUA 2Q8JA 3K0VA 2CZHA 2WKYA 3CVGA 1Y9UA 1DOTA 4X04A 3EQ1A 3VDFA 2YLNA 2Z8EA 1F9BA 2FIXA 2Z8FA 4EXLA 5TU0A 5IKBA 1US4A 2M8CA 3C34A 4G2ZA 4FORA 2I0CA 4N17A 3IL1B 1R1NA 2QMXA 3IB1A 4MFIA 1FJ6A 1JVXA 4KXPA 4UACA 1H45A 5H8NB 5CMKA 4ZEIA 4ZZAA 4F1UA 4GXAA 3ROJA 2XX8A 3EHSA 3FBPA 3MPLA 4U4XA 3RGYA 4EUOA 5IZ1A 5TPAA 4F19A 5BWJA 4JDFA 4BDMA 5IZ3A 1B32A 1IQ7A 1BLFA 1UIVA 2FIEA 3D4CA 1D4NA 1POTA 4QF9A 2DWHA 1LCTA 4N91A 1B51A 3PPPA 4U22A 4IO4A 5DEXA 3GXAA 2DVZA 1GTKA 3NOHA 4TOZA 1Z7NE 3W9WA 2G29A 5L9SA 4I1DA 1XS5A 4OVQA 3RYDA 2F97A 5I84A 4IGRA 4KQPA 3G3HA 4OXVA 4FIMA 3RPWA 4FBPA 2RC8A 4ECFA 2FYIA 1K9YA 3O6HA 2DWAA 2F7AA 1UQWA 1M5EA 3RLFE 1M5BA 4P1EA 3LBSA 4F1VA 2V93A 3PU5A 3E13X 3C33A 5DVJA 1XVXA 4XKQA 1H3DA 1HSLA 3K6XA 5F24A 4XKPA 4YB6A 2PMSA 3CIJA 4H65A 3FVNA 1M5DA 2Y84A 1IMEA 2B3BA 1FSAA 1B5JA 4U21A 5ICQA 5EQAA 4YMAA 4M4GA 2HFBA 1EZ9A 1USYH 3EKIA 4GXSB 4ONYA 2XXIA 3K00A 1B3LA 2ZYNA 4GWZA 4DDDA 2OBGA 4MHFA 4MNIA 5FHOA 5CMCA 2GHAA 1QUJA 4GWXA 4PFTA 1IZ1A 4YAHX 5ESYA 1B3GA 4OEUA 3O9PA 4GBWA 4OERA 5TP9B 4RXLA 5HBCA 1FTKA 2DSFA 4O7MA 1R9LA 5IZ3B 4AB6A 4ELRA 4DCXA 3UN6A 1LBBA 4AQ4A 1P1QA 3G7WA 4YB7A 4U23A 4EXKA 1MM7A 2QVUA 3A3UA 3LSFB 1G0IA 1I69A 3HCQA 3LSXA 2QS2A 1QUKA 4U1OA 2B65A 3KC1A 2VD2A 5CBRA 2B3FA 3UGWA 4OFOA 1FPFA 4GBVA 3PGFA 1MM6A 4YKKA 2P3NA 3V8XB 1N3WA 4N6DA 4GL8A 1RKMA 3TKDA 4QFKA 4OHNA 4H8IA 4PGNA 3D1RA 1ZKBA 4MIJA 3OO8A 1SW1A 4NF0A 4P56A 4ZDMA 5FTHA 2XXKA 2VD3A 4EDPA 1S7YA 4I9DA 3VVFA 4DXUA 1FPDA 5A5XB 2Q89A 3SEYA 3CG3A 2XWKA 4ESXA 2OX3A 4NF8B 3OELA 3U93A 4DIGA 1FBGA 1D9YA 3VVEA 3FXRA 3N26A 1VFDA 1NUXA 4NHBA 3HFUA 4ISUA 4Z0IA 1JW1A 2Z8DA 3O97A 3UORA 4F3PA 1QVSA 2I3VA 3KOSA 1NNTA 2XD2A 5ET8A 4R2BA 4OVRA 3IOWA 5F1QA 2PFZA 2VT5A 3B6TA 5H8HA 1A54A 1A40A 1Y20A 1MH4A 3SEVA 1FBFA 2VP1A 3ILTB 2NXOA 5CMMA 3TTKA 1A8FA 1LAGE 2R6GE 3M3FA 3MW0A 2V4CA 4R2FA 3TTRA 2O1LA 3TELA 4RPOA 3L6GA 4MMPA 2DDKA 1K9ZA 2VHAA 3USDA 4G61A 2RCBA 4PE5B 2X7QA 3OSRA 1ZJLA 1FQBA 3ODBA 3FVKA 3GYYA 4OFJA 2F35A 3N6UA 5BUUA 4N15A 4EF2A 4G8NA 1ZTYA 1DPEA 4QSEA 2QSXA 2XX9A 2XD3A 4F39A 4N6KA 4RK2A 3MWBA 2PBWA 2DOJA 3RT6B 4N4UA 4BDRA 4POWA 2X26A 3PUXE 4LZ5A 1BIYA 4G4PA 3FGSA 4R75A 3DM0A 1YAEA 4MNCA 3FVGA 2XHDA 5KDTA 3THIA 2F5XA 1H44A 1NFTA 3IAZA 1NV3A 2BJJX 3B6QA 5J16A 2V3QA 1R9QA 5FBPA 4OMBA 1SDXA 3A09A 4QBAA 2OCUA 1D9VA 2ZYKA 3C36A 2UXAA 4HCWA 4GRKA 5K2XA 4JSDA 4NF4B 4PGPA 1SYIA 2ZZWA 5M2VA 2H99A 3V5AA 2WEFA 2XXYA 3PPQA 3QUFA 4YICA 4G8HA 1II5A 1QULA 4JVCA 1PC3A 3MVXA 3TQLA 4YU0A 4NEDA 3PMWA 4PFYA 1RDZA 4KFQA 4X1BA 1MRPA 3M3LA 4PBHA 4KYEA 4P9KA 3BKIB 1FBEA 4NAPA 4TQUQ 3Q27A 4UABA 2L5VA 2Q2CA 1WVJA 3RQTA 2VPNA 1SYHA 5KZTA 5DVIA 2XXQA 4KPTA 1DBZA 1QKAA 5CBSA 3GBAA 5B7DA 4QFNA 5AA2A 3PD8A 1DMBA 1ZBMA 1EU8A 2VGQA 5I57A 3FXUA 2F34A
chains in the Genus database with same CATH topology
1MXVA 1Z7ME 1P99A 1B32A 1HSEA 2ONSA 3MPKA 3MZ1A 3HPIA 1IQ7A 1BLFA 1MY2A 1OIBA 1UIVA 1D4NA 3D4CA 4KCDA 1POTA 2DP8A 4QF9A 3TQWA 3U94A 2DWHA 3KGCA 3UIFA 2XXVA 1OMPA 4QFOA 3T9VA 1LCTA 3OD7A 1B51A 3M8UA 3HHFA 3PPPA 4U22A 2OWTA 4U2RA 4C1TA 5TP9A 2XXWA 1JW5A 4IO4A 5DEXA 2AYSA 2I3WA 3TTNA 3GXAA 4RYAA 1MQJA 3FV1A 4H8JA 2XXPA 2XXHA 3PPRA 4U1ZA 5AA4B 2DVZA 4O3AA 4QFLA 4WEPA 4IO3A 1GTKA 2D21A 3FUZA 3O6IA 3N5LA 1JEUA 4QFPA 4R6HA 4XXUA 5F7VA 5ISUA 3O2AA 4TOZA 1Z7NE 2F36A 4GL0A 4H67A 1IXGA 3MAMA 2D3IA 3IX1A 4R6YA 3O66A 1FCKA 1NL5A 3FIRA 4OFLA 4DZ1A 2PVUA 2UVHA 4OENA 3TPAA 3W9WA 4XKNA 2G29A 5L9SA 1MXWA 4GIZA 2O84X 4I1DA 1XS5A 3IB2A 1N84A 1URDA 3I3VA 1MXUA 1FW0A 2F78A 3VLVA 4DE8A 1LAHE 4JWXA 2F6GA 2V25A 3U92A 4R9GA 3TFLA 1VSOA 2F97A 2I4BA 3U72A 5I84A 4IGRA 4PFUA 3TDJA 3F11A 4KQPA 4NF5B 3KFMA 3G3HA 4GOTA 1PB8A 4FATA 4OXVA 4FIMA 1UTBA 1Y4TA 1LFIA 3RPWA 1UTHA 2HZLA 2RC8A 3LR1A 4ECFA 1KWHA 2D5WA 2FYIA 3C9HA 2R71A 1ANFA 2GRVA 4N13A 4RA1A 3O6HA 1B3EA 1B3HA 1IXIA 2DWAA 2F7AA 2H5YA 1UQWA 3LC8A 4QHQA 1M5EA 3N6TA 2DVCA 4LVQA 1EZOA 1N76A 1M5BA 3K6WA 3RLFE 3SDFA 4C0RA 1M5FA 5I56A 2KLFA 3R7XA 3LSWA 2VOZA 3KN7A 1MH3A 3LBSA 4F1VA 2V93A 3PU5A 3SESA 4QRZA 2F8DA 3E13X 3MUQA 4YMBA 4ZEDA 4O3BA 3C33A 2PT2A 3K01A 5DVJA 1XVXA 4XKQA 1H3DA 4NE4A 2I49A 4ZS9A 3TCHA 1US5A 2V3TA 3ONMA 4H1XA 1B6HA 1HSLA 1MY3A 3LSLA 3OO9A 1XC1A 3K6XA 1BTJA 5TPAB 3T9HB 2NVUB 4XKPA 2ONRA 4YB6A 1MQDA 2Y7RA 5EYFA 2PMSA 1Q1KA 3CIJA 4H65A 5DTBA 2V84A 3W9VA 2W7YA 4X48A 5I2NA 2Y7WA 1TT1A 4FECA 4G77A 3FVNA 4R73A 1M5DA 4HCYA 3O28A 3PD9A 1I6QA 2Y84A 3RY3A 2B3BA 1FTJA 2IA4A 3N94A 4MBPA 2OJTA 4U21A 1B5JA 1Q35A 1B5IA 1MPCA 2Z23A 3SERA 2NOOA 4BDNA 5I57B 3QXMA 1ZMGA 4ZEKA 5ICQA 5AA4A 1LFHA 1B0LA 1EH3A 5I2KA 2Q9TA 5J1DA 4YMAA 2UVJA 3GZGA 3H3GA 4M4GA 1Y3NA 3IORA 2A5TB 1EZ9A 1VE4A 2HFBA 5L9OA 2VGQA 1USYH 4ONYA 3FJ7A 4GXSB 2XXIA 1LAXA 2HAUA 3K00A 2RC9A 1MY0A 1TWYA 3HV1A 3HHGA 3OSQA 5ICTA 3P7IA 1JVYA 2F6PA 2RINA 4ZEBA 2AL5A 1B3LA 2ZYNA 2AIXA 4DDDA 1A7LA 1B4HA 2OBGA 3CR9A 4ND9A 4LZ8A 1URGA 1MS7A 1WDNA 4GF8A 3Q26A 4NF5A 2ZYOA 5JTYB 3QYTA 5FHOA 5CMCA 3M3KA 2GHAA 1QUJA 4JXIA 1O64A 3E3KA 1B1HA 5AE4A 1NNFA 3MBPA 3RTWB 4PFTA 1JETA 1MY4A 5DVFA 4LZ7A 1B58A 1IZ1A 4OVJA 2Z22A 1AOVA 5DYHA 4PFWA 3BBRA 1MG1A 1QKBA 1B0HA 3CFZA 3S9EA 4YAHX 3TCFA 3MVZA 1B3GA 4OEUA 1S9TA 1P1WA 1RYOA 1SBPA 3O9PA 4KYDA 5I59B 3L6HA 1GR2A 3WAEA 3E4RA 3TTLA 2FNCA 4GWOA 3TYHA 4DCYA 2HEUA 4OERA 3C31A 3VE1B 3RT8A 5CBRA 1CE2A 3AXFA 1XOCA 3HN0A 3K6UA 2H9BA 3KBRA 3PMVA 4JBZA 5TP9B 5I58B 2H25A 3FZVA 1OVTA 1B52A 1Y4CA 2ZYMA 1B7UA 3H03A 1FTKA 2DSFA 3KOTA 4RXLA 1ATGA 1R9LA 5HBCA 4Q5TA 4DXBA 4ELOA 2PYYA 4O3CA 2QS4A 4AB6A 4LQ5A 2HCAA 4KYSA 1DTGA 3MVYA 4QSCA 5HPQA 4ELRA 3JYRA 4DCXA 3UN6A 2O1MA 3K2DA 1NKXA 3TZAA 1IUDA 1SI1A 3RNNA 1MXYA 1LBBA 4AQ4A 5I59A 1OLCA 3EHTA 3K1PA 2O69A 1FQAA 2OZZA 4LP2B 1P1QA 4MLQA 3SEXA 5AA1A 3G7WA 5CI5A 4YZZA 4YB7A 4U23A 1LBCA 2LAOA 4EXKA 3A3CA 1MM7A 3DP4A 3MP8A 3MP6A 1IITA 4MLVA 4F31B 2H98A 3FV2A 3A3UA 3IR1A 3LSFB 3TUSA 1I69A 3HCQA 1O7TA 3KEIA 3PV0E 1LGBC 3LSXA 4K3FA 5H8QB 2IEEA 1Y1ZA 2QS2A 5I2NB 1QUKA 3B7DA 2B65A 3DP6A 2VD2A 3GLBA 4U1OA 4DXCA 1UTBB 2B3FA 3MQ9A 3UGWA 3SETA 4OFOA 1IXCA 3PMXA 3ECRA 1B9JA 4FE8A 4I8CA 4L17A 4F1YA 2ZXTA 2I4CA 4ESWA 3PGFA 1MQGA 1MM6A 1XT8A 3E9XA 3OOAA 3Q29A 4XTCQ 2R9JA 4YKKA 4F3GA 3K4UA 3W15C 1JQFA 1IXHA 1B05A 3CFLA 3H6WA 4X9TA 2HAVA 3T9UA 3VXBA 4Z7EA 1URSA 5FHNA 1B7ZA 1B4ZA 1MQIA 1LAFE 4Q30B 4YKPA 3V8XB 1FQDA 4ZZEA 3MZBA 2RF1A 1N3WA 3IOVA 3K6VA 3R26A 3EF7A 4GL8A 4IY5A 1NH8A 4IY6A 3OEKA 5H8FA 4MF3A 4PETA 4E0XA 3MP1A 1NNKA 3CRBA 1RKMA 3TKDA 4ZE9A 3FATA 1FTLA 4OETA 1M5CA 1OQHA 2O7IA 3KG2A 4G8MA 4FEDA 2O68A 2REJA 4QFKA 4YKIA 3MVWA 4LUBA 3CG1A 3H06B 4OHNA 2ONKE 2P2AA 4HW8A 4H8IA 1SI0A 1FQFA 4H6DA 3UP9A 5CM6A 3KZGA 1ZKBA 3I6VA 3OO8A 2XXXA 1SW1A 2E1SA 4NF8A 3FXQA 4R6KA 3QIMA 1PDAA 3OEMA 4ZDMA 5FTHA 3DELB 1MY1A 4IO2A 3LUYA 2VD3A 4EDPA 4KCCA 4C1UA 1BKAA 1A99A 1DPPA 1S7YA 4I9DA 3VVFA 3R6UA 4DXUA 3RN8A 4KI0E 3BFTA 3G3KA 5A5XB 3G3IA 4OESA 4LONB 2Q89A 4IO7A 5B70A 1J1NA 1SVXB 2O6AA 2XX7A 1B40A 3OO6A 1VFEA 2ESNA 1NH7A 4LA9A 3CG3A 3SEYA 3IJXB 1LLSA 4QSDA 4NF6A 4WEDA 4ESXA 2I0BA 1FQEA 4NF8B 5I2KB 3TODA 3OELA 2I48A 3K1MA 4HS7A 4N07A 4R72A 1N7XA 5L9MA 3U93A 4DIGA 5I58A 1T0KA 1XVYA 4U4SA 4PP0A 2DXYA 1LB8A 1D9YA 5H8HB 3VVEA 3SEUA 3QUJA 3FXRA 4LQ2A 3N26A 1VFDA 1GVCA 3PUWE 3T93B 4JWYA 4ISUA 4PQJA 1D3KA 2P1SA 3C35A 4Z0IA 4BLAA 1JW1A 2Z8DA 3O97A 1ELJA 5ELVA 1MXXA 5H8QA 3UORA 4NMYA 1FTOA 3VXCA 4BDQA 1QVSA 3DP8A 4F3PA 2I3VA 1A55A 2RC7A 4KHZE 2I58A 3KOSA 3UK4A 1R6ZA 1POY1 1LSTA 1NNTA 2XD2A 3B6WA 3PUZE 4R2BA 5DEXB 1IIWA 2HQ0A 4R9FA 3CSGA 3IOWA 5F1QA 2Y7PA 3B6TA 1ZIUA 3JZJA 2P0SA 4OWDA 3T22A 1AIVA 3PPOA 5H8HA 2GFEA 3EN3A 3S2VA 3TMGA 1OLAA 2F7CA 1A54A 3K1NA 1A40A 3T96B 1YPNA 2CMOA 1Y20A 4H5GA 1MH4A 2CZLA 1BP5A 4TLLB 3KN8A 2OWSA 2UYFA 4GQOA 5H8NA 5FTIA 3SEVA 2O51A 3Q28A 2VP1A 1O63A 5KCJB 1SW4A 3ILTB 3IOUA 4M1VA 3V89B 2REGA 5ITPA 3MC2A 3O6GA 2NXOA 4DLDA 5CMMA 3FJGA 3TTKA 4G68C 4FEBA 2ABHA 2O7UA 1A8FA 2Q2AA 2QS3A 3G3JA 4EF1A 1LAGE 2DXRA 5H8FB 2R6GE 1S50A 4NWCA 2THIA 3PUVE 1N04A 1I6BA 3QK6A 1WODA 2Q88A 2RCAA 3K02A 3M3FA 2XXRA 4LATA 1CB6A 4RPNA 2DQVA 4NWDA 4E0WA 4ZEFA 3MW0A 1LCFA 3IO4A 5AA2B 1IEJA 4R2FA 1XHYA 3JV9A 3MJNA 1AH5A 1TXFA 4G68B 3TTRA 2O1LA 4OZ9A 2DWIA 3TEPA 3TELA 4XKRA 4RPOA 4YB5A 4F3BA 5AA3A 3L6GA 1DTZA 1P1OA 3KJTA 2OK2A 3RTFB 2VHAA 1A8EA 1YCJA 3H7MA 3FD3A 1AMFA 1JNFA 2V3UA 1FTMA 2Y7IA 4POXA 4THIA 3USDA 2RCBA 3QAXA 1H43A 2X7QA 3OSRA 4H5FA 1ZJLA 2ZNTA 4NF6B 3Q25A 4PE5B 3VLWA 1FQBA 4ZE8A 5AA2D 3TAJA 3ODBA 4ELQA 5IAIA 4RK9A 1SW5A 3FVKA 2PX1A 5L8DA 1JW4A 1OVBA 2RKMA 3S9NC 4IO6A 3IOTA 4OFJA 2F35A 3N6UA 4RNSA 3OMBA 4YKJA 4NTLA 4EF2A 5BUUA 4G8NA 3U1OA 1ZTYA 1B2HA 3H4ZA 1DPEA 4F2QA 1N0TA 1YTVA 2UVGA 3H6TA 3KSJA 4KR5A 4JSOA 2XXTA 4UA8A 5CRYA 4QSEA 3S4UA 3U8QA 3CSBA 3EPEA 3HSTA 1OQGA 4BDLA 3VV5A 1MDQA 2A5SA 2ZNSA 3PUYE 4F29A 4EQBA 3FVOA 2QSXA 2FA7A 2XD3A 2XX9A 2XXUA 4F39A 3I5OA 3VVDA 3WAFA 2X7PA 1GV8A 5KDTB 4RK2A 2QPQA 3MWBA 1SQYA 2QL3A 2PBWA 2DOJA 2DE2A 1TFAA 2ZNUA 2DE4A 3IO6A 3KSXA 3RT6B 3QSLA 4BDRA 1H76A 2E0SA 2UYEA 3VLUA 2QMWA 1VR5A 4POWA 2X26A 1AL3A 4R74A 1PB7A 4WKMA 5K2YA 2DS9A 2G93A 4HTGA 5FHMA 3PUXE 4LZ5A 5H8SA 1BIYA 1QUIA 2A5TA 1PB9A 4FJPA 4G4PA 1B7HA 3FGSA 3S9LC 1MDP1 1Y3QA 4X1DA 3CFXA 4R75A 3DM0A 1YAEA 1HSJA 3FVGA 3CI8A 3ZSFA 1Y1MA 3MZ9A 1DSNA 2UVIA 5JK4A 2XHDA 4GFRA 1ZLQA 4RJZA 5KDTA 4F18A 3THIA 3KN3A 4FAJA 2GH9A 2F5XA 4IO5A 4NF4A 4Q8RA 5KCJA 1UTHB 2ANJA 3ZKKA 4KD5A 2QS1A 3GBBA 1H44A 1NFTA 3IAZA 4GLIA 4P0GA 2I6EA 1I6AA 4EQ9A 4H0WA 2BJJX 3OXNA 4EQ7A 5JTYA 5CMBA 3B6QA 2NWJA 3SKPA 1ZU0A 1NMUA 2HXWA 3OO7A 2V3QA 3S9MC 1USYE 1R9QA 1LB9A 4GD5A 5CC2A 4G68A 4OMBA 1B5HA 2YJPA 1SDXA 2HZKA 1L5TA 3UA8A 2QJEA 2GHBA 3A09A 5I56B 4JWOA 3V83A 1SD3A 3IJOB 2ALUA 1NNPA 1D9VA 2OCUA 2ZYKA 2UXAA 3C36A 3D4GA 4GRKA 4HCWA 5A5XA 4N6PA 4Q0CA 5JEIA 4OQOA 4WXJA 3IK6B 5K2XA 1PEBA 3TTMA 1PBQA 4JSDA 3T66A 1QW0A 4NF4B 2F7BA 4GVOA 1SYIA 2Q8JA 3K0VA 2YPNA 4F2OA 5M2VA 2DWJA 3TCGA 4OEVA 4F3SA 2H99A 3V5AA 2PT1A 2WKYA 1N7WA 1GGGA 3CVGA 1P1UA 1Y9UA 4XIGQ 1DOTA 2XXYA 3PPQA 3EQ1A 5ITOA 2YLNA 2Z8EA 4I62A 3VDFA 1EZPA 3QUFA 4JB7A 1F9BA 1B1XA 2QRYA 4G8HA 4YICA 5EHSA 3IB0A 3C32A 1B46A 1II5A 1QULA 2Z8FA 3ILUB 4EXLA 4ZECA 5TU0A 1PC3A 1P1NA 5IKBA 3MVXA 3TQLA 1US4A 3VFJA 4YU0A 1MQHA 2M8CA 4NEDA 4OYVA 3DLNA 3PMWA 4P11A 3RUMA 3C34A 4OTEA 3SEWA 3T9XB 4G2ZA 4IGTA 1Y3PA 3EHUA 3KJ7A 4FORA 4PFYA 2I0CA 3ZKLA 3G3FA 4KFQA 4F22A 2H4IA 1MRPA 4X1BA 3O29A 3IL1B 2DYXA 1R1NA 3M3LA 1LFGA 2QMXA 1MPDA 3IB1A 4KYEA 3BKIB 3FASA 4MFIA 4TLMB 4AB5A 1UIUA 4BDOA 4TQUQ 3Q27A 1JVXA 3H6UA 2Q2CA 4MH5A 3C4MA 1QJMA 4UACA 1H45A 5H8NB 3FJMA 2ZMBA 1WVJA 1PBPA 1SW2A 1FQCA 2OLBA 3HO7A 4ZEIA 3RQTA 3G3GA 5CMKA 4ZZAA 1N3XA 1SYHA 5KZTA 5DVIA 5EHMA 4F1UA 4RY1A 4GXAA 1B3FA 2XX8A 2NUVA 2XXQA 3EHSA 3MPLA 5DT6A 4U4XA 3ZS6A 1MXZA 1RYXA 4P0IA 3RGYA 4KPTA 2AL4A 1QKAA 4ELPA 4EUOA 5CBSA 4IB2A 3GBAA 3OENA 5B7DA 1TFDA 4QFNA 2Y7KA 5AA2A 5HM4B 1MPBA 3PD8A 5TPAA 4F19A 5BWJA 1DMBA 1ZBMA 3H6VA 3PPNA 1EU8A 3BFUA 4JDFA 2DE3A 5I57A 3FXUA 1JEVA 4BDMA 2F34A 5LOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MXV A;  1Z7M E;  1P99 A;  1B32 A;  1HSE A;  2ONS A;  3MPK A;  3MZ1 A;  3HPI A;  1IQ7 A;  1BLF A;  1MY2 A;  1OIB A;  1UIV A;  1D4N A;  3D4C A;  4KCD A;  1POT A;  2DP8 A;  4QF9 A;  3TQW A;  3U94 A;  2DWH A;  3KGC A;  3UIF A;  2XXV A;  1OMP A;  4QFO A;  3T9V A;  1LCT A;  3OD7 A;  1B51 A;  3M8U A;  3HHF A;  3PPP A;  4U22 A;  2OWT A;  4U2R A;  4C1T A;  5TP9 A;  2XXW A;  1JW5 A;  4IO4 A;  5DEX A;  2AYS A;  2I3W A;  3TTN A;  3GXA A;  4RYA A;  1MQJ A;  3FV1 A;  4H8J A;  2XXP A;  2XXH A;  3PPR A;  4U1Z A;  5AA4 B;  2DVZ A;  4O3A A;  4QFL A;  4WEP A;  4IO3 A;  1GTK A;  2D21 A;  3FUZ A;  3O6I A;  3N5L A;  1JEU A;  4QFP A;  4R6H A;  4XXU A;  5F7V A;  5ISU A;  3O2A A;  4TOZ A;  1Z7N E;  2F36 A;  4GL0 A;  4H67 A;  1IXG A;  3MAM A;  2D3I A;  3IX1 A;  4R6Y A;  3O66 A;  1FCK A;  1NL5 A;  3FIR A;  4OFL A;  4DZ1 A;  2PVU A;  2UVH A;  4OEN A;  3TPA A;  3W9W A;  4XKN A;  2G29 A;  5L9S A;  1MXW A;  4GIZ A;  2O84 X;  4I1D A;  1XS5 A;  3IB2 A;  1N84 A;  1URD A;  3I3V A;  1MXU A;  1FW0 A;  2F78 A;  3VLV A;  4DE8 A;  1LAH E;  4JWX A;  2F6G A;  2V25 A;  3U92 A;  4R9G A;  3TFL A;  1VSO A;  2F97 A;  2I4B A;  3U72 A;  5I84 A;  4IGR A;  4PFU A;  3TDJ A;  3F11 A;  4KQP A;  4NF5 B;  3KFM A;  3G3H A;  4GOT A;  1PB8 A;  4FAT A;  4OXV A;  4FIM A;  1UTB A;  1Y4T A;  1LFI A;  3RPW A;  1UTH A;  2HZL A;  2RC8 A;  3LR1 A;  4ECF A;  1KWH A;  2D5W A;  2FYI A;  3C9H A;  2R71 A;  1ANF A;  2GRV A;  4N13 A;  4RA1 A;  3O6H A;  1B3E A;  1B3H A;  1IXI A;  2DWA A;  2F7A A;  2H5Y A;  1UQW A;  3LC8 A;  4QHQ A;  1M5E A;  3N6T A;  2DVC A;  4LVQ A;  1EZO A;  1N76 A;  1M5B A;  3K6W A;  3RLF E;  3SDF A;  4C0R A;  1M5F A;  5I56 A;  2KLF A;  3R7X A;  3LSW A;  2VOZ A;  3KN7 A;  1MH3 A;  3LBS A;  4F1V A;  2V93 A;  3PU5 A;  3SES A;  4QRZ A;  2F8D A;  3E13 X;  3MUQ A;  4YMB A;  4ZED A;  4O3B A;  3C33 A;  2PT2 A;  3K01 A;  5DVJ A;  1XVX A;  4XKQ A;  1H3D A;  4NE4 A;  2I49 A;  4ZS9 A;  3TCH A;  1US5 A;  2V3T A;  3ONM A;  4H1X A;  1B6H A;  1HSL A;  1MY3 A;  3LSL A;  3OO9 A;  1XC1 A;  3K6X A;  1BTJ A;  5TPA B;  3T9H B;  2NVU B;  4XKP A;  2ONR A;  4YB6 A;  1MQD A;  2Y7R A;  5EYF A;  2PMS A;  1Q1K A;  3CIJ A;  4H65 A;  5DTB A;  2V84 A;  3W9V A;  2W7Y A;  4X48 A;  5I2N A;  2Y7W A;  1TT1 A;  4FEC A;  4G77 A;  3FVN A;  4R73 A;  1M5D A;  4HCY A;  3O28 A;  3PD9 A;  1I6Q A;  2Y84 A;  3RY3 A;  2B3B A;  1FTJ A;  2IA4 A;  3N94 A;  4MBP A;  2OJT A;  4U21 A;  1B5J A;  1Q35 A;  1B5I A;  1MPC A;  2Z23 A;  3SER A;  2NOO A;  4BDN A;  5I57 B;  3QXM A;  1ZMG A;  4ZEK A;  5ICQ A;  5AA4 A;  1LFH A;  1B0L A;  1EH3 A;  5I2K A;  2Q9T A;  5J1D A;  4YMA A;  2UVJ A;  3GZG A;  3H3G A;  4M4G A;  1Y3N A;  3IOR A;  2A5T B;  1EZ9 A;  1VE4 A;  2HFB A;  5L9O A;  2VGQ A;  1USY H;  4ONY A;  3FJ7 A;  4GXS B;  2XXI A;  1LAX A;  2HAU A;  3K00 A;  2RC9 A;  1MY0 A;  1TWY A;  3HV1 A;  3HHG A;  3OSQ A;  5ICT A;  3P7I A;  1JVY A;  2F6P A;  2RIN A;  4ZEB A;  2AL5 A;  1B3L A;  2ZYN A;  2AIX A;  4DDD A;  1A7L A;  1B4H A;  2OBG A;  3CR9 A;  4ND9 A;  4LZ8 A;  1URG A;  1MS7 A;  1WDN A;  4GF8 A;  3Q26 A;  4NF5 A;  2ZYO A;  5JTY B;  3QYT A;  5FHO A;  5CMC A;  3M3K A;  2GHA A;  1QUJ A;  4JXI A;  1O64 A;  3E3K A;  1B1H A;  5AE4 A;  1NNF A;  3MBP A;  3RTW B;  4PFT A;  1JET A;  1MY4 A;  5DVF A;  4LZ7 A;  1B58 A;  1IZ1 A;  4OVJ A;  2Z22 A;  1AOV A;  5DYH A;  4PFW A;  3BBR A;  1MG1 A;  1QKB A;  1B0H A;  3CFZ A;  3S9E A;  4YAH X;  3TCF A;  3MVZ A;  1B3G A;  4OEU A;  1S9T A;  1P1W A;  1RYO A;  1SBP A;  3O9P A;  4KYD A;  5I59 B;  3L6H A;  1GR2 A;  3WAE A;  3E4R A;  3TTL A;  2FNC A;  4GWO A;  3TYH A;  4DCY A;  2HEU A;  4OER A;  3C31 A;  3VE1 B;  3RT8 A;  5CBR A;  1CE2 A;  3AXF A;  1XOC A;  3HN0 A;  3K6U A;  2H9B A;  3KBR A;  3PMV A;  4JBZ A;  5TP9 B;  5I58 B;  2H25 A;  3FZV A;  1OVT A;  1B52 A;  1Y4C A;  2ZYM A;  1B7U A;  3H03 A;  1FTK A;  2DSF A;  3KOT A;  4RXL A;  1ATG A;  1R9L A;  5HBC A;  4Q5T A;  4DXB A;  4ELO A;  2PYY A;  4O3C A;  2QS4 A;  4AB6 A;  4LQ5 A;  2HCA A;  4KYS A;  1DTG A;  3MVY A;  4QSC A;  5HPQ A;  4ELR A;  3JYR A;  4DCX A;  3UN6 A;  2O1M A;  3K2D A;  1NKX A;  3TZA A;  1IUD A;  1SI1 A;  3RNN A;  1MXY A;  1LBB A;  4AQ4 A;  5I59 A;  1OLC A;  3EHT A;  3K1P A;  2O69 A;  1FQA A;  2OZZ A;  4LP2 B;  1P1Q A;  4MLQ A;  3SEX A;  5AA1 A;  3G7W A;  5CI5 A;  4YZZ A;  4YB7 A;  4U23 A;  1LBC A;  2LAO A;  4EXK A;  3A3C A;  1MM7 A;  3DP4 A;  3MP8 A;  3MP6 A;  1IIT A;  4MLV A;  4F31 B;  2H98 A;  3FV2 A;  3A3U A;  3IR1 A;  3LSF B;  3TUS A;  1I69 A;  3HCQ A;  1O7T A;  3KEI A;  3PV0 E;  1LGB C;  3LSX A;  4K3F A;  5H8Q B;  2IEE A;  1Y1Z A;  2QS2 A;  5I2N B;  1QUK A;  3B7D A;  2B65 A;  3DP6 A;  2VD2 A;  3GLB A;  4U1O A;  4DXC A;  1UTB B;  2B3F A;  3MQ9 A;  3UGW A;  3SET A;  4OFO A;  1IXC A;  3PMX A;  3ECR A;  1B9J A;  4FE8 A;  4I8C A;  4L17 A;  4F1Y A;  2ZXT A;  2I4C A;  4ESW A;  3PGF A;  1MQG A;  1MM6 A;  1XT8 A;  3E9X A;  3OOA A;  3Q29 A;  4XTC Q;  2R9J A;  4YKK A;  4F3G A;  3K4U A;  3W15 C;  1JQF A;  1IXH A;  1B05 A;  3CFL A;  3H6W A;  4X9T A;  2HAV A;  3T9U A;  3VXB A;  4Z7E A;  1URS A;  5FHN A;  1B7Z A;  1B4Z A;  1MQI A;  1LAF E;  4Q30 B;  4YKP A;  3V8X B;  1FQD A;  4ZZE A;  3MZB A;  2RF1 A;  1N3W A;  3IOV A;  3K6V A;  3R26 A;  3EF7 A;  4GL8 A;  4IY5 A;  1NH8 A;  4IY6 A;  3OEK A;  5H8F A;  4MF3 A;  4PET A;  4E0X A;  3MP1 A;  1NNK A;  3CRB A;  1RKM A;  3TKD A;  4ZE9 A;  3FAT A;  1FTL A;  4OET A;  1M5C A;  1OQH A;  2O7I A;  3KG2 A;  4G8M A;  4FED A;  2O68 A;  2REJ A;  4QFK A;  4YKI A;  3MVW A;  4LUB A;  3CG1 A;  3H06 B;  4OHN A;  2ONK E;  2P2A A;  4HW8 A;  4H8I A;  1SI0 A;  1FQF A;  4H6D A;  3UP9 A;  5CM6 A;  3KZG A;  1ZKB A;  3I6V A;  3OO8 A;  2XXX A;  1SW1 A;  2E1S A;  4NF8 A;  3FXQ A;  4R6K A;  3QIM A;  1PDA A;  3OEM A;  4ZDM A;  5FTH A;  3DEL B;  1MY1 A;  4IO2 A;  3LUY A;  2VD3 A;  4EDP A;  4KCC A;  4C1U A;  1BKA A;  1A99 A;  1DPP A;  1S7Y A;  4I9D A;  3VVF A;  3R6U A;  4DXU A;  3RN8 A;  4KI0 E;  3BFT A;  3G3K A;  5A5X B;  3G3I A;  4OES A;  4LON B;  2Q89 A;  4IO7 A;  5B70 A;  1J1N A;  1SVX B;  2O6A A;  2XX7 A;  1B40 A;  3OO6 A;  1VFE A;  2ESN A;  1NH7 A;  4LA9 A;  3CG3 A;  3SEY A;  3IJX B;  1LLS A;  4QSD A;  4NF6 A;  4WED A;  4ESX A;  2I0B A;  1FQE A;  4NF8 B;  5I2K B;  3TOD A;  3OEL A;  2I48 A;  3K1M A;  4HS7 A;  4N07 A;  4R72 A;  1N7X A;  5L9M A;  3U93 A;  4DIG A;  5I58 A;  1T0K A;  1XVY A;  4U4S A;  4PP0 A;  2DXY A;  1LB8 A;  1D9Y A;  5H8H B;  3VVE A;  3SEU A;  3QUJ A;  3FXR A;  4LQ2 A;  3N26 A;  1VFD A;  1GVC A;  3PUW E;  3T93 B;  4JWY A;  4ISU A;  4PQJ A;  1D3K A;  2P1S A;  3C35 A;  4Z0I A;  4BLA A;  1JW1 A;  2Z8D A;  3O97 A;  1ELJ A;  5ELV A;  1MXX A;  5H8Q A;  3UOR A;  4NMY A;  1FTO A;  3VXC A;  4BDQ A;  1QVS A;  3DP8 A;  4F3P A;  2I3V A;  1A55 A;  2RC7 A;  4KHZ E;  2I58 A;  3KOS A;  3UK4 A;  1R6Z A;  1POY 1;  1LST A;  1NNT A;  2XD2 A;  3B6W A;  3PUZ E;  4R2B A;  5DEX B;  1IIW A;  2HQ0 A;  4R9F A;  3CSG A;  3IOW A;  5F1Q A;  2Y7P A;  3B6T A;  1ZIU A;  3JZJ A;  2P0S A;  4OWD A;  3T22 A;  1AIV A;  3PPO A;  5H8H A;  2GFE A;  3EN3 A;  3S2V A;  3TMG A;  1OLA A;  2F7C A;  1A54 A;  3K1N A;  1A40 A;  3T96 B;  1YPN A;  2CMO A;  1Y20 A;  4H5G A;  1MH4 A;  2CZL A;  1BP5 A;  4TLL B;  3KN8 A;  2OWS A;  2UYF A;  4GQO A;  5H8N A;  5FTI A;  3SEV A;  2O51 A;  3Q28 A;  2VP1 A;  1O63 A;  5KCJ B;  1SW4 A;  3ILT B;  3IOU A;  4M1V A;  3V89 B;  2REG A;  5ITP A;  3MC2 A;  3O6G A;  2NXO A;  4DLD A;  5CMM A;  3FJG A;  3TTK A;  4G68 C;  4FEB A;  2ABH A;  2O7U A;  1A8F A;  2Q2A A;  2QS3 A;  3G3J A;  4EF1 A;  1LAG E;  2DXR A;  5H8F B;  2R6G E;  1S50 A;  4NWC A;  2THI A;  3PUV E;  1N04 A;  1I6B A;  3QK6 A;  1WOD A;  2Q88 A;  2RCA A;  3K02 A;  3M3F A;  2XXR A;  4LAT A;  1CB6 A;  4RPN A;  2DQV A;  4NWD A;  4E0W A;  4ZEF A;  3MW0 A;  1LCF A;  3IO4 A;  5AA2 B;  1IEJ A;  4R2F A;  1XHY A;  3JV9 A;  3MJN A;  1AH5 A;  1TXF A;  4G68 B;  3TTR A;  2O1L A;  4OZ9 A;  2DWI A;  3TEP A;  3TEL A;  4XKR A;  4RPO A;  4YB5 A;  4F3B A;  5AA3 A;  3L6G A;  1DTZ A;  1P1O A;  3KJT A;  2OK2 A;  3RTF B;  2VHA A;  1A8E A;  1YCJ A;  3H7M A;  3FD3 A;  1AMF A;  1JNF A;  2V3U A;  1FTM A;  2Y7I A;  4POX A;  4THI A;  3USD A;  2RCB A;  3QAX A;  1H43 A;  2X7Q A;  3OSR A;  4H5F A;  1ZJL A;  2ZNT A;  4NF6 B;  3Q25 A;  4PE5 B;  3VLW A;  1FQB A;  4ZE8 A;  5AA2 D;  3TAJ A;  3ODB A;  4ELQ A;  5IAI A;  4RK9 A;  1SW5 A;  3FVK A;  2PX1 A;  5L8D A;  1JW4 A;  1OVB A;  2RKM A;  3S9N C;  4IO6 A;  3IOT A;  4OFJ A;  2F35 A;  3N6U A;  4RNS A;  3OMB A;  4YKJ A;  4NTL A;  4EF2 A;  5BUU A;  4G8N A;  3U1O A;  1ZTY A;  1B2H A;  3H4Z A;  1DPE A;  4F2Q A;  1N0T A;  1YTV A;  2UVG A;  3H6T A;  3KSJ A;  4KR5 A;  4JSO A;  2XXT A;  4UA8 A;  5CRY A;  4QSE A;  3S4U A;  3U8Q A;  3CSB A;  3EPE A;  3HST A;  1OQG A;  4BDL A;  3VV5 A;  1MDQ A;  2A5S A;  2ZNS A;  3PUY E;  4F29 A;  4EQB A;  3FVO A;  2QSX A;  2FA7 A;  2XD3 A;  2XX9 A;  2XXU A;  4F39 A;  3I5O A;  3VVD A;  3WAF A;  2X7P A;  1GV8 A;  5KDT B;  4RK2 A;  2QPQ A;  3MWB A;  1SQY A;  2QL3 A;  2PBW A;  2DOJ A;  2DE2 A;  1TFA A;  2ZNU A;  2DE4 A;  3IO6 A;  3KSX A;  3RT6 B;  3QSL A;  4BDR A;  1H76 A;  2E0S A;  2UYE A;  3VLU A;  2QMW A;  1VR5 A;  4POW A;  2X26 A;  1AL3 A;  4R74 A;  1PB7 A;  4WKM A;  5K2Y A;  2DS9 A;  2G93 A;  4HTG A;  5FHM A;  3PUX E;  4LZ5 A;  5H8S A;  1BIY A;  1QUI A;  2A5T A;  1PB9 A;  4FJP A;  4G4P A;  1B7H A;  3FGS A;  3S9L C;  1MDP 1;  1Y3Q A;  4X1D A;  3CFX A;  4R75 A;  3DM0 A;  1YAE A;  1HSJ A;  3FVG A;  3CI8 A;  3ZSF A;  1Y1M A;  3MZ9 A;  1DSN A;  2UVI A;  5JK4 A;  2XHD A;  4GFR A;  1ZLQ A;  4RJZ A;  5KDT A;  4F18 A;  3THI A;  3KN3 A;  4FAJ A;  2GH9 A;  2F5X A;  4IO5 A;  4NF4 A;  4Q8R A;  5KCJ A;  1UTH B;  2ANJ A;  3ZKK A;  4KD5 A;  2QS1 A;  3GBB A;  1H44 A;  1NFT A;  3IAZ A;  4GLI A;  4P0G A;  2I6E A;  1I6A A;  4EQ9 A;  4H0W A;  2BJJ X;  3OXN A;  4EQ7 A;  5JTY A;  5CMB A;  3B6Q A;  2NWJ A;  3SKP A;  1ZU0 A;  1NMU A;  2HXW A;  3OO7 A;  2V3Q A;  3S9M C;  1USY E;  1R9Q A;  1LB9 A;  4GD5 A;  5CC2 A;  4G68 A;  4OMB A;  1B5H A;  2YJP A;  1SDX A;  2HZK A;  1L5T A;  3UA8 A;  2QJE A;  2GHB A;  3A09 A;  5I56 B;  4JWO A;  3V83 A;  1SD3 A;  3IJO B;  2ALU A;  1NNP A;  1D9V A;  2OCU A;  2ZYK A;  2UXA A;  3C36 A;  3D4G A;  4GRK A;  4HCW A;  5A5X A;  4N6P A;  4Q0C A;  5JEI A;  4OQO A;  4WXJ A;  3IK6 B;  5K2X A;  1PEB A;  3TTM A;  1PBQ A;  4JSD A;  3T66 A;  1QW0 A;  4NF4 B;  2F7B A;  4GVO A;  1SYI A;  2Q8J A;  3K0V A;  2YPN A;  4F2O A;  5M2V A;  2DWJ A;  3TCG A;  4OEV A;  4F3S A;  2H99 A;  3V5A A;  2PT1 A;  2WKY A;  1N7W A;  1GGG A;  3CVG A;  1P1U A;  1Y9U A;  4XIG Q;  1DOT A;  2XXY A;  3PPQ A;  3EQ1 A;  5ITO A;  2YLN A;  2Z8E A;  4I62 A;  3VDF A;  1EZP A;  3QUF A;  4JB7 A;  1F9B A;  1B1X A;  2QRY A;  4G8H A;  4YIC A;  5EHS A;  3IB0 A;  3C32 A;  1B46 A;  1II5 A;  1QUL A;  2Z8F A;  3ILU B;  4EXL A;  4ZEC A;  5TU0 A;  1PC3 A;  1P1N A;  5IKB A;  3MVX A;  3TQL A;  1US4 A;  3VFJ A;  4YU0 A;  1MQH A;  2M8C A;  4NED A;  4OYV A;  3DLN A;  3PMW A;  4P11 A;  3RUM A;  3C34 A;  4OTE A;  3SEW A;  3T9X B;  4G2Z A;  4IGT A;  1Y3P A;  3EHU A;  3KJ7 A;  4FOR A;  4PFY A;  2I0C A;  3ZKL A;  3G3F A;  4KFQ A;  4F22 A;  2H4I A;  1MRP A;  4X1B A;  3O29 A;  3IL1 B;  2DYX A;  1R1N A;  3M3L A;  1LFG A;  2QMX A;  1MPD A;  3IB1 A;  4KYE A;  3BKI B;  3FAS A;  4MFI A;  4TLM B;  4AB5 A;  1UIU A;  4BDO A;  4TQU Q;  3Q27 A;  1JVX A;  3H6U A;  2Q2C A;  4MH5 A;  3C4M A;  1QJM A;  4UAC A;  1H45 A;  5H8N B;  3FJM A;  2ZMB A;  1WVJ A;  1PBP A;  1SW2 A;  1FQC A;  2OLB A;  3HO7 A;  4ZEI A;  3RQT A;  3G3G A;  5CMK A;  4ZZA A;  1N3X A;  1SYH A;  5KZT A;  5DVI A;  5EHM A;  4F1U A;  4RY1 A;  4GXA A;  1B3F A;  2XX8 A;  2NUV A;  2XXQ A;  3EHS A;  3MPL A;  5DT6 A;  4U4X A;  3ZS6 A;  1MXZ A;  1RYX A;  4P0I A;  3RGY A;  4KPT A;  2AL4 A;  1QKA A;  4ELP A;  4EUO A;  5CBS A;  4IB2 A;  3GBA A;  3OEN A;  5B7D A;  1TFD A;  4QFN A;  2Y7K A;  5AA2 A;  5HM4 B;  1MPB A;  3PD8 A;  5TPA A;  4F19 A;  5BWJ A;  1DMB A;  1ZBM A;  3H6V A;  3PPN A;  1EU8 A;  3BFU A;  4JDF A;  2DE3 A;  5I57 A;  3FXU A;  1JEV A;  4BDM A;  2F34 A;  5LOM A; 
#chains in the Genus database with same CATH topology
 2CZI A;  1NV4 A;  1Z7M E;  3MPK A;  4JB7 A;  1OIB A;  2PCR A;  4F1Y A;  3U94 A;  3KGC A;  1OMP A;  4X8R A;  4H46 A;  3OD7 A;  2WBB A;  2OWT A;  4U2R A;  1JW5 A;  2I3W A;  3TTN A;  4JVI A;  1MQJ A;  1DCU A;  4H8J A;  2XXH A;  3PPR A;  4U1Z A;  5AA4 B;  4WEP A;  2D21 A;  4QFP A;  2XWI A;  4H67 A;  4R6Y A;  3O66 A;  1FCK A;  2CEX A;  2UVH A;  4NX1 A;  4GIZ A;  4DI3 D;  3IB2 A;  1URD A;  2QVR A;  1MXU A;  2F78 A;  4PF8 A;  1LAH E;  5I3S A;  3E79 A;  1LBZ A;  3TFL A;  3U72 A;  4PFU A;  3TDJ A;  4MNP A;  3LR1 A;  2R71 A;  1ANF A;  4RA1 A;  2NWJ A;  1IXI A;  2H5Y A;  4QHQ A;  1FRP A;  3K6W A;  1M5F A;  3R7X A;  2VOZ A;  4QRZ A;  4YMB A;  2I49 A;  3ONM A;  2V3T A;  4H1X A;  4OVP A;  1XC1 A;  1BTJ A;  5TPA B;  1QGX A;  2ONR A;  3LUZ A;  1MQD A;  1NI9 A;  5I2N A;  2Y7W A;  1I6Q A;  3RY3 A;  2IA4 A;  1EYK A;  1Q35 A;  5I57 B;  2Z23 A;  2NOO A;  1ZMG A;  1EH3 A;  5I2K A;  5J1D A;  3GZG A;  5L9O A;  1LAX A;  2RC9 A;  3HHG A;  5ICT A;  3P7I A;  3E78 A;  2RIN A;  2AL5 A;  1B4H A;  4ND9 A;  3CR9 A;  4HE0 A;  2ZYO A;  1B1H A;  1JET A;  1MY4 A;  1B58 A;  4MCO A;  5ET5 A;  1B0H A;  3S9E A;  3MVZ A;  3L6H A;  4MEV A;  4PAI A;  3TTL A;  2FNC A;  2HEU A;  3AXF A;  1XOC A;  3PMV A;  2R8T A;  4JBZ A;  1KZ8 A;  1B52 A;  1Y4C A;  3KOT A;  3H03 A;  4ELO A;  2PYY A;  4O3C A;  2QS4 A;  4KYS A;  3K2D A;  1NKX A;  3TZA A;  1IUD A;  1SI1 A;  1FQA A;  5AA1 A;  5CI5 A;  2LAO A;  3MP8 A;  3MP6 A;  4IR8 A;  1IIT A;  2H98 A;  3FV2 A;  1VDW A;  3TUS A;  1O7T A;  5H8Q B;  2IEE A;  3B7D A;  3DP6 A;  3SET A;  3PMX A;  2ZXT A;  2I4C A;  4ESW A;  2R9J A;  3K4U A;  3W15 C;  1JQF A;  1IXH A;  1B05 A;  2HAV A;  2F3B A;  1MQI A;  1LAF E;  4YKP A;  1AWB A;  4GWS A;  3R26 A;  3EF7 A;  4IY5 A;  1NH8 A;  4IY6 A;  3OEK A;  4PE3 A;  3MP1 A;  3CRB A;  3KG2 A;  4FED A;  2O68 A;  2REJ A;  5LTC A;  3T1B A;  3H06 B;  2ONK E;  2P2A A;  3KZG A;  4XFE A;  2E1S A;  1LBY A;  1MY1 A;  4C1U A;  1BKA A;  3RN8 A;  4KI0 E;  3G3K A;  2ZZX A;  2XWO A;  1J1N A;  2O6A A;  2XX7 A;  1B40 A;  5I7I A;  5T3J A;  2I0B A;  3TOD A;  4R72 A;  2I48 A;  4N07 A;  1XVY A;  1LB8 A;  5H8H B;  3SEU A;  3QUJ A;  3PUW E;  1RDY A;  4O8M A;  1ELJ A;  1FTO A;  2RC7 A;  4KHZ E;  2I58 A;  3PUZ E;  3IFC A;  1ZIU A;  3JZJ A;  2P0S A;  1AIV A;  2GFE A;  3EN3 A;  3S2V A;  3TMG A;  1OLA A;  3K1N A;  2CMO A;  2CZK A;  4GQO A;  2O51 A;  3Q28 A;  3IOU A;  1FPK A;  3O6G A;  2ABH A;  2THI A;  1N04 A;  1I6B A;  5I58 A;  2RCA A;  2XXR A;  4NWD A;  4XF5 A;  1LCF A;  3IO4 A;  1IEJ A;  5IZZ A;  3TEP A;  4F3B A;  1DTZ A;  2OK2 A;  1FTM A;  4THI A;  2WBD A;  4NF6 B;  4H5F A;  3Q25 A;  4ZE8 A;  3TAJ A;  4ELQ A;  3PTY A;  1JW4 A;  1OVB A;  2RKM A;  3IOT A;  4NTL A;  1B2H A;  4F2Q A;  4KR5 A;  2XXT A;  5AA2 D;  3HST A;  4P3L A;  4O7I A;  1MDQ A;  3PUY E;  2FA7 A;  5KDT B;  3SZP A;  1SQY A;  2QL3 A;  1TFA A;  1H76 A;  2E0S A;  2QMW A;  5K2Y A;  1AL3 A;  4R74 A;  5FHM A;  1QUI A;  2A5T A;  4FJP A;  1B7H A;  1FBH A;  3MZ9 A;  1DSN A;  3KN3 A;  4MAG A;  4NF4 A;  4Q8R A;  1UTH B;  3ZKK A;  3GBB A;  3RPL B;  1NMU A;  2ZZV A;  4G68 A;  4OA4 A;  5I56 B;  2HZK A;  3V83 A;  2B4M A;  2GHB A;  4K3F A;  2ALU A;  5ET7 A;  4N6P A;  5JEI A;  1PBQ A;  2XA5 A;  4F3S A;  2DWJ A;  2PT1 A;  1GGG A;  1P1U A;  4XIG Q;  4N8Y A;  5ITO A;  4I62 A;  1IMC A;  2QRY A;  4PFR A;  3IB0 A;  3ILU B;  4ZEC A;  1P1N A;  1FBP A;  1CNQ A;  1MQH A;  4OYV A;  3DLN A;  3T9X B;  4IGT A;  1Y3P A;  3EHU A;  3KJ7 A;  3ZKL A;  3G3F A;  4F22 A;  1LFG A;  1MPD A;  4TLM B;  2CEY A;  3FXB A;  3H6U A;  4MH5 A;  2JJK A;  3FJM A;  1PBP A;  2OLB A;  1FQC A;  1B3F A;  2NUV A;  3ZS6 A;  1RYX A;  2AL4 A;  4IB2 A;  1TFD A;  5HM4 B;  4DI4 B;  3H6V A;  2DE3 A;  1JEV A;  3TCH A;  2ONS A;  1HSE A;  4G68 B;  3HPI A;  1MY2 A;  2DP8 A;  3TQW A;  3UIF A;  2XXV A;  3HHF A;  1FPL A;  3LV0 A;  4C1T A;  2AYS A;  4OAN A;  3FV1 A;  1INP A;  4O3A A;  4QFL A;  2B4L A;  1JEU A;  3N5L A;  4R6H A;  4PDD A;  5F7V A;  5ISU A;  2F36 A;  4GL0 A;  4HE1 A;  1NL5 A;  4OFL A;  4DZ1 A;  2PVU A;  3TPA A;  4OEN A;  4XKN A;  1MXW A;  5EYG A;  2F6G A;  2V25 A;  4R9G A;  4NF5 B;  4GOT A;  4FAT A;  1LFI A;  5IM2 A;  1B3H A;  4NG7 A;  5A5L A;  4LVQ A;  2DVC A;  1EZO A;  1N76 A;  4C0R A;  3SDF A;  4P47 A;  3KN7 A;  2HPG A;  3SES A;  4ZED A;  3MUQ A;  4O3B A;  2PT2 A;  3K01 A;  1FJ9 A;  4NE4 A;  4ZS9 A;  1US5 A;  1B6H A;  1LBW A;  1MY3 A;  3LSL A;  3OO9 A;  2PFY A;  2Y7R A;  5EYF A;  3W9V A;  2W7Y A;  1TT1 A;  4FEC A;  4G77 A;  4R73 A;  3O28 A;  4HE2 A;  1MPC A;  4BDN A;  4MJO A;  2Q9T A;  3H3G A;  1Y3N A;  2A5T B;  3FJ7 A;  1MY0 A;  1TWY A;  3OSQ A;  1JVY A;  2F6P A;  1IMF A;  2AIX A;  1A7L A;  1URG A;  1MS7 A;  4GF8 A;  1NUZ A;  5JTY B;  4NF5 A;  3QYT A;  3M3K A;  3E3K A;  1NNF A;  3MBP A;  4LZ7 A;  4PDH A;  4OVJ A;  2Z22 A;  3ISP A;  3CFZ A;  1S9T A;  1P1W A;  4PFB A;  4KYD A;  1GR2 A;  1NV2 A;  3E4R A;  3WAE A;  4GWO A;  3TYH A;  4DCY A;  1CE2 A;  3KBR A;  2H9B A;  2H25 A;  4AS4 A;  1FPG A;  1OVT A;  2ZYM A;  3T93 B;  1ATG A;  4DXB A;  1EYJ A;  3MVY A;  3JYR A;  2O1M A;  1MXY A;  5I59 A;  1OLC A;  2O69 A;  2OZZ A;  4LP2 B;  4YZZ A;  3DP4 A;  4MLV A;  4NQ8 A;  4F31 B;  3IR1 A;  1LGB C;  1Y1Z A;  4DXC A;  1UTB B;  3ECR A;  1B9J A;  4L17 A;  1XT8 A;  3Q29 A;  3OOA A;  4XTC Q;  4HW8 A;  3H6W A;  4Z7E A;  1NV6 A;  5FHN A;  4Q30 B;  3IOV A;  5H8F A;  1NNK A;  2GQ1 A;  1FTL A;  3FAT A;  3RTW B;  1M5C A;  1OQH A;  2O7I A;  4G8M A;  4YKI A;  1IMA A;  4LUB A;  1DK4 A;  4H6D A;  2FHY A;  5CM6 A;  4H45 A;  1G0H A;  2Q8M A;  3FXQ A;  4R6K A;  1PDA A;  2OWZ A;  3OEM A;  5ET6 A;  3DEL B;  4IO2 A;  3LUY A;  3RPL A;  3R6U A;  3BFT A;  3G3I A;  4OES A;  4IO7 A;  4N81 A;  1VFE A;  2ESN A;  4LA9 A;  1RDX A;  1LLS A;  4QSD A;  4WED A;  5I2K B;  1N7X A;  5L9M A;  1KA0 A;  4U4S A;  4PP0 A;  4LQ2 A;  1GVC A;  4JWY A;  4PQJ A;  4NN3 A;  5H8Q A;  4BLA A;  3DP8 A;  3UK4 A;  1POY 1;  1LST A;  3B6W A;  1IIW A;  2HQ0 A;  2Y7P A;  3T22 A;  4OWD A;  2F7C A;  2CZL A;  4GX6 A;  1BP5 A;  2OWS A;  2UYF A;  4PCD A;  1NV5 A;  4N8G A;  5FTI A;  2REG A;  5ITP A;  3MC2 A;  4LN5 A;  4PAF A;  3G3J A;  5H8F B;  4NWC A;  3PUV E;  3QK6 A;  1WOD A;  4LAT A;  3K02 A;  4RPN A;  4E0W A;  4P1L A;  3MJN A;  5EYH A;  4XKR A;  3KJT A;  1YCJ A;  3FD3 A;  1JNF A;  2Y7I A;  4GWY A;  4PAK A;  4POX A;  3QAX A;  3BIG A;  4RK9 A;  1FTA A;  3S9N C;  4IO6 A;  4RNS A;  3OMB A;  4PBQ A;  1YTV A;  3KSJ A;  4UA8 A;  3S4U A;  3U8Q A;  3CSB A;  3EPE A;  1OQG A;  3VV5 A;  1NUY A;  2A5S A;  3FVO A;  4PFI A;  3WAF A;  2QPQ A;  2ZNU A;  3MST A;  3QSL A;  2UYE A;  3VLU A;  1VR5 A;  4WKM A;  5H8S A;  1PB9 A;  3S9L C;  1MDP 1;  4X1D A;  3CFX A;  1HSJ A;  3CI8 A;  5JK4 A;  2UVI A;  3KC0 A;  1ZLQ A;  4FAJ A;  5KCJ A;  4EQ9 A;  2KQZ A;  4EQ7 A;  1JP4 A;  3SKP A;  1ZU0 A;  2HXW A;  3OO7 A;  3S9M C;  4GD5 A;  5CC2 A;  3D4G A;  4JVD A;  5A5X A;  4WXJ A;  3IK6 B;  1PEB A;  1QW0 A;  2F7B A;  4GVO A;  2YPN A;  4F2O A;  3TCG A;  4OEV A;  1N7W A;  1KA1 A;  3B50 A;  1EZP A;  1B1X A;  4I3E A;  5EHS A;  4O94 A;  3C32 A;  1B46 A;  1FBD A;  3VFJ A;  4P11 A;  3RUM A;  3SEW A;  4OTE A;  5EQ9 A;  2H4I A;  3O29 A;  1YZ0 A;  4HXV A;  5I5P A;  2DYX A;  4GX3 A;  4AB5 A;  2F3D A;  3FAS A;  1UIU A;  4BDO A;  3C4M A;  1QJM A;  4AS5 A;  2ZMB A;  1SW2 A;  3HO7 A;  3G3G A;  1N3X A;  5EHM A;  4GWU A;  4RY1 A;  5DT6 A;  1MXZ A;  4P0I A;  4ELP A;  3OEN A;  2Y7K A;  1MPB A;  3PPN A;  3BFU A;  1NV1 A;  1MXV A;  1P99 A;  3MZ1 A;  4KCD A;  2WYK A;  1LBV A;  4QFO A;  3T9V A;  2HXR A;  3M8U A;  2QVV A;  2XXW A;  5TP9 A;  4RYA A;  2XXP A;  4IO3 A;  3FUZ A;  3O6I A;  4XXU A;  3O2A A;  1IXG A;  3MAM A;  1BK4 A;  2D3I A;  3IX1 A;  3FIR A;  4GWW A;  2O84 X;  1N84 A;  3I3V A;  1FW0 A;  3VLV A;  4DE8 A;  4JWX A;  1VSO A;  2I4B A;  3B8B A;  3F11 A;  3KFM A;  1FPB A;  1PB8 A;  4I3Y A;  1UTB A;  1Y4T A;  4XEQ A;  1UTH A;  2HZL A;  1KWH A;  2D5W A;  3C9H A;  2Q74 A;  2GRV A;  4N13 A;  1B3E A;  3LC8 A;  3N6T A;  5EQ8 A;  3BIH A;  5I56 A;  2KLF A;  3LSW A;  1MH3 A;  2F8D A;  1Q9D A;  4OVS A;  3A29 A;  1FBC A;  3T9H B;  2NVU B;  5DTB A;  1Q1K A;  2V84 A;  4X48 A;  4HCY A;  3PD9 A;  1FPJ A;  1FTJ A;  3N94 A;  4MBP A;  2OJT A;  1B5I A;  3SER A;  3QXM A;  5DW8 A;  1LFH A;  4ZEK A;  5AA4 A;  1B0L A;  2UVJ A;  1SPI A;  3IOR A;  1VE4 A;  1D9Q A;  1IMD A;  2P3V A;  2HAU A;  3HV1 A;  1NV7 A;  1EYI A;  4ZEB A;  1IMB A;  4LZ8 A;  1WDN A;  3Q26 A;  4JXI A;  5EQ7 A;  1O64 A;  5AE4 A;  5DVF A;  1AOV A;  5DYH A;  4PFW A;  3BBR A;  1MG1 A;  1QKB A;  3TCF A;  2QFL A;  1RYO A;  1SBP A;  5I59 B;  4QXD A;  4PC9 A;  3C31 A;  3VE1 B;  3RT8 A;  3HN0 A;  3K6U A;  5I58 B;  3FZV A;  1B7U A;  3U92 A;  2WX9 A;  4Q5T A;  4GX4 A;  4LQ5 A;  2HCA A;  1DTG A;  4QSC A;  2MKZ A;  2WYP A;  3RNN A;  3K1P A;  3EHT A;  4MLQ A;  3SEX A;  1LBC A;  3A3C A;  3KEI A;  3PV0 E;  5I2N B;  3GLB A;  3MQ9 A;  1IXC A;  3KBZ A;  4FE8 A;  4I8C A;  4MX6 A;  1MQG A;  3E9X A;  4F3G A;  5LOM A;  3CFL A;  4X9T A;  3T9U A;  3VXB A;  1URS A;  1B7Z A;  1B4Z A;  1FQD A;  4ZZE A;  3MZB A;  2RF1 A;  3K6V A;  4MF3 A;  4PET A;  4E0X A;  4ZE9 A;  4OET A;  3MVW A;  3CG1 A;  3MYU A;  1SI0 A;  1FQF A;  3UP9 A;  3I6V A;  2XXX A;  3U65 A;  4NF8 A;  3QIM A;  2FBP A;  4KCC A;  1A99 A;  1DPP A;  4LON B;  5B70 A;  1SVX B;  3OO6 A;  2FVZ A;  1NH7 A;  3IJX B;  2Y5K A;  4NF6 A;  1FQE A;  3K1M A;  4HS7 A;  1T0K A;  2DXY A;  1D3K A;  2P1S A;  3C35 A;  5ELV A;  1MXX A;  4NMY A;  3VXC A;  4BDQ A;  1A55 A;  1R6Z A;  5DEX B;  1FPI A;  4R9F A;  3CSG A;  3QMF A;  3PPO A;  2Y5L A;  3T96 B;  1YPN A;  4H5G A;  4TLL B;  3KN8 A;  5H8N A;  1O63 A;  5KCJ B;  2VPO A;  1SW4 A;  3V89 B;  4M1V A;  4DLD A;  3FJG A;  1LBX A;  4G68 C;  1LEV A;  2O7U A;  2Q2A A;  2QS3 A;  4FEB A;  4EF1 A;  2DXR A;  1S50 A;  2Q88 A;  4PTK A;  1CB6 A;  1NV0 A;  2DQV A;  4ZEF A;  1XI6 A;  5AA2 B;  1XHY A;  3JV9 A;  1AH5 A;  1TXF A;  4OZ9 A;  2DWI A;  4YB5 A;  5AA3 A;  2XWV A;  1P1O A;  1YYZ A;  3RTF B;  3H7M A;  1A8E A;  1AMF A;  2V3U A;  2KR0 A;  1H43 A;  2ZNT A;  3VLW A;  5IAI A;  1SW5 A;  2PX1 A;  5L8D A;  4YKJ A;  3U1O A;  3H4Z A;  1N0T A;  2UVG A;  3H6T A;  5CRY A;  4JSO A;  4BDL A;  3CHG A;  3IFA A;  5LDZ A;  4F29 A;  2ZNS A;  4EQB A;  2XXU A;  3I5O A;  3VVD A;  2X7P A;  1GV8 A;  3T0J A;  2DE2 A;  2DE4 A;  3IO6 A;  3KSX A;  2HHM A;  1YXI A;  1NUW A;  1PB7 A;  2DS9 A;  2G93 A;  4HTG A;  5HPQ A;  1Y3Q A;  5IGA A;  3ZSF A;  1Y1M A;  4GFR A;  2BJI A;  4RJZ A;  4F18 A;  2GH9 A;  4IO5 A;  2ANJ A;  1FPE A;  4KD5 A;  2QS1 A;  4GLI A;  4P0G A;  2I6E A;  1I6A A;  5JTY A;  4H0W A;  3OXN A;  5CMB A;  4I40 A;  4P8B A;  1USY E;  1LB9 A;  1B5H A;  2YJP A;  3UA8 A;  1L5T A;  2QJE A;  4PF6 A;  4JWO A;  1SD3 A;  3IJO B;  1NNP A;  4Q0C A;  4OQO A;  3TTM A;  4OVT A;  3T66 A;  4NGU A;  2Q8J A;  3K0V A;  2CZH A;  2WKY A;  3CVG A;  1Y9U A;  1DOT A;  4X04 A;  3EQ1 A;  3VDF A;  2YLN A;  2Z8E A;  1F9B A;  2FIX A;  2Z8F A;  4EXL A;  5TU0 A;  5IKB A;  1US4 A;  2M8C A;  3C34 A;  4G2Z A;  4FOR A;  2I0C A;  4N17 A;  3IL1 B;  1R1N A;  2QMX A;  3IB1 A;  4MFI A;  1FJ6 A;  1JVX A;  4KXP A;  4UAC A;  1H45 A;  5H8N B;  5CMK A;  4ZEI A;  4ZZA A;  4F1U A;  4GXA A;  3ROJ A;  2XX8 A;  3EHS A;  3FBP A;  3MPL A;  4U4X A;  3RGY A;  4EUO A;  5IZ1 A;  5TPA A;  4F19 A;  5BWJ A;  4JDF A;  4BDM A;  5IZ3 A;  1B32 A;  1IQ7 A;  1BLF A;  1UIV A;  2FIE A;  3D4C A;  1D4N A;  1POT A;  4QF9 A;  2DWH A;  1LCT A;  4N91 A;  1B51 A;  3PPP A;  4U22 A;  4IO4 A;  5DEX A;  3GXA A;  2DVZ A;  1GTK A;  3NOH A;  4TOZ A;  1Z7N E;  3W9W A;  2G29 A;  5L9S A;  4I1D A;  1XS5 A;  4OVQ A;  3RYD A;  2F97 A;  5I84 A;  4IGR A;  4KQP A;  3G3H A;  4OXV A;  4FIM A;  3RPW A;  4FBP A;  2RC8 A;  4ECF A;  2FYI A;  1K9Y A;  3O6H A;  2DWA A;  2F7A A;  1UQW A;  1M5E A;  3RLF E;  1M5B A;  4P1E A;  3LBS A;  4F1V A;  2V93 A;  3PU5 A;  3E13 X;  3C33 A;  5DVJ A;  1XVX A;  4XKQ A;  1H3D A;  1HSL A;  3K6X A;  5F24 A;  4XKP A;  4YB6 A;  2PMS A;  3CIJ A;  4H65 A;  3FVN A;  1M5D A;  2Y84 A;  1IME A;  2B3B A;  1FSA A;  1B5J A;  4U21 A;  5ICQ A;  5EQA A;  4YMA A;  4M4G A;  2HFB A;  1EZ9 A;  1USY H;  3EKI A;  4GXS B;  4ONY A;  2XXI A;  3K00 A;  1B3L A;  2ZYN A;  4GWZ A;  4DDD A;  2OBG A;  4MHF A;  4MNI A;  5FHO A;  5CMC A;  2GHA A;  1QUJ A;  4GWX A;  4PFT A;  1IZ1 A;  4YAH X;  5ESY A;  1B3G A;  4OEU A;  3O9P A;  4GBW A;  4OER A;  5TP9 B;  4RXL A;  5HBC A;  1FTK A;  2DSF A;  4O7M A;  1R9L A;  5IZ3 B;  4AB6 A;  4ELR A;  4DCX A;  3UN6 A;  1LBB A;  4AQ4 A;  1P1Q A;  3G7W A;  4YB7 A;  4U23 A;  4EXK A;  1MM7 A;  2QVU A;  3A3U A;  3LSF B;  1G0I A;  1I69 A;  3HCQ A;  3LSX A;  2QS2 A;  1QUK A;  4U1O A;  2B65 A;  3KC1 A;  2VD2 A;  5CBR A;  2B3F A;  3UGW A;  4OFO A;  1FPF A;  4GBV A;  3PGF A;  1MM6 A;  4YKK A;  2P3N A;  3V8X B;  1N3W A;  4N6D A;  4GL8 A;  1RKM A;  3TKD A;  4QFK A;  4OHN A;  4H8I A;  4PGN A;  3D1R A;  1ZKB A;  4MIJ A;  3OO8 A;  1SW1 A;  4NF0 A;  4P56 A;  4ZDM A;  5FTH A;  2XXK A;  2VD3 A;  4EDP A;  1S7Y A;  4I9D A;  3VVF A;  4DXU A;  1FPD A;  5A5X B;  2Q89 A;  3SEY A;  3CG3 A;  2XWK A;  4ESX A;  2OX3 A;  4NF8 B;  3OEL A;  3U93 A;  4DIG A;  1FBG A;  1D9Y A;  3VVE A;  3FXR A;  3N26 A;  1VFD A;  1NUX A;  4NHB A;  3HFU A;  4ISU A;  4Z0I A;  1JW1 A;  2Z8D A;  3O97 A;  3UOR A;  4F3P A;  1QVS A;  2I3V A;  3KOS A;  1NNT A;  2XD2 A;  5ET8 A;  4R2B A;  4OVR A;  3IOW A;  5F1Q A;  2PFZ A;  2VT5 A;  3B6T A;  5H8H A;  1A54 A;  1A40 A;  1Y20 A;  1MH4 A;  3SEV A;  1FBF A;  2VP1 A;  3ILT B;  2NXO A;  5CMM A;  3TTK A;  1A8F A;  1LAG E;  2R6G E;  3M3F A;  3MW0 A;  2V4C A;  4R2F A;  3TTR A;  2O1L A;  3TEL A;  4RPO A;  3L6G A;  4MMP A;  2DDK A;  1K9Z A;  2VHA A;  3USD A;  4G61 A;  2RCB A;  4PE5 B;  2X7Q A;  3OSR A;  1ZJL A;  1FQB A;  3ODB A;  3FVK A;  3GYY A;  4OFJ A;  2F35 A;  3N6U A;  5BUU A;  4N15 A;  4EF2 A;  4G8N A;  1ZTY A;  1DPE A;  4QSE A;  2QSX A;  2XX9 A;  2XD3 A;  4F39 A;  4N6K A;  4RK2 A;  3MWB A;  2PBW A;  2DOJ A;  3RT6 B;  4N4U A;  4BDR A;  4POW A;  2X26 A;  3PUX E;  4LZ5 A;  1BIY A;  4G4P A;  3FGS A;  4R75 A;  3DM0 A;  1YAE A;  4MNC A;  3FVG A;  2XHD A;  5KDT A;  3THI A;  2F5X A;  1H44 A;  1NFT A;  3IAZ A;  1NV3 A;  2BJJ X;  3B6Q A;  5J16 A;  2V3Q A;  1R9Q A;  5FBP A;  4OMB A;  1SDX A;  3A09 A;  4QBA A;  2OCU A;  1D9V A;  2ZYK A;  3C36 A;  2UXA A;  4HCW A;  4GRK A;  5K2X A;  4JSD A;  4NF4 B;  4PGP A;  1SYI A;  2ZZW A;  5M2V A;  2H99 A;  3V5A A;  2WEF A;  2XXY A;  3PPQ A;  3QUF A;  4YIC A;  4G8H A;  1II5 A;  1QUL A;  4JVC A;  1PC3 A;  3MVX A;  3TQL A;  4YU0 A;  4NED A;  3PMW A;  4PFY A;  1RDZ A;  4KFQ A;  4X1B A;  1MRP A;  3M3L A;  4PBH A;  4KYE A;  4P9K A;  3BKI B;  1FBE A;  4NAP A;  4TQU Q;  3Q27 A;  4UAB A;  2L5V A;  2Q2C A;  1WVJ A;  3RQT A;  2VPN A;  1SYH A;  5KZT A;  5DVI A;  2XXQ A;  4KPT A;  1DBZ A;  1QKA A;  5CBS A;  3GBA A;  5B7D A;  4QFN A;  5AA2 A;  3PD8 A;  1DMB A;  1ZBM A;  1EU8 A;  2VGQ A;  5I57 A;  3FXU A;  2F34 A; 
#chains in the Genus database with same CATH homology
 1MXV A;  1Z7M E;  1P99 A;  1B32 A;  1HSE A;  2ONS A;  3MPK A;  3MZ1 A;  3HPI A;  1IQ7 A;  1BLF A;  1MY2 A;  1OIB A;  1UIV A;  1D4N A;  3D4C A;  4KCD A;  1POT A;  2DP8 A;  4QF9 A;  3TQW A;  3U94 A;  2DWH A;  3KGC A;  3UIF A;  2XXV A;  1OMP A;  4QFO A;  3T9V A;  1LCT A;  3OD7 A;  1B51 A;  3M8U A;  3HHF A;  3PPP A;  4U22 A;  2OWT A;  4U2R A;  4C1T A;  5TP9 A;  2XXW A;  1JW5 A;  4IO4 A;  5DEX A;  2AYS A;  2I3W A;  3TTN A;  3GXA A;  4RYA A;  1MQJ A;  3FV1 A;  4H8J A;  2XXP A;  2XXH A;  3PPR A;  4U1Z A;  5AA4 B;  2DVZ A;  4O3A A;  4QFL A;  4WEP A;  4IO3 A;  1GTK A;  2D21 A;  3FUZ A;  3O6I A;  3N5L A;  1JEU A;  4QFP A;  4R6H A;  4XXU A;  5F7V A;  5ISU A;  3O2A A;  4TOZ A;  1Z7N E;  2F36 A;  4GL0 A;  4H67 A;  1IXG A;  3MAM A;  2D3I A;  3IX1 A;  4R6Y A;  3O66 A;  1FCK A;  1NL5 A;  3FIR A;  4OFL A;  4DZ1 A;  2PVU A;  2UVH A;  4OEN A;  3TPA A;  3W9W A;  4XKN A;  2G29 A;  5L9S A;  1MXW A;  4GIZ A;  2O84 X;  4I1D A;  1XS5 A;  3IB2 A;  1N84 A;  1URD A;  3I3V A;  1MXU A;  1FW0 A;  2F78 A;  3VLV A;  4DE8 A;  1LAH E;  4JWX A;  2F6G A;  2V25 A;  3U92 A;  4R9G A;  3TFL A;  1VSO A;  2F97 A;  2I4B A;  3U72 A;  5I84 A;  4IGR A;  4PFU A;  3TDJ A;  3F11 A;  4KQP A;  4NF5 B;  3KFM A;  3G3H A;  4GOT A;  1PB8 A;  4FAT A;  4OXV A;  4FIM A;  1UTB A;  1Y4T A;  1LFI A;  3RPW A;  1UTH A;  2HZL A;  2RC8 A;  3LR1 A;  4ECF A;  1KWH A;  2D5W A;  2FYI A;  3C9H A;  2R71 A;  1ANF A;  2GRV A;  4N13 A;  4RA1 A;  3O6H A;  1B3E A;  1B3H A;  1IXI A;  2DWA A;  2F7A A;  2H5Y A;  1UQW A;  3LC8 A;  4QHQ A;  1M5E A;  3N6T A;  2DVC A;  4LVQ A;  1EZO A;  1N76 A;  1M5B A;  3K6W A;  3RLF E;  3SDF A;  4C0R A;  1M5F A;  5I56 A;  2KLF A;  3R7X A;  3LSW A;  2VOZ A;  3KN7 A;  1MH3 A;  3LBS A;  4F1V A;  2V93 A;  3PU5 A;  3SES A;  4QRZ A;  2F8D A;  3E13 X;  3MUQ A;  4YMB A;  4ZED A;  4O3B A;  3C33 A;  2PT2 A;  3K01 A;  5DVJ A;  1XVX A;  4XKQ A;  1H3D A;  4NE4 A;  2I49 A;  4ZS9 A;  3TCH A;  1US5 A;  2V3T A;  3ONM A;  4H1X A;  1B6H A;  1HSL A;  1MY3 A;  3LSL A;  3OO9 A;  1XC1 A;  3K6X A;  1BTJ A;  5TPA B;  3T9H B;  2NVU B;  4XKP A;  2ONR A;  4YB6 A;  1MQD A;  2Y7R A;  5EYF A;  2PMS A;  1Q1K A;  3CIJ A;  4H65 A;  5DTB A;  2V84 A;  3W9V A;  2W7Y A;  4X48 A;  5I2N A;  2Y7W A;  1TT1 A;  4FEC A;  4G77 A;  3FVN A;  4R73 A;  1M5D A;  4HCY A;  3O28 A;  3PD9 A;  1I6Q A;  2Y84 A;  3RY3 A;  2B3B A;  1FTJ A;  2IA4 A;  3N94 A;  4MBP A;  2OJT A;  4U21 A;  1B5J A;  1Q35 A;  1B5I A;  1MPC A;  2Z23 A;  3SER A;  2NOO A;  4BDN A;  5I57 B;  3QXM A;  1ZMG A;  4ZEK A;  5ICQ A;  5AA4 A;  1LFH A;  1B0L A;  1EH3 A;  5I2K A;  2Q9T A;  5J1D A;  4YMA A;  2UVJ A;  3GZG A;  3H3G A;  4M4G A;  1Y3N A;  3IOR A;  2A5T B;  1EZ9 A;  1VE4 A;  2HFB A;  5L9O A;  2VGQ A;  1USY H;  4ONY A;  3FJ7 A;  4GXS B;  2XXI A;  1LAX A;  2HAU A;  3K00 A;  2RC9 A;  1MY0 A;  1TWY A;  3HV1 A;  3HHG A;  3OSQ A;  5ICT A;  3P7I A;  1JVY A;  2F6P A;  2RIN A;  4ZEB A;  2AL5 A;  1B3L A;  2ZYN A;  2AIX A;  4DDD A;  1A7L A;  1B4H A;  2OBG A;  3CR9 A;  4ND9 A;  4LZ8 A;  1URG A;  1MS7 A;  1WDN A;  4GF8 A;  3Q26 A;  4NF5 A;  2ZYO A;  5JTY B;  3QYT A;  5FHO A;  5CMC A;  3M3K A;  2GHA A;  1QUJ A;  4JXI A;  1O64 A;  3E3K A;  1B1H A;  5AE4 A;  1NNF A;  3MBP A;  3RTW B;  4PFT A;  1JET A;  1MY4 A;  5DVF A;  4LZ7 A;  1B58 A;  1IZ1 A;  4OVJ A;  2Z22 A;  1AOV A;  5DYH A;  4PFW A;  3BBR A;  1MG1 A;  1QKB A;  1B0H A;  3CFZ A;  3S9E A;  4YAH X;  3TCF A;  3MVZ A;  1B3G A;  4OEU A;  1S9T A;  1P1W A;  1RYO A;  1SBP A;  3O9P A;  4KYD A;  5I59 B;  3L6H A;  1GR2 A;  3WAE A;  3E4R A;  3TTL A;  2FNC A;  4GWO A;  3TYH A;  4DCY A;  2HEU A;  4OER A;  3C31 A;  3VE1 B;  3RT8 A;  5CBR A;  1CE2 A;  3AXF A;  1XOC A;  3HN0 A;  3K6U A;  2H9B A;  3KBR A;  3PMV A;  4JBZ A;  5TP9 B;  5I58 B;  2H25 A;  3FZV A;  1OVT A;  1B52 A;  1Y4C A;  2ZYM A;  1B7U A;  3H03 A;  1FTK A;  2DSF A;  3KOT A;  4RXL A;  1ATG A;  1R9L A;  5HBC A;  4Q5T A;  4DXB A;  4ELO A;  2PYY A;  4O3C A;  2QS4 A;  4AB6 A;  4LQ5 A;  2HCA A;  4KYS A;  1DTG A;  3MVY A;  4QSC A;  5HPQ A;  4ELR A;  3JYR A;  4DCX A;  3UN6 A;  2O1M A;  3K2D A;  1NKX A;  3TZA A;  1IUD A;  1SI1 A;  3RNN A;  1MXY A;  1LBB A;  4AQ4 A;  5I59 A;  1OLC A;  3EHT A;  3K1P A;  2O69 A;  1FQA A;  2OZZ A;  4LP2 B;  1P1Q A;  4MLQ A;  3SEX A;  5AA1 A;  3G7W A;  5CI5 A;  4YZZ A;  4YB7 A;  4U23 A;  1LBC A;  2LAO A;  4EXK A;  3A3C A;  1MM7 A;  3DP4 A;  3MP8 A;  3MP6 A;  1IIT A;  4MLV A;  4F31 B;  2H98 A;  3FV2 A;  3A3U A;  3IR1 A;  3LSF B;  3TUS A;  1I69 A;  3HCQ A;  1O7T A;  3KEI A;  3PV0 E;  1LGB C;  3LSX A;  4K3F A;  5H8Q B;  2IEE A;  1Y1Z A;  2QS2 A;  5I2N B;  1QUK A;  3B7D A;  2B65 A;  3DP6 A;  2VD2 A;  3GLB A;  4U1O A;  4DXC A;  1UTB B;  2B3F A;  3MQ9 A;  3UGW A;  3SET A;  4OFO A;  1IXC A;  3PMX A;  3ECR A;  1B9J A;  4FE8 A;  4I8C A;  4L17 A;  4F1Y A;  2ZXT A;  2I4C A;  4ESW A;  3PGF A;  1MQG A;  1MM6 A;  1XT8 A;  3E9X A;  3OOA A;  3Q29 A;  4XTC Q;  2R9J A;  4YKK A;  4F3G A;  3K4U A;  3W15 C;  1JQF A;  1IXH A;  1B05 A;  3CFL A;  3H6W A;  4X9T A;  2HAV A;  3T9U A;  3VXB A;  4Z7E A;  1URS A;  5FHN A;  1B7Z A;  1B4Z A;  1MQI A;  1LAF E;  4Q30 B;  4YKP A;  3V8X B;  1FQD A;  4ZZE A;  3MZB A;  2RF1 A;  1N3W A;  3IOV A;  3K6V A;  3R26 A;  3EF7 A;  4GL8 A;  4IY5 A;  1NH8 A;  4IY6 A;  3OEK A;  5H8F A;  4MF3 A;  4PET A;  4E0X A;  3MP1 A;  1NNK A;  3CRB A;  1RKM A;  3TKD A;  4ZE9 A;  3FAT A;  1FTL A;  4OET A;  1M5C A;  1OQH A;  2O7I A;  3KG2 A;  4G8M A;  4FED A;  2O68 A;  2REJ A;  4QFK A;  4YKI A;  3MVW A;  4LUB A;  3CG1 A;  3H06 B;  4OHN A;  2ONK E;  2P2A A;  4HW8 A;  4H8I A;  1SI0 A;  1FQF A;  4H6D A;  3UP9 A;  5CM6 A;  3KZG A;  1ZKB A;  3I6V A;  3OO8 A;  2XXX A;  1SW1 A;  2E1S A;  4NF8 A;  3FXQ A;  4R6K A;  3QIM A;  1PDA A;  3OEM A;  4ZDM A;  5FTH A;  3DEL B;  1MY1 A;  4IO2 A;  3LUY A;  2VD3 A;  4EDP A;  4KCC A;  4C1U A;  1BKA A;  1A99 A;  1DPP A;  1S7Y A;  4I9D A;  3VVF A;  3R6U A;  4DXU A;  3RN8 A;  4KI0 E;  3BFT A;  3G3K A;  5A5X B;  3G3I A;  4OES A;  4LON B;  2Q89 A;  4IO7 A;  5B70 A;  1J1N A;  1SVX B;  2O6A A;  2XX7 A;  1B40 A;  3OO6 A;  1VFE A;  2ESN A;  1NH7 A;  4LA9 A;  3CG3 A;  3SEY A;  3IJX B;  1LLS A;  4QSD A;  4NF6 A;  4WED A;  4ESX A;  2I0B A;  1FQE A;  4NF8 B;  5I2K B;  3TOD A;  3OEL A;  2I48 A;  3K1M A;  4HS7 A;  4N07 A;  4R72 A;  1N7X A;  5L9M A;  3U93 A;  4DIG A;  5I58 A;  1T0K A;  1XVY A;  4U4S A;  4PP0 A;  2DXY A;  1LB8 A;  1D9Y A;  5H8H B;  3VVE A;  3SEU A;  3QUJ A;  3FXR A;  4LQ2 A;  3N26 A;  1VFD A;  1GVC A;  3PUW E;  3T93 B;  4JWY A;  4ISU A;  4PQJ A;  1D3K A;  2P1S A;  3C35 A;  4Z0I A;  4BLA A;  1JW1 A;  2Z8D A;  3O97 A;  1ELJ A;  5ELV A;  1MXX A;  5H8Q A;  3UOR A;  4NMY A;  1FTO A;  3VXC A;  4BDQ A;  1QVS A;  3DP8 A;  4F3P A;  2I3V A;  1A55 A;  2RC7 A;  4KHZ E;  2I58 A;  3KOS A;  3UK4 A;  1R6Z A;  1POY 1;  1LST A;  1NNT A;  2XD2 A;  3B6W A;  3PUZ E;  4R2B A;  5DEX B;  1IIW A;  2HQ0 A;  4R9F A;  3CSG A;  3IOW A;  5F1Q A;  2Y7P A;  3B6T A;  1ZIU A;  3JZJ A;  2P0S A;  4OWD A;  3T22 A;  1AIV A;  3PPO A;  5H8H A;  2GFE A;  3EN3 A;  3S2V A;  3TMG A;  1OLA A;  2F7C A;  1A54 A;  3K1N A;  1A40 A;  3T96 B;  1YPN A;  2CMO A;  1Y20 A;  4H5G A;  1MH4 A;  2CZL A;  1BP5 A;  4TLL B;  3KN8 A;  2OWS A;  2UYF A;  4GQO A;  5H8N A;  5FTI A;  3SEV A;  2O51 A;  3Q28 A;  2VP1 A;  1O63 A;  5KCJ B;  1SW4 A;  3ILT B;  3IOU A;  4M1V A;  3V89 B;  2REG A;  5ITP A;  3MC2 A;  3O6G A;  2NXO A;  4DLD A;  5CMM A;  3FJG A;  3TTK A;  4G68 C;  4FEB A;  2ABH A;  2O7U A;  1A8F A;  2Q2A A;  2QS3 A;  3G3J A;  4EF1 A;  1LAG E;  2DXR A;  5H8F B;  2R6G E;  1S50 A;  4NWC A;  2THI A;  3PUV E;  1N04 A;  1I6B A;  3QK6 A;  1WOD A;  2Q88 A;  2RCA A;  3K02 A;  3M3F A;  2XXR A;  4LAT A;  1CB6 A;  4RPN A;  2DQV A;  4NWD A;  4E0W A;  4ZEF A;  3MW0 A;  1LCF A;  3IO4 A;  5AA2 B;  1IEJ A;  4R2F A;  1XHY A;  3JV9 A;  3MJN A;  1AH5 A;  1TXF A;  4G68 B;  3TTR A;  2O1L A;  4OZ9 A;  2DWI A;  3TEP A;  3TEL A;  4XKR A;  4RPO A;  4YB5 A;  4F3B A;  5AA3 A;  3L6G A;  1DTZ A;  1P1O A;  3KJT A;  2OK2 A;  3RTF B;  2VHA A;  1A8E A;  1YCJ A;  3H7M A;  3FD3 A;  1AMF A;  1JNF A;  2V3U A;  1FTM A;  2Y7I A;  4POX A;  4THI A;  3USD A;  2RCB A;  3QAX A;  1H43 A;  2X7Q A;  3OSR A;  4H5F A;  1ZJL A;  2ZNT A;  4NF6 B;  3Q25 A;  4PE5 B;  3VLW A;  1FQB A;  4ZE8 A;  5AA2 D;  3TAJ A;  3ODB A;  4ELQ A;  5IAI A;  4RK9 A;  1SW5 A;  3FVK A;  2PX1 A;  5L8D A;  1JW4 A;  1OVB A;  2RKM A;  3S9N C;  4IO6 A;  3IOT A;  4OFJ A;  2F35 A;  3N6U A;  4RNS A;  3OMB A;  4YKJ A;  4NTL A;  4EF2 A;  5BUU A;  4G8N A;  3U1O A;  1ZTY A;  1B2H A;  3H4Z A;  1DPE A;  4F2Q A;  1N0T A;  1YTV A;  2UVG A;  3H6T A;  3KSJ A;  4KR5 A;  4JSO A;  2XXT A;  4UA8 A;  5CRY A;  4QSE A;  3S4U A;  3U8Q A;  3CSB A;  3EPE A;  3HST A;  1OQG A;  4BDL A;  3VV5 A;  1MDQ A;  2A5S A;  2ZNS A;  3PUY E;  4F29 A;  4EQB A;  3FVO A;  2QSX A;  2FA7 A;  2XD3 A;  2XX9 A;  2XXU A;  4F39 A;  3I5O A;  3VVD A;  3WAF A;  2X7P A;  1GV8 A;  5KDT B;  4RK2 A;  2QPQ A;  3MWB A;  1SQY A;  2QL3 A;  2PBW A;  2DOJ A;  2DE2 A;  1TFA A;  2ZNU A;  2DE4 A;  3IO6 A;  3KSX A;  3RT6 B;  3QSL A;  4BDR A;  1H76 A;  2E0S A;  2UYE A;  3VLU A;  2QMW A;  1VR5 A;  4POW A;  2X26 A;  1AL3 A;  4R74 A;  1PB7 A;  4WKM A;  5K2Y A;  2DS9 A;  2G93 A;  4HTG A;  5FHM A;  3PUX E;  4LZ5 A;  5H8S A;  1BIY A;  1QUI A;  2A5T A;  1PB9 A;  4FJP A;  4G4P A;  1B7H A;  3FGS A;  3S9L C;  1MDP 1;  1Y3Q A;  4X1D A;  3CFX A;  4R75 A;  3DM0 A;  1YAE A;  1HSJ A;  3FVG A;  3CI8 A;  3ZSF A;  1Y1M A;  3MZ9 A;  1DSN A;  2UVI A;  5JK4 A;  2XHD A;  4GFR A;  1ZLQ A;  4RJZ A;  5KDT A;  4F18 A;  3THI A;  3KN3 A;  4FAJ A;  2GH9 A;  2F5X A;  4IO5 A;  4NF4 A;  4Q8R A;  5KCJ A;  1UTH B;  2ANJ A;  3ZKK A;  4KD5 A;  2QS1 A;  3GBB A;  1H44 A;  1NFT A;  3IAZ A;  4GLI A;  4P0G A;  2I6E A;  1I6A A;  4EQ9 A;  4H0W A;  2BJJ X;  3OXN A;  4EQ7 A;  5JTY A;  5CMB A;  3B6Q A;  2NWJ A;  3SKP A;  1ZU0 A;  1NMU A;  2HXW A;  3OO7 A;  2V3Q A;  3S9M C;  1USY E;  1R9Q A;  1LB9 A;  4GD5 A;  5CC2 A;  4G68 A;  4OMB A;  1B5H A;  2YJP A;  1SDX A;  2HZK A;  1L5T A;  3UA8 A;  2QJE A;  2GHB A;  3A09 A;  5I56 B;  4JWO A;  3V83 A;  1SD3 A;  3IJO B;  2ALU A;  1NNP A;  1D9V A;  2OCU A;  2ZYK A;  2UXA A;  3C36 A;  3D4G A;  4GRK A;  4HCW A;  5A5X A;  4N6P A;  4Q0C A;  5JEI A;  4OQO A;  4WXJ A;  3IK6 B;  5K2X A;  1PEB A;  3TTM A;  1PBQ A;  4JSD A;  3T66 A;  1QW0 A;  4NF4 B;  2F7B A;  4GVO A;  1SYI A;  2Q8J A;  3K0V A;  2YPN A;  4F2O A;  5M2V A;  2DWJ A;  3TCG A;  4OEV A;  4F3S A;  2H99 A;  3V5A A;  2PT1 A;  2WKY A;  1N7W A;  1GGG A;  3CVG A;  1P1U A;  1Y9U A;  4XIG Q;  1DOT A;  2XXY A;  3PPQ A;  3EQ1 A;  5ITO A;  2YLN A;  2Z8E A;  4I62 A;  3VDF A;  1EZP A;  3QUF A;  4JB7 A;  1F9B A;  1B1X A;  2QRY A;  4G8H A;  4YIC A;  5EHS A;  3IB0 A;  3C32 A;  1B46 A;  1II5 A;  1QUL A;  2Z8F A;  3ILU B;  4EXL A;  4ZEC A;  5TU0 A;  1PC3 A;  1P1N A;  5IKB A;  3MVX A;  3TQL A;  1US4 A;  3VFJ A;  4YU0 A;  1MQH A;  2M8C A;  4NED A;  4OYV A;  3DLN A;  3PMW A;  4P11 A;  3RUM A;  3C34 A;  4OTE A;  3SEW A;  3T9X B;  4G2Z A;  4IGT A;  1Y3P A;  3EHU A;  3KJ7 A;  4FOR A;  4PFY A;  2I0C A;  3ZKL A;  3G3F A;  4KFQ A;  4F22 A;  2H4I A;  1MRP A;  4X1B A;  3O29 A;  3IL1 B;  2DYX A;  1R1N A;  3M3L A;  1LFG A;  2QMX A;  1MPD A;  3IB1 A;  4KYE A;  3BKI B;  3FAS A;  4MFI A;  4TLM B;  4AB5 A;  1UIU A;  4BDO A;  4TQU Q;  3Q27 A;  1JVX A;  3H6U A;  2Q2C A;  4MH5 A;  3C4M A;  1QJM A;  4UAC A;  1H45 A;  5H8N B;  3FJM A;  2ZMB A;  1WVJ A;  1PBP A;  1SW2 A;  1FQC A;  2OLB A;  3HO7 A;  4ZEI A;  3RQT A;  3G3G A;  5CMK A;  4ZZA A;  1N3X A;  1SYH A;  5KZT A;  5DVI A;  5EHM A;  4F1U A;  4RY1 A;  4GXA A;  1B3F A;  2XX8 A;  2NUV A;  2XXQ A;  3EHS A;  3MPL A;  5DT6 A;  4U4X A;  3ZS6 A;  1MXZ A;  1RYX A;  4P0I A;  3RGY A;  4KPT A;  2AL4 A;  1QKA A;  4ELP A;  4EUO A;  5CBS A;  4IB2 A;  3GBA A;  3OEN A;  5B7D A;  1TFD A;  4QFN A;  2Y7K A;  5AA2 A;  5HM4 B;  1MPB A;  3PD8 A;  5TPA A;  4F19 A;  5BWJ A;  1DMB A;  1ZBM A;  3H6V A;  3PPN A;  1EU8 A;  3BFU A;  4JDF A;  2DE3 A;  5I57 A;  3FXU A;  1JEV A;  4BDM A;  2F34 A;  5LOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...