2F97A

Effector binding domain of benm (crystals generated from high ph conditions)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
216
Chain Sequence
EKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oligomerization of BenM, a LysR-type transcriptional regulator: structural basis for the aggregation of proteins in this family.
pubmed doi rcsb
source organism Acinetobacter baylyi
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator benM
total genus 72
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f97A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f97A02
3C32A 1PC3A 1HSLA 3VDFA 5AA2A 4BLAA 1UTHA 1H3DA 1LFHA 3H6VA 1ZIUA 2RC7A 2OK2A 2XD2A 5CMMA 3I6VA 3MVWA 3QUFA 3IJXB 5L8DA 3C9HA 1P1NA 2AL4A 1NNPA 1XVXA 3LUYA 2X7QA 2XXHA 3KBRA 5A5XA 2VD3A 1DMBA 1MH4A 3I3VA 4GFRA 5HBCA 2YJPA 5I58A 2HQ0A 4F22A 3IR1A 3QSLA 2Q2AA 2DSFA 3PU5A 4GXSB 3TEPA 2OJTA 4POWA 3OELA 4TOZA 2ZMBA 3FXUA 2V93A 4IY5A 3ZS6A 1BP5A 3MPKA 1O63A 2XXQA 4ND9A 1A40A 3TDJA 2F7BA 4ZECA 3EHTA 5KCJB 2PYYA 1A8EA 2DVZA 3FJ7A 4TQUQ 3ODBA 3CFLA 2P0SA 2Z8FA 4RPNA 1AL3A 5CMCA 3RUMA 5L9MA 3TKDA 1JETA 1NNKA 1R1NA 3VVEA 4OQOA 4F2OA 2YPNA 2ONRA 4I9DA 4EUOA 1MPDA 2X26A 1MXUA 4NF5B 1TFAA 4KYDA 3SEUA 3T93B 4OETA 4YB6A 4NEDA 4ZE9A 1S9TA 5H8NB 4FE8A 3OMBA 4KR5A 1ZMGA 2O1LA 3TTLA 1IZ1A 2D3IA 1MY1A 2I3VA 2XXRA 1I6BA 2DXRA 3H6WA 4K3FA 4F3GA 3UN6A 3S4UA 3OO8A 1TFDA 4ESWA 1Y1MA 5HM4B 3B6QA 3E13X 3DLNA 5DVJA 4F31B 5ICQA 4H6DA 3KJ7A 3O9PA 1Y1ZA 4F29A 4F3PA 3MBPA 1OMPA 1WDNA 2A5TA 5FHMA 1NNFA 4KI0E 5F7VA 2PBWA 3KZGA 4XIGQ 1I6AA 3OO6A 4R6YA 1EU8A 2I0CA 4KQPA 5CBRA 4RXLA 1B9JA 1MY0A 3HSTA 4AQ4A 1USYE 3A09A 3MW0A 4M1VA 1FQAA 1SW2A 2O6AA 2Q8JA 4U4XA 3RTWB 3JYRA 5FTHA 3L6GA 3FJMA 4LZ7A 4ZZEA 3SERA 5HPQA 2RC8A 4Q0CA 1SYHA 2RCBA 1D9YA 5TP9B 4JWYA 1NL5A 3G3FA 1O7TA 1F9BA 3OD7A 4GQOA 4YKJA 1PBPA 2WKYA 3KOSA 4OVJA 5AA1A 1A99A 4DCXA 4BDMA 3N94A 1IUDA 4H0WA 3K1MA 3L6HA 3IOTA 3ONMA 2F78A 1Q35A 4R72A 3TCFA 5B7DA 1PEBA 4DDDA 5EHSA 2ZYKA 3LSWA 4F3SA 3W15C 3CIJA 3HCQA 4EF1A 1B7UA 4ZE8A 1AOVA 2FNCA 2ZXTA 1MQGA 2REGA 2XXWA 2DYXA 3FD3A 4FEBA 3SEWA 4ECFA 5H8QB 3TELA 5KZTA 1JNFA 2UVIA 1B4ZA 5TP9A 5KDTA 1B3HA 1B1XA 2XHDA 3VV5A 1IITA 3C33A 3C4MA 3K1NA 5DT6A 5H8FB 4FIMA 3TFLA 1N84A 1VSOA 2VGQA 3PPPA 3HHGA 2O69A 3H6UA 4POXA 5DVFA 2XXVA 3S2VA 1AMFA 3T96B 2QL3A 3MAMA 3MQ9A 3CSBA 3G3IA 1LB9A 5I2NA 1DPEA 3ZSFA 5H8NA 3PMVA 5ITPA 3O66A 4G68A 4G77A 1UQWA 4PFYA 5K2YA 1B3EA 4UA8A 1FQFA 2I48A 4XKPA 4YKKA 2IEEA 3QAXA 4RA1A 3MVYA 2AYSA 2F5XA 2GFEA 5KDTB 4I62A 5L9OA 1LCFA 3RY3A 2OLBA 2DWJA 3CI8A 1JEUA 1L5TA 2ZNSA 3CSGA 3PPRA 1H44A 3N5LA 4OENA 1FQEA 4BDNA 2PVUA 1Z7NE 4QSEA 4Z0IA 5LOMA 1XS5A 3HHFA 2QJEA 4AB5A 3DM0A 4OFOA 3U93A 2I3WA 1OVBA 1BTJA 2RC9A 3RT8A 4U1OA 4R74A 4PP0A 4GD5A 2QRYA 3IJOB 1XOCA 3N26A 3QIMA 3IL1B 4XKQA 1YPNA 3S9LC 4F39A 4RJZA 2O7UA 3VXBA 4BDLA 4OEUA 3FVOA 3O2AA 2PX1A 3MZ1A 5AE4A 1QW0A 5EHMA 4EQ9A 4PFTA 4Z7EA 1NKXA 4FECA 3BFTA 2ALUA 2I6EA 5I2KB 4YKIA 2H25A 1FW0A 3D4CA 1LAXA 3RTFB 2DVCA 3ZKKA 5AA4A 1SW4A 3H4ZA 4EQ7A 4AB6A 3IK6B 3EF7A 4XXUA 4H67A 1B6HA 3EN3A 2OWTA 3MZ9A 1I6QA 2D5WA 3OSRA 4GLIA 1MQIA 4GL0A 1ZU0A 3UA8A 1ANFA 4X1DA 3RT6B 4G4PA 2ESNA 3E9XA 4H65A 4JDFA 1IXIA 2QS1A 1M5CA 1YCJA 1N04A 1MY3A 3IB1A 3KN7A 1J1NA 1B05A 4QFOA 1B3FA 4R9GA 5I84A 3TTMA 4QHQA 3C35A 1JEVA 1H43A 4NWDA 3T22A 2UYFA 3FASA 1R9LA 3C31A 3TQLA 3E3KA 4DLDA 4R73A 4YB5A 3TODA 1Y9UA 2DWAA 5CMBA 3U94A 1FTKA 3KEIA 1CE2A 3OSQA 1MQDA 5DTBA 4DIGA 3G7WA 2Y7IA 2Y7PA 3I5OA 3GZGA 4ONYA 4ESXA 1XC1A 5I58B 4BDQA 3QUJA 1HSJA 3FXQA 4QFPA 4DE8A 2G93A 1SD3A 5AA2B 2Y7RA 1D9VA 2BJJX 3O6GA 5B70A 2O84X 2QPQA 4GF8A 1QJMA 1B52A 1B51A 4U22A 5ELVA 5IAIA 1B4HA 3A3CA 3IB0A 4LZ5A 1GTKA 4MBPA 5DYHA 3OO7A 4Q30B 5KCJA 2VD2A 4LUBA 1PB9A 3PUVE 1IXHA 1EH3A 2PT2A 1B40A 1IXGA 4U1ZA 2QS3A 1B7HA 5ITOA 3T9XB 1VR5A 2NOOA 3K01A 3K02A 3OO9A 3U8QA 4WEDA 4GRKA 3SEYA 3SEVA 2NXOA 2XXUA 1P1QA 4QFKA 1PB8A 2DE4A 3IORA 3MUQA 4O3CA 1Y3PA 4DXCA 1MRPA 3TUSA 3CG3A 4HS7A 1BLFA 2XX7A 3KOTA 3G3JA 3EPEA 4IGRA 4MF3A 2Y84A 3H3GA 4OESA 4X1BA 4NMYA 1DOTA 3FJGA 5TPAA 3H7MA 1RKMA 3FUZA 2IA4A 1M5FA 1WODA 2Q9TA 2QMXA 2D21A 3K1PA 3R26A 4ISUA 4P0GA 4P0IA 4R2FA 4P11A 2UVJA 3OXNA 4M4GA 2DOJA 3FVGA 3N6TA 4ZEFA 2DE2A 3S9EA 4FAJA 2HCAA 3HPIA 4U4SA 4ZDMA 1KWHA 2I49A 1ZKBA 4NF8A 4GIZA 4U2RA 3USDA 1A8FA 2OZZA 1I69A 2W7YA 3M3LA 1Y3NA 3S9NC 3FVKA 3HN0A 3B6TA 4QFNA 4PFWA 3PPQA 1IIWA 2HAVA 4JWOA 4IB2A 3FIRA 5AA3A 4ZEBA 3K2DA 3TCHA 3ILTB 2Z23A 5I59A 1ZTYA 2B3FA 2ZNUA 4KYEA 4R6HA 4F1YA 1FQDA 1FTMA 1HSEA 1IQ7A 1LAFE 3LC8A 2HZKA 4XKNA 3IO6A 4BDRA 3RLFE 4LQ2A 3GBBA 2ZYMA 2GRVA 3PUXE 3K00A 4NWCA 3VXCA 3T9UA 3IOWA 4YKPA 3MC2A 2X7PA 4EDPA 1OLAA 3IOUA 1Z7ME 2O7IA 3H6TA 3MWBA 4IY6A 3UGWA 4THIA 4ZEDA 2YLNA 3SETA 2H98A 4F1VA 1SI0A 1SBPA 1OQHA 3FZVA 1LBCA 3KFMA 1R9QA 4LATA 1DSNA 4G2ZA 2DE3A 4HCWA 4OZ9A 1D3KA 4OHNA 5H8SA 4HW8A 2H99A 4KCDA 1B0HA 1VE4A 5AA4B 4GWOA 3G3HA 2HAUA 2RF1A 4FORA 1MM6A 1ATGA 4U21A 2F7AA 1IXCA 3CFXA 4FEDA 4PE5B 3VLWA 1LLSA 5DEXB 3VVFA 4DXUA 3TTNA 3P7IA 1NH8A 1WVJA 4RYAA 3U92A 4H5GA 2B65A 3WAEA 2VHAA 1QUJA 1NFTA 3FATA 3E4RA 3QK6A 4NF6B 1B5HA 4LA9A 1LAHE 1DPPA 2H5YA 3IAZA 1RYXA 4Q8RA 4QSDA 3V8XB 2KLFA 1MPCA 2CMOA 3W9VA 4F2QA 3U72A 2XXIA 3JV9A 4H1XA 5TPAB 2GH9A 2Z8EA 2DP8A 3PUZE 4OEVA 3IB2A 3UORA 3BFUA 3VLVA 3PPNA 2UXAA 4KFQA 1S7YA 3QXMA 4G8NA 1N76A 3EHSA 1M5DA 4RK2A 4G8MA 4GVOA 2RCAA 1B1HA 1MQJA 1T0KA 2R9JA 4E0XA 1EZPA 3IO4A 3OEMA 1OVTA 2V3TA 4KYSA 4YU0A 1MDP1 4I1DA 4NF6A 2ANJA 5I56A 1SDXA 1D4NA 5CI5A 4RY1A 4HTGA 1JVYA 3JZJA 3Q27A 2V25A 4C1UA 4X9TA 1JW1A 1B46A 4LP2B 1ELJA 2HXWA 4QFLA 1MH3A 4R2BA 1LBBA 1FTLA 5BWJA 5H8HA 2F97A 2Y7KA 1Y20A 2F36A 3PPOA 3TAJA 3TQWA 3TYHA 4ELRA 4EXKA 5JK4A 3SESA 1QKAA 3O28A 1OLCA 2PMSA 2XXXA 3RGYA 2DWHA 2OWSA 1S50A 4IO6A 4YZZA 1Q1KA 3W9WA 4NTLA 3O6IA 1LB8A 3T9HB 1UTBA 2Y7WA 3C34A 5FHNA 4F3BA 4F1UA 4XKRA 4FJPA 3UK4A 4EQBA 2XXYA 3H03A 4LZ8A 3UIFA 1Y4CA 2PT1A 4O3AA 2E0SA 2A5TB 4C1TA 2XXTA 3K0VA 1QKBA 3K6UA 3M8UA 5JTYB 4EXLA 3MP8A 1H76A 1LSTA 2AIXA 5DEXA 5EYFA 1SW5A 3CG1A 3O97A 5J1DA 1BIYA 3V5AA 1P99A 4ELQA 3MJNA 4TLLB 2XX9A 5FHOA 1URSA 1FTJA 2QMWA 4LQ5A 1MY4A 3B7DA 3CFZA 1N7XA 4GOTA 2F7CA 3G3GA 1FQBA 1B2HA 3Q26A 4F18A 1XT8A 1Y4TA 2VP1A 4RNSA 2I58A 2UYEA 1SQYA 4OERA 1B7ZA 1B32A 2ONKE 2V3QA 3GXAA 2ZNTA 2GHAA 5CRYA 4ZEIA 5TU0A 1MQHA 4X48A 2H9BA 2QS4A 1MY2A 3TTRA 2VOZA 3O29A 4KPTA 3SKPA 1MXXA 4O3BA 3U1OA 4OFLA 2HZLA 3CRBA 3OENA 4ZEKA 1LCTA 4G8HA 1XVYA 5I56B 2HFBA 1AH5A 3GLBA 4I8CA 4IO7A 3K6VA 1TT1A 5JEIA 1CB6A 3K6WA 4DXBA 5I59B 3M3KA 3ZKLA 1USYH 4GXAA 4JB7A 4PQJA 5CM6A 5H8FA 1AIVA 2UVHA 1SW1A 2XD3A 4QRZA 3F11A 1ZJLA 2XX8A 1VFEA 2F6GA 3THIA 3RN8A 1N3XA 2ZYOA 1EZ9A 2OCUA 4RK9A 5I2NB 1N7WA 4JXIA 1TXFA 3LBSA 3G3KA 3D4GA 1JVXA 4G68B 1TWYA 3LR1A 3KN3A 3OEKA 4N6PA 3TPAA 4YMBA 2I4CA 3FV1A 3OOAA 2QS2A 4R75A 1MXZA 1XHYA 2RINA 3DP8A 4ELOA 3B6WA 3DELB 1FQCA 1MG1A 1US4A 2ONSA 4IO4A 1DTZA 1NH7A 4JBZA 2FYIA 3TCGA 1FCKA 5ISUA 2DS9A 3FXRA 3DP6A 1IEJA 1ZBMA 2I4BA 3ECRA 3PD9A 3Q29A 4PFUA 5I57B 1PBQA 1DTGA 3K4UA 3PD8A 4NF4B 3DP4A 2CZLA 3VLUA 3LSFB 1GR2A 4WKMA 1UIVA 1A7LA 3IOVA 3T66A 3CR9A 3KSJA 2UVGA 4NF5A 2H4IA 2Z8DA 4BDOA 1PB7A 3SDFA 1N0TA 1GV8A 1UTBB 2M8CA 3RPWA 1YAEA 1MM7A 2LAOA 3K6XA 4ZS9A 3WAFA 4OWDA 3Q25A 5F1QA 4JWXA 2B3BA 3RNNA 2AL5A 3SEXA 1MXVA 4E0WA 2O68A 3BKIB 4N13A 3RQTA 1B3LA 1LGBC 2F8DA 3GBAA 4IO3A 1B5IA 2V3UA 2ZYNA 4HCYA 1POY1 5BUUA 1PDAA 2XXPA 3CVGA 3AXFA 1QULA 3KG2A 4WXJA 5FTIA 2OBGA 4C0RA 1O64A 3H06B 2FA7A 1A54A 4TLMB 3TMGA 2I0BA 4H8JA 1BKAA 1POTA 1QUIA 4OXVA 1LFIA 1QUKA 2V84A 4H8IA 3MVXA 3MP6A 3LSXA 1VFDA 5DVIA 3MVZA 4MLVA 5I57A 1SVXB 3PMWA 4KHZE 4NE4A 2F34A 3MP1A 2THIA 2GHBA 2NVUB 3KJTA 3V89B 1YTVA 3V83A 1URDA 1P1WA 3A3UA 3MPLA 5AA2D 3MZBA 3R6UA 4L17A 4UACA 5A5XB 1R6ZA 1P1OA 1MXYA 4MLQA 4KCCA 4RPOA 5K2XA 2R71A 4LONB 1US5A 5CBSA 1QVSA 2O51A 2QSXA 2DWIA 4MH5A 4OFJA 4OMBA 5IKBA 1NMUA 5L9SA 1UIUA 4IO5A 1N3WA 5JTYA 1Y3QA 3PUYE 5ICTA 1B5JA 1OIBA 2A5SA 4YAHX 4ZZAA 2Q88A 3PMXA 3BBRA 4JSDA 4OYVA 1FTOA 4YICA 3M3FA 4IO2A 1URGA 4WEPA 4R6KA 4YB7A 4JSOA 3ILUB 5CMKA 3FGSA 5H8QA 2F35A 3TZAA 3UP9A 3EQ1A 3C36A 2REJA 3N6UA 3QYTA 1SYIA 1B0LA 1JQFA 4QF9A 1M5EA 3TTKA 4DZ1A 1ZLQA 2O1MA 4NF4A 2Q2CA 4Q5TA 3FV2A 4GL8A 1A55A 2F6PA 2NUVA 3VVDA 1JW5A 1B3GA 2P2AA 1MDQA 4OTEA 5H8HB 3T9VA 1RYOA 4U23A 3IX1A 5I2KA 1OQGA 2G29A 4R9FA 2R6GE 4YMAA 1P1UA 1EZOA 3PV0E 1B58A 4QSCA 4XTCQ 1JW4A 2DXYA 4EF2A 1UTHB 3PGFA 4LVQA 2E1SA 4IGTA 2DQVA 3Q28A 1II5A 5M2VA 4N07A 3VE1B 3R7XA 3S9MC 2Z22A 3HO7A 2Q89A 3EHUA 3KSXA 3HV1A 3O6HA 4KD5A 1NNTA 4PETA 1H45A 4DCYA 1M5BA 2RKMA 1GGGA 3KGCA 4ELPA 1LAGE 1MS7A 3KN8A 2ABHA 2P1SA 3PUWE 4G68C 4NF8B 3VFJA 5CC2A 1MPBA 2HEUA 1GVCA 4MFIA 1LFGA 2NWJA 1SI1A 1MXWA 3FVNA 4H5FA 4F19A 4FATA 3LSLA
chains in the Genus database with same CATH superfamily
3H6VA 5L8DA 1P1NA 2AL4A 3KC0A 5A5XA 2VD3A 1DMBA 3TEPA 4TOZA 2XWOA 2V93A 3EHTA 3A29A 2DVZA 4TQUQ 5L9MA 1JP4A 2YPNA 4EUOA 4I9DA 1MXUA 1RDYA 1IZ1A 1MY1A 2XXRA 3H6WA 1I6BA 2DXRA 3S4UA 3OO8A 3ROJA 4F31B 4XF5A 4QBAA 1WDNA 2A5TA 1NNFA 1NUZA 4XIGQ 1I6AA 5CBRA 4X04A 1EU8A 1AWBA 2I0CA 5I57A 4AQ4A 3MW0A 4M1VA 1SW2A 2O6AA 1G0HA 3L6GA 3SERA 2PFZA 2RCBA 4MJOA 1D9YA 3G3FA 1O7TA 4GQOA 4YKJA 1A99A 3N94A 1IUDA 1FBDA 1PEBA 4F3SA 3W15C 3CIJA 1MQGA 2REGA 4P3LA 3SEWA 4ECFA 1JNFA 2UVIA 1B4ZA 3VV5A 3C4MA 1VSOA 2VGQA 4GWYA 2XXVA 5DVFA 5IZ1A 1KA1A 3MAMA 3G3IA 1LB9A 1DPEA 3O66A 4PFYA 1B3EA 4YKKA 1IMAA 5L9OA 2DWJA 5I2KA 1JEUA 3PPRA 3N5LA 5LOMA 3U93A 4NGUA 3IJOB 3QIMA 3IL1B 4F39A 3FVOA 4PFBA 5AE4A 4PFRA 4FECA 2ALUA 4YKIA 1FW0A 3RTFB 1SW4A 3IK6B 1B6HA 4N8YA 3OSRA 4OVSA 3HFUA 1FPJA 4G4PA 4JDFA 1IXIA 2QS1A 3KN7A 1J1NA 1EYJA 1JEVA 1H43A 3C35A 3T22A 1R9LA 5EYGA 4R73A 4YB5A 3SZPA 3U94A 4MNIA 4DIGA 3G7WA 2XWKA 4QFPA 2G93A 2O84X 1XI6A 5ELVA 1B4HA 4LZ5A 4Q30B 2VD2A 3PUVE 1EH3A 5ITOA 1VR5A 3K01A 3K02A 4GRKA 1PB8A 2DE4A 1FPGA 1LBXA 3MUQA 1Y3PA 3TUSA 1MRPA 5DT6A 4IGRA 4UABA 1DOTA 5TPAA 3H7MA 3K1PA 4ISUA 4P0IA 2UVJA 2VT5A 3OXNA 4M4GA 2DOJA 4ZEFA 3S9EA 1KWHA 2I49A 4NAPA 4GIZA 3RYDA 1A8FA 1NV1A 2HPGA 4GWZA 4PBHA 3HN0A 1FPLA 4PFWA 1IIWA 2HAVA 3K2DA 3ILTB 4O94A 5I59A 2B3FA 1FQDA 1HSEA 1LAFE 3LC8A 3IO6A 4BDRA 3RLFE 2XWIA 4LQ2A 3GBBA 4YKPA 2ZZVA 2WYPA 4EDPA 2O7IA 3H6TA 3UGWA 5J16A 2YLNA 3SETA 4F1VA 1OQHA 4GWXA 4LATA 3ISPA 4U21A 4PE5B 1FPKA 3P7IA 1NH8A 4H5GA 2B65A 3WAEA 2VHAA 4NF6B 3QK6A 1LAHE 2H5YA 4QSDA 2KLFA 2XXIA 2GH9A 3IFAA 3VLVA 3IB2A 2UXAA 1S7YA 4G8NA 1M5DA 4G8MA 1B1HA 4E0XA 1EZPA 3OEMA 4KYSA 1D4NA 4JVDA 4RY1A 1JW1A 4QFLA 5H8HA 1NV0A 2F97A 2Q8MA 1Y20A 4EXKA 2B4MA 3RGYA 4I3EA 3O6IA 3T9HB 4FJPA 2XXYA 3H03A 2A5TB 4EXLA 1LSTA 5EYFA 5J1DA 1BIYA 2QMWA 1FTJA 3B7DA 4GOTA 2F7CA 3G3GA 3Q26A 5IZ3A 1Y4TA 2VP1A 2I58A 1B7ZA 2V3QA 4ZEIA 5CRYA 2ZNTA 4P47A 4X48A 3TTRA 3SKPA 1MXXA 3U1OA 4G8HA 5I56B 4IO7A 1TT1A 1IMDA 1CB6A 3M3KA 3ZKLA 4GXAA 4JB7A 4PQJA 3F11A 1ZJLA 1FSAA 5ET5A 1RDZA 1EZ9A 2OCUA 4P9KA 3OEKA 4MX6A 3DELB 1FQCA 4N81A 1FCKA 2DS9A 3FXRA 1ZBMA 3Q29A 1DTGA 4NF4B 3VLUA 1RDXA 1UIVA 3CR9A 1LBVA 2Z8DA 4BDOA 1PB7A 1GV8A 2LAOA 2OX3A 5F1QA 2B3BA 4N13A 4IO3A 5BUUA 1QULA 4WXJA 4GX4A 2FA7A 3NOHA 4H8JA 1POTA 4OXVA 3B8BA 1QUKA 3MP6A 3MVZA 4MLVA 1SVXB 4KHZE 3KJTA 1URDA 4UACA 2R8TA 1MXYA 4LONB 1US5A 4MH5A 1NMUA 5JTYA 5ICTA 4ZZAA 3BBRA 4OYVA 3KBZA 4N8GA 1FTAA 1CNQA 4QF9A 3EQ1A 3N6UA 4DZ1A 1SYIA 1B0LA 1M5EA 1ZLQA 3KC1A 4Q5TA 3FV2A 4PAKA 1MDQA 3T1BA 1B58A 1JW4A 2DXYA 5M2VA 3KSXA 3O6HA 3KGCA 1LAGE 3PUWE 2HEUA 1GVCA 4MFIA 1LFGA 2F3DA 2NWJA 5AA2A 4BLAA 1H3DA 4PDDA 3QUFA 2YJPA 2HQ0A 4F22A 1NV6A 3PU5A 2OJTA 4POWA 1BP5A 3MPKA 1O63A 2XXQA 4ND9A 2F7BA 5KCJB 3FJ7A 2ZZWA 2Z8FA 3T0JA 4OQOA 2WEFA 4F2OA 4GWWA 1MPDA 1TFAA 3T93B 4ZE9A 1S9TA 5H8NB 3OMBA 4KR5A 3TTLA 2D3IA 5I56A 5I5PA 3UN6A 5HM4B 4NN3A 5DVJA 4F29A 4F3PA 3KZGA 4R6YA 1FJ9A 1MY0A 3HSTA 3A09A 4AS5A 4ZZEA 5HPQA 4Q0CA 1FPBA 3KOSA 4OVJA 3BIGA 3K1MA 3IOTA 3TCFA 1Q35A 1FBPA 3LSWA 3B50A 4EF1A 5A5LA 3FD3A 5H8QB 5KZTA 5TP9A 1B3HA 4MNCA 3C33A 3K1NA 2HHMA 3TFLA 1N84A 3PPPA 4POXA 1AMFA 3ZSFA 1EYKA 5ITPA 4UA8A 2I48A 1NV3A 2GFEA 5KDTB 2OLBA 1L5TA 1FQEA 2PVUA 1Z7NE 4QSEA 2B4LA 4AB5A 2CZIA 2I3WA 1OVBA 2RC9A 4GD5A 3N26A 4XKQA 1YPNA 2O7UA 4PFTA 3BFTA 5AA4A 3H4ZA 4AB6A 1NV2A 4H67A 4IR8A 2OWTA 3MZ9A 4GBWA 1MQIA 4GL0A 3RT6B 2ESNA 3E9XA 1YCJA 1B3FA 5I84A 4QHQA 4NWDA 3GYYA 3TQLA 4DLDA 3TODA 5CMBA 1FTKA 1QGXA 2Y7IA 5DW8A 3GZGA 3QUJA 1HSJA 5AA2B 1D9VA 2BJJX 3O6GA 4HXVA 2QPQA 4GF8A 1QJMA 3A3CA 4MBPA 1GTKA 4MEVA 1IXHA 4ELRA 1IXGA 4U1ZA 3OO9A 4WEDA 4P56A 2NXOA 4QFKA 3IORA 4DXCA 4MF3A 4OESA 3EPEA 3H3GA 4O7IA 1RKMA 3FUZA 2IA4A 3R26A 2QMXA 4P0GA 2XXKA 3FVGA 4FAJA 4U4SA 4NF8A 1ZKBA 3USDA 2W7YA 3M3LA 1Y3NA 4JWOA 4IB2A 3TCHA 1IQ7A 2HZKA 4XKNA 4NWCA 2L5VA 4THIA 5LTCA 5ET7A 4N15A 3FZVA 2QVRA 1LBCA 1R9QA 4G2ZA 1FBHA 2DE3A 4OHNA 4HW8A 1B0HA 2FBPA 4GWOA 2QVVA 4FORA 1MM6A 1ATGA 3CFXA 3VVFA 1LLSA 5DEXB 3TTNA 1K9YA 1QUJA 1NFTA 3E4RA 1DPPA 4Q8RA 2CMOA 1FRPA 4NX1A 2DP8A 3PUZE 3UORA 3EHSA 2RCAA 4MCOA 1MDP1 5IGAA 4C1UA 4X9TA 4P1LA 2HXWA 1MH3A 5ET8A 1FTLA 5BWJA 1YXIA 2Y7KA 2F36A 3MYUA 3SESA 1QKAA 2PMSA 1S50A 4NTLA 1UTBA 3C34A 4LZ8A 1Y4CA 4C1TA 2XXTA 1H76A 4TLLB 2XX9A 1DCUA 3CFZA 1FQBA 1B2HA 4F18A 4RNSA 2UYEA 4OERA 3V5AA 2ONKE 2VOZA 4OVPA 2DDKA 5FBPA 4DI4B 1LCTA 1XVYA 3GLBA 5JEIA 3K6WA 1NUYA 1AIVA 5EQ9A 2XX8A 2F6GA 3THIA 1BK4A 2ZYOA 4RK9A 1N7WA 3D4GA 1JVXA 3LR1A 3TPAA 2I4CA 4R75A 1MXZA 2RINA 4ELOA 1US4A 2ONSA 4IO4A 1DTZA 5ISUA 3DP6A 1IEJA 3PD9A 3PD8A 1SPIA 3DP4A 3LSFB 4WKMA 2XWVA 1UTBB 3BIHA 3RPWA 1YAEA 1MM7A 4E0WA 2O68A 1B3LA 1LGBC 3GBAA 2V3UA 4HCYA 2XXPA 3KG2A 2OBGA 4MNPA 2I0BA 1QUIA 3LSXA 2THIA 2NVUB 3A3UA 5AA2D 3MZBA 5A5XB 1R6ZA 1P1OA 2O51A 2QSXA 2DWIA 4MMPA 4OMBA 5IKBA 5L9SA 1UIUA 2P3VA 1Y3QA 2QFLA 5ESYA 4YAHX 1FTOA 4IO2A 4WEPA 4R6KA 5H8QA 3UP9A 2REJA 3U65A 1JQFA 2O1MA 1A55A 2F6PA 1B3GA 5H8HB 4PAFA 1RYOA 3IX1A 4H46A 4AS4A 2R6GE 1EZOA 2CZKA 3PGFA 4LVQA 2E1SA 4IGTA 1II5A 4PETA 4DCYA 1H45A 2RKMA 2ABHA 4NF8B 3VFJA 4PC9A 4FATA 3LSLA 2CEXA 4PE3A 1UTHA 1LFHA 2V4CA 2RC7A 2OK2A 3I6VA 3MVWA 4PGNA 2X7QA 2XXHA 3I3VA 1MH4A 4GFRA 5I58A 5HBCA 3IR1A 3QSLA 2Q2AA 2DSFA 4GXSB 2WX9A 2KR0A 4IY5A 1A40A 4ZECA 2PYYA 1A8EA 1T0KA 3ODBA 2P0SA 1AL3A 3TKDA 1JETA 1NNKA 1R1NA 2ONRA 4HE2A 1KA0A 4KYDA 4OETA 4PF6A 1NV4A 1ZMGA 2O1LA 2F3BA 4K3FA 4F3GA 4ESWA 3IFCA 3KJ7A 1Y1ZA 4KI0E 1LBZA 4KQPA 1USYE 1FQAA 2Q8JA 4U4XA 3RTWB 3JYRA 3FJMA 4LZ7A 2RC8A 4I40A 5TP9B 4JWYA 1FBFA 1F9BA 3OD7A 5AA1A 2WKYA 1LBYA 4H0WA 3L6HA 3ONMA 5B7DA 2F78A 4PDHA 5EHSA 4O8MA 1AOVA 2ZXTA 4FEBA 5KDTA 1B1XA 4FIMA 3MSTA 2O69A 3H6UA 3S2VA 3T96B 3PMVA 5K2YA 4G68A 1UQWA 4XKPA 2IEEA 4RA1A 3MVYA 1LCFA 2ZNSA 3CSGA 4OENA 1H44A 4BDNA 4Z0IA 1XS5A 4OFOA 2QRYA 1XOCA 2BJIA 4RJZA 4PCDA 3VXBA 4BDLA 4OEUA 3O2AA 2PX1A 3MZ1A 4EQ9A 4OA4A 1K9ZA 2H25A 3D4CA 2DVCA 4EQ7A 1FPIA 4NG7A 3EF7A 4XXUA 3EN3A 1I6QA 4GLIA 3UA8A 1ANFA 4X1DA 5IM2A 4NHBA 1B05A 4QFOA 3TTMA 2UYFA 3QMFA 5EQ7A 3C31A 1Y9UA 3OSQA 2Y7PA 3I5OA 4ONYA 4ESXA 4BDQA 1INPA 4DE8A 1SD3A 2Y7RA 5B70A 4U22A 1FBCA 3IB0A 5KCJA 5DYHA 3OO7A 1PB9A 1B40A 2QS3A 1B7HA 3T9XB 2NOOA 3U8QA 2XXUA 1YZ0A 5FTHA 4HS7A 1D9QA 3KOTA 3G3JA 4N17A 2GQ1A 3LV0A 2Q9TA 4P11A 3N6TA 2DE2A 2HCAA 4U2RA 1I69A 3FVKA 4QFNA 2VPNA 5AA3A 4P8BA 2Z23A 4R6HA 1FTMA 2GRVA 3PUXE 3K00A 3T9UA 1OLAA 3MWBA 4ZEDA 2H98A 3KFMA 1DSNA 1D3KA 5H8SA 4N91A 1FJ6A 2H99A 5ET6A 3G3HA 1NUWA 2HAUA 2ZZXA 1IXCA 3VLWA 3U92A 3FATA 4PBQA 4LA9A 1RYXA 3V8XB 3W9VA 1MPCA 4F2QA 4P1EA 5TPAB 2Z8EA 4OEVA 3BFUA 3PPNA 4KFQA 1FBGA 3QXMA 4RK2A 1IMEA 1LEVA 1OVTA 4GBVA 4YU0A 1SDXA 4HE1A 5CI5A 1JVYA 3JZJA 1B46A 3PPOA 3PTYA 3TYHA 5JK4A 3CHGA 2FHYA 4OANA 2DWHA 4IO6A 1Q1KA 1LB8A 4F1UA 3UK4A 3UIFA 2PT1A 3K0VA 5JTYB 1SW5A 3CG1A 3O97A 3MJNA 5FHOA 1URSA 4LQ5A 1N7XA 2Y5LA 5TU0A 2GHAA 1MQHA 2HZLA 3CRBA 5EQAA 4GWUA 1AH5A 3K6VA 4GWSA 4DXBA 1USYH 2UVHA 2XD3A 4QRZA 4DI3D 2CZHA 4GX3A 1TXFA 3LBSA 4G68B 1TWYA 3KN3A 2QS2A 1XHYA 3B6WA 1NH7A 2FYIA 2OWZA 4PFUA 2I4BA 5I57B 3FXBA 1PBQA 3K4UA 3IOVA 1A7LA 3T66A 5I7IA 2UVGA 2H4IA 2M8CA 4ZS9A 3K6XA 3WAFA 3Q25A 3RNNA 2AL5A 3SEXA 3BKIB 2ZYNA 2QVUA 3RPLA 1PDAA 1YYZA 3CVGA 4C0RA 1O64A 4TLMB 1VDWA 1BKAA 2V84A 4H8IA 3MVXA 3PMWA 2F34A 2GHBA 3V83A 1P1WA 3MPLA 5K2XA 4KCCA 2R71A 1QVSA 4G61A 3E79A 4IO5A 3PUYE 1OIBA 2A5SA 2Q88A 4YICA 3M3FA 4X8RA 1URGA 4YB7A 3FGSA 3QYTA 2HXRA 4NF4A 2NUVA 4OTEA 1OQGA 4R9FA 4YMAA 1P1UA 3PV0E 4QSCA 3D1RA 4EF2A 1UTHB 2DQVA 3Q28A 1DBZA 3S9MC 2Z22A 2Q89A 3HV1A 1NNTA 1MS7A 5CC2A 4KXPA 1SI1A 4U23A 3FVNA 4H5FA 4F19A 3C32A 1PC3A 1HSLA 3VDFA 3RPLB 1ZIUA 2XD2A 5CMMA 3IJXB 3C9HA 1NNPA 1XVXA 3LUYA 3KBRA 4JVIA 3OELA 2ZMBA 3FXUA 3ZS6A 3TDJA 2XA5A 3CFLA 4RPNA 5CMCA 3RUMA 3VVEA 2X26A 4NF5B 3SEUA 4YB6A 4NEDA 4FE8A 2I3VA 1TFDA 1Y1MA 3B6QA 3E13X 3DLNA 4H6DA 3O9PA 5F24A 3MBPA 1OMPA 5FHMA 5F7VA 2PBWA 3OO6A 4RXLA 1B9JA 1SYHA 2FIEA 1NL5A 1EYIA 1PBPA 4DCXA 4BDMA 1IMBA 4R72A 4DDDA 1NV5A 2ZYKA 4NF0A 3HCQA 1B7UA 4ZE8A 2FNCA 2XXWA 2DYXA 3TELA 2XHDA 1IITA 5H8FB 3HHGA 5EQ8A 4PAIA 2QL3A 3MQ9A 3CSBA 5I2NA 5H8NA 4G77A 1FQFA 3QAXA 4N4UA 2AYSA 2F5XA 1KZ8A 4I62A 2PCRA 4MAGA 3RY3A 5IZZA 3CI8A 3HHFA 4MHFA 2QJEA 3DM0A 1BTJA 1FPFA 3RT8A 4U1OA 4R74A 4PP0A 3S9LC 1QW0A 4QXDA 5EHMA 4Z7EA 1NKXA 1LBWA 2I6EA 5I2KB 3ZKKA 1LAXA 1DK4A 5T3JA 2D5WA 1ZU0A 1NI9A 2VPOA 4H65A 1M5CA 3IB1A 1N04A 1MY3A 4R9GA 5I3SA 3FASA 3E3KA 2DWAA 3KEIA 1CE2A 5DTBA 1MQDA 1IMCA 1XC1A 5I58B 1FPEA 3FXQA 4OVTA 5IAIA 1B52A 1B51A 4LUBA 2PT2A 4XFEA 4PFIA 3SEYA 3SEVA 3LUZA 1P1QA 1NV7A 4XEQA 4O3CA 3CG3A 1BLFA 2XX7A 4H45A 2Y84A 4X1BA 4NMYA 2FIXA 3FJGA 1M5FA 1WODA 5ICQA 2D21A 4R2FA 4MIJA 3HPIA 4ZDMA 4GX6A 2OZZA 3S9NC 3B6TA 3PPQA 3FIRA 1IMFA 4ZEBA 1FBEA 4PF8A 1ZTYA 2ZNUA 4KYEA 4F1YA 2ZYMA 3VXCA 3IOWA 3MC2A 4FBPA 2X7PA 3IOUA 1Z7ME 4IY6A 3EKIA 1SI0A 1SBPA 4OZ9A 4OVRA 4HCWA 4KCDA 2MKZA 1VE4A 4LN5A 5AA4B 2RF1A 2F7AA 4FEDA 4DXUA 4RYAA 1WVJA 1B5HA 3IAZA 3U72A 4PGPA 3JV9A 4H1XA 1N76A 4GVOA 1MQJA 2R9JA 3IO4A 2V3TA 4I1DA 4NF6A 2ANJA 4HTGA 3Q27A 2V25A 4LP2B 1ELJA 4R2BA 1LBBA 3TQWA 3TAJA 3O28A 1OLCA 2XXXA 2OWSA 4YZZA 3W9WA 4I3YA 4N6KA 2Y7WA 5FHNA 4F3BA 4XKRA 4EQBA 4PTKA 1G0IA 4O3AA 2E0SA 3K6UA 1QKBA 3M8UA 2WBDA 3MP8A 2AIXA 5DEXA 4ELQA 1P99A 2WBBA 1MY4A 1XT8A 1SQYA 4OVQA 1B32A 3GXAA 2H9BA 2QS4A 1MY2A 3FBPA 3O29A 4KPTA 4O3BA 4OFLA 3OENA 4ZEKA 2HFBA 4I8CA 5I59B 5IZ3B 5CM6A 5H8FA 1SW1A 4O7MA 5LDZA 1VFEA 3RN8A 1Q9DA 1N3XA 5I2NB 4JVCA 4JXIA 3G3KA 4N6PA 4YMBA 3FV1A 3OOAA 5EYHA 3DP8A 2PFYA 1MG1A 4JBZA 2KQZA 3TCGA 3ECRA 2CZLA 1GR2A 3KSJA 4NF5A 3SDFA 1N0TA 4OWDA 4JWXA 4HE0A 1MXVA 3RQTA 2F8DA 1B5IA 1POY1 3AXFA 5FTIA 3H06B 2P3NA 1A54A 3TMGA 1LFIA 1VFDA 5DVIA 4NE4A 1FPDA 3MP1A 2WYKA 3V89B 1YTVA 3R6UA 4L17A 2Y5KA 2JJKA 4MLQA 4RPOA 5CBSA 4OFJA 1N3WA 4NQ8A 1B5JA 2FVZA 3PMXA 4JSDA 4N6DA 4JSOA 3ILUB 5CMKA 2F35A 3TZAA 3C36A 3TTKA 2Q74A 2Q2CA 4GL8A 3VVDA 1JW5A 2P2AA 1NUXA 3T9VA 2G29A 4XTCQ 3VE1B 4N07A 3R7XA 3HO7A 3EHUA 4KD5A 4ELPA 3E78A 1M5BA 1GGGA 3KN8A 2P1SA 4G68C 1MPBA 2CEYA 1MXWA
chains in the Genus database with same CATH topology
3C32A 1PC3A 1HSLA 3VDFA 5AA2A 4BLAA 1UTHA 1H3DA 1LFHA 3H6VA 1ZIUA 2RC7A 2OK2A 2XD2A 5CMMA 3I6VA 3MVWA 3QUFA 3IJXB 5L8DA 3C9HA 1P1NA 2AL4A 1NNPA 1XVXA 3LUYA 2X7QA 2XXHA 3KBRA 5A5XA 2VD3A 1DMBA 1MH4A 3I3VA 4GFRA 5HBCA 2YJPA 5I58A 2HQ0A 4F22A 3IR1A 3QSLA 2Q2AA 2DSFA 3PU5A 4GXSB 3TEPA 2OJTA 4POWA 3OELA 4TOZA 2ZMBA 3FXUA 2V93A 4IY5A 3ZS6A 1BP5A 3MPKA 1O63A 2XXQA 4ND9A 1A40A 3TDJA 2F7BA 4ZECA 3EHTA 5KCJB 2PYYA 1A8EA 2DVZA 3FJ7A 4TQUQ 3ODBA 3CFLA 2P0SA 2Z8FA 4RPNA 1AL3A 5CMCA 3RUMA 5L9MA 3TKDA 1JETA 1NNKA 1R1NA 3VVEA 4OQOA 4F2OA 2YPNA 2ONRA 4I9DA 4EUOA 1MPDA 2X26A 1MXUA 4NF5B 1TFAA 4KYDA 3SEUA 3T93B 4OETA 4YB6A 4NEDA 4ZE9A 1S9TA 5H8NB 4FE8A 3OMBA 4KR5A 1ZMGA 2O1LA 3TTLA 1IZ1A 2D3IA 1MY1A 2I3VA 2XXRA 1I6BA 2DXRA 3H6WA 4K3FA 4F3GA 3UN6A 3S4UA 3OO8A 1TFDA 4ESWA 1Y1MA 5HM4B 3B6QA 3E13X 3DLNA 5DVJA 4F31B 5ICQA 4H6DA 3KJ7A 3O9PA 1Y1ZA 4F29A 4F3PA 3MBPA 1OMPA 1WDNA 2A5TA 5FHMA 1NNFA 4KI0E 5F7VA 2PBWA 3KZGA 4XIGQ 1I6AA 3OO6A 4R6YA 1EU8A 2I0CA 4KQPA 5CBRA 4RXLA 1B9JA 1MY0A 3HSTA 4AQ4A 1USYE 3A09A 3MW0A 4M1VA 1FQAA 1SW2A 2O6AA 2Q8JA 4U4XA 3RTWB 3JYRA 5FTHA 3L6GA 3FJMA 4LZ7A 4ZZEA 3SERA 5HPQA 2RC8A 4Q0CA 1SYHA 2RCBA 1D9YA 5TP9B 4JWYA 1NL5A 3G3FA 1O7TA 1F9BA 3OD7A 4GQOA 4YKJA 1PBPA 2WKYA 3KOSA 4OVJA 5AA1A 1A99A 4DCXA 4BDMA 3N94A 1IUDA 4H0WA 3K1MA 3L6HA 3IOTA 3ONMA 2F78A 1Q35A 4R72A 3TCFA 5B7DA 1PEBA 4DDDA 5EHSA 2ZYKA 3LSWA 4F3SA 3W15C 3CIJA 3HCQA 4EF1A 1B7UA 4ZE8A 1AOVA 2FNCA 2ZXTA 1MQGA 2REGA 2XXWA 2DYXA 3FD3A 4FEBA 3SEWA 4ECFA 5H8QB 3TELA 5KZTA 1JNFA 2UVIA 1B4ZA 5TP9A 5KDTA 1B3HA 1B1XA 2XHDA 3VV5A 1IITA 3C33A 3C4MA 3K1NA 5DT6A 5H8FB 4FIMA 3TFLA 1N84A 1VSOA 2VGQA 3PPPA 3HHGA 2O69A 3H6UA 4POXA 5DVFA 2XXVA 3S2VA 1AMFA 3T96B 2QL3A 3MAMA 3MQ9A 3CSBA 3G3IA 1LB9A 5I2NA 1DPEA 3ZSFA 5H8NA 3PMVA 5ITPA 3O66A 4G68A 4G77A 1UQWA 4PFYA 5K2YA 1B3EA 4UA8A 1FQFA 2I48A 4XKPA 4YKKA 2IEEA 3QAXA 4RA1A 3MVYA 2AYSA 2F5XA 2GFEA 5KDTB 4I62A 5L9OA 1LCFA 3RY3A 2OLBA 2DWJA 3CI8A 1JEUA 1L5TA 2ZNSA 3CSGA 3PPRA 1H44A 3N5LA 4OENA 1FQEA 4BDNA 2PVUA 1Z7NE 4QSEA 4Z0IA 5LOMA 1XS5A 3HHFA 2QJEA 4AB5A 3DM0A 4OFOA 3U93A 2I3WA 1OVBA 1BTJA 2RC9A 3RT8A 4U1OA 4R74A 4PP0A 4GD5A 2QRYA 3IJOB 1XOCA 3N26A 3QIMA 3IL1B 4XKQA 1YPNA 3S9LC 4F39A 4RJZA 2O7UA 3VXBA 4BDLA 4OEUA 3FVOA 3O2AA 2PX1A 3MZ1A 5AE4A 1QW0A 5EHMA 4EQ9A 4PFTA 4Z7EA 1NKXA 4FECA 3BFTA 2ALUA 2I6EA 5I2KB 4YKIA 2H25A 1FW0A 3D4CA 1LAXA 3RTFB 2DVCA 3ZKKA 5AA4A 1SW4A 3H4ZA 4EQ7A 4AB6A 3IK6B 3EF7A 4XXUA 4H67A 1B6HA 3EN3A 2OWTA 3MZ9A 1I6QA 2D5WA 3OSRA 4GLIA 1MQIA 4GL0A 1ZU0A 3UA8A 1ANFA 4X1DA 3RT6B 4G4PA 2ESNA 3E9XA 4H65A 4JDFA 1IXIA 2QS1A 1M5CA 1YCJA 1N04A 1MY3A 3IB1A 3KN7A 1J1NA 1B05A 4QFOA 1B3FA 4R9GA 5I84A 3TTMA 4QHQA 3C35A 1JEVA 1H43A 4NWDA 3T22A 2UYFA 3FASA 1R9LA 3C31A 3TQLA 3E3KA 4DLDA 4R73A 4YB5A 3TODA 1Y9UA 2DWAA 5CMBA 3U94A 1FTKA 3KEIA 1CE2A 3OSQA 1MQDA 5DTBA 4DIGA 3G7WA 2Y7IA 2Y7PA 3I5OA 3GZGA 4ONYA 4ESXA 1XC1A 5I58B 4BDQA 3QUJA 1HSJA 3FXQA 4QFPA 4DE8A 2G93A 1SD3A 5AA2B 2Y7RA 1D9VA 2BJJX 3O6GA 5B70A 2O84X 2QPQA 4GF8A 1QJMA 1B52A 1B51A 4U22A 5ELVA 5IAIA 1B4HA 3A3CA 3IB0A 4LZ5A 1GTKA 4MBPA 5DYHA 3OO7A 4Q30B 5KCJA 2VD2A 4LUBA 1PB9A 3PUVE 1IXHA 1EH3A 2PT2A 1B40A 1IXGA 4U1ZA 2QS3A 1B7HA 5ITOA 3T9XB 1VR5A 2NOOA 3K01A 3K02A 3OO9A 3U8QA 4WEDA 4GRKA 3SEYA 3SEVA 2NXOA 2XXUA 1P1QA 4QFKA 1PB8A 2DE4A 3IORA 3MUQA 4O3CA 1Y3PA 4DXCA 1MRPA 3TUSA 3CG3A 4HS7A 1BLFA 2XX7A 3KOTA 3G3JA 3EPEA 4IGRA 4MF3A 2Y84A 3H3GA 4OESA 4X1BA 4NMYA 1DOTA 3FJGA 5TPAA 3H7MA 1RKMA 3FUZA 2IA4A 1M5FA 1WODA 2Q9TA 2QMXA 2D21A 3K1PA 3R26A 4ISUA 4P0GA 4P0IA 4R2FA 4P11A 2UVJA 3OXNA 4M4GA 2DOJA 3FVGA 3N6TA 4ZEFA 2DE2A 3S9EA 4FAJA 2HCAA 3HPIA 4U4SA 4ZDMA 1KWHA 2I49A 1ZKBA 4NF8A 4GIZA 4U2RA 3USDA 1A8FA 2OZZA 1I69A 2W7YA 3M3LA 1Y3NA 3S9NC 3FVKA 3HN0A 3B6TA 4QFNA 4PFWA 3PPQA 1IIWA 2HAVA 4JWOA 4IB2A 3FIRA 5AA3A 4ZEBA 3K2DA 3TCHA 3ILTB 2Z23A 5I59A 1ZTYA 2B3FA 2ZNUA 4KYEA 4R6HA 4F1YA 1FQDA 1FTMA 1HSEA 1IQ7A 1LAFE 3LC8A 2HZKA 4XKNA 3IO6A 4BDRA 3RLFE 4LQ2A 3GBBA 2ZYMA 2GRVA 3PUXE 3K00A 4NWCA 3VXCA 3T9UA 3IOWA 4YKPA 3MC2A 2X7PA 4EDPA 1OLAA 3IOUA 1Z7ME 2O7IA 3H6TA 3MWBA 4IY6A 3UGWA 4THIA 4ZEDA 2YLNA 3SETA 2H98A 4F1VA 1SI0A 1SBPA 1OQHA 3FZVA 1LBCA 3KFMA 1R9QA 4LATA 1DSNA 4G2ZA 2DE3A 4HCWA 4OZ9A 1D3KA 4OHNA 5H8SA 4HW8A 2H99A 4KCDA 1B0HA 1VE4A 5AA4B 4GWOA 3G3HA 2HAUA 2RF1A 4FORA 1MM6A 1ATGA 4U21A 2F7AA 1IXCA 3CFXA 4FEDA 4PE5B 3VLWA 1LLSA 5DEXB 3VVFA 4DXUA 3TTNA 3P7IA 1NH8A 1WVJA 4RYAA 3U92A 4H5GA 2B65A 3WAEA 2VHAA 1QUJA 1NFTA 3FATA 3E4RA 3QK6A 4NF6B 1B5HA 4LA9A 1LAHE 1DPPA 2H5YA 3IAZA 1RYXA 4Q8RA 4QSDA 3V8XB 2KLFA 1MPCA 2CMOA 3W9VA 4F2QA 3U72A 2XXIA 3JV9A 4H1XA 5TPAB 2GH9A 2Z8EA 2DP8A 3PUZE 4OEVA 3IB2A 3UORA 3BFUA 3VLVA 3PPNA 2UXAA 4KFQA 1S7YA 3QXMA 4G8NA 1N76A 3EHSA 1M5DA 4RK2A 4G8MA 4GVOA 2RCAA 1B1HA 1MQJA 1T0KA 2R9JA 4E0XA 1EZPA 3IO4A 3OEMA 1OVTA 2V3TA 4KYSA 4YU0A 1MDP1 4I1DA 4NF6A 2ANJA 5I56A 1SDXA 1D4NA 5CI5A 4RY1A 4HTGA 1JVYA 3JZJA 3Q27A 2V25A 4C1UA 4X9TA 1JW1A 1B46A 4LP2B 1ELJA 2HXWA 4QFLA 1MH3A 4R2BA 1LBBA 1FTLA 5BWJA 5H8HA 2F97A 2Y7KA 1Y20A 2F36A 3PPOA 3TAJA 3TQWA 3TYHA 4ELRA 4EXKA 5JK4A 3SESA 1QKAA 3O28A 1OLCA 2PMSA 2XXXA 3RGYA 2DWHA 2OWSA 1S50A 4IO6A 4YZZA 1Q1KA 3W9WA 4NTLA 3O6IA 1LB8A 3T9HB 1UTBA 2Y7WA 3C34A 5FHNA 4F3BA 4F1UA 4XKRA 4FJPA 3UK4A 4EQBA 2XXYA 3H03A 4LZ8A 3UIFA 1Y4CA 2PT1A 4O3AA 2E0SA 2A5TB 4C1TA 2XXTA 3K0VA 1QKBA 3K6UA 3M8UA 5JTYB 4EXLA 3MP8A 1H76A 1LSTA 2AIXA 5DEXA 5EYFA 1SW5A 3CG1A 3O97A 5J1DA 1BIYA 3V5AA 1P99A 4ELQA 3MJNA 4TLLB 2XX9A 5FHOA 1URSA 1FTJA 2QMWA 4LQ5A 1MY4A 3B7DA 3CFZA 1N7XA 4GOTA 2F7CA 3G3GA 1FQBA 1B2HA 3Q26A 4F18A 1XT8A 1Y4TA 2VP1A 4RNSA 2I58A 2UYEA 1SQYA 4OERA 1B7ZA 1B32A 2ONKE 2V3QA 3GXAA 2ZNTA 2GHAA 5CRYA 4ZEIA 5TU0A 1MQHA 4X48A 2H9BA 2QS4A 1MY2A 3TTRA 2VOZA 3O29A 4KPTA 3SKPA 1MXXA 4O3BA 3U1OA 4OFLA 2HZLA 3CRBA 3OENA 4ZEKA 1LCTA 4G8HA 1XVYA 5I56B 2HFBA 1AH5A 3GLBA 4I8CA 4IO7A 3K6VA 1TT1A 5JEIA 1CB6A 3K6WA 4DXBA 5I59B 3M3KA 3ZKLA 1USYH 4GXAA 4JB7A 4PQJA 5CM6A 5H8FA 1AIVA 2UVHA 1SW1A 2XD3A 4QRZA 3F11A 1ZJLA 2XX8A 1VFEA 2F6GA 3THIA 3RN8A 1N3XA 2ZYOA 1EZ9A 2OCUA 4RK9A 5I2NB 1N7WA 4JXIA 1TXFA 3LBSA 3G3KA 3D4GA 1JVXA 4G68B 1TWYA 3LR1A 3KN3A 3OEKA 4N6PA 3TPAA 4YMBA 2I4CA 3FV1A 3OOAA 2QS2A 4R75A 1MXZA 1XHYA 2RINA 3DP8A 4ELOA 3B6WA 3DELB 1FQCA 1MG1A 1US4A 2ONSA 4IO4A 1DTZA 1NH7A 4JBZA 2FYIA 3TCGA 1FCKA 5ISUA 2DS9A 3FXRA 3DP6A 1IEJA 1ZBMA 2I4BA 3ECRA 3PD9A 3Q29A 4PFUA 5I57B 1PBQA 1DTGA 3K4UA 3PD8A 4NF4B 3DP4A 2CZLA 3VLUA 3LSFB 1GR2A 4WKMA 1UIVA 1A7LA 3IOVA 3T66A 3CR9A 3KSJA 2UVGA 4NF5A 2H4IA 2Z8DA 4BDOA 1PB7A 3SDFA 1N0TA 1GV8A 1UTBB 2M8CA 3RPWA 1YAEA 1MM7A 2LAOA 3K6XA 4ZS9A 3WAFA 4OWDA 3Q25A 5F1QA 4JWXA 2B3BA 3RNNA 2AL5A 3SEXA 1MXVA 4E0WA 2O68A 3BKIB 4N13A 3RQTA 1B3LA 1LGBC 2F8DA 3GBAA 4IO3A 1B5IA 2V3UA 2ZYNA 4HCYA 1POY1 5BUUA 1PDAA 2XXPA 3CVGA 3AXFA 1QULA 3KG2A 4WXJA 5FTIA 2OBGA 4C0RA 1O64A 3H06B 2FA7A 1A54A 4TLMB 3TMGA 2I0BA 4H8JA 1BKAA 1POTA 1QUIA 4OXVA 1LFIA 1QUKA 2V84A 4H8IA 3MVXA 3MP6A 3LSXA 1VFDA 5DVIA 3MVZA 4MLVA 5I57A 1SVXB 3PMWA 4KHZE 4NE4A 2F34A 3MP1A 2THIA 2GHBA 2NVUB 3KJTA 3V89B 1YTVA 3V83A 1URDA 1P1WA 3A3UA 3MPLA 5AA2D 3MZBA 3R6UA 4L17A 4UACA 5A5XB 1R6ZA 1P1OA 1MXYA 4MLQA 4KCCA 4RPOA 5K2XA 2R71A 4LONB 1US5A 5CBSA 1QVSA 2O51A 2QSXA 2DWIA 4MH5A 4OFJA 4OMBA 5IKBA 1NMUA 5L9SA 1UIUA 4IO5A 1N3WA 5JTYA 1Y3QA 3PUYE 5ICTA 1B5JA 1OIBA 2A5SA 4YAHX 4ZZAA 2Q88A 3PMXA 3BBRA 4JSDA 4OYVA 1FTOA 4YICA 3M3FA 4IO2A 1URGA 4WEPA 4R6KA 4YB7A 4JSOA 3ILUB 5CMKA 3FGSA 5H8QA 2F35A 3TZAA 3UP9A 3EQ1A 3C36A 2REJA 3N6UA 3QYTA 1SYIA 1B0LA 1JQFA 4QF9A 1M5EA 3TTKA 4DZ1A 1ZLQA 2O1MA 4NF4A 2Q2CA 4Q5TA 3FV2A 4GL8A 1A55A 2F6PA 2NUVA 3VVDA 1JW5A 1B3GA 2P2AA 1MDQA 4OTEA 5H8HB 3T9VA 1RYOA 4U23A 3IX1A 5I2KA 1OQGA 2G29A 4R9FA 2R6GE 4YMAA 1P1UA 1EZOA 3PV0E 1B58A 4QSCA 4XTCQ 1JW4A 2DXYA 4EF2A 1UTHB 3PGFA 4LVQA 2E1SA 4IGTA 2DQVA 3Q28A 1II5A 5M2VA 4N07A 3VE1B 3R7XA 3S9MC 2Z22A 3HO7A 2Q89A 3EHUA 3KSXA 3HV1A 3O6HA 4KD5A 1NNTA 4PETA 1H45A 4DCYA 1M5BA 2RKMA 1GGGA 3KGCA 4ELPA 1LAGE 1MS7A 3KN8A 2ABHA 2P1SA 3PUWE 4G68C 4NF8B 3VFJA 5CC2A 1MPBA 2HEUA 1GVCA 4MFIA 1LFGA 2NWJA 1SI1A 1MXWA 3FVNA 4H5FA 4F19A 4FATA 3LSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C32 A;  1PC3 A;  1HSL A;  3VDF A;  5AA2 A;  4BLA A;  1UTH A;  1H3D A;  1LFH A;  3H6V A;  1ZIU A;  2RC7 A;  2OK2 A;  2XD2 A;  5CMM A;  3I6V A;  3MVW A;  3QUF A;  3IJX B;  5L8D A;  3C9H A;  1P1N A;  2AL4 A;  1NNP A;  1XVX A;  3LUY A;  2X7Q A;  2XXH A;  3KBR A;  5A5X A;  2VD3 A;  1DMB A;  1MH4 A;  3I3V A;  4GFR A;  5HBC A;  2YJP A;  5I58 A;  2HQ0 A;  4F22 A;  3IR1 A;  3QSL A;  2Q2A A;  2DSF A;  3PU5 A;  4GXS B;  3TEP A;  2OJT A;  4POW A;  3OEL A;  4TOZ A;  2ZMB A;  3FXU A;  2V93 A;  4IY5 A;  3ZS6 A;  1BP5 A;  3MPK A;  1O63 A;  2XXQ A;  4ND9 A;  1A40 A;  3TDJ A;  2F7B A;  4ZEC A;  3EHT A;  5KCJ B;  2PYY A;  1A8E A;  2DVZ A;  3FJ7 A;  4TQU Q;  3ODB A;  3CFL A;  2P0S A;  2Z8F A;  4RPN A;  1AL3 A;  5CMC A;  3RUM A;  5L9M A;  3TKD A;  1JET A;  1NNK A;  1R1N A;  3VVE A;  4OQO A;  4F2O A;  2YPN A;  2ONR A;  4I9D A;  4EUO A;  1MPD A;  2X26 A;  1MXU A;  4NF5 B;  1TFA A;  4KYD A;  3SEU A;  3T93 B;  4OET A;  4YB6 A;  4NED A;  4ZE9 A;  1S9T A;  5H8N B;  4FE8 A;  3OMB A;  4KR5 A;  1ZMG A;  2O1L A;  3TTL A;  1IZ1 A;  2D3I A;  1MY1 A;  2I3V A;  2XXR A;  1I6B A;  2DXR A;  3H6W A;  4K3F A;  4F3G A;  3UN6 A;  3S4U A;  3OO8 A;  1TFD A;  4ESW A;  1Y1M A;  5HM4 B;  3B6Q A;  3E13 X;  3DLN A;  5DVJ A;  4F31 B;  5ICQ A;  4H6D A;  3KJ7 A;  3O9P A;  1Y1Z A;  4F29 A;  4F3P A;  3MBP A;  1OMP A;  1WDN A;  2A5T A;  5FHM A;  1NNF A;  4KI0 E;  5F7V A;  2PBW A;  3KZG A;  4XIG Q;  1I6A A;  3OO6 A;  4R6Y A;  1EU8 A;  2I0C A;  4KQP A;  5CBR A;  4RXL A;  1B9J A;  1MY0 A;  3HST A;  4AQ4 A;  1USY E;  3A09 A;  3MW0 A;  4M1V A;  1FQA A;  1SW2 A;  2O6A A;  2Q8J A;  4U4X A;  3RTW B;  3JYR A;  5FTH A;  3L6G A;  3FJM A;  4LZ7 A;  4ZZE A;  3SER A;  5HPQ A;  2RC8 A;  4Q0C A;  1SYH A;  2RCB A;  1D9Y A;  5TP9 B;  4JWY A;  1NL5 A;  3G3F A;  1O7T A;  1F9B A;  3OD7 A;  4GQO A;  4YKJ A;  1PBP A;  2WKY A;  3KOS A;  4OVJ A;  5AA1 A;  1A99 A;  4DCX A;  4BDM A;  3N94 A;  1IUD A;  4H0W A;  3K1M A;  3L6H A;  3IOT A;  3ONM A;  2F78 A;  1Q35 A;  4R72 A;  3TCF A;  5B7D A;  1PEB A;  4DDD A;  5EHS A;  2ZYK A;  3LSW A;  4F3S A;  3W15 C;  3CIJ A;  3HCQ A;  4EF1 A;  1B7U A;  4ZE8 A;  1AOV A;  2FNC A;  2ZXT A;  1MQG A;  2REG A;  2XXW A;  2DYX A;  3FD3 A;  4FEB A;  3SEW A;  4ECF A;  5H8Q B;  3TEL A;  5KZT A;  1JNF A;  2UVI A;  1B4Z A;  5TP9 A;  5KDT A;  1B3H A;  1B1X A;  2XHD A;  3VV5 A;  1IIT A;  3C33 A;  3C4M A;  3K1N A;  5DT6 A;  5H8F B;  4FIM A;  3TFL A;  1N84 A;  1VSO A;  2VGQ A;  3PPP A;  3HHG A;  2O69 A;  3H6U A;  4POX A;  5DVF A;  2XXV A;  3S2V A;  1AMF A;  3T96 B;  2QL3 A;  3MAM A;  3MQ9 A;  3CSB A;  3G3I A;  1LB9 A;  5I2N A;  1DPE A;  3ZSF A;  5H8N A;  3PMV A;  5ITP A;  3O66 A;  4G68 A;  4G77 A;  1UQW A;  4PFY A;  5K2Y A;  1B3E A;  4UA8 A;  1FQF A;  2I48 A;  4XKP A;  4YKK A;  2IEE A;  3QAX A;  4RA1 A;  3MVY A;  2AYS A;  2F5X A;  2GFE A;  5KDT B;  4I62 A;  5L9O A;  1LCF A;  3RY3 A;  2OLB A;  2DWJ A;  3CI8 A;  1JEU A;  1L5T A;  2ZNS A;  3CSG A;  3PPR A;  1H44 A;  3N5L A;  4OEN A;  1FQE A;  4BDN A;  2PVU A;  1Z7N E;  4QSE A;  4Z0I A;  5LOM A;  1XS5 A;  3HHF A;  2QJE A;  4AB5 A;  3DM0 A;  4OFO A;  3U93 A;  2I3W A;  1OVB A;  1BTJ A;  2RC9 A;  3RT8 A;  4U1O A;  4R74 A;  4PP0 A;  4GD5 A;  2QRY A;  3IJO B;  1XOC A;  3N26 A;  3QIM A;  3IL1 B;  4XKQ A;  1YPN A;  3S9L C;  4F39 A;  4RJZ A;  2O7U A;  3VXB A;  4BDL A;  4OEU A;  3FVO A;  3O2A A;  2PX1 A;  3MZ1 A;  5AE4 A;  1QW0 A;  5EHM A;  4EQ9 A;  4PFT A;  4Z7E A;  1NKX A;  4FEC A;  3BFT A;  2ALU A;  2I6E A;  5I2K B;  4YKI A;  2H25 A;  1FW0 A;  3D4C A;  1LAX A;  3RTF B;  2DVC A;  3ZKK A;  5AA4 A;  1SW4 A;  3H4Z A;  4EQ7 A;  4AB6 A;  3IK6 B;  3EF7 A;  4XXU A;  4H67 A;  1B6H A;  3EN3 A;  2OWT A;  3MZ9 A;  1I6Q A;  2D5W A;  3OSR A;  4GLI A;  1MQI A;  4GL0 A;  1ZU0 A;  3UA8 A;  1ANF A;  4X1D A;  3RT6 B;  4G4P A;  2ESN A;  3E9X A;  4H65 A;  4JDF A;  1IXI A;  2QS1 A;  1M5C A;  1YCJ A;  1N04 A;  1MY3 A;  3IB1 A;  3KN7 A;  1J1N A;  1B05 A;  4QFO A;  1B3F A;  4R9G A;  5I84 A;  3TTM A;  4QHQ A;  3C35 A;  1JEV A;  1H43 A;  4NWD A;  3T22 A;  2UYF A;  3FAS A;  1R9L A;  3C31 A;  3TQL A;  3E3K A;  4DLD A;  4R73 A;  4YB5 A;  3TOD A;  1Y9U A;  2DWA A;  5CMB A;  3U94 A;  1FTK A;  3KEI A;  1CE2 A;  3OSQ A;  1MQD A;  5DTB A;  4DIG A;  3G7W A;  2Y7I A;  2Y7P A;  3I5O A;  3GZG A;  4ONY A;  4ESX A;  1XC1 A;  5I58 B;  4BDQ A;  3QUJ A;  1HSJ A;  3FXQ A;  4QFP A;  4DE8 A;  2G93 A;  1SD3 A;  5AA2 B;  2Y7R A;  1D9V A;  2BJJ X;  3O6G A;  5B70 A;  2O84 X;  2QPQ A;  4GF8 A;  1QJM A;  1B52 A;  1B51 A;  4U22 A;  5ELV A;  5IAI A;  1B4H A;  3A3C A;  3IB0 A;  4LZ5 A;  1GTK A;  4MBP A;  5DYH A;  3OO7 A;  4Q30 B;  5KCJ A;  2VD2 A;  4LUB A;  1PB9 A;  3PUV E;  1IXH A;  1EH3 A;  2PT2 A;  1B40 A;  1IXG A;  4U1Z A;  2QS3 A;  1B7H A;  5ITO A;  3T9X B;  1VR5 A;  2NOO A;  3K01 A;  3K02 A;  3OO9 A;  3U8Q A;  4WED A;  4GRK A;  3SEY A;  3SEV A;  2NXO A;  2XXU A;  1P1Q A;  4QFK A;  1PB8 A;  2DE4 A;  3IOR A;  3MUQ A;  4O3C A;  1Y3P A;  4DXC A;  1MRP A;  3TUS A;  3CG3 A;  4HS7 A;  1BLF A;  2XX7 A;  3KOT A;  3G3J A;  3EPE A;  4IGR A;  4MF3 A;  2Y84 A;  3H3G A;  4OES A;  4X1B A;  4NMY A;  1DOT A;  3FJG A;  5TPA A;  3H7M A;  1RKM A;  3FUZ A;  2IA4 A;  1M5F A;  1WOD A;  2Q9T A;  2QMX A;  2D21 A;  3K1P A;  3R26 A;  4ISU A;  4P0G A;  4P0I A;  4R2F A;  4P11 A;  2UVJ A;  3OXN A;  4M4G A;  2DOJ A;  3FVG A;  3N6T A;  4ZEF A;  2DE2 A;  3S9E A;  4FAJ A;  2HCA A;  3HPI A;  4U4S A;  4ZDM A;  1KWH A;  2I49 A;  1ZKB A;  4NF8 A;  4GIZ A;  4U2R A;  3USD A;  1A8F A;  2OZZ A;  1I69 A;  2W7Y A;  3M3L A;  1Y3N A;  3S9N C;  3FVK A;  3HN0 A;  3B6T A;  4QFN A;  4PFW A;  3PPQ A;  1IIW A;  2HAV A;  4JWO A;  4IB2 A;  3FIR A;  5AA3 A;  4ZEB A;  3K2D A;  3TCH A;  3ILT B;  2Z23 A;  5I59 A;  1ZTY A;  2B3F A;  2ZNU A;  4KYE A;  4R6H A;  4F1Y A;  1FQD A;  1FTM A;  1HSE A;  1IQ7 A;  1LAF E;  3LC8 A;  2HZK A;  4XKN A;  3IO6 A;  4BDR A;  3RLF E;  4LQ2 A;  3GBB A;  2ZYM A;  2GRV A;  3PUX E;  3K00 A;  4NWC A;  3VXC A;  3T9U A;  3IOW A;  4YKP A;  3MC2 A;  2X7P A;  4EDP A;  1OLA A;  3IOU A;  1Z7M E;  2O7I A;  3H6T A;  3MWB A;  4IY6 A;  3UGW A;  4THI A;  4ZED A;  2YLN A;  3SET A;  2H98 A;  4F1V A;  1SI0 A;  1SBP A;  1OQH A;  3FZV A;  1LBC A;  3KFM A;  1R9Q A;  4LAT A;  1DSN A;  4G2Z A;  2DE3 A;  4HCW A;  4OZ9 A;  1D3K A;  4OHN A;  5H8S A;  4HW8 A;  2H99 A;  4KCD A;  1B0H A;  1VE4 A;  5AA4 B;  4GWO A;  3G3H A;  2HAU A;  2RF1 A;  4FOR A;  1MM6 A;  1ATG A;  4U21 A;  2F7A A;  1IXC A;  3CFX A;  4FED A;  4PE5 B;  3VLW A;  1LLS A;  5DEX B;  3VVF A;  4DXU A;  3TTN A;  3P7I A;  1NH8 A;  1WVJ A;  4RYA A;  3U92 A;  4H5G A;  2B65 A;  3WAE A;  2VHA A;  1QUJ A;  1NFT A;  3FAT A;  3E4R A;  3QK6 A;  4NF6 B;  1B5H A;  4LA9 A;  1LAH E;  1DPP A;  2H5Y A;  3IAZ A;  1RYX A;  4Q8R A;  4QSD A;  3V8X B;  2KLF A;  1MPC A;  2CMO A;  3W9V A;  4F2Q A;  3U72 A;  2XXI A;  3JV9 A;  4H1X A;  5TPA B;  2GH9 A;  2Z8E A;  2DP8 A;  3PUZ E;  4OEV A;  3IB2 A;  3UOR A;  3BFU A;  3VLV A;  3PPN A;  2UXA A;  4KFQ A;  1S7Y A;  3QXM A;  4G8N A;  1N76 A;  3EHS A;  1M5D A;  4RK2 A;  4G8M A;  4GVO A;  2RCA A;  1B1H A;  1MQJ A;  1T0K A;  2R9J A;  4E0X A;  1EZP A;  3IO4 A;  3OEM A;  1OVT A;  2V3T A;  4KYS A;  4YU0 A;  1MDP 1;  4I1D A;  4NF6 A;  2ANJ A;  5I56 A;  1SDX A;  1D4N A;  5CI5 A;  4RY1 A;  4HTG A;  1JVY A;  3JZJ A;  3Q27 A;  2V25 A;  4C1U A;  4X9T A;  1JW1 A;  1B46 A;  4LP2 B;  1ELJ A;  2HXW A;  4QFL A;  1MH3 A;  4R2B A;  1LBB A;  1FTL A;  5BWJ A;  5H8H A;  2F97 A;  2Y7K A;  1Y20 A;  2F36 A;  3PPO A;  3TAJ A;  3TQW A;  3TYH A;  4ELR A;  4EXK A;  5JK4 A;  3SES A;  1QKA A;  3O28 A;  1OLC A;  2PMS A;  2XXX A;  3RGY A;  2DWH A;  2OWS A;  1S50 A;  4IO6 A;  4YZZ A;  1Q1K A;  3W9W A;  4NTL A;  3O6I A;  1LB8 A;  3T9H B;  1UTB A;  2Y7W A;  3C34 A;  5FHN A;  4F3B A;  4F1U A;  4XKR A;  4FJP A;  3UK4 A;  4EQB A;  2XXY A;  3H03 A;  4LZ8 A;  3UIF A;  1Y4C A;  2PT1 A;  4O3A A;  2E0S A;  2A5T B;  4C1T A;  2XXT A;  3K0V A;  1QKB A;  3K6U A;  3M8U A;  5JTY B;  4EXL A;  3MP8 A;  1H76 A;  1LST A;  2AIX A;  5DEX A;  5EYF A;  1SW5 A;  3CG1 A;  3O97 A;  5J1D A;  1BIY A;  3V5A A;  1P99 A;  4ELQ A;  3MJN A;  4TLL B;  2XX9 A;  5FHO A;  1URS A;  1FTJ A;  2QMW A;  4LQ5 A;  1MY4 A;  3B7D A;  3CFZ A;  1N7X A;  4GOT A;  2F7C A;  3G3G A;  1FQB A;  1B2H A;  3Q26 A;  4F18 A;  1XT8 A;  1Y4T A;  2VP1 A;  4RNS A;  2I58 A;  2UYE A;  1SQY A;  4OER A;  1B7Z A;  1B32 A;  2ONK E;  2V3Q A;  3GXA A;  2ZNT A;  2GHA A;  5CRY A;  4ZEI A;  5TU0 A;  1MQH A;  4X48 A;  2H9B A;  2QS4 A;  1MY2 A;  3TTR A;  2VOZ A;  3O29 A;  4KPT A;  3SKP A;  1MXX A;  4O3B A;  3U1O A;  4OFL A;  2HZL A;  3CRB A;  3OEN A;  4ZEK A;  1LCT A;  4G8H A;  1XVY A;  5I56 B;  2HFB A;  1AH5 A;  3GLB A;  4I8C A;  4IO7 A;  3K6V A;  1TT1 A;  5JEI A;  1CB6 A;  3K6W A;  4DXB A;  5I59 B;  3M3K A;  3ZKL A;  1USY H;  4GXA A;  4JB7 A;  4PQJ A;  5CM6 A;  5H8F A;  1AIV A;  2UVH A;  1SW1 A;  2XD3 A;  4QRZ A;  3F11 A;  1ZJL A;  2XX8 A;  1VFE A;  2F6G A;  3THI A;  3RN8 A;  1N3X A;  2ZYO A;  1EZ9 A;  2OCU A;  4RK9 A;  5I2N B;  1N7W A;  4JXI A;  1TXF A;  3LBS A;  3G3K A;  3D4G A;  1JVX A;  4G68 B;  1TWY A;  3LR1 A;  3KN3 A;  3OEK A;  4N6P A;  3TPA A;  4YMB A;  2I4C A;  3FV1 A;  3OOA A;  2QS2 A;  4R75 A;  1MXZ A;  1XHY A;  2RIN A;  3DP8 A;  4ELO A;  3B6W A;  3DEL B;  1FQC A;  1MG1 A;  1US4 A;  2ONS A;  4IO4 A;  1DTZ A;  1NH7 A;  4JBZ A;  2FYI A;  3TCG A;  1FCK A;  5ISU A;  2DS9 A;  3FXR A;  3DP6 A;  1IEJ A;  1ZBM A;  2I4B A;  3ECR A;  3PD9 A;  3Q29 A;  4PFU A;  5I57 B;  1PBQ A;  1DTG A;  3K4U A;  3PD8 A;  4NF4 B;  3DP4 A;  2CZL A;  3VLU A;  3LSF B;  1GR2 A;  4WKM A;  1UIV A;  1A7L A;  3IOV A;  3T66 A;  3CR9 A;  3KSJ A;  2UVG A;  4NF5 A;  2H4I A;  2Z8D A;  4BDO A;  1PB7 A;  3SDF A;  1N0T A;  1GV8 A;  1UTB B;  2M8C A;  3RPW A;  1YAE A;  1MM7 A;  2LAO A;  3K6X A;  4ZS9 A;  3WAF A;  4OWD A;  3Q25 A;  5F1Q A;  4JWX A;  2B3B A;  3RNN A;  2AL5 A;  3SEX A;  1MXV A;  4E0W A;  2O68 A;  3BKI B;  4N13 A;  3RQT A;  1B3L A;  1LGB C;  2F8D A;  3GBA A;  4IO3 A;  1B5I A;  2V3U A;  2ZYN A;  4HCY A;  1POY 1;  5BUU A;  1PDA A;  2XXP A;  3CVG A;  3AXF A;  1QUL A;  3KG2 A;  4WXJ A;  5FTI A;  2OBG A;  4C0R A;  1O64 A;  3H06 B;  2FA7 A;  1A54 A;  4TLM B;  3TMG A;  2I0B A;  4H8J A;  1BKA A;  1POT A;  1QUI A;  4OXV A;  1LFI A;  1QUK A;  2V84 A;  4H8I A;  3MVX A;  3MP6 A;  3LSX A;  1VFD A;  5DVI A;  3MVZ A;  4MLV A;  5I57 A;  1SVX B;  3PMW A;  4KHZ E;  4NE4 A;  2F34 A;  3MP1 A;  2THI A;  2GHB A;  2NVU B;  3KJT A;  3V89 B;  1YTV A;  3V83 A;  1URD A;  1P1W A;  3A3U A;  3MPL A;  5AA2 D;  3MZB A;  3R6U A;  4L17 A;  4UAC A;  5A5X B;  1R6Z A;  1P1O A;  1MXY A;  4MLQ A;  4KCC A;  4RPO A;  5K2X A;  2R71 A;  4LON B;  1US5 A;  5CBS A;  1QVS A;  2O51 A;  2QSX A;  2DWI A;  4MH5 A;  4OFJ A;  4OMB A;  5IKB A;  1NMU A;  5L9S A;  1UIU A;  4IO5 A;  1N3W A;  5JTY A;  1Y3Q A;  3PUY E;  5ICT A;  1B5J A;  1OIB A;  2A5S A;  4YAH X;  4ZZA A;  2Q88 A;  3PMX A;  3BBR A;  4JSD A;  4OYV A;  1FTO A;  4YIC A;  3M3F A;  4IO2 A;  1URG A;  4WEP A;  4R6K A;  4YB7 A;  4JSO A;  3ILU B;  5CMK A;  3FGS A;  5H8Q A;  2F35 A;  3TZA A;  3UP9 A;  3EQ1 A;  3C36 A;  2REJ A;  3N6U A;  3QYT A;  1SYI A;  1B0L A;  1JQF A;  4QF9 A;  1M5E A;  3TTK A;  4DZ1 A;  1ZLQ A;  2O1M A;  4NF4 A;  2Q2C A;  4Q5T A;  3FV2 A;  4GL8 A;  1A55 A;  2F6P A;  2NUV A;  3VVD A;  1JW5 A;  1B3G A;  2P2A A;  1MDQ A;  4OTE A;  5H8H B;  3T9V A;  1RYO A;  4U23 A;  3IX1 A;  5I2K A;  1OQG A;  2G29 A;  4R9F A;  2R6G E;  4YMA A;  1P1U A;  1EZO A;  3PV0 E;  1B58 A;  4QSC A;  4XTC Q;  1JW4 A;  2DXY A;  4EF2 A;  1UTH B;  3PGF A;  4LVQ A;  2E1S A;  4IGT A;  2DQV A;  3Q28 A;  1II5 A;  5M2V A;  4N07 A;  3VE1 B;  3R7X A;  3S9M C;  2Z22 A;  3HO7 A;  2Q89 A;  3EHU A;  3KSX A;  3HV1 A;  3O6H A;  4KD5 A;  1NNT A;  4PET A;  1H45 A;  4DCY A;  1M5B A;  2RKM A;  1GGG A;  3KGC A;  4ELP A;  1LAG E;  1MS7 A;  3KN8 A;  2ABH A;  2P1S A;  3PUW E;  4G68 C;  4NF8 B;  3VFJ A;  5CC2 A;  1MPB A;  2HEU A;  1GVC A;  4MFI A;  1LFG A;  2NWJ A;  1SI1 A;  1MXW A;  3FVN A;  4H5F A;  4F19 A;  4FAT A;  3LSL A; 
#chains in the Genus database with same CATH topology
 3H6V A;  5L8D A;  1P1N A;  2AL4 A;  3KC0 A;  5A5X A;  2VD3 A;  1DMB A;  3TEP A;  4TOZ A;  2XWO A;  2V93 A;  3EHT A;  3A29 A;  2DVZ A;  4TQU Q;  5L9M A;  1JP4 A;  2YPN A;  4EUO A;  4I9D A;  1MXU A;  1RDY A;  1IZ1 A;  1MY1 A;  2XXR A;  3H6W A;  1I6B A;  2DXR A;  3S4U A;  3OO8 A;  3ROJ A;  4F31 B;  4XF5 A;  4QBA A;  1WDN A;  2A5T A;  1NNF A;  1NUZ A;  4XIG Q;  1I6A A;  5CBR A;  4X04 A;  1EU8 A;  1AWB A;  2I0C A;  5I57 A;  4AQ4 A;  3MW0 A;  4M1V A;  1SW2 A;  2O6A A;  1G0H A;  3L6G A;  3SER A;  2PFZ A;  2RCB A;  4MJO A;  1D9Y A;  3G3F A;  1O7T A;  4GQO A;  4YKJ A;  1A99 A;  3N94 A;  1IUD A;  1FBD A;  1PEB A;  4F3S A;  3W15 C;  3CIJ A;  1MQG A;  2REG A;  4P3L A;  3SEW A;  4ECF A;  1JNF A;  2UVI A;  1B4Z A;  3VV5 A;  3C4M A;  1VSO A;  2VGQ A;  4GWY A;  2XXV A;  5DVF A;  5IZ1 A;  1KA1 A;  3MAM A;  3G3I A;  1LB9 A;  1DPE A;  3O66 A;  4PFY A;  1B3E A;  4YKK A;  1IMA A;  5L9O A;  2DWJ A;  5I2K A;  1JEU A;  3PPR A;  3N5L A;  5LOM A;  3U93 A;  4NGU A;  3IJO B;  3QIM A;  3IL1 B;  4F39 A;  3FVO A;  4PFB A;  5AE4 A;  4PFR A;  4FEC A;  2ALU A;  4YKI A;  1FW0 A;  3RTF B;  1SW4 A;  3IK6 B;  1B6H A;  4N8Y A;  3OSR A;  4OVS A;  3HFU A;  1FPJ A;  4G4P A;  4JDF A;  1IXI A;  2QS1 A;  3KN7 A;  1J1N A;  1EYJ A;  1JEV A;  1H43 A;  3C35 A;  3T22 A;  1R9L A;  5EYG A;  4R73 A;  4YB5 A;  3SZP A;  3U94 A;  4MNI A;  4DIG A;  3G7W A;  2XWK A;  4QFP A;  2G93 A;  2O84 X;  1XI6 A;  5ELV A;  1B4H A;  4LZ5 A;  4Q30 B;  2VD2 A;  3PUV E;  1EH3 A;  5ITO A;  1VR5 A;  3K01 A;  3K02 A;  4GRK A;  1PB8 A;  2DE4 A;  1FPG A;  1LBX A;  3MUQ A;  1Y3P A;  3TUS A;  1MRP A;  5DT6 A;  4IGR A;  4UAB A;  1DOT A;  5TPA A;  3H7M A;  3K1P A;  4ISU A;  4P0I A;  2UVJ A;  2VT5 A;  3OXN A;  4M4G A;  2DOJ A;  4ZEF A;  3S9E A;  1KWH A;  2I49 A;  4NAP A;  4GIZ A;  3RYD A;  1A8F A;  1NV1 A;  2HPG A;  4GWZ A;  4PBH A;  3HN0 A;  1FPL A;  4PFW A;  1IIW A;  2HAV A;  3K2D A;  3ILT B;  4O94 A;  5I59 A;  2B3F A;  1FQD A;  1HSE A;  1LAF E;  3LC8 A;  3IO6 A;  4BDR A;  3RLF E;  2XWI A;  4LQ2 A;  3GBB A;  4YKP A;  2ZZV A;  2WYP A;  4EDP A;  2O7I A;  3H6T A;  3UGW A;  5J16 A;  2YLN A;  3SET A;  4F1V A;  1OQH A;  4GWX A;  4LAT A;  3ISP A;  4U21 A;  4PE5 B;  1FPK A;  3P7I A;  1NH8 A;  4H5G A;  2B65 A;  3WAE A;  2VHA A;  4NF6 B;  3QK6 A;  1LAH E;  2H5Y A;  4QSD A;  2KLF A;  2XXI A;  2GH9 A;  3IFA A;  3VLV A;  3IB2 A;  2UXA A;  1S7Y A;  4G8N A;  1M5D A;  4G8M A;  1B1H A;  4E0X A;  1EZP A;  3OEM A;  4KYS A;  1D4N A;  4JVD A;  4RY1 A;  1JW1 A;  4QFL A;  5H8H A;  1NV0 A;  2F97 A;  2Q8M A;  1Y20 A;  4EXK A;  2B4M A;  3RGY A;  4I3E A;  3O6I A;  3T9H B;  4FJP A;  2XXY A;  3H03 A;  2A5T B;  4EXL A;  1LST A;  5EYF A;  5J1D A;  1BIY A;  2QMW A;  1FTJ A;  3B7D A;  4GOT A;  2F7C A;  3G3G A;  3Q26 A;  5IZ3 A;  1Y4T A;  2VP1 A;  2I58 A;  1B7Z A;  2V3Q A;  4ZEI A;  5CRY A;  2ZNT A;  4P47 A;  4X48 A;  3TTR A;  3SKP A;  1MXX A;  3U1O A;  4G8H A;  5I56 B;  4IO7 A;  1TT1 A;  1IMD A;  1CB6 A;  3M3K A;  3ZKL A;  4GXA A;  4JB7 A;  4PQJ A;  3F11 A;  1ZJL A;  1FSA A;  5ET5 A;  1RDZ A;  1EZ9 A;  2OCU A;  4P9K A;  3OEK A;  4MX6 A;  3DEL B;  1FQC A;  4N81 A;  1FCK A;  2DS9 A;  3FXR A;  1ZBM A;  3Q29 A;  1DTG A;  4NF4 B;  3VLU A;  1RDX A;  1UIV A;  3CR9 A;  1LBV A;  2Z8D A;  4BDO A;  1PB7 A;  1GV8 A;  2LAO A;  2OX3 A;  5F1Q A;  2B3B A;  4N13 A;  4IO3 A;  5BUU A;  1QUL A;  4WXJ A;  4GX4 A;  2FA7 A;  3NOH A;  4H8J A;  1POT A;  4OXV A;  3B8B A;  1QUK A;  3MP6 A;  3MVZ A;  4MLV A;  1SVX B;  4KHZ E;  3KJT A;  1URD A;  4UAC A;  2R8T A;  1MXY A;  4LON B;  1US5 A;  4MH5 A;  1NMU A;  5JTY A;  5ICT A;  4ZZA A;  3BBR A;  4OYV A;  3KBZ A;  4N8G A;  1FTA A;  1CNQ A;  4QF9 A;  3EQ1 A;  3N6U A;  4DZ1 A;  1SYI A;  1B0L A;  1M5E A;  1ZLQ A;  3KC1 A;  4Q5T A;  3FV2 A;  4PAK A;  1MDQ A;  3T1B A;  1B58 A;  1JW4 A;  2DXY A;  5M2V A;  3KSX A;  3O6H A;  3KGC A;  1LAG E;  3PUW E;  2HEU A;  1GVC A;  4MFI A;  1LFG A;  2F3D A;  2NWJ A;  5AA2 A;  4BLA A;  1H3D A;  4PDD A;  3QUF A;  2YJP A;  2HQ0 A;  4F22 A;  1NV6 A;  3PU5 A;  2OJT A;  4POW A;  1BP5 A;  3MPK A;  1O63 A;  2XXQ A;  4ND9 A;  2F7B A;  5KCJ B;  3FJ7 A;  2ZZW A;  2Z8F A;  3T0J A;  4OQO A;  2WEF A;  4F2O A;  4GWW A;  1MPD A;  1TFA A;  3T93 B;  4ZE9 A;  1S9T A;  5H8N B;  3OMB A;  4KR5 A;  3TTL A;  2D3I A;  5I56 A;  5I5P A;  3UN6 A;  5HM4 B;  4NN3 A;  5DVJ A;  4F29 A;  4F3P A;  3KZG A;  4R6Y A;  1FJ9 A;  1MY0 A;  3HST A;  3A09 A;  4AS5 A;  4ZZE A;  5HPQ A;  4Q0C A;  1FPB A;  3KOS A;  4OVJ A;  3BIG A;  3K1M A;  3IOT A;  3TCF A;  1Q35 A;  1FBP A;  3LSW A;  3B50 A;  4EF1 A;  5A5L A;  3FD3 A;  5H8Q B;  5KZT A;  5TP9 A;  1B3H A;  4MNC A;  3C33 A;  3K1N A;  2HHM A;  3TFL A;  1N84 A;  3PPP A;  4POX A;  1AMF A;  3ZSF A;  1EYK A;  5ITP A;  4UA8 A;  2I48 A;  1NV3 A;  2GFE A;  5KDT B;  2OLB A;  1L5T A;  1FQE A;  2PVU A;  1Z7N E;  4QSE A;  2B4L A;  4AB5 A;  2CZI A;  2I3W A;  1OVB A;  2RC9 A;  4GD5 A;  3N26 A;  4XKQ A;  1YPN A;  2O7U A;  4PFT A;  3BFT A;  5AA4 A;  3H4Z A;  4AB6 A;  1NV2 A;  4H67 A;  4IR8 A;  2OWT A;  3MZ9 A;  4GBW A;  1MQI A;  4GL0 A;  3RT6 B;  2ESN A;  3E9X A;  1YCJ A;  1B3F A;  5I84 A;  4QHQ A;  4NWD A;  3GYY A;  3TQL A;  4DLD A;  3TOD A;  5CMB A;  1FTK A;  1QGX A;  2Y7I A;  5DW8 A;  3GZG A;  3QUJ A;  1HSJ A;  5AA2 B;  1D9V A;  2BJJ X;  3O6G A;  4HXV A;  2QPQ A;  4GF8 A;  1QJM A;  3A3C A;  4MBP A;  1GTK A;  4MEV A;  1IXH A;  4ELR A;  1IXG A;  4U1Z A;  3OO9 A;  4WED A;  4P56 A;  2NXO A;  4QFK A;  3IOR A;  4DXC A;  4MF3 A;  4OES A;  3EPE A;  3H3G A;  4O7I A;  1RKM A;  3FUZ A;  2IA4 A;  3R26 A;  2QMX A;  4P0G A;  2XXK A;  3FVG A;  4FAJ A;  4U4S A;  4NF8 A;  1ZKB A;  3USD A;  2W7Y A;  3M3L A;  1Y3N A;  4JWO A;  4IB2 A;  3TCH A;  1IQ7 A;  2HZK A;  4XKN A;  4NWC A;  2L5V A;  4THI A;  5LTC A;  5ET7 A;  4N15 A;  3FZV A;  2QVR A;  1LBC A;  1R9Q A;  4G2Z A;  1FBH A;  2DE3 A;  4OHN A;  4HW8 A;  1B0H A;  2FBP A;  4GWO A;  2QVV A;  4FOR A;  1MM6 A;  1ATG A;  3CFX A;  3VVF A;  1LLS A;  5DEX B;  3TTN A;  1K9Y A;  1QUJ A;  1NFT A;  3E4R A;  1DPP A;  4Q8R A;  2CMO A;  1FRP A;  4NX1 A;  2DP8 A;  3PUZ E;  3UOR A;  3EHS A;  2RCA A;  4MCO A;  1MDP 1;  5IGA A;  4C1U A;  4X9T A;  4P1L A;  2HXW A;  1MH3 A;  5ET8 A;  1FTL A;  5BWJ A;  1YXI A;  2Y7K A;  2F36 A;  3MYU A;  3SES A;  1QKA A;  2PMS A;  1S50 A;  4NTL A;  1UTB A;  3C34 A;  4LZ8 A;  1Y4C A;  4C1T A;  2XXT A;  1H76 A;  4TLL B;  2XX9 A;  1DCU A;  3CFZ A;  1FQB A;  1B2H A;  4F18 A;  4RNS A;  2UYE A;  4OER A;  3V5A A;  2ONK E;  2VOZ A;  4OVP A;  2DDK A;  5FBP A;  4DI4 B;  1LCT A;  1XVY A;  3GLB A;  5JEI A;  3K6W A;  1NUY A;  1AIV A;  5EQ9 A;  2XX8 A;  2F6G A;  3THI A;  1BK4 A;  2ZYO A;  4RK9 A;  1N7W A;  3D4G A;  1JVX A;  3LR1 A;  3TPA A;  2I4C A;  4R75 A;  1MXZ A;  2RIN A;  4ELO A;  1US4 A;  2ONS A;  4IO4 A;  1DTZ A;  5ISU A;  3DP6 A;  1IEJ A;  3PD9 A;  3PD8 A;  1SPI A;  3DP4 A;  3LSF B;  4WKM A;  2XWV A;  1UTB B;  3BIH A;  3RPW A;  1YAE A;  1MM7 A;  4E0W A;  2O68 A;  1B3L A;  1LGB C;  3GBA A;  2V3U A;  4HCY A;  2XXP A;  3KG2 A;  2OBG A;  4MNP A;  2I0B A;  1QUI A;  3LSX A;  2THI A;  2NVU B;  3A3U A;  5AA2 D;  3MZB A;  5A5X B;  1R6Z A;  1P1O A;  2O51 A;  2QSX A;  2DWI A;  4MMP A;  4OMB A;  5IKB A;  5L9S A;  1UIU A;  2P3V A;  1Y3Q A;  2QFL A;  5ESY A;  4YAH X;  1FTO A;  4IO2 A;  4WEP A;  4R6K A;  5H8Q A;  3UP9 A;  2REJ A;  3U65 A;  1JQF A;  2O1M A;  1A55 A;  2F6P A;  1B3G A;  5H8H B;  4PAF A;  1RYO A;  3IX1 A;  4H46 A;  4AS4 A;  2R6G E;  1EZO A;  2CZK A;  3PGF A;  4LVQ A;  2E1S A;  4IGT A;  1II5 A;  4PET A;  4DCY A;  1H45 A;  2RKM A;  2ABH A;  4NF8 B;  3VFJ A;  4PC9 A;  4FAT A;  3LSL A;  2CEX A;  4PE3 A;  1UTH A;  1LFH A;  2V4C A;  2RC7 A;  2OK2 A;  3I6V A;  3MVW A;  4PGN A;  2X7Q A;  2XXH A;  3I3V A;  1MH4 A;  4GFR A;  5I58 A;  5HBC A;  3IR1 A;  3QSL A;  2Q2A A;  2DSF A;  4GXS B;  2WX9 A;  2KR0 A;  4IY5 A;  1A40 A;  4ZEC A;  2PYY A;  1A8E A;  1T0K A;  3ODB A;  2P0S A;  1AL3 A;  3TKD A;  1JET A;  1NNK A;  1R1N A;  2ONR A;  4HE2 A;  1KA0 A;  4KYD A;  4OET A;  4PF6 A;  1NV4 A;  1ZMG A;  2O1L A;  2F3B A;  4K3F A;  4F3G A;  4ESW A;  3IFC A;  3KJ7 A;  1Y1Z A;  4KI0 E;  1LBZ A;  4KQP A;  1USY E;  1FQA A;  2Q8J A;  4U4X A;  3RTW B;  3JYR A;  3FJM A;  4LZ7 A;  2RC8 A;  4I40 A;  5TP9 B;  4JWY A;  1FBF A;  1F9B A;  3OD7 A;  5AA1 A;  2WKY A;  1LBY A;  4H0W A;  3L6H A;  3ONM A;  5B7D A;  2F78 A;  4PDH A;  5EHS A;  4O8M A;  1AOV A;  2ZXT A;  4FEB A;  5KDT A;  1B1X A;  4FIM A;  3MST A;  2O69 A;  3H6U A;  3S2V A;  3T96 B;  3PMV A;  5K2Y A;  4G68 A;  1UQW A;  4XKP A;  2IEE A;  4RA1 A;  3MVY A;  1LCF A;  2ZNS A;  3CSG A;  4OEN A;  1H44 A;  4BDN A;  4Z0I A;  1XS5 A;  4OFO A;  2QRY A;  1XOC A;  2BJI A;  4RJZ A;  4PCD A;  3VXB A;  4BDL A;  4OEU A;  3O2A A;  2PX1 A;  3MZ1 A;  4EQ9 A;  4OA4 A;  1K9Z A;  2H25 A;  3D4C A;  2DVC A;  4EQ7 A;  1FPI A;  4NG7 A;  3EF7 A;  4XXU A;  3EN3 A;  1I6Q A;  4GLI A;  3UA8 A;  1ANF A;  4X1D A;  5IM2 A;  4NHB A;  1B05 A;  4QFO A;  3TTM A;  2UYF A;  3QMF A;  5EQ7 A;  3C31 A;  1Y9U A;  3OSQ A;  2Y7P A;  3I5O A;  4ONY A;  4ESX A;  4BDQ A;  1INP A;  4DE8 A;  1SD3 A;  2Y7R A;  5B70 A;  4U22 A;  1FBC A;  3IB0 A;  5KCJ A;  5DYH A;  3OO7 A;  1PB9 A;  1B40 A;  2QS3 A;  1B7H A;  3T9X B;  2NOO A;  3U8Q A;  2XXU A;  1YZ0 A;  5FTH A;  4HS7 A;  1D9Q A;  3KOT A;  3G3J A;  4N17 A;  2GQ1 A;  3LV0 A;  2Q9T A;  4P11 A;  3N6T A;  2DE2 A;  2HCA A;  4U2R A;  1I69 A;  3FVK A;  4QFN A;  2VPN A;  5AA3 A;  4P8B A;  2Z23 A;  4R6H A;  1FTM A;  2GRV A;  3PUX E;  3K00 A;  3T9U A;  1OLA A;  3MWB A;  4ZED A;  2H98 A;  3KFM A;  1DSN A;  1D3K A;  5H8S A;  4N91 A;  1FJ6 A;  2H99 A;  5ET6 A;  3G3H A;  1NUW A;  2HAU A;  2ZZX A;  1IXC A;  3VLW A;  3U92 A;  3FAT A;  4PBQ A;  4LA9 A;  1RYX A;  3V8X B;  3W9V A;  1MPC A;  4F2Q A;  4P1E A;  5TPA B;  2Z8E A;  4OEV A;  3BFU A;  3PPN A;  4KFQ A;  1FBG A;  3QXM A;  4RK2 A;  1IME A;  1LEV A;  1OVT A;  4GBV A;  4YU0 A;  1SDX A;  4HE1 A;  5CI5 A;  1JVY A;  3JZJ A;  1B46 A;  3PPO A;  3PTY A;  3TYH A;  5JK4 A;  3CHG A;  2FHY A;  4OAN A;  2DWH A;  4IO6 A;  1Q1K A;  1LB8 A;  4F1U A;  3UK4 A;  3UIF A;  2PT1 A;  3K0V A;  5JTY B;  1SW5 A;  3CG1 A;  3O97 A;  3MJN A;  5FHO A;  1URS A;  4LQ5 A;  1N7X A;  2Y5L A;  5TU0 A;  2GHA A;  1MQH A;  2HZL A;  3CRB A;  5EQA A;  4GWU A;  1AH5 A;  3K6V A;  4GWS A;  4DXB A;  1USY H;  2UVH A;  2XD3 A;  4QRZ A;  4DI3 D;  2CZH A;  4GX3 A;  1TXF A;  3LBS A;  4G68 B;  1TWY A;  3KN3 A;  2QS2 A;  1XHY A;  3B6W A;  1NH7 A;  2FYI A;  2OWZ A;  4PFU A;  2I4B A;  5I57 B;  3FXB A;  1PBQ A;  3K4U A;  3IOV A;  1A7L A;  3T66 A;  5I7I A;  2UVG A;  2H4I A;  2M8C A;  4ZS9 A;  3K6X A;  3WAF A;  3Q25 A;  3RNN A;  2AL5 A;  3SEX A;  3BKI B;  2ZYN A;  2QVU A;  3RPL A;  1PDA A;  1YYZ A;  3CVG A;  4C0R A;  1O64 A;  4TLM B;  1VDW A;  1BKA A;  2V84 A;  4H8I A;  3MVX A;  3PMW A;  2F34 A;  2GHB A;  3V83 A;  1P1W A;  3MPL A;  5K2X A;  4KCC A;  2R71 A;  1QVS A;  4G61 A;  3E79 A;  4IO5 A;  3PUY E;  1OIB A;  2A5S A;  2Q88 A;  4YIC A;  3M3F A;  4X8R A;  1URG A;  4YB7 A;  3FGS A;  3QYT A;  2HXR A;  4NF4 A;  2NUV A;  4OTE A;  1OQG A;  4R9F A;  4YMA A;  1P1U A;  3PV0 E;  4QSC A;  3D1R A;  4EF2 A;  1UTH B;  2DQV A;  3Q28 A;  1DBZ A;  3S9M C;  2Z22 A;  2Q89 A;  3HV1 A;  1NNT A;  1MS7 A;  5CC2 A;  4KXP A;  1SI1 A;  4U23 A;  3FVN A;  4H5F A;  4F19 A;  3C32 A;  1PC3 A;  1HSL A;  3VDF A;  3RPL B;  1ZIU A;  2XD2 A;  5CMM A;  3IJX B;  3C9H A;  1NNP A;  1XVX A;  3LUY A;  3KBR A;  4JVI A;  3OEL A;  2ZMB A;  3FXU A;  3ZS6 A;  3TDJ A;  2XA5 A;  3CFL A;  4RPN A;  5CMC A;  3RUM A;  3VVE A;  2X26 A;  4NF5 B;  3SEU A;  4YB6 A;  4NED A;  4FE8 A;  2I3V A;  1TFD A;  1Y1M A;  3B6Q A;  3E13 X;  3DLN A;  4H6D A;  3O9P A;  5F24 A;  3MBP A;  1OMP A;  5FHM A;  5F7V A;  2PBW A;  3OO6 A;  4RXL A;  1B9J A;  1SYH A;  2FIE A;  1NL5 A;  1EYI A;  1PBP A;  4DCX A;  4BDM A;  1IMB A;  4R72 A;  4DDD A;  1NV5 A;  2ZYK A;  4NF0 A;  3HCQ A;  1B7U A;  4ZE8 A;  2FNC A;  2XXW A;  2DYX A;  3TEL A;  2XHD A;  1IIT A;  5H8F B;  3HHG A;  5EQ8 A;  4PAI A;  2QL3 A;  3MQ9 A;  3CSB A;  5I2N A;  5H8N A;  4G77 A;  1FQF A;  3QAX A;  4N4U A;  2AYS A;  2F5X A;  1KZ8 A;  4I62 A;  2PCR A;  4MAG A;  3RY3 A;  5IZZ A;  3CI8 A;  3HHF A;  4MHF A;  2QJE A;  3DM0 A;  1BTJ A;  1FPF A;  3RT8 A;  4U1O A;  4R74 A;  4PP0 A;  3S9L C;  1QW0 A;  4QXD A;  5EHM A;  4Z7E A;  1NKX A;  1LBW A;  2I6E A;  5I2K B;  3ZKK A;  1LAX A;  1DK4 A;  5T3J A;  2D5W A;  1ZU0 A;  1NI9 A;  2VPO A;  4H65 A;  1M5C A;  3IB1 A;  1N04 A;  1MY3 A;  4R9G A;  5I3S A;  3FAS A;  3E3K A;  2DWA A;  3KEI A;  1CE2 A;  5DTB A;  1MQD A;  1IMC A;  1XC1 A;  5I58 B;  1FPE A;  3FXQ A;  4OVT A;  5IAI A;  1B52 A;  1B51 A;  4LUB A;  2PT2 A;  4XFE A;  4PFI A;  3SEY A;  3SEV A;  3LUZ A;  1P1Q A;  1NV7 A;  4XEQ A;  4O3C A;  3CG3 A;  1BLF A;  2XX7 A;  4H45 A;  2Y84 A;  4X1B A;  4NMY A;  2FIX A;  3FJG A;  1M5F A;  1WOD A;  5ICQ A;  2D21 A;  4R2F A;  4MIJ A;  3HPI A;  4ZDM A;  4GX6 A;  2OZZ A;  3S9N C;  3B6T A;  3PPQ A;  3FIR A;  1IMF A;  4ZEB A;  1FBE A;  4PF8 A;  1ZTY A;  2ZNU A;  4KYE A;  4F1Y A;  2ZYM A;  3VXC A;  3IOW A;  3MC2 A;  4FBP A;  2X7P A;  3IOU A;  1Z7M E;  4IY6 A;  3EKI A;  1SI0 A;  1SBP A;  4OZ9 A;  4OVR A;  4HCW A;  4KCD A;  2MKZ A;  1VE4 A;  4LN5 A;  5AA4 B;  2RF1 A;  2F7A A;  4FED A;  4DXU A;  4RYA A;  1WVJ A;  1B5H A;  3IAZ A;  3U72 A;  4PGP A;  3JV9 A;  4H1X A;  1N76 A;  4GVO A;  1MQJ A;  2R9J A;  3IO4 A;  2V3T A;  4I1D A;  4NF6 A;  2ANJ A;  4HTG A;  3Q27 A;  2V25 A;  4LP2 B;  1ELJ A;  4R2B A;  1LBB A;  3TQW A;  3TAJ A;  3O28 A;  1OLC A;  2XXX A;  2OWS A;  4YZZ A;  3W9W A;  4I3Y A;  4N6K A;  2Y7W A;  5FHN A;  4F3B A;  4XKR A;  4EQB A;  4PTK A;  1G0I A;  4O3A A;  2E0S A;  3K6U A;  1QKB A;  3M8U A;  2WBD A;  3MP8 A;  2AIX A;  5DEX A;  4ELQ A;  1P99 A;  2WBB A;  1MY4 A;  1XT8 A;  1SQY A;  4OVQ A;  1B32 A;  3GXA A;  2H9B A;  2QS4 A;  1MY2 A;  3FBP A;  3O29 A;  4KPT A;  4O3B A;  4OFL A;  3OEN A;  4ZEK A;  2HFB A;  4I8C A;  5I59 B;  5IZ3 B;  5CM6 A;  5H8F A;  1SW1 A;  4O7M A;  5LDZ A;  1VFE A;  3RN8 A;  1Q9D A;  1N3X A;  5I2N B;  4JVC A;  4JXI A;  3G3K A;  4N6P A;  4YMB A;  3FV1 A;  3OOA A;  5EYH A;  3DP8 A;  2PFY A;  1MG1 A;  4JBZ A;  2KQZ A;  3TCG A;  3ECR A;  2CZL A;  1GR2 A;  3KSJ A;  4NF5 A;  3SDF A;  1N0T A;  4OWD A;  4JWX A;  4HE0 A;  1MXV A;  3RQT A;  2F8D A;  1B5I A;  1POY 1;  3AXF A;  5FTI A;  3H06 B;  2P3N A;  1A54 A;  3TMG A;  1LFI A;  1VFD A;  5DVI A;  4NE4 A;  1FPD A;  3MP1 A;  2WYK A;  3V89 B;  1YTV A;  3R6U A;  4L17 A;  2Y5K A;  2JJK A;  4MLQ A;  4RPO A;  5CBS A;  4OFJ A;  1N3W A;  4NQ8 A;  1B5J A;  2FVZ A;  3PMX A;  4JSD A;  4N6D A;  4JSO A;  3ILU B;  5CMK A;  2F35 A;  3TZA A;  3C36 A;  3TTK A;  2Q74 A;  2Q2C A;  4GL8 A;  3VVD A;  1JW5 A;  2P2A A;  1NUX A;  3T9V A;  2G29 A;  4XTC Q;  3VE1 B;  4N07 A;  3R7X A;  3HO7 A;  3EHU A;  4KD5 A;  4ELP A;  3E78 A;  1M5B A;  1GGG A;  3KN8 A;  2P1S A;  4G68 C;  1MPB A;  2CEY A;  1MXW A; 
#chains in the Genus database with same CATH homology
 3C32 A;  1PC3 A;  1HSL A;  3VDF A;  5AA2 A;  4BLA A;  1UTH A;  1H3D A;  1LFH A;  3H6V A;  1ZIU A;  2RC7 A;  2OK2 A;  2XD2 A;  5CMM A;  3I6V A;  3MVW A;  3QUF A;  3IJX B;  5L8D A;  3C9H A;  1P1N A;  2AL4 A;  1NNP A;  1XVX A;  3LUY A;  2X7Q A;  2XXH A;  3KBR A;  5A5X A;  2VD3 A;  1DMB A;  1MH4 A;  3I3V A;  4GFR A;  5HBC A;  2YJP A;  5I58 A;  2HQ0 A;  4F22 A;  3IR1 A;  3QSL A;  2Q2A A;  2DSF A;  3PU5 A;  4GXS B;  3TEP A;  2OJT A;  4POW A;  3OEL A;  4TOZ A;  2ZMB A;  3FXU A;  2V93 A;  4IY5 A;  3ZS6 A;  1BP5 A;  3MPK A;  1O63 A;  2XXQ A;  4ND9 A;  1A40 A;  3TDJ A;  2F7B A;  4ZEC A;  3EHT A;  5KCJ B;  2PYY A;  1A8E A;  2DVZ A;  3FJ7 A;  4TQU Q;  3ODB A;  3CFL A;  2P0S A;  2Z8F A;  4RPN A;  1AL3 A;  5CMC A;  3RUM A;  5L9M A;  3TKD A;  1JET A;  1NNK A;  1R1N A;  3VVE A;  4OQO A;  4F2O A;  2YPN A;  2ONR A;  4I9D A;  4EUO A;  1MPD A;  2X26 A;  1MXU A;  4NF5 B;  1TFA A;  4KYD A;  3SEU A;  3T93 B;  4OET A;  4YB6 A;  4NED A;  4ZE9 A;  1S9T A;  5H8N B;  4FE8 A;  3OMB A;  4KR5 A;  1ZMG A;  2O1L A;  3TTL A;  1IZ1 A;  2D3I A;  1MY1 A;  2I3V A;  2XXR A;  1I6B A;  2DXR A;  3H6W A;  4K3F A;  4F3G A;  3UN6 A;  3S4U A;  3OO8 A;  1TFD A;  4ESW A;  1Y1M A;  5HM4 B;  3B6Q A;  3E13 X;  3DLN A;  5DVJ A;  4F31 B;  5ICQ A;  4H6D A;  3KJ7 A;  3O9P A;  1Y1Z A;  4F29 A;  4F3P A;  3MBP A;  1OMP A;  1WDN A;  2A5T A;  5FHM A;  1NNF A;  4KI0 E;  5F7V A;  2PBW A;  3KZG A;  4XIG Q;  1I6A A;  3OO6 A;  4R6Y A;  1EU8 A;  2I0C A;  4KQP A;  5CBR A;  4RXL A;  1B9J A;  1MY0 A;  3HST A;  4AQ4 A;  1USY E;  3A09 A;  3MW0 A;  4M1V A;  1FQA A;  1SW2 A;  2O6A A;  2Q8J A;  4U4X A;  3RTW B;  3JYR A;  5FTH A;  3L6G A;  3FJM A;  4LZ7 A;  4ZZE A;  3SER A;  5HPQ A;  2RC8 A;  4Q0C A;  1SYH A;  2RCB A;  1D9Y A;  5TP9 B;  4JWY A;  1NL5 A;  3G3F A;  1O7T A;  1F9B A;  3OD7 A;  4GQO A;  4YKJ A;  1PBP A;  2WKY A;  3KOS A;  4OVJ A;  5AA1 A;  1A99 A;  4DCX A;  4BDM A;  3N94 A;  1IUD A;  4H0W A;  3K1M A;  3L6H A;  3IOT A;  3ONM A;  2F78 A;  1Q35 A;  4R72 A;  3TCF A;  5B7D A;  1PEB A;  4DDD A;  5EHS A;  2ZYK A;  3LSW A;  4F3S A;  3W15 C;  3CIJ A;  3HCQ A;  4EF1 A;  1B7U A;  4ZE8 A;  1AOV A;  2FNC A;  2ZXT A;  1MQG A;  2REG A;  2XXW A;  2DYX A;  3FD3 A;  4FEB A;  3SEW A;  4ECF A;  5H8Q B;  3TEL A;  5KZT A;  1JNF A;  2UVI A;  1B4Z A;  5TP9 A;  5KDT A;  1B3H A;  1B1X A;  2XHD A;  3VV5 A;  1IIT A;  3C33 A;  3C4M A;  3K1N A;  5DT6 A;  5H8F B;  4FIM A;  3TFL A;  1N84 A;  1VSO A;  2VGQ A;  3PPP A;  3HHG A;  2O69 A;  3H6U A;  4POX A;  5DVF A;  2XXV A;  3S2V A;  1AMF A;  3T96 B;  2QL3 A;  3MAM A;  3MQ9 A;  3CSB A;  3G3I A;  1LB9 A;  5I2N A;  1DPE A;  3ZSF A;  5H8N A;  3PMV A;  5ITP A;  3O66 A;  4G68 A;  4G77 A;  1UQW A;  4PFY A;  5K2Y A;  1B3E A;  4UA8 A;  1FQF A;  2I48 A;  4XKP A;  4YKK A;  2IEE A;  3QAX A;  4RA1 A;  3MVY A;  2AYS A;  2F5X A;  2GFE A;  5KDT B;  4I62 A;  5L9O A;  1LCF A;  3RY3 A;  2OLB A;  2DWJ A;  3CI8 A;  1JEU A;  1L5T A;  2ZNS A;  3CSG A;  3PPR A;  1H44 A;  3N5L A;  4OEN A;  1FQE A;  4BDN A;  2PVU A;  1Z7N E;  4QSE A;  4Z0I A;  5LOM A;  1XS5 A;  3HHF A;  2QJE A;  4AB5 A;  3DM0 A;  4OFO A;  3U93 A;  2I3W A;  1OVB A;  1BTJ A;  2RC9 A;  3RT8 A;  4U1O A;  4R74 A;  4PP0 A;  4GD5 A;  2QRY A;  3IJO B;  1XOC A;  3N26 A;  3QIM A;  3IL1 B;  4XKQ A;  1YPN A;  3S9L C;  4F39 A;  4RJZ A;  2O7U A;  3VXB A;  4BDL A;  4OEU A;  3FVO A;  3O2A A;  2PX1 A;  3MZ1 A;  5AE4 A;  1QW0 A;  5EHM A;  4EQ9 A;  4PFT A;  4Z7E A;  1NKX A;  4FEC A;  3BFT A;  2ALU A;  2I6E A;  5I2K B;  4YKI A;  2H25 A;  1FW0 A;  3D4C A;  1LAX A;  3RTF B;  2DVC A;  3ZKK A;  5AA4 A;  1SW4 A;  3H4Z A;  4EQ7 A;  4AB6 A;  3IK6 B;  3EF7 A;  4XXU A;  4H67 A;  1B6H A;  3EN3 A;  2OWT A;  3MZ9 A;  1I6Q A;  2D5W A;  3OSR A;  4GLI A;  1MQI A;  4GL0 A;  1ZU0 A;  3UA8 A;  1ANF A;  4X1D A;  3RT6 B;  4G4P A;  2ESN A;  3E9X A;  4H65 A;  4JDF A;  1IXI A;  2QS1 A;  1M5C A;  1YCJ A;  1N04 A;  1MY3 A;  3IB1 A;  3KN7 A;  1J1N A;  1B05 A;  4QFO A;  1B3F A;  4R9G A;  5I84 A;  3TTM A;  4QHQ A;  3C35 A;  1JEV A;  1H43 A;  4NWD A;  3T22 A;  2UYF A;  3FAS A;  1R9L A;  3C31 A;  3TQL A;  3E3K A;  4DLD A;  4R73 A;  4YB5 A;  3TOD A;  1Y9U A;  2DWA A;  5CMB A;  3U94 A;  1FTK A;  3KEI A;  1CE2 A;  3OSQ A;  1MQD A;  5DTB A;  4DIG A;  3G7W A;  2Y7I A;  2Y7P A;  3I5O A;  3GZG A;  4ONY A;  4ESX A;  1XC1 A;  5I58 B;  4BDQ A;  3QUJ A;  1HSJ A;  3FXQ A;  4QFP A;  4DE8 A;  2G93 A;  1SD3 A;  5AA2 B;  2Y7R A;  1D9V A;  2BJJ X;  3O6G A;  5B70 A;  2O84 X;  2QPQ A;  4GF8 A;  1QJM A;  1B52 A;  1B51 A;  4U22 A;  5ELV A;  5IAI A;  1B4H A;  3A3C A;  3IB0 A;  4LZ5 A;  1GTK A;  4MBP A;  5DYH A;  3OO7 A;  4Q30 B;  5KCJ A;  2VD2 A;  4LUB A;  1PB9 A;  3PUV E;  1IXH A;  1EH3 A;  2PT2 A;  1B40 A;  1IXG A;  4U1Z A;  2QS3 A;  1B7H A;  5ITO A;  3T9X B;  1VR5 A;  2NOO A;  3K01 A;  3K02 A;  3OO9 A;  3U8Q A;  4WED A;  4GRK A;  3SEY A;  3SEV A;  2NXO A;  2XXU A;  1P1Q A;  4QFK A;  1PB8 A;  2DE4 A;  3IOR A;  3MUQ A;  4O3C A;  1Y3P A;  4DXC A;  1MRP A;  3TUS A;  3CG3 A;  4HS7 A;  1BLF A;  2XX7 A;  3KOT A;  3G3J A;  3EPE A;  4IGR A;  4MF3 A;  2Y84 A;  3H3G A;  4OES A;  4X1B A;  4NMY A;  1DOT A;  3FJG A;  5TPA A;  3H7M A;  1RKM A;  3FUZ A;  2IA4 A;  1M5F A;  1WOD A;  2Q9T A;  2QMX A;  2D21 A;  3K1P A;  3R26 A;  4ISU A;  4P0G A;  4P0I A;  4R2F A;  4P11 A;  2UVJ A;  3OXN A;  4M4G A;  2DOJ A;  3FVG A;  3N6T A;  4ZEF A;  2DE2 A;  3S9E A;  4FAJ A;  2HCA A;  3HPI A;  4U4S A;  4ZDM A;  1KWH A;  2I49 A;  1ZKB A;  4NF8 A;  4GIZ A;  4U2R A;  3USD A;  1A8F A;  2OZZ A;  1I69 A;  2W7Y A;  3M3L A;  1Y3N A;  3S9N C;  3FVK A;  3HN0 A;  3B6T A;  4QFN A;  4PFW A;  3PPQ A;  1IIW A;  2HAV A;  4JWO A;  4IB2 A;  3FIR A;  5AA3 A;  4ZEB A;  3K2D A;  3TCH A;  3ILT B;  2Z23 A;  5I59 A;  1ZTY A;  2B3F A;  2ZNU A;  4KYE A;  4R6H A;  4F1Y A;  1FQD A;  1FTM A;  1HSE A;  1IQ7 A;  1LAF E;  3LC8 A;  2HZK A;  4XKN A;  3IO6 A;  4BDR A;  3RLF E;  4LQ2 A;  3GBB A;  2ZYM A;  2GRV A;  3PUX E;  3K00 A;  4NWC A;  3VXC A;  3T9U A;  3IOW A;  4YKP A;  3MC2 A;  2X7P A;  4EDP A;  1OLA A;  3IOU A;  1Z7M E;  2O7I A;  3H6T A;  3MWB A;  4IY6 A;  3UGW A;  4THI A;  4ZED A;  2YLN A;  3SET A;  2H98 A;  4F1V A;  1SI0 A;  1SBP A;  1OQH A;  3FZV A;  1LBC A;  3KFM A;  1R9Q A;  4LAT A;  1DSN A;  4G2Z A;  2DE3 A;  4HCW A;  4OZ9 A;  1D3K A;  4OHN A;  5H8S A;  4HW8 A;  2H99 A;  4KCD A;  1B0H A;  1VE4 A;  5AA4 B;  4GWO A;  3G3H A;  2HAU A;  2RF1 A;  4FOR A;  1MM6 A;  1ATG A;  4U21 A;  2F7A A;  1IXC A;  3CFX A;  4FED A;  4PE5 B;  3VLW A;  1LLS A;  5DEX B;  3VVF A;  4DXU A;  3TTN A;  3P7I A;  1NH8 A;  1WVJ A;  4RYA A;  3U92 A;  4H5G A;  2B65 A;  3WAE A;  2VHA A;  1QUJ A;  1NFT A;  3FAT A;  3E4R A;  3QK6 A;  4NF6 B;  1B5H A;  4LA9 A;  1LAH E;  1DPP A;  2H5Y A;  3IAZ A;  1RYX A;  4Q8R A;  4QSD A;  3V8X B;  2KLF A;  1MPC A;  2CMO A;  3W9V A;  4F2Q A;  3U72 A;  2XXI A;  3JV9 A;  4H1X A;  5TPA B;  2GH9 A;  2Z8E A;  2DP8 A;  3PUZ E;  4OEV A;  3IB2 A;  3UOR A;  3BFU A;  3VLV A;  3PPN A;  2UXA A;  4KFQ A;  1S7Y A;  3QXM A;  4G8N A;  1N76 A;  3EHS A;  1M5D A;  4RK2 A;  4G8M A;  4GVO A;  2RCA A;  1B1H A;  1MQJ A;  1T0K A;  2R9J A;  4E0X A;  1EZP A;  3IO4 A;  3OEM A;  1OVT A;  2V3T A;  4KYS A;  4YU0 A;  1MDP 1;  4I1D A;  4NF6 A;  2ANJ A;  5I56 A;  1SDX A;  1D4N A;  5CI5 A;  4RY1 A;  4HTG A;  1JVY A;  3JZJ A;  3Q27 A;  2V25 A;  4C1U A;  4X9T A;  1JW1 A;  1B46 A;  4LP2 B;  1ELJ A;  2HXW A;  4QFL A;  1MH3 A;  4R2B A;  1LBB A;  1FTL A;  5BWJ A;  5H8H A;  2F97 A;  2Y7K A;  1Y20 A;  2F36 A;  3PPO A;  3TAJ A;  3TQW A;  3TYH A;  4ELR A;  4EXK A;  5JK4 A;  3SES A;  1QKA A;  3O28 A;  1OLC A;  2PMS A;  2XXX A;  3RGY A;  2DWH A;  2OWS A;  1S50 A;  4IO6 A;  4YZZ A;  1Q1K A;  3W9W A;  4NTL A;  3O6I A;  1LB8 A;  3T9H B;  1UTB A;  2Y7W A;  3C34 A;  5FHN A;  4F3B A;  4F1U A;  4XKR A;  4FJP A;  3UK4 A;  4EQB A;  2XXY A;  3H03 A;  4LZ8 A;  3UIF A;  1Y4C A;  2PT1 A;  4O3A A;  2E0S A;  2A5T B;  4C1T A;  2XXT A;  3K0V A;  1QKB A;  3K6U A;  3M8U A;  5JTY B;  4EXL A;  3MP8 A;  1H76 A;  1LST A;  2AIX A;  5DEX A;  5EYF A;  1SW5 A;  3CG1 A;  3O97 A;  5J1D A;  1BIY A;  3V5A A;  1P99 A;  4ELQ A;  3MJN A;  4TLL B;  2XX9 A;  5FHO A;  1URS A;  1FTJ A;  2QMW A;  4LQ5 A;  1MY4 A;  3B7D A;  3CFZ A;  1N7X A;  4GOT A;  2F7C A;  3G3G A;  1FQB A;  1B2H A;  3Q26 A;  4F18 A;  1XT8 A;  1Y4T A;  2VP1 A;  4RNS A;  2I58 A;  2UYE A;  1SQY A;  4OER A;  1B7Z A;  1B32 A;  2ONK E;  2V3Q A;  3GXA A;  2ZNT A;  2GHA A;  5CRY A;  4ZEI A;  5TU0 A;  1MQH A;  4X48 A;  2H9B A;  2QS4 A;  1MY2 A;  3TTR A;  2VOZ A;  3O29 A;  4KPT A;  3SKP A;  1MXX A;  4O3B A;  3U1O A;  4OFL A;  2HZL A;  3CRB A;  3OEN A;  4ZEK A;  1LCT A;  4G8H A;  1XVY A;  5I56 B;  2HFB A;  1AH5 A;  3GLB A;  4I8C A;  4IO7 A;  3K6V A;  1TT1 A;  5JEI A;  1CB6 A;  3K6W A;  4DXB A;  5I59 B;  3M3K A;  3ZKL A;  1USY H;  4GXA A;  4JB7 A;  4PQJ A;  5CM6 A;  5H8F A;  1AIV A;  2UVH A;  1SW1 A;  2XD3 A;  4QRZ A;  3F11 A;  1ZJL A;  2XX8 A;  1VFE A;  2F6G A;  3THI A;  3RN8 A;  1N3X A;  2ZYO A;  1EZ9 A;  2OCU A;  4RK9 A;  5I2N B;  1N7W A;  4JXI A;  1TXF A;  3LBS A;  3G3K A;  3D4G A;  1JVX A;  4G68 B;  1TWY A;  3LR1 A;  3KN3 A;  3OEK A;  4N6P A;  3TPA A;  4YMB A;  2I4C A;  3FV1 A;  3OOA A;  2QS2 A;  4R75 A;  1MXZ A;  1XHY A;  2RIN A;  3DP8 A;  4ELO A;  3B6W A;  3DEL B;  1FQC A;  1MG1 A;  1US4 A;  2ONS A;  4IO4 A;  1DTZ A;  1NH7 A;  4JBZ A;  2FYI A;  3TCG A;  1FCK A;  5ISU A;  2DS9 A;  3FXR A;  3DP6 A;  1IEJ A;  1ZBM A;  2I4B A;  3ECR A;  3PD9 A;  3Q29 A;  4PFU A;  5I57 B;  1PBQ A;  1DTG A;  3K4U A;  3PD8 A;  4NF4 B;  3DP4 A;  2CZL A;  3VLU A;  3LSF B;  1GR2 A;  4WKM A;  1UIV A;  1A7L A;  3IOV A;  3T66 A;  3CR9 A;  3KSJ A;  2UVG A;  4NF5 A;  2H4I A;  2Z8D A;  4BDO A;  1PB7 A;  3SDF A;  1N0T A;  1GV8 A;  1UTB B;  2M8C A;  3RPW A;  1YAE A;  1MM7 A;  2LAO A;  3K6X A;  4ZS9 A;  3WAF A;  4OWD A;  3Q25 A;  5F1Q A;  4JWX A;  2B3B A;  3RNN A;  2AL5 A;  3SEX A;  1MXV A;  4E0W A;  2O68 A;  3BKI B;  4N13 A;  3RQT A;  1B3L A;  1LGB C;  2F8D A;  3GBA A;  4IO3 A;  1B5I A;  2V3U A;  2ZYN A;  4HCY A;  1POY 1;  5BUU A;  1PDA A;  2XXP A;  3CVG A;  3AXF A;  1QUL A;  3KG2 A;  4WXJ A;  5FTI A;  2OBG A;  4C0R A;  1O64 A;  3H06 B;  2FA7 A;  1A54 A;  4TLM B;  3TMG A;  2I0B A;  4H8J A;  1BKA A;  1POT A;  1QUI A;  4OXV A;  1LFI A;  1QUK A;  2V84 A;  4H8I A;  3MVX A;  3MP6 A;  3LSX A;  1VFD A;  5DVI A;  3MVZ A;  4MLV A;  5I57 A;  1SVX B;  3PMW A;  4KHZ E;  4NE4 A;  2F34 A;  3MP1 A;  2THI A;  2GHB A;  2NVU B;  3KJT A;  3V89 B;  1YTV A;  3V83 A;  1URD A;  1P1W A;  3A3U A;  3MPL A;  5AA2 D;  3MZB A;  3R6U A;  4L17 A;  4UAC A;  5A5X B;  1R6Z A;  1P1O A;  1MXY A;  4MLQ A;  4KCC A;  4RPO A;  5K2X A;  2R71 A;  4LON B;  1US5 A;  5CBS A;  1QVS A;  2O51 A;  2QSX A;  2DWI A;  4MH5 A;  4OFJ A;  4OMB A;  5IKB A;  1NMU A;  5L9S A;  1UIU A;  4IO5 A;  1N3W A;  5JTY A;  1Y3Q A;  3PUY E;  5ICT A;  1B5J A;  1OIB A;  2A5S A;  4YAH X;  4ZZA A;  2Q88 A;  3PMX A;  3BBR A;  4JSD A;  4OYV A;  1FTO A;  4YIC A;  3M3F A;  4IO2 A;  1URG A;  4WEP A;  4R6K A;  4YB7 A;  4JSO A;  3ILU B;  5CMK A;  3FGS A;  5H8Q A;  2F35 A;  3TZA A;  3UP9 A;  3EQ1 A;  3C36 A;  2REJ A;  3N6U A;  3QYT A;  1SYI A;  1B0L A;  1JQF A;  4QF9 A;  1M5E A;  3TTK A;  4DZ1 A;  1ZLQ A;  2O1M A;  4NF4 A;  2Q2C A;  4Q5T A;  3FV2 A;  4GL8 A;  1A55 A;  2F6P A;  2NUV A;  3VVD A;  1JW5 A;  1B3G A;  2P2A A;  1MDQ A;  4OTE A;  5H8H B;  3T9V A;  1RYO A;  4U23 A;  3IX1 A;  5I2K A;  1OQG A;  2G29 A;  4R9F A;  2R6G E;  4YMA A;  1P1U A;  1EZO A;  3PV0 E;  1B58 A;  4QSC A;  4XTC Q;  1JW4 A;  2DXY A;  4EF2 A;  1UTH B;  3PGF A;  4LVQ A;  2E1S A;  4IGT A;  2DQV A;  3Q28 A;  1II5 A;  5M2V A;  4N07 A;  3VE1 B;  3R7X A;  3S9M C;  2Z22 A;  3HO7 A;  2Q89 A;  3EHU A;  3KSX A;  3HV1 A;  3O6H A;  4KD5 A;  1NNT A;  4PET A;  1H45 A;  4DCY A;  1M5B A;  2RKM A;  1GGG A;  3KGC A;  4ELP A;  1LAG E;  1MS7 A;  3KN8 A;  2ABH A;  2P1S A;  3PUW E;  4G68 C;  4NF8 B;  3VFJ A;  5CC2 A;  1MPB A;  2HEU A;  1GVC A;  4MFI A;  1LFG A;  2NWJ A;  1SI1 A;  1MXW A;  3FVN A;  4H5F A;  4F19 A;  4FAT A;  3LSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...