5B70A

Oxyr2 e204g regulatory domain from vibrio vulnificus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
219
structure length
209
Chain Sequence
GAMMQGQLKLGCIPTIAPFLLCDLVQEINQRFPQLNLLLREDTTTNLLTALRHGELDVLILALPVEIDGMESRVVGQDPFKMVISRHQAGAIKVPIKYDDLPDESVFLLEKGHCLTEHAVSACKLTDKEKINPFSATSLHTLVQMVANGLGTTFIPQMAIDHGLLDNQNLVVIEPPGQQAYRDIGLVWRPSSSRSKTFNQLAEVVSELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The hydrogen peroxide hypersensitivity of OxyR2 in Vibrio vulnificus depends on conformational constraints
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Transcription
molecule keywords LysR family transcriptional regulator
total genus 58
structure length 209
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5b70A01
1LGBC 3BFUA 1RYXA 3H6WA 3I3VA 3PPQA 4FE8A 1B5JA 4ECFA 3TQLA 2XX9A 1VFDA 2REJA 4QSCA 1B5IA 4OQOA 2HQ0A 5DVFA 3E4RA 3SEVA 2F78A 2QS2A 3K6WA 4R72A 5FHOA 2YLNA 3K2DA 4RNSA 4RPOA 3PUVE 5H8HA 2XD2A 3T9XB 5B70A 2OLBA 1R6ZA 2Q89A 2AL5A 2RC8A 3OD7A 4G68C 4GIZA 1JW4A 2AYSA 2RKMA 3FJMA 4JBZA 4R9GA 4UACA 3S2VA 4DE8A 3TCHA 2DE3A 2OK2A 3T9VA 3N94A 3K0VA 1ATGA 3CI8A 4KR5A 3V5AA 4LP2B 1SI0A 1PBPA 3TFLA 4LVQA 1SQYA 2Y7WA 1N7XA 3B6QA 1LLSA 3CG3A 3K6VA 2HZLA 3OELA 4RK2A 4RXLA 1SVXB 2IEEA 5FHMA 1MDP1 3TKDA 2Z8FA 1Z7NE 4GFRA 5H8FB 2QS3A 3MPLA 2ONRA 3QXMA 4AQ4A 5JEIA 3W9WA 2QS4A 1POTA 2LAOA 1ANFA 3KSJA 1FTLA 4G8HA 4X48A 1SW2A 5FTIA 1H43A 3RPWA 3TTKA 5AA2B 5AA4B 3MVWA 3SERA 5KCJA 4NWCA 2UVJA 3KJTA 1NNFA 1N3XA 4YKIA 3IOUA 5F7VA 1LB9A 3B6TA 4GWOA 4IO7A 1EZPA 4F29A 2P0SA 4GRKA 3K01A 3SEUA 4BDOA 4ELQA 1FTMA 2B3BA 2H5YA 3O9PA 1B0HA 1MDQA 5FHNA 3TAJA 2FA7A 5H8FA 1VSOA 2Y7IA 4MFIA 3FVNA 3DLNA 2O84X 4R75A 2OJTA 2Z8DA 5KCJB 1P99A 5CMCA 5AA4A 1P1WA 2XXXA 3R26A 1LBBA 4YB7A 2DWIA 1FQCA 3FGSA 4QFPA 3TCGA 1MH3A 1MS7A 1UTHA 1OLCA 1BTJA 1PBQA 1VFEA 2GFEA 3CG1A 3KFMA 1SI1A 3M3LA 3MQ9A 3O29A 5ELVA 3U92A 1NH7A 3TMGA 4NE4A 3O66A 3WAEA 3PD9A 3CVGA 4BDNA 4GOTA 2RC7A 3IJXB 2NOOA 3LR1A 5A5XB 4GD5A 4TQUQ 5J1DA 2RINA 4HCYA 4LA9A 1MQHA 1LAFE 1JETA 3H7MA 1SBPA 4XKNA 1GTKA 2I49A 4NF4B 5CRYA 4DLDA 3FD3A 1OVTA 3F11A 4I8CA 2B3FA 3KSXA 1PB9A 1FQFA 3EPEA 5EHSA 3FATA 2H4IA 1R1NA 4EXLA 2O1MA 2UXAA 3CIJA 3LSWA 4KYDA 3MP1A 1QUKA 4G8MA 3D4CA 3FJ7A 4WEPA 3E9XA 4YAHX 2H9BA 3K00A 1SYHA 4XXUA 3RTWB 4DDDA 3EQ1A 1MXYA 3C32A 4R2BA 5H8SA 3TYHA 4GXSB 1B9JA 4F1UA 4HCWA 3TTRA 1BKAA 1SYIA 4G77A 4YKKA 2O69A 4N13A 2DE2A 4R6KA 3Q27A 4OMBA 3VLVA 5IAIA 4IY6A 2QMXA 1FTOA 2AL4A 3EHTA 3PPPA 2XX8A 3PPOA 3SESA 3IB1A 3MP8A 2QRYA 5L8DA 1XVXA 2DP8A 2X26A 2GRVA 5H8HB 4YKJA 4UA8A 1S7YA 1Y3PA 4PE5B 4PFTA 3H6VA 1QUJA 2G93A 3SEWA 5I56A 2DSFA 4P11A 1Z7ME 4N6PA 3VVEA 5I2NA 3HPIA 3MC2A 1GV8A 4OZ9A 2DS9A 1B1HA 3C36A 1Q1KA 3I5OA 3MUQA 3MVXA 3N5LA 3PMXA 4QRZA 1I6BA 4O3AA 4F18A 2ZNTA 5BWJA 1JEUA 1O63A 3Q26A 4K3FA 4ELRA 4R9FA 3O2AA 3T96B 3PPNA 4IO2A 1IEJA 3IB2A 2VD2A 4JDFA 2I0CA 1USYH 2PT1A 3CRBA 3FASA 1B3EA 2F7AA 2O68A 3FV1A 3CSGA 2Y7PA 3KN7A 1FQEA 3KOSA 4ND9A 3HHGA 5M2VA 2OWTA 4H67A 3SETA 3U72A 4AB5A 4JB7A 2QJEA 4U4XA 4ISUA 5H8NB 2VD3A 1B32A 3B7DA 2X7QA 4F3SA 4ZEBA 3USDA 3JV9A 3TTNA 3G3HA 1QW0A 4EF1A 2XXUA 3QK6A 4Q5TA 1B46A 1A40A 1M5BA 4G8NA 3VV5A 1S50A 5CMMA 1SW1A 3KG2A 3FVGA 1MY4A 4U4SA 4C0RA 3FXRA 3OSQA 1HSLA 2NXOA 4XKRA 4YU0A 1ZJLA 3MP6A 5H8NA 2ZYMA 3IOVA 2I48A 1P1NA 1UTHB 1NKXA 5CMKA 1MPCA 3A09A 2ZMBA 1MRPA 3RY3A 1JNFA 1D9YA 1BP5A 2O51A 4O3CA 2Y7RA 4OHNA 4FATA 5HM4B 3D4GA 3QYTA 2XXQA 5I84A 1MY1A 3K1PA 1A8FA 3MPKA 3O6GA 1B58A 2ABHA 3C31A 4G4PA 2FNCA 5A5XA 3TELA 3C34A 2PYYA 3O6HA 4IY5A 5I2NB 3MWBA 2I6EA 1VR5A 4L17A 1IITA 1FTKA 1XS5A 3I6VA 5HBCA 4MH5A 1TWYA 1OVBA 4HS7A 1A8EA 1URSA 3KOTA 1AIVA 4BDMA 1D9VA 2PT2A 3FXQA 4ONYA 4X1BA 2ONKE 1MG1A 5JTYB 2GHAA 3MZ9A 3PPRA 4P0GA 5I57B 3UGWA 1GGGA 5BUUA 2OWSA 3QIMA 3TTMA 3G3IA 1JW1A 1OLAA 1QKAA 2PMSA 2PBWA 4LATA 1MPDA 1XT8A 1I69A 2Q2CA 3N26A 1BIYA 4PFYA 5JK4A 1M5DA 3AXFA 1ZMGA 1B2HA 1P1OA 5AA3A 1SDXA 1WODA 1IUDA 2ZNSA 3FV2A 2Z22A 4F3PA 4ZS9A 3PMWA 1Y9UA 5HPQA 1P1UA 5DVIA 1JVYA 2UYEA 4F2OA 1CE2A 1HSEA 2FYIA 1GVCA 4EXKA 1XHYA 2GHBA 2REGA 3V89B 1VE4A 2DQVA 1ZIUA 4BDQA 1EU8A 4GF8A 1DPPA 4GQOA 1RYOA 1SW4A 4TLMB 1LCFA 3ILUB 3RQTA 1LB8A 4PETA 4C1UA 3ZSFA 1LAHE 4FJPA 2XXHA 5ICTA 1H45A 3BKIB 4I62A 4JWXA 4TOZA 5ITPA 5L9SA 3IOTA 1CB6A 4H5GA 1Y1MA 3HCQA 2X7PA 1N7WA 1NH8A 1NNTA 3GBBA 4OESA 4PQJA 2KLFA 5AA1A 1URDA 3N6TA 4M1VA 4R74A 4I1DA 4F2QA 4F31B 4WXJA 4DXUA 3KBRA 3MVZA 4FAJA 2UVGA 1US5A 1YAEA 1B3HA 4G2ZA 1EZOA 1SD3A 1DOTA 4X1DA 4DCXA 3U93A 4KYSA 4OFJA 4U21A 2CMOA 4Z7EA 4KCCA 3S9MC 4JWOA 3DP8A 2ZYNA 1J1NA 1MXZA 5CBSA 1R9QA 4EUOA 1LFIA 2V3TA 1LFHA 3CFZA 1B51A 2V84A 4H1XA 2DWJA 2F7CA 2Q2AA 1MQJA 2HAUA 1NMUA 2ZXTA 2DOJA 2XXRA 5H8QA 3T22A 3EHSA 2DXYA 4ELPA 3M3KA 1TFAA 3MW0A 4RK9A 2ANJA 1TT1A 4RYAA 3SEXA 3N6UA 2HAVA 2I58A 2V3QA 3QUJA 1MXVA 3DELB 1A55A 4PP0A 4QFKA 5CI5A 3QAXA 4ESWA 3PMVA 4OEVA 3SEYA 4FEBA 3RUMA 4ZEIA 4H8JA 4RA1A 4KHZE 1IXGA 3KEIA 4KI0E 4OETA 3TPAA 4F39A 3TEPA 1RKMA 1SW5A 2WKYA 2Z8EA 3A3CA 2DE4A 4G68A 5H8QB 4C1TA 3K6XA 1LAXA 1YPNA 1N3WA 3H6TA 4LUBA 3TUSA 3IB0A 4U2RA 3T9HB 5KDTA 1IXIA 1AL3A 4XIGQ 3V83A 5ISUA 3PUYE 4DXBA 2AIXA 2Z23A 3PU5A 4LQ2A 4LZ7A 3UORA 3A3UA 4Q30B 3FIRA 2XXWA 5JTYA 1D4NA 1I6QA 3EHUA 4ZEKA 4U1OA 3WAFA 3GZGA 5F1QA 2NVUB 5I57A 3U94A 2W7YA 4BDLA 5LOMA 1URGA 2XHDA 1MM6A 4OFOA 2UYFA 3EN3A 4PFUA 1FQDA 1AMFA 3HO7A 5KDTB 3K1NA 3M8UA 4R2FA 4THIA 1PB8A 4QFOA 1EZ9A 4JSDA 4BLAA 1FW0A 2H99A 2DYXA 2ZYKA 2A5TA 2DWHA 5K2XA 1A7LA 1B7UA 2H98A 4KPTA 4NF8A 1WDNA 4ZE9A 2QPQA 4N07A 4DXCA 3Q28A 1GR2A 3FXUA 3OOAA 3VVDA 4U22A 1H44A 1LFGA 3PUZE 3PV0E 4EQ9A 1B3GA 1P1QA 3L6HA 4TLLB 4YICA 5DYHA 3O28A 4OWDA 4QFNA 3RLFE 3U1OA 1Q35A 5DEXA 5IKBA 3T93B 1AH5A 3H06B 2A5TB 2GH9A 1XC1A 1B0LA 2B65A 3R6UA 3UN6A 1AOVA 4NF8B 3KZGA 2XXIA 3C4MA 3M3FA 3G3JA 2QSXA 3FVKA 3RN8A 3DP6A 4OEUA 2O1LA 1MY0A 2RC9A 1ZTYA 3IAZA 4IO6A 3T9UA 1MY3A 3S9LC 2V3UA 3TQWA 3FVOA 4MBPA 3DP4A 4GLIA 1N84A 1Y3QA 4NF6A 4HW8A 2G29A 4WEDA 1OQHA 1PEBA 3GBAA 3UA8A 4H5FA 3HN0A 5I59B 4IB2A 3UIFA 3IK6B 1Y4TA 1US4A 5DVJA 5TU0A 1B6HA 5ITOA 4QFLA 4OTEA 1A54A 2F8DA 2BJJX 2NUVA 2UVHA 3BFTA 1Y3NA 5FTHA 4DCYA 3PD8A 4ZECA 2DXRA 1TFDA 3HHFA 3HSTA 1ZLQA 1ZU0A 2E1SA 2Y84A 2I4BA 4XKQA 3E3KA 3C9HA 4NF5A 2ZYOA 4NF6B 1UQWA 3IJOB 1MXWA 3LBSA 5L9MA 4QSDA 2QS1A 3MZBA 3OEKA 3OXNA 4R6HA 1IIWA 1M5CA 1OMPA 3CR9A 3EF7A 4M4GA 4MLQA 2F36A 3IO4A 3MVYA 3MZ1A 2I4CA 4YKPA 4AB6A 2D3IA 4GL8A 5TPAB 4ELOA 4F3GA 1O7TA 1O64A 3B6WA 1H3DA 3ECRA 3OO9A 3QSLA 4YB6A 1B7HA 1D3KA 4G68B 1A99A 4H6DA 1XVYA 2IA4A 1ZKBA 4NEDA 3BBRA 3TDJA 2ESNA 4EQ7A 4ZEDA 1PDAA 4ZZEA 3JYRA 1MM7A 2F35A 1QULA 2O6AA 2VHAA 1JQFA 2OCUA 3IO6A 3G3FA 3O6IA 4NF5B 1B1XA 5TP9A 1USYE 1OIBA 2DWAA 3G3GA 3RGYA 5AA2D 1XOCA 5CC2A 4QF9A 2F6PA 3OO8A 1KWHA 3Q25A 4NWDA 1LCTA 3GXAA 1B40A 3LUYA 4QSEA 1LAGE 1Y20A 5TPAA 2ONSA 3FZVA 3S4UA 2F97A 4HTGA 4IO4A 1B3FA 4POWA 2ZNUA 1B52A 3LSXA 1B4HA 4JWYA 3S9EA 4POXA 2DVCA 3L6GA 2V93A 4H8IA 2XD3A 5K2YA 1I6AA 1M5FA 4RY1A 3IOWA 4E0WA 2I0BA 1OQGA 4Q0CA 1QVSA 3PUXE 4U1ZA 1ELJA 4OFLA 4OYVA 4YZZA 3OENA 1N0TA 1MH4A 4GVOA 1NL5A 4MLVA 4MF3A 3QUFA 3P7IA 1EH3A 1QKBA 2XXYA 3MBPA 2RCAA 4P0IA 3ODBA 4F3BA 5ICQA 5CBRA 3K02A 4OXVA 5DEXB 1H76A 4KCDA 1UTBB 4QHQA 3W9VA 2NWJA 5I58A 2D21A 2H25A 4X9TA 4LZ8A 4ZE8A 2F34A 1MPBA 2D5WA 2F6GA 2HCAA 3SDFA 3H3GA 4OVJA 2ALUA 1B4ZA 2O7UA 2R9JA 1MY2A 1QUIA 3IR1A 3KGCA 1JW5A 2R6GE 3LSFB 4H65A 3ZKKA 1B5HA 4O3BA 5CMBA 1Y1ZA 1IZ1A 2PX1A 3ZS6A 4OENA 3E13X 1F9BA 1R9LA 2P1SA 5I56B 1M5EA 3C33A 3MAMA 3ZKLA 2YJPA 4IO5A 4FIMA 5I58B 2R71A 1II5A 4FECA 4ZEFA 5AE4A 1BLFA 2DVZA 4EQBA 4ZDMA 5I59A 3HV1A 4RPNA 2Q9TA 3CSBA 3FJGA 4KFQA 3VE1B 1WVJA 4IO3A 1FTJA 4KYEA 3VXBA 1IQ7A 2I3VA 4F19A 4JXIA 3RT8A 4R73A 1YTVA 2CZLA 3CFXA 1DMBA 1FCKA 4GL0A 1NNKA 2QMWA 3V8XB 4FEDA 3PUWE 1B7ZA 3IORA 1LSTA 1DSNA 1POY1 1ZBMA 2PVUA 2UVIA 2VP1A 4RJZA 1DTZA 2A5SA 1JVXA 5DTBA 4YMBA 1FQAA 5AA2A 4YMAA 4ZZAA 3R7XA 1IXCA 1IXHA 2P2AA 1MXUA 4LZ5A 3K6UA 2HXWA 1B3LA 3IL1B 3TZAA 3G7WA 2VOZA 5L9OA 2F5XA 1YCJA 2Q8JA 3VLWA 3ILTB 4F1YA 3ONMA 1NNPA 2XX7A 4DIGA 2HEUA 1MQIA 3TTLA 3OO7A 2XXPA 2M8CA 3C35A 5TP9B 4EDPA 4IGTA 4JSOA 2RF1A 3H4ZA 4H0WA 1UIVA 3KN3A 5DT6A 2OZZA 4LQ5A 4R6YA 3RNNA 4Q8RA 1LBCA 3OSRA 1UIUA 1HSJA 1JEVA 2THIA 3H6UA 4WKMA 3VFJA 3W15C 4E0XA 3CFLA 4FORA 4NF4A 4ESXA 4F22A 3KN8A 1N04A 1T0KA 3FUZA 4LONB 3K4UA 1DTGA 2OBGA 2V25A 3OEMA 3OMBA 4Z0IA 5I2KB 3LC8A 1PC3A 5EHMA 4DZ1A 1Y4CA 1N76A 2F7BA 3H03A 2VGQA 3K1MA 4NMYA 5EYFA 4PFWA 3VDFA 4GXAA 3MJNA 3LSLA 3O97A 3UK4A 3VXCA 3RT6B 4EF2A 2XXTA 2Y7KA 3VLUA 1DPEA 1FQBA 3U8QA 5KZTA 3SKPA 2HZKA 2E0SA 3S9NC 2Q88A 2YPNA 3IX1A 3G3KA 4XKPA 2RCBA 4U23A 5CM6A 3GLBA 1NFTA 3T66A 3VVFA 3KJ7A 3UP9A 4BDRA 1TXFA 2I3WA 5I2KA 3TCFA 4YB5A 3RTFB 1MXXA 1QJMA 4KQPA 4F1VA 3TODA 2QL3A 4XTCQ 3JZJA 3THIA 1PB7A 1UTBA 2O7IA 3Q29A 3DM0A 4IGRA 4OERA 2XXVA 1L5TA 4NTLA 5B7DA 1S9TA 3PGFA 1B05A 1MQGA 2HFBA 3OO6A 4I9DA 4KD5A 1MQDA
chains in the Genus database with same CATH superfamily
1RYXA 4FE8A 3PPQA 4MEVA 1B5IA 2QS2A 3K6WA 5I56A 4RNSA 3PUVE 1R6ZA 3OD7A 2RKMA 2AYSA 4DE8A 3TCHA 2DE3A 4KR5A 3V5AA 1SI0A 4LVQA 4RK2A 5FHMA 3TKDA 3QXMA 3MPLA 4AQ4A 3W9WA 2LAOA 4X48A 1ANFA 5FBPA 3MVWA 1FBDA 1LB9A 1K9YA 4GRKA 2FA7A 4MFIA 2OJTA 2Z8DA 2XXXA 3R26A 4QFPA 1FPEA 1BTJA 2JJKA 4NE4A 3O66A 4BDNA 4GOTA 3LR1A 2FIXA 4LA9A 1GTKA 4P3LA 3F11A 4I8CA 2B3FA 3KSXA 5EHSA 1R1NA 3BIGA 2UXAA 4JVIA 3CIJA 3LSWA 2ZZVA 3K00A 3EQ1A 1MXYA 4R2BA 5H8SA 4YKKA 2DE2A 4R6KA 2AL4A 3SESA 2QRYA 2GRVA 5H8HB 4UA8A 4PFTA 2DSFA 4PC9A 4P11A 1GV8A 3MVXA 4O3AA 2ZNTA 1D9QA 1JEUA 1O63A 4PE3A 3O2AA 4QBAA 1IEJA 3IB2A 5M2VA 4ND9A 2Y7PA 4C1TA 3SETA 3HHGA 2OWTA 4JB7A 5I7IA 1KA0A 3G3HA 1YZ0A 4Q5TA 1B46A 1A40A 5CMMA 1SW1A 4AS4A 3KG2A 3RY3A 2XWIA 1D9YA 1BP5A 2O51A 2Y7RA 5HM4B 3QYTA 1MY1A 3MPKA 3O6GA 3C31A 2PYYA 2I6EA 1VR5A 5HBCA 4BDMA 1D9VA 4ONYA 5JTYB 3MZ9A 4MMPA 1OLAA 2P3VA 1IMDA 1MPDA 5JK4A 1I69A 1BIYA 1IUDA 4GWYA 3EKIA 5DVIA 5IZ3A 1CE2A 2FYIA 1GVCA 4EXKA 4I3EA 4N81A 2DQVA 1NUYA 1LB8A 4C1UA 2XXHA 4TOZA 3RPLB 1Y1MA 5AA1A 2KLFA 4M1VA 2FHYA 4R74A 4WXJA 2UVGA 4G2ZA 4KYSA 2CMOA 4JWOA 2ZYNA 2Y5KA 1R9QA 1LFIA 4OVTA 4MX6A 2V84A 5DW8A 1MQJA 1NMUA 4PTKA 5H8QA 3T22A 2ANJA 3SEXA 3N6UA 2I58A 5CI5A 4ESWA 3SEYA 4ZEIA 4OETA 1YPNA 1N3WA 3T9HB 4XIGQ 3PUYE 4HE2A 4Q30B 2XXWA 1D4NA 4ZEKA 4PBQA 3WAFA 5I57A 2NVUB 5F1QA 2W7YA 4OFOA 4HXVA 3EN3A 4PFUA 4BLAA 1PB8A 2ZYKA 2DWHA 1A7LA 4ZE9A 4NF8A 2QPQA 4PAIA 3FXUA 4U22A 3PV0E 4YICA 3L6HA 3RLFE 3O28A 4OWDA 4QFNA 5IKBA 1AH5A 4P9KA 2GH9A 3UN6A 3FVKA 1FPGA 4IO6A 2V3UA 4GLIA 2G29A 3IK6B 1US4A 5TU0A 5ITOA 4OTEA 1A54A 2F8DA 2NUVA 3BFTA 4ZECA 4N6DA 3HSTA 4P8BA 1ZU0A 4IR8A 4NF5A 2ZYOA 3LBSA 2QS1A 3MZBA 1IIWA 4OVPA 1OMPA 4MLQA 4AB6A 5TPAB 4ELOA 2WYKA 3B6WA 3OO9A 3QSLA 4H6DA 1XVYA 3TDJA 4NEDA 1MM7A 5TP9A 1B1XA 2DWAA 3G3GA 4N6KA 4PGNA 2F6PA 2ONSA 2F97A 2XA5A 5I5PA 2V93A 4P56A 3IOWA 4RY1A 2XWKA 3PUXE 4U1ZA 1ELJA 3OENA 1N0TA 4MLVA 1EH3A 1QKBA 2RCAA 4P0IA 3ODBA 5EQ8A 5CBRA 4X8RA 2NWJA 2D21A 2H25A 1MPBA 4QXDA 2HCAA 1MY2A 1FBHA 3KGCA 4H65A 2R6GE 5EYGA 3ZKKA 1Y1ZA 1IZ1A 3E13X 1M5EA 3MAMA 5I58B 2DVZA 4ZDMA 1EYJA 4KYEA 3VXBA 2VPOA 4JXIA 3RT8A 2CZLA 4O7MA 3V8XB 4FEDA 1B7ZA 1ZBMA 2VP1A 2A5SA 5DTBA 4YMBA 5AA2A 4ZZAA 3R7XA 4PBHA 3D1RA 1B3LA 1YCJA 4DIGA 3OO7A 2M8CA 4H0WA 4LQ5A 1LBCA 1JEVA 2THIA 1FJ6A 4F22A 2R8TA 1FPKA 4LONB 1DTGA 2OBGA 2V25A 3FXBA 3LC8A 1PC3A 5I3SA 2F7BA 5EYFA 3VXCA 3MJNA 3UK4A 2XXTA 1DPEA 2HPGA 4NHBA 4U23A 3T66A 3VVFA 2WYPA 1NV4A 4GBWA 4P1EA 4YB5A 3RTFB 5LDZA 3TODA 1PB7A 3Q29A 3DM0A 4I9DA 1MQDA 1LGBC 3I3VA 1B5JA 3TQLA 4OQOA 2HQ0A 1DK4A 4LN5A 3E4RA 2F78A 4R72A 2YLNA 5B70A 2Q89A 5ITPA 4GIZA 4JBZA 4UACA 3S2VA 3K0VA 1ATGA 1SQYA 3B6QA 2HZLA 1MDP1 4GFRA 2ONRA 2QS4A 1RDZA 5FTIA 3LV0A 2WBDA 3SERA 3KJTA 5F7VA 3B6TA 4IO7A 1EZPA 4F29A 3K01A 1FTMA 2B3BA 4FBPA 1MDQA 5H8FA 2Y7IA 4R75A 1P1WA 4YB7A 5IZZA 1FQCA 3FGSA 1UTHA 1FTAA 1OLCA 1VFEA 3U92A 1SI1A 3O29A 1NH7A 3PD9A 2RC7A 5A5XB 3H7MA 3BIHA 2I49A 5ET5A 3FD3A 4KYDA 4G8MA 3D4CA 3RTWB 1NV6A 2H9BA 1FSAA 3C32A 4F1UA 4GXSB 1B9JA 3TTRA 4MNCA 3Q27A 1FTOA 1LBZA 3EHTA 3IB1A 1Y3PA 3H6VA 1QUJA 1IMAA 1Z7ME 3CHGA 3MC2A 3C36A 3MUQA 3PMXA 1I6BA 4PDDA 1YYZA 4AS5A 2FIEA 4K3FA 4ELRA 1NUXA 4R9FA 3T96B 3PPNA 5H8HA 4YU0A 3CSGA 5H8NB 4F3SA 2XWOA 3TTNA 1QW0A 4EF1A 3FVGA 4XKRA 1ZJLA 2ZYMA 2HHMA 3HFUA 4DI3D 1MPCA 1JNFA 4NGUA 4O3CA 4FATA 3D4GA 5I84A 1KZ8A 3ROJA 5A5XA 3TELA 3O6HA 4L17A 1IITA 3I6VA 1OVBA 1URSA 2PT2A 4X1BA 1MG1A 4P0GA 5IZ3B 3UGWA 1GGGA 5BUUA 3TTMA 4LATA 2Q2CA 1P1OA 1WODA 2ZNSA 4F3PA 4ZS9A 5HPQA 1JVYA 2UYEA 4F2OA 1Q9DA 1VE4A 1SW4A 3ILUB 1QGXA 4GWXA 5EYHA 4JWXA 5L9SA 5EQ7A 3HCQA 2X7PA 1NH8A 3GBBA 4OESA 4FAJA 3KBRA 4X1DA 1NV5A 3U93A 4OFJA 4U21A 4EUOA 1LFHA 2KR0A 3CFZA 2OX3A 4H1XA 2DWJA 2Q2AA 2ZXTA 4PFIA 4ELPA 4GX6A 5ET8A 2HAVA 3B8BA 2V3QA 4GWWA 2Q8MA 1A55A 3QAXA 3RUMA 4RA1A 1SPIA 1IXGA 3KEIA 4KI0E 3TEPA 1RKMA 3A3CA 3IB0A 4U2RA 5F24A 2Z23A 4LQ2A 3PU5A 3UORA 2OWZA 3A3UA 4U1OA 3GZGA 1URGA 2XHDA 4O8MA 2GQ1A 4XFEA 3HO7A 4R2FA 4THIA 1IMBA 1EZ9A 4JSDA 2DYXA 4OA4A 2H98A 4KPTA 5IZ1A 2CEXA 1GR2A 1H44A 1LFGA 4TLLB 5DYHA 3U1OA 5DEXA 4P1LA 1XC1A 4NF8B 1FPBA 3KZGA 3C4MA 2VPNA 2O1LA 3T9UA 3KBZA 3TQWA 3DP4A 4HW8A 4WEDA 1OQHA 3UA8A 3HN0A 5I59B 2UVHA 1Y3NA 3PD8A 1DBZA 3E3KA 4NF6B 5EQAA 5IM2A 3TTLA 4YKPA 2I4CA 2D3IA 1H3DA 4G68B 1A99A 4EQ7A 2IA4A 1ZKBA 4N8GA 2F35A 2O6AA 1QULA 1JQFA 2OCUA 3IO6A 4H46A 1USYE 1XOCA 1KWHA 3Q25A 4NWDA 3GXAA 3LUYA 4PFRA 3FZVA 4IO4A 1B3FA 4JWYA 2DVCA 2XD3A 5K2YA 1LEVA 4I3YA 4OYVA 1MH4A 1AWBA 2P3NA 3QUFA 4MAGA 3MBPA 5DEXB 4QHQA 5I58A 4ZE8A 2F34A 2F6GA 3H3GA 4P47A 2O7UA 1FPJA 3LSFB 3ZS6A 4EDPA 2PX1A 1R9LA 2PCRA 2R71A 1II5A 5AE4A 5I59A 3FJGA 1CNQA 3VE1B 1FPDA 3CFXA 1LSTA 1DSNA 1FQAA 1IXHA 1MXUA 1LBXA 3K6UA 5EQ9A 2HXWA 3TZAA 3G7WA 5L9OA 3ILTB 1NNPA 1IMEA 2XXPA 2ZZXA 4JSOA 3H4ZA 4Q8RA 2WBBA 4NG7A 1UIUA 4E0XA 4PDHA 3SZPA 3VFJA 3K4UA 3OMBA 3IFCA 3O97A 3RT6B 3VLUA 3U8QA 1FQBA 2YPNA 4N17A 2RCBA 3UP9A 2Q74A 1YXIA 4UABA 5I2KA 1QJMA 4KQPA 1FBEA 4XTCQ 4IGRA 4OERA 4NTLA 5B7DA 1S9TA 3PGFA 1B05A 1MQGA 3OO6A 3BFUA 4ECFA 1VFDA 1NUZA 4QSCA 3SEVA 3T9XB 2XD2A 1NI9A 2RC8A 5I2NB 4R9GA 1JW4A 2OK2A 3T9VA 1LBVA 3N94A 3CI8A 3RYDA 1PBPA 3TFLA 1N7XA 1LLSA 3GYYA 2IEEA 2Z8FA 5JEIA 5H8FB 3KSJA 1FTLA 1SW2A 5KCJA 1H43A 2UVJA 4YKIA 3IOUA 4MJOA 4GWOA 4ELQA 2H5YA 4MNPA 1B0HA 4I40A 1VSOA 5J16A 2O84X 5AA4A 3TCGA 4NF4B 3KFMA 3M3LA 3TMGA 3CVGA 1FRPA 3IJXB 2NOOA 4TQUQ 5J1DA 2XWVA 5IGAA 4XKNA 1MQHA 1INPA 4DLDA 1OVTA 2KQZA 1PB9A 2H4IA 4EXLA 2O1MA 3MP1A 1QUKA 4YAHX 3E9XA 4DDDA 4XXUA 1SYHA 3TYHA 4G77A 1SYIA 5IAIA 4OMBA 4IY6A 3PPOA 5T3JA 3MP8A 5L8DA 2X26A 4YKJA 4PE5B 3VVEA 5I2NA 2DS9A 3I5OA 5BWJA 3Q26A 1JP4A 2VD2A 3FV1A 2I0CA 1USYH 2PT1A 3CRBA 1B3EA 3KN7A 3M8UA 3E79A 3RPWA 4EF2A 4F3GA 1FQEA 3KOSA 1AIVA 2QJEA 4U4XA 2V4CA 4ISUA 3B7DA 1B32A 2X7QA 3USDA 4G8NA 3VV5A 1S50A 3T1BA 3FXRA 1HSLA 2NXOA 3MP6A 5H8NA 1P1NA 1NKXA 2XXQA 3K1PA 1A8FA 4G4PA 2FNCA 3MWBA 1XS5A 4MH5A 3FXQA 2ONKE 4MHFA 4NX1A 5I57B 3G3IA 4PFYA 1M5DA 3AXFA 1ZMGA 5AA3A 1SDXA 3FV2A 3PMWA 1FPLA 1HSEA 1XHYA 3V89B 4GF8A 2DDKA 4GQOA 1RYOA 4TLMB 3RQTA 3ZSFA 4FJPA 1H45A 4I62A 1CB6A 4H5GA 1N7WA 1FBPA 4JVDA 1URDA 3N6TA 4F31B 1YAEA 1B3HA 1SD3A 4GX3A 3S9MC 1J1NA 1B51A 1RDYA 2L5VA 2VT5A 2F7CA 1BK4A 1K9ZA 2XXRA 2DXYA 3M3KA 3MW0A 1DCUA 4RK9A 4Z0IA 4OEVA 4KHZE 2DE4A 1LAXA 3TUSA 4LUBA 5KDTA 2XXKA 4DXBA 4LZ7A 5JTYA 4N8YA 1I6QA 3EHUA 1EYKA 4BDLA 1EYIA 1AMFA 3K1NA 4QFOA 1FW0A 3B50A 3MSTA 2ZZWA 1B7UA 1WDNA 4GX4A 4N07A 4DXCA 3Q28A 3OOAA 4PAKA 1FJ9A 3PUZE 4EQ9A 4KXPA 3T93B 3H06B 1IMFA 2A5TB 3A29A 1AOVA 4OEUA 3IAZA 3FVOA 4MCOA 1N84A 1Y3QA 4NF6A 1PEBA 4H5FA 3UIFA 1Y4TA 4QFLA 2BJJX 3T0JA 5FTHA 3HHFA 4GWUA 2I4BA 4N4UA 1UQWA 4QSDA 3OEKA 1M5CA 3IO4A 3MVYA 3MZ1A 4GL8A 1O7TA 1O64A 3ECRA 1B7HA 3MYUA 3BBRA 2CEYA 2ESNA 4ZZEA 3O6IA 3IFAA 1LBWA 3RGYA 5CC2A 1LCTA 1B40A 4QSEA 1B4HA 4GBVA 4POXA 3L6GA 2CZHA 4H8IA 4NF0A 1OQGA 1QVSA 4YZZA 4GVOA 1NL5A 4MF3A 5ICQA 5ET6A 3K02A 2D5WA 3SDFA 4OVJA 1QUIA 4NQ8A 1B5HA 4O3BA 5CMBA 4DCXA 1F9BA 2P1SA 4O94A 3ZKLA 2YJPA 4EQBA 3HV1A 4RPNA 2Q9TA 4KFQA 1WVJA 4OVSA 1IQ7A 2I3VA 4R73A 1YTVA 1NNKA 2QMWA 3PUWE 5LTCA 1POY1 4RJZA 4YMAA 1NV0A 3VLWA 3ONMA 1FBFA 2HEUA 5TP9B 2FVZA 4IGTA 5DT6A 2RF1A 1UIVA 2OZZA 4R6YA 4PF8A 3OSRA 3H6UA 4ESXA 3CFLA 3KN8A 1T0KA 2PFZA 3OEMA 5I2KB 5EHMA 4DZ1A 4XF5A 1N76A 2VGQA 3K1MA 4PFWA 3VDFA 4GXAA 2Y7KA 3SKPA 2HZKA 2E0SA 2Q88A 3G3KA 5CM6A 3GLBA 1NFTA 3KJ7A 4BDRA 1TXFA 3TCFA 4OANA 2QL3A 3THIA 3JZJA 4BDQA 2XXVA 2HFBA 4KD5A 4O7IA 3H6WA 2XX9A 2REJA 2HXRA 5DVFA 5FHOA 3K2DA 4RPOA 1FBGA 2OLBA 2AL5A 4G68C 3FJMA 1G0HA 4LP2B 2Y7WA 3CG3A 4N91A 3K6VA 3OELA 4RXLA 1SVXB 1Z7NE 2QS3A 3LUZA 1POTA 4G8HA 5AA2B 3TTKA 5AA4B 4H45A 4JVCA 4NWCA 1NNFA 4X04A 1N3XA 4XEQA 2P0SA 3SEUA 4BDOA 3O9PA 3TAJA 2F3DA 5FHNA 3U65A 3FVNA 3DLNA 5KCJB 1P99A 5CMCA 1LBBA 2DWIA 1MH3A 1MS7A 3CG1A 1PBQA 2GFEA 3MQ9A 5ELVA 3WAEA 1NV1A 4GD5A 2RINA 4HCYA 5CRYA 1LAFE 1JETA 1SBPA 1FQFA 3EPEA 4DI4B 3FATA 4WEPA 3FJ7A 1IMCA 4HCWA 1BKAA 2O69A 4N13A 4OVQA 3VLVA 2F3BA 2QMXA 3PPPA 2XX8A 2QVUA 2WEFA 1XVXA 2DP8A 1S7YA 3SEWA 2G93A 4N6PA 3HPIA 4OZ9A 3N5LA 1B1HA 4QRZA 1Q1KA 1RDXA 4IO2A 4JDFA 3FASA 2F7AA 4F18A 1NV2A 2O68A 4H67A 4AB5A 3U72A 2VD3A 4ZEBA 3JV9A 2XXUA 3QK6A 1M5BA 5A5LA 1MY4A 4U4SA 4C0RA 3OSQA 3IOVA 2I48A 4PFBA 1UTHB 2B4LA 5CMKA 1XI6A 2WX9A 3A09A 2ZMBA 1MRPA 3FBPA 4OHNA 1B58A 2ABHA 3C34A 4IY5A 1FTKA 2MKZA 1TWYA 4HS7A 1A8EA 3KOTA 2Y5LA 4OVRA 3QMFA 2GHAA 4PCDA 3PPRA 2OWSA 1NUWA 3QIMA 4MNIA 1JW1A 1QKAA 2PMSA 2PBWA 1XT8A 3N26A 1B2HA 2Z22A 1Y9UA 1P1UA 5ESYA 2GHBA 2REGA 1VDWA 1ZIUA 1EU8A 1DPPA 1LCFA 2QVRA 4PETA 1LAHE 5ICTA 3BKIB 3IOTA 1NNTA 4PQJA 4F2QA 4I1DA 4DXUA 3MVZA 1EZOA 1US5A 1DOTA 3KC0A 4Z7EA 4KCCA 3DP8A 1MXZA 5CBSA 3E78A 2V3TA 3RPLA 2FBPA 2HAUA 2DOJA 4GWSA 3EHSA 1TFAA 1TT1A 4RYAA 4ZEDA 1LBYA 3QUJA 4QFKA 1MXVA 3DELB 4PP0A 3PMVA 4FEBA 4F1YA 4H8JA 3TPAA 4F39A 1SW5A 2WKYA 2Z8EA 4G68A 5H8QB 3K6XA 3H6TA 5ISUA 3V83A 1IXIA 1AL3A 2AIXA 3PTYA 3FIRA 2CZIA 4PF6A 3U94A 1MM6A 2QFLA 2UYFA 1FQDA 5KDTB 2H99A 2A5TA 5K2XA 4HE1A 4MIJA 3KC1A 4GWZA 3VVDA 1G0IA 1B3GA 1P1QA 3ISPA 1Q35A 2BJIA 1B0LA 2B65A 3R6UA 1KA1A 2XXIA 3M3FA 3G3JA 2QSXA 3RN8A 3DP6A 4NN3A 1MY0A 2RC9A 1ZTYA 1MY3A 3S9LC 4MBPA 3GBAA 4IB2A 5DVJA 1B6HA 4DCYA 2DXRA 1TFDA 1FBCA 1ZLQA 2E1SA 2Y84A 4XKQA 3C9HA 3IJOB 1MXWA 5L9MA 4R6HA 3OXNA 3CR9A 3EF7A 4M4GA 2F36A 1FPFA 4YB6A 1D3KA 1PDAA 3JYRA 2CZKA 4NF5B 2VHAA 3G3FA 1OIBA 5AA2D 4QF9A 3OO8A 5TPAA 1LAGE 1Y20A 3S4UA 4HTGA 4POWA 2ZNUA 1B52A 3LSXA 3S9EA 5ET7A 1I6AA 1M5FA 4E0WA 2I0BA 4Q0CA 4OFLA 2QVVA 3P7IA 3NOHA 2XXYA 4F3BA 4OXVA 1H76A 4KCDA 1UTBB 3W9VA 4G61A 4X9TA 4LZ8A 2ALUA 1B4ZA 2R9JA 3IR1A 1JW5A 4OENA 5I56B 3C33A 4IO5A 4FIMA 4FECA 4ZEFA 1BLFA 3CSBA 4IO3A 1FTJA 4F19A 1DMBA 1FCKA 4GL0A 3IORA 4N15A 2PVUA 2UVIA 1DTZA 1JVXA 4PAFA 1IXCA 4HE0A 2P2AA 4LZ5A 3IL1B 2VOZA 2F5XA 2Q8JA 2XX7A 1MQIA 3C35A 3KN3A 3RNNA 1FPIA 2PFYA 1HSJA 3W15C 4WKMA 4FORA 4NF4A 1N04A 3FUZA 1NV7A 2B4MA 1Y4CA 3H03A 4NMYA 1NV3A 4NAPA 3LSLA 4PGPA 5KZTA 3S9NC 3IX1A 4XKPA 2I3WA 1MXXA 4F1VA 5LOMA 1UTBA 2O7IA 1L5TA
chains in the Genus database with same CATH topology
1LGBC 3BFUA 1RYXA 3H6WA 3I3VA 3PPQA 4FE8A 1B5JA 4ECFA 3TQLA 2XX9A 1VFDA 2REJA 4QSCA 1B5IA 4OQOA 2HQ0A 5DVFA 3E4RA 3SEVA 2F78A 2QS2A 3K6WA 4R72A 5FHOA 2YLNA 3K2DA 4RNSA 4RPOA 3PUVE 5H8HA 2XD2A 3T9XB 5B70A 2OLBA 1R6ZA 2Q89A 2AL5A 2RC8A 3OD7A 4G68C 4GIZA 1JW4A 2AYSA 2RKMA 3FJMA 4JBZA 4R9GA 4UACA 3S2VA 4DE8A 3TCHA 2DE3A 2OK2A 3T9VA 3N94A 3K0VA 1ATGA 3CI8A 4KR5A 3V5AA 4LP2B 1SI0A 1PBPA 3TFLA 4LVQA 1SQYA 2Y7WA 1N7XA 3B6QA 1LLSA 3CG3A 3K6VA 2HZLA 3OELA 4RK2A 4RXLA 1SVXB 2IEEA 5FHMA 1MDP1 3TKDA 2Z8FA 1Z7NE 4GFRA 5H8FB 2QS3A 3MPLA 2ONRA 3QXMA 4AQ4A 5JEIA 3W9WA 2QS4A 1POTA 2LAOA 1ANFA 3KSJA 1FTLA 4G8HA 4X48A 1SW2A 5FTIA 1H43A 3RPWA 3TTKA 5AA2B 5AA4B 3MVWA 3SERA 5KCJA 4NWCA 2UVJA 3KJTA 1NNFA 1N3XA 4YKIA 3IOUA 5F7VA 1LB9A 3B6TA 4GWOA 4IO7A 1EZPA 4F29A 2P0SA 4GRKA 3K01A 3SEUA 4BDOA 4ELQA 1FTMA 2B3BA 2H5YA 3O9PA 1B0HA 1MDQA 5FHNA 3TAJA 2FA7A 5H8FA 1VSOA 2Y7IA 4MFIA 3FVNA 3DLNA 2O84X 4R75A 2OJTA 2Z8DA 5KCJB 1P99A 5CMCA 5AA4A 1P1WA 2XXXA 3R26A 1LBBA 4YB7A 2DWIA 1FQCA 3FGSA 4QFPA 3TCGA 1MH3A 1MS7A 1UTHA 1OLCA 1BTJA 1PBQA 1VFEA 2GFEA 3CG1A 3KFMA 1SI1A 3M3LA 3MQ9A 3O29A 5ELVA 3U92A 1NH7A 3TMGA 4NE4A 3O66A 3WAEA 3PD9A 3CVGA 4BDNA 4GOTA 2RC7A 3IJXB 2NOOA 3LR1A 5A5XB 4GD5A 4TQUQ 5J1DA 2RINA 4HCYA 4LA9A 1MQHA 1LAFE 1JETA 3H7MA 1SBPA 4XKNA 1GTKA 2I49A 4NF4B 5CRYA 4DLDA 3FD3A 1OVTA 3F11A 4I8CA 2B3FA 3KSXA 1PB9A 1FQFA 3EPEA 5EHSA 3FATA 2H4IA 1R1NA 4EXLA 2O1MA 2UXAA 3CIJA 3LSWA 4KYDA 3MP1A 1QUKA 4G8MA 3D4CA 3FJ7A 4WEPA 3E9XA 4YAHX 2H9BA 3K00A 1SYHA 4XXUA 3RTWB 4DDDA 3EQ1A 1MXYA 3C32A 4R2BA 5H8SA 3TYHA 4GXSB 1B9JA 4F1UA 4HCWA 3TTRA 1BKAA 1SYIA 4G77A 4YKKA 2O69A 4N13A 2DE2A 4R6KA 3Q27A 4OMBA 3VLVA 5IAIA 4IY6A 2QMXA 1FTOA 2AL4A 3EHTA 3PPPA 2XX8A 3PPOA 3SESA 3IB1A 3MP8A 2QRYA 5L8DA 1XVXA 2DP8A 2X26A 2GRVA 5H8HB 4YKJA 4UA8A 1S7YA 1Y3PA 4PE5B 4PFTA 3H6VA 1QUJA 2G93A 3SEWA 5I56A 2DSFA 4P11A 1Z7ME 4N6PA 3VVEA 5I2NA 3HPIA 3MC2A 1GV8A 4OZ9A 2DS9A 1B1HA 3C36A 1Q1KA 3I5OA 3MUQA 3MVXA 3N5LA 3PMXA 4QRZA 1I6BA 4O3AA 4F18A 2ZNTA 5BWJA 1JEUA 1O63A 3Q26A 4K3FA 4ELRA 4R9FA 3O2AA 3T96B 3PPNA 4IO2A 1IEJA 3IB2A 2VD2A 4JDFA 2I0CA 1USYH 2PT1A 3CRBA 3FASA 1B3EA 2F7AA 2O68A 3FV1A 3CSGA 2Y7PA 3KN7A 1FQEA 3KOSA 4ND9A 3HHGA 5M2VA 2OWTA 4H67A 3SETA 3U72A 4AB5A 4JB7A 2QJEA 4U4XA 4ISUA 5H8NB 2VD3A 1B32A 3B7DA 2X7QA 4F3SA 4ZEBA 3USDA 3JV9A 3TTNA 3G3HA 1QW0A 4EF1A 2XXUA 3QK6A 4Q5TA 1B46A 1A40A 1M5BA 4G8NA 3VV5A 1S50A 5CMMA 1SW1A 3KG2A 3FVGA 1MY4A 4U4SA 4C0RA 3FXRA 3OSQA 1HSLA 2NXOA 4XKRA 4YU0A 1ZJLA 3MP6A 5H8NA 2ZYMA 3IOVA 2I48A 1P1NA 1UTHB 1NKXA 5CMKA 1MPCA 3A09A 2ZMBA 1MRPA 3RY3A 1JNFA 1D9YA 1BP5A 2O51A 4O3CA 2Y7RA 4OHNA 4FATA 5HM4B 3D4GA 3QYTA 2XXQA 5I84A 1MY1A 3K1PA 1A8FA 3MPKA 3O6GA 1B58A 2ABHA 3C31A 4G4PA 2FNCA 5A5XA 3TELA 3C34A 2PYYA 3O6HA 4IY5A 5I2NB 3MWBA 2I6EA 1VR5A 4L17A 1IITA 1FTKA 1XS5A 3I6VA 5HBCA 4MH5A 1TWYA 1OVBA 4HS7A 1A8EA 1URSA 3KOTA 1AIVA 4BDMA 1D9VA 2PT2A 3FXQA 4ONYA 4X1BA 2ONKE 1MG1A 5JTYB 2GHAA 3MZ9A 3PPRA 4P0GA 5I57B 3UGWA 1GGGA 5BUUA 2OWSA 3QIMA 3TTMA 3G3IA 1JW1A 1OLAA 1QKAA 2PMSA 2PBWA 4LATA 1MPDA 1XT8A 1I69A 2Q2CA 3N26A 1BIYA 4PFYA 5JK4A 1M5DA 3AXFA 1ZMGA 1B2HA 1P1OA 5AA3A 1SDXA 1WODA 1IUDA 2ZNSA 3FV2A 2Z22A 4F3PA 4ZS9A 3PMWA 1Y9UA 5HPQA 1P1UA 5DVIA 1JVYA 2UYEA 4F2OA 1CE2A 1HSEA 2FYIA 1GVCA 4EXKA 1XHYA 2GHBA 2REGA 3V89B 1VE4A 2DQVA 1ZIUA 4BDQA 1EU8A 4GF8A 1DPPA 4GQOA 1RYOA 1SW4A 4TLMB 1LCFA 3ILUB 3RQTA 1LB8A 4PETA 4C1UA 3ZSFA 1LAHE 4FJPA 2XXHA 5ICTA 1H45A 3BKIB 4I62A 4JWXA 4TOZA 5ITPA 5L9SA 3IOTA 1CB6A 4H5GA 1Y1MA 3HCQA 2X7PA 1N7WA 1NH8A 1NNTA 3GBBA 4OESA 4PQJA 2KLFA 5AA1A 1URDA 3N6TA 4M1VA 4R74A 4I1DA 4F2QA 4F31B 4WXJA 4DXUA 3KBRA 3MVZA 4FAJA 2UVGA 1US5A 1YAEA 1B3HA 4G2ZA 1EZOA 1SD3A 1DOTA 4X1DA 4DCXA 3U93A 4KYSA 4OFJA 4U21A 2CMOA 4Z7EA 4KCCA 3S9MC 4JWOA 3DP8A 2ZYNA 1J1NA 1MXZA 5CBSA 1R9QA 4EUOA 1LFIA 2V3TA 1LFHA 3CFZA 1B51A 2V84A 4H1XA 2DWJA 2F7CA 2Q2AA 1MQJA 2HAUA 1NMUA 2ZXTA 2DOJA 2XXRA 5H8QA 3T22A 3EHSA 2DXYA 4ELPA 3M3KA 1TFAA 3MW0A 4RK9A 2ANJA 1TT1A 4RYAA 3SEXA 3N6UA 2HAVA 2I58A 2V3QA 3QUJA 1MXVA 3DELB 1A55A 4PP0A 4QFKA 5CI5A 3QAXA 4ESWA 3PMVA 4OEVA 3SEYA 4FEBA 3RUMA 4ZEIA 4H8JA 4RA1A 4KHZE 1IXGA 3KEIA 4KI0E 4OETA 3TPAA 4F39A 3TEPA 1RKMA 1SW5A 2WKYA 2Z8EA 3A3CA 2DE4A 4G68A 5H8QB 4C1TA 3K6XA 1LAXA 1YPNA 1N3WA 3H6TA 4LUBA 3TUSA 3IB0A 4U2RA 3T9HB 5KDTA 1IXIA 1AL3A 4XIGQ 3V83A 5ISUA 3PUYE 4DXBA 2AIXA 2Z23A 3PU5A 4LQ2A 4LZ7A 3UORA 3A3UA 4Q30B 3FIRA 2XXWA 5JTYA 1D4NA 1I6QA 3EHUA 4ZEKA 4U1OA 3WAFA 3GZGA 5F1QA 2NVUB 5I57A 3U94A 2W7YA 4BDLA 5LOMA 1URGA 2XHDA 1MM6A 4OFOA 2UYFA 3EN3A 4PFUA 1FQDA 1AMFA 3HO7A 5KDTB 3K1NA 3M8UA 4R2FA 4THIA 1PB8A 4QFOA 1EZ9A 4JSDA 4BLAA 1FW0A 2H99A 2DYXA 2ZYKA 2A5TA 2DWHA 5K2XA 1A7LA 1B7UA 2H98A 4KPTA 4NF8A 1WDNA 4ZE9A 2QPQA 4N07A 4DXCA 3Q28A 1GR2A 3FXUA 3OOAA 3VVDA 4U22A 1H44A 1LFGA 3PUZE 3PV0E 4EQ9A 1B3GA 1P1QA 3L6HA 4TLLB 4YICA 5DYHA 3O28A 4OWDA 4QFNA 3RLFE 3U1OA 1Q35A 5DEXA 5IKBA 3T93B 1AH5A 3H06B 2A5TB 2GH9A 1XC1A 1B0LA 2B65A 3R6UA 3UN6A 1AOVA 4NF8B 3KZGA 2XXIA 3C4MA 3M3FA 3G3JA 2QSXA 3FVKA 3RN8A 3DP6A 4OEUA 2O1LA 1MY0A 2RC9A 1ZTYA 3IAZA 4IO6A 3T9UA 1MY3A 3S9LC 2V3UA 3TQWA 3FVOA 4MBPA 3DP4A 4GLIA 1N84A 1Y3QA 4NF6A 4HW8A 2G29A 4WEDA 1OQHA 1PEBA 3GBAA 3UA8A 4H5FA 3HN0A 5I59B 4IB2A 3UIFA 3IK6B 1Y4TA 1US4A 5DVJA 5TU0A 1B6HA 5ITOA 4QFLA 4OTEA 1A54A 2F8DA 2BJJX 2NUVA 2UVHA 3BFTA 1Y3NA 5FTHA 4DCYA 3PD8A 4ZECA 2DXRA 1TFDA 3HHFA 3HSTA 1ZLQA 1ZU0A 2E1SA 2Y84A 2I4BA 4XKQA 3E3KA 3C9HA 4NF5A 2ZYOA 4NF6B 1UQWA 3IJOB 1MXWA 3LBSA 5L9MA 4QSDA 2QS1A 3MZBA 3OEKA 3OXNA 4R6HA 1IIWA 1M5CA 1OMPA 3CR9A 3EF7A 4M4GA 4MLQA 2F36A 3IO4A 3MVYA 3MZ1A 2I4CA 4YKPA 4AB6A 2D3IA 4GL8A 5TPAB 4ELOA 4F3GA 1O7TA 1O64A 3B6WA 1H3DA 3ECRA 3OO9A 3QSLA 4YB6A 1B7HA 1D3KA 4G68B 1A99A 4H6DA 1XVYA 2IA4A 1ZKBA 4NEDA 3BBRA 3TDJA 2ESNA 4EQ7A 4ZEDA 1PDAA 4ZZEA 3JYRA 1MM7A 2F35A 1QULA 2O6AA 2VHAA 1JQFA 2OCUA 3IO6A 3G3FA 3O6IA 4NF5B 1B1XA 5TP9A 1USYE 1OIBA 2DWAA 3G3GA 3RGYA 5AA2D 1XOCA 5CC2A 4QF9A 2F6PA 3OO8A 1KWHA 3Q25A 4NWDA 1LCTA 3GXAA 1B40A 3LUYA 4QSEA 1LAGE 1Y20A 5TPAA 2ONSA 3FZVA 3S4UA 2F97A 4HTGA 4IO4A 1B3FA 4POWA 2ZNUA 1B52A 3LSXA 1B4HA 4JWYA 3S9EA 4POXA 2DVCA 3L6GA 2V93A 4H8IA 2XD3A 5K2YA 1I6AA 1M5FA 4RY1A 3IOWA 4E0WA 2I0BA 1OQGA 4Q0CA 1QVSA 3PUXE 4U1ZA 1ELJA 4OFLA 4OYVA 4YZZA 3OENA 1N0TA 1MH4A 4GVOA 1NL5A 4MLVA 4MF3A 3QUFA 3P7IA 1EH3A 1QKBA 2XXYA 3MBPA 2RCAA 4P0IA 3ODBA 4F3BA 5ICQA 5CBRA 3K02A 4OXVA 5DEXB 1H76A 4KCDA 1UTBB 4QHQA 3W9VA 2NWJA 5I58A 2D21A 2H25A 4X9TA 4LZ8A 4ZE8A 2F34A 1MPBA 2D5WA 2F6GA 2HCAA 3SDFA 3H3GA 4OVJA 2ALUA 1B4ZA 2O7UA 2R9JA 1MY2A 1QUIA 3IR1A 3KGCA 1JW5A 2R6GE 3LSFB 4H65A 3ZKKA 1B5HA 4O3BA 5CMBA 1Y1ZA 1IZ1A 2PX1A 3ZS6A 4OENA 3E13X 1F9BA 1R9LA 2P1SA 5I56B 1M5EA 3C33A 3MAMA 3ZKLA 2YJPA 4IO5A 4FIMA 5I58B 2R71A 1II5A 4FECA 4ZEFA 5AE4A 1BLFA 2DVZA 4EQBA 4ZDMA 5I59A 3HV1A 4RPNA 2Q9TA 3CSBA 3FJGA 4KFQA 3VE1B 1WVJA 4IO3A 1FTJA 4KYEA 3VXBA 1IQ7A 2I3VA 4F19A 4JXIA 3RT8A 4R73A 1YTVA 2CZLA 3CFXA 1DMBA 1FCKA 4GL0A 1NNKA 2QMWA 3V8XB 4FEDA 3PUWE 1B7ZA 3IORA 1LSTA 1DSNA 1POY1 1ZBMA 2PVUA 2UVIA 2VP1A 4RJZA 1DTZA 2A5SA 1JVXA 5DTBA 4YMBA 1FQAA 5AA2A 4YMAA 4ZZAA 3R7XA 1IXCA 1IXHA 2P2AA 1MXUA 4LZ5A 3K6UA 2HXWA 1B3LA 3IL1B 3TZAA 3G7WA 2VOZA 5L9OA 2F5XA 1YCJA 2Q8JA 3VLWA 3ILTB 4F1YA 3ONMA 1NNPA 2XX7A 4DIGA 2HEUA 1MQIA 3TTLA 3OO7A 2XXPA 2M8CA 3C35A 5TP9B 4EDPA 4IGTA 4JSOA 2RF1A 3H4ZA 4H0WA 1UIVA 3KN3A 5DT6A 2OZZA 4LQ5A 4R6YA 3RNNA 4Q8RA 1LBCA 3OSRA 1UIUA 1HSJA 1JEVA 2THIA 3H6UA 4WKMA 3VFJA 3W15C 4E0XA 3CFLA 4FORA 4NF4A 4ESXA 4F22A 3KN8A 1N04A 1T0KA 3FUZA 4LONB 3K4UA 1DTGA 2OBGA 2V25A 3OEMA 3OMBA 4Z0IA 5I2KB 3LC8A 1PC3A 5EHMA 4DZ1A 1Y4CA 1N76A 2F7BA 3H03A 2VGQA 3K1MA 4NMYA 5EYFA 4PFWA 3VDFA 4GXAA 3MJNA 3LSLA 3O97A 3UK4A 3VXCA 3RT6B 4EF2A 2XXTA 2Y7KA 3VLUA 1DPEA 1FQBA 3U8QA 5KZTA 3SKPA 2HZKA 2E0SA 3S9NC 2Q88A 2YPNA 3IX1A 3G3KA 4XKPA 2RCBA 4U23A 5CM6A 3GLBA 1NFTA 3T66A 3VVFA 3KJ7A 3UP9A 4BDRA 1TXFA 2I3WA 5I2KA 3TCFA 4YB5A 3RTFB 1MXXA 1QJMA 4KQPA 4F1VA 3TODA 2QL3A 4XTCQ 3JZJA 3THIA 1PB7A 1UTBA 2O7IA 3Q29A 3DM0A 4IGRA 4OERA 2XXVA 1L5TA 4NTLA 5B7DA 1S9TA 3PGFA 1B05A 1MQGA 2HFBA 3OO6A 4I9DA 4KD5A 1MQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LGB C;  3BFU A;  1RYX A;  3H6W A;  3I3V A;  3PPQ A;  4FE8 A;  1B5J A;  4ECF A;  3TQL A;  2XX9 A;  1VFD A;  2REJ A;  4QSC A;  1B5I A;  4OQO A;  2HQ0 A;  5DVF A;  3E4R A;  3SEV A;  2F78 A;  2QS2 A;  3K6W A;  4R72 A;  5FHO A;  2YLN A;  3K2D A;  4RNS A;  4RPO A;  3PUV E;  5H8H A;  2XD2 A;  3T9X B;  5B70 A;  2OLB A;  1R6Z A;  2Q89 A;  2AL5 A;  2RC8 A;  3OD7 A;  4G68 C;  4GIZ A;  1JW4 A;  2AYS A;  2RKM A;  3FJM A;  4JBZ A;  4R9G A;  4UAC A;  3S2V A;  4DE8 A;  3TCH A;  2DE3 A;  2OK2 A;  3T9V A;  3N94 A;  3K0V A;  1ATG A;  3CI8 A;  4KR5 A;  3V5A A;  4LP2 B;  1SI0 A;  1PBP A;  3TFL A;  4LVQ A;  1SQY A;  2Y7W A;  1N7X A;  3B6Q A;  1LLS A;  3CG3 A;  3K6V A;  2HZL A;  3OEL A;  4RK2 A;  4RXL A;  1SVX B;  2IEE A;  5FHM A;  1MDP 1;  3TKD A;  2Z8F A;  1Z7N E;  4GFR A;  5H8F B;  2QS3 A;  3MPL A;  2ONR A;  3QXM A;  4AQ4 A;  5JEI A;  3W9W A;  2QS4 A;  1POT A;  2LAO A;  1ANF A;  3KSJ A;  1FTL A;  4G8H A;  4X48 A;  1SW2 A;  5FTI A;  1H43 A;  3RPW A;  3TTK A;  5AA2 B;  5AA4 B;  3MVW A;  3SER A;  5KCJ A;  4NWC A;  2UVJ A;  3KJT A;  1NNF A;  1N3X A;  4YKI A;  3IOU A;  5F7V A;  1LB9 A;  3B6T A;  4GWO A;  4IO7 A;  1EZP A;  4F29 A;  2P0S A;  4GRK A;  3K01 A;  3SEU A;  4BDO A;  4ELQ A;  1FTM A;  2B3B A;  2H5Y A;  3O9P A;  1B0H A;  1MDQ A;  5FHN A;  3TAJ A;  2FA7 A;  5H8F A;  1VSO A;  2Y7I A;  4MFI A;  3FVN A;  3DLN A;  2O84 X;  4R75 A;  2OJT A;  2Z8D A;  5KCJ B;  1P99 A;  5CMC A;  5AA4 A;  1P1W A;  2XXX A;  3R26 A;  1LBB A;  4YB7 A;  2DWI A;  1FQC A;  3FGS A;  4QFP A;  3TCG A;  1MH3 A;  1MS7 A;  1UTH A;  1OLC A;  1BTJ A;  1PBQ A;  1VFE A;  2GFE A;  3CG1 A;  3KFM A;  1SI1 A;  3M3L A;  3MQ9 A;  3O29 A;  5ELV A;  3U92 A;  1NH7 A;  3TMG A;  4NE4 A;  3O66 A;  3WAE A;  3PD9 A;  3CVG A;  4BDN A;  4GOT A;  2RC7 A;  3IJX B;  2NOO A;  3LR1 A;  5A5X B;  4GD5 A;  4TQU Q;  5J1D A;  2RIN A;  4HCY A;  4LA9 A;  1MQH A;  1LAF E;  1JET A;  3H7M A;  1SBP A;  4XKN A;  1GTK A;  2I49 A;  4NF4 B;  5CRY A;  4DLD A;  3FD3 A;  1OVT A;  3F11 A;  4I8C A;  2B3F A;  3KSX A;  1PB9 A;  1FQF A;  3EPE A;  5EHS A;  3FAT A;  2H4I A;  1R1N A;  4EXL A;  2O1M A;  2UXA A;  3CIJ A;  3LSW A;  4KYD A;  3MP1 A;  1QUK A;  4G8M A;  3D4C A;  3FJ7 A;  4WEP A;  3E9X A;  4YAH X;  2H9B A;  3K00 A;  1SYH A;  4XXU A;  3RTW B;  4DDD A;  3EQ1 A;  1MXY A;  3C32 A;  4R2B A;  5H8S A;  3TYH A;  4GXS B;  1B9J A;  4F1U A;  4HCW A;  3TTR A;  1BKA A;  1SYI A;  4G77 A;  4YKK A;  2O69 A;  4N13 A;  2DE2 A;  4R6K A;  3Q27 A;  4OMB A;  3VLV A;  5IAI A;  4IY6 A;  2QMX A;  1FTO A;  2AL4 A;  3EHT A;  3PPP A;  2XX8 A;  3PPO A;  3SES A;  3IB1 A;  3MP8 A;  2QRY A;  5L8D A;  1XVX A;  2DP8 A;  2X26 A;  2GRV A;  5H8H B;  4YKJ A;  4UA8 A;  1S7Y A;  1Y3P A;  4PE5 B;  4PFT A;  3H6V A;  1QUJ A;  2G93 A;  3SEW A;  5I56 A;  2DSF A;  4P11 A;  1Z7M E;  4N6P A;  3VVE A;  5I2N A;  3HPI A;  3MC2 A;  1GV8 A;  4OZ9 A;  2DS9 A;  1B1H A;  3C36 A;  1Q1K A;  3I5O A;  3MUQ A;  3MVX A;  3N5L A;  3PMX A;  4QRZ A;  1I6B A;  4O3A A;  4F18 A;  2ZNT A;  5BWJ A;  1JEU A;  1O63 A;  3Q26 A;  4K3F A;  4ELR A;  4R9F A;  3O2A A;  3T96 B;  3PPN A;  4IO2 A;  1IEJ A;  3IB2 A;  2VD2 A;  4JDF A;  2I0C A;  1USY H;  2PT1 A;  3CRB A;  3FAS A;  1B3E A;  2F7A A;  2O68 A;  3FV1 A;  3CSG A;  2Y7P A;  3KN7 A;  1FQE A;  3KOS A;  4ND9 A;  3HHG A;  5M2V A;  2OWT A;  4H67 A;  3SET A;  3U72 A;  4AB5 A;  4JB7 A;  2QJE A;  4U4X A;  4ISU A;  5H8N B;  2VD3 A;  1B32 A;  3B7D A;  2X7Q A;  4F3S A;  4ZEB A;  3USD A;  3JV9 A;  3TTN A;  3G3H A;  1QW0 A;  4EF1 A;  2XXU A;  3QK6 A;  4Q5T A;  1B46 A;  1A40 A;  1M5B A;  4G8N A;  3VV5 A;  1S50 A;  5CMM A;  1SW1 A;  3KG2 A;  3FVG A;  1MY4 A;  4U4S A;  4C0R A;  3FXR A;  3OSQ A;  1HSL A;  2NXO A;  4XKR A;  4YU0 A;  1ZJL A;  3MP6 A;  5H8N A;  2ZYM A;  3IOV A;  2I48 A;  1P1N A;  1UTH B;  1NKX A;  5CMK A;  1MPC A;  3A09 A;  2ZMB A;  1MRP A;  3RY3 A;  1JNF A;  1D9Y A;  1BP5 A;  2O51 A;  4O3C A;  2Y7R A;  4OHN A;  4FAT A;  5HM4 B;  3D4G A;  3QYT A;  2XXQ A;  5I84 A;  1MY1 A;  3K1P A;  1A8F A;  3MPK A;  3O6G A;  1B58 A;  2ABH A;  3C31 A;  4G4P A;  2FNC A;  5A5X A;  3TEL A;  3C34 A;  2PYY A;  3O6H A;  4IY5 A;  5I2N B;  3MWB A;  2I6E A;  1VR5 A;  4L17 A;  1IIT A;  1FTK A;  1XS5 A;  3I6V A;  5HBC A;  4MH5 A;  1TWY A;  1OVB A;  4HS7 A;  1A8E A;  1URS A;  3KOT A;  1AIV A;  4BDM A;  1D9V A;  2PT2 A;  3FXQ A;  4ONY A;  4X1B A;  2ONK E;  1MG1 A;  5JTY B;  2GHA A;  3MZ9 A;  3PPR A;  4P0G A;  5I57 B;  3UGW A;  1GGG A;  5BUU A;  2OWS A;  3QIM A;  3TTM A;  3G3I A;  1JW1 A;  1OLA A;  1QKA A;  2PMS A;  2PBW A;  4LAT A;  1MPD A;  1XT8 A;  1I69 A;  2Q2C A;  3N26 A;  1BIY A;  4PFY A;  5JK4 A;  1M5D A;  3AXF A;  1ZMG A;  1B2H A;  1P1O A;  5AA3 A;  1SDX A;  1WOD A;  1IUD A;  2ZNS A;  3FV2 A;  2Z22 A;  4F3P A;  4ZS9 A;  3PMW A;  1Y9U A;  5HPQ A;  1P1U A;  5DVI A;  1JVY A;  2UYE A;  4F2O A;  1CE2 A;  1HSE A;  2FYI A;  1GVC A;  4EXK A;  1XHY A;  2GHB A;  2REG A;  3V89 B;  1VE4 A;  2DQV A;  1ZIU A;  4BDQ A;  1EU8 A;  4GF8 A;  1DPP A;  4GQO A;  1RYO A;  1SW4 A;  4TLM B;  1LCF A;  3ILU B;  3RQT A;  1LB8 A;  4PET A;  4C1U A;  3ZSF A;  1LAH E;  4FJP A;  2XXH A;  5ICT A;  1H45 A;  3BKI B;  4I62 A;  4JWX A;  4TOZ A;  5ITP A;  5L9S A;  3IOT A;  1CB6 A;  4H5G A;  1Y1M A;  3HCQ A;  2X7P A;  1N7W A;  1NH8 A;  1NNT A;  3GBB A;  4OES A;  4PQJ A;  2KLF A;  5AA1 A;  1URD A;  3N6T A;  4M1V A;  4R74 A;  4I1D A;  4F2Q A;  4F31 B;  4WXJ A;  4DXU A;  3KBR A;  3MVZ A;  4FAJ A;  2UVG A;  1US5 A;  1YAE A;  1B3H A;  4G2Z A;  1EZO A;  1SD3 A;  1DOT A;  4X1D A;  4DCX A;  3U93 A;  4KYS A;  4OFJ A;  4U21 A;  2CMO A;  4Z7E A;  4KCC A;  3S9M C;  4JWO A;  3DP8 A;  2ZYN A;  1J1N A;  1MXZ A;  5CBS A;  1R9Q A;  4EUO A;  1LFI A;  2V3T A;  1LFH A;  3CFZ A;  1B51 A;  2V84 A;  4H1X A;  2DWJ A;  2F7C A;  2Q2A A;  1MQJ A;  2HAU A;  1NMU A;  2ZXT A;  2DOJ A;  2XXR A;  5H8Q A;  3T22 A;  3EHS A;  2DXY A;  4ELP A;  3M3K A;  1TFA A;  3MW0 A;  4RK9 A;  2ANJ A;  1TT1 A;  4RYA A;  3SEX A;  3N6U A;  2HAV A;  2I58 A;  2V3Q A;  3QUJ A;  1MXV A;  3DEL B;  1A55 A;  4PP0 A;  4QFK A;  5CI5 A;  3QAX A;  4ESW A;  3PMV A;  4OEV A;  3SEY A;  4FEB A;  3RUM A;  4ZEI A;  4H8J A;  4RA1 A;  4KHZ E;  1IXG A;  3KEI A;  4KI0 E;  4OET A;  3TPA A;  4F39 A;  3TEP A;  1RKM A;  1SW5 A;  2WKY A;  2Z8E A;  3A3C A;  2DE4 A;  4G68 A;  5H8Q B;  4C1T A;  3K6X A;  1LAX A;  1YPN A;  1N3W A;  3H6T A;  4LUB A;  3TUS A;  3IB0 A;  4U2R A;  3T9H B;  5KDT A;  1IXI A;  1AL3 A;  4XIG Q;  3V83 A;  5ISU A;  3PUY E;  4DXB A;  2AIX A;  2Z23 A;  3PU5 A;  4LQ2 A;  4LZ7 A;  3UOR A;  3A3U A;  4Q30 B;  3FIR A;  2XXW A;  5JTY A;  1D4N A;  1I6Q A;  3EHU A;  4ZEK A;  4U1O A;  3WAF A;  3GZG A;  5F1Q A;  2NVU B;  5I57 A;  3U94 A;  2W7Y A;  4BDL A;  5LOM A;  1URG A;  2XHD A;  1MM6 A;  4OFO A;  2UYF A;  3EN3 A;  4PFU A;  1FQD A;  1AMF A;  3HO7 A;  5KDT B;  3K1N A;  3M8U A;  4R2F A;  4THI A;  1PB8 A;  4QFO A;  1EZ9 A;  4JSD A;  4BLA A;  1FW0 A;  2H99 A;  2DYX A;  2ZYK A;  2A5T A;  2DWH A;  5K2X A;  1A7L A;  1B7U A;  2H98 A;  4KPT A;  4NF8 A;  1WDN A;  4ZE9 A;  2QPQ A;  4N07 A;  4DXC A;  3Q28 A;  1GR2 A;  3FXU A;  3OOA A;  3VVD A;  4U22 A;  1H44 A;  1LFG A;  3PUZ E;  3PV0 E;  4EQ9 A;  1B3G A;  1P1Q A;  3L6H A;  4TLL B;  4YIC A;  5DYH A;  3O28 A;  4OWD A;  4QFN A;  3RLF E;  3U1O A;  1Q35 A;  5DEX A;  5IKB A;  3T93 B;  1AH5 A;  3H06 B;  2A5T B;  2GH9 A;  1XC1 A;  1B0L A;  2B65 A;  3R6U A;  3UN6 A;  1AOV A;  4NF8 B;  3KZG A;  2XXI A;  3C4M A;  3M3F A;  3G3J A;  2QSX A;  3FVK A;  3RN8 A;  3DP6 A;  4OEU A;  2O1L A;  1MY0 A;  2RC9 A;  1ZTY A;  3IAZ A;  4IO6 A;  3T9U A;  1MY3 A;  3S9L C;  2V3U A;  3TQW A;  3FVO A;  4MBP A;  3DP4 A;  4GLI A;  1N84 A;  1Y3Q A;  4NF6 A;  4HW8 A;  2G29 A;  4WED A;  1OQH A;  1PEB A;  3GBA A;  3UA8 A;  4H5F A;  3HN0 A;  5I59 B;  4IB2 A;  3UIF A;  3IK6 B;  1Y4T A;  1US4 A;  5DVJ A;  5TU0 A;  1B6H A;  5ITO A;  4QFL A;  4OTE A;  1A54 A;  2F8D A;  2BJJ X;  2NUV A;  2UVH A;  3BFT A;  1Y3N A;  5FTH A;  4DCY A;  3PD8 A;  4ZEC A;  2DXR A;  1TFD A;  3HHF A;  3HST A;  1ZLQ A;  1ZU0 A;  2E1S A;  2Y84 A;  2I4B A;  4XKQ A;  3E3K A;  3C9H A;  4NF5 A;  2ZYO A;  4NF6 B;  1UQW A;  3IJO B;  1MXW A;  3LBS A;  5L9M A;  4QSD A;  2QS1 A;  3MZB A;  3OEK A;  3OXN A;  4R6H A;  1IIW A;  1M5C A;  1OMP A;  3CR9 A;  3EF7 A;  4M4G A;  4MLQ A;  2F36 A;  3IO4 A;  3MVY A;  3MZ1 A;  2I4C A;  4YKP A;  4AB6 A;  2D3I A;  4GL8 A;  5TPA B;  4ELO A;  4F3G A;  1O7T A;  1O64 A;  3B6W A;  1H3D A;  3ECR A;  3OO9 A;  3QSL A;  4YB6 A;  1B7H A;  1D3K A;  4G68 B;  1A99 A;  4H6D A;  1XVY A;  2IA4 A;  1ZKB A;  4NED A;  3BBR A;  3TDJ A;  2ESN A;  4EQ7 A;  4ZED A;  1PDA A;  4ZZE A;  3JYR A;  1MM7 A;  2F35 A;  1QUL A;  2O6A A;  2VHA A;  1JQF A;  2OCU A;  3IO6 A;  3G3F A;  3O6I A;  4NF5 B;  1B1X A;  5TP9 A;  1USY E;  1OIB A;  2DWA A;  3G3G A;  3RGY A;  5AA2 D;  1XOC A;  5CC2 A;  4QF9 A;  2F6P A;  3OO8 A;  1KWH A;  3Q25 A;  4NWD A;  1LCT A;  3GXA A;  1B40 A;  3LUY A;  4QSE A;  1LAG E;  1Y20 A;  5TPA A;  2ONS A;  3FZV A;  3S4U A;  2F97 A;  4HTG A;  4IO4 A;  1B3F A;  4POW A;  2ZNU A;  1B52 A;  3LSX A;  1B4H A;  4JWY A;  3S9E A;  4POX A;  2DVC A;  3L6G A;  2V93 A;  4H8I A;  2XD3 A;  5K2Y A;  1I6A A;  1M5F A;  4RY1 A;  3IOW A;  4E0W A;  2I0B A;  1OQG A;  4Q0C A;  1QVS A;  3PUX E;  4U1Z A;  1ELJ A;  4OFL A;  4OYV A;  4YZZ A;  3OEN A;  1N0T A;  1MH4 A;  4GVO A;  1NL5 A;  4MLV A;  4MF3 A;  3QUF A;  3P7I A;  1EH3 A;  1QKB A;  2XXY A;  3MBP A;  2RCA A;  4P0I A;  3ODB A;  4F3B A;  5ICQ A;  5CBR A;  3K02 A;  4OXV A;  5DEX B;  1H76 A;  4KCD A;  1UTB B;  4QHQ A;  3W9V A;  2NWJ A;  5I58 A;  2D21 A;  2H25 A;  4X9T A;  4LZ8 A;  4ZE8 A;  2F34 A;  1MPB A;  2D5W A;  2F6G A;  2HCA A;  3SDF A;  3H3G A;  4OVJ A;  2ALU A;  1B4Z A;  2O7U A;  2R9J A;  1MY2 A;  1QUI A;  3IR1 A;  3KGC A;  1JW5 A;  2R6G E;  3LSF B;  4H65 A;  3ZKK A;  1B5H A;  4O3B A;  5CMB A;  1Y1Z A;  1IZ1 A;  2PX1 A;  3ZS6 A;  4OEN A;  3E13 X;  1F9B A;  1R9L A;  2P1S A;  5I56 B;  1M5E A;  3C33 A;  3MAM A;  3ZKL A;  2YJP A;  4IO5 A;  4FIM A;  5I58 B;  2R71 A;  1II5 A;  4FEC A;  4ZEF A;  5AE4 A;  1BLF A;  2DVZ A;  4EQB A;  4ZDM A;  5I59 A;  3HV1 A;  4RPN A;  2Q9T A;  3CSB A;  3FJG A;  4KFQ A;  3VE1 B;  1WVJ A;  4IO3 A;  1FTJ A;  4KYE A;  3VXB A;  1IQ7 A;  2I3V A;  4F19 A;  4JXI A;  3RT8 A;  4R73 A;  1YTV A;  2CZL A;  3CFX A;  1DMB A;  1FCK A;  4GL0 A;  1NNK A;  2QMW A;  3V8X B;  4FED A;  3PUW E;  1B7Z A;  3IOR A;  1LST A;  1DSN A;  1POY 1;  1ZBM A;  2PVU A;  2UVI A;  2VP1 A;  4RJZ A;  1DTZ A;  2A5S A;  1JVX A;  5DTB A;  4YMB A;  1FQA A;  5AA2 A;  4YMA A;  4ZZA A;  3R7X A;  1IXC A;  1IXH A;  2P2A A;  1MXU A;  4LZ5 A;  3K6U A;  2HXW A;  1B3L A;  3IL1 B;  3TZA A;  3G7W A;  2VOZ A;  5L9O A;  2F5X A;  1YCJ A;  2Q8J A;  3VLW A;  3ILT B;  4F1Y A;  3ONM A;  1NNP A;  2XX7 A;  4DIG A;  2HEU A;  1MQI A;  3TTL A;  3OO7 A;  2XXP A;  2M8C A;  3C35 A;  5TP9 B;  4EDP A;  4IGT A;  4JSO A;  2RF1 A;  3H4Z A;  4H0W A;  1UIV A;  3KN3 A;  5DT6 A;  2OZZ A;  4LQ5 A;  4R6Y A;  3RNN A;  4Q8R A;  1LBC A;  3OSR A;  1UIU A;  1HSJ A;  1JEV A;  2THI A;  3H6U A;  4WKM A;  3VFJ A;  3W15 C;  4E0X A;  3CFL A;  4FOR A;  4NF4 A;  4ESX A;  4F22 A;  3KN8 A;  1N04 A;  1T0K A;  3FUZ A;  4LON B;  3K4U A;  1DTG A;  2OBG A;  2V25 A;  3OEM A;  3OMB A;  4Z0I A;  5I2K B;  3LC8 A;  1PC3 A;  5EHM A;  4DZ1 A;  1Y4C A;  1N76 A;  2F7B A;  3H03 A;  2VGQ A;  3K1M A;  4NMY A;  5EYF A;  4PFW A;  3VDF A;  4GXA A;  3MJN A;  3LSL A;  3O97 A;  3UK4 A;  3VXC A;  3RT6 B;  4EF2 A;  2XXT A;  2Y7K A;  3VLU A;  1DPE A;  1FQB A;  3U8Q A;  5KZT A;  3SKP A;  2HZK A;  2E0S A;  3S9N C;  2Q88 A;  2YPN A;  3IX1 A;  3G3K A;  4XKP A;  2RCB A;  4U23 A;  5CM6 A;  3GLB A;  1NFT A;  3T66 A;  3VVF A;  3KJ7 A;  3UP9 A;  4BDR A;  1TXF A;  2I3W A;  5I2K A;  3TCF A;  4YB5 A;  3RTF B;  1MXX A;  1QJM A;  4KQP A;  4F1V A;  3TOD A;  2QL3 A;  4XTC Q;  3JZJ A;  3THI A;  1PB7 A;  1UTB A;  2O7I A;  3Q29 A;  3DM0 A;  4IGR A;  4OER A;  2XXV A;  1L5T A;  4NTL A;  5B7D A;  1S9T A;  3PGF A;  1B05 A;  1MQG A;  2HFB A;  3OO6 A;  4I9D A;  4KD5 A;  1MQD A; 
#chains in the Genus database with same CATH topology
 1RYX A;  4FE8 A;  3PPQ A;  4MEV A;  1B5I A;  2QS2 A;  3K6W A;  5I56 A;  4RNS A;  3PUV E;  1R6Z A;  3OD7 A;  2RKM A;  2AYS A;  4DE8 A;  3TCH A;  2DE3 A;  4KR5 A;  3V5A A;  1SI0 A;  4LVQ A;  4RK2 A;  5FHM A;  3TKD A;  3QXM A;  3MPL A;  4AQ4 A;  3W9W A;  2LAO A;  4X48 A;  1ANF A;  5FBP A;  3MVW A;  1FBD A;  1LB9 A;  1K9Y A;  4GRK A;  2FA7 A;  4MFI A;  2OJT A;  2Z8D A;  2XXX A;  3R26 A;  4QFP A;  1FPE A;  1BTJ A;  2JJK A;  4NE4 A;  3O66 A;  4BDN A;  4GOT A;  3LR1 A;  2FIX A;  4LA9 A;  1GTK A;  4P3L A;  3F11 A;  4I8C A;  2B3F A;  3KSX A;  5EHS A;  1R1N A;  3BIG A;  2UXA A;  4JVI A;  3CIJ A;  3LSW A;  2ZZV A;  3K00 A;  3EQ1 A;  1MXY A;  4R2B A;  5H8S A;  4YKK A;  2DE2 A;  4R6K A;  2AL4 A;  3SES A;  2QRY A;  2GRV A;  5H8H B;  4UA8 A;  4PFT A;  2DSF A;  4PC9 A;  4P11 A;  1GV8 A;  3MVX A;  4O3A A;  2ZNT A;  1D9Q A;  1JEU A;  1O63 A;  4PE3 A;  3O2A A;  4QBA A;  1IEJ A;  3IB2 A;  5M2V A;  4ND9 A;  2Y7P A;  4C1T A;  3SET A;  3HHG A;  2OWT A;  4JB7 A;  5I7I A;  1KA0 A;  3G3H A;  1YZ0 A;  4Q5T A;  1B46 A;  1A40 A;  5CMM A;  1SW1 A;  4AS4 A;  3KG2 A;  3RY3 A;  2XWI A;  1D9Y A;  1BP5 A;  2O51 A;  2Y7R A;  5HM4 B;  3QYT A;  1MY1 A;  3MPK A;  3O6G A;  3C31 A;  2PYY A;  2I6E A;  1VR5 A;  5HBC A;  4BDM A;  1D9V A;  4ONY A;  5JTY B;  3MZ9 A;  4MMP A;  1OLA A;  2P3V A;  1IMD A;  1MPD A;  5JK4 A;  1I69 A;  1BIY A;  1IUD A;  4GWY A;  3EKI A;  5DVI A;  5IZ3 A;  1CE2 A;  2FYI A;  1GVC A;  4EXK A;  4I3E A;  4N81 A;  2DQV A;  1NUY A;  1LB8 A;  4C1U A;  2XXH A;  4TOZ A;  3RPL B;  1Y1M A;  5AA1 A;  2KLF A;  4M1V A;  2FHY A;  4R74 A;  4WXJ A;  2UVG A;  4G2Z A;  4KYS A;  2CMO A;  4JWO A;  2ZYN A;  2Y5K A;  1R9Q A;  1LFI A;  4OVT A;  4MX6 A;  2V84 A;  5DW8 A;  1MQJ A;  1NMU A;  4PTK A;  5H8Q A;  3T22 A;  2ANJ A;  3SEX A;  3N6U A;  2I58 A;  5CI5 A;  4ESW A;  3SEY A;  4ZEI A;  4OET A;  1YPN A;  1N3W A;  3T9H B;  4XIG Q;  3PUY E;  4HE2 A;  4Q30 B;  2XXW A;  1D4N A;  4ZEK A;  4PBQ A;  3WAF A;  5I57 A;  2NVU B;  5F1Q A;  2W7Y A;  4OFO A;  4HXV A;  3EN3 A;  4PFU A;  4BLA A;  1PB8 A;  2ZYK A;  2DWH A;  1A7L A;  4ZE9 A;  4NF8 A;  2QPQ A;  4PAI A;  3FXU A;  4U22 A;  3PV0 E;  4YIC A;  3L6H A;  3RLF E;  3O28 A;  4OWD A;  4QFN A;  5IKB A;  1AH5 A;  4P9K A;  2GH9 A;  3UN6 A;  3FVK A;  1FPG A;  4IO6 A;  2V3U A;  4GLI A;  2G29 A;  3IK6 B;  1US4 A;  5TU0 A;  5ITO A;  4OTE A;  1A54 A;  2F8D A;  2NUV A;  3BFT A;  4ZEC A;  4N6D A;  3HST A;  4P8B A;  1ZU0 A;  4IR8 A;  4NF5 A;  2ZYO A;  3LBS A;  2QS1 A;  3MZB A;  1IIW A;  4OVP A;  1OMP A;  4MLQ A;  4AB6 A;  5TPA B;  4ELO A;  2WYK A;  3B6W A;  3OO9 A;  3QSL A;  4H6D A;  1XVY A;  3TDJ A;  4NED A;  1MM7 A;  5TP9 A;  1B1X A;  2DWA A;  3G3G A;  4N6K A;  4PGN A;  2F6P A;  2ONS A;  2F97 A;  2XA5 A;  5I5P A;  2V93 A;  4P56 A;  3IOW A;  4RY1 A;  2XWK A;  3PUX E;  4U1Z A;  1ELJ A;  3OEN A;  1N0T A;  4MLV A;  1EH3 A;  1QKB A;  2RCA A;  4P0I A;  3ODB A;  5EQ8 A;  5CBR A;  4X8R A;  2NWJ A;  2D21 A;  2H25 A;  1MPB A;  4QXD A;  2HCA A;  1MY2 A;  1FBH A;  3KGC A;  4H65 A;  2R6G E;  5EYG A;  3ZKK A;  1Y1Z A;  1IZ1 A;  3E13 X;  1M5E A;  3MAM A;  5I58 B;  2DVZ A;  4ZDM A;  1EYJ A;  4KYE A;  3VXB A;  2VPO A;  4JXI A;  3RT8 A;  2CZL A;  4O7M A;  3V8X B;  4FED A;  1B7Z A;  1ZBM A;  2VP1 A;  2A5S A;  5DTB A;  4YMB A;  5AA2 A;  4ZZA A;  3R7X A;  4PBH A;  3D1R A;  1B3L A;  1YCJ A;  4DIG A;  3OO7 A;  2M8C A;  4H0W A;  4LQ5 A;  1LBC A;  1JEV A;  2THI A;  1FJ6 A;  4F22 A;  2R8T A;  1FPK A;  4LON B;  1DTG A;  2OBG A;  2V25 A;  3FXB A;  3LC8 A;  1PC3 A;  5I3S A;  2F7B A;  5EYF A;  3VXC A;  3MJN A;  3UK4 A;  2XXT A;  1DPE A;  2HPG A;  4NHB A;  4U23 A;  3T66 A;  3VVF A;  2WYP A;  1NV4 A;  4GBW A;  4P1E A;  4YB5 A;  3RTF B;  5LDZ A;  3TOD A;  1PB7 A;  3Q29 A;  3DM0 A;  4I9D A;  1MQD A;  1LGB C;  3I3V A;  1B5J A;  3TQL A;  4OQO A;  2HQ0 A;  1DK4 A;  4LN5 A;  3E4R A;  2F78 A;  4R72 A;  2YLN A;  5B70 A;  2Q89 A;  5ITP A;  4GIZ A;  4JBZ A;  4UAC A;  3S2V A;  3K0V A;  1ATG A;  1SQY A;  3B6Q A;  2HZL A;  1MDP 1;  4GFR A;  2ONR A;  2QS4 A;  1RDZ A;  5FTI A;  3LV0 A;  2WBD A;  3SER A;  3KJT A;  5F7V A;  3B6T A;  4IO7 A;  1EZP A;  4F29 A;  3K01 A;  1FTM A;  2B3B A;  4FBP A;  1MDQ A;  5H8F A;  2Y7I A;  4R75 A;  1P1W A;  4YB7 A;  5IZZ A;  1FQC A;  3FGS A;  1UTH A;  1FTA A;  1OLC A;  1VFE A;  3U92 A;  1SI1 A;  3O29 A;  1NH7 A;  3PD9 A;  2RC7 A;  5A5X B;  3H7M A;  3BIH A;  2I49 A;  5ET5 A;  3FD3 A;  4KYD A;  4G8M A;  3D4C A;  3RTW B;  1NV6 A;  2H9B A;  1FSA A;  3C32 A;  4F1U A;  4GXS B;  1B9J A;  3TTR A;  4MNC A;  3Q27 A;  1FTO A;  1LBZ A;  3EHT A;  3IB1 A;  1Y3P A;  3H6V A;  1QUJ A;  1IMA A;  1Z7M E;  3CHG A;  3MC2 A;  3C36 A;  3MUQ A;  3PMX A;  1I6B A;  4PDD A;  1YYZ A;  4AS5 A;  2FIE A;  4K3F A;  4ELR A;  1NUX A;  4R9F A;  3T96 B;  3PPN A;  5H8H A;  4YU0 A;  3CSG A;  5H8N B;  4F3S A;  2XWO A;  3TTN A;  1QW0 A;  4EF1 A;  3FVG A;  4XKR A;  1ZJL A;  2ZYM A;  2HHM A;  3HFU A;  4DI3 D;  1MPC A;  1JNF A;  4NGU A;  4O3C A;  4FAT A;  3D4G A;  5I84 A;  1KZ8 A;  3ROJ A;  5A5X A;  3TEL A;  3O6H A;  4L17 A;  1IIT A;  3I6V A;  1OVB A;  1URS A;  2PT2 A;  4X1B A;  1MG1 A;  4P0G A;  5IZ3 B;  3UGW A;  1GGG A;  5BUU A;  3TTM A;  4LAT A;  2Q2C A;  1P1O A;  1WOD A;  2ZNS A;  4F3P A;  4ZS9 A;  5HPQ A;  1JVY A;  2UYE A;  4F2O A;  1Q9D A;  1VE4 A;  1SW4 A;  3ILU B;  1QGX A;  4GWX A;  5EYH A;  4JWX A;  5L9S A;  5EQ7 A;  3HCQ A;  2X7P A;  1NH8 A;  3GBB A;  4OES A;  4FAJ A;  3KBR A;  4X1D A;  1NV5 A;  3U93 A;  4OFJ A;  4U21 A;  4EUO A;  1LFH A;  2KR0 A;  3CFZ A;  2OX3 A;  4H1X A;  2DWJ A;  2Q2A A;  2ZXT A;  4PFI A;  4ELP A;  4GX6 A;  5ET8 A;  2HAV A;  3B8B A;  2V3Q A;  4GWW A;  2Q8M A;  1A55 A;  3QAX A;  3RUM A;  4RA1 A;  1SPI A;  1IXG A;  3KEI A;  4KI0 E;  3TEP A;  1RKM A;  3A3C A;  3IB0 A;  4U2R A;  5F24 A;  2Z23 A;  4LQ2 A;  3PU5 A;  3UOR A;  2OWZ A;  3A3U A;  4U1O A;  3GZG A;  1URG A;  2XHD A;  4O8M A;  2GQ1 A;  4XFE A;  3HO7 A;  4R2F A;  4THI A;  1IMB A;  1EZ9 A;  4JSD A;  2DYX A;  4OA4 A;  2H98 A;  4KPT A;  5IZ1 A;  2CEX A;  1GR2 A;  1H44 A;  1LFG A;  4TLL B;  5DYH A;  3U1O A;  5DEX A;  4P1L A;  1XC1 A;  4NF8 B;  1FPB A;  3KZG A;  3C4M A;  2VPN A;  2O1L A;  3T9U A;  3KBZ A;  3TQW A;  3DP4 A;  4HW8 A;  4WED A;  1OQH A;  3UA8 A;  3HN0 A;  5I59 B;  2UVH A;  1Y3N A;  3PD8 A;  1DBZ A;  3E3K A;  4NF6 B;  5EQA A;  5IM2 A;  3TTL A;  4YKP A;  2I4C A;  2D3I A;  1H3D A;  4G68 B;  1A99 A;  4EQ7 A;  2IA4 A;  1ZKB A;  4N8G A;  2F35 A;  2O6A A;  1QUL A;  1JQF A;  2OCU A;  3IO6 A;  4H46 A;  1USY E;  1XOC A;  1KWH A;  3Q25 A;  4NWD A;  3GXA A;  3LUY A;  4PFR A;  3FZV A;  4IO4 A;  1B3F A;  4JWY A;  2DVC A;  2XD3 A;  5K2Y A;  1LEV A;  4I3Y A;  4OYV A;  1MH4 A;  1AWB A;  2P3N A;  3QUF A;  4MAG A;  3MBP A;  5DEX B;  4QHQ A;  5I58 A;  4ZE8 A;  2F34 A;  2F6G A;  3H3G A;  4P47 A;  2O7U A;  1FPJ A;  3LSF B;  3ZS6 A;  4EDP A;  2PX1 A;  1R9L A;  2PCR A;  2R71 A;  1II5 A;  5AE4 A;  5I59 A;  3FJG A;  1CNQ A;  3VE1 B;  1FPD A;  3CFX A;  1LST A;  1DSN A;  1FQA A;  1IXH A;  1MXU A;  1LBX A;  3K6U A;  5EQ9 A;  2HXW A;  3TZA A;  3G7W A;  5L9O A;  3ILT B;  1NNP A;  1IME A;  2XXP A;  2ZZX A;  4JSO A;  3H4Z A;  4Q8R A;  2WBB A;  4NG7 A;  1UIU A;  4E0X A;  4PDH A;  3SZP A;  3VFJ A;  3K4U A;  3OMB A;  3IFC A;  3O97 A;  3RT6 B;  3VLU A;  3U8Q A;  1FQB A;  2YPN A;  4N17 A;  2RCB A;  3UP9 A;  2Q74 A;  1YXI A;  4UAB A;  5I2K A;  1QJM A;  4KQP A;  1FBE A;  4XTC Q;  4IGR A;  4OER A;  4NTL A;  5B7D A;  1S9T A;  3PGF A;  1B05 A;  1MQG A;  3OO6 A;  3BFU A;  4ECF A;  1VFD A;  1NUZ A;  4QSC A;  3SEV A;  3T9X B;  2XD2 A;  1NI9 A;  2RC8 A;  5I2N B;  4R9G A;  1JW4 A;  2OK2 A;  3T9V A;  1LBV A;  3N94 A;  3CI8 A;  3RYD A;  1PBP A;  3TFL A;  1N7X A;  1LLS A;  3GYY A;  2IEE A;  2Z8F A;  5JEI A;  5H8F B;  3KSJ A;  1FTL A;  1SW2 A;  5KCJ A;  1H43 A;  2UVJ A;  4YKI A;  3IOU A;  4MJO A;  4GWO A;  4ELQ A;  2H5Y A;  4MNP A;  1B0H A;  4I40 A;  1VSO A;  5J16 A;  2O84 X;  5AA4 A;  3TCG A;  4NF4 B;  3KFM A;  3M3L A;  3TMG A;  3CVG A;  1FRP A;  3IJX B;  2NOO A;  4TQU Q;  5J1D A;  2XWV A;  5IGA A;  4XKN A;  1MQH A;  1INP A;  4DLD A;  1OVT A;  2KQZ A;  1PB9 A;  2H4I A;  4EXL A;  2O1M A;  3MP1 A;  1QUK A;  4YAH X;  3E9X A;  4DDD A;  4XXU A;  1SYH A;  3TYH A;  4G77 A;  1SYI A;  5IAI A;  4OMB A;  4IY6 A;  3PPO A;  5T3J A;  3MP8 A;  5L8D A;  2X26 A;  4YKJ A;  4PE5 B;  3VVE A;  5I2N A;  2DS9 A;  3I5O A;  5BWJ A;  3Q26 A;  1JP4 A;  2VD2 A;  3FV1 A;  2I0C A;  1USY H;  2PT1 A;  3CRB A;  1B3E A;  3KN7 A;  3M8U A;  3E79 A;  3RPW A;  4EF2 A;  4F3G A;  1FQE A;  3KOS A;  1AIV A;  2QJE A;  4U4X A;  2V4C A;  4ISU A;  3B7D A;  1B32 A;  2X7Q A;  3USD A;  4G8N A;  3VV5 A;  1S50 A;  3T1B A;  3FXR A;  1HSL A;  2NXO A;  3MP6 A;  5H8N A;  1P1N A;  1NKX A;  2XXQ A;  3K1P A;  1A8F A;  4G4P A;  2FNC A;  3MWB A;  1XS5 A;  4MH5 A;  3FXQ A;  2ONK E;  4MHF A;  4NX1 A;  5I57 B;  3G3I A;  4PFY A;  1M5D A;  3AXF A;  1ZMG A;  5AA3 A;  1SDX A;  3FV2 A;  3PMW A;  1FPL A;  1HSE A;  1XHY A;  3V89 B;  4GF8 A;  2DDK A;  4GQO A;  1RYO A;  4TLM B;  3RQT A;  3ZSF A;  4FJP A;  1H45 A;  4I62 A;  1CB6 A;  4H5G A;  1N7W A;  1FBP A;  4JVD A;  1URD A;  3N6T A;  4F31 B;  1YAE A;  1B3H A;  1SD3 A;  4GX3 A;  3S9M C;  1J1N A;  1B51 A;  1RDY A;  2L5V A;  2VT5 A;  2F7C A;  1BK4 A;  1K9Z A;  2XXR A;  2DXY A;  3M3K A;  3MW0 A;  1DCU A;  4RK9 A;  4Z0I A;  4OEV A;  4KHZ E;  2DE4 A;  1LAX A;  3TUS A;  4LUB A;  5KDT A;  2XXK A;  4DXB A;  4LZ7 A;  5JTY A;  4N8Y A;  1I6Q A;  3EHU A;  1EYK A;  4BDL A;  1EYI A;  1AMF A;  3K1N A;  4QFO A;  1FW0 A;  3B50 A;  3MST A;  2ZZW A;  1B7U A;  1WDN A;  4GX4 A;  4N07 A;  4DXC A;  3Q28 A;  3OOA A;  4PAK A;  1FJ9 A;  3PUZ E;  4EQ9 A;  4KXP A;  3T93 B;  3H06 B;  1IMF A;  2A5T B;  3A29 A;  1AOV A;  4OEU A;  3IAZ A;  3FVO A;  4MCO A;  1N84 A;  1Y3Q A;  4NF6 A;  1PEB A;  4H5F A;  3UIF A;  1Y4T A;  4QFL A;  2BJJ X;  3T0J A;  5FTH A;  3HHF A;  4GWU A;  2I4B A;  4N4U A;  1UQW A;  4QSD A;  3OEK A;  1M5C A;  3IO4 A;  3MVY A;  3MZ1 A;  4GL8 A;  1O7T A;  1O64 A;  3ECR A;  1B7H A;  3MYU A;  3BBR A;  2CEY A;  2ESN A;  4ZZE A;  3O6I A;  3IFA A;  1LBW A;  3RGY A;  5CC2 A;  1LCT A;  1B40 A;  4QSE A;  1B4H A;  4GBV A;  4POX A;  3L6G A;  2CZH A;  4H8I A;  4NF0 A;  1OQG A;  1QVS A;  4YZZ A;  4GVO A;  1NL5 A;  4MF3 A;  5ICQ A;  5ET6 A;  3K02 A;  2D5W A;  3SDF A;  4OVJ A;  1QUI A;  4NQ8 A;  1B5H A;  4O3B A;  5CMB A;  4DCX A;  1F9B A;  2P1S A;  4O94 A;  3ZKL A;  2YJP A;  4EQB A;  3HV1 A;  4RPN A;  2Q9T A;  4KFQ A;  1WVJ A;  4OVS A;  1IQ7 A;  2I3V A;  4R73 A;  1YTV A;  1NNK A;  2QMW A;  3PUW E;  5LTC A;  1POY 1;  4RJZ A;  4YMA A;  1NV0 A;  3VLW A;  3ONM A;  1FBF A;  2HEU A;  5TP9 B;  2FVZ A;  4IGT A;  5DT6 A;  2RF1 A;  1UIV A;  2OZZ A;  4R6Y A;  4PF8 A;  3OSR A;  3H6U A;  4ESX A;  3CFL A;  3KN8 A;  1T0K A;  2PFZ A;  3OEM A;  5I2K B;  5EHM A;  4DZ1 A;  4XF5 A;  1N76 A;  2VGQ A;  3K1M A;  4PFW A;  3VDF A;  4GXA A;  2Y7K A;  3SKP A;  2HZK A;  2E0S A;  2Q88 A;  3G3K A;  5CM6 A;  3GLB A;  1NFT A;  3KJ7 A;  4BDR A;  1TXF A;  3TCF A;  4OAN A;  2QL3 A;  3THI A;  3JZJ A;  4BDQ A;  2XXV A;  2HFB A;  4KD5 A;  4O7I A;  3H6W A;  2XX9 A;  2REJ A;  2HXR A;  5DVF A;  5FHO A;  3K2D A;  4RPO A;  1FBG A;  2OLB A;  2AL5 A;  4G68 C;  3FJM A;  1G0H A;  4LP2 B;  2Y7W A;  3CG3 A;  4N91 A;  3K6V A;  3OEL A;  4RXL A;  1SVX B;  1Z7N E;  2QS3 A;  3LUZ A;  1POT A;  4G8H A;  5AA2 B;  3TTK A;  5AA4 B;  4H45 A;  4JVC A;  4NWC A;  1NNF A;  4X04 A;  1N3X A;  4XEQ A;  2P0S A;  3SEU A;  4BDO A;  3O9P A;  3TAJ A;  2F3D A;  5FHN A;  3U65 A;  3FVN A;  3DLN A;  5KCJ B;  1P99 A;  5CMC A;  1LBB A;  2DWI A;  1MH3 A;  1MS7 A;  3CG1 A;  1PBQ A;  2GFE A;  3MQ9 A;  5ELV A;  3WAE A;  1NV1 A;  4GD5 A;  2RIN A;  4HCY A;  5CRY A;  1LAF E;  1JET A;  1SBP A;  1FQF A;  3EPE A;  4DI4 B;  3FAT A;  4WEP A;  3FJ7 A;  1IMC A;  4HCW A;  1BKA A;  2O69 A;  4N13 A;  4OVQ A;  3VLV A;  2F3B A;  2QMX A;  3PPP A;  2XX8 A;  2QVU A;  2WEF A;  1XVX A;  2DP8 A;  1S7Y A;  3SEW A;  2G93 A;  4N6P A;  3HPI A;  4OZ9 A;  3N5L A;  1B1H A;  4QRZ A;  1Q1K A;  1RDX A;  4IO2 A;  4JDF A;  3FAS A;  2F7A A;  4F18 A;  1NV2 A;  2O68 A;  4H67 A;  4AB5 A;  3U72 A;  2VD3 A;  4ZEB A;  3JV9 A;  2XXU A;  3QK6 A;  1M5B A;  5A5L A;  1MY4 A;  4U4S A;  4C0R A;  3OSQ A;  3IOV A;  2I48 A;  4PFB A;  1UTH B;  2B4L A;  5CMK A;  1XI6 A;  2WX9 A;  3A09 A;  2ZMB A;  1MRP A;  3FBP A;  4OHN A;  1B58 A;  2ABH A;  3C34 A;  4IY5 A;  1FTK A;  2MKZ A;  1TWY A;  4HS7 A;  1A8E A;  3KOT A;  2Y5L A;  4OVR A;  3QMF A;  2GHA A;  4PCD A;  3PPR A;  2OWS A;  1NUW A;  3QIM A;  4MNI A;  1JW1 A;  1QKA A;  2PMS A;  2PBW A;  1XT8 A;  3N26 A;  1B2H A;  2Z22 A;  1Y9U A;  1P1U A;  5ESY A;  2GHB A;  2REG A;  1VDW A;  1ZIU A;  1EU8 A;  1DPP A;  1LCF A;  2QVR A;  4PET A;  1LAH E;  5ICT A;  3BKI B;  3IOT A;  1NNT A;  4PQJ A;  4F2Q A;  4I1D A;  4DXU A;  3MVZ A;  1EZO A;  1US5 A;  1DOT A;  3KC0 A;  4Z7E A;  4KCC A;  3DP8 A;  1MXZ A;  5CBS A;  3E78 A;  2V3T A;  3RPL A;  2FBP A;  2HAU A;  2DOJ A;  4GWS A;  3EHS A;  1TFA A;  1TT1 A;  4RYA A;  4ZED A;  1LBY A;  3QUJ A;  4QFK A;  1MXV A;  3DEL B;  4PP0 A;  3PMV A;  4FEB A;  4F1Y A;  4H8J A;  3TPA A;  4F39 A;  1SW5 A;  2WKY A;  2Z8E A;  4G68 A;  5H8Q B;  3K6X A;  3H6T A;  5ISU A;  3V83 A;  1IXI A;  1AL3 A;  2AIX A;  3PTY A;  3FIR A;  2CZI A;  4PF6 A;  3U94 A;  1MM6 A;  2QFL A;  2UYF A;  1FQD A;  5KDT B;  2H99 A;  2A5T A;  5K2X A;  4HE1 A;  4MIJ A;  3KC1 A;  4GWZ A;  3VVD A;  1G0I A;  1B3G A;  1P1Q A;  3ISP A;  1Q35 A;  2BJI A;  1B0L A;  2B65 A;  3R6U A;  1KA1 A;  2XXI A;  3M3F A;  3G3J A;  2QSX A;  3RN8 A;  3DP6 A;  4NN3 A;  1MY0 A;  2RC9 A;  1ZTY A;  1MY3 A;  3S9L C;  4MBP A;  3GBA A;  4IB2 A;  5DVJ A;  1B6H A;  4DCY A;  2DXR A;  1TFD A;  1FBC A;  1ZLQ A;  2E1S A;  2Y84 A;  4XKQ A;  3C9H A;  3IJO B;  1MXW A;  5L9M A;  4R6H A;  3OXN A;  3CR9 A;  3EF7 A;  4M4G A;  2F36 A;  1FPF A;  4YB6 A;  1D3K A;  1PDA A;  3JYR A;  2CZK A;  4NF5 B;  2VHA A;  3G3F A;  1OIB A;  5AA2 D;  4QF9 A;  3OO8 A;  5TPA A;  1LAG E;  1Y20 A;  3S4U A;  4HTG A;  4POW A;  2ZNU A;  1B52 A;  3LSX A;  3S9E A;  5ET7 A;  1I6A A;  1M5F A;  4E0W A;  2I0B A;  4Q0C A;  4OFL A;  2QVV A;  3P7I A;  3NOH A;  2XXY A;  4F3B A;  4OXV A;  1H76 A;  4KCD A;  1UTB B;  3W9V A;  4G61 A;  4X9T A;  4LZ8 A;  2ALU A;  1B4Z A;  2R9J A;  3IR1 A;  1JW5 A;  4OEN A;  5I56 B;  3C33 A;  4IO5 A;  4FIM A;  4FEC A;  4ZEF A;  1BLF A;  3CSB A;  4IO3 A;  1FTJ A;  4F19 A;  1DMB A;  1FCK A;  4GL0 A;  3IOR A;  4N15 A;  2PVU A;  2UVI A;  1DTZ A;  1JVX A;  4PAF A;  1IXC A;  4HE0 A;  2P2A A;  4LZ5 A;  3IL1 B;  2VOZ A;  2F5X A;  2Q8J A;  2XX7 A;  1MQI A;  3C35 A;  3KN3 A;  3RNN A;  1FPI A;  2PFY A;  1HSJ A;  3W15 C;  4WKM A;  4FOR A;  4NF4 A;  1N04 A;  3FUZ A;  1NV7 A;  2B4M A;  1Y4C A;  3H03 A;  4NMY A;  1NV3 A;  4NAP A;  3LSL A;  4PGP A;  5KZT A;  3S9N C;  3IX1 A;  4XKP A;  2I3W A;  1MXX A;  4F1V A;  5LOM A;  1UTB A;  2O7I A;  1L5T A; 
#chains in the Genus database with same CATH homology
 1LGB C;  3BFU A;  1RYX A;  3H6W A;  3I3V A;  3PPQ A;  4FE8 A;  1B5J A;  4ECF A;  3TQL A;  2XX9 A;  1VFD A;  2REJ A;  4QSC A;  1B5I A;  4OQO A;  2HQ0 A;  5DVF A;  3E4R A;  3SEV A;  2F78 A;  2QS2 A;  3K6W A;  4R72 A;  5FHO A;  2YLN A;  3K2D A;  4RNS A;  4RPO A;  3PUV E;  5H8H A;  2XD2 A;  3T9X B;  5B70 A;  2OLB A;  1R6Z A;  2Q89 A;  2AL5 A;  2RC8 A;  3OD7 A;  4G68 C;  4GIZ A;  1JW4 A;  2AYS A;  2RKM A;  3FJM A;  4JBZ A;  4R9G A;  4UAC A;  3S2V A;  4DE8 A;  3TCH A;  2DE3 A;  2OK2 A;  3T9V A;  3N94 A;  3K0V A;  1ATG A;  3CI8 A;  4KR5 A;  3V5A A;  4LP2 B;  1SI0 A;  1PBP A;  3TFL A;  4LVQ A;  1SQY A;  2Y7W A;  1N7X A;  3B6Q A;  1LLS A;  3CG3 A;  3K6V A;  2HZL A;  3OEL A;  4RK2 A;  4RXL A;  1SVX B;  2IEE A;  5FHM A;  1MDP 1;  3TKD A;  2Z8F A;  1Z7N E;  4GFR A;  5H8F B;  2QS3 A;  3MPL A;  2ONR A;  3QXM A;  4AQ4 A;  5JEI A;  3W9W A;  2QS4 A;  1POT A;  2LAO A;  1ANF A;  3KSJ A;  1FTL A;  4G8H A;  4X48 A;  1SW2 A;  5FTI A;  1H43 A;  3RPW A;  3TTK A;  5AA2 B;  5AA4 B;  3MVW A;  3SER A;  5KCJ A;  4NWC A;  2UVJ A;  3KJT A;  1NNF A;  1N3X A;  4YKI A;  3IOU A;  5F7V A;  1LB9 A;  3B6T A;  4GWO A;  4IO7 A;  1EZP A;  4F29 A;  2P0S A;  4GRK A;  3K01 A;  3SEU A;  4BDO A;  4ELQ A;  1FTM A;  2B3B A;  2H5Y A;  3O9P A;  1B0H A;  1MDQ A;  5FHN A;  3TAJ A;  2FA7 A;  5H8F A;  1VSO A;  2Y7I A;  4MFI A;  3FVN A;  3DLN A;  2O84 X;  4R75 A;  2OJT A;  2Z8D A;  5KCJ B;  1P99 A;  5CMC A;  5AA4 A;  1P1W A;  2XXX A;  3R26 A;  1LBB A;  4YB7 A;  2DWI A;  1FQC A;  3FGS A;  4QFP A;  3TCG A;  1MH3 A;  1MS7 A;  1UTH A;  1OLC A;  1BTJ A;  1PBQ A;  1VFE A;  2GFE A;  3CG1 A;  3KFM A;  1SI1 A;  3M3L A;  3MQ9 A;  3O29 A;  5ELV A;  3U92 A;  1NH7 A;  3TMG A;  4NE4 A;  3O66 A;  3WAE A;  3PD9 A;  3CVG A;  4BDN A;  4GOT A;  2RC7 A;  3IJX B;  2NOO A;  3LR1 A;  5A5X B;  4GD5 A;  4TQU Q;  5J1D A;  2RIN A;  4HCY A;  4LA9 A;  1MQH A;  1LAF E;  1JET A;  3H7M A;  1SBP A;  4XKN A;  1GTK A;  2I49 A;  4NF4 B;  5CRY A;  4DLD A;  3FD3 A;  1OVT A;  3F11 A;  4I8C A;  2B3F A;  3KSX A;  1PB9 A;  1FQF A;  3EPE A;  5EHS A;  3FAT A;  2H4I A;  1R1N A;  4EXL A;  2O1M A;  2UXA A;  3CIJ A;  3LSW A;  4KYD A;  3MP1 A;  1QUK A;  4G8M A;  3D4C A;  3FJ7 A;  4WEP A;  3E9X A;  4YAH X;  2H9B A;  3K00 A;  1SYH A;  4XXU A;  3RTW B;  4DDD A;  3EQ1 A;  1MXY A;  3C32 A;  4R2B A;  5H8S A;  3TYH A;  4GXS B;  1B9J A;  4F1U A;  4HCW A;  3TTR A;  1BKA A;  1SYI A;  4G77 A;  4YKK A;  2O69 A;  4N13 A;  2DE2 A;  4R6K A;  3Q27 A;  4OMB A;  3VLV A;  5IAI A;  4IY6 A;  2QMX A;  1FTO A;  2AL4 A;  3EHT A;  3PPP A;  2XX8 A;  3PPO A;  3SES A;  3IB1 A;  3MP8 A;  2QRY A;  5L8D A;  1XVX A;  2DP8 A;  2X26 A;  2GRV A;  5H8H B;  4YKJ A;  4UA8 A;  1S7Y A;  1Y3P A;  4PE5 B;  4PFT A;  3H6V A;  1QUJ A;  2G93 A;  3SEW A;  5I56 A;  2DSF A;  4P11 A;  1Z7M E;  4N6P A;  3VVE A;  5I2N A;  3HPI A;  3MC2 A;  1GV8 A;  4OZ9 A;  2DS9 A;  1B1H A;  3C36 A;  1Q1K A;  3I5O A;  3MUQ A;  3MVX A;  3N5L A;  3PMX A;  4QRZ A;  1I6B A;  4O3A A;  4F18 A;  2ZNT A;  5BWJ A;  1JEU A;  1O63 A;  3Q26 A;  4K3F A;  4ELR A;  4R9F A;  3O2A A;  3T96 B;  3PPN A;  4IO2 A;  1IEJ A;  3IB2 A;  2VD2 A;  4JDF A;  2I0C A;  1USY H;  2PT1 A;  3CRB A;  3FAS A;  1B3E A;  2F7A A;  2O68 A;  3FV1 A;  3CSG A;  2Y7P A;  3KN7 A;  1FQE A;  3KOS A;  4ND9 A;  3HHG A;  5M2V A;  2OWT A;  4H67 A;  3SET A;  3U72 A;  4AB5 A;  4JB7 A;  2QJE A;  4U4X A;  4ISU A;  5H8N B;  2VD3 A;  1B32 A;  3B7D A;  2X7Q A;  4F3S A;  4ZEB A;  3USD A;  3JV9 A;  3TTN A;  3G3H A;  1QW0 A;  4EF1 A;  2XXU A;  3QK6 A;  4Q5T A;  1B46 A;  1A40 A;  1M5B A;  4G8N A;  3VV5 A;  1S50 A;  5CMM A;  1SW1 A;  3KG2 A;  3FVG A;  1MY4 A;  4U4S A;  4C0R A;  3FXR A;  3OSQ A;  1HSL A;  2NXO A;  4XKR A;  4YU0 A;  1ZJL A;  3MP6 A;  5H8N A;  2ZYM A;  3IOV A;  2I48 A;  1P1N A;  1UTH B;  1NKX A;  5CMK A;  1MPC A;  3A09 A;  2ZMB A;  1MRP A;  3RY3 A;  1JNF A;  1D9Y A;  1BP5 A;  2O51 A;  4O3C A;  2Y7R A;  4OHN A;  4FAT A;  5HM4 B;  3D4G A;  3QYT A;  2XXQ A;  5I84 A;  1MY1 A;  3K1P A;  1A8F A;  3MPK A;  3O6G A;  1B58 A;  2ABH A;  3C31 A;  4G4P A;  2FNC A;  5A5X A;  3TEL A;  3C34 A;  2PYY A;  3O6H A;  4IY5 A;  5I2N B;  3MWB A;  2I6E A;  1VR5 A;  4L17 A;  1IIT A;  1FTK A;  1XS5 A;  3I6V A;  5HBC A;  4MH5 A;  1TWY A;  1OVB A;  4HS7 A;  1A8E A;  1URS A;  3KOT A;  1AIV A;  4BDM A;  1D9V A;  2PT2 A;  3FXQ A;  4ONY A;  4X1B A;  2ONK E;  1MG1 A;  5JTY B;  2GHA A;  3MZ9 A;  3PPR A;  4P0G A;  5I57 B;  3UGW A;  1GGG A;  5BUU A;  2OWS A;  3QIM A;  3TTM A;  3G3I A;  1JW1 A;  1OLA A;  1QKA A;  2PMS A;  2PBW A;  4LAT A;  1MPD A;  1XT8 A;  1I69 A;  2Q2C A;  3N26 A;  1BIY A;  4PFY A;  5JK4 A;  1M5D A;  3AXF A;  1ZMG A;  1B2H A;  1P1O A;  5AA3 A;  1SDX A;  1WOD A;  1IUD A;  2ZNS A;  3FV2 A;  2Z22 A;  4F3P A;  4ZS9 A;  3PMW A;  1Y9U A;  5HPQ A;  1P1U A;  5DVI A;  1JVY A;  2UYE A;  4F2O A;  1CE2 A;  1HSE A;  2FYI A;  1GVC A;  4EXK A;  1XHY A;  2GHB A;  2REG A;  3V89 B;  1VE4 A;  2DQV A;  1ZIU A;  4BDQ A;  1EU8 A;  4GF8 A;  1DPP A;  4GQO A;  1RYO A;  1SW4 A;  4TLM B;  1LCF A;  3ILU B;  3RQT A;  1LB8 A;  4PET A;  4C1U A;  3ZSF A;  1LAH E;  4FJP A;  2XXH A;  5ICT A;  1H45 A;  3BKI B;  4I62 A;  4JWX A;  4TOZ A;  5ITP A;  5L9S A;  3IOT A;  1CB6 A;  4H5G A;  1Y1M A;  3HCQ A;  2X7P A;  1N7W A;  1NH8 A;  1NNT A;  3GBB A;  4OES A;  4PQJ A;  2KLF A;  5AA1 A;  1URD A;  3N6T A;  4M1V A;  4R74 A;  4I1D A;  4F2Q A;  4F31 B;  4WXJ A;  4DXU A;  3KBR A;  3MVZ A;  4FAJ A;  2UVG A;  1US5 A;  1YAE A;  1B3H A;  4G2Z A;  1EZO A;  1SD3 A;  1DOT A;  4X1D A;  4DCX A;  3U93 A;  4KYS A;  4OFJ A;  4U21 A;  2CMO A;  4Z7E A;  4KCC A;  3S9M C;  4JWO A;  3DP8 A;  2ZYN A;  1J1N A;  1MXZ A;  5CBS A;  1R9Q A;  4EUO A;  1LFI A;  2V3T A;  1LFH A;  3CFZ A;  1B51 A;  2V84 A;  4H1X A;  2DWJ A;  2F7C A;  2Q2A A;  1MQJ A;  2HAU A;  1NMU A;  2ZXT A;  2DOJ A;  2XXR A;  5H8Q A;  3T22 A;  3EHS A;  2DXY A;  4ELP A;  3M3K A;  1TFA A;  3MW0 A;  4RK9 A;  2ANJ A;  1TT1 A;  4RYA A;  3SEX A;  3N6U A;  2HAV A;  2I58 A;  2V3Q A;  3QUJ A;  1MXV A;  3DEL B;  1A55 A;  4PP0 A;  4QFK A;  5CI5 A;  3QAX A;  4ESW A;  3PMV A;  4OEV A;  3SEY A;  4FEB A;  3RUM A;  4ZEI A;  4H8J A;  4RA1 A;  4KHZ E;  1IXG A;  3KEI A;  4KI0 E;  4OET A;  3TPA A;  4F39 A;  3TEP A;  1RKM A;  1SW5 A;  2WKY A;  2Z8E A;  3A3C A;  2DE4 A;  4G68 A;  5H8Q B;  4C1T A;  3K6X A;  1LAX A;  1YPN A;  1N3W A;  3H6T A;  4LUB A;  3TUS A;  3IB0 A;  4U2R A;  3T9H B;  5KDT A;  1IXI A;  1AL3 A;  4XIG Q;  3V83 A;  5ISU A;  3PUY E;  4DXB A;  2AIX A;  2Z23 A;  3PU5 A;  4LQ2 A;  4LZ7 A;  3UOR A;  3A3U A;  4Q30 B;  3FIR A;  2XXW A;  5JTY A;  1D4N A;  1I6Q A;  3EHU A;  4ZEK A;  4U1O A;  3WAF A;  3GZG A;  5F1Q A;  2NVU B;  5I57 A;  3U94 A;  2W7Y A;  4BDL A;  5LOM A;  1URG A;  2XHD A;  1MM6 A;  4OFO A;  2UYF A;  3EN3 A;  4PFU A;  1FQD A;  1AMF A;  3HO7 A;  5KDT B;  3K1N A;  3M8U A;  4R2F A;  4THI A;  1PB8 A;  4QFO A;  1EZ9 A;  4JSD A;  4BLA A;  1FW0 A;  2H99 A;  2DYX A;  2ZYK A;  2A5T A;  2DWH A;  5K2X A;  1A7L A;  1B7U A;  2H98 A;  4KPT A;  4NF8 A;  1WDN A;  4ZE9 A;  2QPQ A;  4N07 A;  4DXC A;  3Q28 A;  1GR2 A;  3FXU A;  3OOA A;  3VVD A;  4U22 A;  1H44 A;  1LFG A;  3PUZ E;  3PV0 E;  4EQ9 A;  1B3G A;  1P1Q A;  3L6H A;  4TLL B;  4YIC A;  5DYH A;  3O28 A;  4OWD A;  4QFN A;  3RLF E;  3U1O A;  1Q35 A;  5DEX A;  5IKB A;  3T93 B;  1AH5 A;  3H06 B;  2A5T B;  2GH9 A;  1XC1 A;  1B0L A;  2B65 A;  3R6U A;  3UN6 A;  1AOV A;  4NF8 B;  3KZG A;  2XXI A;  3C4M A;  3M3F A;  3G3J A;  2QSX A;  3FVK A;  3RN8 A;  3DP6 A;  4OEU A;  2O1L A;  1MY0 A;  2RC9 A;  1ZTY A;  3IAZ A;  4IO6 A;  3T9U A;  1MY3 A;  3S9L C;  2V3U A;  3TQW A;  3FVO A;  4MBP A;  3DP4 A;  4GLI A;  1N84 A;  1Y3Q A;  4NF6 A;  4HW8 A;  2G29 A;  4WED A;  1OQH A;  1PEB A;  3GBA A;  3UA8 A;  4H5F A;  3HN0 A;  5I59 B;  4IB2 A;  3UIF A;  3IK6 B;  1Y4T A;  1US4 A;  5DVJ A;  5TU0 A;  1B6H A;  5ITO A;  4QFL A;  4OTE A;  1A54 A;  2F8D A;  2BJJ X;  2NUV A;  2UVH A;  3BFT A;  1Y3N A;  5FTH A;  4DCY A;  3PD8 A;  4ZEC A;  2DXR A;  1TFD A;  3HHF A;  3HST A;  1ZLQ A;  1ZU0 A;  2E1S A;  2Y84 A;  2I4B A;  4XKQ A;  3E3K A;  3C9H A;  4NF5 A;  2ZYO A;  4NF6 B;  1UQW A;  3IJO B;  1MXW A;  3LBS A;  5L9M A;  4QSD A;  2QS1 A;  3MZB A;  3OEK A;  3OXN A;  4R6H A;  1IIW A;  1M5C A;  1OMP A;  3CR9 A;  3EF7 A;  4M4G A;  4MLQ A;  2F36 A;  3IO4 A;  3MVY A;  3MZ1 A;  2I4C A;  4YKP A;  4AB6 A;  2D3I A;  4GL8 A;  5TPA B;  4ELO A;  4F3G A;  1O7T A;  1O64 A;  3B6W A;  1H3D A;  3ECR A;  3OO9 A;  3QSL A;  4YB6 A;  1B7H A;  1D3K A;  4G68 B;  1A99 A;  4H6D A;  1XVY A;  2IA4 A;  1ZKB A;  4NED A;  3BBR A;  3TDJ A;  2ESN A;  4EQ7 A;  4ZED A;  1PDA A;  4ZZE A;  3JYR A;  1MM7 A;  2F35 A;  1QUL A;  2O6A A;  2VHA A;  1JQF A;  2OCU A;  3IO6 A;  3G3F A;  3O6I A;  4NF5 B;  1B1X A;  5TP9 A;  1USY E;  1OIB A;  2DWA A;  3G3G A;  3RGY A;  5AA2 D;  1XOC A;  5CC2 A;  4QF9 A;  2F6P A;  3OO8 A;  1KWH A;  3Q25 A;  4NWD A;  1LCT A;  3GXA A;  1B40 A;  3LUY A;  4QSE A;  1LAG E;  1Y20 A;  5TPA A;  2ONS A;  3FZV A;  3S4U A;  2F97 A;  4HTG A;  4IO4 A;  1B3F A;  4POW A;  2ZNU A;  1B52 A;  3LSX A;  1B4H A;  4JWY A;  3S9E A;  4POX A;  2DVC A;  3L6G A;  2V93 A;  4H8I A;  2XD3 A;  5K2Y A;  1I6A A;  1M5F A;  4RY1 A;  3IOW A;  4E0W A;  2I0B A;  1OQG A;  4Q0C A;  1QVS A;  3PUX E;  4U1Z A;  1ELJ A;  4OFL A;  4OYV A;  4YZZ A;  3OEN A;  1N0T A;  1MH4 A;  4GVO A;  1NL5 A;  4MLV A;  4MF3 A;  3QUF A;  3P7I A;  1EH3 A;  1QKB A;  2XXY A;  3MBP A;  2RCA A;  4P0I A;  3ODB A;  4F3B A;  5ICQ A;  5CBR A;  3K02 A;  4OXV A;  5DEX B;  1H76 A;  4KCD A;  1UTB B;  4QHQ A;  3W9V A;  2NWJ A;  5I58 A;  2D21 A;  2H25 A;  4X9T A;  4LZ8 A;  4ZE8 A;  2F34 A;  1MPB A;  2D5W A;  2F6G A;  2HCA A;  3SDF A;  3H3G A;  4OVJ A;  2ALU A;  1B4Z A;  2O7U A;  2R9J A;  1MY2 A;  1QUI A;  3IR1 A;  3KGC A;  1JW5 A;  2R6G E;  3LSF B;  4H65 A;  3ZKK A;  1B5H A;  4O3B A;  5CMB A;  1Y1Z A;  1IZ1 A;  2PX1 A;  3ZS6 A;  4OEN A;  3E13 X;  1F9B A;  1R9L A;  2P1S A;  5I56 B;  1M5E A;  3C33 A;  3MAM A;  3ZKL A;  2YJP A;  4IO5 A;  4FIM A;  5I58 B;  2R71 A;  1II5 A;  4FEC A;  4ZEF A;  5AE4 A;  1BLF A;  2DVZ A;  4EQB A;  4ZDM A;  5I59 A;  3HV1 A;  4RPN A;  2Q9T A;  3CSB A;  3FJG A;  4KFQ A;  3VE1 B;  1WVJ A;  4IO3 A;  1FTJ A;  4KYE A;  3VXB A;  1IQ7 A;  2I3V A;  4F19 A;  4JXI A;  3RT8 A;  4R73 A;  1YTV A;  2CZL A;  3CFX A;  1DMB A;  1FCK A;  4GL0 A;  1NNK A;  2QMW A;  3V8X B;  4FED A;  3PUW E;  1B7Z A;  3IOR A;  1LST A;  1DSN A;  1POY 1;  1ZBM A;  2PVU A;  2UVI A;  2VP1 A;  4RJZ A;  1DTZ A;  2A5S A;  1JVX A;  5DTB A;  4YMB A;  1FQA A;  5AA2 A;  4YMA A;  4ZZA A;  3R7X A;  1IXC A;  1IXH A;  2P2A A;  1MXU A;  4LZ5 A;  3K6U A;  2HXW A;  1B3L A;  3IL1 B;  3TZA A;  3G7W A;  2VOZ A;  5L9O A;  2F5X A;  1YCJ A;  2Q8J A;  3VLW A;  3ILT B;  4F1Y A;  3ONM A;  1NNP A;  2XX7 A;  4DIG A;  2HEU A;  1MQI A;  3TTL A;  3OO7 A;  2XXP A;  2M8C A;  3C35 A;  5TP9 B;  4EDP A;  4IGT A;  4JSO A;  2RF1 A;  3H4Z A;  4H0W A;  1UIV A;  3KN3 A;  5DT6 A;  2OZZ A;  4LQ5 A;  4R6Y A;  3RNN A;  4Q8R A;  1LBC A;  3OSR A;  1UIU A;  1HSJ A;  1JEV A;  2THI A;  3H6U A;  4WKM A;  3VFJ A;  3W15 C;  4E0X A;  3CFL A;  4FOR A;  4NF4 A;  4ESX A;  4F22 A;  3KN8 A;  1N04 A;  1T0K A;  3FUZ A;  4LON B;  3K4U A;  1DTG A;  2OBG A;  2V25 A;  3OEM A;  3OMB A;  4Z0I A;  5I2K B;  3LC8 A;  1PC3 A;  5EHM A;  4DZ1 A;  1Y4C A;  1N76 A;  2F7B A;  3H03 A;  2VGQ A;  3K1M A;  4NMY A;  5EYF A;  4PFW A;  3VDF A;  4GXA A;  3MJN A;  3LSL A;  3O97 A;  3UK4 A;  3VXC A;  3RT6 B;  4EF2 A;  2XXT A;  2Y7K A;  3VLU A;  1DPE A;  1FQB A;  3U8Q A;  5KZT A;  3SKP A;  2HZK A;  2E0S A;  3S9N C;  2Q88 A;  2YPN A;  3IX1 A;  3G3K A;  4XKP A;  2RCB A;  4U23 A;  5CM6 A;  3GLB A;  1NFT A;  3T66 A;  3VVF A;  3KJ7 A;  3UP9 A;  4BDR A;  1TXF A;  2I3W A;  5I2K A;  3TCF A;  4YB5 A;  3RTF B;  1MXX A;  1QJM A;  4KQP A;  4F1V A;  3TOD A;  2QL3 A;  4XTC Q;  3JZJ A;  3THI A;  1PB7 A;  1UTB A;  2O7I A;  3Q29 A;  3DM0 A;  4IGR A;  4OER A;  2XXV A;  1L5T A;  4NTL A;  5B7D A;  1S9T A;  3PGF A;  1B05 A;  1MQG A;  2HFB A;  3OO6 A;  4I9D A;  4KD5 A;  1MQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...