5B70A

Oxyr2 e204g regulatory domain from vibrio vulnificus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
219
structure length
209
Chain Sequence
b'GAMMQGQLKLGCIPTIAPFLLCDLVQEINQRFPQLNLLLREDTTTNLLTALRHGELDVLILALPVEIDGMESRVVGQDPFKMVISRHQAGAIKVPIKYDDLPDESVFLLEKGHCLTEHAVSACKLTDKEKINPFSATSLHTLVQMVANGLGTTFIPQMAIDHGLLDNQNLVVIEPPGQQAYRDIGLVWRPSSSRSKTFNQLAEVVSELL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR family transcriptional regulator
molecule tags Transcription
source organism Vibrio vulnificus
publication title The hydrogen peroxide hypersensitivity of OxyR2 in Vibrio vulnificus depends on conformational constraints
pubmed doi rcsb
total genus 58
structure length 209
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5b70A01
1MDP1 3E4RA 3OENA 4QRZA 3HPIA 2DS9A 3H06B 4YZZA 5TPAB 4F3SA 1MG1A 2XX9A 3C36A 1MXXA 3CI8A 4PE5B 2ZMBA 1FQCA 2W7YA 4ZEIA 5IKBA 3SEXA 1B58A 4GVOA 3H6UA 1A40A 3MP8A 1B5HA 5DVFA 3BBRA 4G8HA 3QAXA 5JTYB 1BTJA 1MY3A 2O84X 4JWOA 1VE4A 2I4CA 3DELB 2OLBA 3QYTA 4KYSA 4U1ZA 3TCHA 3TTLA 1EZOA 4HCWA 1VR5A 1ZKBA 4NF6A 3FV2A 5BUUA 2BJJX 3LSXA 4OFJA 5I2KB 5L9SA 3ONMA 4I1DA 2D3IA 2UVGA 3QUFA 3CFLA 2H98A 4I62A 4N13A 2AL4A 1II5A 1OVBA 2F97A 4XXUA 5I59A 2O68A 5B70A 3FGSA 2Y7WA 2F6PA 4BDNA 5F1QA 1I6QA 3TDJA 2Z22A 3OXNA 3MP6A 3W9WA 3KEIA 4LQ2A 3F11A 4YB6A 5ELVA 1UTHB 1B3GA 1I69A 4LUBA 5H8NA 3O29A 4GOTA 1FCKA 4NTLA 1B0HA 4R9FA 3PUYE 2QJEA 3E13X 4WEDA 3T93B 4DDDA 3FJ7A 4EXKA 3EF7A 4POXA 2GHBA 4FEBA 3OMBA 3M3LA 4F19A 1B5IA 4KD5A 4YICA 1ZJLA 5JEIA 1ELJA 5FHOA 2R71A 3KJTA 3FVGA 1FQDA 1N04A 1HSEA 1S7YA 1SW1A 2HCAA 3C33A 3RY3A 4H8IA 1US4A 4R73A 1WODA 2Q88A 4U4XA 3CR9A 1QW0A 4YB7A 3FJMA 3V8XB 5A5XA 5K2XA 5ICTA 3I3VA 4RY1A 2XXUA 1N7WA 3IOUA 4NE4A 3LSFB 1TXFA 1GV8A 1QUIA 3DLNA 4LZ5A 4LP2B 2Q9TA 3KBRA 1M5EA 1H43A 1URDA 5I56A 5J1DA 1SD3A 3N94A 2VP1A 1S50A 3I6VA 1B2HA 1M5DA 4O3BA 5CMCA 2DOJA 3G7WA 3K02A 2VD2A 4R72A 1LAXA 4WEPA 5CRYA 4GWOA 2GRVA 1DMBA 1Z7ME 3OSQA 2ANJA 4PFYA 3TKDA 3UORA 3SEWA 1NNTA 4FAJA 3E9XA 4JBZA 2I49A 1DPEA 1PBPA 2ONKE 1SDXA 2V3TA 2YPNA 1SYHA 2DVZA 3IB1A 1B40A 4IGTA 2OWSA 3L6HA 2NWJA 3K1PA 3IX1A 3KFMA 3ODBA 3VLUA 3ZS6A 3D4CA 2XX8A 4QFNA 4IO3A 5I84A 2FNCA 4R2FA 4OFLA 1FQBA 3RUMA 2HXWA 2O7UA 3D4GA 2H99A 3MP1A 3EHUA 3H6VA 5AE4A 1B1XA 3IR1A 1LAGE 2QS1A 1RYOA 2HZLA 3KN8A 4LATA 4MH5A 1LBCA 3KZGA 3S2VA 5I59B 2DWJA 1MPCA 3B6TA 1US5A 2R6GE 4FEDA 1N76A 4F18A 1B6HA 1FTJA 4GXAA 3O66A 1FW0A 2RCBA 3C9HA 3G3FA 3CVGA 5DT6A 1B9JA 2H25A 4XKNA 3MVWA 2DE2A 3C4MA 1B4HA 1SW5A 5I2NA 2A5TA 4O3CA 4Z0IA 2ZYOA 4OESA 3JV9A 1VFEA 1HSLA 3JYRA 2P1SA 1T0KA 2AIXA 1IXHA 1SVXB 1B4ZA 3VVDA 3A3UA 3RGYA 3HO7A 3K1MA 3BFTA 2D21A 2GFEA 1YTVA 2F34A 4JB7A 4NWDA 3PPNA 1FTOA 3C34A 5H8QB 5TU0A 4MLQA 3W9VA 1POTA 2DQVA 3KGCA 3IJXB 4OQOA 4C0RA 4U22A 2HQ0A 2V3UA 1LB8A 3CSGA 5CMBA 1JEVA 1P1WA 4PFTA 2Y84A 3LR1A 3A09A 1A99A 1KWHA 2A5SA 1B0LA 1EZ9A 2D5WA 2I58A 3EHSA 4G77A 5EHMA 5EYFA 1J1NA 3T96B 2X26A 1QJMA 3U94A 4BDOA 4ZE8A 4IB2A 1A8FA 4FJPA 4OXVA 4DXUA 3CSBA 3PGFA 2QPQA 3MZBA 4F2QA 2M8CA 3TCFA 3PD9A 4TLMB 1S9TA 1VFDA 3FV1A 5ITPA 2I4BA 1IIWA 4IO2A 2F6GA 4PETA 1QVSA 1N0TA 1B7ZA 3O97A 1B1HA 1H44A 1CE2A 1JVYA 2E1SA 2RC8A 2Y7RA 2I0CA 3FXQA 3HHGA 4KPTA 3LBSA 3ZSFA 2FA7A 3MQ9A 3C31A 4JDFA 4RXLA 2ONRA 4JSDA 3V89B 3SEUA 1MXZA 2VGQA 1M5CA 1DTGA 1EZPA 4QSDA 3O2AA 1R6ZA 4NF4B 4C1UA 2UVJA 2THIA 3RLFE 3TFLA 3IL1B 4ZEDA 1UTHA 4IO4A 5AA2B 5AA1A 1PEBA 4XIGQ 5H8SA 4U4SA 3SETA 2LAOA 1Y1MA 3TODA 3RTFB 4BDQA 5K2YA 2NVUB 1H3DA 1PB8A 3MZ1A 3QIMA 4ZEKA 2XXIA 3CG3A 2HEUA 1B3FA 3GBBA 5AA2D 4POWA 3U93A 1URGA 3LC8A 1D3KA 4FORA 4JSOA 4EQ7A 4R6HA 4Z7EA 5CBSA 1BIYA 4O3AA 5ISUA 3H03A 3U8QA 1Z7NE 4UA8A 3CFXA 3P7IA 4NF5A 4PQJA 5TP9A 3T9HB 1MPDA 2H9BA 1B3HA 5BWJA 1XOCA 5CMKA 1XHYA 3OO9A 4OMBA 1OQGA 4KQPA 5FTHA 5IAIA 4DXCA 4GRKA 5KZTA 1O7TA 1USYE 2DE4A 3PPRA 4LVQA 3S9MC 1FTKA 5AA4A 2ZYMA 4YKIA 5KCJB 5B7DA 3AXFA 2QMXA 4IY6A 1JW5A 2H4IA 3IOWA 3TELA 1OVTA 3FXUA 4XKQA 2QRYA 3G3HA 3KSXA 4GL8A 3SERA 1PB7A 3KN7A 5H8QA 5ICQA 4NWCA 3WAFA 2ZNSA 5AA2A 3G3JA 2ALUA 3O28A 4R9GA 4XTCQ 2QMWA 3FVOA 2WKYA 4F39A 4GD5A 3K1NA 1B3LA 1LAFE 4OEUA 4RK9A 4WKMA 3MPLA 1MQDA 5EHSA 3THIA 1QKAA 1JVXA 4G68C 4BDMA 4EQ9A 1Y3QA 4ZEBA 3MJNA 3MWBA 4BLAA 1MRPA 2QSXA 1GR2A 2Y7KA 4OVJA 4ZDMA 4YMAA 3LSLA 2I6EA 2QS3A 3EPEA 4KHZE 1MS7A 4G4PA 4LZ7A 1P1QA 2FYIA 3K00A 2XD3A 3PUZE 1LFGA 1IEJA 4FECA 4HS7A 4ZEFA 2OK2A 5I58A 4LZ8A 2XXPA 3PV0E 1D9YA 4IY5A 2DXRA 2UVIA 2I3WA 1LSTA 4U23A 4DE8A 3GXAA 3PMVA 3PPOA 4DZ1A 2B3BA 4GLIA 1NKXA 4EXLA 1AIVA 4H1XA 1MM6A 4I9DA 2XXTA 3FVKA 3IAZA 3KSJA 4JXIA 3N6UA 4KFQA 5FHMA 4X1DA 1B51A 4ZZEA 3TYHA 3U1OA 1LFIA 3ECRA 5ITOA 2F36A 2DP8A 1FQFA 3CIJA 2AL5A 2CZLA 4OTEA 4MLVA 1Y4TA 5I2NB 4R75A 4X1BA 1Y3NA 3PUXE 4Q0CA 2ZNUA 2G29A 3G3IA 2F7CA 4E0XA 1B3EA 2B65A 4M1VA 1D9VA 1ZMGA 4GQOA 2RF1A 4L17A 4RK2A 1L5TA 3TZAA 1IXCA 3G3GA 4OENA 1FQEA 2HFBA 3MW0A 5KDTB 1MH3A 1PBQA 2F7BA 4QFOA 3KOTA 3H4ZA 3Q27A 3SEVA 1AH5A 2X7PA 4RNSA 3Q29A 4QSCA 4FATA 5I57A 2VD3A 2QL3A 3HCQA 3VVFA 3MVXA 3VXBA 4R2BA 1D4NA 1B32A 1DPPA 3GZGA 5L9OA 4RPNA 3FASA 3HV1A 5I58B 1A8EA 2NOOA 3DP4A 3G3KA 2DWAA 3ZKLA 2F35A 1P1NA 1BLFA 3OELA 4XKPA 1N3WA 3O6IA 1PDAA 2V3QA 3CG1A 3EHTA 4YAHX 1IXGA 1A7LA 3K6UA 3VLWA 4BDRA 4H5FA 5LOMA 2DVCA 3IJOB 4MBPA 4E0WA 1JNFA 3T9XB 4X9TA 1AMFA 3V5AA 4H67A 4OYVA 1SBPA 4Q8RA 4GF8A 5JK4A 4F1VA 3N6TA 5CBRA 1MY1A 4OZ9A 2Q2AA 3IB2A 3SEYA 1LCTA 1N7XA 1Y1ZA 3MUQA 2CMOA 1MQHA 1YAEA 4PP0A 4EDPA 2PT2A 1POY1 2B3FA 3R6UA 4PFWA 3W15C 3BKIB 1R9LA 4MF3A 5H8FA 1NH7A 3QSLA 3FIRA 1QUJA 3CFZA 4LA9A 2Z8DA 4ZZAA 1AOVA 2Z8EA 2O69A 3OO8A 3S9EA 4ESWA 3B6WA 3MVYA 3PUWE 3FZVA 5FHNA 4ECFA 5A5XB 4IO5A 3KOSA 1MY4A 2F8DA 4RYAA 4NF6B 1Q1KA 2XXRA 2DWIA 1EU8A 1JW1A 2HAUA 3CRBA 1NL5A 4NF5B 1CB6A 2GH9A 2Y7IA 4QFPA 5DVJA 1TFDA 4ELRA 1IITA 3O6HA 3MPKA 3TPAA 4EUOA 3SDFA 3TAJA 4HCYA 4IGRA 3K0VA 3TQWA 4AQ4A 4YMBA 2OWTA 3KG2A 1ATGA 4I8CA 3GLBA 1QUKA 1F9BA 3TCGA 1XVXA 4RJZA 5HPQA 1MDQA 3LUYA 2IEEA 5DTBA 4H6DA 1USYH 4IO7A 4ISUA 5F7VA 2Q89A 5L9MA 4F3BA 5KCJA 1N3XA 1VSOA 2DWHA 3K6WA 3VVEA 1QULA 3TMGA 4KI0E 1P99A 2KLFA 3IOVA 3ILUB 1BP5A 1OIBA 2RC7A 3LSWA 2XXVA 1UIVA 3PPPA 2G93A 4NF8A 2XHDA 3IO4A 4G8NA 3T9UA 1PC3A 3RT6B 3TQLA 3PPQA 4QF9A 3OSRA 3VXCA 5TP9B 3MBPA 1GGGA 3O6GA 4G2ZA 5DYHA 4KCDA 1MPBA 4F3GA 1MQJA 2RC9A 4R6YA 2ABHA 2ZNTA 1UQWA 3OEKA 5CI5A 2Q2CA 3S9LC 2F5XA 1LB9A 2GHAA 5HM4B 3RQTA 3VDFA 4ELOA 1RYXA 3IB0A 3U72A 3UK4A 1IQ7A 4F3PA 4ZS9A 3PMXA 1MY0A 2X7QA 4M4GA 1Q35A 3TTMA 1SI1A 1UIUA 5TPAA 3K4UA 1NNFA 2HZKA 2OCUA 2RINA 3TTRA 3VLVA 2DXYA 3L6GA 3PMWA 2O7IA 4DCYA 3S9NC 1NNKA 4ZE9A 4QFLA 3H6TA 2I48A 4N07A 1P1UA 3ILTB 1H76A 2HAVA 1TFAA 3H6WA 1MXUA 3S4UA 3SESA 4YKPA 2XXQA 4AB6A 3PU5A 4H5GA 4C1TA 1JEUA 5CMMA 1QKBA 4RPOA 3VV5A 4TLLB 4P11A 3HN0A 4TQUQ 5DEXB 4F2OA 4QFKA 4GFRA 1YPNA 2QS2A 4P0IA 2XXXA 2XXHA 3BFUA 1DTZA 3KJ7A 2OZZA 4IO6A 1MXVA 4LQ5A 4U2RA 4ZECA 3EQ1A 4HTGA 3USDA 2P2AA 2Z23A 1WVJA 5CC2A 1LFHA 3RTWB 1OLAA 1R1NA 4G8MA 1FQAA 1I6BA 5M2VA 4NMYA 5AA4B 5DVIA 4OWDA 2ZYKA 1SYIA 2ZXTA 4KR5A 4R6KA 1Y20A 4XKRA 1TWYA 4QHQA 1B7HA 2REGA 4K3FA 2REJA 4PFUA 4OETA 4R74A 1FTLA 1EH3A 3UGWA 2PYYA 3TTNA 3B7DA 3K6VA 2A5TB 4NEDA 2XX7A 1IXIA 4Q30B 3PUVE 2AYSA 5JTYA 3E3KA 3N5LA 2O51A 2R9JA 3OO6A 4Q5TA 3EN3A 3OEMA 2VOZA 1LCFA 2F7AA 1OMPA 2I0BA 2PX1A 3KN3A 3C32A 4F1UA 3JZJA 3QXMA 1B7UA 3FJGA 2H5YA 4N6PA 1ZTYA 4U1OA 3OD7A 4GXSB 4DIGA 4EF2A 3U92A 2RKMA 3MAMA 3Q25A 5I57B 1SW4A 2UYFA 1B5JA 1MM7A 4MFIA 4YB5A 3T9VA 4DXBA 1I6AA 1RKMA 3MVZA 1XC1A 3M8UA 4UACA 2XD2A 5H8HA 1ZLQA 4FE8A 4EF1A 1OQHA 3K6XA 2UYEA 2XXYA 2NUVA 3DP8A 3RN8A 1XS5A 3UN6A 3IO6A 1WDNA 4OHNA 1N84A 1NMUA 1R9QA 3IK6B 4KYDA 3I5OA 4OERA 4H8JA 2PT1A 2Y7PA 2Q8JA 1O64A 4F22A 4YKKA 3GBAA 4JWXA 3SKPA 2O1LA 1MQGA 4NF8B 1A55A 1HSJA 2OJTA 2Z8FA 3H3GA 1XVYA 3R7XA 2V93A 2NXOA 4HW8A 2PVUA 1O63A 1P1OA 1TT1A 3C35A 2P0SA 5HBCA 3MZ9A 2VHAA 5H8FB 1JW4A 1ANFA 3Q28A 4OEVA 1SI0A 2IA4A 3TEPA 3RPWA 2V84A 3IORA 4YKJA 1LGBC 3FVNA 4LONB 1ZU0A 1IUDA 2XXWA 1ZIUA 3DP6A 1DOTA 1MQIA 3FXRA 3PD8A 4H0WA 4P0GA 4ONYA 4NF4A 1DSNA 4X48A 3T66A 2YJPA 4EQBA 5KDTA 4QSEA 2UXAA 1UTBB 4ND9A 4YU0A 4KYEA 1SW2A 1XT8A 1YCJA 2DE3A 3DM0A 3IOTA 3OO7A 3QUJA 3R26A 4G68B 4GIZA 4OFOA 1UTBA 1NH8A 1Y4CA 4U21A 3A3CA 3M3KA 2PBWA 1M5FA 3K01A 1BKAA 4H65A 3UP9A 4G68A 4F1YA 1B52A 2I3VA 1JETA 3B6QA 3FD3A 5H8NB 3ZKKA 3QK6A 1NFTA 3FUZA 3TUSA 2E0SA 3MC2A 4TOZA 3VFJA 1JQFA 1GTKA 1GVCA 4BDLA 1Y3PA 1Y9UA 1B46A 4JWYA 4KCCA 4ELPA 1MXWA 2YLNA 2F78A 3M3FA 4WXJA 1A54A 1B05A 1LLSA 2ZYNA 1ZBMA 3OOAA 1URSA 2QS4A 2V25A 3FATA 5FTIA 1MXYA 1PB9A 4ESXA 3V83A 4AB5A 3UA8A 2RCAA 2ESNA 3HHFA 1IZ1A 3HSTA 2O1MA 2ONSA 5I2KA 2OBGA 4DLDA 3UIFA 3RT8A 3WAEA 4ELQA 1SQYA 3Q26A 1FTMA 4F29A 1AL3A 3TTKA 1M5BA 5DEXA 1OLCA 2DYXA 1MY2A 1MH4A 3VE1B 3K2DA 4F31B 3O9PA 4RA1A 3T22A 5L8DA 2UVHA 5AA3A 1LAHE 5CM6A 1LBBA 4THIA 1NNPA 3N26A 4FIMA 5I56B 4DCXA 3RNNA 2DSFA 3H7MA 1H45A 5H8HB 2PMSA 4GL0A 2O6AA
chains in the Genus database with same CATH superfamily
1DCUA 3C36A 3CI8A 4MNPA 2ZMBA 4ZEIA 4GVOA 5I5PA 5DVFA 4MMPA 4JWOA 2I4CA 3QYTA 1VR5A 3FV2A 4OFJA 3ONMA 4I1DA 4I62A 4N13A 2AL4A 2O68A 3FGSA 4I3EA 5F1QA 1I6QA 3KEIA 4LQ2A 3F11A 1G0IA 3O29A 2QJEA 2GHBA 3OMBA 4MEVA 4KD5A 4YICA 2R71A 1SPIA 2Q88A 5A5XA 4X8RA 5ICTA 2XXUA 3IOUA 3DLNA 4LZ5A 5J1DA 3I6VA 4GWZA 2VPNA 3K02A 4WEPA 4GWOA 2GRVA 4PFYA 4FAJA 4PGNA 2I49A 2ONKE 2YPNA 4IGTA 3IX1A 2KR0A 3D4CA 5I84A 5LTCA 4R2FA 2OWZA 1FQBA 2H99A 2XWKA 1QGXA 1RYOA 3KN8A 4LATA 3KZGA 2R6GE 4FEDA 1N76A 1FW0A 1B9JA 2ZYOA 4OESA 2GFEA 2F34A 3PPNA 1FTOA 5H8QB 3KGCA 5EQ9A 1LB8A 3CSGA 3UGWA 4U1ZA 4PE3A 2D5WA 5EHMA 1B0LA 4G77A 1G0HA 4PF6A 3T96B 1INPA 4IB2A 4OXVA 3MZBA 1S9TA 2Y5KA 4IO2A 1B1HA 3HHGA 2Y7RA 3KBZA 1NV0A 3C31A 3MQ9A 4JDFA 2ONRA 4JSDA 5ESYA 1MXZA 4O8MA 1EZPA 4C1UA 3TFLA 3IL1B 1UTHA 3NOHA 3SETA 5J16A 2NVUB 3MZ1A 1RDZA 2XXIA 5AA2D 4PDDA 4POWA 3U93A 4EQ7A 5CBSA 4O3AA 1MPDA 3OO9A 1OQGA 4DXCA 5KZTA 3S9MC 4YKIA 5B7DA 1FPDA 2H4IA 3IOWA 1OVTA 3FXUA 4GL8A 4PBQA 3O28A 3FVOA 3K1NA 2ZZVA 1MQDA 3B50A 1FBFA 1Y3QA 3MJNA 3MWBA 2QSXA 4LZ7A 1P1QA 2FYIA 4HS7A 1LBYA 4LZ8A 2WYPA 2XXPA 1D9YA 4IY5A 2DXRA 2I3WA 1MM6A 4I9DA 3FVKA 5FHMA 3U1OA 1B51A 2AL5A 4MLVA 1Y4TA 4X1BA 2G29A 4M1VA 1D9VA 1ZMGA 2RF1A 2VT5A 4OVQA 4OENA 2HFBA 3MW0A 1MH3A 2F7BA 1NV7A 1AH5A 5I57A 4FATA 2VD3A 4JVIA 1D4NA 3GZGA 3HV1A 3ZKLA 2F35A 5HBCA 1BLFA 4YAHX 3CG1A 1IXGA 3VLWA 3V5AA 1DK4A 4H46A 1Y1ZA 3MUQA 3D1RA 2PT2A 4PFWA 4DI3D 4MF3A 1FPGA 3QSLA 3FIRA 4LA9A 4ZZAA 2Z8EA 2O69A 3OO8A 3MVYA 3PUWE 4ECFA 2XXRA 2DWIA 2HAUA 4NF5B 4AS5A 2GH9A 4QFPA 5DVJA 4ELRA 1IITA 3MPKA 3TPAA 4HCYA 4AQ4A 3ROJA 5IZZA 5ET8A 3KG2A 1FPJA 1F9BA 1XVXA 2IEEA 4H6DA 1USYH 4IO7A 4X04A 4F3BA 2Q89A 2DWHA 3E78A 3BIGA 3TMGA 4KI0E 3IOVA 3ILUB 1BP5A 4NF8A 3IO4A 2RC9A 3OEKA 2Q2CA 5EQ7A 4ELOA 1RYXA 1SI1A 5TPAA 2O7IA 4DCYA 3S9NC 2I48A 4N07A 1H76A 2XXQA 3PU5A 4H5GA 1JEUA 4RPOA 3VV5A 1LBWA 2WBDA 1YPNA 2QS2A 3BFUA 3SZPA 5CC2A 1WVJA 1R1NA 1FQAA 5AA4B 1Y20A 4QHQA 4K3FA 2REJA 3TTNA 3B7DA 2QVRA 2XX7A 5JTYA 3N5LA 5IM2A 2O51A 2R9JA 2VOZA 3C32A 4F1UA 3JZJA 3OD7A 5ET7A 4YB5A 4MIJA 2XD2A 5EYHA 1ZLQA 2XXYA 3DP8A 3UN6A 3IO6A 1R9QA 2Q8JA 4OERA 2Y7PA 1NV1A 1MQGA 4HW8A 2PVUA 1TT1A 3C35A 3GYYA 2VHAA 1JW4A 1ANFA 3KC0A 2V84A 3IORA 4YKJA 3FVNA 1ZIUA 4H0WA 4ONYA 1XT8A 3RPLA 3DM0A 3OO7A 3UA8A 4UACA 4G68B 4OFOA 4GIZA 4EXKA 1NH8A 4F1YA 1NFTA 2CEYA 3MC2A 4TOZA 4JWYA 4ELPA 3M3FA 1B05A 2ZYNA 3OOAA 4ESXA 3FATA 1PB9A 1EYKA 3E79A 3HHFA 3HSTA 3LV0A 5I2KA 4DLDA 1NV3A 1RDYA 3Q26A 1AL3A 1OLCA 3VE1B 4F31B 3K2DA 1NNPA 2PFZA 3N26A 4FIMA 2PMSA 4GL0A 1MDP1 2WX9A 2DS9A 1MG1A 2XX9A 5T3JA 1MXXA 2XXKA 3SEXA 3H6UA 1A40A 3BBRA 5JTYB 1FPIA 4KYSA 2OLBA 3TTLA 4HCWA 2JJKA 4NF6A 3LSXA 5I2KB 5L9SA 2D3IA 3QUFA 3CFLA 2H98A 1OVBA 1K9ZA 4DI4B 1NV6A 2Z22A 3OXNA 3MP6A 4P47A 4LUBA 4WEDA 3T93B 3FJ7A 4F19A 5JEIA 1ELJA 4N8GA 1N04A 1HSEA 4H8IA 2WEFA 1WODA 4U4XA 3CR9A 3FJMA 5K2XA 4RY1A 3LSFB 1TXFA 1URDA 5I56A 1SD3A 4PDHA 1S50A 5CMCA 1LAXA 3OSQA 3UORA 3SEWA 1SDXA 2NWJA 2OWSA 3ZS6A 3KFMA 5ET6A 4OFLA 2QVUA 3H6VA 2HZLA 4MH5A 1LBCA 4F18A 1B6HA 1FTJA 4GXAA 3C9HA 5DT6A 3CVGA 4XKNA 3MVWA 1B4HA 2A5TA 5EQ8A 4HE0A 3K1MA 3BFTA 1CNQA 3C34A 4C0RA 5CMBA 2V3UA 1P1WA 3A09A 2A5SA 1EZ9A 1J1NA 3U94A 4ZE8A 4FJPA 2V4CA 3PGFA 4F2QA 2M8CA 3TCFA 4PETA 1QVSA 5I2NB 3ZSFA 3IFCA 4GX3A 3FXQA 4KPTA 2FA7A 3V89B 2F3BA 3RLFE 4ZEDA 4XIGQ 2GQ1A 4BDQA 1H3DA 4OVTA 4JSOA 4FORA 4Z7EA 3H03A 4UA8A 3CFXA 3P7IA 5TP9A 2H9BA 5BWJA 5CMKA 4OMBA 5IAIA 2DE4A 3PPRA 2P3VA 1JW5A 3TELA 4XKQA 3QMFA 5H8QA 2ZNSA 3G3JA 4F39A 2WKYA 1B3LA 1LAFE 4RK9A 4WKMA 4FBPA 2I6EA 4G4PA 3K00A 4FECA 2OK2A 2B3BA 1NKXA 2FVZA 4X1DA 3ECRA 1FQFA 5I3SA 3PUXE 4Q0CA 2F7CA 4GQOA 4I3YA 1IXCA 1FPLA 5KDTB 3H4ZA 3Q27A 3SEVA 5I59A 3MVXA 4R2BA 5L9OA 4P1LA 1FJ9A 1A8EA 3DP4A 2DWAA 5LDZA 5EHSA 4BDRA 1A7LA 4H5FA 2QFLA 3IJOB 4MBPA 4PCDA 4X9TA 1AMFA 1SBPA 4Q8RA 4GF8A 4N6DA 4QBAA 1MY1A 2Q2AA 3IB2A 1LCTA 2CMOA 4PP0A 4EDPA 3R6UA 5H8FA 1FBEA 1QUJA 3CFZA 3B6WA 5A5XB 3KOSA 1FBGA 3CRBA 1CB6A 2XA5A 4GWUA 4EUOA 4YMBA 2OWTA 4I8CA 4GBWA 1BK4A 4GX4A 4ISUA 4G61A 1N3XA 3K6WA 1FTAA 2KLFA 1OIBA 1UIVA 2G93A 2XHDA 3TQLA 3O6GA 4G2ZA 5DYHA 4KCDA 3S9LC 2CZHA 3RQTA 3IB0A 3UK4A 4F3PA 4ZS9A 2X7QA 4N15A 1Q35A 2QVVA 1NNFA 2RINA 4O7MA 3VLVA 4IR8A 4ZE9A 1IMDA 4GWYA 2KQZA 3ILTB 2HAVA 3H6WA 1MXUA 3SESA 4AB6A 1NUYA 3HN0A 4TQUQ 5DEXB 4F2OA 4BDOA 1DTZA 4HTGA 3USDA 2P2AA 2Z23A 1LFHA 1OLAA 5M2VA 1SYIA 1XI6A 2REGA 1FTLA 1VDWA 4NQ8A 3K6VA 4NEDA 1IXIA 3PUVE 4PAFA 1NUXA 4NN3A 3OO6A 1LCFA 2I0BA 3KN3A 2PX1A 4N8YA 3A29A 3QXMA 2H5YA 4U1OA 4DIGA 4HE1A 2RKMA 3Q25A 5I57B 1SW4A 2UYFA 1B5JA 1MM7A 5I7IA 1I6AA 1XC1A 3M8UA 4GWXA 1OQHA 3K6XA 4PTKA 3RN8A 4OHNA 1NMUA 3I5OA 5EYGA 1O64A 1DBZA 4HXVA 3GBAA 1LBVA 1P1OA 2P0SA 5H8FB 3Q28A 2IA4A 1FRPA 3PD8A 4P0GA 4EQBA 2YJPA 5KDTA 4PGPA 4ND9A 4KYEA 3IOTA 4PQJA 3R26A 1UTBA 3M3KA 3UP9A 1JETA 5H8NB 3FUZA 1JQFA 1GTKA 1NV4A 1GVCA 4BDLA 1MXWA 4WXJA 2HHMA 3S9EA 3V83A 1MXYA 2FIXA 2ESNA 2ONSA 3RT8A 3WAEA 1SQYA 1FTMA 4F29A 5DEXA 5L8DA 1LAHE 3EKIA 3H7MA 5H8HB 2O6AA 3E4RA 3OENA 4QRZA 3HPIA 3H06B 1LBXA 4F3SA 1FQCA 2W7YA 1B58A 3MP8A 1B5HA 1MY3A 2O84X 1VE4A 1EZOA 5IGAA 4P56A 2UVGA 3MYUA 2Y7WA 2F6PA 4BDNA 4YB6A 4QXDA 1I69A 5H8NA 4GOTA 1FCKA 1B0HA 4R9FA 3PUYE 2L5VA 4DDDA 3EF7A 4POXA 3M3LA 3FVGA 1FQDA 3RY3A 1SW1A 3C33A 4NGUA 1US4A 1QW0A 3V8XB 4NE4A 1GV8A 3KBRA 1M5EA 1H43A 1B2HA 1M5DA 5AA1A 2ANJA 3TKDA 5IZ3B 3E9XA 4GBVA 3IB1A 1B40A 3ODBA 3VLUA 1IMFA 2XX8A 4IO3A 4QFNA 4PFBA 1RDXA 2FNCA 4XEQA 2FHYA 3RUMA 2O7UA 3D4GA 3EHUA 3IR1A 4NF0A 3S2VA 3O66A 2RCBA 3G3FA 1SW5A 4Z0IA 3JV9A 4I40A 1HSLA 3JYRA 2AIXA 1IXHA 1SVXB 1B4ZA 2Q74A 1Q9DA 3HO7A 5TU0A 2HQ0A 2Y84A 3IFAA 3LR1A 1KWHA 3EHSA 3FXBA 5EYFA 1QJMA 4DXUA 3CSBA 2OX3A 4GWSA 4TLMB 3FV1A 2Y5LA 2I4BA 2F6GA 1N0TA 1B7ZA 3O97A 1H44A 2E1SA 1CE2A 1YXIA 5L9MA 3RPLB 1M5CA 1DTGA 4QSDA 4NF4B 2UVJA 2Q8MA 4IO4A 1PEBA 5H8SA 4U4SA 3TODA 5K2YA 1PB8A 3GBBA 4KXPA 1NI9A 1URGA 1D3KA 1Z7NE 3T9HB 4KQPA 4GRKA 1USYE 1FTKA 3AXFA 2QMXA 4IY6A 2QRYA 3G3HA 3KSXA 4N6KA 5ICQA 4NWCA 3WAFA 5AA2A 2ALUA 4XTCQ 3U65A 4H45A 3THIA 1QKAA 1JVXA 1NV5A 4BDMA 4EQ9A 4ZEBA 1MRPA 4OVJA 1GR2A 2B4MA 3EPEA 1MS7A 4ZEFA 4P8BA 3PUZE 2XD3A 1LFGA 2P3NA 3PV0E 4DE8A 1AIVA 3GXAA 3PMVA 3PPOA 4H1XA 3IAZA 1NUWA 3N6UA 4KFQA 3TYHA 2CZLA 4OTEA 4R75A 2FBPA 3G3IA 3TZAA 4UABA 1FQEA 1KA0A 3B8BA 3Q29A 3HCQA 2CZIA 3FASA 5I58B 1P1NA 3OELA 4XKPA 1PDAA 2V3QA 4AS4A 3EHTA 1FBPA 1JNFA 3T9XB 4H67A 5ET5A 4OZ9A 2PFYA 1YAEA 3BKIB 1NH7A 5F24A 1AOVA 3FZVA 5FHNA 2F8DA 4RYAA 4NF6B 1EU8A 3MSTA 1FSAA 3O6HA 4OANA 3SDFA 1FBHA 4IGRA 3K0VA 1ATGA 3GLBA 1QUKA 1MDQA 5KCJA 1VSOA 2PCRA 1P99A 2RC7A 1PC3A 3RT6B 3PPQA 4QF9A 3OSRA 3VXCA 5TP9B 3MBPA 1GGGA 4F3GA 4MHFA 4R6YA 2ABHA 2ZNTA 2F5XA 2GHAA 5IZ3A 5HM4B 4MNCA 3VDFA 3U72A 4PAKA 1MY0A 1UIUA 3K4UA 2HZKA 3TTRA 2OCUA 3L6GA 1NNKA 4HE2A 3H6TA 3CHGA 1TFAA 2XWOA 3S4UA 4C1TA 5CMMA 4TLLB 4P11A 4GFRA 2XXXA 3KJ7A 2OZZA 4IO6A 4LQ5A 3EQ1A 4O7IA 2WYKA 4NMYA 1IMBA 4PF8A 4XKRA 1TWYA 1B7HA 4PFUA 4R74A 2PYYA 2A5TB 4Q30B 2AYSA 3E3KA 4Q5TA 2F7AA 5EQAA 1B7UA 3FJGA 4N6PA 4PAIA 4NX1A 4GX6A 4DXBA 3MVZA 5H8HA 4XF5A 4FE8A 4EF1A 2UYEA 2NUVA 1XS5A 1WDNA 1N84A 4KYDA 5A5LA 4OVRA 4H8JA 2PT1A 4F22A 4YKKA 1FPKA 4JWXA 4N91A 2O1LA 3SKPA 1A55A 1XVYA 2V93A 1JP4A 3MZ9A 4OEVA 1IMAA 3TEPA 1LGBC 1LEVA 1ZU0A 1IUDA 1DOTA 3FXRA 4JVCA 4NF4A 2UXAA 4YU0A 1SW2A 1YCJA 2DE3A 3QUJA 1Y4CA 3A3CA 1M5FA 3K01A 1BKAA 3B6QA 3FD3A 3ZKKA 3QK6A 3VFJA 1Y9UA 1B46A 4KCCA 2F78A 1A54A 1LLSA 1ZBMA 2QS4A 2RCAA 1IZ1A 2CZKA 2O1MA 3UIFA 4ELQA 3TTKA 1M5BA 1MY2A 3T22A 5AA3A 2ZZXA 5I56B 4DCXA 1H45A 3TDJA 5ITOA 4YZZA 2XWVA 4MJOA 5TPAB 1FPBA 4PE5B 5IKBA 4G8HA 3QAXA 1BTJA 5F7VA 3DELB 3TCHA 1ZKBA 2DDKA 5BUUA 2BJJX 4NAPA 2XWIA 1II5A 2F97A 4XXUA 5B70A 3KC1A 3W9WA 5ELVA 1UTHB 1B3GA 4NTLA 2BJIA 3E13X 5DW8A 1NV2A 4FEBA 1B5IA 1ZJLA 5FHOA 3KJTA 1S7YA 2HCAA 4R73A 4YB7A 3I3VA 1N7WA 1QUIA 4LP2B 2Q9TA 3N94A 1AWBA 2VP1A 4O3BA 2DOJA 3G7WA 4R72A 2VD2A 5CRYA 1DMBA 1Z7ME 1NNTA 4JBZA 1DPEA 1PBPA 2V3TA 1SYHA 4LN5A 4P9KA 2DVZA 4EF2A 3L6HA 3K1PA 3PTYA 2B4LA 1EYIA 2HXWA 3MP1A 5AE4A 2HPGA 1B1XA 1LAGE 2QS1A 2DWJA 1MPCA 3B6TA 1US5A 2H25A 2DE2A 3C4MA 5I2NA 4MNIA 4O3CA 1VFEA 1T0KA 2P1SA 3VVDA 3A3UA 3RGYA 2D21A 1YTVA 4JB7A 4NWDA 4NHBA 4DZ1A 4MLQA 3W9VA 1POTA 2DQVA 3IJXB 4OQOA 4U22A 1JEVA 4PFTA 1A99A 2I58A 2X26A 1A8FA 2QPQA 3PD9A 1VFDA 5ITPA 1IIWA 1YYZA 1JVYA 2RC8A 2I0CA 3LBSA 4RXLA 4NG7A 3SEUA 2VGQA 3O2AA 1R6ZA 2THIA 4N81A 5AA2B 2LAOA 1Y1MA 3RTFB 3QIMA 4ZEKA 3CG3A 2HEUA 1B3FA 2R8TA 3LC8A 4R6HA 1BIYA 5ISUA 2MKZA 3U8QA 4NF5A 1B3HA 4O94A 1XOCA 1XHYA 5FTHA 1O7TA 4LVQA 5AA4A 2ZYMA 5KCJB 3SERA 1PB7A 3KN7A 1YZ0A 1FBDA 4R9GA 2QMWA 4GD5A 4OEUA 3HFUA 3MPLA 4G68C 1LBZA 4BLAA 4ZDMA 2Y7KA 3LSLA 4MX6A 2QS3A 4KHZE 5I58A 1IEJA 4U23A 2UVIA 1LSTA 4EXLA 4GLIA 2XXTA 3KSJA 4JXIA 4ZZEA 1LFIA 2F36A 2DP8A 1D9QA 3CIJA 1Y3NA 2ZNUA 4E0XA 1B3EA 2B65A 4RK2A 4L17A 1L5TA 2HXRA 2VPOA 3G3GA 4GWWA 4N4UA 1PBQA 4QFOA 3KOTA 2X7PA 4RNSA 2QL3A 3VVFA 3VXBA 1B32A 1DPPA 4RPNA 4PFRA 3T1BA 2NOOA 3G3KA 1N3WA 3O6IA 3K6UA 5LOMA 2DVCA 4E0WA 1FPFA 4OYVA 5JK4A 4F1VA 3N6TA 1IMEA 5CBRA 3SEYA 1N7XA 1MQHA 1POY1 2B3FA 3W15C 3BIHA 1R9LA 2Z8DA 4ESWA 4IO5A 1MY4A 3T0JA 1KZ8A 1FBCA 1Q1KA 1FPEA 1JW1A 1NL5A 2Y7IA 4N17A 1TFDA 2CEXA 3TAJA 3TQWA 3TCGA 4RJZA 5HPQA 3LUYA 5DTBA 3VVEA 1QULA 5FTIA 3PPPA 3LSWA 2XXVA 3T9UA 4G8NA 4P3LA 4OA4A 1MPBA 1MQJA 1UQWA 1NUZA 5CI5A 1LB9A 1IQ7A 4OVSA 3PMXA 4M4GA 3TTMA 4PC9A 4PBHA 2DXYA 3PMWA 4QFLA 1P1UA 4YKPA 1QKBA 4QFKA 4P0IA 2XXHA 1MXVA 4U2RA 4MCOA 4ZECA 3RTWB 4G8MA 1I6BA 5DVIA 4OWDA 2ZYKA 2ZXTA 4KR5A 4R6KA 4OETA 1EH3A 3EN3A 3OEMA 1FJ6A 1OMPA 4P1EA 1ZTYA 4GXSB 4MAGA 3U92A 3MAMA 2FIEA 1EYJA 3LUZA 4XFEA 4MFIA 3T9VA 2ZZWA 1RKMA 4OVPA 3RYDA 2WBBA 4QSCA 3IK6B 4NF8B 1HSJA 2OJTA 2Z8FA 3H3GA 3R7XA 1K9YA 2NXOA 1O63A 1KA1A 1SI0A 3RPWA 4LONB 2XXWA 3DP6A 1MQIA 4X48A 3T66A 1DSNA 4QSEA 4JVDA 1UTBB 4YMAA 4U21A 2PBWA 4H65A 4G68A 1B52A 2I3VA 3TUSA 2E0SA 1Y3PA 2YLNA 3ISPA 5I59B 1URSA 2V25A 3FBPA 4PFIA 4AB5A 5FBPA 2OBGA 2DYXA 1IMCA 1MH4A 3O9PA 4RA1A 2UVHA 5CM6A 1LBBA 4THIA 2F3DA 3RNNA 2DSFA 5IZ1A
chains in the Genus database with same CATH topology
1MDP1 3E4RA 3OENA 4QRZA 3HPIA 2DS9A 3H06B 4YZZA 5TPAB 4F3SA 1MG1A 2XX9A 3C36A 1MXXA 3CI8A 4PE5B 2ZMBA 1FQCA 2W7YA 4ZEIA 5IKBA 3SEXA 1B58A 4GVOA 3H6UA 1A40A 3MP8A 1B5HA 5DVFA 3BBRA 4G8HA 3QAXA 5JTYB 1BTJA 1MY3A 2O84X 4JWOA 1VE4A 2I4CA 3DELB 2OLBA 3QYTA 4KYSA 4U1ZA 3TCHA 3TTLA 1EZOA 4HCWA 1VR5A 1ZKBA 4NF6A 3FV2A 5BUUA 2BJJX 3LSXA 4OFJA 5I2KB 5L9SA 3ONMA 4I1DA 2D3IA 2UVGA 3QUFA 3CFLA 2H98A 4I62A 4N13A 2AL4A 1II5A 1OVBA 2F97A 4XXUA 5I59A 2O68A 5B70A 3FGSA 2Y7WA 2F6PA 4BDNA 5F1QA 1I6QA 3TDJA 2Z22A 3OXNA 3MP6A 3W9WA 3KEIA 4LQ2A 3F11A 4YB6A 5ELVA 1UTHB 1B3GA 1I69A 4LUBA 5H8NA 3O29A 4GOTA 1FCKA 4NTLA 1B0HA 4R9FA 3PUYE 2QJEA 3E13X 4WEDA 3T93B 4DDDA 3FJ7A 4EXKA 3EF7A 4POXA 2GHBA 4FEBA 3OMBA 3M3LA 4F19A 1B5IA 4KD5A 4YICA 1ZJLA 5JEIA 1ELJA 5FHOA 2R71A 3KJTA 3FVGA 1FQDA 1N04A 1HSEA 1S7YA 1SW1A 2HCAA 3C33A 3RY3A 4H8IA 1US4A 4R73A 1WODA 2Q88A 4U4XA 3CR9A 1QW0A 4YB7A 3FJMA 3V8XB 5A5XA 5K2XA 5ICTA 3I3VA 4RY1A 2XXUA 1N7WA 3IOUA 4NE4A 3LSFB 1TXFA 1GV8A 1QUIA 3DLNA 4LZ5A 4LP2B 2Q9TA 3KBRA 1M5EA 1H43A 1URDA 5I56A 5J1DA 1SD3A 3N94A 2VP1A 1S50A 3I6VA 1B2HA 1M5DA 4O3BA 5CMCA 2DOJA 3G7WA 3K02A 2VD2A 4R72A 1LAXA 4WEPA 5CRYA 4GWOA 2GRVA 1DMBA 1Z7ME 3OSQA 2ANJA 4PFYA 3TKDA 3UORA 3SEWA 1NNTA 4FAJA 3E9XA 4JBZA 2I49A 1DPEA 1PBPA 2ONKE 1SDXA 2V3TA 2YPNA 1SYHA 2DVZA 3IB1A 1B40A 4IGTA 2OWSA 3L6HA 2NWJA 3K1PA 3IX1A 3KFMA 3ODBA 3VLUA 3ZS6A 3D4CA 2XX8A 4QFNA 4IO3A 5I84A 2FNCA 4R2FA 4OFLA 1FQBA 3RUMA 2HXWA 2O7UA 3D4GA 2H99A 3MP1A 3EHUA 3H6VA 5AE4A 1B1XA 3IR1A 1LAGE 2QS1A 1RYOA 2HZLA 3KN8A 4LATA 4MH5A 1LBCA 3KZGA 3S2VA 5I59B 2DWJA 1MPCA 3B6TA 1US5A 2R6GE 4FEDA 1N76A 4F18A 1B6HA 1FTJA 4GXAA 3O66A 1FW0A 2RCBA 3C9HA 3G3FA 3CVGA 5DT6A 1B9JA 2H25A 4XKNA 3MVWA 2DE2A 3C4MA 1B4HA 1SW5A 5I2NA 2A5TA 4O3CA 4Z0IA 2ZYOA 4OESA 3JV9A 1VFEA 1HSLA 3JYRA 2P1SA 1T0KA 2AIXA 1IXHA 1SVXB 1B4ZA 3VVDA 3A3UA 3RGYA 3HO7A 3K1MA 3BFTA 2D21A 2GFEA 1YTVA 2F34A 4JB7A 4NWDA 3PPNA 1FTOA 3C34A 5H8QB 5TU0A 4MLQA 3W9VA 1POTA 2DQVA 3KGCA 3IJXB 4OQOA 4C0RA 4U22A 2HQ0A 2V3UA 1LB8A 3CSGA 5CMBA 1JEVA 1P1WA 4PFTA 2Y84A 3LR1A 3A09A 1A99A 1KWHA 2A5SA 1B0LA 1EZ9A 2D5WA 2I58A 3EHSA 4G77A 5EHMA 5EYFA 1J1NA 3T96B 2X26A 1QJMA 3U94A 4BDOA 4ZE8A 4IB2A 1A8FA 4FJPA 4OXVA 4DXUA 3CSBA 3PGFA 2QPQA 3MZBA 4F2QA 2M8CA 3TCFA 3PD9A 4TLMB 1S9TA 1VFDA 3FV1A 5ITPA 2I4BA 1IIWA 4IO2A 2F6GA 4PETA 1QVSA 1N0TA 1B7ZA 3O97A 1B1HA 1H44A 1CE2A 1JVYA 2E1SA 2RC8A 2Y7RA 2I0CA 3FXQA 3HHGA 4KPTA 3LBSA 3ZSFA 2FA7A 3MQ9A 3C31A 4JDFA 4RXLA 2ONRA 4JSDA 3V89B 3SEUA 1MXZA 2VGQA 1M5CA 1DTGA 1EZPA 4QSDA 3O2AA 1R6ZA 4NF4B 4C1UA 2UVJA 2THIA 3RLFE 3TFLA 3IL1B 4ZEDA 1UTHA 4IO4A 5AA2B 5AA1A 1PEBA 4XIGQ 5H8SA 4U4SA 3SETA 2LAOA 1Y1MA 3TODA 3RTFB 4BDQA 5K2YA 2NVUB 1H3DA 1PB8A 3MZ1A 3QIMA 4ZEKA 2XXIA 3CG3A 2HEUA 1B3FA 3GBBA 5AA2D 4POWA 3U93A 1URGA 3LC8A 1D3KA 4FORA 4JSOA 4EQ7A 4R6HA 4Z7EA 5CBSA 1BIYA 4O3AA 5ISUA 3H03A 3U8QA 1Z7NE 4UA8A 3CFXA 3P7IA 4NF5A 4PQJA 5TP9A 3T9HB 1MPDA 2H9BA 1B3HA 5BWJA 1XOCA 5CMKA 1XHYA 3OO9A 4OMBA 1OQGA 4KQPA 5FTHA 5IAIA 4DXCA 4GRKA 5KZTA 1O7TA 1USYE 2DE4A 3PPRA 4LVQA 3S9MC 1FTKA 5AA4A 2ZYMA 4YKIA 5KCJB 5B7DA 3AXFA 2QMXA 4IY6A 1JW5A 2H4IA 3IOWA 3TELA 1OVTA 3FXUA 4XKQA 2QRYA 3G3HA 3KSXA 4GL8A 3SERA 1PB7A 3KN7A 5H8QA 5ICQA 4NWCA 3WAFA 2ZNSA 5AA2A 3G3JA 2ALUA 3O28A 4R9GA 4XTCQ 2QMWA 3FVOA 2WKYA 4F39A 4GD5A 3K1NA 1B3LA 1LAFE 4OEUA 4RK9A 4WKMA 3MPLA 1MQDA 5EHSA 3THIA 1QKAA 1JVXA 4G68C 4BDMA 4EQ9A 1Y3QA 4ZEBA 3MJNA 3MWBA 4BLAA 1MRPA 2QSXA 1GR2A 2Y7KA 4OVJA 4ZDMA 4YMAA 3LSLA 2I6EA 2QS3A 3EPEA 4KHZE 1MS7A 4G4PA 4LZ7A 1P1QA 2FYIA 3K00A 2XD3A 3PUZE 1LFGA 1IEJA 4FECA 4HS7A 4ZEFA 2OK2A 5I58A 4LZ8A 2XXPA 3PV0E 1D9YA 4IY5A 2DXRA 2UVIA 2I3WA 1LSTA 4U23A 4DE8A 3GXAA 3PMVA 3PPOA 4DZ1A 2B3BA 4GLIA 1NKXA 4EXLA 1AIVA 4H1XA 1MM6A 4I9DA 2XXTA 3FVKA 3IAZA 3KSJA 4JXIA 3N6UA 4KFQA 5FHMA 4X1DA 1B51A 4ZZEA 3TYHA 3U1OA 1LFIA 3ECRA 5ITOA 2F36A 2DP8A 1FQFA 3CIJA 2AL5A 2CZLA 4OTEA 4MLVA 1Y4TA 5I2NB 4R75A 4X1BA 1Y3NA 3PUXE 4Q0CA 2ZNUA 2G29A 3G3IA 2F7CA 4E0XA 1B3EA 2B65A 4M1VA 1D9VA 1ZMGA 4GQOA 2RF1A 4L17A 4RK2A 1L5TA 3TZAA 1IXCA 3G3GA 4OENA 1FQEA 2HFBA 3MW0A 5KDTB 1MH3A 1PBQA 2F7BA 4QFOA 3KOTA 3H4ZA 3Q27A 3SEVA 1AH5A 2X7PA 4RNSA 3Q29A 4QSCA 4FATA 5I57A 2VD3A 2QL3A 3HCQA 3VVFA 3MVXA 3VXBA 4R2BA 1D4NA 1B32A 1DPPA 3GZGA 5L9OA 4RPNA 3FASA 3HV1A 5I58B 1A8EA 2NOOA 3DP4A 3G3KA 2DWAA 3ZKLA 2F35A 1P1NA 1BLFA 3OELA 4XKPA 1N3WA 3O6IA 1PDAA 2V3QA 3CG1A 3EHTA 4YAHX 1IXGA 1A7LA 3K6UA 3VLWA 4BDRA 4H5FA 5LOMA 2DVCA 3IJOB 4MBPA 4E0WA 1JNFA 3T9XB 4X9TA 1AMFA 3V5AA 4H67A 4OYVA 1SBPA 4Q8RA 4GF8A 5JK4A 4F1VA 3N6TA 5CBRA 1MY1A 4OZ9A 2Q2AA 3IB2A 3SEYA 1LCTA 1N7XA 1Y1ZA 3MUQA 2CMOA 1MQHA 1YAEA 4PP0A 4EDPA 2PT2A 1POY1 2B3FA 3R6UA 4PFWA 3W15C 3BKIB 1R9LA 4MF3A 5H8FA 1NH7A 3QSLA 3FIRA 1QUJA 3CFZA 4LA9A 2Z8DA 4ZZAA 1AOVA 2Z8EA 2O69A 3OO8A 3S9EA 4ESWA 3B6WA 3MVYA 3PUWE 3FZVA 5FHNA 4ECFA 5A5XB 4IO5A 3KOSA 1MY4A 2F8DA 4RYAA 4NF6B 1Q1KA 2XXRA 2DWIA 1EU8A 1JW1A 2HAUA 3CRBA 1NL5A 4NF5B 1CB6A 2GH9A 2Y7IA 4QFPA 5DVJA 1TFDA 4ELRA 1IITA 3O6HA 3MPKA 3TPAA 4EUOA 3SDFA 3TAJA 4HCYA 4IGRA 3K0VA 3TQWA 4AQ4A 4YMBA 2OWTA 3KG2A 1ATGA 4I8CA 3GLBA 1QUKA 1F9BA 3TCGA 1XVXA 4RJZA 5HPQA 1MDQA 3LUYA 2IEEA 5DTBA 4H6DA 1USYH 4IO7A 4ISUA 5F7VA 2Q89A 5L9MA 4F3BA 5KCJA 1N3XA 1VSOA 2DWHA 3K6WA 3VVEA 1QULA 3TMGA 4KI0E 1P99A 2KLFA 3IOVA 3ILUB 1BP5A 1OIBA 2RC7A 3LSWA 2XXVA 1UIVA 3PPPA 2G93A 4NF8A 2XHDA 3IO4A 4G8NA 3T9UA 1PC3A 3RT6B 3TQLA 3PPQA 4QF9A 3OSRA 3VXCA 5TP9B 3MBPA 1GGGA 3O6GA 4G2ZA 5DYHA 4KCDA 1MPBA 4F3GA 1MQJA 2RC9A 4R6YA 2ABHA 2ZNTA 1UQWA 3OEKA 5CI5A 2Q2CA 3S9LC 2F5XA 1LB9A 2GHAA 5HM4B 3RQTA 3VDFA 4ELOA 1RYXA 3IB0A 3U72A 3UK4A 1IQ7A 4F3PA 4ZS9A 3PMXA 1MY0A 2X7QA 4M4GA 1Q35A 3TTMA 1SI1A 1UIUA 5TPAA 3K4UA 1NNFA 2HZKA 2OCUA 2RINA 3TTRA 3VLVA 2DXYA 3L6GA 3PMWA 2O7IA 4DCYA 3S9NC 1NNKA 4ZE9A 4QFLA 3H6TA 2I48A 4N07A 1P1UA 3ILTB 1H76A 2HAVA 1TFAA 3H6WA 1MXUA 3S4UA 3SESA 4YKPA 2XXQA 4AB6A 3PU5A 4H5GA 4C1TA 1JEUA 5CMMA 1QKBA 4RPOA 3VV5A 4TLLB 4P11A 3HN0A 4TQUQ 5DEXB 4F2OA 4QFKA 4GFRA 1YPNA 2QS2A 4P0IA 2XXXA 2XXHA 3BFUA 1DTZA 3KJ7A 2OZZA 4IO6A 1MXVA 4LQ5A 4U2RA 4ZECA 3EQ1A 4HTGA 3USDA 2P2AA 2Z23A 1WVJA 5CC2A 1LFHA 3RTWB 1OLAA 1R1NA 4G8MA 1FQAA 1I6BA 5M2VA 4NMYA 5AA4B 5DVIA 4OWDA 2ZYKA 1SYIA 2ZXTA 4KR5A 4R6KA 1Y20A 4XKRA 1TWYA 4QHQA 1B7HA 2REGA 4K3FA 2REJA 4PFUA 4OETA 4R74A 1FTLA 1EH3A 3UGWA 2PYYA 3TTNA 3B7DA 3K6VA 2A5TB 4NEDA 2XX7A 1IXIA 4Q30B 3PUVE 2AYSA 5JTYA 3E3KA 3N5LA 2O51A 2R9JA 3OO6A 4Q5TA 3EN3A 3OEMA 2VOZA 1LCFA 2F7AA 1OMPA 2I0BA 2PX1A 3KN3A 3C32A 4F1UA 3JZJA 3QXMA 1B7UA 3FJGA 2H5YA 4N6PA 1ZTYA 4U1OA 3OD7A 4GXSB 4DIGA 4EF2A 3U92A 2RKMA 3MAMA 3Q25A 5I57B 1SW4A 2UYFA 1B5JA 1MM7A 4MFIA 4YB5A 3T9VA 4DXBA 1I6AA 1RKMA 3MVZA 1XC1A 3M8UA 4UACA 2XD2A 5H8HA 1ZLQA 4FE8A 4EF1A 1OQHA 3K6XA 2UYEA 2XXYA 2NUVA 3DP8A 3RN8A 1XS5A 3UN6A 3IO6A 1WDNA 4OHNA 1N84A 1NMUA 1R9QA 3IK6B 4KYDA 3I5OA 4OERA 4H8JA 2PT1A 2Y7PA 2Q8JA 1O64A 4F22A 4YKKA 3GBAA 4JWXA 3SKPA 2O1LA 1MQGA 4NF8B 1A55A 1HSJA 2OJTA 2Z8FA 3H3GA 1XVYA 3R7XA 2V93A 2NXOA 4HW8A 2PVUA 1O63A 1P1OA 1TT1A 3C35A 2P0SA 5HBCA 3MZ9A 2VHAA 5H8FB 1JW4A 1ANFA 3Q28A 4OEVA 1SI0A 2IA4A 3TEPA 3RPWA 2V84A 3IORA 4YKJA 1LGBC 3FVNA 4LONB 1ZU0A 1IUDA 2XXWA 1ZIUA 3DP6A 1DOTA 1MQIA 3FXRA 3PD8A 4H0WA 4P0GA 4ONYA 4NF4A 1DSNA 4X48A 3T66A 2YJPA 4EQBA 5KDTA 4QSEA 2UXAA 1UTBB 4ND9A 4YU0A 4KYEA 1SW2A 1XT8A 1YCJA 2DE3A 3DM0A 3IOTA 3OO7A 3QUJA 3R26A 4G68B 4GIZA 4OFOA 1UTBA 1NH8A 1Y4CA 4U21A 3A3CA 3M3KA 2PBWA 1M5FA 3K01A 1BKAA 4H65A 3UP9A 4G68A 4F1YA 1B52A 2I3VA 1JETA 3B6QA 3FD3A 5H8NB 3ZKKA 3QK6A 1NFTA 3FUZA 3TUSA 2E0SA 3MC2A 4TOZA 3VFJA 1JQFA 1GTKA 1GVCA 4BDLA 1Y3PA 1Y9UA 1B46A 4JWYA 4KCCA 4ELPA 1MXWA 2YLNA 2F78A 3M3FA 4WXJA 1A54A 1B05A 1LLSA 2ZYNA 1ZBMA 3OOAA 1URSA 2QS4A 2V25A 3FATA 5FTIA 1MXYA 1PB9A 4ESXA 3V83A 4AB5A 3UA8A 2RCAA 2ESNA 3HHFA 1IZ1A 3HSTA 2O1MA 2ONSA 5I2KA 2OBGA 4DLDA 3UIFA 3RT8A 3WAEA 4ELQA 1SQYA 3Q26A 1FTMA 4F29A 1AL3A 3TTKA 1M5BA 5DEXA 1OLCA 2DYXA 1MY2A 1MH4A 3VE1B 3K2DA 4F31B 3O9PA 4RA1A 3T22A 5L8DA 2UVHA 5AA3A 1LAHE 5CM6A 1LBBA 4THIA 1NNPA 3N26A 4FIMA 5I56B 4DCXA 3RNNA 2DSFA 3H7MA 1H45A 5H8HB 2PMSA 4GL0A 2O6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDP 1;  3E4R A;  3OEN A;  4QRZ A;  3HPI A;  2DS9 A;  3H06 B;  4YZZ A;  5TPA B;  4F3S A;  1MG1 A;  2XX9 A;  3C36 A;  1MXX A;  3CI8 A;  4PE5 B;  2ZMB A;  1FQC A;  2W7Y A;  4ZEI A;  5IKB A;  3SEX A;  1B58 A;  4GVO A;  3H6U A;  1A40 A;  3MP8 A;  1B5H A;  5DVF A;  3BBR A;  4G8H A;  3QAX A;  5JTY B;  1BTJ A;  1MY3 A;  2O84 X;  4JWO A;  1VE4 A;  2I4C A;  3DEL B;  2OLB A;  3QYT A;  4KYS A;  4U1Z A;  3TCH A;  3TTL A;  1EZO A;  4HCW A;  1VR5 A;  1ZKB A;  4NF6 A;  3FV2 A;  5BUU A;  2BJJ X;  3LSX A;  4OFJ A;  5I2K B;  5L9S A;  3ONM A;  4I1D A;  2D3I A;  2UVG A;  3QUF A;  3CFL A;  2H98 A;  4I62 A;  4N13 A;  2AL4 A;  1II5 A;  1OVB A;  2F97 A;  4XXU A;  5I59 A;  2O68 A;  5B70 A;  3FGS A;  2Y7W A;  2F6P A;  4BDN A;  5F1Q A;  1I6Q A;  3TDJ A;  2Z22 A;  3OXN A;  3MP6 A;  3W9W A;  3KEI A;  4LQ2 A;  3F11 A;  4YB6 A;  5ELV A;  1UTH B;  1B3G A;  1I69 A;  4LUB A;  5H8N A;  3O29 A;  4GOT A;  1FCK A;  4NTL A;  1B0H A;  4R9F A;  3PUY E;  2QJE A;  3E13 X;  4WED A;  3T93 B;  4DDD A;  3FJ7 A;  4EXK A;  3EF7 A;  4POX A;  2GHB A;  4FEB A;  3OMB A;  3M3L A;  4F19 A;  1B5I A;  4KD5 A;  4YIC A;  1ZJL A;  5JEI A;  1ELJ A;  5FHO A;  2R71 A;  3KJT A;  3FVG A;  1FQD A;  1N04 A;  1HSE A;  1S7Y A;  1SW1 A;  2HCA A;  3C33 A;  3RY3 A;  4H8I A;  1US4 A;  4R73 A;  1WOD A;  2Q88 A;  4U4X A;  3CR9 A;  1QW0 A;  4YB7 A;  3FJM A;  3V8X B;  5A5X A;  5K2X A;  5ICT A;  3I3V A;  4RY1 A;  2XXU A;  1N7W A;  3IOU A;  4NE4 A;  3LSF B;  1TXF A;  1GV8 A;  1QUI A;  3DLN A;  4LZ5 A;  4LP2 B;  2Q9T A;  3KBR A;  1M5E A;  1H43 A;  1URD A;  5I56 A;  5J1D A;  1SD3 A;  3N94 A;  2VP1 A;  1S50 A;  3I6V A;  1B2H A;  1M5D A;  4O3B A;  5CMC A;  2DOJ A;  3G7W A;  3K02 A;  2VD2 A;  4R72 A;  1LAX A;  4WEP A;  5CRY A;  4GWO A;  2GRV A;  1DMB A;  1Z7M E;  3OSQ A;  2ANJ A;  4PFY A;  3TKD A;  3UOR A;  3SEW A;  1NNT A;  4FAJ A;  3E9X A;  4JBZ A;  2I49 A;  1DPE A;  1PBP A;  2ONK E;  1SDX A;  2V3T A;  2YPN A;  1SYH A;  2DVZ A;  3IB1 A;  1B40 A;  4IGT A;  2OWS A;  3L6H A;  2NWJ A;  3K1P A;  3IX1 A;  3KFM A;  3ODB A;  3VLU A;  3ZS6 A;  3D4C A;  2XX8 A;  4QFN A;  4IO3 A;  5I84 A;  2FNC A;  4R2F A;  4OFL A;  1FQB A;  3RUM A;  2HXW A;  2O7U A;  3D4G A;  2H99 A;  3MP1 A;  3EHU A;  3H6V A;  5AE4 A;  1B1X A;  3IR1 A;  1LAG E;  2QS1 A;  1RYO A;  2HZL A;  3KN8 A;  4LAT A;  4MH5 A;  1LBC A;  3KZG A;  3S2V A;  5I59 B;  2DWJ A;  1MPC A;  3B6T A;  1US5 A;  2R6G E;  4FED A;  1N76 A;  4F18 A;  1B6H A;  1FTJ A;  4GXA A;  3O66 A;  1FW0 A;  2RCB A;  3C9H A;  3G3F A;  3CVG A;  5DT6 A;  1B9J A;  2H25 A;  4XKN A;  3MVW A;  2DE2 A;  3C4M A;  1B4H A;  1SW5 A;  5I2N A;  2A5T A;  4O3C A;  4Z0I A;  2ZYO A;  4OES A;  3JV9 A;  1VFE A;  1HSL A;  3JYR A;  2P1S A;  1T0K A;  2AIX A;  1IXH A;  1SVX B;  1B4Z A;  3VVD A;  3A3U A;  3RGY A;  3HO7 A;  3K1M A;  3BFT A;  2D21 A;  2GFE A;  1YTV A;  2F34 A;  4JB7 A;  4NWD A;  3PPN A;  1FTO A;  3C34 A;  5H8Q B;  5TU0 A;  4MLQ A;  3W9V A;  1POT A;  2DQV A;  3KGC A;  3IJX B;  4OQO A;  4C0R A;  4U22 A;  2HQ0 A;  2V3U A;  1LB8 A;  3CSG A;  5CMB A;  1JEV A;  1P1W A;  4PFT A;  2Y84 A;  3LR1 A;  3A09 A;  1A99 A;  1KWH A;  2A5S A;  1B0L A;  1EZ9 A;  2D5W A;  2I58 A;  3EHS A;  4G77 A;  5EHM A;  5EYF A;  1J1N A;  3T96 B;  2X26 A;  1QJM A;  3U94 A;  4BDO A;  4ZE8 A;  4IB2 A;  1A8F A;  4FJP A;  4OXV A;  4DXU A;  3CSB A;  3PGF A;  2QPQ A;  3MZB A;  4F2Q A;  2M8C A;  3TCF A;  3PD9 A;  4TLM B;  1S9T A;  1VFD A;  3FV1 A;  5ITP A;  2I4B A;  1IIW A;  4IO2 A;  2F6G A;  4PET A;  1QVS A;  1N0T A;  1B7Z A;  3O97 A;  1B1H A;  1H44 A;  1CE2 A;  1JVY A;  2E1S A;  2RC8 A;  2Y7R A;  2I0C A;  3FXQ A;  3HHG A;  4KPT A;  3LBS A;  3ZSF A;  2FA7 A;  3MQ9 A;  3C31 A;  4JDF A;  4RXL A;  2ONR A;  4JSD A;  3V89 B;  3SEU A;  1MXZ A;  2VGQ A;  1M5C A;  1DTG A;  1EZP A;  4QSD A;  3O2A A;  1R6Z A;  4NF4 B;  4C1U A;  2UVJ A;  2THI A;  3RLF E;  3TFL A;  3IL1 B;  4ZED A;  1UTH A;  4IO4 A;  5AA2 B;  5AA1 A;  1PEB A;  4XIG Q;  5H8S A;  4U4S A;  3SET A;  2LAO A;  1Y1M A;  3TOD A;  3RTF B;  4BDQ A;  5K2Y A;  2NVU B;  1H3D A;  1PB8 A;  3MZ1 A;  3QIM A;  4ZEK A;  2XXI A;  3CG3 A;  2HEU A;  1B3F A;  3GBB A;  5AA2 D;  4POW A;  3U93 A;  1URG A;  3LC8 A;  1D3K A;  4FOR A;  4JSO A;  4EQ7 A;  4R6H A;  4Z7E A;  5CBS A;  1BIY A;  4O3A A;  5ISU A;  3H03 A;  3U8Q A;  1Z7N E;  4UA8 A;  3CFX A;  3P7I A;  4NF5 A;  4PQJ A;  5TP9 A;  3T9H B;  1MPD A;  2H9B A;  1B3H A;  5BWJ A;  1XOC A;  5CMK A;  1XHY A;  3OO9 A;  4OMB A;  1OQG A;  4KQP A;  5FTH A;  5IAI A;  4DXC A;  4GRK A;  5KZT A;  1O7T A;  1USY E;  2DE4 A;  3PPR A;  4LVQ A;  3S9M C;  1FTK A;  5AA4 A;  2ZYM A;  4YKI A;  5KCJ B;  5B7D A;  3AXF A;  2QMX A;  4IY6 A;  1JW5 A;  2H4I A;  3IOW A;  3TEL A;  1OVT A;  3FXU A;  4XKQ A;  2QRY A;  3G3H A;  3KSX A;  4GL8 A;  3SER A;  1PB7 A;  3KN7 A;  5H8Q A;  5ICQ A;  4NWC A;  3WAF A;  2ZNS A;  5AA2 A;  3G3J A;  2ALU A;  3O28 A;  4R9G A;  4XTC Q;  2QMW A;  3FVO A;  2WKY A;  4F39 A;  4GD5 A;  3K1N A;  1B3L A;  1LAF E;  4OEU A;  4RK9 A;  4WKM A;  3MPL A;  1MQD A;  5EHS A;  3THI A;  1QKA A;  1JVX A;  4G68 C;  4BDM A;  4EQ9 A;  1Y3Q A;  4ZEB A;  3MJN A;  3MWB A;  4BLA A;  1MRP A;  2QSX A;  1GR2 A;  2Y7K A;  4OVJ A;  4ZDM A;  4YMA A;  3LSL A;  2I6E A;  2QS3 A;  3EPE A;  4KHZ E;  1MS7 A;  4G4P A;  4LZ7 A;  1P1Q A;  2FYI A;  3K00 A;  2XD3 A;  3PUZ E;  1LFG A;  1IEJ A;  4FEC A;  4HS7 A;  4ZEF A;  2OK2 A;  5I58 A;  4LZ8 A;  2XXP A;  3PV0 E;  1D9Y A;  4IY5 A;  2DXR A;  2UVI A;  2I3W A;  1LST A;  4U23 A;  4DE8 A;  3GXA A;  3PMV A;  3PPO A;  4DZ1 A;  2B3B A;  4GLI A;  1NKX A;  4EXL A;  1AIV A;  4H1X A;  1MM6 A;  4I9D A;  2XXT A;  3FVK A;  3IAZ A;  3KSJ A;  4JXI A;  3N6U A;  4KFQ A;  5FHM A;  4X1D A;  1B51 A;  4ZZE A;  3TYH A;  3U1O A;  1LFI A;  3ECR A;  5ITO A;  2F36 A;  2DP8 A;  1FQF A;  3CIJ A;  2AL5 A;  2CZL A;  4OTE A;  4MLV A;  1Y4T A;  5I2N B;  4R75 A;  4X1B A;  1Y3N A;  3PUX E;  4Q0C A;  2ZNU A;  2G29 A;  3G3I A;  2F7C A;  4E0X A;  1B3E A;  2B65 A;  4M1V A;  1D9V A;  1ZMG A;  4GQO A;  2RF1 A;  4L17 A;  4RK2 A;  1L5T A;  3TZA A;  1IXC A;  3G3G A;  4OEN A;  1FQE A;  2HFB A;  3MW0 A;  5KDT B;  1MH3 A;  1PBQ A;  2F7B A;  4QFO A;  3KOT A;  3H4Z A;  3Q27 A;  3SEV A;  1AH5 A;  2X7P A;  4RNS A;  3Q29 A;  4QSC A;  4FAT A;  5I57 A;  2VD3 A;  2QL3 A;  3HCQ A;  3VVF A;  3MVX A;  3VXB A;  4R2B A;  1D4N A;  1B32 A;  1DPP A;  3GZG A;  5L9O A;  4RPN A;  3FAS A;  3HV1 A;  5I58 B;  1A8E A;  2NOO A;  3DP4 A;  3G3K A;  2DWA A;  3ZKL A;  2F35 A;  1P1N A;  1BLF A;  3OEL A;  4XKP A;  1N3W A;  3O6I A;  1PDA A;  2V3Q A;  3CG1 A;  3EHT A;  4YAH X;  1IXG A;  1A7L A;  3K6U A;  3VLW A;  4BDR A;  4H5F A;  5LOM A;  2DVC A;  3IJO B;  4MBP A;  4E0W A;  1JNF A;  3T9X B;  4X9T A;  1AMF A;  3V5A A;  4H67 A;  4OYV A;  1SBP A;  4Q8R A;  4GF8 A;  5JK4 A;  4F1V A;  3N6T A;  5CBR A;  1MY1 A;  4OZ9 A;  2Q2A A;  3IB2 A;  3SEY A;  1LCT A;  1N7X A;  1Y1Z A;  3MUQ A;  2CMO A;  1MQH A;  1YAE A;  4PP0 A;  4EDP A;  2PT2 A;  1POY 1;  2B3F A;  3R6U A;  4PFW A;  3W15 C;  3BKI B;  1R9L A;  4MF3 A;  5H8F A;  1NH7 A;  3QSL A;  3FIR A;  1QUJ A;  3CFZ A;  4LA9 A;  2Z8D A;  4ZZA A;  1AOV A;  2Z8E A;  2O69 A;  3OO8 A;  3S9E A;  4ESW A;  3B6W A;  3MVY A;  3PUW E;  3FZV A;  5FHN A;  4ECF A;  5A5X B;  4IO5 A;  3KOS A;  1MY4 A;  2F8D A;  4RYA A;  4NF6 B;  1Q1K A;  2XXR A;  2DWI A;  1EU8 A;  1JW1 A;  2HAU A;  3CRB A;  1NL5 A;  4NF5 B;  1CB6 A;  2GH9 A;  2Y7I A;  4QFP A;  5DVJ A;  1TFD A;  4ELR A;  1IIT A;  3O6H A;  3MPK A;  3TPA A;  4EUO A;  3SDF A;  3TAJ A;  4HCY A;  4IGR A;  3K0V A;  3TQW A;  4AQ4 A;  4YMB A;  2OWT A;  3KG2 A;  1ATG A;  4I8C A;  3GLB A;  1QUK A;  1F9B A;  3TCG A;  1XVX A;  4RJZ A;  5HPQ A;  1MDQ A;  3LUY A;  2IEE A;  5DTB A;  4H6D A;  1USY H;  4IO7 A;  4ISU A;  5F7V A;  2Q89 A;  5L9M A;  4F3B A;  5KCJ A;  1N3X A;  1VSO A;  2DWH A;  3K6W A;  3VVE A;  1QUL A;  3TMG A;  4KI0 E;  1P99 A;  2KLF A;  3IOV A;  3ILU B;  1BP5 A;  1OIB A;  2RC7 A;  3LSW A;  2XXV A;  1UIV A;  3PPP A;  2G93 A;  4NF8 A;  2XHD A;  3IO4 A;  4G8N A;  3T9U A;  1PC3 A;  3RT6 B;  3TQL A;  3PPQ A;  4QF9 A;  3OSR A;  3VXC A;  5TP9 B;  3MBP A;  1GGG A;  3O6G A;  4G2Z A;  5DYH A;  4KCD A;  1MPB A;  4F3G A;  1MQJ A;  2RC9 A;  4R6Y A;  2ABH A;  2ZNT A;  1UQW A;  3OEK A;  5CI5 A;  2Q2C A;  3S9L C;  2F5X A;  1LB9 A;  2GHA A;  5HM4 B;  3RQT A;  3VDF A;  4ELO A;  1RYX A;  3IB0 A;  3U72 A;  3UK4 A;  1IQ7 A;  4F3P A;  4ZS9 A;  3PMX A;  1MY0 A;  2X7Q A;  4M4G A;  1Q35 A;  3TTM A;  1SI1 A;  1UIU A;  5TPA A;  3K4U A;  1NNF A;  2HZK A;  2OCU A;  2RIN A;  3TTR A;  3VLV A;  2DXY A;  3L6G A;  3PMW A;  2O7I A;  4DCY A;  3S9N C;  1NNK A;  4ZE9 A;  4QFL A;  3H6T A;  2I48 A;  4N07 A;  1P1U A;  3ILT B;  1H76 A;  2HAV A;  1TFA A;  3H6W A;  1MXU A;  3S4U A;  3SES A;  4YKP A;  2XXQ A;  4AB6 A;  3PU5 A;  4H5G A;  4C1T A;  1JEU A;  5CMM A;  1QKB A;  4RPO A;  3VV5 A;  4TLL B;  4P11 A;  3HN0 A;  4TQU Q;  5DEX B;  4F2O A;  4QFK A;  4GFR A;  1YPN A;  2QS2 A;  4P0I A;  2XXX A;  2XXH A;  3BFU A;  1DTZ A;  3KJ7 A;  2OZZ A;  4IO6 A;  1MXV A;  4LQ5 A;  4U2R A;  4ZEC A;  3EQ1 A;  4HTG A;  3USD A;  2P2A A;  2Z23 A;  1WVJ A;  5CC2 A;  1LFH A;  3RTW B;  1OLA A;  1R1N A;  4G8M A;  1FQA A;  1I6B A;  5M2V A;  4NMY A;  5AA4 B;  5DVI A;  4OWD A;  2ZYK A;  1SYI A;  2ZXT A;  4KR5 A;  4R6K A;  1Y20 A;  4XKR A;  1TWY A;  4QHQ A;  1B7H A;  2REG A;  4K3F A;  2REJ A;  4PFU A;  4OET A;  4R74 A;  1FTL A;  1EH3 A;  3UGW A;  2PYY A;  3TTN A;  3B7D A;  3K6V A;  2A5T B;  4NED A;  2XX7 A;  1IXI A;  4Q30 B;  3PUV E;  2AYS A;  5JTY A;  3E3K A;  3N5L A;  2O51 A;  2R9J A;  3OO6 A;  4Q5T A;  3EN3 A;  3OEM A;  2VOZ A;  1LCF A;  2F7A A;  1OMP A;  2I0B A;  2PX1 A;  3KN3 A;  3C32 A;  4F1U A;  3JZJ A;  3QXM A;  1B7U A;  3FJG A;  2H5Y A;  4N6P A;  1ZTY A;  4U1O A;  3OD7 A;  4GXS B;  4DIG A;  4EF2 A;  3U92 A;  2RKM A;  3MAM A;  3Q25 A;  5I57 B;  1SW4 A;  2UYF A;  1B5J A;  1MM7 A;  4MFI A;  4YB5 A;  3T9V A;  4DXB A;  1I6A A;  1RKM A;  3MVZ A;  1XC1 A;  3M8U A;  4UAC A;  2XD2 A;  5H8H A;  1ZLQ A;  4FE8 A;  4EF1 A;  1OQH A;  3K6X A;  2UYE A;  2XXY A;  2NUV A;  3DP8 A;  3RN8 A;  1XS5 A;  3UN6 A;  3IO6 A;  1WDN A;  4OHN A;  1N84 A;  1NMU A;  1R9Q A;  3IK6 B;  4KYD A;  3I5O A;  4OER A;  4H8J A;  2PT1 A;  2Y7P A;  2Q8J A;  1O64 A;  4F22 A;  4YKK A;  3GBA A;  4JWX A;  3SKP A;  2O1L A;  1MQG A;  4NF8 B;  1A55 A;  1HSJ A;  2OJT A;  2Z8F A;  3H3G A;  1XVY A;  3R7X A;  2V93 A;  2NXO A;  4HW8 A;  2PVU A;  1O63 A;  1P1O A;  1TT1 A;  3C35 A;  2P0S A;  5HBC A;  3MZ9 A;  2VHA A;  5H8F B;  1JW4 A;  1ANF A;  3Q28 A;  4OEV A;  1SI0 A;  2IA4 A;  3TEP A;  3RPW A;  2V84 A;  3IOR A;  4YKJ A;  1LGB C;  3FVN A;  4LON B;  1ZU0 A;  1IUD A;  2XXW A;  1ZIU A;  3DP6 A;  1DOT A;  1MQI A;  3FXR A;  3PD8 A;  4H0W A;  4P0G A;  4ONY A;  4NF4 A;  1DSN A;  4X48 A;  3T66 A;  2YJP A;  4EQB A;  5KDT A;  4QSE A;  2UXA A;  1UTB B;  4ND9 A;  4YU0 A;  4KYE A;  1SW2 A;  1XT8 A;  1YCJ A;  2DE3 A;  3DM0 A;  3IOT A;  3OO7 A;  3QUJ A;  3R26 A;  4G68 B;  4GIZ A;  4OFO A;  1UTB A;  1NH8 A;  1Y4C A;  4U21 A;  3A3C A;  3M3K A;  2PBW A;  1M5F A;  3K01 A;  1BKA A;  4H65 A;  3UP9 A;  4G68 A;  4F1Y A;  1B52 A;  2I3V A;  1JET A;  3B6Q A;  3FD3 A;  5H8N B;  3ZKK A;  3QK6 A;  1NFT A;  3FUZ A;  3TUS A;  2E0S A;  3MC2 A;  4TOZ A;  3VFJ A;  1JQF A;  1GTK A;  1GVC A;  4BDL A;  1Y3P A;  1Y9U A;  1B46 A;  4JWY A;  4KCC A;  4ELP A;  1MXW A;  2YLN A;  2F78 A;  3M3F A;  4WXJ A;  1A54 A;  1B05 A;  1LLS A;  2ZYN A;  1ZBM A;  3OOA A;  1URS A;  2QS4 A;  2V25 A;  3FAT A;  5FTI A;  1MXY A;  1PB9 A;  4ESX A;  3V83 A;  4AB5 A;  3UA8 A;  2RCA A;  2ESN A;  3HHF A;  1IZ1 A;  3HST A;  2O1M A;  2ONS A;  5I2K A;  2OBG A;  4DLD A;  3UIF A;  3RT8 A;  3WAE A;  4ELQ A;  1SQY A;  3Q26 A;  1FTM A;  4F29 A;  1AL3 A;  3TTK A;  1M5B A;  5DEX A;  1OLC A;  2DYX A;  1MY2 A;  1MH4 A;  3VE1 B;  3K2D A;  4F31 B;  3O9P A;  4RA1 A;  3T22 A;  5L8D A;  2UVH A;  5AA3 A;  1LAH E;  5CM6 A;  1LBB A;  4THI A;  1NNP A;  3N26 A;  4FIM A;  5I56 B;  4DCX A;  3RNN A;  2DSF A;  3H7M A;  1H45 A;  5H8H B;  2PMS A;  4GL0 A;  2O6A A; 
#chains in the Genus database with same CATH topology
 1DCU A;  3C36 A;  3CI8 A;  4MNP A;  2ZMB A;  4ZEI A;  4GVO A;  5I5P A;  5DVF A;  4MMP A;  4JWO A;  2I4C A;  3QYT A;  1VR5 A;  3FV2 A;  4OFJ A;  3ONM A;  4I1D A;  4I62 A;  4N13 A;  2AL4 A;  2O68 A;  3FGS A;  4I3E A;  5F1Q A;  1I6Q A;  3KEI A;  4LQ2 A;  3F11 A;  1G0I A;  3O29 A;  2QJE A;  2GHB A;  3OMB A;  4MEV A;  4KD5 A;  4YIC A;  2R71 A;  1SPI A;  2Q88 A;  5A5X A;  4X8R A;  5ICT A;  2XXU A;  3IOU A;  3DLN A;  4LZ5 A;  5J1D A;  3I6V A;  4GWZ A;  2VPN A;  3K02 A;  4WEP A;  4GWO A;  2GRV A;  4PFY A;  4FAJ A;  4PGN A;  2I49 A;  2ONK E;  2YPN A;  4IGT A;  3IX1 A;  2KR0 A;  3D4C A;  5I84 A;  5LTC A;  4R2F A;  2OWZ A;  1FQB A;  2H99 A;  2XWK A;  1QGX A;  1RYO A;  3KN8 A;  4LAT A;  3KZG A;  2R6G E;  4FED A;  1N76 A;  1FW0 A;  1B9J A;  2ZYO A;  4OES A;  2GFE A;  2F34 A;  3PPN A;  1FTO A;  5H8Q B;  3KGC A;  5EQ9 A;  1LB8 A;  3CSG A;  3UGW A;  4U1Z A;  4PE3 A;  2D5W A;  5EHM A;  1B0L A;  4G77 A;  1G0H A;  4PF6 A;  3T96 B;  1INP A;  4IB2 A;  4OXV A;  3MZB A;  1S9T A;  2Y5K A;  4IO2 A;  1B1H A;  3HHG A;  2Y7R A;  3KBZ A;  1NV0 A;  3C31 A;  3MQ9 A;  4JDF A;  2ONR A;  4JSD A;  5ESY A;  1MXZ A;  4O8M A;  1EZP A;  4C1U A;  3TFL A;  3IL1 B;  1UTH A;  3NOH A;  3SET A;  5J16 A;  2NVU B;  3MZ1 A;  1RDZ A;  2XXI A;  5AA2 D;  4PDD A;  4POW A;  3U93 A;  4EQ7 A;  5CBS A;  4O3A A;  1MPD A;  3OO9 A;  1OQG A;  4DXC A;  5KZT A;  3S9M C;  4YKI A;  5B7D A;  1FPD A;  2H4I A;  3IOW A;  1OVT A;  3FXU A;  4GL8 A;  4PBQ A;  3O28 A;  3FVO A;  3K1N A;  2ZZV A;  1MQD A;  3B50 A;  1FBF A;  1Y3Q A;  3MJN A;  3MWB A;  2QSX A;  4LZ7 A;  1P1Q A;  2FYI A;  4HS7 A;  1LBY A;  4LZ8 A;  2WYP A;  2XXP A;  1D9Y A;  4IY5 A;  2DXR A;  2I3W A;  1MM6 A;  4I9D A;  3FVK A;  5FHM A;  3U1O A;  1B51 A;  2AL5 A;  4MLV A;  1Y4T A;  4X1B A;  2G29 A;  4M1V A;  1D9V A;  1ZMG A;  2RF1 A;  2VT5 A;  4OVQ A;  4OEN A;  2HFB A;  3MW0 A;  1MH3 A;  2F7B A;  1NV7 A;  1AH5 A;  5I57 A;  4FAT A;  2VD3 A;  4JVI A;  1D4N A;  3GZG A;  3HV1 A;  3ZKL A;  2F35 A;  5HBC A;  1BLF A;  4YAH X;  3CG1 A;  1IXG A;  3VLW A;  3V5A A;  1DK4 A;  4H46 A;  1Y1Z A;  3MUQ A;  3D1R A;  2PT2 A;  4PFW A;  4DI3 D;  4MF3 A;  1FPG A;  3QSL A;  3FIR A;  4LA9 A;  4ZZA A;  2Z8E A;  2O69 A;  3OO8 A;  3MVY A;  3PUW E;  4ECF A;  2XXR A;  2DWI A;  2HAU A;  4NF5 B;  4AS5 A;  2GH9 A;  4QFP A;  5DVJ A;  4ELR A;  1IIT A;  3MPK A;  3TPA A;  4HCY A;  4AQ4 A;  3ROJ A;  5IZZ A;  5ET8 A;  3KG2 A;  1FPJ A;  1F9B A;  1XVX A;  2IEE A;  4H6D A;  1USY H;  4IO7 A;  4X04 A;  4F3B A;  2Q89 A;  2DWH A;  3E78 A;  3BIG A;  3TMG A;  4KI0 E;  3IOV A;  3ILU B;  1BP5 A;  4NF8 A;  3IO4 A;  2RC9 A;  3OEK A;  2Q2C A;  5EQ7 A;  4ELO A;  1RYX A;  1SI1 A;  5TPA A;  2O7I A;  4DCY A;  3S9N C;  2I48 A;  4N07 A;  1H76 A;  2XXQ A;  3PU5 A;  4H5G A;  1JEU A;  4RPO A;  3VV5 A;  1LBW A;  2WBD A;  1YPN A;  2QS2 A;  3BFU A;  3SZP A;  5CC2 A;  1WVJ A;  1R1N A;  1FQA A;  5AA4 B;  1Y20 A;  4QHQ A;  4K3F A;  2REJ A;  3TTN A;  3B7D A;  2QVR A;  2XX7 A;  5JTY A;  3N5L A;  5IM2 A;  2O51 A;  2R9J A;  2VOZ A;  3C32 A;  4F1U A;  3JZJ A;  3OD7 A;  5ET7 A;  4YB5 A;  4MIJ A;  2XD2 A;  5EYH A;  1ZLQ A;  2XXY A;  3DP8 A;  3UN6 A;  3IO6 A;  1R9Q A;  2Q8J A;  4OER A;  2Y7P A;  1NV1 A;  1MQG A;  4HW8 A;  2PVU A;  1TT1 A;  3C35 A;  3GYY A;  2VHA A;  1JW4 A;  1ANF A;  3KC0 A;  2V84 A;  3IOR A;  4YKJ A;  3FVN A;  1ZIU A;  4H0W A;  4ONY A;  1XT8 A;  3RPL A;  3DM0 A;  3OO7 A;  3UA8 A;  4UAC A;  4G68 B;  4OFO A;  4GIZ A;  4EXK A;  1NH8 A;  4F1Y A;  1NFT A;  2CEY A;  3MC2 A;  4TOZ A;  4JWY A;  4ELP A;  3M3F A;  1B05 A;  2ZYN A;  3OOA A;  4ESX A;  3FAT A;  1PB9 A;  1EYK A;  3E79 A;  3HHF A;  3HST A;  3LV0 A;  5I2K A;  4DLD A;  1NV3 A;  1RDY A;  3Q26 A;  1AL3 A;  1OLC A;  3VE1 B;  4F31 B;  3K2D A;  1NNP A;  2PFZ A;  3N26 A;  4FIM A;  2PMS A;  4GL0 A;  1MDP 1;  2WX9 A;  2DS9 A;  1MG1 A;  2XX9 A;  5T3J A;  1MXX A;  2XXK A;  3SEX A;  3H6U A;  1A40 A;  3BBR A;  5JTY B;  1FPI A;  4KYS A;  2OLB A;  3TTL A;  4HCW A;  2JJK A;  4NF6 A;  3LSX A;  5I2K B;  5L9S A;  2D3I A;  3QUF A;  3CFL A;  2H98 A;  1OVB A;  1K9Z A;  4DI4 B;  1NV6 A;  2Z22 A;  3OXN A;  3MP6 A;  4P47 A;  4LUB A;  4WED A;  3T93 B;  3FJ7 A;  4F19 A;  5JEI A;  1ELJ A;  4N8G A;  1N04 A;  1HSE A;  4H8I A;  2WEF A;  1WOD A;  4U4X A;  3CR9 A;  3FJM A;  5K2X A;  4RY1 A;  3LSF B;  1TXF A;  1URD A;  5I56 A;  1SD3 A;  4PDH A;  1S50 A;  5CMC A;  1LAX A;  3OSQ A;  3UOR A;  3SEW A;  1SDX A;  2NWJ A;  2OWS A;  3ZS6 A;  3KFM A;  5ET6 A;  4OFL A;  2QVU A;  3H6V A;  2HZL A;  4MH5 A;  1LBC A;  4F18 A;  1B6H A;  1FTJ A;  4GXA A;  3C9H A;  5DT6 A;  3CVG A;  4XKN A;  3MVW A;  1B4H A;  2A5T A;  5EQ8 A;  4HE0 A;  3K1M A;  3BFT A;  1CNQ A;  3C34 A;  4C0R A;  5CMB A;  2V3U A;  1P1W A;  3A09 A;  2A5S A;  1EZ9 A;  1J1N A;  3U94 A;  4ZE8 A;  4FJP A;  2V4C A;  3PGF A;  4F2Q A;  2M8C A;  3TCF A;  4PET A;  1QVS A;  5I2N B;  3ZSF A;  3IFC A;  4GX3 A;  3FXQ A;  4KPT A;  2FA7 A;  3V89 B;  2F3B A;  3RLF E;  4ZED A;  4XIG Q;  2GQ1 A;  4BDQ A;  1H3D A;  4OVT A;  4JSO A;  4FOR A;  4Z7E A;  3H03 A;  4UA8 A;  3CFX A;  3P7I A;  5TP9 A;  2H9B A;  5BWJ A;  5CMK A;  4OMB A;  5IAI A;  2DE4 A;  3PPR A;  2P3V A;  1JW5 A;  3TEL A;  4XKQ A;  3QMF A;  5H8Q A;  2ZNS A;  3G3J A;  4F39 A;  2WKY A;  1B3L A;  1LAF E;  4RK9 A;  4WKM A;  4FBP A;  2I6E A;  4G4P A;  3K00 A;  4FEC A;  2OK2 A;  2B3B A;  1NKX A;  2FVZ A;  4X1D A;  3ECR A;  1FQF A;  5I3S A;  3PUX E;  4Q0C A;  2F7C A;  4GQO A;  4I3Y A;  1IXC A;  1FPL A;  5KDT B;  3H4Z A;  3Q27 A;  3SEV A;  5I59 A;  3MVX A;  4R2B A;  5L9O A;  4P1L A;  1FJ9 A;  1A8E A;  3DP4 A;  2DWA A;  5LDZ A;  5EHS A;  4BDR A;  1A7L A;  4H5F A;  2QFL A;  3IJO B;  4MBP A;  4PCD A;  4X9T A;  1AMF A;  1SBP A;  4Q8R A;  4GF8 A;  4N6D A;  4QBA A;  1MY1 A;  2Q2A A;  3IB2 A;  1LCT A;  2CMO A;  4PP0 A;  4EDP A;  3R6U A;  5H8F A;  1FBE A;  1QUJ A;  3CFZ A;  3B6W A;  5A5X B;  3KOS A;  1FBG A;  3CRB A;  1CB6 A;  2XA5 A;  4GWU A;  4EUO A;  4YMB A;  2OWT A;  4I8C A;  4GBW A;  1BK4 A;  4GX4 A;  4ISU A;  4G61 A;  1N3X A;  3K6W A;  1FTA A;  2KLF A;  1OIB A;  1UIV A;  2G93 A;  2XHD A;  3TQL A;  3O6G A;  4G2Z A;  5DYH A;  4KCD A;  3S9L C;  2CZH A;  3RQT A;  3IB0 A;  3UK4 A;  4F3P A;  4ZS9 A;  2X7Q A;  4N15 A;  1Q35 A;  2QVV A;  1NNF A;  2RIN A;  4O7M A;  3VLV A;  4IR8 A;  4ZE9 A;  1IMD A;  4GWY A;  2KQZ A;  3ILT B;  2HAV A;  3H6W A;  1MXU A;  3SES A;  4AB6 A;  1NUY A;  3HN0 A;  4TQU Q;  5DEX B;  4F2O A;  4BDO A;  1DTZ A;  4HTG A;  3USD A;  2P2A A;  2Z23 A;  1LFH A;  1OLA A;  5M2V A;  1SYI A;  1XI6 A;  2REG A;  1FTL A;  1VDW A;  4NQ8 A;  3K6V A;  4NED A;  1IXI A;  3PUV E;  4PAF A;  1NUX A;  4NN3 A;  3OO6 A;  1LCF A;  2I0B A;  3KN3 A;  2PX1 A;  4N8Y A;  3A29 A;  3QXM A;  2H5Y A;  4U1O A;  4DIG A;  4HE1 A;  2RKM A;  3Q25 A;  5I57 B;  1SW4 A;  2UYF A;  1B5J A;  1MM7 A;  5I7I A;  1I6A A;  1XC1 A;  3M8U A;  4GWX A;  1OQH A;  3K6X A;  4PTK A;  3RN8 A;  4OHN A;  1NMU A;  3I5O A;  5EYG A;  1O64 A;  1DBZ A;  4HXV A;  3GBA A;  1LBV A;  1P1O A;  2P0S A;  5H8F B;  3Q28 A;  2IA4 A;  1FRP A;  3PD8 A;  4P0G A;  4EQB A;  2YJP A;  5KDT A;  4PGP A;  4ND9 A;  4KYE A;  3IOT A;  4PQJ A;  3R26 A;  1UTB A;  3M3K A;  3UP9 A;  1JET A;  5H8N B;  3FUZ A;  1JQF A;  1GTK A;  1NV4 A;  1GVC A;  4BDL A;  1MXW A;  4WXJ A;  2HHM A;  3S9E A;  3V83 A;  1MXY A;  2FIX A;  2ESN A;  2ONS A;  3RT8 A;  3WAE A;  1SQY A;  1FTM A;  4F29 A;  5DEX A;  5L8D A;  1LAH E;  3EKI A;  3H7M A;  5H8H B;  2O6A A;  3E4R A;  3OEN A;  4QRZ A;  3HPI A;  3H06 B;  1LBX A;  4F3S A;  1FQC A;  2W7Y A;  1B58 A;  3MP8 A;  1B5H A;  1MY3 A;  2O84 X;  1VE4 A;  1EZO A;  5IGA A;  4P56 A;  2UVG A;  3MYU A;  2Y7W A;  2F6P A;  4BDN A;  4YB6 A;  4QXD A;  1I69 A;  5H8N A;  4GOT A;  1FCK A;  1B0H A;  4R9F A;  3PUY E;  2L5V A;  4DDD A;  3EF7 A;  4POX A;  3M3L A;  3FVG A;  1FQD A;  3RY3 A;  1SW1 A;  3C33 A;  4NGU A;  1US4 A;  1QW0 A;  3V8X B;  4NE4 A;  1GV8 A;  3KBR A;  1M5E A;  1H43 A;  1B2H A;  1M5D A;  5AA1 A;  2ANJ A;  3TKD A;  5IZ3 B;  3E9X A;  4GBV A;  3IB1 A;  1B40 A;  3ODB A;  3VLU A;  1IMF A;  2XX8 A;  4IO3 A;  4QFN A;  4PFB A;  1RDX A;  2FNC A;  4XEQ A;  2FHY A;  3RUM A;  2O7U A;  3D4G A;  3EHU A;  3IR1 A;  4NF0 A;  3S2V A;  3O66 A;  2RCB A;  3G3F A;  1SW5 A;  4Z0I A;  3JV9 A;  4I40 A;  1HSL A;  3JYR A;  2AIX A;  1IXH A;  1SVX B;  1B4Z A;  2Q74 A;  1Q9D A;  3HO7 A;  5TU0 A;  2HQ0 A;  2Y84 A;  3IFA A;  3LR1 A;  1KWH A;  3EHS A;  3FXB A;  5EYF A;  1QJM A;  4DXU A;  3CSB A;  2OX3 A;  4GWS A;  4TLM B;  3FV1 A;  2Y5L A;  2I4B A;  2F6G A;  1N0T A;  1B7Z A;  3O97 A;  1H44 A;  2E1S A;  1CE2 A;  1YXI A;  5L9M A;  3RPL B;  1M5C A;  1DTG A;  4QSD A;  4NF4 B;  2UVJ A;  2Q8M A;  4IO4 A;  1PEB A;  5H8S A;  4U4S A;  3TOD A;  5K2Y A;  1PB8 A;  3GBB A;  4KXP A;  1NI9 A;  1URG A;  1D3K A;  1Z7N E;  3T9H B;  4KQP A;  4GRK A;  1USY E;  1FTK A;  3AXF A;  2QMX A;  4IY6 A;  2QRY A;  3G3H A;  3KSX A;  4N6K A;  5ICQ A;  4NWC A;  3WAF A;  5AA2 A;  2ALU A;  4XTC Q;  3U65 A;  4H45 A;  3THI A;  1QKA A;  1JVX A;  1NV5 A;  4BDM A;  4EQ9 A;  4ZEB A;  1MRP A;  4OVJ A;  1GR2 A;  2B4M A;  3EPE A;  1MS7 A;  4ZEF A;  4P8B A;  3PUZ E;  2XD3 A;  1LFG A;  2P3N A;  3PV0 E;  4DE8 A;  1AIV A;  3GXA A;  3PMV A;  3PPO A;  4H1X A;  3IAZ A;  1NUW A;  3N6U A;  4KFQ A;  3TYH A;  2CZL A;  4OTE A;  4R75 A;  2FBP A;  3G3I A;  3TZA A;  4UAB A;  1FQE A;  1KA0 A;  3B8B A;  3Q29 A;  3HCQ A;  2CZI A;  3FAS A;  5I58 B;  1P1N A;  3OEL A;  4XKP A;  1PDA A;  2V3Q A;  4AS4 A;  3EHT A;  1FBP A;  1JNF A;  3T9X B;  4H67 A;  5ET5 A;  4OZ9 A;  2PFY A;  1YAE A;  3BKI B;  1NH7 A;  5F24 A;  1AOV A;  3FZV A;  5FHN A;  2F8D A;  4RYA A;  4NF6 B;  1EU8 A;  3MST A;  1FSA A;  3O6H A;  4OAN A;  3SDF A;  1FBH A;  4IGR A;  3K0V A;  1ATG A;  3GLB A;  1QUK A;  1MDQ A;  5KCJ A;  1VSO A;  2PCR A;  1P99 A;  2RC7 A;  1PC3 A;  3RT6 B;  3PPQ A;  4QF9 A;  3OSR A;  3VXC A;  5TP9 B;  3MBP A;  1GGG A;  4F3G A;  4MHF A;  4R6Y A;  2ABH A;  2ZNT A;  2F5X A;  2GHA A;  5IZ3 A;  5HM4 B;  4MNC A;  3VDF A;  3U72 A;  4PAK A;  1MY0 A;  1UIU A;  3K4U A;  2HZK A;  3TTR A;  2OCU A;  3L6G A;  1NNK A;  4HE2 A;  3H6T A;  3CHG A;  1TFA A;  2XWO A;  3S4U A;  4C1T A;  5CMM A;  4TLL B;  4P11 A;  4GFR A;  2XXX A;  3KJ7 A;  2OZZ A;  4IO6 A;  4LQ5 A;  3EQ1 A;  4O7I A;  2WYK A;  4NMY A;  1IMB A;  4PF8 A;  4XKR A;  1TWY A;  1B7H A;  4PFU A;  4R74 A;  2PYY A;  2A5T B;  4Q30 B;  2AYS A;  3E3K A;  4Q5T A;  2F7A A;  5EQA A;  1B7U A;  3FJG A;  4N6P A;  4PAI A;  4NX1 A;  4GX6 A;  4DXB A;  3MVZ A;  5H8H A;  4XF5 A;  4FE8 A;  4EF1 A;  2UYE A;  2NUV A;  1XS5 A;  1WDN A;  1N84 A;  4KYD A;  5A5L A;  4OVR A;  4H8J A;  2PT1 A;  4F22 A;  4YKK A;  1FPK A;  4JWX A;  4N91 A;  2O1L A;  3SKP A;  1A55 A;  1XVY A;  2V93 A;  1JP4 A;  3MZ9 A;  4OEV A;  1IMA A;  3TEP A;  1LGB C;  1LEV A;  1ZU0 A;  1IUD A;  1DOT A;  3FXR A;  4JVC A;  4NF4 A;  2UXA A;  4YU0 A;  1SW2 A;  1YCJ A;  2DE3 A;  3QUJ A;  1Y4C A;  3A3C A;  1M5F A;  3K01 A;  1BKA A;  3B6Q A;  3FD3 A;  3ZKK A;  3QK6 A;  3VFJ A;  1Y9U A;  1B46 A;  4KCC A;  2F78 A;  1A54 A;  1LLS A;  1ZBM A;  2QS4 A;  2RCA A;  1IZ1 A;  2CZK A;  2O1M A;  3UIF A;  4ELQ A;  3TTK A;  1M5B A;  1MY2 A;  3T22 A;  5AA3 A;  2ZZX A;  5I56 B;  4DCX A;  1H45 A;  3TDJ A;  5ITO A;  4YZZ A;  2XWV A;  4MJO A;  5TPA B;  1FPB A;  4PE5 B;  5IKB A;  4G8H A;  3QAX A;  1BTJ A;  5F7V A;  3DEL B;  3TCH A;  1ZKB A;  2DDK A;  5BUU A;  2BJJ X;  4NAP A;  2XWI A;  1II5 A;  2F97 A;  4XXU A;  5B70 A;  3KC1 A;  3W9W A;  5ELV A;  1UTH B;  1B3G A;  4NTL A;  2BJI A;  3E13 X;  5DW8 A;  1NV2 A;  4FEB A;  1B5I A;  1ZJL A;  5FHO A;  3KJT A;  1S7Y A;  2HCA A;  4R73 A;  4YB7 A;  3I3V A;  1N7W A;  1QUI A;  4LP2 B;  2Q9T A;  3N94 A;  1AWB A;  2VP1 A;  4O3B A;  2DOJ A;  3G7W A;  4R72 A;  2VD2 A;  5CRY A;  1DMB A;  1Z7M E;  1NNT A;  4JBZ A;  1DPE A;  1PBP A;  2V3T A;  1SYH A;  4LN5 A;  4P9K A;  2DVZ A;  4EF2 A;  3L6H A;  3K1P A;  3PTY A;  2B4L A;  1EYI A;  2HXW A;  3MP1 A;  5AE4 A;  2HPG A;  1B1X A;  1LAG E;  2QS1 A;  2DWJ A;  1MPC A;  3B6T A;  1US5 A;  2H25 A;  2DE2 A;  3C4M A;  5I2N A;  4MNI A;  4O3C A;  1VFE A;  1T0K A;  2P1S A;  3VVD A;  3A3U A;  3RGY A;  2D21 A;  1YTV A;  4JB7 A;  4NWD A;  4NHB A;  4DZ1 A;  4MLQ A;  3W9V A;  1POT A;  2DQV A;  3IJX B;  4OQO A;  4U22 A;  1JEV A;  4PFT A;  1A99 A;  2I58 A;  2X26 A;  1A8F A;  2QPQ A;  3PD9 A;  1VFD A;  5ITP A;  1IIW A;  1YYZ A;  1JVY A;  2RC8 A;  2I0C A;  3LBS A;  4RXL A;  4NG7 A;  3SEU A;  2VGQ A;  3O2A A;  1R6Z A;  2THI A;  4N81 A;  5AA2 B;  2LAO A;  1Y1M A;  3RTF B;  3QIM A;  4ZEK A;  3CG3 A;  2HEU A;  1B3F A;  2R8T A;  3LC8 A;  4R6H A;  1BIY A;  5ISU A;  2MKZ A;  3U8Q A;  4NF5 A;  1B3H A;  4O94 A;  1XOC A;  1XHY A;  5FTH A;  1O7T A;  4LVQ A;  5AA4 A;  2ZYM A;  5KCJ B;  3SER A;  1PB7 A;  3KN7 A;  1YZ0 A;  1FBD A;  4R9G A;  2QMW A;  4GD5 A;  4OEU A;  3HFU A;  3MPL A;  4G68 C;  1LBZ A;  4BLA A;  4ZDM A;  2Y7K A;  3LSL A;  4MX6 A;  2QS3 A;  4KHZ E;  5I58 A;  1IEJ A;  4U23 A;  2UVI A;  1LST A;  4EXL A;  4GLI A;  2XXT A;  3KSJ A;  4JXI A;  4ZZE A;  1LFI A;  2F36 A;  2DP8 A;  1D9Q A;  3CIJ A;  1Y3N A;  2ZNU A;  4E0X A;  1B3E A;  2B65 A;  4RK2 A;  4L17 A;  1L5T A;  2HXR A;  2VPO A;  3G3G A;  4GWW A;  4N4U A;  1PBQ A;  4QFO A;  3KOT A;  2X7P A;  4RNS A;  2QL3 A;  3VVF A;  3VXB A;  1B32 A;  1DPP A;  4RPN A;  4PFR A;  3T1B A;  2NOO A;  3G3K A;  1N3W A;  3O6I A;  3K6U A;  5LOM A;  2DVC A;  4E0W A;  1FPF A;  4OYV A;  5JK4 A;  4F1V A;  3N6T A;  1IME A;  5CBR A;  3SEY A;  1N7X A;  1MQH A;  1POY 1;  2B3F A;  3W15 C;  3BIH A;  1R9L A;  2Z8D A;  4ESW A;  4IO5 A;  1MY4 A;  3T0J A;  1KZ8 A;  1FBC A;  1Q1K A;  1FPE A;  1JW1 A;  1NL5 A;  2Y7I A;  4N17 A;  1TFD A;  2CEX A;  3TAJ A;  3TQW A;  3TCG A;  4RJZ A;  5HPQ A;  3LUY A;  5DTB A;  3VVE A;  1QUL A;  5FTI A;  3PPP A;  3LSW A;  2XXV A;  3T9U A;  4G8N A;  4P3L A;  4OA4 A;  1MPB A;  1MQJ A;  1UQW A;  1NUZ A;  5CI5 A;  1LB9 A;  1IQ7 A;  4OVS A;  3PMX A;  4M4G A;  3TTM A;  4PC9 A;  4PBH A;  2DXY A;  3PMW A;  4QFL A;  1P1U A;  4YKP A;  1QKB A;  4QFK A;  4P0I A;  2XXH A;  1MXV A;  4U2R A;  4MCO A;  4ZEC A;  3RTW B;  4G8M A;  1I6B A;  5DVI A;  4OWD A;  2ZYK A;  2ZXT A;  4KR5 A;  4R6K A;  4OET A;  1EH3 A;  3EN3 A;  3OEM A;  1FJ6 A;  1OMP A;  4P1E A;  1ZTY A;  4GXS B;  4MAG A;  3U92 A;  3MAM A;  2FIE A;  1EYJ A;  3LUZ A;  4XFE A;  4MFI A;  3T9V A;  2ZZW A;  1RKM A;  4OVP A;  3RYD A;  2WBB A;  4QSC A;  3IK6 B;  4NF8 B;  1HSJ A;  2OJT A;  2Z8F A;  3H3G A;  3R7X A;  1K9Y A;  2NXO A;  1O63 A;  1KA1 A;  1SI0 A;  3RPW A;  4LON B;  2XXW A;  3DP6 A;  1MQI A;  4X48 A;  3T66 A;  1DSN A;  4QSE A;  4JVD A;  1UTB B;  4YMA A;  4U21 A;  2PBW A;  4H65 A;  4G68 A;  1B52 A;  2I3V A;  3TUS A;  2E0S A;  1Y3P A;  2YLN A;  3ISP A;  5I59 B;  1URS A;  2V25 A;  3FBP A;  4PFI A;  4AB5 A;  5FBP A;  2OBG A;  2DYX A;  1IMC A;  1MH4 A;  3O9P A;  4RA1 A;  2UVH A;  5CM6 A;  1LBB A;  4THI A;  2F3D A;  3RNN A;  2DSF A;  5IZ1 A; 
#chains in the Genus database with same CATH homology
 1MDP 1;  3E4R A;  3OEN A;  4QRZ A;  3HPI A;  2DS9 A;  3H06 B;  4YZZ A;  5TPA B;  4F3S A;  1MG1 A;  2XX9 A;  3C36 A;  1MXX A;  3CI8 A;  4PE5 B;  2ZMB A;  1FQC A;  2W7Y A;  4ZEI A;  5IKB A;  3SEX A;  1B58 A;  4GVO A;  3H6U A;  1A40 A;  3MP8 A;  1B5H A;  5DVF A;  3BBR A;  4G8H A;  3QAX A;  5JTY B;  1BTJ A;  1MY3 A;  2O84 X;  4JWO A;  1VE4 A;  2I4C A;  3DEL B;  2OLB A;  3QYT A;  4KYS A;  4U1Z A;  3TCH A;  3TTL A;  1EZO A;  4HCW A;  1VR5 A;  1ZKB A;  4NF6 A;  3FV2 A;  5BUU A;  2BJJ X;  3LSX A;  4OFJ A;  5I2K B;  5L9S A;  3ONM A;  4I1D A;  2D3I A;  2UVG A;  3QUF A;  3CFL A;  2H98 A;  4I62 A;  4N13 A;  2AL4 A;  1II5 A;  1OVB A;  2F97 A;  4XXU A;  5I59 A;  2O68 A;  5B70 A;  3FGS A;  2Y7W A;  2F6P A;  4BDN A;  5F1Q A;  1I6Q A;  3TDJ A;  2Z22 A;  3OXN A;  3MP6 A;  3W9W A;  3KEI A;  4LQ2 A;  3F11 A;  4YB6 A;  5ELV A;  1UTH B;  1B3G A;  1I69 A;  4LUB A;  5H8N A;  3O29 A;  4GOT A;  1FCK A;  4NTL A;  1B0H A;  4R9F A;  3PUY E;  2QJE A;  3E13 X;  4WED A;  3T93 B;  4DDD A;  3FJ7 A;  4EXK A;  3EF7 A;  4POX A;  2GHB A;  4FEB A;  3OMB A;  3M3L A;  4F19 A;  1B5I A;  4KD5 A;  4YIC A;  1ZJL A;  5JEI A;  1ELJ A;  5FHO A;  2R71 A;  3KJT A;  3FVG A;  1FQD A;  1N04 A;  1HSE A;  1S7Y A;  1SW1 A;  2HCA A;  3C33 A;  3RY3 A;  4H8I A;  1US4 A;  4R73 A;  1WOD A;  2Q88 A;  4U4X A;  3CR9 A;  1QW0 A;  4YB7 A;  3FJM A;  3V8X B;  5A5X A;  5K2X A;  5ICT A;  3I3V A;  4RY1 A;  2XXU A;  1N7W A;  3IOU A;  4NE4 A;  3LSF B;  1TXF A;  1GV8 A;  1QUI A;  3DLN A;  4LZ5 A;  4LP2 B;  2Q9T A;  3KBR A;  1M5E A;  1H43 A;  1URD A;  5I56 A;  5J1D A;  1SD3 A;  3N94 A;  2VP1 A;  1S50 A;  3I6V A;  1B2H A;  1M5D A;  4O3B A;  5CMC A;  2DOJ A;  3G7W A;  3K02 A;  2VD2 A;  4R72 A;  1LAX A;  4WEP A;  5CRY A;  4GWO A;  2GRV A;  1DMB A;  1Z7M E;  3OSQ A;  2ANJ A;  4PFY A;  3TKD A;  3UOR A;  3SEW A;  1NNT A;  4FAJ A;  3E9X A;  4JBZ A;  2I49 A;  1DPE A;  1PBP A;  2ONK E;  1SDX A;  2V3T A;  2YPN A;  1SYH A;  2DVZ A;  3IB1 A;  1B40 A;  4IGT A;  2OWS A;  3L6H A;  2NWJ A;  3K1P A;  3IX1 A;  3KFM A;  3ODB A;  3VLU A;  3ZS6 A;  3D4C A;  2XX8 A;  4QFN A;  4IO3 A;  5I84 A;  2FNC A;  4R2F A;  4OFL A;  1FQB A;  3RUM A;  2HXW A;  2O7U A;  3D4G A;  2H99 A;  3MP1 A;  3EHU A;  3H6V A;  5AE4 A;  1B1X A;  3IR1 A;  1LAG E;  2QS1 A;  1RYO A;  2HZL A;  3KN8 A;  4LAT A;  4MH5 A;  1LBC A;  3KZG A;  3S2V A;  5I59 B;  2DWJ A;  1MPC A;  3B6T A;  1US5 A;  2R6G E;  4FED A;  1N76 A;  4F18 A;  1B6H A;  1FTJ A;  4GXA A;  3O66 A;  1FW0 A;  2RCB A;  3C9H A;  3G3F A;  3CVG A;  5DT6 A;  1B9J A;  2H25 A;  4XKN A;  3MVW A;  2DE2 A;  3C4M A;  1B4H A;  1SW5 A;  5I2N A;  2A5T A;  4O3C A;  4Z0I A;  2ZYO A;  4OES A;  3JV9 A;  1VFE A;  1HSL A;  3JYR A;  2P1S A;  1T0K A;  2AIX A;  1IXH A;  1SVX B;  1B4Z A;  3VVD A;  3A3U A;  3RGY A;  3HO7 A;  3K1M A;  3BFT A;  2D21 A;  2GFE A;  1YTV A;  2F34 A;  4JB7 A;  4NWD A;  3PPN A;  1FTO A;  3C34 A;  5H8Q B;  5TU0 A;  4MLQ A;  3W9V A;  1POT A;  2DQV A;  3KGC A;  3IJX B;  4OQO A;  4C0R A;  4U22 A;  2HQ0 A;  2V3U A;  1LB8 A;  3CSG A;  5CMB A;  1JEV A;  1P1W A;  4PFT A;  2Y84 A;  3LR1 A;  3A09 A;  1A99 A;  1KWH A;  2A5S A;  1B0L A;  1EZ9 A;  2D5W A;  2I58 A;  3EHS A;  4G77 A;  5EHM A;  5EYF A;  1J1N A;  3T96 B;  2X26 A;  1QJM A;  3U94 A;  4BDO A;  4ZE8 A;  4IB2 A;  1A8F A;  4FJP A;  4OXV A;  4DXU A;  3CSB A;  3PGF A;  2QPQ A;  3MZB A;  4F2Q A;  2M8C A;  3TCF A;  3PD9 A;  4TLM B;  1S9T A;  1VFD A;  3FV1 A;  5ITP A;  2I4B A;  1IIW A;  4IO2 A;  2F6G A;  4PET A;  1QVS A;  1N0T A;  1B7Z A;  3O97 A;  1B1H A;  1H44 A;  1CE2 A;  1JVY A;  2E1S A;  2RC8 A;  2Y7R A;  2I0C A;  3FXQ A;  3HHG A;  4KPT A;  3LBS A;  3ZSF A;  2FA7 A;  3MQ9 A;  3C31 A;  4JDF A;  4RXL A;  2ONR A;  4JSD A;  3V89 B;  3SEU A;  1MXZ A;  2VGQ A;  1M5C A;  1DTG A;  1EZP A;  4QSD A;  3O2A A;  1R6Z A;  4NF4 B;  4C1U A;  2UVJ A;  2THI A;  3RLF E;  3TFL A;  3IL1 B;  4ZED A;  1UTH A;  4IO4 A;  5AA2 B;  5AA1 A;  1PEB A;  4XIG Q;  5H8S A;  4U4S A;  3SET A;  2LAO A;  1Y1M A;  3TOD A;  3RTF B;  4BDQ A;  5K2Y A;  2NVU B;  1H3D A;  1PB8 A;  3MZ1 A;  3QIM A;  4ZEK A;  2XXI A;  3CG3 A;  2HEU A;  1B3F A;  3GBB A;  5AA2 D;  4POW A;  3U93 A;  1URG A;  3LC8 A;  1D3K A;  4FOR A;  4JSO A;  4EQ7 A;  4R6H A;  4Z7E A;  5CBS A;  1BIY A;  4O3A A;  5ISU A;  3H03 A;  3U8Q A;  1Z7N E;  4UA8 A;  3CFX A;  3P7I A;  4NF5 A;  4PQJ A;  5TP9 A;  3T9H B;  1MPD A;  2H9B A;  1B3H A;  5BWJ A;  1XOC A;  5CMK A;  1XHY A;  3OO9 A;  4OMB A;  1OQG A;  4KQP A;  5FTH A;  5IAI A;  4DXC A;  4GRK A;  5KZT A;  1O7T A;  1USY E;  2DE4 A;  3PPR A;  4LVQ A;  3S9M C;  1FTK A;  5AA4 A;  2ZYM A;  4YKI A;  5KCJ B;  5B7D A;  3AXF A;  2QMX A;  4IY6 A;  1JW5 A;  2H4I A;  3IOW A;  3TEL A;  1OVT A;  3FXU A;  4XKQ A;  2QRY A;  3G3H A;  3KSX A;  4GL8 A;  3SER A;  1PB7 A;  3KN7 A;  5H8Q A;  5ICQ A;  4NWC A;  3WAF A;  2ZNS A;  5AA2 A;  3G3J A;  2ALU A;  3O28 A;  4R9G A;  4XTC Q;  2QMW A;  3FVO A;  2WKY A;  4F39 A;  4GD5 A;  3K1N A;  1B3L A;  1LAF E;  4OEU A;  4RK9 A;  4WKM A;  3MPL A;  1MQD A;  5EHS A;  3THI A;  1QKA A;  1JVX A;  4G68 C;  4BDM A;  4EQ9 A;  1Y3Q A;  4ZEB A;  3MJN A;  3MWB A;  4BLA A;  1MRP A;  2QSX A;  1GR2 A;  2Y7K A;  4OVJ A;  4ZDM A;  4YMA A;  3LSL A;  2I6E A;  2QS3 A;  3EPE A;  4KHZ E;  1MS7 A;  4G4P A;  4LZ7 A;  1P1Q A;  2FYI A;  3K00 A;  2XD3 A;  3PUZ E;  1LFG A;  1IEJ A;  4FEC A;  4HS7 A;  4ZEF A;  2OK2 A;  5I58 A;  4LZ8 A;  2XXP A;  3PV0 E;  1D9Y A;  4IY5 A;  2DXR A;  2UVI A;  2I3W A;  1LST A;  4U23 A;  4DE8 A;  3GXA A;  3PMV A;  3PPO A;  4DZ1 A;  2B3B A;  4GLI A;  1NKX A;  4EXL A;  1AIV A;  4H1X A;  1MM6 A;  4I9D A;  2XXT A;  3FVK A;  3IAZ A;  3KSJ A;  4JXI A;  3N6U A;  4KFQ A;  5FHM A;  4X1D A;  1B51 A;  4ZZE A;  3TYH A;  3U1O A;  1LFI A;  3ECR A;  5ITO A;  2F36 A;  2DP8 A;  1FQF A;  3CIJ A;  2AL5 A;  2CZL A;  4OTE A;  4MLV A;  1Y4T A;  5I2N B;  4R75 A;  4X1B A;  1Y3N A;  3PUX E;  4Q0C A;  2ZNU A;  2G29 A;  3G3I A;  2F7C A;  4E0X A;  1B3E A;  2B65 A;  4M1V A;  1D9V A;  1ZMG A;  4GQO A;  2RF1 A;  4L17 A;  4RK2 A;  1L5T A;  3TZA A;  1IXC A;  3G3G A;  4OEN A;  1FQE A;  2HFB A;  3MW0 A;  5KDT B;  1MH3 A;  1PBQ A;  2F7B A;  4QFO A;  3KOT A;  3H4Z A;  3Q27 A;  3SEV A;  1AH5 A;  2X7P A;  4RNS A;  3Q29 A;  4QSC A;  4FAT A;  5I57 A;  2VD3 A;  2QL3 A;  3HCQ A;  3VVF A;  3MVX A;  3VXB A;  4R2B A;  1D4N A;  1B32 A;  1DPP A;  3GZG A;  5L9O A;  4RPN A;  3FAS A;  3HV1 A;  5I58 B;  1A8E A;  2NOO A;  3DP4 A;  3G3K A;  2DWA A;  3ZKL A;  2F35 A;  1P1N A;  1BLF A;  3OEL A;  4XKP A;  1N3W A;  3O6I A;  1PDA A;  2V3Q A;  3CG1 A;  3EHT A;  4YAH X;  1IXG A;  1A7L A;  3K6U A;  3VLW A;  4BDR A;  4H5F A;  5LOM A;  2DVC A;  3IJO B;  4MBP A;  4E0W A;  1JNF A;  3T9X B;  4X9T A;  1AMF A;  3V5A A;  4H67 A;  4OYV A;  1SBP A;  4Q8R A;  4GF8 A;  5JK4 A;  4F1V A;  3N6T A;  5CBR A;  1MY1 A;  4OZ9 A;  2Q2A A;  3IB2 A;  3SEY A;  1LCT A;  1N7X A;  1Y1Z A;  3MUQ A;  2CMO A;  1MQH A;  1YAE A;  4PP0 A;  4EDP A;  2PT2 A;  1POY 1;  2B3F A;  3R6U A;  4PFW A;  3W15 C;  3BKI B;  1R9L A;  4MF3 A;  5H8F A;  1NH7 A;  3QSL A;  3FIR A;  1QUJ A;  3CFZ A;  4LA9 A;  2Z8D A;  4ZZA A;  1AOV A;  2Z8E A;  2O69 A;  3OO8 A;  3S9E A;  4ESW A;  3B6W A;  3MVY A;  3PUW E;  3FZV A;  5FHN A;  4ECF A;  5A5X B;  4IO5 A;  3KOS A;  1MY4 A;  2F8D A;  4RYA A;  4NF6 B;  1Q1K A;  2XXR A;  2DWI A;  1EU8 A;  1JW1 A;  2HAU A;  3CRB A;  1NL5 A;  4NF5 B;  1CB6 A;  2GH9 A;  2Y7I A;  4QFP A;  5DVJ A;  1TFD A;  4ELR A;  1IIT A;  3O6H A;  3MPK A;  3TPA A;  4EUO A;  3SDF A;  3TAJ A;  4HCY A;  4IGR A;  3K0V A;  3TQW A;  4AQ4 A;  4YMB A;  2OWT A;  3KG2 A;  1ATG A;  4I8C A;  3GLB A;  1QUK A;  1F9B A;  3TCG A;  1XVX A;  4RJZ A;  5HPQ A;  1MDQ A;  3LUY A;  2IEE A;  5DTB A;  4H6D A;  1USY H;  4IO7 A;  4ISU A;  5F7V A;  2Q89 A;  5L9M A;  4F3B A;  5KCJ A;  1N3X A;  1VSO A;  2DWH A;  3K6W A;  3VVE A;  1QUL A;  3TMG A;  4KI0 E;  1P99 A;  2KLF A;  3IOV A;  3ILU B;  1BP5 A;  1OIB A;  2RC7 A;  3LSW A;  2XXV A;  1UIV A;  3PPP A;  2G93 A;  4NF8 A;  2XHD A;  3IO4 A;  4G8N A;  3T9U A;  1PC3 A;  3RT6 B;  3TQL A;  3PPQ A;  4QF9 A;  3OSR A;  3VXC A;  5TP9 B;  3MBP A;  1GGG A;  3O6G A;  4G2Z A;  5DYH A;  4KCD A;  1MPB A;  4F3G A;  1MQJ A;  2RC9 A;  4R6Y A;  2ABH A;  2ZNT A;  1UQW A;  3OEK A;  5CI5 A;  2Q2C A;  3S9L C;  2F5X A;  1LB9 A;  2GHA A;  5HM4 B;  3RQT A;  3VDF A;  4ELO A;  1RYX A;  3IB0 A;  3U72 A;  3UK4 A;  1IQ7 A;  4F3P A;  4ZS9 A;  3PMX A;  1MY0 A;  2X7Q A;  4M4G A;  1Q35 A;  3TTM A;  1SI1 A;  1UIU A;  5TPA A;  3K4U A;  1NNF A;  2HZK A;  2OCU A;  2RIN A;  3TTR A;  3VLV A;  2DXY A;  3L6G A;  3PMW A;  2O7I A;  4DCY A;  3S9N C;  1NNK A;  4ZE9 A;  4QFL A;  3H6T A;  2I48 A;  4N07 A;  1P1U A;  3ILT B;  1H76 A;  2HAV A;  1TFA A;  3H6W A;  1MXU A;  3S4U A;  3SES A;  4YKP A;  2XXQ A;  4AB6 A;  3PU5 A;  4H5G A;  4C1T A;  1JEU A;  5CMM A;  1QKB A;  4RPO A;  3VV5 A;  4TLL B;  4P11 A;  3HN0 A;  4TQU Q;  5DEX B;  4F2O A;  4QFK A;  4GFR A;  1YPN A;  2QS2 A;  4P0I A;  2XXX A;  2XXH A;  3BFU A;  1DTZ A;  3KJ7 A;  2OZZ A;  4IO6 A;  1MXV A;  4LQ5 A;  4U2R A;  4ZEC A;  3EQ1 A;  4HTG A;  3USD A;  2P2A A;  2Z23 A;  1WVJ A;  5CC2 A;  1LFH A;  3RTW B;  1OLA A;  1R1N A;  4G8M A;  1FQA A;  1I6B A;  5M2V A;  4NMY A;  5AA4 B;  5DVI A;  4OWD A;  2ZYK A;  1SYI A;  2ZXT A;  4KR5 A;  4R6K A;  1Y20 A;  4XKR A;  1TWY A;  4QHQ A;  1B7H A;  2REG A;  4K3F A;  2REJ A;  4PFU A;  4OET A;  4R74 A;  1FTL A;  1EH3 A;  3UGW A;  2PYY A;  3TTN A;  3B7D A;  3K6V A;  2A5T B;  4NED A;  2XX7 A;  1IXI A;  4Q30 B;  3PUV E;  2AYS A;  5JTY A;  3E3K A;  3N5L A;  2O51 A;  2R9J A;  3OO6 A;  4Q5T A;  3EN3 A;  3OEM A;  2VOZ A;  1LCF A;  2F7A A;  1OMP A;  2I0B A;  2PX1 A;  3KN3 A;  3C32 A;  4F1U A;  3JZJ A;  3QXM A;  1B7U A;  3FJG A;  2H5Y A;  4N6P A;  1ZTY A;  4U1O A;  3OD7 A;  4GXS B;  4DIG A;  4EF2 A;  3U92 A;  2RKM A;  3MAM A;  3Q25 A;  5I57 B;  1SW4 A;  2UYF A;  1B5J A;  1MM7 A;  4MFI A;  4YB5 A;  3T9V A;  4DXB A;  1I6A A;  1RKM A;  3MVZ A;  1XC1 A;  3M8U A;  4UAC A;  2XD2 A;  5H8H A;  1ZLQ A;  4FE8 A;  4EF1 A;  1OQH A;  3K6X A;  2UYE A;  2XXY A;  2NUV A;  3DP8 A;  3RN8 A;  1XS5 A;  3UN6 A;  3IO6 A;  1WDN A;  4OHN A;  1N84 A;  1NMU A;  1R9Q A;  3IK6 B;  4KYD A;  3I5O A;  4OER A;  4H8J A;  2PT1 A;  2Y7P A;  2Q8J A;  1O64 A;  4F22 A;  4YKK A;  3GBA A;  4JWX A;  3SKP A;  2O1L A;  1MQG A;  4NF8 B;  1A55 A;  1HSJ A;  2OJT A;  2Z8F A;  3H3G A;  1XVY A;  3R7X A;  2V93 A;  2NXO A;  4HW8 A;  2PVU A;  1O63 A;  1P1O A;  1TT1 A;  3C35 A;  2P0S A;  5HBC A;  3MZ9 A;  2VHA A;  5H8F B;  1JW4 A;  1ANF A;  3Q28 A;  4OEV A;  1SI0 A;  2IA4 A;  3TEP A;  3RPW A;  2V84 A;  3IOR A;  4YKJ A;  1LGB C;  3FVN A;  4LON B;  1ZU0 A;  1IUD A;  2XXW A;  1ZIU A;  3DP6 A;  1DOT A;  1MQI A;  3FXR A;  3PD8 A;  4H0W A;  4P0G A;  4ONY A;  4NF4 A;  1DSN A;  4X48 A;  3T66 A;  2YJP A;  4EQB A;  5KDT A;  4QSE A;  2UXA A;  1UTB B;  4ND9 A;  4YU0 A;  4KYE A;  1SW2 A;  1XT8 A;  1YCJ A;  2DE3 A;  3DM0 A;  3IOT A;  3OO7 A;  3QUJ A;  3R26 A;  4G68 B;  4GIZ A;  4OFO A;  1UTB A;  1NH8 A;  1Y4C A;  4U21 A;  3A3C A;  3M3K A;  2PBW A;  1M5F A;  3K01 A;  1BKA A;  4H65 A;  3UP9 A;  4G68 A;  4F1Y A;  1B52 A;  2I3V A;  1JET A;  3B6Q A;  3FD3 A;  5H8N B;  3ZKK A;  3QK6 A;  1NFT A;  3FUZ A;  3TUS A;  2E0S A;  3MC2 A;  4TOZ A;  3VFJ A;  1JQF A;  1GTK A;  1GVC A;  4BDL A;  1Y3P A;  1Y9U A;  1B46 A;  4JWY A;  4KCC A;  4ELP A;  1MXW A;  2YLN A;  2F78 A;  3M3F A;  4WXJ A;  1A54 A;  1B05 A;  1LLS A;  2ZYN A;  1ZBM A;  3OOA A;  1URS A;  2QS4 A;  2V25 A;  3FAT A;  5FTI A;  1MXY A;  1PB9 A;  4ESX A;  3V83 A;  4AB5 A;  3UA8 A;  2RCA A;  2ESN A;  3HHF A;  1IZ1 A;  3HST A;  2O1M A;  2ONS A;  5I2K A;  2OBG A;  4DLD A;  3UIF A;  3RT8 A;  3WAE A;  4ELQ A;  1SQY A;  3Q26 A;  1FTM A;  4F29 A;  1AL3 A;  3TTK A;  1M5B A;  5DEX A;  1OLC A;  2DYX A;  1MY2 A;  1MH4 A;  3VE1 B;  3K2D A;  4F31 B;  3O9P A;  4RA1 A;  3T22 A;  5L8D A;  2UVH A;  5AA3 A;  1LAH E;  5CM6 A;  1LBB A;  4THI A;  1NNP A;  3N26 A;  4FIM A;  5I56 B;  4DCX A;  3RNN A;  2DSF A;  3H7M A;  1H45 A;  5H8H B;  2PMS A;  4GL0 A;  2O6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...