5B70A

Oxyr2 e204g regulatory domain from vibrio vulnificus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
219
structure length
209
Chain Sequence
b'GAMMQGQLKLGCIPTIAPFLLCDLVQEINQRFPQLNLLLREDTTTNLLTALRHGELDVLILALPVEIDGMESRVVGQDPFKMVISRHQAGAIKVPIKYDDLPDESVFLLEKGHCLTEHAVSACKLTDKEKINPFSATSLHTLVQMVANGLGTTFIPQMAIDHGLLDNQNLVVIEPPGQQAYRDIGLVWRPSSSRSKTFNQLAEVVSELL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR family transcriptional regulator
publication title The hydrogen peroxide hypersensitivity of OxyR2 in Vibrio vulnificus depends on conformational constraints
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Transcription
total genus 58
structure length 209
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5b70A01
5AE4A 3OSRA 5KDTB 2F5XA 1MY0A 1CE2A 2HCAA 3KFMA 4NF4A 4QSEA 3VLWA 4HCYA 2YLNA 1MXUA 3OD7A 2REJA 4R2FA 5DEXB 1RYXA 2Y84A 1LFGA 4RY1A 3V83A 5DVIA 3KBRA 4XKQA 1NMUA 4ZZEA 3K6XA 2UYEA 2XXWA 4ZEBA 3VLUA 1LAHE 4PFYA 2DWAA 3H03A 2DE2A 3OEMA 3S9NC 1QVSA 3GXAA 4U23A 4GF8A 4MH5A 3UN6A 1IXIA 3HSTA 2XXYA 4R75A 2UVGA 4OZ9A 1VFEA 5IAIA 1TFAA 4Q5TA 1M5CA 5I58A 3V89B 1ELJA 3Q29A 2AYSA 4R6YA 4H1XA 1VE4A 5TU0A 4G8NA 3RQTA 1FQCA 1VFDA 5HM4B 4R6HA 3PPRA 4DDDA 2V25A 3PUXE 1FTLA 3TEPA 1B05A 4LQ2A 1JW4A 2I6EA 3TTKA 2O6AA 4LP2B 4QFNA 3N6UA 3FVGA 1URGA 2OBGA 5EYFA 1B5JA 1MPCA 1S7YA 3KJTA 1POTA 4OMBA 4RJZA 4IGRA 4GVOA 2BJJX 2D5WA 5CBSA 2F7BA 5I2NA 4EQBA 2E1SA 1ZJLA 1PB9A 5AA3A 1JNFA 3TYHA 1A40A 3CVGA 5CMCA 1XHYA 5I56A 1USYH 4JSOA 4R9FA 2Z8EA 2HEUA 1YAEA 2ZNSA 3B6TA 3PMXA 4FAJA 3FZVA 2DWHA 3KN8A 4F3BA 2A5TA 2ZYKA 3EN3A 4WXJA 1B4HA 1JEUA 3K1NA 3T66A 4NF5B 4QSCA 3SESA 2DE4A 2R6GE 3BBRA 1B7UA 4FORA 4AQ4A 3IORA 2ZXTA 1B4ZA 2E0SA 4QFLA 2GRVA 1O63A 2DVZA 2B65A 1J1NA 1MY1A 4OEUA 2A5SA 1RYOA 1MRPA 3IL1B 2YPNA 2Q88A 1M5BA 3C32A 2H5YA 4RXLA 1WDNA 1IUDA 2DQVA 1MS7A 2PT2A 4WKMA 5K2XA 4F22A 5JTYA 3CR9A 4BDRA 4ELPA 3C34A 4H65A 1OLAA 2HAVA 3M3LA 3GZGA 2XXQA 1O64A 3PPQA 1IZ1A 3OO9A 1FTOA 2F34A 3MP1A 5AA1A 3K00A 5B7DA 5ISUA 2VHAA 4R6KA 2WKYA 3PD9A 2QS1A 1XVXA 2P2AA 1D4NA 4NF6B 5ICTA 1AOVA 4Q30B 3U92A 1DOTA 1SW5A 3C36A 3ILUB 1EZPA 5CC2A 1D9YA 1LAFE 1MXVA 5H8FB 1UIUA 3I3VA 2X7QA 4X1DA 1BP5A 1FCKA 4TOZA 5H8QA 3U72A 5J1DA 3GLBA 4MLVA 3O29A 5CBRA 3VXBA 1N7XA 1O7TA 3R7XA 2GH9A 4UA8A 4OTEA 1AMFA 4KR5A 3QUFA 4IY6A 5HPQA 3K4UA 3H6WA 3KSXA 4BDOA 4KYEA 3G3JA 1B40A 5F1QA 5CMKA 2PT1A 2F7AA 3LUYA 4L17A 3VFJA 3N26A 1B1XA 2V3QA 1MG1A 3MC2A 1UTBB 5I2KA 3T9XB 3FUZA 1S50A 1Q1KA 4H5GA 4KFQA 5F7VA 1Y3QA 4GXSB 1EH3A 2F35A 1NNKA 4MFIA 3TTNA 2XXXA 4HTGA 1N84A 4GIZA 2OLBA 1Y3PA 5DYHA 1MM7A 4NF4B 2QS3A 5CM6A 1MY2A 1WVJA 4FEDA 4LUBA 1B1HA 2ONRA 3RN8A 3ILTB 2XXTA 3ZSFA 1MH3A 2NOOA 5H8HA 3K6UA 3G3FA 4FATA 2RF1A 1I6AA 2ZNUA 1XOCA 3ZKLA 1QUIA 4QFPA 3IOWA 3KSJA 1MQHA 1SQYA 1GV8A 3CI8A 3UP9A 1R6ZA 2NVUB 4GFRA 4XXUA 1NH7A 4DCXA 4BDNA 2Q2AA 5I58B 3C31A 3LSLA 3QXMA 3OO7A 3HHFA 3M3KA 3FIRA 1NH8A 3MVZA 2PYYA 3HHGA 5H8NA 1NNPA 3HO7A 4G8HA 3SERA 2DS9A 2THIA 4OEVA 1UTHA 3LSWA 4ONYA 4F2OA 3G3GA 3OO6A 4QHQA 3EHUA 4N6PA 3ZS6A 4IO3A 3S9MC 1QUKA 4HW8A 2CMOA 3QSLA 3MJNA 3H3GA 4ZE8A 5I2NB 3S9EA 2RKMA 1N04A 3H06B 4LATA 1TWYA 2DVCA 5I56B 1Y9UA 2I49A 5TP9A 3SEWA 2ESNA 1URDA 1FQBA 4KYSA 5M2VA 1A54A 2O68A 2LAOA 5L9OA 2UVIA 1AH5A 4M1VA 2XXRA 4KHZE 4YKIA 1SD3A 2A5TB 4H6DA 1B3FA 2HXWA 4U2RA 4RA1A 3TCHA 1JQFA 4IO5A 3MZBA 2GHAA 1A8FA 4ESXA 1Q35A 2V3UA 4F3GA 3W9VA 1TT1A 1YTVA 1N3XA 4G68A 1H44A 4OETA 5EHSA 4EUOA 1EU8A 5FHOA 2UVJA 5BUUA 3MPLA 5AA2A 3CG3A 4DXCA 2DE3A 3BFTA 1IQ7A 4EF1A 1UQWA 3KN3A 4OVJA 4KQPA 2F8DA 5KZTA 1B3EA 2RC7A 1SW2A 4NMYA 2XXPA 3V5AA 2QRYA 4ELRA 5JTYB 4ZEDA 1OIBA 4DXUA 1P1UA 4LZ5A 3D4GA 2XD2A 4JSDA 4DE8A 4F1VA 2QS2A 4JB7A 1B5IA 1Y4TA 1US5A 2V3TA 3HPIA 1OQHA 3THIA 4YKKA 1IITA 3PPOA 3T96B 2YJPA 3GBBA 3K6WA 1B7HA 1SI0A 3FASA 3PPPA 4G68C 2XXHA 4R2BA 2H25A 3IJOB 2F7CA 1R1NA 3G3HA 4Z0IA 5K2YA 2F36A 2HAUA 3G3IA 3DP8A 2H98A 5AA4A 2RCBA 4O3CA 2FA7A 4XKNA 3RY3A 4GQOA 2DYXA 1GGGA 3KEIA 5I84A 5H8QB 4C1UA 4FECA 3A3CA 3FGSA 2F6GA 5I59A 5L9SA 3VVDA 4OFJA 3MWBA 4MLQA 2VD2A 4DIGA 1DPEA 1H3DA 2HQ0A 4HCWA 4U1ZA 1B3LA 1MDQA 3SEXA 3DM0A 2UVHA 3FJ7A 3K1MA 3CFZA 1VSOA 4JWXA 3K6VA 3TAJA 1US4A 5I2KB 4EQ9A 1JW5A 4RK2A 4F39A 4ZDMA 1XC1A 3WAFA 3Q28A 1HSJA 4EQ7A 1PB8A 1JETA 3ECRA 1XS5A 3O6HA 2R71A 2PX1A 1OMPA 3SEYA 3T93B 2B3FA 3E9XA 1A7LA 2V93A 3KZGA 4X1BA 3N94A 3CG1A 4UACA 3RGYA 4RK9A 3E4RA 4RNSA 1L5TA 3TCGA 5H8HB 2RC9A 4NTLA 3U1OA 4R72A 1DSNA 3OSQA 3IO6A 2QPQA 5CMMA 2H4IA 3H4ZA 4U22A 3IJXB 2GHBA 1P1QA 4E0WA 3EF7A 4QF9A 2R9JA 3C9HA 3OENA 3TZAA 2OZZA 3CIJA 1IXHA 1SYIA 1MXXA 4Z7EA 4YAHX 1URSA 2Q9TA 3TQLA 4GOTA 4OXVA 3HCQA 1MY3A 4THIA 4YMBA 5FHMA 5H8NB 4FE8A 1MPBA 5DT6A 4MF3A 1Y4CA 3PV0E 1MQGA 3OOAA 5ELVA 4GXAA 1DPPA 1SYHA 1I6BA 1H45A 1Z7NE 4GLIA 2FNCA 2H99A 1IXCA 3IOVA 3U8QA 3TPAA 2G93A 2GFEA 1DMBA 3L6HA 3M3FA 2PVUA 5H8SA 4M4GA 1PBPA 3VDFA 3S9LC 3MZ1A 4IO4A 2OWTA 3MPKA 4PFWA 2G29A 3RTWB 4NWCA 1ZMGA 3O2AA 5TP9B 1YCJA 3ZKKA 3S2VA 3UORA 4KCCA 2ZNTA 3C35A 2Y7PA 3TUSA 4U4SA 2ONKE 4QFOA 2ZMBA 1ZLQA 4RPOA 2Q8JA 3O97A 5HBCA 5I57A 3R26A 3H7MA 1MQIA 4H8JA 5CI5A 2ALUA 3RPWA 4R74A 4G68B 4E0XA 4GRKA 4PETA 2I3WA 4KYDA 4TLLB 2D21A 5AA2B 3VLVA 4POWA 3T9HB 4JXIA 5BWJA 4G8MA 4GL8A 2Y7RA 3UIFA 2Z23A 4EDPA 3OEKA 3Q26A 3QIMA 3SETA 4ZEIA 1NL5A 3T9VA 3D4CA 1P1WA 4JBZA 2I4BA 1PBQA 3N5LA 3O6IA 4P0IA 1GVCA 3G7WA 4JDFA 5CRYA 1NKXA 3T9UA 3KOSA 1ZKBA 3IO4A 2O7IA 1FQEA 5ITOA 2Y7KA 4LONB 2I58A 3QUJA 2F6PA 1Y3NA 4F3PA 3BFUA 3OXNA 4FIMA 1P99A 4QRZA 1ZBMA 3FXUA 3Q25A 2X26A 3EQ1A 3M8UA 4YMAA 3PUVE 3EHTA 4OQOA 5AA4B 1PB7A 4EXKA 2O84X 3JZJA 1LB9A 1ANFA 2HFBA 4DZ1A 1RKMA 4F1UA 3VVFA 3TODA 1LLSA 3JV9A 1OLCA 4U21A 5I59B 3MUQA 1JVXA 1LCTA 4XIGQ 3QYTA 5H8FA 1MM6A 3W9WA 4LZ8A 4X9TA 4F1YA 5B70A 3K2DA 4PQJA 4AB5A 3FV2A 2FYIA 2O7UA 4YKPA 3Q27A 1QKAA 2RCAA 1LAXA 1QULA 3RNNA 3VVEA 4YB6A 3PMVA 2F97A 5FHNA 2Y7WA 3C33A 4IO7A 4ELQA 2Q89A 1BIYA 4KI0E 4PFTA 4ZZAA 3H6TA 4X48A 1ZIUA 3H6VA 4G77A 4ZS9A 5EHMA 2X7PA 1R9QA 1D3KA 4FEBA 2QJEA 1I6QA 3LC8A 3LR1A 1H43A 2XD3A 4PP0A 4FJPA 3OO8A 3UA8A 3PMWA 3PUZE 2AIXA 5TPAA 4OENA 2VD3A 3WAEA 3FD3A 3SDFA 3CFLA 3A09A 3KN7A 4OHNA 4R9GA 3UK4A 4NEDA 3E3KA 2AL5A 2XX7A 1NNFA 3I5OA 3IX1A 4Q0CA 4RYAA 4JWOA 4F19A 2Z8FA 1N7WA 2Z22A 3QAXA 1N0TA 4JWYA 4XKRA 4POXA 2ANJA 3U94A 1TFDA 3S4UA 3UGWA 1UIVA 2XXUA 1FQDA 3I6VA 3U93A 2XHDA 5KCJA 1EZ9A 4C1TA 3JYRA 5CMBA 2DWJA 2B3BA 3IB1A 1JVYA 3FXRA 2I3VA 3PU5A 3O9PA 1FQFA 1B0HA 5LOMA 1A99A 3CSBA 2RC8A 4O3BA 4NF8A 3VXCA 1SI1A 4NWDA 3F11A 3KOTA 4KCDA 1P1OA 1CB6A 4H0WA 3PD8A 3SEUA 4WEDA 1VR5A 1Z7ME 4P11A 4QSDA 1MDP1 2ABHA 3IB2A 3CFXA 2OWSA 1LBBA 3K01A 4OYVA 1OVBA 4ZEFA 1NNTA 2CZLA 3MW0A 1D9VA 1ZU0A 1LFIA 1GR2A 1MXWA 3B6WA 1B3HA 4OWDA 5I57B 4LA9A 4GWOA 2ZYMA 2KLFA 2O51A 1GTKA 3RLFE 1USYE 2P1SA 1FTKA 3GBAA 4YZZA 2VGQA 1LGBC 4BLAA 4ND9A 2Q2CA 4O3AA 3FATA 4ZEKA 4F3SA 3RT6B 2DXRA 3TTLA 1P1NA 3W15C 1NFTA 4ELOA 1PC3A 2V84A 2QMXA 2O1LA 4OERA 1FW0A 1II5A 5IKBA 1ZTYA 5DTBA 1SBPA 1B52A 4XTCQ 3TCFA 2F78A 1B7ZA 3FVOA 1Y1ZA 4BDMA 4N13A 2OK2A 5A5XA 1PDAA 3VV5A 2I48A 5ICQA 3FVKA 2DWIA 3CSGA 4U1OA 5KDTA 4I62A 3OELA 4PE5B 3RT8A 5DEXA 1KWHA 1XVYA 3O28A 2IA4A 3T22A 3PUYE 3PGFA 3CRBA 1B6HA 4KD5A 3B7DA 1TXFA 2I0BA 2XXVA 1MPDA 4Q8RA 4F2QA 2VOZA 2XX8A 3DP4A 1IXGA 1B3GA 5DVJA 3TFLA 1HSEA 4YU0A 1Y1MA 4ECFA 1AIVA 1M5FA 3HV1A 1A55A 5ITPA 5DVFA 4XKPA 2Y7IA 1UTHB 2AL4A 4TQUQ 2W7YA 4DLDA 3USDA 4PFUA 1FTJA 3IOUA 2O1MA 4ZECA 1R9LA 3LSFB 3K1PA 1B46A 3H6UA 2PBWA 4I8CA 5JK4A 1S9TA 3ONMA 4EXLA 3DP6A 4G4PA 1BLFA 1FQAA 1I69A 3P7IA 1LSTA 1SVXB 2DSFA 4OFOA 4YB5A 1BTJA 4IO6A 3O6GA 1MQDA 3TTRA 1IIWA 4NE4A 3MVYA 1MXYA 3HN0A 3MVXA 4G2ZA 1EZOA 1JW1A 3B6QA 1A8EA 1B51A 4I9DA 3K0VA 3SKPA 4K3FA 2I4CA 3OMBA 4H8IA 3KGCA 1T0KA 4IO2A 3PPNA 2ZYNA 3PUWE 1MXZA 4YICA 3FV1A 1SW4A 2DOJA 1LCFA 2OJTA 2HZLA 3N6TA 3DELB 4EF2A 3MBPA 3O66A 3BKIB 1N3WA 3LSXA 1HSLA 4F29A 4LVQA 3KG2A 4WEPA 5FTIA 4NF5A 3EHSA 3TQWA 1LBCA 4F18A 1F9BA 2VP1A 5TPAB 1WODA 2DP8A 3MP8A 1LAGE 1JEVA 4MBPA 2HZKA 2NWJA 3TDJA 2P0SA 1SW1A 4ISUA 3MQ9A 4KPTA 5FTHA 4C0RA 4LQ5A 5JEIA 4N07A 4IY5A 2I0CA 1YPNA 1Y20A 3K02A 1DTZA 3L6GA 5KCJB 4IB2A 2UXAA 4YB7A 3MP6A 4DXBA 5L8DA 1B2HA 2XXIA 2IEEA 3KJ7A 3TELA 3FXQA 3QK6A 3AXFA 4I1DA 1MH4A 3IAZA 2XX9A 4OFLA 3DLNA 1BKAA 4GD5A 1XT8A 1POY1 4H67A 5AA2D 1AL3A 4NF8B 4R73A 3LBSA 3FVNA 4NF6A 4QFKA 1LFHA 1PEBA 3VE1B 4IGTA 3SEVA 2REGA 3IB0A 1MQJA 1DTGA 3E13X 4F31B 3IK6B 3IOTA 2QMWA 4ESWA 2RINA 1B5HA 3TTMA 3MVWA 4OESA 1IEJA 2NUVA 2M8CA 1N76A 3A3UA 1ATGA 4RPNA 4YKJA 4BDQA 2ZYOA 4LZ7A 1LB8A 1M5DA 2D3IA 2H9BA 4H5FA 2Z8DA 5L9MA 3RUMA 3IR1A 2ONSA 3MAMA 3R6UA 2PMSA 3EPEA 1QUJA 1QJMA 3MZ9A 1M5EA 4ZE9A 1B58A 1SDXA 1B0LA 1OVTA 3TMGA 4U4XA 4TLMB 3FJMA 1B9JA 3V8XB 2DXYA 1UTBA 1OQGA 2NXOA 1MY4A 3TKDA 3C4MA 1H76A 1QW0A 4DCYA 1FTMA 4GL0A 4HS7A 1QKBA 2QS4A 3RTFB 2OCUA 3G3KA 4P0GA 2QSXA 3FJGA 3ODBA 5A5XB 4AB6A 2QL3A 2UYFA 2O69A 1B32A 4BDLA
chains in the Genus database with same CATH superfamily
5AE4A 3OSRA 1IMEA 5KDTB 2F5XA 1MY0A 1CE2A 2HCAA 1FSAA 3KFMA 4NF4A 4QSEA 3VLWA 4HCYA 2YLNA 1MXUA 3OD7A 1NV3A 2REJA 4R2FA 5DEXB 1RYXA 2Y84A 1LFGA 4RY1A 3V83A 5DVIA 3KBRA 2HPGA 1NMUA 2KQZA 4XKQA 4ZZEA 3K6XA 2UYEA 2XXWA 4ZEBA 3VLUA 1LAHE 4PFYA 2DWAA 1FJ6A 3H03A 2DE2A 3OEMA 3S9NC 1QVSA 3GXAA 4U23A 4GF8A 4MH5A 3UN6A 1IXIA 3HSTA 2XXYA 1BK4A 4R75A 2UVGA 4OZ9A 2QVVA 1VFEA 3LV0A 5IAIA 1TFAA 4Q5TA 1M5CA 5I58A 3V89B 1ELJA 3Q29A 2AYSA 4R6YA 4H1XA 1VE4A 5TU0A 4G8NA 3RQTA 1FQCA 1NV1A 1FPKA 1VFDA 5HM4B 4R6HA 2B4MA 3PPRA 4DDDA 2V25A 3PUXE 1KA0A 1VDWA 1FBFA 1FTLA 3TEPA 1B05A 3MSTA 4LQ2A 1JW4A 1LBZA 2I6EA 3TTKA 2O6AA 4LP2B 2PCRA 4QFNA 3N6UA 3FVGA 1URGA 2OBGA 4P56A 5EYFA 1B5JA 1MPCA 1S7YA 3KJTA 1POTA 4OMBA 4RJZA 3FXBA 4GVOA 4IGRA 2BJJX 2D5WA 5CBSA 2F7BA 5I2NA 4EQBA 1D9QA 2E1SA 2XWKA 1ZJLA 1PB9A 5AA3A 5T3JA 1JNFA 3TYHA 1A40A 3CVGA 5CMCA 1XHYA 5I56A 1USYH 4JSOA 4R9FA 2Z8EA 2HEUA 1YAEA 5F24A 2ZNSA 3B6TA 3PMXA 4FAJA 3FZVA 4PC9A 2DWHA 3KN8A 4F3BA 1FBPA 2A5TA 3ISPA 2ZYKA 3EN3A 4WXJA 1B4HA 1JEUA 3K1NA 3T66A 4I40A 4NF5B 1NV6A 4MCOA 4QSCA 3SESA 2DE4A 2R6GE 3BBRA 1B7UA 1NV0A 4FORA 4AQ4A 3IORA 2ZXTA 1B4ZA 2E0SA 4AS5A 4QFLA 2GRVA 1O63A 2DVZA 2B65A 1J1NA 1MY1A 4OEUA 2HHMA 4N91A 2A5SA 1RYOA 1MRPA 3IL1B 2YPNA 2Q88A 1M5BA 3C32A 2H5YA 4RXLA 1WDNA 1IUDA 2DQVA 1MS7A 2PT2A 4WKMA 5K2XA 4F22A 5JTYA 1JP4A 3CR9A 4BDRA 4ELPA 3C34A 4PTKA 4H65A 2CZHA 1OLAA 2HAVA 3M3LA 3GZGA 2XXQA 1O64A 4MAGA 4N8GA 3PPQA 1IZ1A 3OO9A 1FTOA 2F34A 3MP1A 5AA1A 3K00A 5B7DA 5ISUA 2VHAA 4R6KA 2WKYA 3PD9A 2QS1A 1XVXA 2P2AA 1D4NA 4NF6B 5ICTA 1AOVA 4Q30B 4GX6A 3U92A 1DOTA 1SW5A 3C36A 3ILUB 3A29A 3E78A 1EZPA 5CC2A 1D9YA 1LAFE 1MXVA 5H8FB 1UIUA 1LBXA 3I3VA 2X7QA 4H46A 4X1DA 4HE0A 5FBPA 1BP5A 1FCKA 4TOZA 5H8QA 3U72A 1NV5A 5J1DA 3GLBA 4MLVA 3O29A 5CBRA 3VXBA 1N7XA 1O7TA 3R7XA 2GH9A 4XF5A 4UA8A 3RYDA 4OTEA 1AMFA 4KR5A 3QUFA 4IY6A 4GWUA 4N17A 5HPQA 3K4UA 3H6WA 3KSXA 1IMCA 4BDOA 4KYEA 1Q9DA 3G3JA 1B40A 5F1QA 2OX3A 5CMKA 2PT1A 2F7AA 3LUYA 4L17A 3VFJA 3N26A 1B1XA 2V3QA 1MG1A 3MC2A 1UTBB 1FRPA 5I2KA 3T9XB 3FUZA 1S50A 2Y5LA 1Q1KA 4H5GA 4KFQA 5F7VA 1Y3QA 4AS4A 4GXSB 1EH3A 2F35A 1NNKA 4MFIA 3TTNA 2XXXA 4HTGA 2PFYA 1N84A 2XWIA 4GIZA 2OLBA 1Y3PA 5DYHA 1MM7A 4NF4B 1FPGA 2QS3A 2VT5A 5CM6A 1MY2A 1WVJA 4FEDA 4NX1A 4LUBA 3ROJA 1B1HA 2ONRA 3RN8A 3ILTB 2XXTA 3ZSFA 1IMBA 1MH3A 2NOOA 5H8HA 3K6UA 4NGUA 1NV4A 3G3FA 4FATA 2BJIA 2F3DA 2RF1A 1I6AA 2VPOA 2ZNUA 1XOCA 3ZKLA 1QUIA 4QFPA 3IOWA 3KSJA 1MQHA 2ZZWA 1SQYA 1GV8A 3CI8A 3UP9A 3KBZA 1R6ZA 2NVUB 4GFRA 1EYIA 4XXUA 3T1BA 3RPLA 1NH7A 4DCXA 4BDNA 2Q2AA 5I58B 3C31A 3LSLA 3QXMA 3OO7A 3HHFA 3M3KA 3FIRA 1NH8A 3MVZA 2PYYA 3HHGA 5H8NA 1NNPA 3HO7A 4G8HA 3SERA 2DS9A 1DBZA 4OVPA 2THIA 4OEVA 1UTHA 3LSWA 2CZIA 4ONYA 4F2OA 3G3GA 3OO6A 2CEXA 4QHQA 4P8BA 3EHUA 4N6PA 3ZS6A 4P9KA 4IO3A 3S9MC 4PDHA 1QUKA 4HW8A 2CMOA 3QSLA 3MJNA 3H3GA 4ZE8A 5I2NB 3S9EA 2RKMA 1N04A 3H06B 4LATA 1TWYA 2DVCA 5I56B 1Y9UA 4NAPA 2I49A 5TP9A 3SEWA 2ESNA 1URDA 1FQBA 4KYSA 5M2VA 1A54A 4DI3D 2O68A 3CHGA 2LAOA 5L9OA 2UVIA 1AH5A 4NN3A 4M1VA 2XXRA 4KHZE 2FIEA 4YKIA 2QVRA 1SD3A 2A5TB 4H6DA 3QMFA 1B3FA 2HXWA 4U2RA 2XWOA 4RA1A 3GYYA 3TCHA 4PBHA 1JQFA 4O8MA 4IO5A 3MZBA 2GHAA 1A8FA 4ESXA 4N15A 1Q35A 1NUYA 4P1EA 2FVZA 2V3UA 4F3GA 5IGAA 2HXRA 3W9VA 1TT1A 1YTVA 1N3XA 4G68A 1H44A 4OETA 5EHSA 4EUOA 1KA1A 1EU8A 3EKIA 5FHOA 2UVJA 5BUUA 3MPLA 5AA2A 2WX9A 3CG3A 4DXCA 4FBPA 1NV7A 2DE3A 3BFTA 1IQ7A 2DDKA 2WBBA 4EF1A 1UQWA 3KN3A 4OVJA 4KQPA 2F8DA 1FBEA 5KZTA 1B3EA 2RC7A 1SW2A 4NMYA 2XXPA 3V5AA 3IFCA 4NHBA 1RDXA 4PF8A 1YXIA 2QRYA 4ELRA 5JTYB 4ZEDA 1OIBA 4DXUA 1P1UA 4LZ5A 3D4GA 2XD2A 4JSDA 4DE8A 4F1VA 2QS2A 4JB7A 1B5IA 1Y4TA 1US5A 2V3TA 4I3EA 3HPIA 1OQHA 3THIA 4MJOA 1FBCA 4YKKA 1IITA 3PPOA 1FBDA 3T96B 5J16A 2YJPA 3GBBA 3K6WA 1B7HA 2WBDA 3B50A 1SI0A 3FASA 3PPPA 4G68C 2XXHA 4R2BA 2H25A 1DK4A 3IJOB 2F7CA 1R1NA 3FBPA 3G3HA 4Z0IA 5K2YA 2F36A 2HAUA 3G3IA 3DP8A 2H98A 5AA4A 2RCBA 4O3CA 1FPIA 2FA7A 4O94A 4XKNA 3RY3A 4GQOA 2KR0A 2DYXA 4P3LA 1GGGA 3KEIA 4HE2A 5I84A 5H8QB 4C1UA 4FECA 3A3CA 3FGSA 2F6GA 4O7IA 5I59A 5IZ3A 5L9SA 3VVDA 4OFJA 2PFZA 3MWBA 4MLQA 2VD2A 4DIGA 1DPEA 4PAFA 1H3DA 2HQ0A 4HCWA 4U1ZA 1B3LA 1MDQA 3SEXA 3DM0A 2UVHA 3FJ7A 3K1MA 3CFZA 1VSOA 4JWXA 4GWYA 3K6VA 4OVSA 3TAJA 1K9YA 1US4A 1FPFA 5I2KB 4EQ9A 1JW5A 4RK2A 4F39A 4ZDMA 1XC1A 3WAFA 3Q28A 1HSJA 3MYUA 1NUXA 4QXDA 4EQ7A 1PB8A 1JETA 3ECRA 1XS5A 3O6HA 2R71A 2PX1A 1OMPA 3SEYA 3BIGA 3T93B 2B3FA 3E9XA 1A7LA 2V93A 3KZGA 2B4LA 3D1RA 4X1BA 5I5PA 3N94A 3CG1A 4GX3A 4GBVA 4UACA 3RGYA 3NOHA 2XA5A 4RK9A 3E4RA 4RNSA 1L5TA 3TCGA 5H8HB 2RC9A 4NTLA 3U1OA 4R72A 1DSNA 3OSQA 3IO6A 2QPQA 4PCDA 5CMMA 2H4IA 3H4ZA 1RDYA 4U22A 3IJXB 5ET5A 2GHBA 4GWXA 1P1QA 4E0WA 3EF7A 4QF9A 2R9JA 3C9HA 1CNQA 3OENA 3TZAA 2OZZA 3CIJA 1IXHA 1SYIA 1MXXA 4Z7EA 4YAHX 1URSA 2FHYA 5IZZA 2Q9TA 3TQLA 4GOTA 4XEQA 4OXVA 3HCQA 1MY3A 3KC1A 4THIA 4YMBA 5FHMA 5H8NB 4FE8A 1FBGA 1MPBA 5DT6A 4MF3A 1Y4CA 3PV0E 1MQGA 3OOAA 2CEYA 5ELVA 4GXAA 1DPPA 1SYHA 1I6BA 1H45A 4JVIA 1Z7NE 4GLIA 4PFRA 2FNCA 2H99A 1IXCA 3IOVA 3U8QA 3TPAA 2G93A 2GFEA 1QGXA 1DMBA 3L6HA 3M3FA 2PVUA 5H8SA 1NV2A 4M4GA 1PBPA 4MX6A 4N6KA 3VDFA 3S9LC 3MZ1A 4IO4A 2OWTA 3MPKA 4GX4A 2G29A 4PFWA 5ET7A 3RTWB 1EYKA 4NWCA 1FPDA 1ZMGA 3O2AA 5TP9B 1YCJA 1FBHA 3ZKKA 3S2VA 3UORA 4KCCA 2ZNTA 3C35A 2Y7PA 3TUSA 4U4SA 2ONKE 4QFOA 2ZMBA 1ZLQA 4RPOA 2Q8JA 3O97A 5HBCA 5I57A 3R26A 3H7MA 1MQIA 4MEVA 4H8JA 5CI5A 2ALUA 3RPWA 4R74A 4G68B 4E0XA 5I7IA 4GRKA 4PETA 2I3WA 4KYDA 4TLLB 2D21A 5AA2B 3VLVA 4POWA 3T9HB 4JXIA 3KC0A 5BWJA 4G8MA 4GL8A 2Y7RA 2QVUA 3UIFA 2Z23A 2GQ1A 4EDPA 3OEKA 4MHFA 3Q26A 3QIMA 3SETA 4O7MA 4ZEIA 1NL5A 3T9VA 4P47A 3D4CA 1P1WA 1LBYA 4JBZA 2I4BA 1PBQA 3N5LA 3O6IA 1NI9A 4P0IA 1GVCA 3G7WA 4JDFA 5CRYA 1NKXA 3T9UA 3KOSA 1ZKBA 3IO4A 2O7IA 1FQEA 5ITOA 2WEFA 2Y7KA 3SZPA 3BIHA 4LONB 2I58A 3QUJA 2F6PA 1Y3NA 4F3PA 4OVQA 3BFUA 3OXNA 4FIMA 1P99A 4DI4B 4QRZA 1NUWA 1ZBMA 4N8YA 1DCUA 3FXUA 3Q25A 2X26A 4PBQA 3EQ1A 3M8UA 4YMAA 3PUVE 3EHTA 4OQOA 5AA4B 1PB7A 4EXKA 2O84X 3JZJA 1LB9A 1ANFA 2HFBA 4DZ1A 1RKMA 4F1UA 3VVFA 3TODA 1LLSA 3JV9A 1OLCA 4MNIA 4U21A 5I59B 1YYZA 5IZ3B 3MUQA 1JVXA 2MKZA 1LCTA 4UABA 4XIGQ 4MNPA 3QYTA 4QBAA 5H8FA 1MM6A 3W9WA 2ZZXA 4LZ8A 4X9TA 4F1YA 4P1LA 4N4UA 5B70A 3K2DA 4PQJA 4AB5A 3FV2A 2FYIA 2O7UA 4JVCA 4YKPA 2P3NA 3Q27A 1QKAA 2RCAA 5A5LA 4IR8A 1LAXA 1IMDA 1QULA 4H45A 3RNNA 4LN5A 3VVEA 4YB6A 3PMVA 2F97A 5FHNA 2Y7WA 3C33A 4IO7A 1G0IA 4ELQA 1XI6A 2Q89A 1BIYA 4KI0E 4PFTA 4ZZAA 3H6TA 2L5VA 4X48A 1FPLA 1KZ8A 1ZIUA 3H6VA 4G77A 4PDDA 4ZS9A 5EHMA 5LDZA 2X7PA 1R9QA 1D3KA 4FEBA 2QJEA 1I6QA 4PAKA 3LC8A 3LR1A 1H43A 2ZZVA 2OWZA 2XD3A 4HXVA 4PP0A 4FJPA 3OO8A 3UA8A 3PMWA 3PUZE 1AWBA 2AIXA 5TPAA 4OENA 2VD3A 3WAEA 3FD3A 5EYHA 3SDFA 3CFLA 5I3SA 3A09A 3KN7A 4OHNA 4R9GA 3UK4A 4NEDA 3E3KA 2AL5A 2XX7A 1NNFA 3I5OA 3IX1A 4Q0CA 4RYAA 4JWOA 4HE1A 4F19A 2Z8FA 1N7WA 2Z22A 3QAXA 1N0TA 4PE3A 4JWYA 4XKRA 4POXA 2ANJA 3U94A 1TFDA 3S4UA 3UGWA 1UIVA 2XXUA 2R8TA 1FQDA 3I6VA 5EQ8A 3U93A 4MNCA 2XHDA 5KCJA 1EZ9A 4C1TA 2V4CA 3JYRA 5CMBA 2DWJA 5LTCA 2B3BA 3IB1A 1JVYA 3FXRA 2I3VA 3PU5A 3O9PA 1FQFA 4I3YA 1B0HA 5LOMA 1A99A 3CSBA 5ET6A 2RC8A 4O3BA 4NF8A 3VXCA 1SI1A 4NWDA 3F11A 2WYPA 3KOTA 2WYKA 4KCDA 1P1OA 1CB6A 1IMFA 4H0WA 3PD8A 3SEUA 4WEDA 1VR5A 1Z7ME 4P11A 4QSDA 1MDP1 2ABHA 3IB2A 3CFXA 2OWSA 2JJKA 1LBBA 3K01A 4OYVA 1OVBA 1FTAA 4ZEFA 5DW8A 1NNTA 2CZLA 3MW0A 1D9VA 1ZU0A 1SPIA 1LFIA 1GR2A 1MXWA 3B6WA 3LUZA 1B3HA 1YZ0A 4OWDA 5I57B 4GBWA 4LA9A 4GWOA 2ZYMA 2KLFA 2O51A 1GTKA 3RLFE 1USYE 2P1SA 1FTKA 3GBAA 4YZZA 4N81A 2VGQA 1LGBC 2Q74A 4BLAA 4ND9A 2Q2CA 4O3AA 3FATA 4ZEKA 4F3SA 5ESYA 3RT6B 2DXRA 3TTLA 1P1NA 3W15C 1NFTA 4ELOA 1PC3A 3T0JA 2V84A 2QMXA 2O1LA 4OERA 1FJ9A 1FW0A 1II5A 5IKBA 1ZTYA 5DTBA 1SBPA 1B52A 4XTCQ 2Q8MA 3TCFA 2F78A 1B7ZA 3FVOA 1Y1ZA 4BDMA 4N13A 2OK2A 5A5XA 1PDAA 3VV5A 2I48A 5ICQA 3FVKA 2DWIA 3CSGA 4U1OA 5KDTA 4I62A 3OELA 1INPA 4PE5B 2QFLA 5EQAA 3RT8A 5DEXA 1KWHA 1XVYA 3O28A 2IA4A 4OVTA 3T22A 3PUYE 3PGFA 3CRBA 1B6HA 4KD5A 3B7DA 4OA4A 1TXFA 2CZKA 2I0BA 2XXVA 1MPDA 4Q8RA 4F2QA 5EQ9A 1EYJA 3RPLB 2VOZA 2XX8A 4KXPA 3DP4A 1IXGA 4PGNA 1B3GA 5DVJA 3TFLA 1HSEA 1LBWA 3E79A 4YU0A 1Y1MA 4ECFA 3B8BA 2VPNA 1AIVA 1M5FA 3U65A 3HV1A 1A55A 5ITPA 5DVFA 4XKPA 2P3VA 2Y7IA 1UTHB 2AL4A 4TQUQ 2W7YA 4DLDA 3USDA 4PFUA 5IM2A 1FPJA 2Y5KA 4OVRA 1FTJA 3IOUA 2O1MA 4ZECA 1R9LA 3LSFB 3K1PA 1B46A 3H6UA 5EQ7A 2PBWA 4I8CA 5JK4A 1S9TA 1RDZA 3ONMA 4EXLA 3DP6A 4G4PA 1BLFA 1FQAA 1I69A 4MIJA 3P7IA 1LSTA 1SVXB 2DSFA 4OFOA 4YB5A 4NG7A 1BTJA 4IO6A 3O6GA 1MQDA 3TTRA 1IIWA 4NE4A 3MVYA 1MXYA 3HN0A 3MVXA 4G2ZA 1EZOA 1LEVA 2F3BA 1JW1A 3B6QA 1A8EA 1B51A 4I9DA 3K0VA 3SKPA 1G0HA 4K3FA 2I4CA 3OMBA 4H8IA 3KGCA 1T0KA 4IO2A 3PPNA 2ZYNA 3PUWE 1MXZA 4YICA 3FV1A 1SW4A 2DOJA 1LCFA 2OJTA 2HZLA 3N6TA 3DELB 4PF6A 4EF2A 3MBPA 3O66A 3BKIB 1N3WA 3LSXA 1HSLA 4F29A 4LVQA 3KG2A 4WEPA 5FTIA 4NF5A 4MMPA 4G61A 3EHSA 4NF0A 3TQWA 1LBCA 4F18A 1F9BA 1K9ZA 2VP1A 5TPAB 4PFBA 1WODA 2DP8A 3MP8A 1LAGE 1JEVA 3IFAA 4MBPA 2HZKA 2NWJA 3TDJA 2P0SA 1SW1A 4OANA 4ISUA 3MQ9A 4KPTA 5FTHA 4C0RA 4LQ5A 5JEIA 2FIXA 2XXKA 4N07A 4IY5A 2I0CA 1YPNA 1IMAA 1Y20A 1NUZA 3K02A 1DTZA 3L6GA 5IZ1A 5KCJB 4IB2A 2UXAA 4YB7A 2XWVA 4XFEA 3MP6A 4X04A 4GWWA 4X8RA 4DXBA 5L8DA 1B2HA 2XXIA 2IEEA 3KJ7A 3TELA 3FXQA 3QK6A 3AXFA 1FPEA 4I1DA 1MH4A 3IAZA 2XX9A 4OFLA 3DLNA 1BKAA 4PAIA 4GD5A 1XT8A 1POY1 4GWZA 4H67A 5AA2D 1AL3A 4NF8B 4R73A 3LBSA 3FVNA 4NF6A 4QFKA 1LFHA 4N6DA 4GWSA 1PEBA 3VE1B 4IGTA 3SEVA 2REGA 1FPBA 3IB0A 1MQJA 1DTGA 3E13X 4F31B 3IK6B 3IOTA 2QMWA 4ESWA 2RINA 1B5HA 3TTMA 3MVWA 4OESA 1IEJA 2NUVA 2M8CA 1N76A 5ET8A 3A3UA 4JVDA 1ATGA 4PGPA 4RPNA 4YKJA 4BDQA 4PFIA 2ZYOA 4LZ7A 1LB8A 1M5DA 2D3IA 2H9BA 4H5FA 2Z8DA 5L9MA 3RUMA 3IR1A 2ONSA 3MAMA 3R6UA 2PMSA 3EPEA 1QUJA 1QJMA 3MZ9A 1M5EA 4NQ8A 4ZE9A 1B58A 1SDXA 1B0LA 1OVTA 3TMGA 2FBPA 1LBVA 4U4XA 4TLMB 3FJMA 1B9JA 3V8XB 2DXYA 1UTBA 3PTYA 1OQGA 2NXOA 1MY4A 3TKDA 3C4MA 1H76A 1QW0A 4DCYA 1FTMA 4GL0A 4HS7A 1QKBA 2QS4A 3RTFB 2OCUA 3G3KA 4P0GA 2QSXA 3FJGA 3ODBA 5A5XB 4AB6A 2QL3A 2UYFA 3HFUA 5EYGA 2O69A 1B32A 4BDLA
chains in the Genus database with same CATH topology
5AE4A 3OSRA 5KDTB 2F5XA 1MY0A 1CE2A 2HCAA 3KFMA 4NF4A 4QSEA 3VLWA 4HCYA 2YLNA 1MXUA 3OD7A 2REJA 4R2FA 5DEXB 1RYXA 2Y84A 1LFGA 4RY1A 3V83A 5DVIA 3KBRA 4XKQA 1NMUA 4ZZEA 3K6XA 2UYEA 2XXWA 4ZEBA 3VLUA 1LAHE 4PFYA 2DWAA 3H03A 2DE2A 3OEMA 3S9NC 1QVSA 3GXAA 4U23A 4GF8A 4MH5A 3UN6A 1IXIA 3HSTA 2XXYA 4R75A 2UVGA 4OZ9A 1VFEA 5IAIA 1TFAA 4Q5TA 1M5CA 5I58A 3V89B 1ELJA 3Q29A 2AYSA 4R6YA 4H1XA 1VE4A 5TU0A 4G8NA 3RQTA 1FQCA 1VFDA 5HM4B 4R6HA 3PPRA 4DDDA 2V25A 3PUXE 1FTLA 3TEPA 1B05A 4LQ2A 1JW4A 2I6EA 3TTKA 2O6AA 4LP2B 4QFNA 3N6UA 3FVGA 1URGA 2OBGA 5EYFA 1B5JA 1MPCA 1S7YA 3KJTA 1POTA 4OMBA 4RJZA 4IGRA 4GVOA 2BJJX 2D5WA 5CBSA 2F7BA 5I2NA 4EQBA 2E1SA 1ZJLA 1PB9A 5AA3A 1JNFA 3TYHA 1A40A 3CVGA 5CMCA 1XHYA 5I56A 1USYH 4JSOA 4R9FA 2Z8EA 2HEUA 1YAEA 2ZNSA 3B6TA 3PMXA 4FAJA 3FZVA 2DWHA 3KN8A 4F3BA 2A5TA 2ZYKA 3EN3A 4WXJA 1B4HA 1JEUA 3K1NA 3T66A 4NF5B 4QSCA 3SESA 2DE4A 2R6GE 3BBRA 1B7UA 4FORA 4AQ4A 3IORA 2ZXTA 1B4ZA 2E0SA 4QFLA 2GRVA 1O63A 2DVZA 2B65A 1J1NA 1MY1A 4OEUA 2A5SA 1RYOA 1MRPA 3IL1B 2YPNA 2Q88A 1M5BA 3C32A 2H5YA 4RXLA 1WDNA 1IUDA 2DQVA 1MS7A 2PT2A 4WKMA 5K2XA 4F22A 5JTYA 3CR9A 4BDRA 4ELPA 3C34A 4H65A 1OLAA 2HAVA 3M3LA 3GZGA 2XXQA 1O64A 3PPQA 1IZ1A 3OO9A 1FTOA 2F34A 3MP1A 5AA1A 3K00A 5B7DA 5ISUA 2VHAA 4R6KA 2WKYA 3PD9A 2QS1A 1XVXA 2P2AA 1D4NA 4NF6B 5ICTA 1AOVA 4Q30B 3U92A 1DOTA 1SW5A 3C36A 3ILUB 1EZPA 5CC2A 1D9YA 1LAFE 1MXVA 5H8FB 1UIUA 3I3VA 2X7QA 4X1DA 1BP5A 1FCKA 4TOZA 5H8QA 3U72A 5J1DA 3GLBA 4MLVA 3O29A 5CBRA 3VXBA 1N7XA 1O7TA 3R7XA 2GH9A 4UA8A 4OTEA 1AMFA 4KR5A 3QUFA 4IY6A 5HPQA 3K4UA 3H6WA 3KSXA 4BDOA 4KYEA 3G3JA 1B40A 5F1QA 5CMKA 2PT1A 2F7AA 3LUYA 4L17A 3VFJA 3N26A 1B1XA 2V3QA 1MG1A 3MC2A 1UTBB 5I2KA 3T9XB 3FUZA 1S50A 1Q1KA 4H5GA 4KFQA 5F7VA 1Y3QA 4GXSB 1EH3A 2F35A 1NNKA 4MFIA 3TTNA 2XXXA 4HTGA 1N84A 4GIZA 2OLBA 1Y3PA 5DYHA 1MM7A 4NF4B 2QS3A 5CM6A 1MY2A 1WVJA 4FEDA 4LUBA 1B1HA 2ONRA 3RN8A 3ILTB 2XXTA 3ZSFA 1MH3A 2NOOA 5H8HA 3K6UA 3G3FA 4FATA 2RF1A 1I6AA 2ZNUA 1XOCA 3ZKLA 1QUIA 4QFPA 3IOWA 3KSJA 1MQHA 1SQYA 1GV8A 3CI8A 3UP9A 1R6ZA 2NVUB 4GFRA 4XXUA 1NH7A 4DCXA 4BDNA 2Q2AA 5I58B 3C31A 3LSLA 3QXMA 3OO7A 3HHFA 3M3KA 3FIRA 1NH8A 3MVZA 2PYYA 3HHGA 5H8NA 1NNPA 3HO7A 4G8HA 3SERA 2DS9A 2THIA 4OEVA 1UTHA 3LSWA 4ONYA 4F2OA 3G3GA 3OO6A 4QHQA 3EHUA 4N6PA 3ZS6A 4IO3A 3S9MC 1QUKA 4HW8A 2CMOA 3QSLA 3MJNA 3H3GA 4ZE8A 5I2NB 3S9EA 2RKMA 1N04A 3H06B 4LATA 1TWYA 2DVCA 5I56B 1Y9UA 2I49A 5TP9A 3SEWA 2ESNA 1URDA 1FQBA 4KYSA 5M2VA 1A54A 2O68A 2LAOA 5L9OA 2UVIA 1AH5A 4M1VA 2XXRA 4KHZE 4YKIA 1SD3A 2A5TB 4H6DA 1B3FA 2HXWA 4U2RA 4RA1A 3TCHA 1JQFA 4IO5A 3MZBA 2GHAA 1A8FA 4ESXA 1Q35A 2V3UA 4F3GA 3W9VA 1TT1A 1YTVA 1N3XA 4G68A 1H44A 4OETA 5EHSA 4EUOA 1EU8A 5FHOA 2UVJA 5BUUA 3MPLA 5AA2A 3CG3A 4DXCA 2DE3A 3BFTA 1IQ7A 4EF1A 1UQWA 3KN3A 4OVJA 4KQPA 2F8DA 5KZTA 1B3EA 2RC7A 1SW2A 4NMYA 2XXPA 3V5AA 2QRYA 4ELRA 5JTYB 4ZEDA 1OIBA 4DXUA 1P1UA 4LZ5A 3D4GA 2XD2A 4JSDA 4DE8A 4F1VA 2QS2A 4JB7A 1B5IA 1Y4TA 1US5A 2V3TA 3HPIA 1OQHA 3THIA 4YKKA 1IITA 3PPOA 3T96B 2YJPA 3GBBA 3K6WA 1B7HA 1SI0A 3FASA 3PPPA 4G68C 2XXHA 4R2BA 2H25A 3IJOB 2F7CA 1R1NA 3G3HA 4Z0IA 5K2YA 2F36A 2HAUA 3G3IA 3DP8A 2H98A 5AA4A 2RCBA 4O3CA 2FA7A 4XKNA 3RY3A 4GQOA 2DYXA 1GGGA 3KEIA 5I84A 5H8QB 4C1UA 4FECA 3A3CA 3FGSA 2F6GA 5I59A 5L9SA 3VVDA 4OFJA 3MWBA 4MLQA 2VD2A 4DIGA 1DPEA 1H3DA 2HQ0A 4HCWA 4U1ZA 1B3LA 1MDQA 3SEXA 3DM0A 2UVHA 3FJ7A 3K1MA 3CFZA 1VSOA 4JWXA 3K6VA 3TAJA 1US4A 5I2KB 4EQ9A 1JW5A 4RK2A 4F39A 4ZDMA 1XC1A 3WAFA 3Q28A 1HSJA 4EQ7A 1PB8A 1JETA 3ECRA 1XS5A 3O6HA 2R71A 2PX1A 1OMPA 3SEYA 3T93B 2B3FA 3E9XA 1A7LA 2V93A 3KZGA 4X1BA 3N94A 3CG1A 4UACA 3RGYA 4RK9A 3E4RA 4RNSA 1L5TA 3TCGA 5H8HB 2RC9A 4NTLA 3U1OA 4R72A 1DSNA 3OSQA 3IO6A 2QPQA 5CMMA 2H4IA 3H4ZA 4U22A 3IJXB 2GHBA 1P1QA 4E0WA 3EF7A 4QF9A 2R9JA 3C9HA 3OENA 3TZAA 2OZZA 3CIJA 1IXHA 1SYIA 1MXXA 4Z7EA 4YAHX 1URSA 2Q9TA 3TQLA 4GOTA 4OXVA 3HCQA 1MY3A 4THIA 4YMBA 5FHMA 5H8NB 4FE8A 1MPBA 5DT6A 4MF3A 1Y4CA 3PV0E 1MQGA 3OOAA 5ELVA 4GXAA 1DPPA 1SYHA 1I6BA 1H45A 1Z7NE 4GLIA 2FNCA 2H99A 1IXCA 3IOVA 3U8QA 3TPAA 2G93A 2GFEA 1DMBA 3L6HA 3M3FA 2PVUA 5H8SA 4M4GA 1PBPA 3VDFA 3S9LC 3MZ1A 4IO4A 2OWTA 3MPKA 4PFWA 2G29A 3RTWB 4NWCA 1ZMGA 3O2AA 5TP9B 1YCJA 3ZKKA 3S2VA 3UORA 4KCCA 2ZNTA 3C35A 2Y7PA 3TUSA 4U4SA 2ONKE 4QFOA 2ZMBA 1ZLQA 4RPOA 2Q8JA 3O97A 5HBCA 5I57A 3R26A 3H7MA 1MQIA 4H8JA 5CI5A 2ALUA 3RPWA 4R74A 4G68B 4E0XA 4GRKA 4PETA 2I3WA 4KYDA 4TLLB 2D21A 5AA2B 3VLVA 4POWA 3T9HB 4JXIA 5BWJA 4G8MA 4GL8A 2Y7RA 3UIFA 2Z23A 4EDPA 3OEKA 3Q26A 3QIMA 3SETA 4ZEIA 1NL5A 3T9VA 3D4CA 1P1WA 4JBZA 2I4BA 1PBQA 3N5LA 3O6IA 4P0IA 1GVCA 3G7WA 4JDFA 5CRYA 1NKXA 3T9UA 3KOSA 1ZKBA 3IO4A 2O7IA 1FQEA 5ITOA 2Y7KA 4LONB 2I58A 3QUJA 2F6PA 1Y3NA 4F3PA 3BFUA 3OXNA 4FIMA 1P99A 4QRZA 1ZBMA 3FXUA 3Q25A 2X26A 3EQ1A 3M8UA 4YMAA 3PUVE 3EHTA 4OQOA 5AA4B 1PB7A 4EXKA 2O84X 3JZJA 1LB9A 1ANFA 2HFBA 4DZ1A 1RKMA 4F1UA 3VVFA 3TODA 1LLSA 3JV9A 1OLCA 4U21A 5I59B 3MUQA 1JVXA 1LCTA 4XIGQ 3QYTA 5H8FA 1MM6A 3W9WA 4LZ8A 4X9TA 4F1YA 5B70A 3K2DA 4PQJA 4AB5A 3FV2A 2FYIA 2O7UA 4YKPA 3Q27A 1QKAA 2RCAA 1LAXA 1QULA 3RNNA 3VVEA 4YB6A 3PMVA 2F97A 5FHNA 2Y7WA 3C33A 4IO7A 4ELQA 2Q89A 1BIYA 4KI0E 4PFTA 4ZZAA 3H6TA 4X48A 1ZIUA 3H6VA 4G77A 4ZS9A 5EHMA 2X7PA 1R9QA 1D3KA 4FEBA 2QJEA 1I6QA 3LC8A 3LR1A 1H43A 2XD3A 4PP0A 4FJPA 3OO8A 3UA8A 3PMWA 3PUZE 2AIXA 5TPAA 4OENA 2VD3A 3WAEA 3FD3A 3SDFA 3CFLA 3A09A 3KN7A 4OHNA 4R9GA 3UK4A 4NEDA 3E3KA 2AL5A 2XX7A 1NNFA 3I5OA 3IX1A 4Q0CA 4RYAA 4JWOA 4F19A 2Z8FA 1N7WA 2Z22A 3QAXA 1N0TA 4JWYA 4XKRA 4POXA 2ANJA 3U94A 1TFDA 3S4UA 3UGWA 1UIVA 2XXUA 1FQDA 3I6VA 3U93A 2XHDA 5KCJA 1EZ9A 4C1TA 3JYRA 5CMBA 2DWJA 2B3BA 3IB1A 1JVYA 3FXRA 2I3VA 3PU5A 3O9PA 1FQFA 1B0HA 5LOMA 1A99A 3CSBA 2RC8A 4O3BA 4NF8A 3VXCA 1SI1A 4NWDA 3F11A 3KOTA 4KCDA 1P1OA 1CB6A 4H0WA 3PD8A 3SEUA 4WEDA 1VR5A 1Z7ME 4P11A 4QSDA 1MDP1 2ABHA 3IB2A 3CFXA 2OWSA 1LBBA 3K01A 4OYVA 1OVBA 4ZEFA 1NNTA 2CZLA 3MW0A 1D9VA 1ZU0A 1LFIA 1GR2A 1MXWA 3B6WA 1B3HA 4OWDA 5I57B 4LA9A 4GWOA 2ZYMA 2KLFA 2O51A 1GTKA 3RLFE 1USYE 2P1SA 1FTKA 3GBAA 4YZZA 2VGQA 1LGBC 4BLAA 4ND9A 2Q2CA 4O3AA 3FATA 4ZEKA 4F3SA 3RT6B 2DXRA 3TTLA 1P1NA 3W15C 1NFTA 4ELOA 1PC3A 2V84A 2QMXA 2O1LA 4OERA 1FW0A 1II5A 5IKBA 1ZTYA 5DTBA 1SBPA 1B52A 4XTCQ 3TCFA 2F78A 1B7ZA 3FVOA 1Y1ZA 4BDMA 4N13A 2OK2A 5A5XA 1PDAA 3VV5A 2I48A 5ICQA 3FVKA 2DWIA 3CSGA 4U1OA 5KDTA 4I62A 3OELA 4PE5B 3RT8A 5DEXA 1KWHA 1XVYA 3O28A 2IA4A 3T22A 3PUYE 3PGFA 3CRBA 1B6HA 4KD5A 3B7DA 1TXFA 2I0BA 2XXVA 1MPDA 4Q8RA 4F2QA 2VOZA 2XX8A 3DP4A 1IXGA 1B3GA 5DVJA 3TFLA 1HSEA 4YU0A 1Y1MA 4ECFA 1AIVA 1M5FA 3HV1A 1A55A 5ITPA 5DVFA 4XKPA 2Y7IA 1UTHB 2AL4A 4TQUQ 2W7YA 4DLDA 3USDA 4PFUA 1FTJA 3IOUA 2O1MA 4ZECA 1R9LA 3LSFB 3K1PA 1B46A 3H6UA 2PBWA 4I8CA 5JK4A 1S9TA 3ONMA 4EXLA 3DP6A 4G4PA 1BLFA 1FQAA 1I69A 3P7IA 1LSTA 1SVXB 2DSFA 4OFOA 4YB5A 1BTJA 4IO6A 3O6GA 1MQDA 3TTRA 1IIWA 4NE4A 3MVYA 1MXYA 3HN0A 3MVXA 4G2ZA 1EZOA 1JW1A 3B6QA 1A8EA 1B51A 4I9DA 3K0VA 3SKPA 4K3FA 2I4CA 3OMBA 4H8IA 3KGCA 1T0KA 4IO2A 3PPNA 2ZYNA 3PUWE 1MXZA 4YICA 3FV1A 1SW4A 2DOJA 1LCFA 2OJTA 2HZLA 3N6TA 3DELB 4EF2A 3MBPA 3O66A 3BKIB 1N3WA 3LSXA 1HSLA 4F29A 4LVQA 3KG2A 4WEPA 5FTIA 4NF5A 3EHSA 3TQWA 1LBCA 4F18A 1F9BA 2VP1A 5TPAB 1WODA 2DP8A 3MP8A 1LAGE 1JEVA 4MBPA 2HZKA 2NWJA 3TDJA 2P0SA 1SW1A 4ISUA 3MQ9A 4KPTA 5FTHA 4C0RA 4LQ5A 5JEIA 4N07A 4IY5A 2I0CA 1YPNA 1Y20A 3K02A 1DTZA 3L6GA 5KCJB 4IB2A 2UXAA 4YB7A 3MP6A 4DXBA 5L8DA 1B2HA 2XXIA 2IEEA 3KJ7A 3TELA 3FXQA 3QK6A 3AXFA 4I1DA 1MH4A 3IAZA 2XX9A 4OFLA 3DLNA 1BKAA 4GD5A 1XT8A 1POY1 4H67A 5AA2D 1AL3A 4NF8B 4R73A 3LBSA 3FVNA 4NF6A 4QFKA 1LFHA 1PEBA 3VE1B 4IGTA 3SEVA 2REGA 3IB0A 1MQJA 1DTGA 3E13X 4F31B 3IK6B 3IOTA 2QMWA 4ESWA 2RINA 1B5HA 3TTMA 3MVWA 4OESA 1IEJA 2NUVA 2M8CA 1N76A 3A3UA 1ATGA 4RPNA 4YKJA 4BDQA 2ZYOA 4LZ7A 1LB8A 1M5DA 2D3IA 2H9BA 4H5FA 2Z8DA 5L9MA 3RUMA 3IR1A 2ONSA 3MAMA 3R6UA 2PMSA 3EPEA 1QUJA 1QJMA 3MZ9A 1M5EA 4ZE9A 1B58A 1SDXA 1B0LA 1OVTA 3TMGA 4U4XA 4TLMB 3FJMA 1B9JA 3V8XB 2DXYA 1UTBA 1OQGA 2NXOA 1MY4A 3TKDA 3C4MA 1H76A 1QW0A 4DCYA 1FTMA 4GL0A 4HS7A 1QKBA 2QS4A 3RTFB 2OCUA 3G3KA 4P0GA 2QSXA 3FJGA 3ODBA 5A5XB 4AB6A 2QL3A 2UYFA 2O69A 1B32A 4BDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AE4 A;  3OSR A;  5KDT B;  2F5X A;  1MY0 A;  1CE2 A;  2HCA A;  3KFM A;  4NF4 A;  4QSE A;  3VLW A;  4HCY A;  2YLN A;  1MXU A;  3OD7 A;  2REJ A;  4R2F A;  5DEX B;  1RYX A;  2Y84 A;  1LFG A;  4RY1 A;  3V83 A;  5DVI A;  3KBR A;  4XKQ A;  1NMU A;  4ZZE A;  3K6X A;  2UYE A;  2XXW A;  4ZEB A;  3VLU A;  1LAH E;  4PFY A;  2DWA A;  3H03 A;  2DE2 A;  3OEM A;  3S9N C;  1QVS A;  3GXA A;  4U23 A;  4GF8 A;  4MH5 A;  3UN6 A;  1IXI A;  3HST A;  2XXY A;  4R75 A;  2UVG A;  4OZ9 A;  1VFE A;  5IAI A;  1TFA A;  4Q5T A;  1M5C A;  5I58 A;  3V89 B;  1ELJ A;  3Q29 A;  2AYS A;  4R6Y A;  4H1X A;  1VE4 A;  5TU0 A;  4G8N A;  3RQT A;  1FQC A;  1VFD A;  5HM4 B;  4R6H A;  3PPR A;  4DDD A;  2V25 A;  3PUX E;  1FTL A;  3TEP A;  1B05 A;  4LQ2 A;  1JW4 A;  2I6E A;  3TTK A;  2O6A A;  4LP2 B;  4QFN A;  3N6U A;  3FVG A;  1URG A;  2OBG A;  5EYF A;  1B5J A;  1MPC A;  1S7Y A;  3KJT A;  1POT A;  4OMB A;  4RJZ A;  4IGR A;  4GVO A;  2BJJ X;  2D5W A;  5CBS A;  2F7B A;  5I2N A;  4EQB A;  2E1S A;  1ZJL A;  1PB9 A;  5AA3 A;  1JNF A;  3TYH A;  1A40 A;  3CVG A;  5CMC A;  1XHY A;  5I56 A;  1USY H;  4JSO A;  4R9F A;  2Z8E A;  2HEU A;  1YAE A;  2ZNS A;  3B6T A;  3PMX A;  4FAJ A;  3FZV A;  2DWH A;  3KN8 A;  4F3B A;  2A5T A;  2ZYK A;  3EN3 A;  4WXJ A;  1B4H A;  1JEU A;  3K1N A;  3T66 A;  4NF5 B;  4QSC A;  3SES A;  2DE4 A;  2R6G E;  3BBR A;  1B7U A;  4FOR A;  4AQ4 A;  3IOR A;  2ZXT A;  1B4Z A;  2E0S A;  4QFL A;  2GRV A;  1O63 A;  2DVZ A;  2B65 A;  1J1N A;  1MY1 A;  4OEU A;  2A5S A;  1RYO A;  1MRP A;  3IL1 B;  2YPN A;  2Q88 A;  1M5B A;  3C32 A;  2H5Y A;  4RXL A;  1WDN A;  1IUD A;  2DQV A;  1MS7 A;  2PT2 A;  4WKM A;  5K2X A;  4F22 A;  5JTY A;  3CR9 A;  4BDR A;  4ELP A;  3C34 A;  4H65 A;  1OLA A;  2HAV A;  3M3L A;  3GZG A;  2XXQ A;  1O64 A;  3PPQ A;  1IZ1 A;  3OO9 A;  1FTO A;  2F34 A;  3MP1 A;  5AA1 A;  3K00 A;  5B7D A;  5ISU A;  2VHA A;  4R6K A;  2WKY A;  3PD9 A;  2QS1 A;  1XVX A;  2P2A A;  1D4N A;  4NF6 B;  5ICT A;  1AOV A;  4Q30 B;  3U92 A;  1DOT A;  1SW5 A;  3C36 A;  3ILU B;  1EZP A;  5CC2 A;  1D9Y A;  1LAF E;  1MXV A;  5H8F B;  1UIU A;  3I3V A;  2X7Q A;  4X1D A;  1BP5 A;  1FCK A;  4TOZ A;  5H8Q A;  3U72 A;  5J1D A;  3GLB A;  4MLV A;  3O29 A;  5CBR A;  3VXB A;  1N7X A;  1O7T A;  3R7X A;  2GH9 A;  4UA8 A;  4OTE A;  1AMF A;  4KR5 A;  3QUF A;  4IY6 A;  5HPQ A;  3K4U A;  3H6W A;  3KSX A;  4BDO A;  4KYE A;  3G3J A;  1B40 A;  5F1Q A;  5CMK A;  2PT1 A;  2F7A A;  3LUY A;  4L17 A;  3VFJ A;  3N26 A;  1B1X A;  2V3Q A;  1MG1 A;  3MC2 A;  1UTB B;  5I2K A;  3T9X B;  3FUZ A;  1S50 A;  1Q1K A;  4H5G A;  4KFQ A;  5F7V A;  1Y3Q A;  4GXS B;  1EH3 A;  2F35 A;  1NNK A;  4MFI A;  3TTN A;  2XXX A;  4HTG A;  1N84 A;  4GIZ A;  2OLB A;  1Y3P A;  5DYH A;  1MM7 A;  4NF4 B;  2QS3 A;  5CM6 A;  1MY2 A;  1WVJ A;  4FED A;  4LUB A;  1B1H A;  2ONR A;  3RN8 A;  3ILT B;  2XXT A;  3ZSF A;  1MH3 A;  2NOO A;  5H8H A;  3K6U A;  3G3F A;  4FAT A;  2RF1 A;  1I6A A;  2ZNU A;  1XOC A;  3ZKL A;  1QUI A;  4QFP A;  3IOW A;  3KSJ A;  1MQH A;  1SQY A;  1GV8 A;  3CI8 A;  3UP9 A;  1R6Z A;  2NVU B;  4GFR A;  4XXU A;  1NH7 A;  4DCX A;  4BDN A;  2Q2A A;  5I58 B;  3C31 A;  3LSL A;  3QXM A;  3OO7 A;  3HHF A;  3M3K A;  3FIR A;  1NH8 A;  3MVZ A;  2PYY A;  3HHG A;  5H8N A;  1NNP A;  3HO7 A;  4G8H A;  3SER A;  2DS9 A;  2THI A;  4OEV A;  1UTH A;  3LSW A;  4ONY A;  4F2O A;  3G3G A;  3OO6 A;  4QHQ A;  3EHU A;  4N6P A;  3ZS6 A;  4IO3 A;  3S9M C;  1QUK A;  4HW8 A;  2CMO A;  3QSL A;  3MJN A;  3H3G A;  4ZE8 A;  5I2N B;  3S9E A;  2RKM A;  1N04 A;  3H06 B;  4LAT A;  1TWY A;  2DVC A;  5I56 B;  1Y9U A;  2I49 A;  5TP9 A;  3SEW A;  2ESN A;  1URD A;  1FQB A;  4KYS A;  5M2V A;  1A54 A;  2O68 A;  2LAO A;  5L9O A;  2UVI A;  1AH5 A;  4M1V A;  2XXR A;  4KHZ E;  4YKI A;  1SD3 A;  2A5T B;  4H6D A;  1B3F A;  2HXW A;  4U2R A;  4RA1 A;  3TCH A;  1JQF A;  4IO5 A;  3MZB A;  2GHA A;  1A8F A;  4ESX A;  1Q35 A;  2V3U A;  4F3G A;  3W9V A;  1TT1 A;  1YTV A;  1N3X A;  4G68 A;  1H44 A;  4OET A;  5EHS A;  4EUO A;  1EU8 A;  5FHO A;  2UVJ A;  5BUU A;  3MPL A;  5AA2 A;  3CG3 A;  4DXC A;  2DE3 A;  3BFT A;  1IQ7 A;  4EF1 A;  1UQW A;  3KN3 A;  4OVJ A;  4KQP A;  2F8D A;  5KZT A;  1B3E A;  2RC7 A;  1SW2 A;  4NMY A;  2XXP A;  3V5A A;  2QRY A;  4ELR A;  5JTY B;  4ZED A;  1OIB A;  4DXU A;  1P1U A;  4LZ5 A;  3D4G A;  2XD2 A;  4JSD A;  4DE8 A;  4F1V A;  2QS2 A;  4JB7 A;  1B5I A;  1Y4T A;  1US5 A;  2V3T A;  3HPI A;  1OQH A;  3THI A;  4YKK A;  1IIT A;  3PPO A;  3T96 B;  2YJP A;  3GBB A;  3K6W A;  1B7H A;  1SI0 A;  3FAS A;  3PPP A;  4G68 C;  2XXH A;  4R2B A;  2H25 A;  3IJO B;  2F7C A;  1R1N A;  3G3H A;  4Z0I A;  5K2Y A;  2F36 A;  2HAU A;  3G3I A;  3DP8 A;  2H98 A;  5AA4 A;  2RCB A;  4O3C A;  2FA7 A;  4XKN A;  3RY3 A;  4GQO A;  2DYX A;  1GGG A;  3KEI A;  5I84 A;  5H8Q B;  4C1U A;  4FEC A;  3A3C A;  3FGS A;  2F6G A;  5I59 A;  5L9S A;  3VVD A;  4OFJ A;  3MWB A;  4MLQ A;  2VD2 A;  4DIG A;  1DPE A;  1H3D A;  2HQ0 A;  4HCW A;  4U1Z A;  1B3L A;  1MDQ A;  3SEX A;  3DM0 A;  2UVH A;  3FJ7 A;  3K1M A;  3CFZ A;  1VSO A;  4JWX A;  3K6V A;  3TAJ A;  1US4 A;  5I2K B;  4EQ9 A;  1JW5 A;  4RK2 A;  4F39 A;  4ZDM A;  1XC1 A;  3WAF A;  3Q28 A;  1HSJ A;  4EQ7 A;  1PB8 A;  1JET A;  3ECR A;  1XS5 A;  3O6H A;  2R71 A;  2PX1 A;  1OMP A;  3SEY A;  3T93 B;  2B3F A;  3E9X A;  1A7L A;  2V93 A;  3KZG A;  4X1B A;  3N94 A;  3CG1 A;  4UAC A;  3RGY A;  4RK9 A;  3E4R A;  4RNS A;  1L5T A;  3TCG A;  5H8H B;  2RC9 A;  4NTL A;  3U1O A;  4R72 A;  1DSN A;  3OSQ A;  3IO6 A;  2QPQ A;  5CMM A;  2H4I A;  3H4Z A;  4U22 A;  3IJX B;  2GHB A;  1P1Q A;  4E0W A;  3EF7 A;  4QF9 A;  2R9J A;  3C9H A;  3OEN A;  3TZA A;  2OZZ A;  3CIJ A;  1IXH A;  1SYI A;  1MXX A;  4Z7E A;  4YAH X;  1URS A;  2Q9T A;  3TQL A;  4GOT A;  4OXV A;  3HCQ A;  1MY3 A;  4THI A;  4YMB A;  5FHM A;  5H8N B;  4FE8 A;  1MPB A;  5DT6 A;  4MF3 A;  1Y4C A;  3PV0 E;  1MQG A;  3OOA A;  5ELV A;  4GXA A;  1DPP A;  1SYH A;  1I6B A;  1H45 A;  1Z7N E;  4GLI A;  2FNC A;  2H99 A;  1IXC A;  3IOV A;  3U8Q A;  3TPA A;  2G93 A;  2GFE A;  1DMB A;  3L6H A;  3M3F A;  2PVU A;  5H8S A;  4M4G A;  1PBP A;  3VDF A;  3S9L C;  3MZ1 A;  4IO4 A;  2OWT A;  3MPK A;  4PFW A;  2G29 A;  3RTW B;  4NWC A;  1ZMG A;  3O2A A;  5TP9 B;  1YCJ A;  3ZKK A;  3S2V A;  3UOR A;  4KCC A;  2ZNT A;  3C35 A;  2Y7P A;  3TUS A;  4U4S A;  2ONK E;  4QFO A;  2ZMB A;  1ZLQ A;  4RPO A;  2Q8J A;  3O97 A;  5HBC A;  5I57 A;  3R26 A;  3H7M A;  1MQI A;  4H8J A;  5CI5 A;  2ALU A;  3RPW A;  4R74 A;  4G68 B;  4E0X A;  4GRK A;  4PET A;  2I3W A;  4KYD A;  4TLL B;  2D21 A;  5AA2 B;  3VLV A;  4POW A;  3T9H B;  4JXI A;  5BWJ A;  4G8M A;  4GL8 A;  2Y7R A;  3UIF A;  2Z23 A;  4EDP A;  3OEK A;  3Q26 A;  3QIM A;  3SET A;  4ZEI A;  1NL5 A;  3T9V A;  3D4C A;  1P1W A;  4JBZ A;  2I4B A;  1PBQ A;  3N5L A;  3O6I A;  4P0I A;  1GVC A;  3G7W A;  4JDF A;  5CRY A;  1NKX A;  3T9U A;  3KOS A;  1ZKB A;  3IO4 A;  2O7I A;  1FQE A;  5ITO A;  2Y7K A;  4LON B;  2I58 A;  3QUJ A;  2F6P A;  1Y3N A;  4F3P A;  3BFU A;  3OXN A;  4FIM A;  1P99 A;  4QRZ A;  1ZBM A;  3FXU A;  3Q25 A;  2X26 A;  3EQ1 A;  3M8U A;  4YMA A;  3PUV E;  3EHT A;  4OQO A;  5AA4 B;  1PB7 A;  4EXK A;  2O84 X;  3JZJ A;  1LB9 A;  1ANF A;  2HFB A;  4DZ1 A;  1RKM A;  4F1U A;  3VVF A;  3TOD A;  1LLS A;  3JV9 A;  1OLC A;  4U21 A;  5I59 B;  3MUQ A;  1JVX A;  1LCT A;  4XIG Q;  3QYT A;  5H8F A;  1MM6 A;  3W9W A;  4LZ8 A;  4X9T A;  4F1Y A;  5B70 A;  3K2D A;  4PQJ A;  4AB5 A;  3FV2 A;  2FYI A;  2O7U A;  4YKP A;  3Q27 A;  1QKA A;  2RCA A;  1LAX A;  1QUL A;  3RNN A;  3VVE A;  4YB6 A;  3PMV A;  2F97 A;  5FHN A;  2Y7W A;  3C33 A;  4IO7 A;  4ELQ A;  2Q89 A;  1BIY A;  4KI0 E;  4PFT A;  4ZZA A;  3H6T A;  4X48 A;  1ZIU A;  3H6V A;  4G77 A;  4ZS9 A;  5EHM A;  2X7P A;  1R9Q A;  1D3K A;  4FEB A;  2QJE A;  1I6Q A;  3LC8 A;  3LR1 A;  1H43 A;  2XD3 A;  4PP0 A;  4FJP A;  3OO8 A;  3UA8 A;  3PMW A;  3PUZ E;  2AIX A;  5TPA A;  4OEN A;  2VD3 A;  3WAE A;  3FD3 A;  3SDF A;  3CFL A;  3A09 A;  3KN7 A;  4OHN A;  4R9G A;  3UK4 A;  4NED A;  3E3K A;  2AL5 A;  2XX7 A;  1NNF A;  3I5O A;  3IX1 A;  4Q0C A;  4RYA A;  4JWO A;  4F19 A;  2Z8F A;  1N7W A;  2Z22 A;  3QAX A;  1N0T A;  4JWY A;  4XKR A;  4POX A;  2ANJ A;  3U94 A;  1TFD A;  3S4U A;  3UGW A;  1UIV A;  2XXU A;  1FQD A;  3I6V A;  3U93 A;  2XHD A;  5KCJ A;  1EZ9 A;  4C1T A;  3JYR A;  5CMB A;  2DWJ A;  2B3B A;  3IB1 A;  1JVY A;  3FXR A;  2I3V A;  3PU5 A;  3O9P A;  1FQF A;  1B0H A;  5LOM A;  1A99 A;  3CSB A;  2RC8 A;  4O3B A;  4NF8 A;  3VXC A;  1SI1 A;  4NWD A;  3F11 A;  3KOT A;  4KCD A;  1P1O A;  1CB6 A;  4H0W A;  3PD8 A;  3SEU A;  4WED A;  1VR5 A;  1Z7M E;  4P11 A;  4QSD A;  1MDP 1;  2ABH A;  3IB2 A;  3CFX A;  2OWS A;  1LBB A;  3K01 A;  4OYV A;  1OVB A;  4ZEF A;  1NNT A;  2CZL A;  3MW0 A;  1D9V A;  1ZU0 A;  1LFI A;  1GR2 A;  1MXW A;  3B6W A;  1B3H A;  4OWD A;  5I57 B;  4LA9 A;  4GWO A;  2ZYM A;  2KLF A;  2O51 A;  1GTK A;  3RLF E;  1USY E;  2P1S A;  1FTK A;  3GBA A;  4YZZ A;  2VGQ A;  1LGB C;  4BLA A;  4ND9 A;  2Q2C A;  4O3A A;  3FAT A;  4ZEK A;  4F3S A;  3RT6 B;  2DXR A;  3TTL A;  1P1N A;  3W15 C;  1NFT A;  4ELO A;  1PC3 A;  2V84 A;  2QMX A;  2O1L A;  4OER A;  1FW0 A;  1II5 A;  5IKB A;  1ZTY A;  5DTB A;  1SBP A;  1B52 A;  4XTC Q;  3TCF A;  2F78 A;  1B7Z A;  3FVO A;  1Y1Z A;  4BDM A;  4N13 A;  2OK2 A;  5A5X A;  1PDA A;  3VV5 A;  2I48 A;  5ICQ A;  3FVK A;  2DWI A;  3CSG A;  4U1O A;  5KDT A;  4I62 A;  3OEL A;  4PE5 B;  3RT8 A;  5DEX A;  1KWH A;  1XVY A;  3O28 A;  2IA4 A;  3T22 A;  3PUY E;  3PGF A;  3CRB A;  1B6H A;  4KD5 A;  3B7D A;  1TXF A;  2I0B A;  2XXV A;  1MPD A;  4Q8R A;  4F2Q A;  2VOZ A;  2XX8 A;  3DP4 A;  1IXG A;  1B3G A;  5DVJ A;  3TFL A;  1HSE A;  4YU0 A;  1Y1M A;  4ECF A;  1AIV A;  1M5F A;  3HV1 A;  1A55 A;  5ITP A;  5DVF A;  4XKP A;  2Y7I A;  1UTH B;  2AL4 A;  4TQU Q;  2W7Y A;  4DLD A;  3USD A;  4PFU A;  1FTJ A;  3IOU A;  2O1M A;  4ZEC A;  1R9L A;  3LSF B;  3K1P A;  1B46 A;  3H6U A;  2PBW A;  4I8C A;  5JK4 A;  1S9T A;  3ONM A;  4EXL A;  3DP6 A;  4G4P A;  1BLF A;  1FQA A;  1I69 A;  3P7I A;  1LST A;  1SVX B;  2DSF A;  4OFO A;  4YB5 A;  1BTJ A;  4IO6 A;  3O6G A;  1MQD A;  3TTR A;  1IIW A;  4NE4 A;  3MVY A;  1MXY A;  3HN0 A;  3MVX A;  4G2Z A;  1EZO A;  1JW1 A;  3B6Q A;  1A8E A;  1B51 A;  4I9D A;  3K0V A;  3SKP A;  4K3F A;  2I4C A;  3OMB A;  4H8I A;  3KGC A;  1T0K A;  4IO2 A;  3PPN A;  2ZYN A;  3PUW E;  1MXZ A;  4YIC A;  3FV1 A;  1SW4 A;  2DOJ A;  1LCF A;  2OJT A;  2HZL A;  3N6T A;  3DEL B;  4EF2 A;  3MBP A;  3O66 A;  3BKI B;  1N3W A;  3LSX A;  1HSL A;  4F29 A;  4LVQ A;  3KG2 A;  4WEP A;  5FTI A;  4NF5 A;  3EHS A;  3TQW A;  1LBC A;  4F18 A;  1F9B A;  2VP1 A;  5TPA B;  1WOD A;  2DP8 A;  3MP8 A;  1LAG E;  1JEV A;  4MBP A;  2HZK A;  2NWJ A;  3TDJ A;  2P0S A;  1SW1 A;  4ISU A;  3MQ9 A;  4KPT A;  5FTH A;  4C0R A;  4LQ5 A;  5JEI A;  4N07 A;  4IY5 A;  2I0C A;  1YPN A;  1Y20 A;  3K02 A;  1DTZ A;  3L6G A;  5KCJ B;  4IB2 A;  2UXA A;  4YB7 A;  3MP6 A;  4DXB A;  5L8D A;  1B2H A;  2XXI A;  2IEE A;  3KJ7 A;  3TEL A;  3FXQ A;  3QK6 A;  3AXF A;  4I1D A;  1MH4 A;  3IAZ A;  2XX9 A;  4OFL A;  3DLN A;  1BKA A;  4GD5 A;  1XT8 A;  1POY 1;  4H67 A;  5AA2 D;  1AL3 A;  4NF8 B;  4R73 A;  3LBS A;  3FVN A;  4NF6 A;  4QFK A;  1LFH A;  1PEB A;  3VE1 B;  4IGT A;  3SEV A;  2REG A;  3IB0 A;  1MQJ A;  1DTG A;  3E13 X;  4F31 B;  3IK6 B;  3IOT A;  2QMW A;  4ESW A;  2RIN A;  1B5H A;  3TTM A;  3MVW A;  4OES A;  1IEJ A;  2NUV A;  2M8C A;  1N76 A;  3A3U A;  1ATG A;  4RPN A;  4YKJ A;  4BDQ A;  2ZYO A;  4LZ7 A;  1LB8 A;  1M5D A;  2D3I A;  2H9B A;  4H5F A;  2Z8D A;  5L9M A;  3RUM A;  3IR1 A;  2ONS A;  3MAM A;  3R6U A;  2PMS A;  3EPE A;  1QUJ A;  1QJM A;  3MZ9 A;  1M5E A;  4ZE9 A;  1B58 A;  1SDX A;  1B0L A;  1OVT A;  3TMG A;  4U4X A;  4TLM B;  3FJM A;  1B9J A;  3V8X B;  2DXY A;  1UTB A;  1OQG A;  2NXO A;  1MY4 A;  3TKD A;  3C4M A;  1H76 A;  1QW0 A;  4DCY A;  1FTM A;  4GL0 A;  4HS7 A;  1QKB A;  2QS4 A;  3RTF B;  2OCU A;  3G3K A;  4P0G A;  2QSX A;  3FJG A;  3ODB A;  5A5X B;  4AB6 A;  2QL3 A;  2UYF A;  2O69 A;  1B32 A;  4BDL A; 
#chains in the Genus database with same CATH topology
 5AE4 A;  3OSR A;  1IME A;  5KDT B;  2F5X A;  1MY0 A;  1CE2 A;  2HCA A;  1FSA A;  3KFM A;  4NF4 A;  4QSE A;  3VLW A;  4HCY A;  2YLN A;  1MXU A;  3OD7 A;  1NV3 A;  2REJ A;  4R2F A;  5DEX B;  1RYX A;  2Y84 A;  1LFG A;  4RY1 A;  3V83 A;  5DVI A;  3KBR A;  2HPG A;  1NMU A;  2KQZ A;  4XKQ A;  4ZZE A;  3K6X A;  2UYE A;  2XXW A;  4ZEB A;  3VLU A;  1LAH E;  4PFY A;  2DWA A;  1FJ6 A;  3H03 A;  2DE2 A;  3OEM A;  3S9N C;  1QVS A;  3GXA A;  4U23 A;  4GF8 A;  4MH5 A;  3UN6 A;  1IXI A;  3HST A;  2XXY A;  1BK4 A;  4R75 A;  2UVG A;  4OZ9 A;  2QVV A;  1VFE A;  3LV0 A;  5IAI A;  1TFA A;  4Q5T A;  1M5C A;  5I58 A;  3V89 B;  1ELJ A;  3Q29 A;  2AYS A;  4R6Y A;  4H1X A;  1VE4 A;  5TU0 A;  4G8N A;  3RQT A;  1FQC A;  1NV1 A;  1FPK A;  1VFD A;  5HM4 B;  4R6H A;  2B4M A;  3PPR A;  4DDD A;  2V25 A;  3PUX E;  1KA0 A;  1VDW A;  1FBF A;  1FTL A;  3TEP A;  1B05 A;  3MST A;  4LQ2 A;  1JW4 A;  1LBZ A;  2I6E A;  3TTK A;  2O6A A;  4LP2 B;  2PCR A;  4QFN A;  3N6U A;  3FVG A;  1URG A;  2OBG A;  4P56 A;  5EYF A;  1B5J A;  1MPC A;  1S7Y A;  3KJT A;  1POT A;  4OMB A;  4RJZ A;  3FXB A;  4GVO A;  4IGR A;  2BJJ X;  2D5W A;  5CBS A;  2F7B A;  5I2N A;  4EQB A;  1D9Q A;  2E1S A;  2XWK A;  1ZJL A;  1PB9 A;  5AA3 A;  5T3J A;  1JNF A;  3TYH A;  1A40 A;  3CVG A;  5CMC A;  1XHY A;  5I56 A;  1USY H;  4JSO A;  4R9F A;  2Z8E A;  2HEU A;  1YAE A;  5F24 A;  2ZNS A;  3B6T A;  3PMX A;  4FAJ A;  3FZV A;  4PC9 A;  2DWH A;  3KN8 A;  4F3B A;  1FBP A;  2A5T A;  3ISP A;  2ZYK A;  3EN3 A;  4WXJ A;  1B4H A;  1JEU A;  3K1N A;  3T66 A;  4I40 A;  4NF5 B;  1NV6 A;  4MCO A;  4QSC A;  3SES A;  2DE4 A;  2R6G E;  3BBR A;  1B7U A;  1NV0 A;  4FOR A;  4AQ4 A;  3IOR A;  2ZXT A;  1B4Z A;  2E0S A;  4AS5 A;  4QFL A;  2GRV A;  1O63 A;  2DVZ A;  2B65 A;  1J1N A;  1MY1 A;  4OEU A;  2HHM A;  4N91 A;  2A5S A;  1RYO A;  1MRP A;  3IL1 B;  2YPN A;  2Q88 A;  1M5B A;  3C32 A;  2H5Y A;  4RXL A;  1WDN A;  1IUD A;  2DQV A;  1MS7 A;  2PT2 A;  4WKM A;  5K2X A;  4F22 A;  5JTY A;  1JP4 A;  3CR9 A;  4BDR A;  4ELP A;  3C34 A;  4PTK A;  4H65 A;  2CZH A;  1OLA A;  2HAV A;  3M3L A;  3GZG A;  2XXQ A;  1O64 A;  4MAG A;  4N8G A;  3PPQ A;  1IZ1 A;  3OO9 A;  1FTO A;  2F34 A;  3MP1 A;  5AA1 A;  3K00 A;  5B7D A;  5ISU A;  2VHA A;  4R6K A;  2WKY A;  3PD9 A;  2QS1 A;  1XVX A;  2P2A A;  1D4N A;  4NF6 B;  5ICT A;  1AOV A;  4Q30 B;  4GX6 A;  3U92 A;  1DOT A;  1SW5 A;  3C36 A;  3ILU B;  3A29 A;  3E78 A;  1EZP A;  5CC2 A;  1D9Y A;  1LAF E;  1MXV A;  5H8F B;  1UIU A;  1LBX A;  3I3V A;  2X7Q A;  4H46 A;  4X1D A;  4HE0 A;  5FBP A;  1BP5 A;  1FCK A;  4TOZ A;  5H8Q A;  3U72 A;  1NV5 A;  5J1D A;  3GLB A;  4MLV A;  3O29 A;  5CBR A;  3VXB A;  1N7X A;  1O7T A;  3R7X A;  2GH9 A;  4XF5 A;  4UA8 A;  3RYD A;  4OTE A;  1AMF A;  4KR5 A;  3QUF A;  4IY6 A;  4GWU A;  4N17 A;  5HPQ A;  3K4U A;  3H6W A;  3KSX A;  1IMC A;  4BDO A;  4KYE A;  1Q9D A;  3G3J A;  1B40 A;  5F1Q A;  2OX3 A;  5CMK A;  2PT1 A;  2F7A A;  3LUY A;  4L17 A;  3VFJ A;  3N26 A;  1B1X A;  2V3Q A;  1MG1 A;  3MC2 A;  1UTB B;  1FRP A;  5I2K A;  3T9X B;  3FUZ A;  1S50 A;  2Y5L A;  1Q1K A;  4H5G A;  4KFQ A;  5F7V A;  1Y3Q A;  4AS4 A;  4GXS B;  1EH3 A;  2F35 A;  1NNK A;  4MFI A;  3TTN A;  2XXX A;  4HTG A;  2PFY A;  1N84 A;  2XWI A;  4GIZ A;  2OLB A;  1Y3P A;  5DYH A;  1MM7 A;  4NF4 B;  1FPG A;  2QS3 A;  2VT5 A;  5CM6 A;  1MY2 A;  1WVJ A;  4FED A;  4NX1 A;  4LUB A;  3ROJ A;  1B1H A;  2ONR A;  3RN8 A;  3ILT B;  2XXT A;  3ZSF A;  1IMB A;  1MH3 A;  2NOO A;  5H8H A;  3K6U A;  4NGU A;  1NV4 A;  3G3F A;  4FAT A;  2BJI A;  2F3D A;  2RF1 A;  1I6A A;  2VPO A;  2ZNU A;  1XOC A;  3ZKL A;  1QUI A;  4QFP A;  3IOW A;  3KSJ A;  1MQH A;  2ZZW A;  1SQY A;  1GV8 A;  3CI8 A;  3UP9 A;  3KBZ A;  1R6Z A;  2NVU B;  4GFR A;  1EYI A;  4XXU A;  3T1B A;  3RPL A;  1NH7 A;  4DCX A;  4BDN A;  2Q2A A;  5I58 B;  3C31 A;  3LSL A;  3QXM A;  3OO7 A;  3HHF A;  3M3K A;  3FIR A;  1NH8 A;  3MVZ A;  2PYY A;  3HHG A;  5H8N A;  1NNP A;  3HO7 A;  4G8H A;  3SER A;  2DS9 A;  1DBZ A;  4OVP A;  2THI A;  4OEV A;  1UTH A;  3LSW A;  2CZI A;  4ONY A;  4F2O A;  3G3G A;  3OO6 A;  2CEX A;  4QHQ A;  4P8B A;  3EHU A;  4N6P A;  3ZS6 A;  4P9K A;  4IO3 A;  3S9M C;  4PDH A;  1QUK A;  4HW8 A;  2CMO A;  3QSL A;  3MJN A;  3H3G A;  4ZE8 A;  5I2N B;  3S9E A;  2RKM A;  1N04 A;  3H06 B;  4LAT A;  1TWY A;  2DVC A;  5I56 B;  1Y9U A;  4NAP A;  2I49 A;  5TP9 A;  3SEW A;  2ESN A;  1URD A;  1FQB A;  4KYS A;  5M2V A;  1A54 A;  4DI3 D;  2O68 A;  3CHG A;  2LAO A;  5L9O A;  2UVI A;  1AH5 A;  4NN3 A;  4M1V A;  2XXR A;  4KHZ E;  2FIE A;  4YKI A;  2QVR A;  1SD3 A;  2A5T B;  4H6D A;  3QMF A;  1B3F A;  2HXW A;  4U2R A;  2XWO A;  4RA1 A;  3GYY A;  3TCH A;  4PBH A;  1JQF A;  4O8M A;  4IO5 A;  3MZB A;  2GHA A;  1A8F A;  4ESX A;  4N15 A;  1Q35 A;  1NUY A;  4P1E A;  2FVZ A;  2V3U A;  4F3G A;  5IGA A;  2HXR A;  3W9V A;  1TT1 A;  1YTV A;  1N3X A;  4G68 A;  1H44 A;  4OET A;  5EHS A;  4EUO A;  1KA1 A;  1EU8 A;  3EKI A;  5FHO A;  2UVJ A;  5BUU A;  3MPL A;  5AA2 A;  2WX9 A;  3CG3 A;  4DXC A;  4FBP A;  1NV7 A;  2DE3 A;  3BFT A;  1IQ7 A;  2DDK A;  2WBB A;  4EF1 A;  1UQW A;  3KN3 A;  4OVJ A;  4KQP A;  2F8D A;  1FBE A;  5KZT A;  1B3E A;  2RC7 A;  1SW2 A;  4NMY A;  2XXP A;  3V5A A;  3IFC A;  4NHB A;  1RDX A;  4PF8 A;  1YXI A;  2QRY A;  4ELR A;  5JTY B;  4ZED A;  1OIB A;  4DXU A;  1P1U A;  4LZ5 A;  3D4G A;  2XD2 A;  4JSD A;  4DE8 A;  4F1V A;  2QS2 A;  4JB7 A;  1B5I A;  1Y4T A;  1US5 A;  2V3T A;  4I3E A;  3HPI A;  1OQH A;  3THI A;  4MJO A;  1FBC A;  4YKK A;  1IIT A;  3PPO A;  1FBD A;  3T96 B;  5J16 A;  2YJP A;  3GBB A;  3K6W A;  1B7H A;  2WBD A;  3B50 A;  1SI0 A;  3FAS A;  3PPP A;  4G68 C;  2XXH A;  4R2B A;  2H25 A;  1DK4 A;  3IJO B;  2F7C A;  1R1N A;  3FBP A;  3G3H A;  4Z0I A;  5K2Y A;  2F36 A;  2HAU A;  3G3I A;  3DP8 A;  2H98 A;  5AA4 A;  2RCB A;  4O3C A;  1FPI A;  2FA7 A;  4O94 A;  4XKN A;  3RY3 A;  4GQO A;  2KR0 A;  2DYX A;  4P3L A;  1GGG A;  3KEI A;  4HE2 A;  5I84 A;  5H8Q B;  4C1U A;  4FEC A;  3A3C A;  3FGS A;  2F6G A;  4O7I A;  5I59 A;  5IZ3 A;  5L9S A;  3VVD A;  4OFJ A;  2PFZ A;  3MWB A;  4MLQ A;  2VD2 A;  4DIG A;  1DPE A;  4PAF A;  1H3D A;  2HQ0 A;  4HCW A;  4U1Z A;  1B3L A;  1MDQ A;  3SEX A;  3DM0 A;  2UVH A;  3FJ7 A;  3K1M A;  3CFZ A;  1VSO A;  4JWX A;  4GWY A;  3K6V A;  4OVS A;  3TAJ A;  1K9Y A;  1US4 A;  1FPF A;  5I2K B;  4EQ9 A;  1JW5 A;  4RK2 A;  4F39 A;  4ZDM A;  1XC1 A;  3WAF A;  3Q28 A;  1HSJ A;  3MYU A;  1NUX A;  4QXD A;  4EQ7 A;  1PB8 A;  1JET A;  3ECR A;  1XS5 A;  3O6H A;  2R71 A;  2PX1 A;  1OMP A;  3SEY A;  3BIG A;  3T93 B;  2B3F A;  3E9X A;  1A7L A;  2V93 A;  3KZG A;  2B4L A;  3D1R A;  4X1B A;  5I5P A;  3N94 A;  3CG1 A;  4GX3 A;  4GBV A;  4UAC A;  3RGY A;  3NOH A;  2XA5 A;  4RK9 A;  3E4R A;  4RNS A;  1L5T A;  3TCG A;  5H8H B;  2RC9 A;  4NTL A;  3U1O A;  4R72 A;  1DSN A;  3OSQ A;  3IO6 A;  2QPQ A;  4PCD A;  5CMM A;  2H4I A;  3H4Z A;  1RDY A;  4U22 A;  3IJX B;  5ET5 A;  2GHB A;  4GWX A;  1P1Q A;  4E0W A;  3EF7 A;  4QF9 A;  2R9J A;  3C9H A;  1CNQ A;  3OEN A;  3TZA A;  2OZZ A;  3CIJ A;  1IXH A;  1SYI A;  1MXX A;  4Z7E A;  4YAH X;  1URS A;  2FHY A;  5IZZ A;  2Q9T A;  3TQL A;  4GOT A;  4XEQ A;  4OXV A;  3HCQ A;  1MY3 A;  3KC1 A;  4THI A;  4YMB A;  5FHM A;  5H8N B;  4FE8 A;  1FBG A;  1MPB A;  5DT6 A;  4MF3 A;  1Y4C A;  3PV0 E;  1MQG A;  3OOA A;  2CEY A;  5ELV A;  4GXA A;  1DPP A;  1SYH A;  1I6B A;  1H45 A;  4JVI A;  1Z7N E;  4GLI A;  4PFR A;  2FNC A;  2H99 A;  1IXC A;  3IOV A;  3U8Q A;  3TPA A;  2G93 A;  2GFE A;  1QGX A;  1DMB A;  3L6H A;  3M3F A;  2PVU A;  5H8S A;  1NV2 A;  4M4G A;  1PBP A;  4MX6 A;  4N6K A;  3VDF A;  3S9L C;  3MZ1 A;  4IO4 A;  2OWT A;  3MPK A;  4GX4 A;  2G29 A;  4PFW A;  5ET7 A;  3RTW B;  1EYK A;  4NWC A;  1FPD A;  1ZMG A;  3O2A A;  5TP9 B;  1YCJ A;  1FBH A;  3ZKK A;  3S2V A;  3UOR A;  4KCC A;  2ZNT A;  3C35 A;  2Y7P A;  3TUS A;  4U4S A;  2ONK E;  4QFO A;  2ZMB A;  1ZLQ A;  4RPO A;  2Q8J A;  3O97 A;  5HBC A;  5I57 A;  3R26 A;  3H7M A;  1MQI A;  4MEV A;  4H8J A;  5CI5 A;  2ALU A;  3RPW A;  4R74 A;  4G68 B;  4E0X A;  5I7I A;  4GRK A;  4PET A;  2I3W A;  4KYD A;  4TLL B;  2D21 A;  5AA2 B;  3VLV A;  4POW A;  3T9H B;  4JXI A;  3KC0 A;  5BWJ A;  4G8M A;  4GL8 A;  2Y7R A;  2QVU A;  3UIF A;  2Z23 A;  2GQ1 A;  4EDP A;  3OEK A;  4MHF A;  3Q26 A;  3QIM A;  3SET A;  4O7M A;  4ZEI A;  1NL5 A;  3T9V A;  4P47 A;  3D4C A;  1P1W A;  1LBY A;  4JBZ A;  2I4B A;  1PBQ A;  3N5L A;  3O6I A;  1NI9 A;  4P0I A;  1GVC A;  3G7W A;  4JDF A;  5CRY A;  1NKX A;  3T9U A;  3KOS A;  1ZKB A;  3IO4 A;  2O7I A;  1FQE A;  5ITO A;  2WEF A;  2Y7K A;  3SZP A;  3BIH A;  4LON B;  2I58 A;  3QUJ A;  2F6P A;  1Y3N A;  4F3P A;  4OVQ A;  3BFU A;  3OXN A;  4FIM A;  1P99 A;  4DI4 B;  4QRZ A;  1NUW A;  1ZBM A;  4N8Y A;  1DCU A;  3FXU A;  3Q25 A;  2X26 A;  4PBQ A;  3EQ1 A;  3M8U A;  4YMA A;  3PUV E;  3EHT A;  4OQO A;  5AA4 B;  1PB7 A;  4EXK A;  2O84 X;  3JZJ A;  1LB9 A;  1ANF A;  2HFB A;  4DZ1 A;  1RKM A;  4F1U A;  3VVF A;  3TOD A;  1LLS A;  3JV9 A;  1OLC A;  4MNI A;  4U21 A;  5I59 B;  1YYZ A;  5IZ3 B;  3MUQ A;  1JVX A;  2MKZ A;  1LCT A;  4UAB A;  4XIG Q;  4MNP A;  3QYT A;  4QBA A;  5H8F A;  1MM6 A;  3W9W A;  2ZZX A;  4LZ8 A;  4X9T A;  4F1Y A;  4P1L A;  4N4U A;  5B70 A;  3K2D A;  4PQJ A;  4AB5 A;  3FV2 A;  2FYI A;  2O7U A;  4JVC A;  4YKP A;  2P3N A;  3Q27 A;  1QKA A;  2RCA A;  5A5L A;  4IR8 A;  1LAX A;  1IMD A;  1QUL A;  4H45 A;  3RNN A;  4LN5 A;  3VVE A;  4YB6 A;  3PMV A;  2F97 A;  5FHN A;  2Y7W A;  3C33 A;  4IO7 A;  1G0I A;  4ELQ A;  1XI6 A;  2Q89 A;  1BIY A;  4KI0 E;  4PFT A;  4ZZA A;  3H6T A;  2L5V A;  4X48 A;  1FPL A;  1KZ8 A;  1ZIU A;  3H6V A;  4G77 A;  4PDD A;  4ZS9 A;  5EHM A;  5LDZ A;  2X7P A;  1R9Q A;  1D3K A;  4FEB A;  2QJE A;  1I6Q A;  4PAK A;  3LC8 A;  3LR1 A;  1H43 A;  2ZZV A;  2OWZ A;  2XD3 A;  4HXV A;  4PP0 A;  4FJP A;  3OO8 A;  3UA8 A;  3PMW A;  3PUZ E;  1AWB A;  2AIX A;  5TPA A;  4OEN A;  2VD3 A;  3WAE A;  3FD3 A;  5EYH A;  3SDF A;  3CFL A;  5I3S A;  3A09 A;  3KN7 A;  4OHN A;  4R9G A;  3UK4 A;  4NED A;  3E3K A;  2AL5 A;  2XX7 A;  1NNF A;  3I5O A;  3IX1 A;  4Q0C A;  4RYA A;  4JWO A;  4HE1 A;  4F19 A;  2Z8F A;  1N7W A;  2Z22 A;  3QAX A;  1N0T A;  4PE3 A;  4JWY A;  4XKR A;  4POX A;  2ANJ A;  3U94 A;  1TFD A;  3S4U A;  3UGW A;  1UIV A;  2XXU A;  2R8T A;  1FQD A;  3I6V A;  5EQ8 A;  3U93 A;  4MNC A;  2XHD A;  5KCJ A;  1EZ9 A;  4C1T A;  2V4C A;  3JYR A;  5CMB A;  2DWJ A;  5LTC A;  2B3B A;  3IB1 A;  1JVY A;  3FXR A;  2I3V A;  3PU5 A;  3O9P A;  1FQF A;  4I3Y A;  1B0H A;  5LOM A;  1A99 A;  3CSB A;  5ET6 A;  2RC8 A;  4O3B A;  4NF8 A;  3VXC A;  1SI1 A;  4NWD A;  3F11 A;  2WYP A;  3KOT A;  2WYK A;  4KCD A;  1P1O A;  1CB6 A;  1IMF A;  4H0W A;  3PD8 A;  3SEU A;  4WED A;  1VR5 A;  1Z7M E;  4P11 A;  4QSD A;  1MDP 1;  2ABH A;  3IB2 A;  3CFX A;  2OWS A;  2JJK A;  1LBB A;  3K01 A;  4OYV A;  1OVB A;  1FTA A;  4ZEF A;  5DW8 A;  1NNT A;  2CZL A;  3MW0 A;  1D9V A;  1ZU0 A;  1SPI A;  1LFI A;  1GR2 A;  1MXW A;  3B6W A;  3LUZ A;  1B3H A;  1YZ0 A;  4OWD A;  5I57 B;  4GBW A;  4LA9 A;  4GWO A;  2ZYM A;  2KLF A;  2O51 A;  1GTK A;  3RLF E;  1USY E;  2P1S A;  1FTK A;  3GBA A;  4YZZ A;  4N81 A;  2VGQ A;  1LGB C;  2Q74 A;  4BLA A;  4ND9 A;  2Q2C A;  4O3A A;  3FAT A;  4ZEK A;  4F3S A;  5ESY A;  3RT6 B;  2DXR A;  3TTL A;  1P1N A;  3W15 C;  1NFT A;  4ELO A;  1PC3 A;  3T0J A;  2V84 A;  2QMX A;  2O1L A;  4OER A;  1FJ9 A;  1FW0 A;  1II5 A;  5IKB A;  1ZTY A;  5DTB A;  1SBP A;  1B52 A;  4XTC Q;  2Q8M A;  3TCF A;  2F78 A;  1B7Z A;  3FVO A;  1Y1Z A;  4BDM A;  4N13 A;  2OK2 A;  5A5X A;  1PDA A;  3VV5 A;  2I48 A;  5ICQ A;  3FVK A;  2DWI A;  3CSG A;  4U1O A;  5KDT A;  4I62 A;  3OEL A;  1INP A;  4PE5 B;  2QFL A;  5EQA A;  3RT8 A;  5DEX A;  1KWH A;  1XVY A;  3O28 A;  2IA4 A;  4OVT A;  3T22 A;  3PUY E;  3PGF A;  3CRB A;  1B6H A;  4KD5 A;  3B7D A;  4OA4 A;  1TXF A;  2CZK A;  2I0B A;  2XXV A;  1MPD A;  4Q8R A;  4F2Q A;  5EQ9 A;  1EYJ A;  3RPL B;  2VOZ A;  2XX8 A;  4KXP A;  3DP4 A;  1IXG A;  4PGN A;  1B3G A;  5DVJ A;  3TFL A;  1HSE A;  1LBW A;  3E79 A;  4YU0 A;  1Y1M A;  4ECF A;  3B8B A;  2VPN A;  1AIV A;  1M5F A;  3U65 A;  3HV1 A;  1A55 A;  5ITP A;  5DVF A;  4XKP A;  2P3V A;  2Y7I A;  1UTH B;  2AL4 A;  4TQU Q;  2W7Y A;  4DLD A;  3USD A;  4PFU A;  5IM2 A;  1FPJ A;  2Y5K A;  4OVR A;  1FTJ A;  3IOU A;  2O1M A;  4ZEC A;  1R9L A;  3LSF B;  3K1P A;  1B46 A;  3H6U A;  5EQ7 A;  2PBW A;  4I8C A;  5JK4 A;  1S9T A;  1RDZ A;  3ONM A;  4EXL A;  3DP6 A;  4G4P A;  1BLF A;  1FQA A;  1I69 A;  4MIJ A;  3P7I A;  1LST A;  1SVX B;  2DSF A;  4OFO A;  4YB5 A;  4NG7 A;  1BTJ A;  4IO6 A;  3O6G A;  1MQD A;  3TTR A;  1IIW A;  4NE4 A;  3MVY A;  1MXY A;  3HN0 A;  3MVX A;  4G2Z A;  1EZO A;  1LEV A;  2F3B A;  1JW1 A;  3B6Q A;  1A8E A;  1B51 A;  4I9D A;  3K0V A;  3SKP A;  1G0H A;  4K3F A;  2I4C A;  3OMB A;  4H8I A;  3KGC A;  1T0K A;  4IO2 A;  3PPN A;  2ZYN A;  3PUW E;  1MXZ A;  4YIC A;  3FV1 A;  1SW4 A;  2DOJ A;  1LCF A;  2OJT A;  2HZL A;  3N6T A;  3DEL B;  4PF6 A;  4EF2 A;  3MBP A;  3O66 A;  3BKI B;  1N3W A;  3LSX A;  1HSL A;  4F29 A;  4LVQ A;  3KG2 A;  4WEP A;  5FTI A;  4NF5 A;  4MMP A;  4G61 A;  3EHS A;  4NF0 A;  3TQW A;  1LBC A;  4F18 A;  1F9B A;  1K9Z A;  2VP1 A;  5TPA B;  4PFB A;  1WOD A;  2DP8 A;  3MP8 A;  1LAG E;  1JEV A;  3IFA A;  4MBP A;  2HZK A;  2NWJ A;  3TDJ A;  2P0S A;  1SW1 A;  4OAN A;  4ISU A;  3MQ9 A;  4KPT A;  5FTH A;  4C0R A;  4LQ5 A;  5JEI A;  2FIX A;  2XXK A;  4N07 A;  4IY5 A;  2I0C A;  1YPN A;  1IMA A;  1Y20 A;  1NUZ A;  3K02 A;  1DTZ A;  3L6G A;  5IZ1 A;  5KCJ B;  4IB2 A;  2UXA A;  4YB7 A;  2XWV A;  4XFE A;  3MP6 A;  4X04 A;  4GWW A;  4X8R A;  4DXB A;  5L8D A;  1B2H A;  2XXI A;  2IEE A;  3KJ7 A;  3TEL A;  3FXQ A;  3QK6 A;  3AXF A;  1FPE A;  4I1D A;  1MH4 A;  3IAZ A;  2XX9 A;  4OFL A;  3DLN A;  1BKA A;  4PAI A;  4GD5 A;  1XT8 A;  1POY 1;  4GWZ A;  4H67 A;  5AA2 D;  1AL3 A;  4NF8 B;  4R73 A;  3LBS A;  3FVN A;  4NF6 A;  4QFK A;  1LFH A;  4N6D A;  4GWS A;  1PEB A;  3VE1 B;  4IGT A;  3SEV A;  2REG A;  1FPB A;  3IB0 A;  1MQJ A;  1DTG A;  3E13 X;  4F31 B;  3IK6 B;  3IOT A;  2QMW A;  4ESW A;  2RIN A;  1B5H A;  3TTM A;  3MVW A;  4OES A;  1IEJ A;  2NUV A;  2M8C A;  1N76 A;  5ET8 A;  3A3U A;  4JVD A;  1ATG A;  4PGP A;  4RPN A;  4YKJ A;  4BDQ A;  4PFI A;  2ZYO A;  4LZ7 A;  1LB8 A;  1M5D A;  2D3I A;  2H9B A;  4H5F A;  2Z8D A;  5L9M A;  3RUM A;  3IR1 A;  2ONS A;  3MAM A;  3R6U A;  2PMS A;  3EPE A;  1QUJ A;  1QJM A;  3MZ9 A;  1M5E A;  4NQ8 A;  4ZE9 A;  1B58 A;  1SDX A;  1B0L A;  1OVT A;  3TMG A;  2FBP A;  1LBV A;  4U4X A;  4TLM B;  3FJM A;  1B9J A;  3V8X B;  2DXY A;  1UTB A;  3PTY A;  1OQG A;  2NXO A;  1MY4 A;  3TKD A;  3C4M A;  1H76 A;  1QW0 A;  4DCY A;  1FTM A;  4GL0 A;  4HS7 A;  1QKB A;  2QS4 A;  3RTF B;  2OCU A;  3G3K A;  4P0G A;  2QSX A;  3FJG A;  3ODB A;  5A5X B;  4AB6 A;  2QL3 A;  2UYF A;  3HFU A;  5EYG A;  2O69 A;  1B32 A;  4BDL A; 
#chains in the Genus database with same CATH homology
 5AE4 A;  3OSR A;  5KDT B;  2F5X A;  1MY0 A;  1CE2 A;  2HCA A;  3KFM A;  4NF4 A;  4QSE A;  3VLW A;  4HCY A;  2YLN A;  1MXU A;  3OD7 A;  2REJ A;  4R2F A;  5DEX B;  1RYX A;  2Y84 A;  1LFG A;  4RY1 A;  3V83 A;  5DVI A;  3KBR A;  4XKQ A;  1NMU A;  4ZZE A;  3K6X A;  2UYE A;  2XXW A;  4ZEB A;  3VLU A;  1LAH E;  4PFY A;  2DWA A;  3H03 A;  2DE2 A;  3OEM A;  3S9N C;  1QVS A;  3GXA A;  4U23 A;  4GF8 A;  4MH5 A;  3UN6 A;  1IXI A;  3HST A;  2XXY A;  4R75 A;  2UVG A;  4OZ9 A;  1VFE A;  5IAI A;  1TFA A;  4Q5T A;  1M5C A;  5I58 A;  3V89 B;  1ELJ A;  3Q29 A;  2AYS A;  4R6Y A;  4H1X A;  1VE4 A;  5TU0 A;  4G8N A;  3RQT A;  1FQC A;  1VFD A;  5HM4 B;  4R6H A;  3PPR A;  4DDD A;  2V25 A;  3PUX E;  1FTL A;  3TEP A;  1B05 A;  4LQ2 A;  1JW4 A;  2I6E A;  3TTK A;  2O6A A;  4LP2 B;  4QFN A;  3N6U A;  3FVG A;  1URG A;  2OBG A;  5EYF A;  1B5J A;  1MPC A;  1S7Y A;  3KJT A;  1POT A;  4OMB A;  4RJZ A;  4IGR A;  4GVO A;  2BJJ X;  2D5W A;  5CBS A;  2F7B A;  5I2N A;  4EQB A;  2E1S A;  1ZJL A;  1PB9 A;  5AA3 A;  1JNF A;  3TYH A;  1A40 A;  3CVG A;  5CMC A;  1XHY A;  5I56 A;  1USY H;  4JSO A;  4R9F A;  2Z8E A;  2HEU A;  1YAE A;  2ZNS A;  3B6T A;  3PMX A;  4FAJ A;  3FZV A;  2DWH A;  3KN8 A;  4F3B A;  2A5T A;  2ZYK A;  3EN3 A;  4WXJ A;  1B4H A;  1JEU A;  3K1N A;  3T66 A;  4NF5 B;  4QSC A;  3SES A;  2DE4 A;  2R6G E;  3BBR A;  1B7U A;  4FOR A;  4AQ4 A;  3IOR A;  2ZXT A;  1B4Z A;  2E0S A;  4QFL A;  2GRV A;  1O63 A;  2DVZ A;  2B65 A;  1J1N A;  1MY1 A;  4OEU A;  2A5S A;  1RYO A;  1MRP A;  3IL1 B;  2YPN A;  2Q88 A;  1M5B A;  3C32 A;  2H5Y A;  4RXL A;  1WDN A;  1IUD A;  2DQV A;  1MS7 A;  2PT2 A;  4WKM A;  5K2X A;  4F22 A;  5JTY A;  3CR9 A;  4BDR A;  4ELP A;  3C34 A;  4H65 A;  1OLA A;  2HAV A;  3M3L A;  3GZG A;  2XXQ A;  1O64 A;  3PPQ A;  1IZ1 A;  3OO9 A;  1FTO A;  2F34 A;  3MP1 A;  5AA1 A;  3K00 A;  5B7D A;  5ISU A;  2VHA A;  4R6K A;  2WKY A;  3PD9 A;  2QS1 A;  1XVX A;  2P2A A;  1D4N A;  4NF6 B;  5ICT A;  1AOV A;  4Q30 B;  3U92 A;  1DOT A;  1SW5 A;  3C36 A;  3ILU B;  1EZP A;  5CC2 A;  1D9Y A;  1LAF E;  1MXV A;  5H8F B;  1UIU A;  3I3V A;  2X7Q A;  4X1D A;  1BP5 A;  1FCK A;  4TOZ A;  5H8Q A;  3U72 A;  5J1D A;  3GLB A;  4MLV A;  3O29 A;  5CBR A;  3VXB A;  1N7X A;  1O7T A;  3R7X A;  2GH9 A;  4UA8 A;  4OTE A;  1AMF A;  4KR5 A;  3QUF A;  4IY6 A;  5HPQ A;  3K4U A;  3H6W A;  3KSX A;  4BDO A;  4KYE A;  3G3J A;  1B40 A;  5F1Q A;  5CMK A;  2PT1 A;  2F7A A;  3LUY A;  4L17 A;  3VFJ A;  3N26 A;  1B1X A;  2V3Q A;  1MG1 A;  3MC2 A;  1UTB B;  5I2K A;  3T9X B;  3FUZ A;  1S50 A;  1Q1K A;  4H5G A;  4KFQ A;  5F7V A;  1Y3Q A;  4GXS B;  1EH3 A;  2F35 A;  1NNK A;  4MFI A;  3TTN A;  2XXX A;  4HTG A;  1N84 A;  4GIZ A;  2OLB A;  1Y3P A;  5DYH A;  1MM7 A;  4NF4 B;  2QS3 A;  5CM6 A;  1MY2 A;  1WVJ A;  4FED A;  4LUB A;  1B1H A;  2ONR A;  3RN8 A;  3ILT B;  2XXT A;  3ZSF A;  1MH3 A;  2NOO A;  5H8H A;  3K6U A;  3G3F A;  4FAT A;  2RF1 A;  1I6A A;  2ZNU A;  1XOC A;  3ZKL A;  1QUI A;  4QFP A;  3IOW A;  3KSJ A;  1MQH A;  1SQY A;  1GV8 A;  3CI8 A;  3UP9 A;  1R6Z A;  2NVU B;  4GFR A;  4XXU A;  1NH7 A;  4DCX A;  4BDN A;  2Q2A A;  5I58 B;  3C31 A;  3LSL A;  3QXM A;  3OO7 A;  3HHF A;  3M3K A;  3FIR A;  1NH8 A;  3MVZ A;  2PYY A;  3HHG A;  5H8N A;  1NNP A;  3HO7 A;  4G8H A;  3SER A;  2DS9 A;  2THI A;  4OEV A;  1UTH A;  3LSW A;  4ONY A;  4F2O A;  3G3G A;  3OO6 A;  4QHQ A;  3EHU A;  4N6P A;  3ZS6 A;  4IO3 A;  3S9M C;  1QUK A;  4HW8 A;  2CMO A;  3QSL A;  3MJN A;  3H3G A;  4ZE8 A;  5I2N B;  3S9E A;  2RKM A;  1N04 A;  3H06 B;  4LAT A;  1TWY A;  2DVC A;  5I56 B;  1Y9U A;  2I49 A;  5TP9 A;  3SEW A;  2ESN A;  1URD A;  1FQB A;  4KYS A;  5M2V A;  1A54 A;  2O68 A;  2LAO A;  5L9O A;  2UVI A;  1AH5 A;  4M1V A;  2XXR A;  4KHZ E;  4YKI A;  1SD3 A;  2A5T B;  4H6D A;  1B3F A;  2HXW A;  4U2R A;  4RA1 A;  3TCH A;  1JQF A;  4IO5 A;  3MZB A;  2GHA A;  1A8F A;  4ESX A;  1Q35 A;  2V3U A;  4F3G A;  3W9V A;  1TT1 A;  1YTV A;  1N3X A;  4G68 A;  1H44 A;  4OET A;  5EHS A;  4EUO A;  1EU8 A;  5FHO A;  2UVJ A;  5BUU A;  3MPL A;  5AA2 A;  3CG3 A;  4DXC A;  2DE3 A;  3BFT A;  1IQ7 A;  4EF1 A;  1UQW A;  3KN3 A;  4OVJ A;  4KQP A;  2F8D A;  5KZT A;  1B3E A;  2RC7 A;  1SW2 A;  4NMY A;  2XXP A;  3V5A A;  2QRY A;  4ELR A;  5JTY B;  4ZED A;  1OIB A;  4DXU A;  1P1U A;  4LZ5 A;  3D4G A;  2XD2 A;  4JSD A;  4DE8 A;  4F1V A;  2QS2 A;  4JB7 A;  1B5I A;  1Y4T A;  1US5 A;  2V3T A;  3HPI A;  1OQH A;  3THI A;  4YKK A;  1IIT A;  3PPO A;  3T96 B;  2YJP A;  3GBB A;  3K6W A;  1B7H A;  1SI0 A;  3FAS A;  3PPP A;  4G68 C;  2XXH A;  4R2B A;  2H25 A;  3IJO B;  2F7C A;  1R1N A;  3G3H A;  4Z0I A;  5K2Y A;  2F36 A;  2HAU A;  3G3I A;  3DP8 A;  2H98 A;  5AA4 A;  2RCB A;  4O3C A;  2FA7 A;  4XKN A;  3RY3 A;  4GQO A;  2DYX A;  1GGG A;  3KEI A;  5I84 A;  5H8Q B;  4C1U A;  4FEC A;  3A3C A;  3FGS A;  2F6G A;  5I59 A;  5L9S A;  3VVD A;  4OFJ A;  3MWB A;  4MLQ A;  2VD2 A;  4DIG A;  1DPE A;  1H3D A;  2HQ0 A;  4HCW A;  4U1Z A;  1B3L A;  1MDQ A;  3SEX A;  3DM0 A;  2UVH A;  3FJ7 A;  3K1M A;  3CFZ A;  1VSO A;  4JWX A;  3K6V A;  3TAJ A;  1US4 A;  5I2K B;  4EQ9 A;  1JW5 A;  4RK2 A;  4F39 A;  4ZDM A;  1XC1 A;  3WAF A;  3Q28 A;  1HSJ A;  4EQ7 A;  1PB8 A;  1JET A;  3ECR A;  1XS5 A;  3O6H A;  2R71 A;  2PX1 A;  1OMP A;  3SEY A;  3T93 B;  2B3F A;  3E9X A;  1A7L A;  2V93 A;  3KZG A;  4X1B A;  3N94 A;  3CG1 A;  4UAC A;  3RGY A;  4RK9 A;  3E4R A;  4RNS A;  1L5T A;  3TCG A;  5H8H B;  2RC9 A;  4NTL A;  3U1O A;  4R72 A;  1DSN A;  3OSQ A;  3IO6 A;  2QPQ A;  5CMM A;  2H4I A;  3H4Z A;  4U22 A;  3IJX B;  2GHB A;  1P1Q A;  4E0W A;  3EF7 A;  4QF9 A;  2R9J A;  3C9H A;  3OEN A;  3TZA A;  2OZZ A;  3CIJ A;  1IXH A;  1SYI A;  1MXX A;  4Z7E A;  4YAH X;  1URS A;  2Q9T A;  3TQL A;  4GOT A;  4OXV A;  3HCQ A;  1MY3 A;  4THI A;  4YMB A;  5FHM A;  5H8N B;  4FE8 A;  1MPB A;  5DT6 A;  4MF3 A;  1Y4C A;  3PV0 E;  1MQG A;  3OOA A;  5ELV A;  4GXA A;  1DPP A;  1SYH A;  1I6B A;  1H45 A;  1Z7N E;  4GLI A;  2FNC A;  2H99 A;  1IXC A;  3IOV A;  3U8Q A;  3TPA A;  2G93 A;  2GFE A;  1DMB A;  3L6H A;  3M3F A;  2PVU A;  5H8S A;  4M4G A;  1PBP A;  3VDF A;  3S9L C;  3MZ1 A;  4IO4 A;  2OWT A;  3MPK A;  4PFW A;  2G29 A;  3RTW B;  4NWC A;  1ZMG A;  3O2A A;  5TP9 B;  1YCJ A;  3ZKK A;  3S2V A;  3UOR A;  4KCC A;  2ZNT A;  3C35 A;  2Y7P A;  3TUS A;  4U4S A;  2ONK E;  4QFO A;  2ZMB A;  1ZLQ A;  4RPO A;  2Q8J A;  3O97 A;  5HBC A;  5I57 A;  3R26 A;  3H7M A;  1MQI A;  4H8J A;  5CI5 A;  2ALU A;  3RPW A;  4R74 A;  4G68 B;  4E0X A;  4GRK A;  4PET A;  2I3W A;  4KYD A;  4TLL B;  2D21 A;  5AA2 B;  3VLV A;  4POW A;  3T9H B;  4JXI A;  5BWJ A;  4G8M A;  4GL8 A;  2Y7R A;  3UIF A;  2Z23 A;  4EDP A;  3OEK A;  3Q26 A;  3QIM A;  3SET A;  4ZEI A;  1NL5 A;  3T9V A;  3D4C A;  1P1W A;  4JBZ A;  2I4B A;  1PBQ A;  3N5L A;  3O6I A;  4P0I A;  1GVC A;  3G7W A;  4JDF A;  5CRY A;  1NKX A;  3T9U A;  3KOS A;  1ZKB A;  3IO4 A;  2O7I A;  1FQE A;  5ITO A;  2Y7K A;  4LON B;  2I58 A;  3QUJ A;  2F6P A;  1Y3N A;  4F3P A;  3BFU A;  3OXN A;  4FIM A;  1P99 A;  4QRZ A;  1ZBM A;  3FXU A;  3Q25 A;  2X26 A;  3EQ1 A;  3M8U A;  4YMA A;  3PUV E;  3EHT A;  4OQO A;  5AA4 B;  1PB7 A;  4EXK A;  2O84 X;  3JZJ A;  1LB9 A;  1ANF A;  2HFB A;  4DZ1 A;  1RKM A;  4F1U A;  3VVF A;  3TOD A;  1LLS A;  3JV9 A;  1OLC A;  4U21 A;  5I59 B;  3MUQ A;  1JVX A;  1LCT A;  4XIG Q;  3QYT A;  5H8F A;  1MM6 A;  3W9W A;  4LZ8 A;  4X9T A;  4F1Y A;  5B70 A;  3K2D A;  4PQJ A;  4AB5 A;  3FV2 A;  2FYI A;  2O7U A;  4YKP A;  3Q27 A;  1QKA A;  2RCA A;  1LAX A;  1QUL A;  3RNN A;  3VVE A;  4YB6 A;  3PMV A;  2F97 A;  5FHN A;  2Y7W A;  3C33 A;  4IO7 A;  4ELQ A;  2Q89 A;  1BIY A;  4KI0 E;  4PFT A;  4ZZA A;  3H6T A;  4X48 A;  1ZIU A;  3H6V A;  4G77 A;  4ZS9 A;  5EHM A;  2X7P A;  1R9Q A;  1D3K A;  4FEB A;  2QJE A;  1I6Q A;  3LC8 A;  3LR1 A;  1H43 A;  2XD3 A;  4PP0 A;  4FJP A;  3OO8 A;  3UA8 A;  3PMW A;  3PUZ E;  2AIX A;  5TPA A;  4OEN A;  2VD3 A;  3WAE A;  3FD3 A;  3SDF A;  3CFL A;  3A09 A;  3KN7 A;  4OHN A;  4R9G A;  3UK4 A;  4NED A;  3E3K A;  2AL5 A;  2XX7 A;  1NNF A;  3I5O A;  3IX1 A;  4Q0C A;  4RYA A;  4JWO A;  4F19 A;  2Z8F A;  1N7W A;  2Z22 A;  3QAX A;  1N0T A;  4JWY A;  4XKR A;  4POX A;  2ANJ A;  3U94 A;  1TFD A;  3S4U A;  3UGW A;  1UIV A;  2XXU A;  1FQD A;  3I6V A;  3U93 A;  2XHD A;  5KCJ A;  1EZ9 A;  4C1T A;  3JYR A;  5CMB A;  2DWJ A;  2B3B A;  3IB1 A;  1JVY A;  3FXR A;  2I3V A;  3PU5 A;  3O9P A;  1FQF A;  1B0H A;  5LOM A;  1A99 A;  3CSB A;  2RC8 A;  4O3B A;  4NF8 A;  3VXC A;  1SI1 A;  4NWD A;  3F11 A;  3KOT A;  4KCD A;  1P1O A;  1CB6 A;  4H0W A;  3PD8 A;  3SEU A;  4WED A;  1VR5 A;  1Z7M E;  4P11 A;  4QSD A;  1MDP 1;  2ABH A;  3IB2 A;  3CFX A;  2OWS A;  1LBB A;  3K01 A;  4OYV A;  1OVB A;  4ZEF A;  1NNT A;  2CZL A;  3MW0 A;  1D9V A;  1ZU0 A;  1LFI A;  1GR2 A;  1MXW A;  3B6W A;  1B3H A;  4OWD A;  5I57 B;  4LA9 A;  4GWO A;  2ZYM A;  2KLF A;  2O51 A;  1GTK A;  3RLF E;  1USY E;  2P1S A;  1FTK A;  3GBA A;  4YZZ A;  2VGQ A;  1LGB C;  4BLA A;  4ND9 A;  2Q2C A;  4O3A A;  3FAT A;  4ZEK A;  4F3S A;  3RT6 B;  2DXR A;  3TTL A;  1P1N A;  3W15 C;  1NFT A;  4ELO A;  1PC3 A;  2V84 A;  2QMX A;  2O1L A;  4OER A;  1FW0 A;  1II5 A;  5IKB A;  1ZTY A;  5DTB A;  1SBP A;  1B52 A;  4XTC Q;  3TCF A;  2F78 A;  1B7Z A;  3FVO A;  1Y1Z A;  4BDM A;  4N13 A;  2OK2 A;  5A5X A;  1PDA A;  3VV5 A;  2I48 A;  5ICQ A;  3FVK A;  2DWI A;  3CSG A;  4U1O A;  5KDT A;  4I62 A;  3OEL A;  4PE5 B;  3RT8 A;  5DEX A;  1KWH A;  1XVY A;  3O28 A;  2IA4 A;  3T22 A;  3PUY E;  3PGF A;  3CRB A;  1B6H A;  4KD5 A;  3B7D A;  1TXF A;  2I0B A;  2XXV A;  1MPD A;  4Q8R A;  4F2Q A;  2VOZ A;  2XX8 A;  3DP4 A;  1IXG A;  1B3G A;  5DVJ A;  3TFL A;  1HSE A;  4YU0 A;  1Y1M A;  4ECF A;  1AIV A;  1M5F A;  3HV1 A;  1A55 A;  5ITP A;  5DVF A;  4XKP A;  2Y7I A;  1UTH B;  2AL4 A;  4TQU Q;  2W7Y A;  4DLD A;  3USD A;  4PFU A;  1FTJ A;  3IOU A;  2O1M A;  4ZEC A;  1R9L A;  3LSF B;  3K1P A;  1B46 A;  3H6U A;  2PBW A;  4I8C A;  5JK4 A;  1S9T A;  3ONM A;  4EXL A;  3DP6 A;  4G4P A;  1BLF A;  1FQA A;  1I69 A;  3P7I A;  1LST A;  1SVX B;  2DSF A;  4OFO A;  4YB5 A;  1BTJ A;  4IO6 A;  3O6G A;  1MQD A;  3TTR A;  1IIW A;  4NE4 A;  3MVY A;  1MXY A;  3HN0 A;  3MVX A;  4G2Z A;  1EZO A;  1JW1 A;  3B6Q A;  1A8E A;  1B51 A;  4I9D A;  3K0V A;  3SKP A;  4K3F A;  2I4C A;  3OMB A;  4H8I A;  3KGC A;  1T0K A;  4IO2 A;  3PPN A;  2ZYN A;  3PUW E;  1MXZ A;  4YIC A;  3FV1 A;  1SW4 A;  2DOJ A;  1LCF A;  2OJT A;  2HZL A;  3N6T A;  3DEL B;  4EF2 A;  3MBP A;  3O66 A;  3BKI B;  1N3W A;  3LSX A;  1HSL A;  4F29 A;  4LVQ A;  3KG2 A;  4WEP A;  5FTI A;  4NF5 A;  3EHS A;  3TQW A;  1LBC A;  4F18 A;  1F9B A;  2VP1 A;  5TPA B;  1WOD A;  2DP8 A;  3MP8 A;  1LAG E;  1JEV A;  4MBP A;  2HZK A;  2NWJ A;  3TDJ A;  2P0S A;  1SW1 A;  4ISU A;  3MQ9 A;  4KPT A;  5FTH A;  4C0R A;  4LQ5 A;  5JEI A;  4N07 A;  4IY5 A;  2I0C A;  1YPN A;  1Y20 A;  3K02 A;  1DTZ A;  3L6G A;  5KCJ B;  4IB2 A;  2UXA A;  4YB7 A;  3MP6 A;  4DXB A;  5L8D A;  1B2H A;  2XXI A;  2IEE A;  3KJ7 A;  3TEL A;  3FXQ A;  3QK6 A;  3AXF A;  4I1D A;  1MH4 A;  3IAZ A;  2XX9 A;  4OFL A;  3DLN A;  1BKA A;  4GD5 A;  1XT8 A;  1POY 1;  4H67 A;  5AA2 D;  1AL3 A;  4NF8 B;  4R73 A;  3LBS A;  3FVN A;  4NF6 A;  4QFK A;  1LFH A;  1PEB A;  3VE1 B;  4IGT A;  3SEV A;  2REG A;  3IB0 A;  1MQJ A;  1DTG A;  3E13 X;  4F31 B;  3IK6 B;  3IOT A;  2QMW A;  4ESW A;  2RIN A;  1B5H A;  3TTM A;  3MVW A;  4OES A;  1IEJ A;  2NUV A;  2M8C A;  1N76 A;  3A3U A;  1ATG A;  4RPN A;  4YKJ A;  4BDQ A;  2ZYO A;  4LZ7 A;  1LB8 A;  1M5D A;  2D3I A;  2H9B A;  4H5F A;  2Z8D A;  5L9M A;  3RUM A;  3IR1 A;  2ONS A;  3MAM A;  3R6U A;  2PMS A;  3EPE A;  1QUJ A;  1QJM A;  3MZ9 A;  1M5E A;  4ZE9 A;  1B58 A;  1SDX A;  1B0L A;  1OVT A;  3TMG A;  4U4X A;  4TLM B;  3FJM A;  1B9J A;  3V8X B;  2DXY A;  1UTB A;  1OQG A;  2NXO A;  1MY4 A;  3TKD A;  3C4M A;  1H76 A;  1QW0 A;  4DCY A;  1FTM A;  4GL0 A;  4HS7 A;  1QKB A;  2QS4 A;  3RTF B;  2OCU A;  3G3K A;  4P0G A;  2QSX A;  3FJG A;  3ODB A;  5A5X B;  4AB6 A;  2QL3 A;  2UYF A;  2O69 A;  1B32 A;  4BDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...