1PBQA

Crystal structure of the nr1 ligand binding core in complex with 5,7-dichlorokynurenic acid (dcka) at 1.90 angstroms resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
286
structure length
274
Chain Sequence
RLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms of activation, inhibition and specificity: crystal structures of the NMDA receptor NR1 ligand-binding core
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligand binding protein
molecule keywords N-methyl-D-aspartate Receptor Subunit 1
total genus 73
structure length 274
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pbqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pbqA02
2F97A 3LBSA 4IO7A 3VLWA 1SQYA 1H43A 2OLBA 4FJPA 4H6DA 5H8NA 3K6UA 4G68C 3TKDA 2VD3A 4HTGA 3A09A 2IA4A 2RINA 4DXUA 4LATA 2RCBA 1LBBA 4DLDA 2XX8A 1URSA 1GVCA 5I2KB 3KOSA 1M5DA 3KN7A 1XVYA 2DWAA 1UTHB 2Q2AA 3OO9A 5EHSA 1BTJA 2ZNSA 3G3KA 1XT8A 1OIBA 1IZ1A 1D9YA 1P99A 2DQVA 1SW2A 2UVHA 1LCFA 4NF8B 5CRYA 1US4A 2OZZA 5ELVA 4FORA 2D5WA 4LQ2A 1A7LA 4LVQA 2I4CA 3HO7A 4JSDA 5H8HB 1D4NA 5AA2D 3S9MC 4KQPA 4GL8A 3VDFA 5TP9A 4AB5A 1XVXA 1A8FA 3SDFA 1EZ9A 4C1TA 2GRVA 4ZEIA 4LP2B 4YKJA 5KDTA 3SEWA 5I2KA 1IXHA 3Q25A 1FQAA 1MQDA 1ZTYA 2Z23A 3C35A 3BFUA 4GRKA 4EF2A 3IB0A 2RCAA 3FVNA 2ONSA 5A5XB 1B3FA 3TQLA 5DEXA 4C0RA 1EZOA 2Q88A 3ECRA 2OJTA 4NEDA 1I6BA 4ND9A 4N6PA 2O7IA 2I4BA 3FUZA 3H6UA 3K6VA 2YLNA 1UIVA 4PETA 2RC8A 1MQJA 4F18A 5I84A 3FV2A 3FZVA 4ELPA 2F36A 1MH3A 2QMXA 3O29A 4RYAA 4K3FA 2V3UA 4WXJA 3V5AA 5H8NB 3OELA 5CM6A 3RN8A 4ZDMA 4EQ7A 3N5LA 2A5SA 3OSRA 2O84X 4I9DA 3TYHA 2BJJX 2DXYA 2LAOA 2REJA 2XXVA 5ISUA 1QJMA 4ZE8A 1CE2A 3KFMA 3O6IA 1JNFA 1B1HA 4IO6A 1D3KA 1LLSA 1YCJA 1Z7NE 1A40A 3AXFA 3C31A 4NTLA 3KGCA 4FEDA 4EDPA 3TEPA 3RT6B 4OESA 4U1ZA 2P1SA 3LSLA 3C34A 4OWDA 3M3FA 3WAEA 5TP9B 3KJTA 1IITA 3MPKA 3OO8A 2HAUA 1POTA 3O6HA 4Z0IA 3OO7A 5ICQA 1MQHA 2NOOA 4OHNA 4EXLA 4X48A 3FASA 2Q89A 2X26A 3O9PA 1USYH 4E0WA 1MXVA 1B51A 2HEUA 3LSWA 4R6YA 3IORA 3RNNA 1FQDA 1GTKA 2PYYA 3Q26A 4I62A 1O7TA 4RA1A 4ELQA 1UTBA 3H3GA 2FA7A 3IOWA 1ANFA 1ZMGA 1MQGA 2F6GA 1LB9A 2DYXA 3FV1A 3OMBA 4G8NA 4QSDA 1QW0A 4XKPA 2AL4A 1GGGA 4JWYA 1AL3A 4ZEDA 1CB6A 3W9VA 2DP8A 3PMVA 5CI5A 1OQHA 2P0SA 2RKMA 3MVYA 1QKAA 1M5EA 4PQJA 2XD3A 3QK6A 4KD5A 1ZBMA 4PFTA 2ZXTA 5TU0A 2PT2A 1VR5A 4GLIA 4U4SA 1P1WA 2CZLA 4LONB 2X7QA 2YJPA 4MLVA 5H8HA 3OENA 3TTLA 2F7AA 4N13A 1OLCA 4HCWA 1I6AA 3T9UA 3PV0E 2ONRA 3FIRA 1B0HA 1NH8A 3E4RA 2HCAA 5I57B 3CR9A 1N7WA 3OO6A 3I5OA 4UACA 1M5CA 3TTKA 1B9JA 4YB5A 3H4ZA 4RK2A 1JW5A 1R9QA 1UQWA 2H5YA 3QXMA 4XTCQ 1B7HA 3VVFA 1H45A 3IB2A 2GFEA 4JWXA 4YU0A 4IO3A 3C4MA 1QUIA 1MY3A 1ZIUA 5H8SA 2ZNTA 4FIMA 4IGRA 3B7DA 2ZNUA 3DM0A 3MVZA 3MZBA 3KOTA 3ODBA 3HHFA 3PMXA 1JEUA 3TQWA 3UORA 5ICTA 4BDOA 3LUYA 1FQEA 3KN3A 3D4GA 3IJOB 4N07A 2NVUB 5JTYB 5KCJB 2I0CA 2Y84A 4JXIA 1A55A 3N6UA 4F3BA 2I48A 2UVJA 3MC2A 3S4UA 5I58A 3RUMA 5J1DA 4KHZE 3FXQA 2FYIA 4WKMA 1FQBA 3FJ7A 2XX7A 4GOTA 4GQOA 4LZ5A 3KJ7A 1MDQA 1B7ZA 2B3BA 2ZYNA 3R26A 1PBQA 4KYEA 5KZTA 2Q8JA 4G4PA 2I6EA 2IEEA 3CSGA 1LAXA 4H5FA 4OETA 3SESA 5AA3A 4OEUA 4Q0CA 4F39A 3JV9A 3O2AA 1NH7A 3PUWE 4ESXA 3ILUB 1B3GA 3IOVA 3PMWA 3K0VA 4OEVA 2XX9A 4C1UA 1WDNA 1MM6A 1YPNA 3RY3A 4YB7A 3MVXA 5I57A 1ELJA 3KBRA 4BDQA 3N26A 4GVOA 4OQOA 3B6QA 2G29A 4O3AA 1ZLQA 4RPOA 5CMBA 2Z8EA 4H0WA 4P11A 3QIMA 4U2RA 2UVGA 2R71A 3CSBA 3UGWA 1H3DA 3R7XA 4YKIA 4Q8RA 3CFZA 3O66A 2H9BA 3MP1A 4YAHX 2ANJA 3RQTA 4WEDA 4IB2A 4TQUQ 3TTRA 2DVCA 1UTHA 5K2YA 4YB6A 5AA2A 1QUJA 3G3JA 5B7DA 1H44A 2AL5A 3G3IA 3K1PA 1S50A 4NWDA 3RTWB 4HW8A 1JW4A 5TPAA 5H8QB 1VSOA 1MQIA 1LCTA 3E9XA 2XXIA 1LBCA 1GR2A 1MG1A 3MZ1A 4LA9A 3T66A 3V8XB 1NNPA 4AB6A 3FVOA 1HSEA 1EU8A 5B70A 3BBRA 1LAGE 4NF6A 4PFUA 2QL3A 1SW4A 2VOZA 3HPIA 1SVXB 1RYXA 4JB7A 2O1MA 4KR5A 4O3CA 5F1QA 3IOTA 3Q29A 2PX1A 3GXAA 3PPRA 1MH4A 2QPQA 1B40A 1JQFA 1MPCA 1R6ZA 3EF7A 1M5FA 1MPBA 1MS7A 3ILTB 3K01A 3PUYE 2Y7KA 3V83A 4H8IA 4R2BA 1TWYA 1JEVA 2F6PA 4JWOA 4G8MA 4EXKA 3QYTA 3ZKKA 2Z8DA 3TCFA 2ESNA 3S2VA 5AA2B 1PBPA 2O6AA 3OSQA 3USDA 4DZ1A 5L9OA 1AIVA 4IO5A 3SEVA 2Y7WA 4BDLA 2DE4A 1NNFA 3HV1A 3FXRA 4IGTA 1BIYA 1TT1A 2QSXA 5IAIA 2GH9A 4Q30B 1MY4A 2RC9A 5FHNA 1EZPA 4WEPA 4XIGQ 1SBPA 2X7PA 3DELB 1SDXA 3GBBA 3VXCA 1AMFA 3THIA 3IJXB 2F35A 4FE8A 4LQ5A 4IO2A 3MZ9A 4YICA 1B3EA 4NF8A 4ONYA 4R73A 3SEUA 3SKPA 4RNSA 4QF9A 3A3UA 2AYSA 1PDAA 4JDFA 3FJMA 3E13X 3H6VA 1B5JA 3JYRA 1XOCA 4G77A 3U1OA 4NMYA 1IIWA 3ONMA 1FTJA 3U94A 1B1XA 1SD3A 5HM4B 4G68A 4NF6B 3RTFB 4RPNA 4DCXA 1B5IA 1I69A 4R75A 5ITPA 2D21A 1N0TA 4KYSA 1N3XA 4R6HA 3MJNA 4XKNA 3N6TA 3CG3A 4XKRA 5HPQA 5DEXB 3TODA 4GD5A 4F2OA 1MY1A 1Y3NA 1Y20A 5BWJA 1LGBC 2NUVA 4OVJA 1VFDA 2PMSA 4ZEBA 3TELA 4QRZA 3KSXA 1YTVA 1US5A 4LUBA 1ZU0A 4UA8A 2DWJA 2B3FA 3WAFA 5A5XA 1NMUA 2UXAA 3MP8A 3H6TA 3Q28A 4QFPA 1B3LA 1XC1A 4QSEA 3K02A 1DPEA 1XHYA 2WKYA 3DP8A 1WODA 3IO6A 1OMPA 3IR1A 4FATA 3EPEA 1LSTA 1B7UA 2A5TA 1JVXA 4NE4A 3T9HB 3KSJA 5DVIA 3UN6A 2YPNA 3UP9A 1IXIA 1MM7A 4POXA 4R6KA 3W9WA 5I59A 2OK2A 2UYEA 1B2HA 1S9TA 2H4IA 3CVGA 3MW0A 4GXAA 3FVKA 5DYHA 5F7VA 5FTIA 3TFLA 2UVIA 5AA1A 1UIUA 2B65A 2O69A 3JZJA 1BLFA 3PU5A 1RYOA 2Y7RA 3K6XA 4PE5B 3KZGA 4RY1A 1B4ZA 2UYFA 3T22A 1LB8A 1FTOA 1MY0A 3O28A 4X9TA 3C33A 1R1NA 4QFOA 2I3VA 1B4HA 4DCYA 1A99A 2XD2A 5AE4A 1HSJA 3B6WA 3M3KA 4R9FA 4ELOA 2QS2A 3VLUA 2QRYA 4I8CA 5I56B 2ALUA 4THIA 3SETA 2ZYMA 3V89B 1POY1 3C32A 5I58B 4R72A 2Q2CA 1TFDA 2XXXA 4I1DA 3CFLA 4GWOA 4BDMA 3M3LA 3PUXE 3HHGA 4POWA 3VV5A 4FEBA 3RLFE 1MPDA 2Z22A 3G3FA 3T9XB 4DE8A 3A3CA 1Q35A 3HN0A 4ESWA 2F34A 3DP4A 1MXWA 4BDRA 3G3GA 3K6WA 4OTEA 3OD7A 1QUKA 3EHTA 3TDJA 5I2NB 3T93B 4NF4B 1IXCA 3F11A 4LZ8A 1FTLA 3I6VA 1YAEA 1A8EA 2A5TB 3QUFA 4OXVA 4YMBA 1IUDA 4YMAA 1BP5A 4QFKA 4F22A 1J1NA 2DVZA 1Y3QA 3QUJA 4PFWA 4U4XA 5KDTB 1VFEA 1Y9UA 4H65A 3T96B 2VGQA 4F1UA 5AA4B 4FECA 5EYFA 1DTZA 1NL5A 4Q5TA 4BLAA 5JK4A 2QJEA 2XXQA 3CIJA 4ZS9A 4QFLA 1B58A 3TCHA 4DIGA 1JVYA 2KLFA 3S9NC 3CI8A 1LFGA 3R6UA 2XXTA 1B6HA 1LFIA 3VXBA 1Y1ZA 3HCQA 4GL0A 4ECFA 2H98A 5JEIA 1AH5A 1N04A 1P1NA 2DS9A 3U8QA 1KWHA 4ZZEA 1D9VA 5LOMA 4QHQA 3H7MA 3P7IA 1Y4CA 2R6GE 2QMWA 3TAJA 4LZ7A 3L6HA 3MWBA 1T0KA 2HXWA 3ZKLA 2XXHA 3MVWA 3FATA 5ITOA 1SYHA 1O63A 4PFYA 1DPPA 1QULA 4KI0E 4YZZA 4MF3A 2OWTA 3K1NA 3I3VA 3Q27A 5H8FB 5HBCA 3FD3A 5I2NA 3OEKA 2E1SA 4M1VA 2V25A 2I49A 4U1OA 4YKPA 4F1YA 3IX1A 5I56A 2O68A 3KN8A 1DOTA 3VFJA 1MXYA 2M8CA 4XXUA 4F3PA 1B32A 1N7XA 3UIFA 4MFIA 3IK6B 2FNCA 1PB8A 3EHUA 3LR1A 1Y4TA 1URGA 4IO4A 4OYVA 3SERA 5DVFA 3UA8A 2HQ0A 5I59B 2E0SA 5L9SA 2NXOA 4U23A 2RF1A 3BKIB 3C36A 1NNKA 4OFOA 3K2DA 1A54A 4GXSB 4OFLA 4KFQA 4ZEKA 1B52A 4KCCA 3KG2A 1SW5A 1MXZA 2P2AA 3LSXA 2HZKA 3TTMA 1FQCA 1LFHA 4X1BA 4TLMB 1UTBB 1BKAA 3CG1A 3EQ1A 2F7BA 1TXFA 2G93A 2I3WA 2XXPA 4O3BA 3VVEA 1PB7A 1B0LA 2V3TA 3EHSA 2OWSA 3OOAA 1B5HA 1SYIA 2OCUA 3FJGA 3ZSFA 5H8FA 4GF8A 2ZMBA 1TFAA 1AOVA 4OZ9A 3PD9A 3PUZE 3TPAA 4U21A 5IKBA 5CC2A 2Y7PA 2F78A 3MUQA 3N94A 4ZZAA 5H8QA 1F9BA 4P0IA 4DXCA 4NF5B 1OLAA 3PPPA 4RK9A 2W7YA 3DP6A 3MQ9A 2CMOA 3E3KA 4EUOA 4F3SA 1USYE 1FW0A 2I0BA 3O6GA 2THIA 5CBRA 1FTKA 2XXYA 4MH5A 3U92A 1MXXA 2V84A 3FVGA 3EN3A 3G3HA 1FTMA 2GHAA 1PC3A 4G68B 1NFTA 1N76A 4R74A 3GZGA 1EH3A 1OVBA 4NF4A 3GBAA 3M8UA 4PP0A 4X1DA 1DTGA 3S9LC 3MBPA 2REGA 4G8HA 4H1XA 2O51A 3TZAA 1QVSA 3SEYA 2DXRA 5K2XA 2V3QA 3HSTA 4JBZA 3O97A 1NKXA 4ZEFA 4ELRA 4F19A 4OFJA 1OQGA 1RKMA 2H25A 4YKKA 5CMMA 3OEMA 2ONKE 1P1UA 5M2VA 5AA4A 2XHDA 2XXUA 2DE3A 2XXRA 2DE2A 2QS4A 4IY6A 2O1LA 5L9MA 3RGYA 1QKBA 1OVTA 4DDDA 1H76A 3K00A 2DOJA 2PVUA 3PPOA 3IAZA 4ISUA 2ZYKA 3GLBA 3MPLA 4HCYA 1N84A 2XXWA 1IXGA 2HFBA 4KPTA 4L17A 3H6WA 4OERA 3TTNA 1ATGA 2VD2A 2VP1A 3BFTA 4R9GA 2VHAA 5KCJA 1FCKA 4E0XA 4P0GA 3T9VA 3MAMA 1JW1A 1S7YA 2F7CA 2H99A 1IEJA 2D3IA 1M5BA 3QSLA 2V93A 4H8JA 4QSCA 4NF5A 3DLNA 1MY2A 5DVJA 2F8DA 4QFNA 4OENA 4GIZA 1II5A 3IOUA 2Y7IA 1B3HA 1O64A 3H06B 4F31B 1Y1MA 5FTHA 4ZECA 3PD8A 1NNTA 2F5XA 1ZJLA 3RT8A 3S9EA 2DWIA 4G2ZA 5DTBA 4H67A 1XS5A 3B6TA 3TUSA 1GV8A 3K1MA 3D4CA 2ZYOA 4R2FA 3UK4A 5BUUA 4EQ9A 3CFXA 2AIXA 1PB9A 2Z8FA 3CRBA 1PEBA 1R9LA 1MRPA 2ABHA 4XKQA 3MP6A 2PT1A 1B05A 2HAVA 5FHMA 3H03A 1DSNA 2DSFA 1JETA 1VE4A 2QS3A 3LSFB 1SI1A 3ZS6A 5CBSA 4IY5A 2DWHA 3W15C 2OBGA 2PBWA 1I6QA 1P1QA 3PGFA 5L8DA 1ZKBA 4OMBA 2NWJA 1LAFE 1MDP1 3K4UA 4F3GA 4ZE9A 1HSLA 4JSOA 2I58A 1P1OA 4RJZA 4MLQA 1B46A 1L5TA 4BDNA 2HZLA 1SW1A 1Z7ME 1MXUA 2QS1A 5CMCA 5EHMA 5FHOA 5DT6A 2RC7A 5TPAB 3VE1B 4TOZA 3VLVA 3KEIA 3IO4A 4Z7EA 5JTYA 1FQFA 4DXBA 4KCDA 1IQ7A 3LC8A 2GHBA 4AQ4A 1LAHE 1DMBA 3OXNA 4HS7A 4RXLA 3PPNA 4U22A 3U93A 4MBPA 4NWCA 3U72A 4EQBA 3G7WA 4GFRA 3TMGA 4F1VA 4F29A 3C9HA 4TLLB 5CMKA 3RPWA 1Q1KA 1SI0A 2Q9TA 3FGSA 4EF1A 4F2QA 1Y3PA 3FXUA 2R9JA 1N3WA 4FAJA 3SEXA 4M4GA 3VVDA 1URDA 3IB1A 3IL1B 1WVJA 3L6GA 3PPQA 3PUVE 2O7UA 4H5GA 4KYDA 3QAXA 3TCGA
chains in the Genus database with same CATH superfamily
1CNQA 2OLBA 4FJPA 5H8NA 3TKDA 2RINA 3QMFA 3KN7A 5EHSA 1UTHB 1D9YA 4JSDA 3E78A 5H8HB 5TP9A 1XVXA 1A8FA 3SDFA 4LP2B 4PF6A 5KDTA 3MYUA 3Q25A 1FQAA 4GRKA 3BFUA 3FVNA 2Y5LA 1EZOA 5DEXA 4C0RA 3SEYA 4N6PA 2O7IA 2YLNA 1YXIA 2ZZXA 3FZVA 2F36A 5H8NB 2V3UA 3OELA 3RN8A 4EQ7A 5DW8A 4ZE8A 3O6IA 1FBPA 1D3KA 4OVSA 3RT6B 2P1SA 3C34A 3KJTA 3OO7A 3FASA 2X26A 4DI4B 2HEUA 5EQ9A 3Q26A 1ZMGA 2DYXA 3FV1A 4XKPA 1GGGA 1CB6A 3W9VA 2DP8A 5CI5A 2VPOA 1QKAA 1M5EA 2XD3A 3QK6A 5TU0A 1ZBMA 2ZXTA 4U4SA 4I3YA 4MLVA 4N13A 1OLCA 2HCAA 5I57B 1R9QA 3VVFA 2F3BA 4JWXA 4YU0A 4IO3A 1MY3A 3ODBA 3UORA 4N07A 3N6UA 5I58A 3S4UA 4N81A 2FYIA 1FPIA 4P9KA 1MDQA 2B3BA 2ZYNA 4KYEA 2FBPA 2IEEA 1RDYA 3IFAA 4Q0CA 3O2AA 3ILUB 1KA0A 4OEVA 4C1UA 1MM6A 4YB7A 3MVXA 4MHFA 4BDQA 4GVOA 2G29A 4RPOA 4U2RA 3R7XA 1NUYA 4WEDA 4IB2A 3RQTA 3TTRA 2WBBA 4YB6A 4GWWA 4PE3A 3RPLB 4AB6A 3FVOA 4KR5A 1NI9A 1SW4A 2QL3A 1SVXB 3HPIA 3IOTA 3Q29A 1LBYA 3PUYE 2P3VA 2Y7KA 4R2BA 4EXKA 2F6PA 2Z8DA 3TCFA 2ESNA 1EYKA 1PBPA 2PFYA 5L9OA 5I5PA 1KZ8A 4IGTA 1TT1A 2GH9A 5FHNA 1SDXA 1AMFA 5J16A 4MX6A 1FBFA 3H6VA 2KR0A 1XOCA 4G77A 3ONMA 4NN3A 4NF6B 5ITPA 4KYSA 4XKRA 3TODA 2F3DA 1Y20A 1LGBC 1VFDA 4QRZA 1FSAA 5A5XA 3H6TA 3IR1A 4N8GA 5A5LA 4NE4A 1JP4A 4POXA 5I59A 1FPGA 1S9TA 3TEPA 3TFLA 1UIUA 2B65A 1BLFA 2Y7RA 5AA3A 1B4ZA 2UYFA 1LB8A 1MY0A 4QFOA 2I3VA 4DCYA 4PBHA 3B6WA 4ELOA 3VLUA 2B4MA 2ALUA 3V89B 1FRPA 4BDMA 3PUXE 4POWA 4FEBA 2Z22A 4BDRA 2Q8MA 3EHTA 1IUDA 4F22A 3QUJA 1Y3QA 4H65A 1NUXA 2QJEA 2XXQA 3CIJA 3PTYA 4DIGA 2KLFA 5IZ1A 1Y1ZA 4ECFA 2H98A 4HE1A 1KWHA 4ZZEA 1D9VA 5LOMA 4QHQA 3H7MA 3TAJA 4LZ7A 3L6HA 1T0KA 3ZKLA 4PFRA 1QULA 4MF3A 3EKIA 5HBCA 3FD3A 4YKPA 1D9QA 2O68A 1DOTA 2V4CA 3UIFA 4MFIA 1PB8A 3EHUA 2HQ0A 5I59B 3BKIB 3C36A 4OFOA 3K2DA 1A54A 4GXSB 4ZEKA 1B52A 2P2AA 1MXZA 1FQCA 2I3WA 2XXPA 1IMBA 3EHSA 2OWSA 3OOAA 1B5HA 2OCUA 3ZSFA 5H8FA 4GF8A 1TFAA 2B4LA 3PD9A 4U21A 4ZZAA 5H8QA 3PPPA 2W7YA 2XWVA 2CMOA 4F3SA 5CBRA 3U92A 1MXXA 4G68B 1FTMA 4OANA 1EH3A 2O51A 5K2XA 2V3QA 4JBZA 3O97A 4ZEFA 5AA4A 1RKMA 2VPNA 4DDDA 1OVTA 1IXGA 4KPTA 4O94A 3TTNA 2VP1A 3MAMA 1II5A 1O64A 3H06B 4F31B 3RT8A 1NNTA 1ZJLA 2DWIA 3K1MA 2ZYOA 2AIXA 1PB9A 1YYZA 1PEBA 4O8MA 4H45A 1VE4A 1SI1A 4GX6A 4UABA 4OMBA 1LAFE 2HHMA 1HSLA 1B46A 2QS1A 1MXUA 3VE1B 5DT6A 2QVRA 3KEIA 3IO4A 1FQFA 2GHBA 4HS7A 4RXLA 3U72A 4GFRA 5CMKA 1Q1KA 4QXDA 2WYKA 4NG7A 3SEXA 4KYDA 2O7UA 3QAXA 3TCGA 2F97A 3LBSA 4IO7A 4PAFA 4P1EA 2VD3A 4HTGA 4DXUA 1LBBA 4DLDA 1URSA 5I2KB 3OO9A 1BTJA 1P99A 2DQVA 2OZZA 3D1RA 4GL8A 4AB5A 1IXHA 1ZTYA 1FBDA 1NV0A 4EF2A 2RCAA 5A5XB 2Q88A 4P47A 3ECRA 4Q8RA 4ND9A 1IMDA 3H6UA 3K6VA 4PETA 5I84A 2QMXA 3O29A 4GX4A 3OSRA 2VT5A 2BJJX 2DXYA 5ISUA 1QJMA 3AXFA 5EQ7A 1Z7NE 1A40A 3KGCA 4OESA 3M3FA 2QVVA 3MPKA 1MQHA 4X48A 2Q89A 4E0WA 1FQDA 1GTKA 4I62A 2OWZA 4RA1A 3H3GA 3IOWA 1MQGA 1YZ0A 2P0SA 4PQJA 4KD5A 4JVCA 2CZLA 4LONB 4HCWA 2ZZVA 3CR9A 1N7WA 3OO6A 3QXMA 1UQWA 4XTCQ 2CZKA 4IGRA 4FIMA 3B7DA 2ZNUA 3MZBA 3TQWA 1JEUA 1FQEA 3KN3A 3IJOB 2I0CA 1A55A 5J1DA 4KHZE 4WKMA 3E79A 4GQOA 2XX7A 4GOTA 3R26A 4G4PA 3CSGA 1LAXA 4H5FA 5FBPA 3SESA 4OEUA 4F39A 3JV9A 1B3GA 1WDNA 4XEQA 4NF0A 3N26A 2XWIA 1ZLQA 4PDHA 2Z8EA 4MAGA 4H0WA 2UVGA 4HXVA 3CFZA 1DBZA 1UTHA 5K2YA 1QUJA 1H44A 2AL5A 4HW8A 5TPAA 5H8QB 1MQIA 4OVQA 4PGPA 2XXIA 1LBCA 1GR2A 1MG1A 1EU8A 5B70A 2VOZA 1RYXA 2O1MA 3GXAA 1MH4A 3EF7A 1R6ZA 3V83A 1TWYA 5IZZA 3USDA 1AIVA 2Q74A 5EYHA 3SEVA 2Y7WA 1NNFA 3HV1A 5IAIA 4XIGQ 3DELB 3VXCA 5FTIA 4IO2A 1B3EA 4R73A 1IMFA 4QF9A 2AYSA 1PDAA 1FPFA 3RYDA 2XXKA 1NV3A 4NMYA 3U94A 1VDWA 1LBWA 4G68A 1I69A 3MJNA 4XKNA 3N6TA 1NV7A 3ROJA 3A29A 1YTVA 1ZU0A 3WAFA 2B3FA 4FBPA 2UXAA 4QFPA 1XHYA 1OMPA 3EPEA 3LV0A 5EQ8A 1JVXA 3T9HB 3KSJA 5DVIA 4KXPA 2YPNA 3UP9A 1IXIA 3MW0A 5DYHA 3FVKA 2XA5A 3KZGA 4PE5B 3T22A 3O28A 1FTOA 3C33A 1R1NA 2XD2A 1HSJA 3M3KA 2CZHA 4I8CA 5I58B 3CFLA 3VV5A 3T9XB 1Q35A 2F34A 1MXWA 3G3GA 3OD7A 5I2NB 4MIJA 1IXCA 4LZ8A 1YAEA 2A5TB 4PFWA 4GWYA 1NV2A 1FJ9A 5EYFA 2WBDA 2GQ1A 4PFIA 1NV5A 3TCHA 1B58A 1JVYA 1QGXA 3CI8A 1B6HA 1LFIA 1FBEA 4GL0A 4PAKA 1AH5A 3P7IA 1Y4CA 2R6GE 5ITOA 4PFYA 1O63A 1DPPA 4YZZA 2OWTA 2DDKA 3Q27A 5I2NA 3OEKA 2I49A 5I56A 4P3LA 1MXYA 4XXUA 4F3PA 1B32A 2FNCA 3SERA 3LR1A 4OYVA 1URGA 5DVFA 4I3EA 2E0SA 2NXOA 4U23A 4X1BA 4TLMB 3CG1A 2F7BA 3VVEA 2ZMBA 4OZ9A 2F78A 1F9BA 4OVTA 3DP6A 1USYE 1FW0A 2I0BA 3O6GA 2THIA 5ET7A 4MH5A 4NF6A 3G3HA 3FVGA 4GWSA 2GHAA 3GZGA 4NF4A 1G0IA 4H1XA 3HSTA 1NKXA 2ZZWA 4F19A 4YKKA 3OEMA 2ONKE 2XXUA 5L9MA 2DE2A 2QS4A 3RGYA 5ET6A 2PVUA 3IAZA 4ISUA 3GLBA 4HCYA 2HFBA 3H6WA 1ATGA 1FCKA 3T9VA 3QSLA 4X04A 1MY2A 2Y7IA 2FIEA 4MNCA 5FTHA 3PD8A 4XFEA 2F5XA 5IZ3B 4H67A 3B6TA 5IM2A 3D4CA 4R2FA 3CRBA 5B7DA 2ABHA 3H03A 2QS3A 5CBSA 3ZS6A 1EYJA 1I6QA 4GWZA 1P1QA 4MMPA 4NQ8A 2NWJA 4ZE9A 4MLQA 4BDNA 2HZLA 1Z7ME 5EHMA 5TPAB 4AQ4A 1LAHE 3OXNA 5IKBA 4MBPA 4NWCA 4EQBA 1FPDA 3RPWA 1SI0A 3FGSA 1Y3PA 2R9JA 1N3WA 4OA4A 4MEVA 1URDA 3IL1B 3L6GA 4GWXA 1SQYA 4N17A 3K6UA 4P56A 4N4UA 3A09A 2RCBA 3KOSA 4PAIA 2DWAA 2Q2AA 1XT8A 1SW2A 2MKZA 4NF8B 5CRYA 4FORA 2D5WA 5AA2D 3S9MC 4KQPA 3VDFA 1FPLA 4C1TA 4ZEIA 1AWBA 3SEWA 1MQDA 1B3FA 3TQLA 2OJTA 4G61A 1RDZA 1UIVA 2RC8A 1MQJA 4MCOA 3FV2A 1MH3A 1IMAA 4RYAA 5CM6A 4ZDMA 2A5SA 2O84X 4I9DA 2REJA 2LAOA 2XXVA 1CE2A 1NV4A 1B1HA 4IO6A 4NTLA 1LLSA 1YCJA 4EDPA 4FEDA 4U1ZA 5TP9B 1NV6A 4X8RA 4OHNA 3O9PA 1USYH 2HXRA 3NOHA 1B51A 3LSWA 4R6YA 3RNNA 2PYYA 1O7TA 4ELQA 3OMBA 1ANFA 4QSDA 2F6GA 1QW0A 4ZEDA 3PMVA 5ET5A 3MVYA 4PFTA 2PT2A 1P1WA 5H8HA 2X7QA 2YJPA 3TTLA 3OENA 2F7AA 5IGAA 3T9UA 2ONRA 2XWKA 1NH8A 3E4RA 4UACA 3I5OA 3TTKA 1B9JA 4YB5A 2H5YA 1B7HA 1H45A 3C4MA 1QUIA 2ZNTA 3U65A 3LUYA 2NVUB 5KCJB 4JXIA 2Y84A 2I48A 1FQBA 3FJ7A 2Q8JA 4OETA 4PDDA 1NH7A 3PUWE 4ESXA 2XX9A 1YPNA 3RY3A 5I57A 2P3NA 4OQOA 4O3AA 5CMBA 1XI6A 4P11A 2R71A 3CSBA 1H3DA 4YKIA 2ANJA 1IMCA 2DVCA 4XF5A 3G3IA 4NX1A 4NWDA 4MNPA 1RDXA 1VSOA 5EQAA 1LCTA 3E9XA 4O7MA 3MZ1A 3V8XB 1NNPA 1IMEA 1HSEA 1LAGE 1BK4A 4JB7A 4PGNA 4O3CA 1DK4A 3PPRA 1B40A 1JQFA 3ILTB 1M5FA 1MPBA 1MS7A 4H8IA 4G8MA 3QYTA 5AA2B 2O6AA 4IO5A 4BDLA 3FXRA 1BIYA 2QSXA 1LBVA 1MY4A 2RC9A 4WEPA 1SBPA 3GBBA 4GX3A 3IJXB 4LQ5A 4YICA 3SKPA 3MZ9A 2QFLA 4JDFA 3FJMA 3E13X 5T3JA 3U1OA 1B1XA 1SD3A 5IZ3A 5HM4B 3RTFB 1B5IA 2D21A 2WYPA 1N0TA 4GD5A 4F2OA 3BIGA 3T1BA 2NUVA 4OVJA 3TELA 3KSXA 4LUBA 4UA8A 3Q28A 1XC1A 4QSEA 3K02A 1DPEA 2WKYA 3IO6A 4FATA 1LSTA 1B7UA 1Q9DA 4PBQA 2UYEA 1B2HA 2H4IA 3CVGA 4GXAA 5F7VA 2UVIA 2O69A 3JZJA 3PU5A 4RY1A 1B4HA 1A99A 1K9YA 2QS2A 4THIA 3SETA 4R72A 2Q2CA 1FBCA 1TFDA 4GWOA 3RLFE 3A3CA 1DCUA 4OTEA 1QUKA 3TDJA 4IR8A 4YMBA 1BP5A 1J1NA 5KDTB 1VFEA 3T96B 5AA4B 1G0HA 4Q5TA 2FHYA 4N91A 4ZS9A 3R6UA 3IFCA 2WX9A 5JEIA 1N04A 3KBZA 2QMWA 2HXWA 3MVWA 1SYHA 4PCDA 2QVUA 3K1NA 4M1VA 2E1SA 4F1YA 3IX1A 3KN8A 3VFJA 2M8CA 1N7XA 4IO4A 2RF1A 1NNKA 2HZKA 3TTMA 3EQ1A 1TXFA 2KQZA 1B0LA 2V3TA 3FJGA 4HE2A 3TPAA 3PUZE 5CC2A 3N94A 3MUQA 4P0IA 4DXCA 4NF5B 1OLAA 3GYYA 3MQ9A 4NAPA 3E3KA 4EUOA 2XXYA 2V84A 3EN3A 1N76A 4R74A 5LDZA 1OVBA 3GBAA 4X1DA 3S9LC 2REGA 3TZAA 2DXRA 4ELRA 4OFJA 1OQGA 2H25A 5M2VA 1P1UA 2XXRA 1QKBA 1H76A 2DOJA 2ZYKA 3MPLA 1N84A 2XXWA 4L17A 4R9GA 2VHAA 5KCJA 4E0XA 2D3IA 1M5BA 2V93A 1INPA 4NF5A 2F8DA 4QFNA 4HE0A 3IOUA 1B3HA 2JJKA 1Y1MA 2PFZA 4ZECA 4N6DA 4G2ZA 2FVZA 3T0JA 5BUUA 4EQ9A 1R9LA 1MRPA 1DSNA 3LSFB 2OBGA 2PBWA 1ZKBA 4F3GA 3RPLA 2I58A 4RJZA 1L5TA 1SW1A 5CMCA 4Z7EA 4JVDA 3SZPA 1IQ7A 1DMBA 4U22A 3PPNA 3G7WA 1FPEA 3TMGA 4F29A 3C9HA 4TLLB 4EF1A 3FXUA 2FIXA 4FAJA 4M4GA 4H5GA 3PUVE 1WVJA 1LEVA 3VLWA 1H43A 4NHBA 4H6DA 4G68C 2IA4A 4LATA 1FPJA 1EYIA 2XX8A 1GVCA 3KC1A 1M5DA 1XVYA 4P8BA 2ZNSA 3G3KA 1OIBA 2UVHA 1IZ1A 1NUZA 1LCFA 1US4A 5ELVA 3B8BA 1LBXA 4LQ2A 1A7LA 4LVQA 2I4CA 3HO7A 1D4NA 1EZ9A 2GRVA 4YKJA 2Z23A 4AS5A 3C35A 3IB0A 2ONSA 4NEDA 1I6BA 2I4BA 3FUZA 4ELPA 4WXJA 3V5AA 1SPIA 2CEYA 3N5LA 3TYHA 3KFMA 4PF8A 1JNFA 4R75A 3C31A 4NGUA 3LSLA 4OWDA 3WAEA 1IITA 3OO8A 2HAUA 1POTA 3O6HA 4Z0IA 5ICQA 2NOOA 4EXLA 4O7IA 4PC9A 1KA1A 1MXVA 3IORA 1UTBA 2FA7A 1LB9A 4G8NA 2AL4A 4JWYA 1AL3A 2PCRA 1NV1A 1OQHA 2RKMA 4GBVA 1VR5A 4GLIA 4I40A 1I6AA 3PV0E 3FIRA 1B0HA 1M5CA 3H4ZA 4RK2A 1JW5A 3IB2A 2GFEA 5ET8A 1ZIUA 5ESYA 5H8SA 3DM0A 3MVZA 3PMXA 3KOTA 3HHFA 5JK4A 5ICTA 4BDOA 3D4GA 5JTYB 4F3BA 3MC2A 2UVJA 3RUMA 3FXQA 4LZ5A 2XWOA 4PFBA 1FPBA 3KJ7A 1B7ZA 1PBQA 5KZTA 2I6EA 5I3SA 3IOVA 3PMWA 3K0VA 4DI3D 1ELJA 3KBRA 3B6QA 3QIMA 3UGWA 3O66A 2H9BA 3MP1A 4YAHX 4TQUQ 3MSTA 5AA2A 3G3JA 3K1PA 3RTWB 1S50A 1JW4A 5EYGA 3HFUA 4LA9A 3T66A 3ISPA 3BBRA 4PFUA 4QBAA 3CHGA 5F1QA 4H46A 2PX1A 2QPQA 4K3FA 1MPCA 4OERA 1FPKA 4DCXA 3K01A 1JEVA 4JWOA 3ZKKA 4GBWA 3S2VA 3OSQA 4DZ1A 2DE4A 4AS4A 4N15A 4Q30B 2CEXA 1EZPA 2X7PA 3THIA 1K9ZA 2F35A 4FE8A 3SEUA 4NF8A 4ONYA 4RNSA 3A3UA 3BIHA 1B5JA 3JYRA 1IIWA 4P1LA 1FTJA 4RPNA 1FTAA 2WEFA 1N3XA 4R6HA 4LN5A 3CG3A 5HPQA 5DEXB 1MY1A 1Y3NA 5BWJA 2PMSA 4ZEBA 1US5A 2DWJA 1NMUA 3MP8A 1B3LA 4OVPA 3DP8A 1WODA 4N8YA 2A5TA 4PTKA 3UN6A 1MM7A 4R6KA 3W9WA 2OK2A 4DXBA 4F18A 5AA1A 2CZIA 1RYOA 3K6XA 4X9TA 4MNIA 5AE4A 4R9FA 2QRYA 2ZYMA 1POY1 3C32A 1LBZA 2XXXA 4I1DA 5I2KA 3M3LA 3HHGA 1MPDA 3G3FA 4DE8A 3HN0A 4ESWA 3DP4A 3K6WA 3T93B 4NF4B 1FJ6A 3F11A 1FTLA 3I6VA 1A8EA 3QUFA 4OXVA 4YMAA 4QFKA 2DVZA 4U4XA 1Y9UA 2VGQA 4F1UA 4FECA 1DTZA 1NL5A 4BLAA 4QFLA 3KC0A 3FXBA 3S9NC 1LFGA 4N6KA 4GWUA 2L5VA 2XXTA 3VXBA 3HCQA 1P1NA 2DS9A 3U8QA 3MWBA 2XXHA 3FATA 4KI0E 3I3VA 5H8FB 4U1OA 2HPGA 2V25A 4JVIA 2R8TA 3IK6B 1Y4TA 3UA8A 5L9SA 4OFLA 4KFQA 4KCCA 3KG2A 1SW5A 1LFHA 3LSXA 4OVRA 1UTBB 1BKAA 3B50A 2G93A 4O3BA 1FBHA 1PB7A 5LTCA 1SYIA 1AOVA 2Y7PA 4RK9A 1FTKA 5I56B 1PC3A 1NFTA 3M8UA 4PP0A 1DTGA 3MBPA 4G8HA 1QVSA 5CMMA 2XHDA 2DE3A 4IY6A 2O1LA 3K00A 3PPOA 2OX3A 3BFTA 2VD2A 4P0GA 1FBGA 1JW1A 1S7YA 2F7CA 4QSCA 2H99A 1IEJA 4H8JA 3LUZA 4MJOA 3DLNA 5DVJA 4OENA 4GIZA 3FBPA 1NUWA 3S9EA 5DTBA 1XS5A 5I7IA 3TUSA 1GV8A 3UK4A 3CFXA 4XKQA 2Z8FA 5FHMA 3MP6A 2PT1A 1B05A 2HAVA 2DSFA 1JETA 4IY5A 2DWHA 3W15C 3PGFA 2Y5KA 5L8DA 1MDP1 3K4UA 4JSOA 1P1OA 5FHOA 2RC7A 3VLVA 5JTYA 4TOZA 4KCDA 3LC8A 3U93A 4F1VA 2Q9TA 4F2QA 5F24A 3VVDA 2BJIA 3IB1A 3PPQA
chains in the Genus database with same CATH topology
2F97A 3LBSA 4IO7A 3VLWA 1SQYA 1H43A 2OLBA 4FJPA 4H6DA 5H8NA 3K6UA 4G68C 3TKDA 2VD3A 4HTGA 3A09A 2IA4A 2RINA 4DXUA 4LATA 2RCBA 1LBBA 4DLDA 2XX8A 1URSA 1GVCA 5I2KB 3KOSA 1M5DA 3KN7A 1XVYA 2DWAA 1UTHB 2Q2AA 3OO9A 5EHSA 1BTJA 2ZNSA 3G3KA 1XT8A 1OIBA 1IZ1A 1D9YA 1P99A 2DQVA 1SW2A 2UVHA 1LCFA 4NF8B 5CRYA 1US4A 2OZZA 5ELVA 4FORA 2D5WA 4LQ2A 1A7LA 4LVQA 2I4CA 3HO7A 4JSDA 5H8HB 1D4NA 5AA2D 3S9MC 4KQPA 4GL8A 3VDFA 5TP9A 4AB5A 1XVXA 1A8FA 3SDFA 1EZ9A 4C1TA 2GRVA 4ZEIA 4LP2B 4YKJA 5KDTA 3SEWA 5I2KA 1IXHA 3Q25A 1FQAA 1MQDA 1ZTYA 2Z23A 3C35A 3BFUA 4GRKA 4EF2A 3IB0A 2RCAA 3FVNA 2ONSA 5A5XB 1B3FA 3TQLA 5DEXA 4C0RA 1EZOA 2Q88A 3ECRA 2OJTA 4NEDA 1I6BA 4ND9A 4N6PA 2O7IA 2I4BA 3FUZA 3H6UA 3K6VA 2YLNA 1UIVA 4PETA 2RC8A 1MQJA 4F18A 5I84A 3FV2A 3FZVA 4ELPA 2F36A 1MH3A 2QMXA 3O29A 4RYAA 4K3FA 2V3UA 4WXJA 3V5AA 5H8NB 3OELA 5CM6A 3RN8A 4ZDMA 4EQ7A 3N5LA 2A5SA 3OSRA 2O84X 4I9DA 3TYHA 2BJJX 2DXYA 2LAOA 2REJA 2XXVA 5ISUA 1QJMA 4ZE8A 1CE2A 3KFMA 3O6IA 1JNFA 1B1HA 4IO6A 1D3KA 1LLSA 1YCJA 1Z7NE 1A40A 3AXFA 3C31A 4NTLA 3KGCA 4FEDA 4EDPA 3TEPA 3RT6B 4OESA 4U1ZA 2P1SA 3LSLA 3C34A 4OWDA 3M3FA 3WAEA 5TP9B 3KJTA 1IITA 3MPKA 3OO8A 2HAUA 1POTA 3O6HA 4Z0IA 3OO7A 5ICQA 1MQHA 2NOOA 4OHNA 4EXLA 4X48A 3FASA 2Q89A 2X26A 3O9PA 1USYH 4E0WA 1MXVA 1B51A 2HEUA 3LSWA 4R6YA 3IORA 3RNNA 1FQDA 1GTKA 2PYYA 3Q26A 4I62A 1O7TA 4RA1A 4ELQA 1UTBA 3H3GA 2FA7A 3IOWA 1ANFA 1ZMGA 1MQGA 2F6GA 1LB9A 2DYXA 3FV1A 3OMBA 4G8NA 4QSDA 1QW0A 4XKPA 2AL4A 1GGGA 4JWYA 1AL3A 4ZEDA 1CB6A 3W9VA 2DP8A 3PMVA 5CI5A 1OQHA 2P0SA 2RKMA 3MVYA 1QKAA 1M5EA 4PQJA 2XD3A 3QK6A 4KD5A 1ZBMA 4PFTA 2ZXTA 5TU0A 2PT2A 1VR5A 4GLIA 4U4SA 1P1WA 2CZLA 4LONB 2X7QA 2YJPA 4MLVA 5H8HA 3OENA 3TTLA 2F7AA 4N13A 1OLCA 4HCWA 1I6AA 3T9UA 3PV0E 2ONRA 3FIRA 1B0HA 1NH8A 3E4RA 2HCAA 5I57B 3CR9A 1N7WA 3OO6A 3I5OA 4UACA 1M5CA 3TTKA 1B9JA 4YB5A 3H4ZA 4RK2A 1JW5A 1R9QA 1UQWA 2H5YA 3QXMA 4XTCQ 1B7HA 3VVFA 1H45A 3IB2A 2GFEA 4JWXA 4YU0A 4IO3A 3C4MA 1QUIA 1MY3A 1ZIUA 5H8SA 2ZNTA 4FIMA 4IGRA 3B7DA 2ZNUA 3DM0A 3MVZA 3MZBA 3KOTA 3ODBA 3HHFA 3PMXA 1JEUA 3TQWA 3UORA 5ICTA 4BDOA 3LUYA 1FQEA 3KN3A 3D4GA 3IJOB 4N07A 2NVUB 5JTYB 5KCJB 2I0CA 2Y84A 4JXIA 1A55A 3N6UA 4F3BA 2I48A 2UVJA 3MC2A 3S4UA 5I58A 3RUMA 5J1DA 4KHZE 3FXQA 2FYIA 4WKMA 1FQBA 3FJ7A 2XX7A 4GOTA 4GQOA 4LZ5A 3KJ7A 1MDQA 1B7ZA 2B3BA 2ZYNA 3R26A 1PBQA 4KYEA 5KZTA 2Q8JA 4G4PA 2I6EA 2IEEA 3CSGA 1LAXA 4H5FA 4OETA 3SESA 5AA3A 4OEUA 4Q0CA 4F39A 3JV9A 3O2AA 1NH7A 3PUWE 4ESXA 3ILUB 1B3GA 3IOVA 3PMWA 3K0VA 4OEVA 2XX9A 4C1UA 1WDNA 1MM6A 1YPNA 3RY3A 4YB7A 3MVXA 5I57A 1ELJA 3KBRA 4BDQA 3N26A 4GVOA 4OQOA 3B6QA 2G29A 4O3AA 1ZLQA 4RPOA 5CMBA 2Z8EA 4H0WA 4P11A 3QIMA 4U2RA 2UVGA 2R71A 3CSBA 3UGWA 1H3DA 3R7XA 4YKIA 4Q8RA 3CFZA 3O66A 2H9BA 3MP1A 4YAHX 2ANJA 3RQTA 4WEDA 4IB2A 4TQUQ 3TTRA 2DVCA 1UTHA 5K2YA 4YB6A 5AA2A 1QUJA 3G3JA 5B7DA 1H44A 2AL5A 3G3IA 3K1PA 1S50A 4NWDA 3RTWB 4HW8A 1JW4A 5TPAA 5H8QB 1VSOA 1MQIA 1LCTA 3E9XA 2XXIA 1LBCA 1GR2A 1MG1A 3MZ1A 4LA9A 3T66A 3V8XB 1NNPA 4AB6A 3FVOA 1HSEA 1EU8A 5B70A 3BBRA 1LAGE 4NF6A 4PFUA 2QL3A 1SW4A 2VOZA 3HPIA 1SVXB 1RYXA 4JB7A 2O1MA 4KR5A 4O3CA 5F1QA 3IOTA 3Q29A 2PX1A 3GXAA 3PPRA 1MH4A 2QPQA 1B40A 1JQFA 1MPCA 1R6ZA 3EF7A 1M5FA 1MPBA 1MS7A 3ILTB 3K01A 3PUYE 2Y7KA 3V83A 4H8IA 4R2BA 1TWYA 1JEVA 2F6PA 4JWOA 4G8MA 4EXKA 3QYTA 3ZKKA 2Z8DA 3TCFA 2ESNA 3S2VA 5AA2B 1PBPA 2O6AA 3OSQA 3USDA 4DZ1A 5L9OA 1AIVA 4IO5A 3SEVA 2Y7WA 4BDLA 2DE4A 1NNFA 3HV1A 3FXRA 4IGTA 1BIYA 1TT1A 2QSXA 5IAIA 2GH9A 4Q30B 1MY4A 2RC9A 5FHNA 1EZPA 4WEPA 4XIGQ 1SBPA 2X7PA 3DELB 1SDXA 3GBBA 3VXCA 1AMFA 3THIA 3IJXB 2F35A 4FE8A 4LQ5A 4IO2A 3MZ9A 4YICA 1B3EA 4NF8A 4ONYA 4R73A 3SEUA 3SKPA 4RNSA 4QF9A 3A3UA 2AYSA 1PDAA 4JDFA 3FJMA 3E13X 3H6VA 1B5JA 3JYRA 1XOCA 4G77A 3U1OA 4NMYA 1IIWA 3ONMA 1FTJA 3U94A 1B1XA 1SD3A 5HM4B 4G68A 4NF6B 3RTFB 4RPNA 4DCXA 1B5IA 1I69A 4R75A 5ITPA 2D21A 1N0TA 4KYSA 1N3XA 4R6HA 3MJNA 4XKNA 3N6TA 3CG3A 4XKRA 5HPQA 5DEXB 3TODA 4GD5A 4F2OA 1MY1A 1Y3NA 1Y20A 5BWJA 1LGBC 2NUVA 4OVJA 1VFDA 2PMSA 4ZEBA 3TELA 4QRZA 3KSXA 1YTVA 1US5A 4LUBA 1ZU0A 4UA8A 2DWJA 2B3FA 3WAFA 5A5XA 1NMUA 2UXAA 3MP8A 3H6TA 3Q28A 4QFPA 1B3LA 1XC1A 4QSEA 3K02A 1DPEA 1XHYA 2WKYA 3DP8A 1WODA 3IO6A 1OMPA 3IR1A 4FATA 3EPEA 1LSTA 1B7UA 2A5TA 1JVXA 4NE4A 3T9HB 3KSJA 5DVIA 3UN6A 2YPNA 3UP9A 1IXIA 1MM7A 4POXA 4R6KA 3W9WA 5I59A 2OK2A 2UYEA 1B2HA 1S9TA 2H4IA 3CVGA 3MW0A 4GXAA 3FVKA 5DYHA 5F7VA 5FTIA 3TFLA 2UVIA 5AA1A 1UIUA 2B65A 2O69A 3JZJA 1BLFA 3PU5A 1RYOA 2Y7RA 3K6XA 4PE5B 3KZGA 4RY1A 1B4ZA 2UYFA 3T22A 1LB8A 1FTOA 1MY0A 3O28A 4X9TA 3C33A 1R1NA 4QFOA 2I3VA 1B4HA 4DCYA 1A99A 2XD2A 5AE4A 1HSJA 3B6WA 3M3KA 4R9FA 4ELOA 2QS2A 3VLUA 2QRYA 4I8CA 5I56B 2ALUA 4THIA 3SETA 2ZYMA 3V89B 1POY1 3C32A 5I58B 4R72A 2Q2CA 1TFDA 2XXXA 4I1DA 3CFLA 4GWOA 4BDMA 3M3LA 3PUXE 3HHGA 4POWA 3VV5A 4FEBA 3RLFE 1MPDA 2Z22A 3G3FA 3T9XB 4DE8A 3A3CA 1Q35A 3HN0A 4ESWA 2F34A 3DP4A 1MXWA 4BDRA 3G3GA 3K6WA 4OTEA 3OD7A 1QUKA 3EHTA 3TDJA 5I2NB 3T93B 4NF4B 1IXCA 3F11A 4LZ8A 1FTLA 3I6VA 1YAEA 1A8EA 2A5TB 3QUFA 4OXVA 4YMBA 1IUDA 4YMAA 1BP5A 4QFKA 4F22A 1J1NA 2DVZA 1Y3QA 3QUJA 4PFWA 4U4XA 5KDTB 1VFEA 1Y9UA 4H65A 3T96B 2VGQA 4F1UA 5AA4B 4FECA 5EYFA 1DTZA 1NL5A 4Q5TA 4BLAA 5JK4A 2QJEA 2XXQA 3CIJA 4ZS9A 4QFLA 1B58A 3TCHA 4DIGA 1JVYA 2KLFA 3S9NC 3CI8A 1LFGA 3R6UA 2XXTA 1B6HA 1LFIA 3VXBA 1Y1ZA 3HCQA 4GL0A 4ECFA 2H98A 5JEIA 1AH5A 1N04A 1P1NA 2DS9A 3U8QA 1KWHA 4ZZEA 1D9VA 5LOMA 4QHQA 3H7MA 3P7IA 1Y4CA 2R6GE 2QMWA 3TAJA 4LZ7A 3L6HA 3MWBA 1T0KA 2HXWA 3ZKLA 2XXHA 3MVWA 3FATA 5ITOA 1SYHA 1O63A 4PFYA 1DPPA 1QULA 4KI0E 4YZZA 4MF3A 2OWTA 3K1NA 3I3VA 3Q27A 5H8FB 5HBCA 3FD3A 5I2NA 3OEKA 2E1SA 4M1VA 2V25A 2I49A 4U1OA 4YKPA 4F1YA 3IX1A 5I56A 2O68A 3KN8A 1DOTA 3VFJA 1MXYA 2M8CA 4XXUA 4F3PA 1B32A 1N7XA 3UIFA 4MFIA 3IK6B 2FNCA 1PB8A 3EHUA 3LR1A 1Y4TA 1URGA 4IO4A 4OYVA 3SERA 5DVFA 3UA8A 2HQ0A 5I59B 2E0SA 5L9SA 2NXOA 4U23A 2RF1A 3BKIB 3C36A 1NNKA 4OFOA 3K2DA 1A54A 4GXSB 4OFLA 4KFQA 4ZEKA 1B52A 4KCCA 3KG2A 1SW5A 1MXZA 2P2AA 3LSXA 2HZKA 3TTMA 1FQCA 1LFHA 4X1BA 4TLMB 1UTBB 1BKAA 3CG1A 3EQ1A 2F7BA 1TXFA 2G93A 2I3WA 2XXPA 4O3BA 3VVEA 1PB7A 1B0LA 2V3TA 3EHSA 2OWSA 3OOAA 1B5HA 1SYIA 2OCUA 3FJGA 3ZSFA 5H8FA 4GF8A 2ZMBA 1TFAA 1AOVA 4OZ9A 3PD9A 3PUZE 3TPAA 4U21A 5IKBA 5CC2A 2Y7PA 2F78A 3MUQA 3N94A 4ZZAA 5H8QA 1F9BA 4P0IA 4DXCA 4NF5B 1OLAA 3PPPA 4RK9A 2W7YA 3DP6A 3MQ9A 2CMOA 3E3KA 4EUOA 4F3SA 1USYE 1FW0A 2I0BA 3O6GA 2THIA 5CBRA 1FTKA 2XXYA 4MH5A 3U92A 1MXXA 2V84A 3FVGA 3EN3A 3G3HA 1FTMA 2GHAA 1PC3A 4G68B 1NFTA 1N76A 4R74A 3GZGA 1EH3A 1OVBA 4NF4A 3GBAA 3M8UA 4PP0A 4X1DA 1DTGA 3S9LC 3MBPA 2REGA 4G8HA 4H1XA 2O51A 3TZAA 1QVSA 3SEYA 2DXRA 5K2XA 2V3QA 3HSTA 4JBZA 3O97A 1NKXA 4ZEFA 4ELRA 4F19A 4OFJA 1OQGA 1RKMA 2H25A 4YKKA 5CMMA 3OEMA 2ONKE 1P1UA 5M2VA 5AA4A 2XHDA 2XXUA 2DE3A 2XXRA 2DE2A 2QS4A 4IY6A 2O1LA 5L9MA 3RGYA 1QKBA 1OVTA 4DDDA 1H76A 3K00A 2DOJA 2PVUA 3PPOA 3IAZA 4ISUA 2ZYKA 3GLBA 3MPLA 4HCYA 1N84A 2XXWA 1IXGA 2HFBA 4KPTA 4L17A 3H6WA 4OERA 3TTNA 1ATGA 2VD2A 2VP1A 3BFTA 4R9GA 2VHAA 5KCJA 1FCKA 4E0XA 4P0GA 3T9VA 3MAMA 1JW1A 1S7YA 2F7CA 2H99A 1IEJA 2D3IA 1M5BA 3QSLA 2V93A 4H8JA 4QSCA 4NF5A 3DLNA 1MY2A 5DVJA 2F8DA 4QFNA 4OENA 4GIZA 1II5A 3IOUA 2Y7IA 1B3HA 1O64A 3H06B 4F31B 1Y1MA 5FTHA 4ZECA 3PD8A 1NNTA 2F5XA 1ZJLA 3RT8A 3S9EA 2DWIA 4G2ZA 5DTBA 4H67A 1XS5A 3B6TA 3TUSA 1GV8A 3K1MA 3D4CA 2ZYOA 4R2FA 3UK4A 5BUUA 4EQ9A 3CFXA 2AIXA 1PB9A 2Z8FA 3CRBA 1PEBA 1R9LA 1MRPA 2ABHA 4XKQA 3MP6A 2PT1A 1B05A 2HAVA 5FHMA 3H03A 1DSNA 2DSFA 1JETA 1VE4A 2QS3A 3LSFB 1SI1A 3ZS6A 5CBSA 4IY5A 2DWHA 3W15C 2OBGA 2PBWA 1I6QA 1P1QA 3PGFA 5L8DA 1ZKBA 4OMBA 2NWJA 1LAFE 1MDP1 3K4UA 4F3GA 4ZE9A 1HSLA 4JSOA 2I58A 1P1OA 4RJZA 4MLQA 1B46A 1L5TA 4BDNA 2HZLA 1SW1A 1Z7ME 1MXUA 2QS1A 5CMCA 5EHMA 5FHOA 5DT6A 2RC7A 5TPAB 3VE1B 4TOZA 3VLVA 3KEIA 3IO4A 4Z7EA 5JTYA 1FQFA 4DXBA 4KCDA 1IQ7A 3LC8A 2GHBA 4AQ4A 1LAHE 1DMBA 3OXNA 4HS7A 4RXLA 3PPNA 4U22A 3U93A 4MBPA 4NWCA 3U72A 4EQBA 3G7WA 4GFRA 3TMGA 4F1VA 4F29A 3C9HA 4TLLB 5CMKA 3RPWA 1Q1KA 1SI0A 2Q9TA 3FGSA 4EF1A 4F2QA 1Y3PA 3FXUA 2R9JA 1N3WA 4FAJA 3SEXA 4M4GA 3VVDA 1URDA 3IB1A 3IL1B 1WVJA 3L6GA 3PPQA 3PUVE 2O7UA 4H5GA 4KYDA 3QAXA 3TCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F97 A;  3LBS A;  4IO7 A;  3VLW A;  1SQY A;  1H43 A;  2OLB A;  4FJP A;  4H6D A;  5H8N A;  3K6U A;  4G68 C;  3TKD A;  2VD3 A;  4HTG A;  3A09 A;  2IA4 A;  2RIN A;  4DXU A;  4LAT A;  2RCB A;  1LBB A;  4DLD A;  2XX8 A;  1URS A;  1GVC A;  5I2K B;  3KOS A;  1M5D A;  3KN7 A;  1XVY A;  2DWA A;  1UTH B;  2Q2A A;  3OO9 A;  5EHS A;  1BTJ A;  2ZNS A;  3G3K A;  1XT8 A;  1OIB A;  1IZ1 A;  1D9Y A;  1P99 A;  2DQV A;  1SW2 A;  2UVH A;  1LCF A;  4NF8 B;  5CRY A;  1US4 A;  2OZZ A;  5ELV A;  4FOR A;  2D5W A;  4LQ2 A;  1A7L A;  4LVQ A;  2I4C A;  3HO7 A;  4JSD A;  5H8H B;  1D4N A;  5AA2 D;  3S9M C;  4KQP A;  4GL8 A;  3VDF A;  5TP9 A;  4AB5 A;  1XVX A;  1A8F A;  3SDF A;  1EZ9 A;  4C1T A;  2GRV A;  4ZEI A;  4LP2 B;  4YKJ A;  5KDT A;  3SEW A;  5I2K A;  1IXH A;  3Q25 A;  1FQA A;  1MQD A;  1ZTY A;  2Z23 A;  3C35 A;  3BFU A;  4GRK A;  4EF2 A;  3IB0 A;  2RCA A;  3FVN A;  2ONS A;  5A5X B;  1B3F A;  3TQL A;  5DEX A;  4C0R A;  1EZO A;  2Q88 A;  3ECR A;  2OJT A;  4NED A;  1I6B A;  4ND9 A;  4N6P A;  2O7I A;  2I4B A;  3FUZ A;  3H6U A;  3K6V A;  2YLN A;  1UIV A;  4PET A;  2RC8 A;  1MQJ A;  4F18 A;  5I84 A;  3FV2 A;  3FZV A;  4ELP A;  2F36 A;  1MH3 A;  2QMX A;  3O29 A;  4RYA A;  4K3F A;  2V3U A;  4WXJ A;  3V5A A;  5H8N B;  3OEL A;  5CM6 A;  3RN8 A;  4ZDM A;  4EQ7 A;  3N5L A;  2A5S A;  3OSR A;  2O84 X;  4I9D A;  3TYH A;  2BJJ X;  2DXY A;  2LAO A;  2REJ A;  2XXV A;  5ISU A;  1QJM A;  4ZE8 A;  1CE2 A;  3KFM A;  3O6I A;  1JNF A;  1B1H A;  4IO6 A;  1D3K A;  1LLS A;  1YCJ A;  1Z7N E;  1A40 A;  3AXF A;  3C31 A;  4NTL A;  3KGC A;  4FED A;  4EDP A;  3TEP A;  3RT6 B;  4OES A;  4U1Z A;  2P1S A;  3LSL A;  3C34 A;  4OWD A;  3M3F A;  3WAE A;  5TP9 B;  3KJT A;  1IIT A;  3MPK A;  3OO8 A;  2HAU A;  1POT A;  3O6H A;  4Z0I A;  3OO7 A;  5ICQ A;  1MQH A;  2NOO A;  4OHN A;  4EXL A;  4X48 A;  3FAS A;  2Q89 A;  2X26 A;  3O9P A;  1USY H;  4E0W A;  1MXV A;  1B51 A;  2HEU A;  3LSW A;  4R6Y A;  3IOR A;  3RNN A;  1FQD A;  1GTK A;  2PYY A;  3Q26 A;  4I62 A;  1O7T A;  4RA1 A;  4ELQ A;  1UTB A;  3H3G A;  2FA7 A;  3IOW A;  1ANF A;  1ZMG A;  1MQG A;  2F6G A;  1LB9 A;  2DYX A;  3FV1 A;  3OMB A;  4G8N A;  4QSD A;  1QW0 A;  4XKP A;  2AL4 A;  1GGG A;  4JWY A;  1AL3 A;  4ZED A;  1CB6 A;  3W9V A;  2DP8 A;  3PMV A;  5CI5 A;  1OQH A;  2P0S A;  2RKM A;  3MVY A;  1QKA A;  1M5E A;  4PQJ A;  2XD3 A;  3QK6 A;  4KD5 A;  1ZBM A;  4PFT A;  2ZXT A;  5TU0 A;  2PT2 A;  1VR5 A;  4GLI A;  4U4S A;  1P1W A;  2CZL A;  4LON B;  2X7Q A;  2YJP A;  4MLV A;  5H8H A;  3OEN A;  3TTL A;  2F7A A;  4N13 A;  1OLC A;  4HCW A;  1I6A A;  3T9U A;  3PV0 E;  2ONR A;  3FIR A;  1B0H A;  1NH8 A;  3E4R A;  2HCA A;  5I57 B;  3CR9 A;  1N7W A;  3OO6 A;  3I5O A;  4UAC A;  1M5C A;  3TTK A;  1B9J A;  4YB5 A;  3H4Z A;  4RK2 A;  1JW5 A;  1R9Q A;  1UQW A;  2H5Y A;  3QXM A;  4XTC Q;  1B7H A;  3VVF A;  1H45 A;  3IB2 A;  2GFE A;  4JWX A;  4YU0 A;  4IO3 A;  3C4M A;  1QUI A;  1MY3 A;  1ZIU A;  5H8S A;  2ZNT A;  4FIM A;  4IGR A;  3B7D A;  2ZNU A;  3DM0 A;  3MVZ A;  3MZB A;  3KOT A;  3ODB A;  3HHF A;  3PMX A;  1JEU A;  3TQW A;  3UOR A;  5ICT A;  4BDO A;  3LUY A;  1FQE A;  3KN3 A;  3D4G A;  3IJO B;  4N07 A;  2NVU B;  5JTY B;  5KCJ B;  2I0C A;  2Y84 A;  4JXI A;  1A55 A;  3N6U A;  4F3B A;  2I48 A;  2UVJ A;  3MC2 A;  3S4U A;  5I58 A;  3RUM A;  5J1D A;  4KHZ E;  3FXQ A;  2FYI A;  4WKM A;  1FQB A;  3FJ7 A;  2XX7 A;  4GOT A;  4GQO A;  4LZ5 A;  3KJ7 A;  1MDQ A;  1B7Z A;  2B3B A;  2ZYN A;  3R26 A;  1PBQ A;  4KYE A;  5KZT A;  2Q8J A;  4G4P A;  2I6E A;  2IEE A;  3CSG A;  1LAX A;  4H5F A;  4OET A;  3SES A;  5AA3 A;  4OEU A;  4Q0C A;  4F39 A;  3JV9 A;  3O2A A;  1NH7 A;  3PUW E;  4ESX A;  3ILU B;  1B3G A;  3IOV A;  3PMW A;  3K0V A;  4OEV A;  2XX9 A;  4C1U A;  1WDN A;  1MM6 A;  1YPN A;  3RY3 A;  4YB7 A;  3MVX A;  5I57 A;  1ELJ A;  3KBR A;  4BDQ A;  3N26 A;  4GVO A;  4OQO A;  3B6Q A;  2G29 A;  4O3A A;  1ZLQ A;  4RPO A;  5CMB A;  2Z8E A;  4H0W A;  4P11 A;  3QIM A;  4U2R A;  2UVG A;  2R71 A;  3CSB A;  3UGW A;  1H3D A;  3R7X A;  4YKI A;  4Q8R A;  3CFZ A;  3O66 A;  2H9B A;  3MP1 A;  4YAH X;  2ANJ A;  3RQT A;  4WED A;  4IB2 A;  4TQU Q;  3TTR A;  2DVC A;  1UTH A;  5K2Y A;  4YB6 A;  5AA2 A;  1QUJ A;  3G3J A;  5B7D A;  1H44 A;  2AL5 A;  3G3I A;  3K1P A;  1S50 A;  4NWD A;  3RTW B;  4HW8 A;  1JW4 A;  5TPA A;  5H8Q B;  1VSO A;  1MQI A;  1LCT A;  3E9X A;  2XXI A;  1LBC A;  1GR2 A;  1MG1 A;  3MZ1 A;  4LA9 A;  3T66 A;  3V8X B;  1NNP A;  4AB6 A;  3FVO A;  1HSE A;  1EU8 A;  5B70 A;  3BBR A;  1LAG E;  4NF6 A;  4PFU A;  2QL3 A;  1SW4 A;  2VOZ A;  3HPI A;  1SVX B;  1RYX A;  4JB7 A;  2O1M A;  4KR5 A;  4O3C A;  5F1Q A;  3IOT A;  3Q29 A;  2PX1 A;  3GXA A;  3PPR A;  1MH4 A;  2QPQ A;  1B40 A;  1JQF A;  1MPC A;  1R6Z A;  3EF7 A;  1M5F A;  1MPB A;  1MS7 A;  3ILT B;  3K01 A;  3PUY E;  2Y7K A;  3V83 A;  4H8I A;  4R2B A;  1TWY A;  1JEV A;  2F6P A;  4JWO A;  4G8M A;  4EXK A;  3QYT A;  3ZKK A;  2Z8D A;  3TCF A;  2ESN A;  3S2V A;  5AA2 B;  1PBP A;  2O6A A;  3OSQ A;  3USD A;  4DZ1 A;  5L9O A;  1AIV A;  4IO5 A;  3SEV A;  2Y7W A;  4BDL A;  2DE4 A;  1NNF A;  3HV1 A;  3FXR A;  4IGT A;  1BIY A;  1TT1 A;  2QSX A;  5IAI A;  2GH9 A;  4Q30 B;  1MY4 A;  2RC9 A;  5FHN A;  1EZP A;  4WEP A;  4XIG Q;  1SBP A;  2X7P A;  3DEL B;  1SDX A;  3GBB A;  3VXC A;  1AMF A;  3THI A;  3IJX B;  2F35 A;  4FE8 A;  4LQ5 A;  4IO2 A;  3MZ9 A;  4YIC A;  1B3E A;  4NF8 A;  4ONY A;  4R73 A;  3SEU A;  3SKP A;  4RNS A;  4QF9 A;  3A3U A;  2AYS A;  1PDA A;  4JDF A;  3FJM A;  3E13 X;  3H6V A;  1B5J A;  3JYR A;  1XOC A;  4G77 A;  3U1O A;  4NMY A;  1IIW A;  3ONM A;  1FTJ A;  3U94 A;  1B1X A;  1SD3 A;  5HM4 B;  4G68 A;  4NF6 B;  3RTF B;  4RPN A;  4DCX A;  1B5I A;  1I69 A;  4R75 A;  5ITP A;  2D21 A;  1N0T A;  4KYS A;  1N3X A;  4R6H A;  3MJN A;  4XKN A;  3N6T A;  3CG3 A;  4XKR A;  5HPQ A;  5DEX B;  3TOD A;  4GD5 A;  4F2O A;  1MY1 A;  1Y3N A;  1Y20 A;  5BWJ A;  1LGB C;  2NUV A;  4OVJ A;  1VFD A;  2PMS A;  4ZEB A;  3TEL A;  4QRZ A;  3KSX A;  1YTV A;  1US5 A;  4LUB A;  1ZU0 A;  4UA8 A;  2DWJ A;  2B3F A;  3WAF A;  5A5X A;  1NMU A;  2UXA A;  3MP8 A;  3H6T A;  3Q28 A;  4QFP A;  1B3L A;  1XC1 A;  4QSE A;  3K02 A;  1DPE A;  1XHY A;  2WKY A;  3DP8 A;  1WOD A;  3IO6 A;  1OMP A;  3IR1 A;  4FAT A;  3EPE A;  1LST A;  1B7U A;  2A5T A;  1JVX A;  4NE4 A;  3T9H B;  3KSJ A;  5DVI A;  3UN6 A;  2YPN A;  3UP9 A;  1IXI A;  1MM7 A;  4POX A;  4R6K A;  3W9W A;  5I59 A;  2OK2 A;  2UYE A;  1B2H A;  1S9T A;  2H4I A;  3CVG A;  3MW0 A;  4GXA A;  3FVK A;  5DYH A;  5F7V A;  5FTI A;  3TFL A;  2UVI A;  5AA1 A;  1UIU A;  2B65 A;  2O69 A;  3JZJ A;  1BLF A;  3PU5 A;  1RYO A;  2Y7R A;  3K6X A;  4PE5 B;  3KZG A;  4RY1 A;  1B4Z A;  2UYF A;  3T22 A;  1LB8 A;  1FTO A;  1MY0 A;  3O28 A;  4X9T A;  3C33 A;  1R1N A;  4QFO A;  2I3V A;  1B4H A;  4DCY A;  1A99 A;  2XD2 A;  5AE4 A;  1HSJ A;  3B6W A;  3M3K A;  4R9F A;  4ELO A;  2QS2 A;  3VLU A;  2QRY A;  4I8C A;  5I56 B;  2ALU A;  4THI A;  3SET A;  2ZYM A;  3V89 B;  1POY 1;  3C32 A;  5I58 B;  4R72 A;  2Q2C A;  1TFD A;  2XXX A;  4I1D A;  3CFL A;  4GWO A;  4BDM A;  3M3L A;  3PUX E;  3HHG A;  4POW A;  3VV5 A;  4FEB A;  3RLF E;  1MPD A;  2Z22 A;  3G3F A;  3T9X B;  4DE8 A;  3A3C A;  1Q35 A;  3HN0 A;  4ESW A;  2F34 A;  3DP4 A;  1MXW A;  4BDR A;  3G3G A;  3K6W A;  4OTE A;  3OD7 A;  1QUK A;  3EHT A;  3TDJ A;  5I2N B;  3T93 B;  4NF4 B;  1IXC A;  3F11 A;  4LZ8 A;  1FTL A;  3I6V A;  1YAE A;  1A8E A;  2A5T B;  3QUF A;  4OXV A;  4YMB A;  1IUD A;  4YMA A;  1BP5 A;  4QFK A;  4F22 A;  1J1N A;  2DVZ A;  1Y3Q A;  3QUJ A;  4PFW A;  4U4X A;  5KDT B;  1VFE A;  1Y9U A;  4H65 A;  3T96 B;  2VGQ A;  4F1U A;  5AA4 B;  4FEC A;  5EYF A;  1DTZ A;  1NL5 A;  4Q5T A;  4BLA A;  5JK4 A;  2QJE A;  2XXQ A;  3CIJ A;  4ZS9 A;  4QFL A;  1B58 A;  3TCH A;  4DIG A;  1JVY A;  2KLF A;  3S9N C;  3CI8 A;  1LFG A;  3R6U A;  2XXT A;  1B6H A;  1LFI A;  3VXB A;  1Y1Z A;  3HCQ A;  4GL0 A;  4ECF A;  2H98 A;  5JEI A;  1AH5 A;  1N04 A;  1P1N A;  2DS9 A;  3U8Q A;  1KWH A;  4ZZE A;  1D9V A;  5LOM A;  4QHQ A;  3H7M A;  3P7I A;  1Y4C A;  2R6G E;  2QMW A;  3TAJ A;  4LZ7 A;  3L6H A;  3MWB A;  1T0K A;  2HXW A;  3ZKL A;  2XXH A;  3MVW A;  3FAT A;  5ITO A;  1SYH A;  1O63 A;  4PFY A;  1DPP A;  1QUL A;  4KI0 E;  4YZZ A;  4MF3 A;  2OWT A;  3K1N A;  3I3V A;  3Q27 A;  5H8F B;  5HBC A;  3FD3 A;  5I2N A;  3OEK A;  2E1S A;  4M1V A;  2V25 A;  2I49 A;  4U1O A;  4YKP A;  4F1Y A;  3IX1 A;  5I56 A;  2O68 A;  3KN8 A;  1DOT A;  3VFJ A;  1MXY A;  2M8C A;  4XXU A;  4F3P A;  1B32 A;  1N7X A;  3UIF A;  4MFI A;  3IK6 B;  2FNC A;  1PB8 A;  3EHU A;  3LR1 A;  1Y4T A;  1URG A;  4IO4 A;  4OYV A;  3SER A;  5DVF A;  3UA8 A;  2HQ0 A;  5I59 B;  2E0S A;  5L9S A;  2NXO A;  4U23 A;  2RF1 A;  3BKI B;  3C36 A;  1NNK A;  4OFO A;  3K2D A;  1A54 A;  4GXS B;  4OFL A;  4KFQ A;  4ZEK A;  1B52 A;  4KCC A;  3KG2 A;  1SW5 A;  1MXZ A;  2P2A A;  3LSX A;  2HZK A;  3TTM A;  1FQC A;  1LFH A;  4X1B A;  4TLM B;  1UTB B;  1BKA A;  3CG1 A;  3EQ1 A;  2F7B A;  1TXF A;  2G93 A;  2I3W A;  2XXP A;  4O3B A;  3VVE A;  1PB7 A;  1B0L A;  2V3T A;  3EHS A;  2OWS A;  3OOA A;  1B5H A;  1SYI A;  2OCU A;  3FJG A;  3ZSF A;  5H8F A;  4GF8 A;  2ZMB A;  1TFA A;  1AOV A;  4OZ9 A;  3PD9 A;  3PUZ E;  3TPA A;  4U21 A;  5IKB A;  5CC2 A;  2Y7P A;  2F78 A;  3MUQ A;  3N94 A;  4ZZA A;  5H8Q A;  1F9B A;  4P0I A;  4DXC A;  4NF5 B;  1OLA A;  3PPP A;  4RK9 A;  2W7Y A;  3DP6 A;  3MQ9 A;  2CMO A;  3E3K A;  4EUO A;  4F3S A;  1USY E;  1FW0 A;  2I0B A;  3O6G A;  2THI A;  5CBR A;  1FTK A;  2XXY A;  4MH5 A;  3U92 A;  1MXX A;  2V84 A;  3FVG A;  3EN3 A;  3G3H A;  1FTM A;  2GHA A;  1PC3 A;  4G68 B;  1NFT A;  1N76 A;  4R74 A;  3GZG A;  1EH3 A;  1OVB A;  4NF4 A;  3GBA A;  3M8U A;  4PP0 A;  4X1D A;  1DTG A;  3S9L C;  3MBP A;  2REG A;  4G8H A;  4H1X A;  2O51 A;  3TZA A;  1QVS A;  3SEY A;  2DXR A;  5K2X A;  2V3Q A;  3HST A;  4JBZ A;  3O97 A;  1NKX A;  4ZEF A;  4ELR A;  4F19 A;  4OFJ A;  1OQG A;  1RKM A;  2H25 A;  4YKK A;  5CMM A;  3OEM A;  2ONK E;  1P1U A;  5M2V A;  5AA4 A;  2XHD A;  2XXU A;  2DE3 A;  2XXR A;  2DE2 A;  2QS4 A;  4IY6 A;  2O1L A;  5L9M A;  3RGY A;  1QKB A;  1OVT A;  4DDD A;  1H76 A;  3K00 A;  2DOJ A;  2PVU A;  3PPO A;  3IAZ A;  4ISU A;  2ZYK A;  3GLB A;  3MPL A;  4HCY A;  1N84 A;  2XXW A;  1IXG A;  2HFB A;  4KPT A;  4L17 A;  3H6W A;  4OER A;  3TTN A;  1ATG A;  2VD2 A;  2VP1 A;  3BFT A;  4R9G A;  2VHA A;  5KCJ A;  1FCK A;  4E0X A;  4P0G A;  3T9V A;  3MAM A;  1JW1 A;  1S7Y A;  2F7C A;  2H99 A;  1IEJ A;  2D3I A;  1M5B A;  3QSL A;  2V93 A;  4H8J A;  4QSC A;  4NF5 A;  3DLN A;  1MY2 A;  5DVJ A;  2F8D A;  4QFN A;  4OEN A;  4GIZ A;  1II5 A;  3IOU A;  2Y7I A;  1B3H A;  1O64 A;  3H06 B;  4F31 B;  1Y1M A;  5FTH A;  4ZEC A;  3PD8 A;  1NNT A;  2F5X A;  1ZJL A;  3RT8 A;  3S9E A;  2DWI A;  4G2Z A;  5DTB A;  4H67 A;  1XS5 A;  3B6T A;  3TUS A;  1GV8 A;  3K1M A;  3D4C A;  2ZYO A;  4R2F A;  3UK4 A;  5BUU A;  4EQ9 A;  3CFX A;  2AIX A;  1PB9 A;  2Z8F A;  3CRB A;  1PEB A;  1R9L A;  1MRP A;  2ABH A;  4XKQ A;  3MP6 A;  2PT1 A;  1B05 A;  2HAV A;  5FHM A;  3H03 A;  1DSN A;  2DSF A;  1JET A;  1VE4 A;  2QS3 A;  3LSF B;  1SI1 A;  3ZS6 A;  5CBS A;  4IY5 A;  2DWH A;  3W15 C;  2OBG A;  2PBW A;  1I6Q A;  1P1Q A;  3PGF A;  5L8D A;  1ZKB A;  4OMB A;  2NWJ A;  1LAF E;  1MDP 1;  3K4U A;  4F3G A;  4ZE9 A;  1HSL A;  4JSO A;  2I58 A;  1P1O A;  4RJZ A;  4MLQ A;  1B46 A;  1L5T A;  4BDN A;  2HZL A;  1SW1 A;  1Z7M E;  1MXU A;  2QS1 A;  5CMC A;  5EHM A;  5FHO A;  5DT6 A;  2RC7 A;  5TPA B;  3VE1 B;  4TOZ A;  3VLV A;  3KEI A;  3IO4 A;  4Z7E A;  5JTY A;  1FQF A;  4DXB A;  4KCD A;  1IQ7 A;  3LC8 A;  2GHB A;  4AQ4 A;  1LAH E;  1DMB A;  3OXN A;  4HS7 A;  4RXL A;  3PPN A;  4U22 A;  3U93 A;  4MBP A;  4NWC A;  3U72 A;  4EQB A;  3G7W A;  4GFR A;  3TMG A;  4F1V A;  4F29 A;  3C9H A;  4TLL B;  5CMK A;  3RPW A;  1Q1K A;  1SI0 A;  2Q9T A;  3FGS A;  4EF1 A;  4F2Q A;  1Y3P A;  3FXU A;  2R9J A;  1N3W A;  4FAJ A;  3SEX A;  4M4G A;  3VVD A;  1URD A;  3IB1 A;  3IL1 B;  1WVJ A;  3L6G A;  3PPQ A;  3PUV E;  2O7U A;  4H5G A;  4KYD A;  3QAX A;  3TCG A; 
#chains in the Genus database with same CATH topology
 1CNQ A;  2OLB A;  4FJP A;  5H8N A;  3TKD A;  2RIN A;  3QMF A;  3KN7 A;  5EHS A;  1UTH B;  1D9Y A;  4JSD A;  3E78 A;  5H8H B;  5TP9 A;  1XVX A;  1A8F A;  3SDF A;  4LP2 B;  4PF6 A;  5KDT A;  3MYU A;  3Q25 A;  1FQA A;  4GRK A;  3BFU A;  3FVN A;  2Y5L A;  1EZO A;  5DEX A;  4C0R A;  3SEY A;  4N6P A;  2O7I A;  2YLN A;  1YXI A;  2ZZX A;  3FZV A;  2F36 A;  5H8N B;  2V3U A;  3OEL A;  3RN8 A;  4EQ7 A;  5DW8 A;  4ZE8 A;  3O6I A;  1FBP A;  1D3K A;  4OVS A;  3RT6 B;  2P1S A;  3C34 A;  3KJT A;  3OO7 A;  3FAS A;  2X26 A;  4DI4 B;  2HEU A;  5EQ9 A;  3Q26 A;  1ZMG A;  2DYX A;  3FV1 A;  4XKP A;  1GGG A;  1CB6 A;  3W9V A;  2DP8 A;  5CI5 A;  2VPO A;  1QKA A;  1M5E A;  2XD3 A;  3QK6 A;  5TU0 A;  1ZBM A;  2ZXT A;  4U4S A;  4I3Y A;  4MLV A;  4N13 A;  1OLC A;  2HCA A;  5I57 B;  1R9Q A;  3VVF A;  2F3B A;  4JWX A;  4YU0 A;  4IO3 A;  1MY3 A;  3ODB A;  3UOR A;  4N07 A;  3N6U A;  5I58 A;  3S4U A;  4N81 A;  2FYI A;  1FPI A;  4P9K A;  1MDQ A;  2B3B A;  2ZYN A;  4KYE A;  2FBP A;  2IEE A;  1RDY A;  3IFA A;  4Q0C A;  3O2A A;  3ILU B;  1KA0 A;  4OEV A;  4C1U A;  1MM6 A;  4YB7 A;  3MVX A;  4MHF A;  4BDQ A;  4GVO A;  2G29 A;  4RPO A;  4U2R A;  3R7X A;  1NUY A;  4WED A;  4IB2 A;  3RQT A;  3TTR A;  2WBB A;  4YB6 A;  4GWW A;  4PE3 A;  3RPL B;  4AB6 A;  3FVO A;  4KR5 A;  1NI9 A;  1SW4 A;  2QL3 A;  1SVX B;  3HPI A;  3IOT A;  3Q29 A;  1LBY A;  3PUY E;  2P3V A;  2Y7K A;  4R2B A;  4EXK A;  2F6P A;  2Z8D A;  3TCF A;  2ESN A;  1EYK A;  1PBP A;  2PFY A;  5L9O A;  5I5P A;  1KZ8 A;  4IGT A;  1TT1 A;  2GH9 A;  5FHN A;  1SDX A;  1AMF A;  5J16 A;  4MX6 A;  1FBF A;  3H6V A;  2KR0 A;  1XOC A;  4G77 A;  3ONM A;  4NN3 A;  4NF6 B;  5ITP A;  4KYS A;  4XKR A;  3TOD A;  2F3D A;  1Y20 A;  1LGB C;  1VFD A;  4QRZ A;  1FSA A;  5A5X A;  3H6T A;  3IR1 A;  4N8G A;  5A5L A;  4NE4 A;  1JP4 A;  4POX A;  5I59 A;  1FPG A;  1S9T A;  3TEP A;  3TFL A;  1UIU A;  2B65 A;  1BLF A;  2Y7R A;  5AA3 A;  1B4Z A;  2UYF A;  1LB8 A;  1MY0 A;  4QFO A;  2I3V A;  4DCY A;  4PBH A;  3B6W A;  4ELO A;  3VLU A;  2B4M A;  2ALU A;  3V89 B;  1FRP A;  4BDM A;  3PUX E;  4POW A;  4FEB A;  2Z22 A;  4BDR A;  2Q8M A;  3EHT A;  1IUD A;  4F22 A;  3QUJ A;  1Y3Q A;  4H65 A;  1NUX A;  2QJE A;  2XXQ A;  3CIJ A;  3PTY A;  4DIG A;  2KLF A;  5IZ1 A;  1Y1Z A;  4ECF A;  2H98 A;  4HE1 A;  1KWH A;  4ZZE A;  1D9V A;  5LOM A;  4QHQ A;  3H7M A;  3TAJ A;  4LZ7 A;  3L6H A;  1T0K A;  3ZKL A;  4PFR A;  1QUL A;  4MF3 A;  3EKI A;  5HBC A;  3FD3 A;  4YKP A;  1D9Q A;  2O68 A;  1DOT A;  2V4C A;  3UIF A;  4MFI A;  1PB8 A;  3EHU A;  2HQ0 A;  5I59 B;  3BKI B;  3C36 A;  4OFO A;  3K2D A;  1A54 A;  4GXS B;  4ZEK A;  1B52 A;  2P2A A;  1MXZ A;  1FQC A;  2I3W A;  2XXP A;  1IMB A;  3EHS A;  2OWS A;  3OOA A;  1B5H A;  2OCU A;  3ZSF A;  5H8F A;  4GF8 A;  1TFA A;  2B4L A;  3PD9 A;  4U21 A;  4ZZA A;  5H8Q A;  3PPP A;  2W7Y A;  2XWV A;  2CMO A;  4F3S A;  5CBR A;  3U92 A;  1MXX A;  4G68 B;  1FTM A;  4OAN A;  1EH3 A;  2O51 A;  5K2X A;  2V3Q A;  4JBZ A;  3O97 A;  4ZEF A;  5AA4 A;  1RKM A;  2VPN A;  4DDD A;  1OVT A;  1IXG A;  4KPT A;  4O94 A;  3TTN A;  2VP1 A;  3MAM A;  1II5 A;  1O64 A;  3H06 B;  4F31 B;  3RT8 A;  1NNT A;  1ZJL A;  2DWI A;  3K1M A;  2ZYO A;  2AIX A;  1PB9 A;  1YYZ A;  1PEB A;  4O8M A;  4H45 A;  1VE4 A;  1SI1 A;  4GX6 A;  4UAB A;  4OMB A;  1LAF E;  2HHM A;  1HSL A;  1B46 A;  2QS1 A;  1MXU A;  3VE1 B;  5DT6 A;  2QVR A;  3KEI A;  3IO4 A;  1FQF A;  2GHB A;  4HS7 A;  4RXL A;  3U72 A;  4GFR A;  5CMK A;  1Q1K A;  4QXD A;  2WYK A;  4NG7 A;  3SEX A;  4KYD A;  2O7U A;  3QAX A;  3TCG A;  2F97 A;  3LBS A;  4IO7 A;  4PAF A;  4P1E A;  2VD3 A;  4HTG A;  4DXU A;  1LBB A;  4DLD A;  1URS A;  5I2K B;  3OO9 A;  1BTJ A;  1P99 A;  2DQV A;  2OZZ A;  3D1R A;  4GL8 A;  4AB5 A;  1IXH A;  1ZTY A;  1FBD A;  1NV0 A;  4EF2 A;  2RCA A;  5A5X B;  2Q88 A;  4P47 A;  3ECR A;  4Q8R A;  4ND9 A;  1IMD A;  3H6U A;  3K6V A;  4PET A;  5I84 A;  2QMX A;  3O29 A;  4GX4 A;  3OSR A;  2VT5 A;  2BJJ X;  2DXY A;  5ISU A;  1QJM A;  3AXF A;  5EQ7 A;  1Z7N E;  1A40 A;  3KGC A;  4OES A;  3M3F A;  2QVV A;  3MPK A;  1MQH A;  4X48 A;  2Q89 A;  4E0W A;  1FQD A;  1GTK A;  4I62 A;  2OWZ A;  4RA1 A;  3H3G A;  3IOW A;  1MQG A;  1YZ0 A;  2P0S A;  4PQJ A;  4KD5 A;  4JVC A;  2CZL A;  4LON B;  4HCW A;  2ZZV A;  3CR9 A;  1N7W A;  3OO6 A;  3QXM A;  1UQW A;  4XTC Q;  2CZK A;  4IGR A;  4FIM A;  3B7D A;  2ZNU A;  3MZB A;  3TQW A;  1JEU A;  1FQE A;  3KN3 A;  3IJO B;  2I0C A;  1A55 A;  5J1D A;  4KHZ E;  4WKM A;  3E79 A;  4GQO A;  2XX7 A;  4GOT A;  3R26 A;  4G4P A;  3CSG A;  1LAX A;  4H5F A;  5FBP A;  3SES A;  4OEU A;  4F39 A;  3JV9 A;  1B3G A;  1WDN A;  4XEQ A;  4NF0 A;  3N26 A;  2XWI A;  1ZLQ A;  4PDH A;  2Z8E A;  4MAG A;  4H0W A;  2UVG A;  4HXV A;  3CFZ A;  1DBZ A;  1UTH A;  5K2Y A;  1QUJ A;  1H44 A;  2AL5 A;  4HW8 A;  5TPA A;  5H8Q B;  1MQI A;  4OVQ A;  4PGP A;  2XXI A;  1LBC A;  1GR2 A;  1MG1 A;  1EU8 A;  5B70 A;  2VOZ A;  1RYX A;  2O1M A;  3GXA A;  1MH4 A;  3EF7 A;  1R6Z A;  3V83 A;  1TWY A;  5IZZ A;  3USD A;  1AIV A;  2Q74 A;  5EYH A;  3SEV A;  2Y7W A;  1NNF A;  3HV1 A;  5IAI A;  4XIG Q;  3DEL B;  3VXC A;  5FTI A;  4IO2 A;  1B3E A;  4R73 A;  1IMF A;  4QF9 A;  2AYS A;  1PDA A;  1FPF A;  3RYD A;  2XXK A;  1NV3 A;  4NMY A;  3U94 A;  1VDW A;  1LBW A;  4G68 A;  1I69 A;  3MJN A;  4XKN A;  3N6T A;  1NV7 A;  3ROJ A;  3A29 A;  1YTV A;  1ZU0 A;  3WAF A;  2B3F A;  4FBP A;  2UXA A;  4QFP A;  1XHY A;  1OMP A;  3EPE A;  3LV0 A;  5EQ8 A;  1JVX A;  3T9H B;  3KSJ A;  5DVI A;  4KXP A;  2YPN A;  3UP9 A;  1IXI A;  3MW0 A;  5DYH A;  3FVK A;  2XA5 A;  3KZG A;  4PE5 B;  3T22 A;  3O28 A;  1FTO A;  3C33 A;  1R1N A;  2XD2 A;  1HSJ A;  3M3K A;  2CZH A;  4I8C A;  5I58 B;  3CFL A;  3VV5 A;  3T9X B;  1Q35 A;  2F34 A;  1MXW A;  3G3G A;  3OD7 A;  5I2N B;  4MIJ A;  1IXC A;  4LZ8 A;  1YAE A;  2A5T B;  4PFW A;  4GWY A;  1NV2 A;  1FJ9 A;  5EYF A;  2WBD A;  2GQ1 A;  4PFI A;  1NV5 A;  3TCH A;  1B58 A;  1JVY A;  1QGX A;  3CI8 A;  1B6H A;  1LFI A;  1FBE A;  4GL0 A;  4PAK A;  1AH5 A;  3P7I A;  1Y4C A;  2R6G E;  5ITO A;  4PFY A;  1O63 A;  1DPP A;  4YZZ A;  2OWT A;  2DDK A;  3Q27 A;  5I2N A;  3OEK A;  2I49 A;  5I56 A;  4P3L A;  1MXY A;  4XXU A;  4F3P A;  1B32 A;  2FNC A;  3SER A;  3LR1 A;  4OYV A;  1URG A;  5DVF A;  4I3E A;  2E0S A;  2NXO A;  4U23 A;  4X1B A;  4TLM B;  3CG1 A;  2F7B A;  3VVE A;  2ZMB A;  4OZ9 A;  2F78 A;  1F9B A;  4OVT A;  3DP6 A;  1USY E;  1FW0 A;  2I0B A;  3O6G A;  2THI A;  5ET7 A;  4MH5 A;  4NF6 A;  3G3H A;  3FVG A;  4GWS A;  2GHA A;  3GZG A;  4NF4 A;  1G0I A;  4H1X A;  3HST A;  1NKX A;  2ZZW A;  4F19 A;  4YKK A;  3OEM A;  2ONK E;  2XXU A;  5L9M A;  2DE2 A;  2QS4 A;  3RGY A;  5ET6 A;  2PVU A;  3IAZ A;  4ISU A;  3GLB A;  4HCY A;  2HFB A;  3H6W A;  1ATG A;  1FCK A;  3T9V A;  3QSL A;  4X04 A;  1MY2 A;  2Y7I A;  2FIE A;  4MNC A;  5FTH A;  3PD8 A;  4XFE A;  2F5X A;  5IZ3 B;  4H67 A;  3B6T A;  5IM2 A;  3D4C A;  4R2F A;  3CRB A;  5B7D A;  2ABH A;  3H03 A;  2QS3 A;  5CBS A;  3ZS6 A;  1EYJ A;  1I6Q A;  4GWZ A;  1P1Q A;  4MMP A;  4NQ8 A;  2NWJ A;  4ZE9 A;  4MLQ A;  4BDN A;  2HZL A;  1Z7M E;  5EHM A;  5TPA B;  4AQ4 A;  1LAH E;  3OXN A;  5IKB A;  4MBP A;  4NWC A;  4EQB A;  1FPD A;  3RPW A;  1SI0 A;  3FGS A;  1Y3P A;  2R9J A;  1N3W A;  4OA4 A;  4MEV A;  1URD A;  3IL1 B;  3L6G A;  4GWX A;  1SQY A;  4N17 A;  3K6U A;  4P56 A;  4N4U A;  3A09 A;  2RCB A;  3KOS A;  4PAI A;  2DWA A;  2Q2A A;  1XT8 A;  1SW2 A;  2MKZ A;  4NF8 B;  5CRY A;  4FOR A;  2D5W A;  5AA2 D;  3S9M C;  4KQP A;  3VDF A;  1FPL A;  4C1T A;  4ZEI A;  1AWB A;  3SEW A;  1MQD A;  1B3F A;  3TQL A;  2OJT A;  4G61 A;  1RDZ A;  1UIV A;  2RC8 A;  1MQJ A;  4MCO A;  3FV2 A;  1MH3 A;  1IMA A;  4RYA A;  5CM6 A;  4ZDM A;  2A5S A;  2O84 X;  4I9D A;  2REJ A;  2LAO A;  2XXV A;  1CE2 A;  1NV4 A;  1B1H A;  4IO6 A;  4NTL A;  1LLS A;  1YCJ A;  4EDP A;  4FED A;  4U1Z A;  5TP9 B;  1NV6 A;  4X8R A;  4OHN A;  3O9P A;  1USY H;  2HXR A;  3NOH A;  1B51 A;  3LSW A;  4R6Y A;  3RNN A;  2PYY A;  1O7T A;  4ELQ A;  3OMB A;  1ANF A;  4QSD A;  2F6G A;  1QW0 A;  4ZED A;  3PMV A;  5ET5 A;  3MVY A;  4PFT A;  2PT2 A;  1P1W A;  5H8H A;  2X7Q A;  2YJP A;  3TTL A;  3OEN A;  2F7A A;  5IGA A;  3T9U A;  2ONR A;  2XWK A;  1NH8 A;  3E4R A;  4UAC A;  3I5O A;  3TTK A;  1B9J A;  4YB5 A;  2H5Y A;  1B7H A;  1H45 A;  3C4M A;  1QUI A;  2ZNT A;  3U65 A;  3LUY A;  2NVU B;  5KCJ B;  4JXI A;  2Y84 A;  2I48 A;  1FQB A;  3FJ7 A;  2Q8J A;  4OET A;  4PDD A;  1NH7 A;  3PUW E;  4ESX A;  2XX9 A;  1YPN A;  3RY3 A;  5I57 A;  2P3N A;  4OQO A;  4O3A A;  5CMB A;  1XI6 A;  4P11 A;  2R71 A;  3CSB A;  1H3D A;  4YKI A;  2ANJ A;  1IMC A;  2DVC A;  4XF5 A;  3G3I A;  4NX1 A;  4NWD A;  4MNP A;  1RDX A;  1VSO A;  5EQA A;  1LCT A;  3E9X A;  4O7M A;  3MZ1 A;  3V8X B;  1NNP A;  1IME A;  1HSE A;  1LAG E;  1BK4 A;  4JB7 A;  4PGN A;  4O3C A;  1DK4 A;  3PPR A;  1B40 A;  1JQF A;  3ILT B;  1M5F A;  1MPB A;  1MS7 A;  4H8I A;  4G8M A;  3QYT A;  5AA2 B;  2O6A A;  4IO5 A;  4BDL A;  3FXR A;  1BIY A;  2QSX A;  1LBV A;  1MY4 A;  2RC9 A;  4WEP A;  1SBP A;  3GBB A;  4GX3 A;  3IJX B;  4LQ5 A;  4YIC A;  3SKP A;  3MZ9 A;  2QFL A;  4JDF A;  3FJM A;  3E13 X;  5T3J A;  3U1O A;  1B1X A;  1SD3 A;  5IZ3 A;  5HM4 B;  3RTF B;  1B5I A;  2D21 A;  2WYP A;  1N0T A;  4GD5 A;  4F2O A;  3BIG A;  3T1B A;  2NUV A;  4OVJ A;  3TEL A;  3KSX A;  4LUB A;  4UA8 A;  3Q28 A;  1XC1 A;  4QSE A;  3K02 A;  1DPE A;  2WKY A;  3IO6 A;  4FAT A;  1LST A;  1B7U A;  1Q9D A;  4PBQ A;  2UYE A;  1B2H A;  2H4I A;  3CVG A;  4GXA A;  5F7V A;  2UVI A;  2O69 A;  3JZJ A;  3PU5 A;  4RY1 A;  1B4H A;  1A99 A;  1K9Y A;  2QS2 A;  4THI A;  3SET A;  4R72 A;  2Q2C A;  1FBC A;  1TFD A;  4GWO A;  3RLF E;  3A3C A;  1DCU A;  4OTE A;  1QUK A;  3TDJ A;  4IR8 A;  4YMB A;  1BP5 A;  1J1N A;  5KDT B;  1VFE A;  3T96 B;  5AA4 B;  1G0H A;  4Q5T A;  2FHY A;  4N91 A;  4ZS9 A;  3R6U A;  3IFC A;  2WX9 A;  5JEI A;  1N04 A;  3KBZ A;  2QMW A;  2HXW A;  3MVW A;  1SYH A;  4PCD A;  2QVU A;  3K1N A;  4M1V A;  2E1S A;  4F1Y A;  3IX1 A;  3KN8 A;  3VFJ A;  2M8C A;  1N7X A;  4IO4 A;  2RF1 A;  1NNK A;  2HZK A;  3TTM A;  3EQ1 A;  1TXF A;  2KQZ A;  1B0L A;  2V3T A;  3FJG A;  4HE2 A;  3TPA A;  3PUZ E;  5CC2 A;  3N94 A;  3MUQ A;  4P0I A;  4DXC A;  4NF5 B;  1OLA A;  3GYY A;  3MQ9 A;  4NAP A;  3E3K A;  4EUO A;  2XXY A;  2V84 A;  3EN3 A;  1N76 A;  4R74 A;  5LDZ A;  1OVB A;  3GBA A;  4X1D A;  3S9L C;  2REG A;  3TZA A;  2DXR A;  4ELR A;  4OFJ A;  1OQG A;  2H25 A;  5M2V A;  1P1U A;  2XXR A;  1QKB A;  1H76 A;  2DOJ A;  2ZYK A;  3MPL A;  1N84 A;  2XXW A;  4L17 A;  4R9G A;  2VHA A;  5KCJ A;  4E0X A;  2D3I A;  1M5B A;  2V93 A;  1INP A;  4NF5 A;  2F8D A;  4QFN A;  4HE0 A;  3IOU A;  1B3H A;  2JJK A;  1Y1M A;  2PFZ A;  4ZEC A;  4N6D A;  4G2Z A;  2FVZ A;  3T0J A;  5BUU A;  4EQ9 A;  1R9L A;  1MRP A;  1DSN A;  3LSF B;  2OBG A;  2PBW A;  1ZKB A;  4F3G A;  3RPL A;  2I58 A;  4RJZ A;  1L5T A;  1SW1 A;  5CMC A;  4Z7E A;  4JVD A;  3SZP A;  1IQ7 A;  1DMB A;  4U22 A;  3PPN A;  3G7W A;  1FPE A;  3TMG A;  4F29 A;  3C9H A;  4TLL B;  4EF1 A;  3FXU A;  2FIX A;  4FAJ A;  4M4G A;  4H5G A;  3PUV E;  1WVJ A;  1LEV A;  3VLW A;  1H43 A;  4NHB A;  4H6D A;  4G68 C;  2IA4 A;  4LAT A;  1FPJ A;  1EYI A;  2XX8 A;  1GVC A;  3KC1 A;  1M5D A;  1XVY A;  4P8B A;  2ZNS A;  3G3K A;  1OIB A;  2UVH A;  1IZ1 A;  1NUZ A;  1LCF A;  1US4 A;  5ELV A;  3B8B A;  1LBX A;  4LQ2 A;  1A7L A;  4LVQ A;  2I4C A;  3HO7 A;  1D4N A;  1EZ9 A;  2GRV A;  4YKJ A;  2Z23 A;  4AS5 A;  3C35 A;  3IB0 A;  2ONS A;  4NED A;  1I6B A;  2I4B A;  3FUZ A;  4ELP A;  4WXJ A;  3V5A A;  1SPI A;  2CEY A;  3N5L A;  3TYH A;  3KFM A;  4PF8 A;  1JNF A;  4R75 A;  3C31 A;  4NGU A;  3LSL A;  4OWD A;  3WAE A;  1IIT A;  3OO8 A;  2HAU A;  1POT A;  3O6H A;  4Z0I A;  5ICQ A;  2NOO A;  4EXL A;  4O7I A;  4PC9 A;  1KA1 A;  1MXV A;  3IOR A;  1UTB A;  2FA7 A;  1LB9 A;  4G8N A;  2AL4 A;  4JWY A;  1AL3 A;  2PCR A;  1NV1 A;  1OQH A;  2RKM A;  4GBV A;  1VR5 A;  4GLI A;  4I40 A;  1I6A A;  3PV0 E;  3FIR A;  1B0H A;  1M5C A;  3H4Z A;  4RK2 A;  1JW5 A;  3IB2 A;  2GFE A;  5ET8 A;  1ZIU A;  5ESY A;  5H8S A;  3DM0 A;  3MVZ A;  3PMX A;  3KOT A;  3HHF A;  5JK4 A;  5ICT A;  4BDO A;  3D4G A;  5JTY B;  4F3B A;  3MC2 A;  2UVJ A;  3RUM A;  3FXQ A;  4LZ5 A;  2XWO A;  4PFB A;  1FPB A;  3KJ7 A;  1B7Z A;  1PBQ A;  5KZT A;  2I6E A;  5I3S A;  3IOV A;  3PMW A;  3K0V A;  4DI3 D;  1ELJ A;  3KBR A;  3B6Q A;  3QIM A;  3UGW A;  3O66 A;  2H9B A;  3MP1 A;  4YAH X;  4TQU Q;  3MST A;  5AA2 A;  3G3J A;  3K1P A;  3RTW B;  1S50 A;  1JW4 A;  5EYG A;  3HFU A;  4LA9 A;  3T66 A;  3ISP A;  3BBR A;  4PFU A;  4QBA A;  3CHG A;  5F1Q A;  4H46 A;  2PX1 A;  2QPQ A;  4K3F A;  1MPC A;  4OER A;  1FPK A;  4DCX A;  3K01 A;  1JEV A;  4JWO A;  3ZKK A;  4GBW A;  3S2V A;  3OSQ A;  4DZ1 A;  2DE4 A;  4AS4 A;  4N15 A;  4Q30 B;  2CEX A;  1EZP A;  2X7P A;  3THI A;  1K9Z A;  2F35 A;  4FE8 A;  3SEU A;  4NF8 A;  4ONY A;  4RNS A;  3A3U A;  3BIH A;  1B5J A;  3JYR A;  1IIW A;  4P1L A;  1FTJ A;  4RPN A;  1FTA A;  2WEF A;  1N3X A;  4R6H A;  4LN5 A;  3CG3 A;  5HPQ A;  5DEX B;  1MY1 A;  1Y3N A;  5BWJ A;  2PMS A;  4ZEB A;  1US5 A;  2DWJ A;  1NMU A;  3MP8 A;  1B3L A;  4OVP A;  3DP8 A;  1WOD A;  4N8Y A;  2A5T A;  4PTK A;  3UN6 A;  1MM7 A;  4R6K A;  3W9W A;  2OK2 A;  4DXB A;  4F18 A;  5AA1 A;  2CZI A;  1RYO A;  3K6X A;  4X9T A;  4MNI A;  5AE4 A;  4R9F A;  2QRY A;  2ZYM A;  1POY 1;  3C32 A;  1LBZ A;  2XXX A;  4I1D A;  5I2K A;  3M3L A;  3HHG A;  1MPD A;  3G3F A;  4DE8 A;  3HN0 A;  4ESW A;  3DP4 A;  3K6W A;  3T93 B;  4NF4 B;  1FJ6 A;  3F11 A;  1FTL A;  3I6V A;  1A8E A;  3QUF A;  4OXV A;  4YMA A;  4QFK A;  2DVZ A;  4U4X A;  1Y9U A;  2VGQ A;  4F1U A;  4FEC A;  1DTZ A;  1NL5 A;  4BLA A;  4QFL A;  3KC0 A;  3FXB A;  3S9N C;  1LFG A;  4N6K A;  4GWU A;  2L5V A;  2XXT A;  3VXB A;  3HCQ A;  1P1N A;  2DS9 A;  3U8Q A;  3MWB A;  2XXH A;  3FAT A;  4KI0 E;  3I3V A;  5H8F B;  4U1O A;  2HPG A;  2V25 A;  4JVI A;  2R8T A;  3IK6 B;  1Y4T A;  3UA8 A;  5L9S A;  4OFL A;  4KFQ A;  4KCC A;  3KG2 A;  1SW5 A;  1LFH A;  3LSX A;  4OVR A;  1UTB B;  1BKA A;  3B50 A;  2G93 A;  4O3B A;  1FBH A;  1PB7 A;  5LTC A;  1SYI A;  1AOV A;  2Y7P A;  4RK9 A;  1FTK A;  5I56 B;  1PC3 A;  1NFT A;  3M8U A;  4PP0 A;  1DTG A;  3MBP A;  4G8H A;  1QVS A;  5CMM A;  2XHD A;  2DE3 A;  4IY6 A;  2O1L A;  3K00 A;  3PPO A;  2OX3 A;  3BFT A;  2VD2 A;  4P0G A;  1FBG A;  1JW1 A;  1S7Y A;  2F7C A;  4QSC A;  2H99 A;  1IEJ A;  4H8J A;  3LUZ A;  4MJO A;  3DLN A;  5DVJ A;  4OEN A;  4GIZ A;  3FBP A;  1NUW A;  3S9E A;  5DTB A;  1XS5 A;  5I7I A;  3TUS A;  1GV8 A;  3UK4 A;  3CFX A;  4XKQ A;  2Z8F A;  5FHM A;  3MP6 A;  2PT1 A;  1B05 A;  2HAV A;  2DSF A;  1JET A;  4IY5 A;  2DWH A;  3W15 C;  3PGF A;  2Y5K A;  5L8D A;  1MDP 1;  3K4U A;  4JSO A;  1P1O A;  5FHO A;  2RC7 A;  3VLV A;  5JTY A;  4TOZ A;  4KCD A;  3LC8 A;  3U93 A;  4F1V A;  2Q9T A;  4F2Q A;  5F24 A;  3VVD A;  2BJI A;  3IB1 A;  3PPQ A; 
#chains in the Genus database with same CATH homology
 2F97 A;  3LBS A;  4IO7 A;  3VLW A;  1SQY A;  1H43 A;  2OLB A;  4FJP A;  4H6D A;  5H8N A;  3K6U A;  4G68 C;  3TKD A;  2VD3 A;  4HTG A;  3A09 A;  2IA4 A;  2RIN A;  4DXU A;  4LAT A;  2RCB A;  1LBB A;  4DLD A;  2XX8 A;  1URS A;  1GVC A;  5I2K B;  3KOS A;  1M5D A;  3KN7 A;  1XVY A;  2DWA A;  1UTH B;  2Q2A A;  3OO9 A;  5EHS A;  1BTJ A;  2ZNS A;  3G3K A;  1XT8 A;  1OIB A;  1IZ1 A;  1D9Y A;  1P99 A;  2DQV A;  1SW2 A;  2UVH A;  1LCF A;  4NF8 B;  5CRY A;  1US4 A;  2OZZ A;  5ELV A;  4FOR A;  2D5W A;  4LQ2 A;  1A7L A;  4LVQ A;  2I4C A;  3HO7 A;  4JSD A;  5H8H B;  1D4N A;  5AA2 D;  3S9M C;  4KQP A;  4GL8 A;  3VDF A;  5TP9 A;  4AB5 A;  1XVX A;  1A8F A;  3SDF A;  1EZ9 A;  4C1T A;  2GRV A;  4ZEI A;  4LP2 B;  4YKJ A;  5KDT A;  3SEW A;  5I2K A;  1IXH A;  3Q25 A;  1FQA A;  1MQD A;  1ZTY A;  2Z23 A;  3C35 A;  3BFU A;  4GRK A;  4EF2 A;  3IB0 A;  2RCA A;  3FVN A;  2ONS A;  5A5X B;  1B3F A;  3TQL A;  5DEX A;  4C0R A;  1EZO A;  2Q88 A;  3ECR A;  2OJT A;  4NED A;  1I6B A;  4ND9 A;  4N6P A;  2O7I A;  2I4B A;  3FUZ A;  3H6U A;  3K6V A;  2YLN A;  1UIV A;  4PET A;  2RC8 A;  1MQJ A;  4F18 A;  5I84 A;  3FV2 A;  3FZV A;  4ELP A;  2F36 A;  1MH3 A;  2QMX A;  3O29 A;  4RYA A;  4K3F A;  2V3U A;  4WXJ A;  3V5A A;  5H8N B;  3OEL A;  5CM6 A;  3RN8 A;  4ZDM A;  4EQ7 A;  3N5L A;  2A5S A;  3OSR A;  2O84 X;  4I9D A;  3TYH A;  2BJJ X;  2DXY A;  2LAO A;  2REJ A;  2XXV A;  5ISU A;  1QJM A;  4ZE8 A;  1CE2 A;  3KFM A;  3O6I A;  1JNF A;  1B1H A;  4IO6 A;  1D3K A;  1LLS A;  1YCJ A;  1Z7N E;  1A40 A;  3AXF A;  3C31 A;  4NTL A;  3KGC A;  4FED A;  4EDP A;  3TEP A;  3RT6 B;  4OES A;  4U1Z A;  2P1S A;  3LSL A;  3C34 A;  4OWD A;  3M3F A;  3WAE A;  5TP9 B;  3KJT A;  1IIT A;  3MPK A;  3OO8 A;  2HAU A;  1POT A;  3O6H A;  4Z0I A;  3OO7 A;  5ICQ A;  1MQH A;  2NOO A;  4OHN A;  4EXL A;  4X48 A;  3FAS A;  2Q89 A;  2X26 A;  3O9P A;  1USY H;  4E0W A;  1MXV A;  1B51 A;  2HEU A;  3LSW A;  4R6Y A;  3IOR A;  3RNN A;  1FQD A;  1GTK A;  2PYY A;  3Q26 A;  4I62 A;  1O7T A;  4RA1 A;  4ELQ A;  1UTB A;  3H3G A;  2FA7 A;  3IOW A;  1ANF A;  1ZMG A;  1MQG A;  2F6G A;  1LB9 A;  2DYX A;  3FV1 A;  3OMB A;  4G8N A;  4QSD A;  1QW0 A;  4XKP A;  2AL4 A;  1GGG A;  4JWY A;  1AL3 A;  4ZED A;  1CB6 A;  3W9V A;  2DP8 A;  3PMV A;  5CI5 A;  1OQH A;  2P0S A;  2RKM A;  3MVY A;  1QKA A;  1M5E A;  4PQJ A;  2XD3 A;  3QK6 A;  4KD5 A;  1ZBM A;  4PFT A;  2ZXT A;  5TU0 A;  2PT2 A;  1VR5 A;  4GLI A;  4U4S A;  1P1W A;  2CZL A;  4LON B;  2X7Q A;  2YJP A;  4MLV A;  5H8H A;  3OEN A;  3TTL A;  2F7A A;  4N13 A;  1OLC A;  4HCW A;  1I6A A;  3T9U A;  3PV0 E;  2ONR A;  3FIR A;  1B0H A;  1NH8 A;  3E4R A;  2HCA A;  5I57 B;  3CR9 A;  1N7W A;  3OO6 A;  3I5O A;  4UAC A;  1M5C A;  3TTK A;  1B9J A;  4YB5 A;  3H4Z A;  4RK2 A;  1JW5 A;  1R9Q A;  1UQW A;  2H5Y A;  3QXM A;  4XTC Q;  1B7H A;  3VVF A;  1H45 A;  3IB2 A;  2GFE A;  4JWX A;  4YU0 A;  4IO3 A;  3C4M A;  1QUI A;  1MY3 A;  1ZIU A;  5H8S A;  2ZNT A;  4FIM A;  4IGR A;  3B7D A;  2ZNU A;  3DM0 A;  3MVZ A;  3MZB A;  3KOT A;  3ODB A;  3HHF A;  3PMX A;  1JEU A;  3TQW A;  3UOR A;  5ICT A;  4BDO A;  3LUY A;  1FQE A;  3KN3 A;  3D4G A;  3IJO B;  4N07 A;  2NVU B;  5JTY B;  5KCJ B;  2I0C A;  2Y84 A;  4JXI A;  1A55 A;  3N6U A;  4F3B A;  2I48 A;  2UVJ A;  3MC2 A;  3S4U A;  5I58 A;  3RUM A;  5J1D A;  4KHZ E;  3FXQ A;  2FYI A;  4WKM A;  1FQB A;  3FJ7 A;  2XX7 A;  4GOT A;  4GQO A;  4LZ5 A;  3KJ7 A;  1MDQ A;  1B7Z A;  2B3B A;  2ZYN A;  3R26 A;  1PBQ A;  4KYE A;  5KZT A;  2Q8J A;  4G4P A;  2I6E A;  2IEE A;  3CSG A;  1LAX A;  4H5F A;  4OET A;  3SES A;  5AA3 A;  4OEU A;  4Q0C A;  4F39 A;  3JV9 A;  3O2A A;  1NH7 A;  3PUW E;  4ESX A;  3ILU B;  1B3G A;  3IOV A;  3PMW A;  3K0V A;  4OEV A;  2XX9 A;  4C1U A;  1WDN A;  1MM6 A;  1YPN A;  3RY3 A;  4YB7 A;  3MVX A;  5I57 A;  1ELJ A;  3KBR A;  4BDQ A;  3N26 A;  4GVO A;  4OQO A;  3B6Q A;  2G29 A;  4O3A A;  1ZLQ A;  4RPO A;  5CMB A;  2Z8E A;  4H0W A;  4P11 A;  3QIM A;  4U2R A;  2UVG A;  2R71 A;  3CSB A;  3UGW A;  1H3D A;  3R7X A;  4YKI A;  4Q8R A;  3CFZ A;  3O66 A;  2H9B A;  3MP1 A;  4YAH X;  2ANJ A;  3RQT A;  4WED A;  4IB2 A;  4TQU Q;  3TTR A;  2DVC A;  1UTH A;  5K2Y A;  4YB6 A;  5AA2 A;  1QUJ A;  3G3J A;  5B7D A;  1H44 A;  2AL5 A;  3G3I A;  3K1P A;  1S50 A;  4NWD A;  3RTW B;  4HW8 A;  1JW4 A;  5TPA A;  5H8Q B;  1VSO A;  1MQI A;  1LCT A;  3E9X A;  2XXI A;  1LBC A;  1GR2 A;  1MG1 A;  3MZ1 A;  4LA9 A;  3T66 A;  3V8X B;  1NNP A;  4AB6 A;  3FVO A;  1HSE A;  1EU8 A;  5B70 A;  3BBR A;  1LAG E;  4NF6 A;  4PFU A;  2QL3 A;  1SW4 A;  2VOZ A;  3HPI A;  1SVX B;  1RYX A;  4JB7 A;  2O1M A;  4KR5 A;  4O3C A;  5F1Q A;  3IOT A;  3Q29 A;  2PX1 A;  3GXA A;  3PPR A;  1MH4 A;  2QPQ A;  1B40 A;  1JQF A;  1MPC A;  1R6Z A;  3EF7 A;  1M5F A;  1MPB A;  1MS7 A;  3ILT B;  3K01 A;  3PUY E;  2Y7K A;  3V83 A;  4H8I A;  4R2B A;  1TWY A;  1JEV A;  2F6P A;  4JWO A;  4G8M A;  4EXK A;  3QYT A;  3ZKK A;  2Z8D A;  3TCF A;  2ESN A;  3S2V A;  5AA2 B;  1PBP A;  2O6A A;  3OSQ A;  3USD A;  4DZ1 A;  5L9O A;  1AIV A;  4IO5 A;  3SEV A;  2Y7W A;  4BDL A;  2DE4 A;  1NNF A;  3HV1 A;  3FXR A;  4IGT A;  1BIY A;  1TT1 A;  2QSX A;  5IAI A;  2GH9 A;  4Q30 B;  1MY4 A;  2RC9 A;  5FHN A;  1EZP A;  4WEP A;  4XIG Q;  1SBP A;  2X7P A;  3DEL B;  1SDX A;  3GBB A;  3VXC A;  1AMF A;  3THI A;  3IJX B;  2F35 A;  4FE8 A;  4LQ5 A;  4IO2 A;  3MZ9 A;  4YIC A;  1B3E A;  4NF8 A;  4ONY A;  4R73 A;  3SEU A;  3SKP A;  4RNS A;  4QF9 A;  3A3U A;  2AYS A;  1PDA A;  4JDF A;  3FJM A;  3E13 X;  3H6V A;  1B5J A;  3JYR A;  1XOC A;  4G77 A;  3U1O A;  4NMY A;  1IIW A;  3ONM A;  1FTJ A;  3U94 A;  1B1X A;  1SD3 A;  5HM4 B;  4G68 A;  4NF6 B;  3RTF B;  4RPN A;  4DCX A;  1B5I A;  1I69 A;  4R75 A;  5ITP A;  2D21 A;  1N0T A;  4KYS A;  1N3X A;  4R6H A;  3MJN A;  4XKN A;  3N6T A;  3CG3 A;  4XKR A;  5HPQ A;  5DEX B;  3TOD A;  4GD5 A;  4F2O A;  1MY1 A;  1Y3N A;  1Y20 A;  5BWJ A;  1LGB C;  2NUV A;  4OVJ A;  1VFD A;  2PMS A;  4ZEB A;  3TEL A;  4QRZ A;  3KSX A;  1YTV A;  1US5 A;  4LUB A;  1ZU0 A;  4UA8 A;  2DWJ A;  2B3F A;  3WAF A;  5A5X A;  1NMU A;  2UXA A;  3MP8 A;  3H6T A;  3Q28 A;  4QFP A;  1B3L A;  1XC1 A;  4QSE A;  3K02 A;  1DPE A;  1XHY A;  2WKY A;  3DP8 A;  1WOD A;  3IO6 A;  1OMP A;  3IR1 A;  4FAT A;  3EPE A;  1LST A;  1B7U A;  2A5T A;  1JVX A;  4NE4 A;  3T9H B;  3KSJ A;  5DVI A;  3UN6 A;  2YPN A;  3UP9 A;  1IXI A;  1MM7 A;  4POX A;  4R6K A;  3W9W A;  5I59 A;  2OK2 A;  2UYE A;  1B2H A;  1S9T A;  2H4I A;  3CVG A;  3MW0 A;  4GXA A;  3FVK A;  5DYH A;  5F7V A;  5FTI A;  3TFL A;  2UVI A;  5AA1 A;  1UIU A;  2B65 A;  2O69 A;  3JZJ A;  1BLF A;  3PU5 A;  1RYO A;  2Y7R A;  3K6X A;  4PE5 B;  3KZG A;  4RY1 A;  1B4Z A;  2UYF A;  3T22 A;  1LB8 A;  1FTO A;  1MY0 A;  3O28 A;  4X9T A;  3C33 A;  1R1N A;  4QFO A;  2I3V A;  1B4H A;  4DCY A;  1A99 A;  2XD2 A;  5AE4 A;  1HSJ A;  3B6W A;  3M3K A;  4R9F A;  4ELO A;  2QS2 A;  3VLU A;  2QRY A;  4I8C A;  5I56 B;  2ALU A;  4THI A;  3SET A;  2ZYM A;  3V89 B;  1POY 1;  3C32 A;  5I58 B;  4R72 A;  2Q2C A;  1TFD A;  2XXX A;  4I1D A;  3CFL A;  4GWO A;  4BDM A;  3M3L A;  3PUX E;  3HHG A;  4POW A;  3VV5 A;  4FEB A;  3RLF E;  1MPD A;  2Z22 A;  3G3F A;  3T9X B;  4DE8 A;  3A3C A;  1Q35 A;  3HN0 A;  4ESW A;  2F34 A;  3DP4 A;  1MXW A;  4BDR A;  3G3G A;  3K6W A;  4OTE A;  3OD7 A;  1QUK A;  3EHT A;  3TDJ A;  5I2N B;  3T93 B;  4NF4 B;  1IXC A;  3F11 A;  4LZ8 A;  1FTL A;  3I6V A;  1YAE A;  1A8E A;  2A5T B;  3QUF A;  4OXV A;  4YMB A;  1IUD A;  4YMA A;  1BP5 A;  4QFK A;  4F22 A;  1J1N A;  2DVZ A;  1Y3Q A;  3QUJ A;  4PFW A;  4U4X A;  5KDT B;  1VFE A;  1Y9U A;  4H65 A;  3T96 B;  2VGQ A;  4F1U A;  5AA4 B;  4FEC A;  5EYF A;  1DTZ A;  1NL5 A;  4Q5T A;  4BLA A;  5JK4 A;  2QJE A;  2XXQ A;  3CIJ A;  4ZS9 A;  4QFL A;  1B58 A;  3TCH A;  4DIG A;  1JVY A;  2KLF A;  3S9N C;  3CI8 A;  1LFG A;  3R6U A;  2XXT A;  1B6H A;  1LFI A;  3VXB A;  1Y1Z A;  3HCQ A;  4GL0 A;  4ECF A;  2H98 A;  5JEI A;  1AH5 A;  1N04 A;  1P1N A;  2DS9 A;  3U8Q A;  1KWH A;  4ZZE A;  1D9V A;  5LOM A;  4QHQ A;  3H7M A;  3P7I A;  1Y4C A;  2R6G E;  2QMW A;  3TAJ A;  4LZ7 A;  3L6H A;  3MWB A;  1T0K A;  2HXW A;  3ZKL A;  2XXH A;  3MVW A;  3FAT A;  5ITO A;  1SYH A;  1O63 A;  4PFY A;  1DPP A;  1QUL A;  4KI0 E;  4YZZ A;  4MF3 A;  2OWT A;  3K1N A;  3I3V A;  3Q27 A;  5H8F B;  5HBC A;  3FD3 A;  5I2N A;  3OEK A;  2E1S A;  4M1V A;  2V25 A;  2I49 A;  4U1O A;  4YKP A;  4F1Y A;  3IX1 A;  5I56 A;  2O68 A;  3KN8 A;  1DOT A;  3VFJ A;  1MXY A;  2M8C A;  4XXU A;  4F3P A;  1B32 A;  1N7X A;  3UIF A;  4MFI A;  3IK6 B;  2FNC A;  1PB8 A;  3EHU A;  3LR1 A;  1Y4T A;  1URG A;  4IO4 A;  4OYV A;  3SER A;  5DVF A;  3UA8 A;  2HQ0 A;  5I59 B;  2E0S A;  5L9S A;  2NXO A;  4U23 A;  2RF1 A;  3BKI B;  3C36 A;  1NNK A;  4OFO A;  3K2D A;  1A54 A;  4GXS B;  4OFL A;  4KFQ A;  4ZEK A;  1B52 A;  4KCC A;  3KG2 A;  1SW5 A;  1MXZ A;  2P2A A;  3LSX A;  2HZK A;  3TTM A;  1FQC A;  1LFH A;  4X1B A;  4TLM B;  1UTB B;  1BKA A;  3CG1 A;  3EQ1 A;  2F7B A;  1TXF A;  2G93 A;  2I3W A;  2XXP A;  4O3B A;  3VVE A;  1PB7 A;  1B0L A;  2V3T A;  3EHS A;  2OWS A;  3OOA A;  1B5H A;  1SYI A;  2OCU A;  3FJG A;  3ZSF A;  5H8F A;  4GF8 A;  2ZMB A;  1TFA A;  1AOV A;  4OZ9 A;  3PD9 A;  3PUZ E;  3TPA A;  4U21 A;  5IKB A;  5CC2 A;  2Y7P A;  2F78 A;  3MUQ A;  3N94 A;  4ZZA A;  5H8Q A;  1F9B A;  4P0I A;  4DXC A;  4NF5 B;  1OLA A;  3PPP A;  4RK9 A;  2W7Y A;  3DP6 A;  3MQ9 A;  2CMO A;  3E3K A;  4EUO A;  4F3S A;  1USY E;  1FW0 A;  2I0B A;  3O6G A;  2THI A;  5CBR A;  1FTK A;  2XXY A;  4MH5 A;  3U92 A;  1MXX A;  2V84 A;  3FVG A;  3EN3 A;  3G3H A;  1FTM A;  2GHA A;  1PC3 A;  4G68 B;  1NFT A;  1N76 A;  4R74 A;  3GZG A;  1EH3 A;  1OVB A;  4NF4 A;  3GBA A;  3M8U A;  4PP0 A;  4X1D A;  1DTG A;  3S9L C;  3MBP A;  2REG A;  4G8H A;  4H1X A;  2O51 A;  3TZA A;  1QVS A;  3SEY A;  2DXR A;  5K2X A;  2V3Q A;  3HST A;  4JBZ A;  3O97 A;  1NKX A;  4ZEF A;  4ELR A;  4F19 A;  4OFJ A;  1OQG A;  1RKM A;  2H25 A;  4YKK A;  5CMM A;  3OEM A;  2ONK E;  1P1U A;  5M2V A;  5AA4 A;  2XHD A;  2XXU A;  2DE3 A;  2XXR A;  2DE2 A;  2QS4 A;  4IY6 A;  2O1L A;  5L9M A;  3RGY A;  1QKB A;  1OVT A;  4DDD A;  1H76 A;  3K00 A;  2DOJ A;  2PVU A;  3PPO A;  3IAZ A;  4ISU A;  2ZYK A;  3GLB A;  3MPL A;  4HCY A;  1N84 A;  2XXW A;  1IXG A;  2HFB A;  4KPT A;  4L17 A;  3H6W A;  4OER A;  3TTN A;  1ATG A;  2VD2 A;  2VP1 A;  3BFT A;  4R9G A;  2VHA A;  5KCJ A;  1FCK A;  4E0X A;  4P0G A;  3T9V A;  3MAM A;  1JW1 A;  1S7Y A;  2F7C A;  2H99 A;  1IEJ A;  2D3I A;  1M5B A;  3QSL A;  2V93 A;  4H8J A;  4QSC A;  4NF5 A;  3DLN A;  1MY2 A;  5DVJ A;  2F8D A;  4QFN A;  4OEN A;  4GIZ A;  1II5 A;  3IOU A;  2Y7I A;  1B3H A;  1O64 A;  3H06 B;  4F31 B;  1Y1M A;  5FTH A;  4ZEC A;  3PD8 A;  1NNT A;  2F5X A;  1ZJL A;  3RT8 A;  3S9E A;  2DWI A;  4G2Z A;  5DTB A;  4H67 A;  1XS5 A;  3B6T A;  3TUS A;  1GV8 A;  3K1M A;  3D4C A;  2ZYO A;  4R2F A;  3UK4 A;  5BUU A;  4EQ9 A;  3CFX A;  2AIX A;  1PB9 A;  2Z8F A;  3CRB A;  1PEB A;  1R9L A;  1MRP A;  2ABH A;  4XKQ A;  3MP6 A;  2PT1 A;  1B05 A;  2HAV A;  5FHM A;  3H03 A;  1DSN A;  2DSF A;  1JET A;  1VE4 A;  2QS3 A;  3LSF B;  1SI1 A;  3ZS6 A;  5CBS A;  4IY5 A;  2DWH A;  3W15 C;  2OBG A;  2PBW A;  1I6Q A;  1P1Q A;  3PGF A;  5L8D A;  1ZKB A;  4OMB A;  2NWJ A;  1LAF E;  1MDP 1;  3K4U A;  4F3G A;  4ZE9 A;  1HSL A;  4JSO A;  2I58 A;  1P1O A;  4RJZ A;  4MLQ A;  1B46 A;  1L5T A;  4BDN A;  2HZL A;  1SW1 A;  1Z7M E;  1MXU A;  2QS1 A;  5CMC A;  5EHM A;  5FHO A;  5DT6 A;  2RC7 A;  5TPA B;  3VE1 B;  4TOZ A;  3VLV A;  3KEI A;  3IO4 A;  4Z7E A;  5JTY A;  1FQF A;  4DXB A;  4KCD A;  1IQ7 A;  3LC8 A;  2GHB A;  4AQ4 A;  1LAH E;  1DMB A;  3OXN A;  4HS7 A;  4RXL A;  3PPN A;  4U22 A;  3U93 A;  4MBP A;  4NWC A;  3U72 A;  4EQB A;  3G7W A;  4GFR A;  3TMG A;  4F1V A;  4F29 A;  3C9H A;  4TLL B;  5CMK A;  3RPW A;  1Q1K A;  1SI0 A;  2Q9T A;  3FGS A;  4EF1 A;  4F2Q A;  1Y3P A;  3FXU A;  2R9J A;  1N3W A;  4FAJ A;  3SEX A;  4M4G A;  3VVD A;  1URD A;  3IB1 A;  3IL1 B;  1WVJ A;  3L6G A;  3PPQ A;  3PUV E;  2O7U A;  4H5G A;  4KYD A;  3QAX A;  3TCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...