1PBQA

Crystal structure of the nr1 ligand binding core in complex with 5,7-dichlorokynurenic acid (dcka) at 1.90 angstroms resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
286
structure length
274
Chain Sequence
RLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords N-methyl-D-aspartate Receptor Subunit 1
publication title Mechanisms of activation, inhibition and specificity: crystal structures of the NMDA receptor NR1 ligand-binding core
pubmed doi rcsb
source organism Rattus norvegicus
total genus 73
structure length 274
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pbqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pbqA02
3DLNA 3M3KA 4ZZAA 2HCAA 5L9SA 5CI5A 2OWSA 2I48A 4OEVA 5H8NA 3TTLA 3WAEA 3ODBA 2REGA 3SERA 4IY6A 1KWHA 3M3LA 3KSJA 1TFDA 5JK4A 5B70A 4NTLA 3QIMA 4HCWA 4DXCA 4DDDA 3CVGA 2DWHA 2A5TB 4ZEDA 1CE2A 3OSQA 2DQVA 4XTCQ 2OZZA 2H99A 1NMUA 3CG3A 5CBRA 4YKKA 1ZBMA 1ZMGA 4RPOA 1UTBB 2HAUA 1FTLA 1B7HA 4G8NA 3QSLA 1OVBA 2V25A 1XS5A 5EHMA 3RLFE 1ZTYA 4F3GA 1B2HA 3QAXA 3HN0A 3RT6B 4KPTA 4F3SA 3I3VA 4TOZA 3TQLA 2H9BA 4I1DA 3MP1A 4ESWA 4QRZA 3JV9A 2ZNUA 1UIUA 1JNFA 1EZ9A 2OCUA 4N07A 1JQFA 4JBZA 5I84A 2V3UA 3SKPA 2G93A 3PPRA 3OO8A 3FXUA 1XVYA 3HV1A 2RC7A 3JZJA 1URSA 5ISUA 3ILUB 3G3KA 1IXIA 2NUVA 4BDNA 1F9BA 2DWAA 1D4NA 4G8MA 5H8NB 5CMMA 3DP4A 4OMBA 1FQAA 1FQDA 4TQUQ 2ZYOA 3SEUA 1IXGA 5I2NA 3MBPA 1P1WA 3R6UA 4PFYA 1SBPA 2M8CA 4HTGA 1US5A 4ELQA 1D9YA 4GOTA 4JSOA 1ZJLA 1H3DA 4ELOA 2AL5A 3E9XA 1B52A 3LSLA 4E0WA 1UTHA 4RK2A 3K6XA 4WEDA 2Y7WA 1UIVA 1M5BA 1MXXA 4BLAA 1I69A 2E0SA 3O2AA 2Q2CA 1JVXA 2Q88A 4NF5A 1QVSA 2W7YA 5H8HA 2REJA 1B46A 4GRKA 1TFAA 3MPKA 2O1LA 2XD3A 3H6TA 3ZS6A 1O7TA 4NE4A 1B32A 2DWIA 3K6WA 1Y4TA 4GLIA 3HPIA 3PPPA 4HCYA 3PMWA 3OELA 3B6QA 4GD5A 2ZXTA 4QFNA 5FTIA 4BDLA 5DVFA 3ZKLA 1CB6A 1YAEA 1FCKA 4RY1A 1N3WA 5CMKA 1JW4A 1T0KA 4PE5B 2XX9A 3OO6A 2GH9A 3C34A 1PEBA 2GHAA 2XXHA 4YAHX 1A54A 3OEMA 1N7WA 2D21A 4Q0CA 3SESA 3MPLA 2DYXA 5A5XA 4DLDA 1SI1A 4OYVA 4R6YA 3LC8A 3UIFA 3PD9A 3W9VA 1EZOA 1EZPA 4R2FA 3BKIB 4QFLA 1NNPA 5DT6A 2H98A 5I2NB 5I2KA 1TXFA 3T9UA 5BWJA 3OXNA 4FECA 1PBQA 4ELRA 4JWOA 4NF6B 2DWJA 3KJTA 4ESXA 3C4MA 5TP9A 1N76A 3FVNA 4MLVA 3T22A 2QS2A 1UTHB 1BTJA 2XXIA 3VLWA 1DPEA 3OSRA 4R73A 2F7CA 4R9FA 3L6HA 3SDFA 1Y3PA 1PDAA 3IL1B 4ZDMA 2Z8FA 3RN8A 1OIBA 4NF5B 3FJ7A 1NNTA 5H8HB 4ZE8A 4BDQA 4FIMA 4TLLB 2ANJA 1OMPA 2F6PA 3C32A 3Q27A 3IOUA 3G3IA 3E13X 1URDA 3V89B 4EQ7A 1YCJA 4OFOA 4JSDA 3TODA 3S9NC 1Y3QA 4MLQA 4PFUA 3M8UA 3DM0A 3K2DA 3MW0A 3RTWB 1RKMA 5I59B 2O7UA 5AA1A 3OO7A 4H8JA 4IO7A 1MM6A 1Z7NE 3LUYA 3TYHA 1OLCA 2I0CA 1A99A 3OENA 4NF8A 4U22A 4R9GA 1LFIA 2X26A 3VVEA 4C0RA 5A5XB 3FD3A 1S7YA 4IO6A 3S4UA 1Y20A 4DZ1A 2Y7RA 4MH5A 4DE8A 1DSNA 4FEBA 4YB5A 3TKDA 3IR1A 4GQOA 2UVIA 4C1TA 1MH4A 4QHQA 3Q28A 3U93A 4MBPA 3DP6A 3ZKKA 5I2KB 2HXWA 4QF9A 2O51A 1M5EA 3V8XB 4PETA 4R6KA 5CC2A 1N0TA 4RXLA 3LSFB 1MM7A 2THIA 1GR2A 4R74A 4DXUA 2Q8JA 1FTOA 3H6UA 1LAFE 3VFJA 4HS7A 5TP9B 3KFMA 1MY4A 2D3IA 1QUIA 1AIVA 4IGTA 3CRBA 4H0WA 1XHYA 3TQWA 1QUJA 4YKPA 2X7QA 2P0SA 2PMSA 4Q30B 4XXUA 5AA2A 4OTEA 4TLMB 4WXJA 3HHFA 1EH3A 4IY5A 2F7AA 3Q25A 3PPQA 2XX8A 1B4ZA 3RGYA 1TT1A 4WEPA 3D4GA 3H03A 4FAJA 2XXXA 4O3CA 3CFLA 5JTYA 3MQ9A 2BJJX 4KD5A 3GXAA 1D9VA 3EHUA 2XXRA 5I58A 4QFKA 3VV5A 1FW0A 3ONMA 3FJGA 1A8FA 3K02A 3O6GA 4NF8B 4GXSB 1SW2A 4DCXA 1B05A 2H5YA 5IAIA 1POY1 2I3VA 4L17A 1MDQA 3TZAA 3EHSA 1QKAA 3C35A 5IKBA 1FQFA 3PMVA 2QMXA 3KSXA 4I62A 3SEYA 2XXUA 1LAHE 5CRYA 4EXKA 3A3UA 2ZNSA 2E1SA 1MQJA 3PGFA 4DIGA 3VVDA 4OESA 1Y4CA 2O7IA 5BUUA 3RT8A 1VSOA 3KOTA 3S9LC 2ZMBA 4JB7A 3TELA 2H25A 1P1OA 3VVFA 3FZVA 5F7VA 2Y84A 3RQTA 2PX1A 1JEVA 1Y9UA 3PPNA 2NXOA 1LAGE 3MP6A 4ZECA 1MXUA 2XXQA 1ZU0A 2OK2A 5ELVA 3O29A 1TWYA 4OFJA 3RPWA 1FTJA 4HW8A 1B51A 1MQHA 1BP5A 1S9TA 4OERA 2R6GE 3H7MA 4G4PA 5AA2B 2AL4A 1P1NA 3LSXA 3G3FA 2F34A 1H43A 1B6HA 3ZSFA 2ONSA 2QS4A 1A55A 2Y7PA 3FVGA 1GTKA 2ZNTA 2IEEA 1D3KA 1J1NA 4AB6A 4OVJA 4EUOA 4OHNA 3MVXA 5HBCA 1AOVA 3KN7A 2DOJA 5JTYB 4XIGQ 4LA9A 1BKAA 5I56A 5AA4A 1MQIA 2PT2A 3MJNA 5CM6A 2NWJA 5I58B 2UYEA 1MXVA 5K2YA 4EDPA 4FEDA 1ATGA 1MRPA 3FUZA 4R72A 5H8SA 5F1QA 3CG1A 3TTRA 2XHDA 3C31A 1SW5A 1P1QA 3R26A 4LZ7A 1RYOA 3VLUA 4KYEA 3CIJA 4GIZA 1POTA 3H4ZA 1MDP1 4RYAA 4X1DA 3FXQA 3ILTB 1LCTA 3SEVA 1O63A 3IX1A 4JWXA 1LB8A 1SYIA 3K00A 1B3GA 2DE2A 4M4GA 3FV2A 3K4UA 1JVYA 1ELJA 1NFTA 1NKXA 3PMXA 2HFBA 2O69A 1B3LA 3M3FA 2F35A 3C36A 3HHGA 5DTBA 4X48A 1L5TA 1YTVA 2FA7A 1SYHA 3I6VA 1SW4A 3PD8A 1ZIUA 1H76A 3K6VA 4KHZE 1B3FA 3KBRA 1DOTA 1QULA 1LGBC 2CMOA 1B5HA 3K1NA 1HSJA 2XD2A 3UGWA 1B3EA 3IOVA 1OLAA 5I57A 2O84X 1MY3A 5L9MA 2RC9A 3FVOA 1BLFA 2XX7A 2GFEA 5AE4A 3TMGA 1SD3A 1PB9A 2QJEA 5H8FA 2PYYA 1GVCA 4XKRA 5CMCA 5AA4B 1JEUA 4LZ5A 2O1MA 3IAZA 5EHSA 2V3QA 1NL5A 4X1BA 2VD3A 1PC3A 3KZGA 2LAOA 3KGCA 2Z8EA 3LBSA 1JETA 1LB9A 5ICQA 3G3GA 3T93B 3IO4A 3DELB 4M1VA 5H8QA 5M2VA 5J1DA 1IXCA 2B3FA 4XKNA 2XXPA 4NF4A 2DSFA 5KDTA 3FVKA 1XT8A 4GL0A 3OMBA 4F18A 1O64A 1UQWA 3N94A 3PV0E 4LVQA 3B6WA 4ISUA 3O6HA 2Q9TA 1Q35A 1NH8A 3PUVE 3HSTA 3U94A 5FHOA 3TTNA 1B7UA 2B3BA 1QJMA 2D5WA 4KYDA 1NNKA 2VOZA 3TPAA 3IK6B 4KCDA 4Q5TA 2V93A 4PP0A 3N5LA 3K01A 5FTHA 1IUDA 3KOSA 2I49A 1A40A 3GBBA 4P0IA 4OETA 3FGSA 4H1XA 5I57B 4G68A 4EF1A 2CZLA 2YJPA 3PUZE 5DVIA 3TCGA 5LOMA 3OOAA 1I6AA 1AH5A 5H8FB 1N7XA 3MVWA 3RTFB 3HO7A 5TPAA 1M5CA 4FORA 3MUQA 3EF7A 1H44A 1SVXB 3O66A 3MC2A 2QMWA 4P11A 2ABHA 3O6IA 3VE1B 1MQGA 5KZTA 4KFQA 3T9XB 4O3AA 4EXLA 2H4IA 1SW1A 4IO4A 3EPEA 4F22A 3H3GA 1II5A 2A5SA 4U4XA 1DTZA 3OD7A 4ONYA 4NF4B 1IITA 5KDTB 1SDXA 1H45A 1B7ZA 1I6BA 1LCFA 3GZGA 1DMBA 5L8DA 4GWOA 3FASA 3UA8A 4F2QA 4THIA 1PBPA 1XVXA 3O9PA 2F6GA 3MZ9A 4LUBA 2Y7KA 4GF8A 1VR5A 3L6GA 3D4CA 4U2RA 2XXVA 3N6TA 4X9TA 1B3HA 5FHNA 5DVJA 3IOWA 1Q1KA 1MY2A 3LR1A 3N6UA 3V5AA 4Z0IA 1QKBA 3H6VA 2HZKA 2PT1A 3PU5A 3KN8A 3B7DA 1Y3NA 4F1YA 2V3TA 3SETA 4Z7EA 4GVOA 3IORA 1XC1A 3T9VA 3KN3A 4QSCA 4EQ9A 4H5GA 4U1OA 1LSTA 2QSXA 3RY3A 2ZYMA 2VHAA 3BBRA 3IB0A 4KI0E 4ND9A 2I58A 2I0BA 3MP8A 2RF1A 3S2VA 3KEIA 3W9WA 4QSEA 2I4CA 3JYRA 4XKPA 2ZYNA 3U8QA 4PFWA 2QPQA 4LP2B 2AIXA 2DXYA 1IIWA 3EN3A 3KJ7A 3S9MC 2Q89A 2ONRA 3CSGA 1IZ1A 5DEXA 3MVYA 3TCHA 1R9QA 3FJMA 5EYFA 5ITOA 1A7LA 4OEUA 3TCFA 1B9JA 3MZBA 3DP8A 4LQ5A 1MY0A 4OWDA 2RINA 4DXBA 2UVHA 2DXRA 2QS3A 3CR9A 2RCAA 4U1ZA 5ICTA 3CFZA 3TTMA 1EU8A 1B5JA 2R9JA 1M5DA 1ZLQA 1M5FA 3GLBA 2P2AA 2DVCA 2G29A 4BDRA 1NNFA 5ITPA 4ECFA 2I3WA 1IXHA 2FYIA 1FTMA 3W15C 1JW5A 2V84A 3Q26A 1OQHA 3UP9A 3B6TA 4YKIA 3LSWA 1HSEA 2XXYA 3O28A 1R1NA 5HPQA 3G3HA 3K1MA 1R9LA 3MVZA 3QUFA 2Z8DA 4JWYA 3A09A 1MG1A 4IO2A 2XXWA 4YMBA 2OLBA 2DP8A 4OFLA 5FHMA 3SEWA 2IA4A 5DYHA 4BDMA 2YPNA 2UVGA 2F36A 4H65A 2F97A 4UA8A 3QK6A 4YU0A 4QFPA 5KCJA 3A3CA 4IO5A 3TEPA 3VXCA 3TFLA 4FJPA 3RNNA 1US4A 1P1UA 3AXFA 1B1XA 2NOOA 1URGA 5HM4B 1WDNA 4OENA 4ZZEA 2Z22A 4U4SA 1AMFA 3Q29A 1MXZA 1DTGA 1N3XA 5DEXB 4OQOA 1N04A 2YLNA 2OJTA 3R7XA 1LBCA 4EF2A 4H5FA 4KYSA 4XKQA 3H6WA 2Y7IA 4GFRA 4YB7A 1ZKBA 1R6ZA 4RNSA 4RJZA 4NF6A 2ONKE 1B58A 4H6DA 2AYSA 3PUWE 1BIYA 3WAFA 2DE3A 4ZEFA 4ZEIA 1FQCA 1B0LA 3CI8A 3RUMA 1FTKA 4YKJA 4BDOA 3U72A 4IB2A 3C9HA 2PVUA 3THIA 3FXRA 4I9DA 1LFGA 4G8HA 5K2XA 3N26A 1SQYA 2OBGA 3OO9A 4KQPA 4POWA 2DE4A 1GV8A 3E3KA 4F3BA 2RC8A 3V83A 3G7WA 2QS1A 3E4RA 1I6QA 4I8CA 2PBWA 1RYXA 4JXIA 4F1UA 4ZEBA 3TDJA 5I56B 1PB7A 3U92A 4N13A 3FV1A 5I59A 1OVTA 2ESNA 2VP1A 3EQ1A 4AQ4A 2DS9A 4N6PA 3QUJA 5KCJB 4E0XA 4GXAA 3K1PA 1P99A 1XOCA 4YZZA 2DVZA 4G2ZA 3CFXA 2HZLA 5JEIA 4RA1A 3IOTA 4NEDA 1B0HA 5CBSA 4QSDA 3TAJA 1B4HA 1WVJA 1USYH 1HSLA 2OWTA 2NVUB 4LQ2A 3IB1A 3T96B 3K0VA 2GHBA 4GL8A 4ZEKA 4NMYA 4U21A 2HAVA 1MH3A 3FATA 1LAXA 2R71A 2I4BA 3P7IA 2QRYA 1MPCA 3GBAA 3BFUA 3T9HB 3UN6A 3F11A 4F2OA 1LBBA 4MF3A 4NWCA 1VFDA 4MFIA 1YPNA 4RK9A 2O68A 1FQBA 1Z7ME 3OEKA 1FQEA 4OXVA 4OZ9A 3VDFA 1MPDA 1Y1MA 3HCQA 1A8EA 4F1VA 1JW1A 4IGRA 4ZS9A 1MY1A 2F7BA 3IO6A 5B7DA 2UYFA 2HEUA 3C33A 4KCCA 4QFOA 1PB8A 2GRVA 3BFTA 3TTKA 4G77A 1DPPA 4KR5A 4O3BA 4H8IA 4F31B 4ELPA 2ZYKA 4P0GA 1ANFA 1MQDA 4DCYA 2HQ0A 3VXBA 4NWDA 3CSBA 3UK4A 4FE8A 3FIRA 3IB2A 3UORA 3ECRA 2Z23A 2P1SA 1QUKA 4R6HA 2KLFA 1GGGA 3K6UA 5H8QB 4R75A 2O6AA 1N84A 3IJXB 4RPNA 2F78A 2I6EA 2WKYA 4FATA 4LZ8A 3PUYE 3VLVA 3G3JA 2ALUA 3USDA 4YB6A 4AB5A 2VD2A 1IQ7A 1MXYA 4JDFA 5L9OA 4U23A 3T66A 3SEXA 1IEJA 3KG2A 2RKMA 2A5TA 4EQBA 1LLSA 3I5OA 1OQGA 2UVJA 3TUSA 1MPBA 4YMAA 4R2BA 4K3FA 3H06B 1UTBA 3MZ1A 1NH7A 3QYTA 1VFEA 3MWBA 3PUXE 4LATA 1B5IA 1LFHA 2XXTA 4YICA 2F8DA 4Q8RA 1B1HA 1VE4A 4POXA 3QXMA 2F5XA 4C1UA 4WKMA 5TU0A 2VGQA 2UXAA 1AL3A 4G68B 4H67A 4F3PA 1Y1ZA 3PPOA 5AA2D 2X7PA 5AA3A 1MXWA 4IO3A 1B40A 3EHTA 3IJOB 1QW0A 4G68C 2QL3A 2B65A 3MAMA 3U1OA 4F29A 2FNCA 4F19A 5TPAB 2Q2AA 1MS7A 1WODA 4LONB 4PQJA 2RCBA 1USYE 3O97A 5CMBA 3S9EA 4PFTA 4UACA 4F39A 1S50A 1SI0A 4ZE9A
chains in the Genus database with same CATH superfamily
5ESYA 3DLNA 4PFRA 3M3KA 4ZZAA 2HCAA 5L9SA 2Q74A 5CI5A 2OWSA 2I48A 4OEVA 5H8NA 3TTLA 4G61A 3BIGA 3WAEA 3ODBA 2REGA 1FJ9A 3SERA 4XEQA 4IY6A 1KWHA 3M3LA 3KSJA 1TFDA 5JK4A 5B70A 4NTLA 3QIMA 4HCWA 4DXCA 4DDDA 3CVGA 2DWHA 2A5TB 1NV5A 4HE2A 4ZEDA 1CE2A 4MNIA 3OSQA 2DQVA 4XTCQ 2OZZA 2H99A 1NMUA 3CG3A 5CBRA 4YKKA 4P8BA 1ZBMA 1ZMGA 4RPOA 1UTBB 2HAUA 1FTLA 1B7HA 4G8NA 4PAKA 3QSLA 1OVBA 4MJOA 2V25A 3KC1A 1XS5A 5EHMA 3RLFE 1ZTYA 4F3GA 1B2HA 3QAXA 3HN0A 3RT6B 4KPTA 4F3SA 3I3VA 4TOZA 3TQLA 2H9BA 1FBCA 4I1DA 2Y5KA 3MP1A 4ESWA 4QRZA 3JV9A 2ZNUA 1UIUA 1JNFA 1EZ9A 4P47A 2OCUA 4N07A 1JQFA 4PTKA 4JBZA 4PBHA 5I84A 2V3UA 3SKPA 2G93A 3PPRA 3OO8A 3FXUA 5ET8A 1XVYA 3HV1A 2RC7A 3JZJA 1URSA 5ISUA 3ILUB 3G3KA 1IXIA 1KA1A 4HE0A 2NUVA 4BDNA 1F9BA 2WX9A 2DWAA 1D4NA 4G8MA 5H8NB 5CMMA 3DP4A 4OMBA 1FQAA 1FQDA 4TQUQ 2ZYOA 1YXIA 3SEUA 1IXGA 5I2NA 2PCRA 3MBPA 1P1WA 3R6UA 4PFYA 1SBPA 2M8CA 4HTGA 1US5A 4ELQA 1D9YA 1NI9A 4GOTA 4JSOA 1ZJLA 1H3DA 4ELOA 2WYPA 2AL5A 3E9XA 1B52A 3LSLA 4E0WA 1UTHA 4RK2A 3K6XA 4GBWA 4WEDA 4N81A 2Y7WA 1UIVA 2QFLA 4MAGA 1M5BA 1MXXA 4BLAA 4GWSA 1I69A 3LV0A 2E0SA 3O2AA 2Q2CA 1JVXA 2Q88A 1NV1A 4NF5A 1G0IA 1QVSA 2W7YA 4GWWA 5H8HA 3ISPA 2REJA 1B46A 4GRKA 1TFAA 3MPKA 2O1LA 2CZKA 2XD3A 3H6TA 3ZS6A 1O7TA 4NE4A 1B32A 2DWIA 3K6WA 1Y4TA 4GLIA 3HPIA 3PPPA 4HCYA 3PMWA 3OELA 3B6QA 4GD5A 2ZXTA 4QFNA 5FTIA 4BDLA 5DVFA 3ZKLA 1CB6A 1YAEA 1FCKA 4RY1A 1N3WA 5CMKA 1JW4A 1T0KA 4PE5B 2QVVA 4MMPA 2XX9A 3OO6A 2GH9A 3C34A 4AS4A 1PEBA 2GHAA 1IMEA 2XXHA 4YAHX 1A54A 3OEMA 1N7WA 2D21A 4Q0CA 3SESA 2OX3A 4PE3A 3MPLA 2DYXA 5A5XA 4DLDA 1SI1A 3HFUA 2R8TA 2HXRA 4OYVA 4R6YA 1VDWA 4N6KA 3LC8A 4N15A 3UIFA 3PD9A 3W9VA 4P3LA 1EZOA 1EZPA 4R2FA 3BKIB 1EYIA 4QFLA 1NNPA 5DT6A 2FHYA 2H98A 5I2NB 5I2KA 1TXFA 3T9UA 5BWJA 3OXNA 4FECA 1PBQA 4ELRA 4JWOA 4NF6B 2DWJA 3KJTA 4P56A 4ESXA 5ET6A 3C4MA 5TP9A 1N76A 3FVNA 4MLVA 3T22A 2QS2A 1UTHB 1BTJA 2XXIA 3VLWA 1DPEA 3OSRA 4R73A 2F7CA 4R9FA 3L6HA 3SDFA 1Y3PA 1PDAA 3IL1B 4ZDMA 2Z8FA 1LBXA 2KR0A 3RN8A 1OIBA 4NF5B 3FJ7A 2FVZA 1NNTA 5H8HB 4ZE8A 4BDQA 3E79A 2B4MA 4FIMA 4TLLB 2ANJA 1NV4A 4NGUA 4O94A 1OMPA 2F6PA 3C32A 3Q27A 3IOUA 3G3IA 3E13X 1URDA 3V89B 4EQ7A 1YCJA 4OFOA 4JSDA 3TODA 3S9NC 1Y3QA 2XA5A 4MLQA 4PFUA 3M8UA 2FBPA 3DM0A 3K2DA 3MW0A 1FBGA 3RTWB 4PGPA 1RKMA 5I59B 2O7UA 5AA1A 3OO7A 4H8JA 4IO7A 1MM6A 1Z7NE 3LUYA 2XWVA 3TYHA 1OLCA 2I0CA 1A99A 3OENA 4NF8A 5J16A 4U22A 4R9GA 1LFIA 2X26A 1CNQA 4P1LA 3VVEA 4C0RA 3D1RA 3FD3A 5A5XB 1S7YA 4IO6A 3S4UA 1Y20A 4I40A 3LUZA 4PGNA 4DZ1A 2XWIA 3RYDA 2Y7RA 4MH5A 4DE8A 1DSNA 2QVUA 4PCDA 4FEBA 4YB5A 3TKDA 4HE1A 3IR1A 4GQOA 2UVIA 4C1TA 1MH4A 4QHQA 3Q28A 3U93A 1FSAA 3DP6A 4MBPA 3ZKKA 4GBVA 2MKZA 5I2KB 2HXWA 4QF9A 2O51A 1M5EA 3V8XB 4GWYA 4PETA 4GWZA 4R6KA 5CC2A 2PFYA 1N0TA 4RXLA 3LSFB 1MM7A 2THIA 1GR2A 4R74A 4DXUA 2Q8JA 1FTOA 3H6UA 1LAFE 3VFJA 4HS7A 5TP9B 3KFMA 1MY4A 2D3IA 1QUIA 1AIVA 1IMCA 4IGTA 3CRBA 1KA0A 4PFBA 4H0WA 1XHYA 3TQWA 3NOHA 4GWUA 1QUJA 2P3NA 4YKPA 2X7QA 2P0SA 1FJ6A 2PMSA 2JJKA 4Q30B 1NV6A 4XXUA 2WEFA 5AA2A 4OTEA 1FBHA 4TLMB 4WXJA 3HHFA 1EH3A 4IY5A 2F7AA 3RPLA 3Q25A 3ROJA 3PPQA 2XX8A 1B4ZA 2F3BA 1DK4A 3RGYA 1TT1A 4WEPA 3D4GA 4O7IA 3H03A 4FAJA 2XXXA 4O3CA 2OWZA 4GX3A 3CFLA 5JTYA 2FIXA 3MQ9A 2BJJX 1FPJA 4KD5A 5IM2A 3GXAA 1D9VA 3EHUA 2F3DA 2XXRA 4PFIA 5I58A 4QFKA 3VV5A 1FW0A 3ONMA 1LBYA 3FJGA 1A8FA 3K02A 2DDKA 3O6GA 4NF8B 4GXSB 1SW2A 4DCXA 1B05A 4MIJA 2H5YA 5IAIA 1POY1 2I3VA 4L17A 1MDQA 3TZAA 3EHSA 1QKAA 3C35A 5IKBA 4NG7A 1FQFA 3PMVA 4JVDA 4MHFA 4N6DA 2QMXA 3KSXA 4I62A 3SEYA 2XXUA 1LAHE 5CRYA 4EXKA 3A3UA 2ZNSA 1KZ8A 2E1SA 1MQJA 3PGFA 4DIGA 3VVDA 4OESA 1Y4CA 2O7IA 5BUUA 5ET7A 3RT8A 3KC0A 1VSOA 3KOTA 3S9LC 2ZMBA 2WYKA 4I3YA 4JB7A 3TELA 2H25A 1P1OA 3VVFA 3FZVA 5F7VA 2Y84A 3RQTA 2PX1A 1JEVA 5A5LA 1Y9UA 3PPNA 2NXOA 1LAGE 3MP6A 5I3SA 4ZECA 1MXUA 2XXQA 1YYZA 1ZU0A 2OK2A 5ELVA 3O29A 1TWYA 4OFJA 4P9KA 1FTJA 3RPWA 4HW8A 1B51A 1MQHA 1EYKA 1BP5A 1S9TA 4OERA 1FTAA 2R6GE 3H7MA 4G4PA 5AA2B 2AL4A 1P1NA 3LSXA 3G3FA 3RPLB 1FRPA 2F34A 1H43A 3CHGA 1B6HA 2GQ1A 4PAIA 3ZSFA 2ONSA 2QS4A 1A55A 2Y7PA 3FVGA 1GTKA 2WBBA 2ZNTA 2IEEA 1D3KA 1J1NA 4AB6A 4OVJA 4EUOA 4OHNA 3MVXA 5HBCA 1AOVA 3KN7A 2DOJA 5JTYB 4XIGQ 4LA9A 1BKAA 5I56A 5AA4A 3GYYA 1MQIA 2PT2A 3MJNA 5CM6A 2NWJA 1IMFA 5I58B 2UYEA 1MXVA 5K2YA 4EDPA 4FEDA 1ATGA 1MRPA 3FUZA 4R72A 5H8SA 5F1QA 3CG1A 1Q9DA 3TTRA 2XHDA 3C31A 1INPA 1SW5A 1P1QA 3R26A 4LZ7A 1RYOA 3VLUA 2CZIA 4KYEA 3CIJA 4GIZA 1POTA 3H4ZA 1MDP1 4RYAA 4X1DA 3FXQA 3ILTB 5ET5A 1LCTA 3SEVA 4OVSA 1O63A 4MEVA 3IX1A 4JWXA 1LB8A 1SYIA 3K00A 1B3GA 2DE2A 4M4GA 3FV2A 3K4UA 1JVYA 1ELJA 5FBPA 1NFTA 1NKXA 3PMXA 2HFBA 2O69A 5IZZA 1B3LA 3M3FA 2F35A 3C36A 3HHGA 5DTBA 4X48A 1L5TA 1YTVA 2FA7A 1SYHA 3I6VA 1SW4A 3PD8A 4N8GA 1ZIUA 1H76A 1FPLA 3K6VA 4KHZE 2FIEA 1B3FA 1RDYA 4XF5A 2HHMA 3KBRA 1DOTA 1QULA 1LGBC 2CMOA 1B5HA 3K1NA 1HSJA 2XD2A 3UGWA 3EKIA 4MNCA 4QXDA 1B3EA 3IOVA 1OLAA 5I57A 2O84X 1MY3A 5L9MA 2RC9A 3FVOA 1BLFA 1DCUA 2XX7A 2GFEA 5AE4A 1EYJA 3TMGA 1SD3A 4OANA 1NUYA 1PB9A 2QJEA 5H8FA 2PYYA 1FPBA 1GVCA 4XKRA 2P3VA 5CMCA 5IZ3A 1K9ZA 5AA4B 1JEUA 4LZ5A 2O1MA 2HPGA 3IAZA 5EHSA 3U65A 2V3QA 1NL5A 4X1BA 2VD3A 4NAPA 1PC3A 3KZGA 2LAOA 4OVQA 3KGCA 2Z8EA 3LBSA 1JETA 3QMFA 3B50A 1LB9A 5ICQA 3G3GA 3T93B 3IO4A 3DELB 4M1VA 5H8QA 5M2VA 5J1DA 1IXCA 2B3FA 2L5VA 4XKNA 2XXPA 4NF4A 2DSFA 5KDTA 1XI6A 3FVKA 1XT8A 4GL0A 3OMBA 4F18A 1O64A 4OVPA 1UQWA 3N94A 3MYUA 1JP4A 3PV0E 4LVQA 3B6WA 4ISUA 3O6HA 2Q9TA 1Q35A 5I7IA 1NH8A 1IMAA 3PUVE 3HSTA 3U94A 2VPOA 5FHOA 3TTNA 1B7UA 2B3BA 1QJMA 2D5WA 4KYDA 1NNKA 2VOZA 3TPAA 3IK6B 4KCDA 4Q5TA 2V93A 4PP0A 3B8BA 3N5LA 3K01A 5FTHA 1IUDA 3KOSA 2BJIA 2I49A 1A40A 3GBBA 4P0IA 4OETA 1FBFA 3FGSA 4H1XA 5I57B 1FPGA 4G68A 4EF1A 2CZLA 4KXPA 2YJPA 3PUZE 5DVIA 3TCGA 5LOMA 3OOAA 1I6AA 1AH5A 4N4UA 5H8FB 1N7XA 3MVWA 4NHBA 3RTFB 3HO7A 5TPAA 1M5CA 4FORA 3MUQA 5T3JA 3SZPA 3EF7A 1H44A 5IZ3B 1SVXB 4OVTA 4XFEA 3O66A 3MC2A 2QMWA 4P11A 2ABHA 3O6IA 3VE1B 1MQGA 5KZTA 4KFQA 3T9XB 4O3AA 4EXLA 2H4IA 1SW1A 4IO4A 3EPEA 4F22A 5EQ9A 3H3GA 1NV3A 1II5A 2A5SA 4PF8A 4U4XA 1DTZA 3OD7A 4ONYA 4NF4B 1IITA 5KDTB 1SDXA 1H45A 1B7ZA 1I6BA 1LCFA 3GZGA 1DMBA 1NUWA 2CZHA 4HXVA 5L8DA 4GWOA 3FASA 3UA8A 1G0HA 2V4CA 4F2QA 4THIA 1PBPA 1XVXA 3O9PA 2F6GA 3MZ9A 4LUBA 2Y7KA 4GF8A 1VR5A 3L6GA 3D4CA 4U2RA 2XXVA 3N6TA 4X9TA 1B3HA 5FHNA 2B4LA 5DVJA 3IOWA 1Q1KA 1MY2A 3LR1A 3N6UA 3V5AA 4Z0IA 1QKBA 3H6VA 2HZKA 2PT1A 3PU5A 3KN8A 3B7DA 1Y3NA 4F1YA 2V3TA 3SETA 4Z7EA 4P1EA 4IR8A 4GVOA 4NX1A 2CEYA 3IORA 1XC1A 3T9VA 3KN3A 4QSCA 4EQ9A 4H5GA 4U1OA 1LSTA 2QSXA 3RY3A 2ZYMA 2VHAA 3BBRA 3IB0A 4KI0E 4ND9A 2I58A 2I0BA 3PTYA 4MNPA 3MP8A 2RF1A 3S2VA 3KEIA 3IFAA 4DI4B 3W9WA 4QSEA 2I4CA 3JYRA 4XKPA 4OA4A 2ZYNA 1NV0A 3U8QA 4PFWA 2QPQA 4LP2B 2AIXA 2DXYA 1IIWA 3EN3A 3KJ7A 3S9MC 2Q89A 2ONRA 1NV2A 3CSGA 1IZ1A 5DEXA 3MVYA 3TCHA 1R9QA 3FJMA 3T1BA 4PDDA 5EYFA 5ITOA 1A7LA 4OEUA 3TCFA 1B9JA 3MZBA 3DP8A 4LQ5A 1MY0A 4OWDA 2RINA 4FBPA 4DXBA 4QBAA 4N8YA 2UVHA 2DXRA 2QS3A 3CR9A 2RCAA 2Y5LA 4U1ZA 5ICTA 3CFZA 5EYGA 4LN5A 1RDXA 4OVRA 3TTMA 1EU8A 4I3EA 1B5JA 2R9JA 1M5DA 1ZLQA 1M5FA 3GLBA 2P2AA 2DVCA 2G29A 4BDRA 1NNFA 5EYHA 5ITPA 4ECFA 2I3WA 1IXHA 4H45A 4MX6A 2FYIA 1IMDA 1FTMA 3W15C 1JW5A 2V84A 3Q26A 1OQHA 3UP9A 3B6TA 4YKIA 3LSWA 1HSEA 2XWKA 2XXYA 4PBQA 3O28A 1R1NA 5HPQA 3G3HA 2XXKA 3K1MA 1R9LA 3MVZA 3QUFA 2Z8DA 2ZZVA 4JWYA 3A09A 1MG1A 4IO2A 2XXWA 4YMBA 2OLBA 2DP8A 3IFCA 1FBEA 4OFLA 2WBDA 5FHMA 3SEWA 2IA4A 4N91A 5DYHA 4BDMA 2YPNA 2UVGA 2F36A 4H65A 2F97A 4UA8A 3QK6A 4YU0A 4QFPA 5KCJA 3A3CA 4IO5A 3TEPA 4GX4A 3VXCA 1BK4A 3TFLA 1FPEA 3MSTA 4FJPA 3RNNA 1US4A 1P1UA 3AXFA 1B1XA 2NOOA 1URGA 5HM4B 1WDNA 4OENA 4ZZEA 2Z22A 4U4SA 1AMFA 3Q29A 1MXZA 1DTGA 1N3XA 5DEXB 4OQOA 1N04A 2YLNA 2OJTA 3R7XA 1LBCA 4EF2A 2CEXA 4H5FA 4KYSA 4XKQA 3H6WA 2Y7IA 4GFRA 4NN3A 4YB7A 1ZKBA 1R6ZA 4H46A 4RNSA 4RJZA 5EQ8A 4NF6A 2ONKE 1B58A 2Q8MA 4H6DA 4PDHA 2AYSA 3PUWE 1BIYA 3WAFA 2DE3A 4ZEFA 4ZEIA 1NV7A 1FQCA 1B0LA 3CI8A 1SPIA 1FTKA 3RUMA 4YKJA 4BDOA 3U72A 4IB2A 3C9HA 2PVUA 3THIA 3FXRA 4PC9A 4I9DA 4DI3D 1LFGA 4G8HA 5K2XA 3N26A 1SQYA 2OBGA 5F24A 3OO9A 4KQPA 2QVRA 4POWA 2DE4A 1GV8A 3E3KA 4F3BA 1FPDA 2RC8A 3V83A 3G7WA 4X04A 4O8MA 5I5PA 5EQAA 2QS1A 3E4RA 1I6QA 4I8CA 2PBWA 1RYXA 4JXIA 1YZ0A 4F1UA 4ZEBA 3TDJA 5I56B 1PB7A 1NUXA 3U92A 4N13A 3FV1A 5I59A 1OVTA 2ESNA 2VP1A 3EQ1A 4AQ4A 2DS9A 4N6PA 3QUJA 1LBWA 5KCJB 4E0XA 4GXAA 3K1PA 1P99A 1XOCA 1RDZA 4YZZA 2DVZA 4G2ZA 3CFXA 2HZLA 5JEIA 4RA1A 3IOTA 4NEDA 1B0HA 5CBSA 4QSDA 3TAJA 1B4HA 1WVJA 2ZZWA 1USYH 1HSLA 2OWTA 1LEVA 2ZZXA 2NVUB 4LQ2A 3IB1A 3T96B 3K0VA 2GHBA 4GL8A 4ZEKA 5IZ1A 4NMYA 4U21A 4GWXA 2HAVA 1MH3A 3FATA 1LAXA 2R71A 2I4BA 3P7IA 2QRYA 1MPCA 1FPFA 3GBAA 3BFUA 3T9HB 1FBPA 3UN6A 3F11A 4F2OA 1LBBA 4MF3A 4MCOA 4JVCA 4NWCA 1VFDA 4MFIA 1YPNA 4RK9A 2O68A 1FQBA 1Z7ME 3OEKA 1FQEA 4OXVA 1AWBA 4OZ9A 2VPNA 3VDFA 1MPDA 1Y1MA 3HCQA 1DBZA 1A8EA 4X8RA 3E78A 4F1VA 1JW1A 4IGRA 4ZS9A 4AS5A 1MY1A 2F7BA 3IO6A 5B7DA 2UYFA 2HEUA 3C33A 4KCCA 1FPKA 4QFOA 1PB8A 2GRVA 3BFTA 3TTKA 4G77A 1DPPA 4JVIA 5LDZA 4KR5A 4O3BA 4H8IA 2PFZA 4F31B 4ELPA 2ZYKA 4P0GA 1ANFA 1MQDA 4DCYA 4N17A 2HQ0A 3VXBA 1IMBA 4NWDA 3CSBA 3UK4A 4FE8A 3FIRA 3IB2A 5EQ7A 3UORA 3ECRA 2Z23A 2P1SA 1QUKA 4NQ8A 4R6HA 2KLFA 1GGGA 3K6UA 2VT5A 5H8QB 3A29A 1FBDA 4R75A 2O6AA 1N84A 3IJXB 4RPNA 2F78A 2I6EA 2WKYA 4FATA 4LZ8A 3PUYE 3VLVA 3G3JA 2ALUA 3USDA 1LBZA 4YB6A 4AB5A 2VD2A 1IQ7A 1MXYA 4JDFA 5L9OA 4U23A 3T66A 3SEXA 1IEJA 3KG2A 4PF6A 2RKMA 1FPIA 2A5TA 4EQBA 2KQZA 3T0JA 1LLSA 4NF0A 3I5OA 1OQGA 2UVJA 3KBZA 3TUSA 1MPBA 4YMAA 4R2BA 4K3FA 3H06B 1UTBA 3MZ1A 1NH7A 3QYTA 1VFEA 1LBVA 3MWBA 3PUXE 4LATA 1B5IA 3BIHA 2XWOA 1LFHA 2XXTA 4YICA 2F8DA 4Q8RA 1B1HA 1D9QA 1VE4A 4POXA 5DW8A 3QXMA 2F5XA 4C1UA 4WKMA 5TU0A 1QGXA 2UXAA 2VGQA 1AL3A 4G68B 4H67A 4GX6A 1Y1ZA 4F3PA 3FBPA 4UABA 3PPOA 5AA2D 2X7PA 5AA3A 1MXWA 4IO3A 1B40A 3EHTA 3IJOB 1QW0A 4G68C 2QL3A 4PAFA 2B65A 3MAMA 4O7MA 3U1OA 4F29A 2FNCA 4F19A 5TPAB 2Q2AA 5LTCA 1MS7A 1WODA 4LONB 1K9YA 4PQJA 2RCBA 1USYE 3O97A 5CMBA 3S9EA 3FXBA 5IGAA 4PFTA 4UACA 4F39A 1S50A 1NUZA 1SI0A 4ZE9A
chains in the Genus database with same CATH topology
3DLNA 3M3KA 4ZZAA 2HCAA 5L9SA 5CI5A 2OWSA 2I48A 4OEVA 5H8NA 3TTLA 3WAEA 3ODBA 2REGA 3SERA 4IY6A 1KWHA 3M3LA 3KSJA 1TFDA 5JK4A 5B70A 4NTLA 3QIMA 4HCWA 4DXCA 4DDDA 3CVGA 2DWHA 2A5TB 4ZEDA 1CE2A 3OSQA 2DQVA 4XTCQ 2OZZA 2H99A 1NMUA 3CG3A 5CBRA 4YKKA 1ZBMA 1ZMGA 4RPOA 1UTBB 2HAUA 1FTLA 1B7HA 4G8NA 3QSLA 1OVBA 2V25A 1XS5A 5EHMA 3RLFE 1ZTYA 4F3GA 1B2HA 3QAXA 3HN0A 3RT6B 4KPTA 4F3SA 3I3VA 4TOZA 3TQLA 2H9BA 4I1DA 3MP1A 4ESWA 4QRZA 3JV9A 2ZNUA 1UIUA 1JNFA 1EZ9A 2OCUA 4N07A 1JQFA 4JBZA 5I84A 2V3UA 3SKPA 2G93A 3PPRA 3OO8A 3FXUA 1XVYA 3HV1A 2RC7A 3JZJA 1URSA 5ISUA 3ILUB 3G3KA 1IXIA 2NUVA 4BDNA 1F9BA 2DWAA 1D4NA 4G8MA 5H8NB 5CMMA 3DP4A 4OMBA 1FQAA 1FQDA 4TQUQ 2ZYOA 3SEUA 1IXGA 5I2NA 3MBPA 1P1WA 3R6UA 4PFYA 1SBPA 2M8CA 4HTGA 1US5A 4ELQA 1D9YA 4GOTA 4JSOA 1ZJLA 1H3DA 4ELOA 2AL5A 3E9XA 1B52A 3LSLA 4E0WA 1UTHA 4RK2A 3K6XA 4WEDA 2Y7WA 1UIVA 1M5BA 1MXXA 4BLAA 1I69A 2E0SA 3O2AA 2Q2CA 1JVXA 2Q88A 4NF5A 1QVSA 2W7YA 5H8HA 2REJA 1B46A 4GRKA 1TFAA 3MPKA 2O1LA 2XD3A 3H6TA 3ZS6A 1O7TA 4NE4A 1B32A 2DWIA 3K6WA 1Y4TA 4GLIA 3HPIA 3PPPA 4HCYA 3PMWA 3OELA 3B6QA 4GD5A 2ZXTA 4QFNA 5FTIA 4BDLA 5DVFA 3ZKLA 1CB6A 1YAEA 1FCKA 4RY1A 1N3WA 5CMKA 1JW4A 1T0KA 4PE5B 2XX9A 3OO6A 2GH9A 3C34A 1PEBA 2GHAA 2XXHA 4YAHX 1A54A 3OEMA 1N7WA 2D21A 4Q0CA 3SESA 3MPLA 2DYXA 5A5XA 4DLDA 1SI1A 4OYVA 4R6YA 3LC8A 3UIFA 3PD9A 3W9VA 1EZOA 1EZPA 4R2FA 3BKIB 4QFLA 1NNPA 5DT6A 2H98A 5I2NB 5I2KA 1TXFA 3T9UA 5BWJA 3OXNA 4FECA 1PBQA 4ELRA 4JWOA 4NF6B 2DWJA 3KJTA 4ESXA 3C4MA 5TP9A 1N76A 3FVNA 4MLVA 3T22A 2QS2A 1UTHB 1BTJA 2XXIA 3VLWA 1DPEA 3OSRA 4R73A 2F7CA 4R9FA 3L6HA 3SDFA 1Y3PA 1PDAA 3IL1B 4ZDMA 2Z8FA 3RN8A 1OIBA 4NF5B 3FJ7A 1NNTA 5H8HB 4ZE8A 4BDQA 4FIMA 4TLLB 2ANJA 1OMPA 2F6PA 3C32A 3Q27A 3IOUA 3G3IA 3E13X 1URDA 3V89B 4EQ7A 1YCJA 4OFOA 4JSDA 3TODA 3S9NC 1Y3QA 4MLQA 4PFUA 3M8UA 3DM0A 3K2DA 3MW0A 3RTWB 1RKMA 5I59B 2O7UA 5AA1A 3OO7A 4H8JA 4IO7A 1MM6A 1Z7NE 3LUYA 3TYHA 1OLCA 2I0CA 1A99A 3OENA 4NF8A 4U22A 4R9GA 1LFIA 2X26A 3VVEA 4C0RA 5A5XB 3FD3A 1S7YA 4IO6A 3S4UA 1Y20A 4DZ1A 2Y7RA 4MH5A 4DE8A 1DSNA 4FEBA 4YB5A 3TKDA 3IR1A 4GQOA 2UVIA 4C1TA 1MH4A 4QHQA 3Q28A 3U93A 4MBPA 3DP6A 3ZKKA 5I2KB 2HXWA 4QF9A 2O51A 1M5EA 3V8XB 4PETA 4R6KA 5CC2A 1N0TA 4RXLA 3LSFB 1MM7A 2THIA 1GR2A 4R74A 4DXUA 2Q8JA 1FTOA 3H6UA 1LAFE 3VFJA 4HS7A 5TP9B 3KFMA 1MY4A 2D3IA 1QUIA 1AIVA 4IGTA 3CRBA 4H0WA 1XHYA 3TQWA 1QUJA 4YKPA 2X7QA 2P0SA 2PMSA 4Q30B 4XXUA 5AA2A 4OTEA 4TLMB 4WXJA 3HHFA 1EH3A 4IY5A 2F7AA 3Q25A 3PPQA 2XX8A 1B4ZA 3RGYA 1TT1A 4WEPA 3D4GA 3H03A 4FAJA 2XXXA 4O3CA 3CFLA 5JTYA 3MQ9A 2BJJX 4KD5A 3GXAA 1D9VA 3EHUA 2XXRA 5I58A 4QFKA 3VV5A 1FW0A 3ONMA 3FJGA 1A8FA 3K02A 3O6GA 4NF8B 4GXSB 1SW2A 4DCXA 1B05A 2H5YA 5IAIA 1POY1 2I3VA 4L17A 1MDQA 3TZAA 3EHSA 1QKAA 3C35A 5IKBA 1FQFA 3PMVA 2QMXA 3KSXA 4I62A 3SEYA 2XXUA 1LAHE 5CRYA 4EXKA 3A3UA 2ZNSA 2E1SA 1MQJA 3PGFA 4DIGA 3VVDA 4OESA 1Y4CA 2O7IA 5BUUA 3RT8A 1VSOA 3KOTA 3S9LC 2ZMBA 4JB7A 3TELA 2H25A 1P1OA 3VVFA 3FZVA 5F7VA 2Y84A 3RQTA 2PX1A 1JEVA 1Y9UA 3PPNA 2NXOA 1LAGE 3MP6A 4ZECA 1MXUA 2XXQA 1ZU0A 2OK2A 5ELVA 3O29A 1TWYA 4OFJA 3RPWA 1FTJA 4HW8A 1B51A 1MQHA 1BP5A 1S9TA 4OERA 2R6GE 3H7MA 4G4PA 5AA2B 2AL4A 1P1NA 3LSXA 3G3FA 2F34A 1H43A 1B6HA 3ZSFA 2ONSA 2QS4A 1A55A 2Y7PA 3FVGA 1GTKA 2ZNTA 2IEEA 1D3KA 1J1NA 4AB6A 4OVJA 4EUOA 4OHNA 3MVXA 5HBCA 1AOVA 3KN7A 2DOJA 5JTYB 4XIGQ 4LA9A 1BKAA 5I56A 5AA4A 1MQIA 2PT2A 3MJNA 5CM6A 2NWJA 5I58B 2UYEA 1MXVA 5K2YA 4EDPA 4FEDA 1ATGA 1MRPA 3FUZA 4R72A 5H8SA 5F1QA 3CG1A 3TTRA 2XHDA 3C31A 1SW5A 1P1QA 3R26A 4LZ7A 1RYOA 3VLUA 4KYEA 3CIJA 4GIZA 1POTA 3H4ZA 1MDP1 4RYAA 4X1DA 3FXQA 3ILTB 1LCTA 3SEVA 1O63A 3IX1A 4JWXA 1LB8A 1SYIA 3K00A 1B3GA 2DE2A 4M4GA 3FV2A 3K4UA 1JVYA 1ELJA 1NFTA 1NKXA 3PMXA 2HFBA 2O69A 1B3LA 3M3FA 2F35A 3C36A 3HHGA 5DTBA 4X48A 1L5TA 1YTVA 2FA7A 1SYHA 3I6VA 1SW4A 3PD8A 1ZIUA 1H76A 3K6VA 4KHZE 1B3FA 3KBRA 1DOTA 1QULA 1LGBC 2CMOA 1B5HA 3K1NA 1HSJA 2XD2A 3UGWA 1B3EA 3IOVA 1OLAA 5I57A 2O84X 1MY3A 5L9MA 2RC9A 3FVOA 1BLFA 2XX7A 2GFEA 5AE4A 3TMGA 1SD3A 1PB9A 2QJEA 5H8FA 2PYYA 1GVCA 4XKRA 5CMCA 5AA4B 1JEUA 4LZ5A 2O1MA 3IAZA 5EHSA 2V3QA 1NL5A 4X1BA 2VD3A 1PC3A 3KZGA 2LAOA 3KGCA 2Z8EA 3LBSA 1JETA 1LB9A 5ICQA 3G3GA 3T93B 3IO4A 3DELB 4M1VA 5H8QA 5M2VA 5J1DA 1IXCA 2B3FA 4XKNA 2XXPA 4NF4A 2DSFA 5KDTA 3FVKA 1XT8A 4GL0A 3OMBA 4F18A 1O64A 1UQWA 3N94A 3PV0E 4LVQA 3B6WA 4ISUA 3O6HA 2Q9TA 1Q35A 1NH8A 3PUVE 3HSTA 3U94A 5FHOA 3TTNA 1B7UA 2B3BA 1QJMA 2D5WA 4KYDA 1NNKA 2VOZA 3TPAA 3IK6B 4KCDA 4Q5TA 2V93A 4PP0A 3N5LA 3K01A 5FTHA 1IUDA 3KOSA 2I49A 1A40A 3GBBA 4P0IA 4OETA 3FGSA 4H1XA 5I57B 4G68A 4EF1A 2CZLA 2YJPA 3PUZE 5DVIA 3TCGA 5LOMA 3OOAA 1I6AA 1AH5A 5H8FB 1N7XA 3MVWA 3RTFB 3HO7A 5TPAA 1M5CA 4FORA 3MUQA 3EF7A 1H44A 1SVXB 3O66A 3MC2A 2QMWA 4P11A 2ABHA 3O6IA 3VE1B 1MQGA 5KZTA 4KFQA 3T9XB 4O3AA 4EXLA 2H4IA 1SW1A 4IO4A 3EPEA 4F22A 3H3GA 1II5A 2A5SA 4U4XA 1DTZA 3OD7A 4ONYA 4NF4B 1IITA 5KDTB 1SDXA 1H45A 1B7ZA 1I6BA 1LCFA 3GZGA 1DMBA 5L8DA 4GWOA 3FASA 3UA8A 4F2QA 4THIA 1PBPA 1XVXA 3O9PA 2F6GA 3MZ9A 4LUBA 2Y7KA 4GF8A 1VR5A 3L6GA 3D4CA 4U2RA 2XXVA 3N6TA 4X9TA 1B3HA 5FHNA 5DVJA 3IOWA 1Q1KA 1MY2A 3LR1A 3N6UA 3V5AA 4Z0IA 1QKBA 3H6VA 2HZKA 2PT1A 3PU5A 3KN8A 3B7DA 1Y3NA 4F1YA 2V3TA 3SETA 4Z7EA 4GVOA 3IORA 1XC1A 3T9VA 3KN3A 4QSCA 4EQ9A 4H5GA 4U1OA 1LSTA 2QSXA 3RY3A 2ZYMA 2VHAA 3BBRA 3IB0A 4KI0E 4ND9A 2I58A 2I0BA 3MP8A 2RF1A 3S2VA 3KEIA 3W9WA 4QSEA 2I4CA 3JYRA 4XKPA 2ZYNA 3U8QA 4PFWA 2QPQA 4LP2B 2AIXA 2DXYA 1IIWA 3EN3A 3KJ7A 3S9MC 2Q89A 2ONRA 3CSGA 1IZ1A 5DEXA 3MVYA 3TCHA 1R9QA 3FJMA 5EYFA 5ITOA 1A7LA 4OEUA 3TCFA 1B9JA 3MZBA 3DP8A 4LQ5A 1MY0A 4OWDA 2RINA 4DXBA 2UVHA 2DXRA 2QS3A 3CR9A 2RCAA 4U1ZA 5ICTA 3CFZA 3TTMA 1EU8A 1B5JA 2R9JA 1M5DA 1ZLQA 1M5FA 3GLBA 2P2AA 2DVCA 2G29A 4BDRA 1NNFA 5ITPA 4ECFA 2I3WA 1IXHA 2FYIA 1FTMA 3W15C 1JW5A 2V84A 3Q26A 1OQHA 3UP9A 3B6TA 4YKIA 3LSWA 1HSEA 2XXYA 3O28A 1R1NA 5HPQA 3G3HA 3K1MA 1R9LA 3MVZA 3QUFA 2Z8DA 4JWYA 3A09A 1MG1A 4IO2A 2XXWA 4YMBA 2OLBA 2DP8A 4OFLA 5FHMA 3SEWA 2IA4A 5DYHA 4BDMA 2YPNA 2UVGA 2F36A 4H65A 2F97A 4UA8A 3QK6A 4YU0A 4QFPA 5KCJA 3A3CA 4IO5A 3TEPA 3VXCA 3TFLA 4FJPA 3RNNA 1US4A 1P1UA 3AXFA 1B1XA 2NOOA 1URGA 5HM4B 1WDNA 4OENA 4ZZEA 2Z22A 4U4SA 1AMFA 3Q29A 1MXZA 1DTGA 1N3XA 5DEXB 4OQOA 1N04A 2YLNA 2OJTA 3R7XA 1LBCA 4EF2A 4H5FA 4KYSA 4XKQA 3H6WA 2Y7IA 4GFRA 4YB7A 1ZKBA 1R6ZA 4RNSA 4RJZA 4NF6A 2ONKE 1B58A 4H6DA 2AYSA 3PUWE 1BIYA 3WAFA 2DE3A 4ZEFA 4ZEIA 1FQCA 1B0LA 3CI8A 3RUMA 1FTKA 4YKJA 4BDOA 3U72A 4IB2A 3C9HA 2PVUA 3THIA 3FXRA 4I9DA 1LFGA 4G8HA 5K2XA 3N26A 1SQYA 2OBGA 3OO9A 4KQPA 4POWA 2DE4A 1GV8A 3E3KA 4F3BA 2RC8A 3V83A 3G7WA 2QS1A 3E4RA 1I6QA 4I8CA 2PBWA 1RYXA 4JXIA 4F1UA 4ZEBA 3TDJA 5I56B 1PB7A 3U92A 4N13A 3FV1A 5I59A 1OVTA 2ESNA 2VP1A 3EQ1A 4AQ4A 2DS9A 4N6PA 3QUJA 5KCJB 4E0XA 4GXAA 3K1PA 1P99A 1XOCA 4YZZA 2DVZA 4G2ZA 3CFXA 2HZLA 5JEIA 4RA1A 3IOTA 4NEDA 1B0HA 5CBSA 4QSDA 3TAJA 1B4HA 1WVJA 1USYH 1HSLA 2OWTA 2NVUB 4LQ2A 3IB1A 3T96B 3K0VA 2GHBA 4GL8A 4ZEKA 4NMYA 4U21A 2HAVA 1MH3A 3FATA 1LAXA 2R71A 2I4BA 3P7IA 2QRYA 1MPCA 3GBAA 3BFUA 3T9HB 3UN6A 3F11A 4F2OA 1LBBA 4MF3A 4NWCA 1VFDA 4MFIA 1YPNA 4RK9A 2O68A 1FQBA 1Z7ME 3OEKA 1FQEA 4OXVA 4OZ9A 3VDFA 1MPDA 1Y1MA 3HCQA 1A8EA 4F1VA 1JW1A 4IGRA 4ZS9A 1MY1A 2F7BA 3IO6A 5B7DA 2UYFA 2HEUA 3C33A 4KCCA 4QFOA 1PB8A 2GRVA 3BFTA 3TTKA 4G77A 1DPPA 4KR5A 4O3BA 4H8IA 4F31B 4ELPA 2ZYKA 4P0GA 1ANFA 1MQDA 4DCYA 2HQ0A 3VXBA 4NWDA 3CSBA 3UK4A 4FE8A 3FIRA 3IB2A 3UORA 3ECRA 2Z23A 2P1SA 1QUKA 4R6HA 2KLFA 1GGGA 3K6UA 5H8QB 4R75A 2O6AA 1N84A 3IJXB 4RPNA 2F78A 2I6EA 2WKYA 4FATA 4LZ8A 3PUYE 3VLVA 3G3JA 2ALUA 3USDA 4YB6A 4AB5A 2VD2A 1IQ7A 1MXYA 4JDFA 5L9OA 4U23A 3T66A 3SEXA 1IEJA 3KG2A 2RKMA 2A5TA 4EQBA 1LLSA 3I5OA 1OQGA 2UVJA 3TUSA 1MPBA 4YMAA 4R2BA 4K3FA 3H06B 1UTBA 3MZ1A 1NH7A 3QYTA 1VFEA 3MWBA 3PUXE 4LATA 1B5IA 1LFHA 2XXTA 4YICA 2F8DA 4Q8RA 1B1HA 1VE4A 4POXA 3QXMA 2F5XA 4C1UA 4WKMA 5TU0A 2VGQA 2UXAA 1AL3A 4G68B 4H67A 4F3PA 1Y1ZA 3PPOA 5AA2D 2X7PA 5AA3A 1MXWA 4IO3A 1B40A 3EHTA 3IJOB 1QW0A 4G68C 2QL3A 2B65A 3MAMA 3U1OA 4F29A 2FNCA 4F19A 5TPAB 2Q2AA 1MS7A 1WODA 4LONB 4PQJA 2RCBA 1USYE 3O97A 5CMBA 3S9EA 4PFTA 4UACA 4F39A 1S50A 1SI0A 4ZE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLN A;  3M3K A;  4ZZA A;  2HCA A;  5L9S A;  5CI5 A;  2OWS A;  2I48 A;  4OEV A;  5H8N A;  3TTL A;  3WAE A;  3ODB A;  2REG A;  3SER A;  4IY6 A;  1KWH A;  3M3L A;  3KSJ A;  1TFD A;  5JK4 A;  5B70 A;  4NTL A;  3QIM A;  4HCW A;  4DXC A;  4DDD A;  3CVG A;  2DWH A;  2A5T B;  4ZED A;  1CE2 A;  3OSQ A;  2DQV A;  4XTC Q;  2OZZ A;  2H99 A;  1NMU A;  3CG3 A;  5CBR A;  4YKK A;  1ZBM A;  1ZMG A;  4RPO A;  1UTB B;  2HAU A;  1FTL A;  1B7H A;  4G8N A;  3QSL A;  1OVB A;  2V25 A;  1XS5 A;  5EHM A;  3RLF E;  1ZTY A;  4F3G A;  1B2H A;  3QAX A;  3HN0 A;  3RT6 B;  4KPT A;  4F3S A;  3I3V A;  4TOZ A;  3TQL A;  2H9B A;  4I1D A;  3MP1 A;  4ESW A;  4QRZ A;  3JV9 A;  2ZNU A;  1UIU A;  1JNF A;  1EZ9 A;  2OCU A;  4N07 A;  1JQF A;  4JBZ A;  5I84 A;  2V3U A;  3SKP A;  2G93 A;  3PPR A;  3OO8 A;  3FXU A;  1XVY A;  3HV1 A;  2RC7 A;  3JZJ A;  1URS A;  5ISU A;  3ILU B;  3G3K A;  1IXI A;  2NUV A;  4BDN A;  1F9B A;  2DWA A;  1D4N A;  4G8M A;  5H8N B;  5CMM A;  3DP4 A;  4OMB A;  1FQA A;  1FQD A;  4TQU Q;  2ZYO A;  3SEU A;  1IXG A;  5I2N A;  3MBP A;  1P1W A;  3R6U A;  4PFY A;  1SBP A;  2M8C A;  4HTG A;  1US5 A;  4ELQ A;  1D9Y A;  4GOT A;  4JSO A;  1ZJL A;  1H3D A;  4ELO A;  2AL5 A;  3E9X A;  1B52 A;  3LSL A;  4E0W A;  1UTH A;  4RK2 A;  3K6X A;  4WED A;  2Y7W A;  1UIV A;  1M5B A;  1MXX A;  4BLA A;  1I69 A;  2E0S A;  3O2A A;  2Q2C A;  1JVX A;  2Q88 A;  4NF5 A;  1QVS A;  2W7Y A;  5H8H A;  2REJ A;  1B46 A;  4GRK A;  1TFA A;  3MPK A;  2O1L A;  2XD3 A;  3H6T A;  3ZS6 A;  1O7T A;  4NE4 A;  1B32 A;  2DWI A;  3K6W A;  1Y4T A;  4GLI A;  3HPI A;  3PPP A;  4HCY A;  3PMW A;  3OEL A;  3B6Q A;  4GD5 A;  2ZXT A;  4QFN A;  5FTI A;  4BDL A;  5DVF A;  3ZKL A;  1CB6 A;  1YAE A;  1FCK A;  4RY1 A;  1N3W A;  5CMK A;  1JW4 A;  1T0K A;  4PE5 B;  2XX9 A;  3OO6 A;  2GH9 A;  3C34 A;  1PEB A;  2GHA A;  2XXH A;  4YAH X;  1A54 A;  3OEM A;  1N7W A;  2D21 A;  4Q0C A;  3SES A;  3MPL A;  2DYX A;  5A5X A;  4DLD A;  1SI1 A;  4OYV A;  4R6Y A;  3LC8 A;  3UIF A;  3PD9 A;  3W9V A;  1EZO A;  1EZP A;  4R2F A;  3BKI B;  4QFL A;  1NNP A;  5DT6 A;  2H98 A;  5I2N B;  5I2K A;  1TXF A;  3T9U A;  5BWJ A;  3OXN A;  4FEC A;  1PBQ A;  4ELR A;  4JWO A;  4NF6 B;  2DWJ A;  3KJT A;  4ESX A;  3C4M A;  5TP9 A;  1N76 A;  3FVN A;  4MLV A;  3T22 A;  2QS2 A;  1UTH B;  1BTJ A;  2XXI A;  3VLW A;  1DPE A;  3OSR A;  4R73 A;  2F7C A;  4R9F A;  3L6H A;  3SDF A;  1Y3P A;  1PDA A;  3IL1 B;  4ZDM A;  2Z8F A;  3RN8 A;  1OIB A;  4NF5 B;  3FJ7 A;  1NNT A;  5H8H B;  4ZE8 A;  4BDQ A;  4FIM A;  4TLL B;  2ANJ A;  1OMP A;  2F6P A;  3C32 A;  3Q27 A;  3IOU A;  3G3I A;  3E13 X;  1URD A;  3V89 B;  4EQ7 A;  1YCJ A;  4OFO A;  4JSD A;  3TOD A;  3S9N C;  1Y3Q A;  4MLQ A;  4PFU A;  3M8U A;  3DM0 A;  3K2D A;  3MW0 A;  3RTW B;  1RKM A;  5I59 B;  2O7U A;  5AA1 A;  3OO7 A;  4H8J A;  4IO7 A;  1MM6 A;  1Z7N E;  3LUY A;  3TYH A;  1OLC A;  2I0C A;  1A99 A;  3OEN A;  4NF8 A;  4U22 A;  4R9G A;  1LFI A;  2X26 A;  3VVE A;  4C0R A;  5A5X B;  3FD3 A;  1S7Y A;  4IO6 A;  3S4U A;  1Y20 A;  4DZ1 A;  2Y7R A;  4MH5 A;  4DE8 A;  1DSN A;  4FEB A;  4YB5 A;  3TKD A;  3IR1 A;  4GQO A;  2UVI A;  4C1T A;  1MH4 A;  4QHQ A;  3Q28 A;  3U93 A;  4MBP A;  3DP6 A;  3ZKK A;  5I2K B;  2HXW A;  4QF9 A;  2O51 A;  1M5E A;  3V8X B;  4PET A;  4R6K A;  5CC2 A;  1N0T A;  4RXL A;  3LSF B;  1MM7 A;  2THI A;  1GR2 A;  4R74 A;  4DXU A;  2Q8J A;  1FTO A;  3H6U A;  1LAF E;  3VFJ A;  4HS7 A;  5TP9 B;  3KFM A;  1MY4 A;  2D3I A;  1QUI A;  1AIV A;  4IGT A;  3CRB A;  4H0W A;  1XHY A;  3TQW A;  1QUJ A;  4YKP A;  2X7Q A;  2P0S A;  2PMS A;  4Q30 B;  4XXU A;  5AA2 A;  4OTE A;  4TLM B;  4WXJ A;  3HHF A;  1EH3 A;  4IY5 A;  2F7A A;  3Q25 A;  3PPQ A;  2XX8 A;  1B4Z A;  3RGY A;  1TT1 A;  4WEP A;  3D4G A;  3H03 A;  4FAJ A;  2XXX A;  4O3C A;  3CFL A;  5JTY A;  3MQ9 A;  2BJJ X;  4KD5 A;  3GXA A;  1D9V A;  3EHU A;  2XXR A;  5I58 A;  4QFK A;  3VV5 A;  1FW0 A;  3ONM A;  3FJG A;  1A8F A;  3K02 A;  3O6G A;  4NF8 B;  4GXS B;  1SW2 A;  4DCX A;  1B05 A;  2H5Y A;  5IAI A;  1POY 1;  2I3V A;  4L17 A;  1MDQ A;  3TZA A;  3EHS A;  1QKA A;  3C35 A;  5IKB A;  1FQF A;  3PMV A;  2QMX A;  3KSX A;  4I62 A;  3SEY A;  2XXU A;  1LAH E;  5CRY A;  4EXK A;  3A3U A;  2ZNS A;  2E1S A;  1MQJ A;  3PGF A;  4DIG A;  3VVD A;  4OES A;  1Y4C A;  2O7I A;  5BUU A;  3RT8 A;  1VSO A;  3KOT A;  3S9L C;  2ZMB A;  4JB7 A;  3TEL A;  2H25 A;  1P1O A;  3VVF A;  3FZV A;  5F7V A;  2Y84 A;  3RQT A;  2PX1 A;  1JEV A;  1Y9U A;  3PPN A;  2NXO A;  1LAG E;  3MP6 A;  4ZEC A;  1MXU A;  2XXQ A;  1ZU0 A;  2OK2 A;  5ELV A;  3O29 A;  1TWY A;  4OFJ A;  3RPW A;  1FTJ A;  4HW8 A;  1B51 A;  1MQH A;  1BP5 A;  1S9T A;  4OER A;  2R6G E;  3H7M A;  4G4P A;  5AA2 B;  2AL4 A;  1P1N A;  3LSX A;  3G3F A;  2F34 A;  1H43 A;  1B6H A;  3ZSF A;  2ONS A;  2QS4 A;  1A55 A;  2Y7P A;  3FVG A;  1GTK A;  2ZNT A;  2IEE A;  1D3K A;  1J1N A;  4AB6 A;  4OVJ A;  4EUO A;  4OHN A;  3MVX A;  5HBC A;  1AOV A;  3KN7 A;  2DOJ A;  5JTY B;  4XIG Q;  4LA9 A;  1BKA A;  5I56 A;  5AA4 A;  1MQI A;  2PT2 A;  3MJN A;  5CM6 A;  2NWJ A;  5I58 B;  2UYE A;  1MXV A;  5K2Y A;  4EDP A;  4FED A;  1ATG A;  1MRP A;  3FUZ A;  4R72 A;  5H8S A;  5F1Q A;  3CG1 A;  3TTR A;  2XHD A;  3C31 A;  1SW5 A;  1P1Q A;  3R26 A;  4LZ7 A;  1RYO A;  3VLU A;  4KYE A;  3CIJ A;  4GIZ A;  1POT A;  3H4Z A;  1MDP 1;  4RYA A;  4X1D A;  3FXQ A;  3ILT B;  1LCT A;  3SEV A;  1O63 A;  3IX1 A;  4JWX A;  1LB8 A;  1SYI A;  3K00 A;  1B3G A;  2DE2 A;  4M4G A;  3FV2 A;  3K4U A;  1JVY A;  1ELJ A;  1NFT A;  1NKX A;  3PMX A;  2HFB A;  2O69 A;  1B3L A;  3M3F A;  2F35 A;  3C36 A;  3HHG A;  5DTB A;  4X48 A;  1L5T A;  1YTV A;  2FA7 A;  1SYH A;  3I6V A;  1SW4 A;  3PD8 A;  1ZIU A;  1H76 A;  3K6V A;  4KHZ E;  1B3F A;  3KBR A;  1DOT A;  1QUL A;  1LGB C;  2CMO A;  1B5H A;  3K1N A;  1HSJ A;  2XD2 A;  3UGW A;  1B3E A;  3IOV A;  1OLA A;  5I57 A;  2O84 X;  1MY3 A;  5L9M A;  2RC9 A;  3FVO A;  1BLF A;  2XX7 A;  2GFE A;  5AE4 A;  3TMG A;  1SD3 A;  1PB9 A;  2QJE A;  5H8F A;  2PYY A;  1GVC A;  4XKR A;  5CMC A;  5AA4 B;  1JEU A;  4LZ5 A;  2O1M A;  3IAZ A;  5EHS A;  2V3Q A;  1NL5 A;  4X1B A;  2VD3 A;  1PC3 A;  3KZG A;  2LAO A;  3KGC A;  2Z8E A;  3LBS A;  1JET A;  1LB9 A;  5ICQ A;  3G3G A;  3T93 B;  3IO4 A;  3DEL B;  4M1V A;  5H8Q A;  5M2V A;  5J1D A;  1IXC A;  2B3F A;  4XKN A;  2XXP A;  4NF4 A;  2DSF A;  5KDT A;  3FVK A;  1XT8 A;  4GL0 A;  3OMB A;  4F18 A;  1O64 A;  1UQW A;  3N94 A;  3PV0 E;  4LVQ A;  3B6W A;  4ISU A;  3O6H A;  2Q9T A;  1Q35 A;  1NH8 A;  3PUV E;  3HST A;  3U94 A;  5FHO A;  3TTN A;  1B7U A;  2B3B A;  1QJM A;  2D5W A;  4KYD A;  1NNK A;  2VOZ A;  3TPA A;  3IK6 B;  4KCD A;  4Q5T A;  2V93 A;  4PP0 A;  3N5L A;  3K01 A;  5FTH A;  1IUD A;  3KOS A;  2I49 A;  1A40 A;  3GBB A;  4P0I A;  4OET A;  3FGS A;  4H1X A;  5I57 B;  4G68 A;  4EF1 A;  2CZL A;  2YJP A;  3PUZ E;  5DVI A;  3TCG A;  5LOM A;  3OOA A;  1I6A A;  1AH5 A;  5H8F B;  1N7X A;  3MVW A;  3RTF B;  3HO7 A;  5TPA A;  1M5C A;  4FOR A;  3MUQ A;  3EF7 A;  1H44 A;  1SVX B;  3O66 A;  3MC2 A;  2QMW A;  4P11 A;  2ABH A;  3O6I A;  3VE1 B;  1MQG A;  5KZT A;  4KFQ A;  3T9X B;  4O3A A;  4EXL A;  2H4I A;  1SW1 A;  4IO4 A;  3EPE A;  4F22 A;  3H3G A;  1II5 A;  2A5S A;  4U4X A;  1DTZ A;  3OD7 A;  4ONY A;  4NF4 B;  1IIT A;  5KDT B;  1SDX A;  1H45 A;  1B7Z A;  1I6B A;  1LCF A;  3GZG A;  1DMB A;  5L8D A;  4GWO A;  3FAS A;  3UA8 A;  4F2Q A;  4THI A;  1PBP A;  1XVX A;  3O9P A;  2F6G A;  3MZ9 A;  4LUB A;  2Y7K A;  4GF8 A;  1VR5 A;  3L6G A;  3D4C A;  4U2R A;  2XXV A;  3N6T A;  4X9T A;  1B3H A;  5FHN A;  5DVJ A;  3IOW A;  1Q1K A;  1MY2 A;  3LR1 A;  3N6U A;  3V5A A;  4Z0I A;  1QKB A;  3H6V A;  2HZK A;  2PT1 A;  3PU5 A;  3KN8 A;  3B7D A;  1Y3N A;  4F1Y A;  2V3T A;  3SET A;  4Z7E A;  4GVO A;  3IOR A;  1XC1 A;  3T9V A;  3KN3 A;  4QSC A;  4EQ9 A;  4H5G A;  4U1O A;  1LST A;  2QSX A;  3RY3 A;  2ZYM A;  2VHA A;  3BBR A;  3IB0 A;  4KI0 E;  4ND9 A;  2I58 A;  2I0B A;  3MP8 A;  2RF1 A;  3S2V A;  3KEI A;  3W9W A;  4QSE A;  2I4C A;  3JYR A;  4XKP A;  2ZYN A;  3U8Q A;  4PFW A;  2QPQ A;  4LP2 B;  2AIX A;  2DXY A;  1IIW A;  3EN3 A;  3KJ7 A;  3S9M C;  2Q89 A;  2ONR A;  3CSG A;  1IZ1 A;  5DEX A;  3MVY A;  3TCH A;  1R9Q A;  3FJM A;  5EYF A;  5ITO A;  1A7L A;  4OEU A;  3TCF A;  1B9J A;  3MZB A;  3DP8 A;  4LQ5 A;  1MY0 A;  4OWD A;  2RIN A;  4DXB A;  2UVH A;  2DXR A;  2QS3 A;  3CR9 A;  2RCA A;  4U1Z A;  5ICT A;  3CFZ A;  3TTM A;  1EU8 A;  1B5J A;  2R9J A;  1M5D A;  1ZLQ A;  1M5F A;  3GLB A;  2P2A A;  2DVC A;  2G29 A;  4BDR A;  1NNF A;  5ITP A;  4ECF A;  2I3W A;  1IXH A;  2FYI A;  1FTM A;  3W15 C;  1JW5 A;  2V84 A;  3Q26 A;  1OQH A;  3UP9 A;  3B6T A;  4YKI A;  3LSW A;  1HSE A;  2XXY A;  3O28 A;  1R1N A;  5HPQ A;  3G3H A;  3K1M A;  1R9L A;  3MVZ A;  3QUF A;  2Z8D A;  4JWY A;  3A09 A;  1MG1 A;  4IO2 A;  2XXW A;  4YMB A;  2OLB A;  2DP8 A;  4OFL A;  5FHM A;  3SEW A;  2IA4 A;  5DYH A;  4BDM A;  2YPN A;  2UVG A;  2F36 A;  4H65 A;  2F97 A;  4UA8 A;  3QK6 A;  4YU0 A;  4QFP A;  5KCJ A;  3A3C A;  4IO5 A;  3TEP A;  3VXC A;  3TFL A;  4FJP A;  3RNN A;  1US4 A;  1P1U A;  3AXF A;  1B1X A;  2NOO A;  1URG A;  5HM4 B;  1WDN A;  4OEN A;  4ZZE A;  2Z22 A;  4U4S A;  1AMF A;  3Q29 A;  1MXZ A;  1DTG A;  1N3X A;  5DEX B;  4OQO A;  1N04 A;  2YLN A;  2OJT A;  3R7X A;  1LBC A;  4EF2 A;  4H5F A;  4KYS A;  4XKQ A;  3H6W A;  2Y7I A;  4GFR A;  4YB7 A;  1ZKB A;  1R6Z A;  4RNS A;  4RJZ A;  4NF6 A;  2ONK E;  1B58 A;  4H6D A;  2AYS A;  3PUW E;  1BIY A;  3WAF A;  2DE3 A;  4ZEF A;  4ZEI A;  1FQC A;  1B0L A;  3CI8 A;  3RUM A;  1FTK A;  4YKJ A;  4BDO A;  3U72 A;  4IB2 A;  3C9H A;  2PVU A;  3THI A;  3FXR A;  4I9D A;  1LFG A;  4G8H A;  5K2X A;  3N26 A;  1SQY A;  2OBG A;  3OO9 A;  4KQP A;  4POW A;  2DE4 A;  1GV8 A;  3E3K A;  4F3B A;  2RC8 A;  3V83 A;  3G7W A;  2QS1 A;  3E4R A;  1I6Q A;  4I8C A;  2PBW A;  1RYX A;  4JXI A;  4F1U A;  4ZEB A;  3TDJ A;  5I56 B;  1PB7 A;  3U92 A;  4N13 A;  3FV1 A;  5I59 A;  1OVT A;  2ESN A;  2VP1 A;  3EQ1 A;  4AQ4 A;  2DS9 A;  4N6P A;  3QUJ A;  5KCJ B;  4E0X A;  4GXA A;  3K1P A;  1P99 A;  1XOC A;  4YZZ A;  2DVZ A;  4G2Z A;  3CFX A;  2HZL A;  5JEI A;  4RA1 A;  3IOT A;  4NED A;  1B0H A;  5CBS A;  4QSD A;  3TAJ A;  1B4H A;  1WVJ A;  1USY H;  1HSL A;  2OWT A;  2NVU B;  4LQ2 A;  3IB1 A;  3T96 B;  3K0V A;  2GHB A;  4GL8 A;  4ZEK A;  4NMY A;  4U21 A;  2HAV A;  1MH3 A;  3FAT A;  1LAX A;  2R71 A;  2I4B A;  3P7I A;  2QRY A;  1MPC A;  3GBA A;  3BFU A;  3T9H B;  3UN6 A;  3F11 A;  4F2O A;  1LBB A;  4MF3 A;  4NWC A;  1VFD A;  4MFI A;  1YPN A;  4RK9 A;  2O68 A;  1FQB A;  1Z7M E;  3OEK A;  1FQE A;  4OXV A;  4OZ9 A;  3VDF A;  1MPD A;  1Y1M A;  3HCQ A;  1A8E A;  4F1V A;  1JW1 A;  4IGR A;  4ZS9 A;  1MY1 A;  2F7B A;  3IO6 A;  5B7D A;  2UYF A;  2HEU A;  3C33 A;  4KCC A;  4QFO A;  1PB8 A;  2GRV A;  3BFT A;  3TTK A;  4G77 A;  1DPP A;  4KR5 A;  4O3B A;  4H8I A;  4F31 B;  4ELP A;  2ZYK A;  4P0G A;  1ANF A;  1MQD A;  4DCY A;  2HQ0 A;  3VXB A;  4NWD A;  3CSB A;  3UK4 A;  4FE8 A;  3FIR A;  3IB2 A;  3UOR A;  3ECR A;  2Z23 A;  2P1S A;  1QUK A;  4R6H A;  2KLF A;  1GGG A;  3K6U A;  5H8Q B;  4R75 A;  2O6A A;  1N84 A;  3IJX B;  4RPN A;  2F78 A;  2I6E A;  2WKY A;  4FAT A;  4LZ8 A;  3PUY E;  3VLV A;  3G3J A;  2ALU A;  3USD A;  4YB6 A;  4AB5 A;  2VD2 A;  1IQ7 A;  1MXY A;  4JDF A;  5L9O A;  4U23 A;  3T66 A;  3SEX A;  1IEJ A;  3KG2 A;  2RKM A;  2A5T A;  4EQB A;  1LLS A;  3I5O A;  1OQG A;  2UVJ A;  3TUS A;  1MPB A;  4YMA A;  4R2B A;  4K3F A;  3H06 B;  1UTB A;  3MZ1 A;  1NH7 A;  3QYT A;  1VFE A;  3MWB A;  3PUX E;  4LAT A;  1B5I A;  1LFH A;  2XXT A;  4YIC A;  2F8D A;  4Q8R A;  1B1H A;  1VE4 A;  4POX A;  3QXM A;  2F5X A;  4C1U A;  4WKM A;  5TU0 A;  2VGQ A;  2UXA A;  1AL3 A;  4G68 B;  4H67 A;  4F3P A;  1Y1Z A;  3PPO A;  5AA2 D;  2X7P A;  5AA3 A;  1MXW A;  4IO3 A;  1B40 A;  3EHT A;  3IJO B;  1QW0 A;  4G68 C;  2QL3 A;  2B65 A;  3MAM A;  3U1O A;  4F29 A;  2FNC A;  4F19 A;  5TPA B;  2Q2A A;  1MS7 A;  1WOD A;  4LON B;  4PQJ A;  2RCB A;  1USY E;  3O97 A;  5CMB A;  3S9E A;  4PFT A;  4UAC A;  4F39 A;  1S50 A;  1SI0 A;  4ZE9 A; 
#chains in the Genus database with same CATH topology
 5ESY A;  3DLN A;  4PFR A;  3M3K A;  4ZZA A;  2HCA A;  5L9S A;  2Q74 A;  5CI5 A;  2OWS A;  2I48 A;  4OEV A;  5H8N A;  3TTL A;  4G61 A;  3BIG A;  3WAE A;  3ODB A;  2REG A;  1FJ9 A;  3SER A;  4XEQ A;  4IY6 A;  1KWH A;  3M3L A;  3KSJ A;  1TFD A;  5JK4 A;  5B70 A;  4NTL A;  3QIM A;  4HCW A;  4DXC A;  4DDD A;  3CVG A;  2DWH A;  2A5T B;  1NV5 A;  4HE2 A;  4ZED A;  1CE2 A;  4MNI A;  3OSQ A;  2DQV A;  4XTC Q;  2OZZ A;  2H99 A;  1NMU A;  3CG3 A;  5CBR A;  4YKK A;  4P8B A;  1ZBM A;  1ZMG A;  4RPO A;  1UTB B;  2HAU A;  1FTL A;  1B7H A;  4G8N A;  4PAK A;  3QSL A;  1OVB A;  4MJO A;  2V25 A;  3KC1 A;  1XS5 A;  5EHM A;  3RLF E;  1ZTY A;  4F3G A;  1B2H A;  3QAX A;  3HN0 A;  3RT6 B;  4KPT A;  4F3S A;  3I3V A;  4TOZ A;  3TQL A;  2H9B A;  1FBC A;  4I1D A;  2Y5K A;  3MP1 A;  4ESW A;  4QRZ A;  3JV9 A;  2ZNU A;  1UIU A;  1JNF A;  1EZ9 A;  4P47 A;  2OCU A;  4N07 A;  1JQF A;  4PTK A;  4JBZ A;  4PBH A;  5I84 A;  2V3U A;  3SKP A;  2G93 A;  3PPR A;  3OO8 A;  3FXU A;  5ET8 A;  1XVY A;  3HV1 A;  2RC7 A;  3JZJ A;  1URS A;  5ISU A;  3ILU B;  3G3K A;  1IXI A;  1KA1 A;  4HE0 A;  2NUV A;  4BDN A;  1F9B A;  2WX9 A;  2DWA A;  1D4N A;  4G8M A;  5H8N B;  5CMM A;  3DP4 A;  4OMB A;  1FQA A;  1FQD A;  4TQU Q;  2ZYO A;  1YXI A;  3SEU A;  1IXG A;  5I2N A;  2PCR A;  3MBP A;  1P1W A;  3R6U A;  4PFY A;  1SBP A;  2M8C A;  4HTG A;  1US5 A;  4ELQ A;  1D9Y A;  1NI9 A;  4GOT A;  4JSO A;  1ZJL A;  1H3D A;  4ELO A;  2WYP A;  2AL5 A;  3E9X A;  1B52 A;  3LSL A;  4E0W A;  1UTH A;  4RK2 A;  3K6X A;  4GBW A;  4WED A;  4N81 A;  2Y7W A;  1UIV A;  2QFL A;  4MAG A;  1M5B A;  1MXX A;  4BLA A;  4GWS A;  1I69 A;  3LV0 A;  2E0S A;  3O2A A;  2Q2C A;  1JVX A;  2Q88 A;  1NV1 A;  4NF5 A;  1G0I A;  1QVS A;  2W7Y A;  4GWW A;  5H8H A;  3ISP A;  2REJ A;  1B46 A;  4GRK A;  1TFA A;  3MPK A;  2O1L A;  2CZK A;  2XD3 A;  3H6T A;  3ZS6 A;  1O7T A;  4NE4 A;  1B32 A;  2DWI A;  3K6W A;  1Y4T A;  4GLI A;  3HPI A;  3PPP A;  4HCY A;  3PMW A;  3OEL A;  3B6Q A;  4GD5 A;  2ZXT A;  4QFN A;  5FTI A;  4BDL A;  5DVF A;  3ZKL A;  1CB6 A;  1YAE A;  1FCK A;  4RY1 A;  1N3W A;  5CMK A;  1JW4 A;  1T0K A;  4PE5 B;  2QVV A;  4MMP A;  2XX9 A;  3OO6 A;  2GH9 A;  3C34 A;  4AS4 A;  1PEB A;  2GHA A;  1IME A;  2XXH A;  4YAH X;  1A54 A;  3OEM A;  1N7W A;  2D21 A;  4Q0C A;  3SES A;  2OX3 A;  4PE3 A;  3MPL A;  2DYX A;  5A5X A;  4DLD A;  1SI1 A;  3HFU A;  2R8T A;  2HXR A;  4OYV A;  4R6Y A;  1VDW A;  4N6K A;  3LC8 A;  4N15 A;  3UIF A;  3PD9 A;  3W9V A;  4P3L A;  1EZO A;  1EZP A;  4R2F A;  3BKI B;  1EYI A;  4QFL A;  1NNP A;  5DT6 A;  2FHY A;  2H98 A;  5I2N B;  5I2K A;  1TXF A;  3T9U A;  5BWJ A;  3OXN A;  4FEC A;  1PBQ A;  4ELR A;  4JWO A;  4NF6 B;  2DWJ A;  3KJT A;  4P56 A;  4ESX A;  5ET6 A;  3C4M A;  5TP9 A;  1N76 A;  3FVN A;  4MLV A;  3T22 A;  2QS2 A;  1UTH B;  1BTJ A;  2XXI A;  3VLW A;  1DPE A;  3OSR A;  4R73 A;  2F7C A;  4R9F A;  3L6H A;  3SDF A;  1Y3P A;  1PDA A;  3IL1 B;  4ZDM A;  2Z8F A;  1LBX A;  2KR0 A;  3RN8 A;  1OIB A;  4NF5 B;  3FJ7 A;  2FVZ A;  1NNT A;  5H8H B;  4ZE8 A;  4BDQ A;  3E79 A;  2B4M A;  4FIM A;  4TLL B;  2ANJ A;  1NV4 A;  4NGU A;  4O94 A;  1OMP A;  2F6P A;  3C32 A;  3Q27 A;  3IOU A;  3G3I A;  3E13 X;  1URD A;  3V89 B;  4EQ7 A;  1YCJ A;  4OFO A;  4JSD A;  3TOD A;  3S9N C;  1Y3Q A;  2XA5 A;  4MLQ A;  4PFU A;  3M8U A;  2FBP A;  3DM0 A;  3K2D A;  3MW0 A;  1FBG A;  3RTW B;  4PGP A;  1RKM A;  5I59 B;  2O7U A;  5AA1 A;  3OO7 A;  4H8J A;  4IO7 A;  1MM6 A;  1Z7N E;  3LUY A;  2XWV A;  3TYH A;  1OLC A;  2I0C A;  1A99 A;  3OEN A;  4NF8 A;  5J16 A;  4U22 A;  4R9G A;  1LFI A;  2X26 A;  1CNQ A;  4P1L A;  3VVE A;  4C0R A;  3D1R A;  3FD3 A;  5A5X B;  1S7Y A;  4IO6 A;  3S4U A;  1Y20 A;  4I40 A;  3LUZ A;  4PGN A;  4DZ1 A;  2XWI A;  3RYD A;  2Y7R A;  4MH5 A;  4DE8 A;  1DSN A;  2QVU A;  4PCD A;  4FEB A;  4YB5 A;  3TKD A;  4HE1 A;  3IR1 A;  4GQO A;  2UVI A;  4C1T A;  1MH4 A;  4QHQ A;  3Q28 A;  3U93 A;  1FSA A;  3DP6 A;  4MBP A;  3ZKK A;  4GBV A;  2MKZ A;  5I2K B;  2HXW A;  4QF9 A;  2O51 A;  1M5E A;  3V8X B;  4GWY A;  4PET A;  4GWZ A;  4R6K A;  5CC2 A;  2PFY A;  1N0T A;  4RXL A;  3LSF B;  1MM7 A;  2THI A;  1GR2 A;  4R74 A;  4DXU A;  2Q8J A;  1FTO A;  3H6U A;  1LAF E;  3VFJ A;  4HS7 A;  5TP9 B;  3KFM A;  1MY4 A;  2D3I A;  1QUI A;  1AIV A;  1IMC A;  4IGT A;  3CRB A;  1KA0 A;  4PFB A;  4H0W A;  1XHY A;  3TQW A;  3NOH A;  4GWU A;  1QUJ A;  2P3N A;  4YKP A;  2X7Q A;  2P0S A;  1FJ6 A;  2PMS A;  2JJK A;  4Q30 B;  1NV6 A;  4XXU A;  2WEF A;  5AA2 A;  4OTE A;  1FBH A;  4TLM B;  4WXJ A;  3HHF A;  1EH3 A;  4IY5 A;  2F7A A;  3RPL A;  3Q25 A;  3ROJ A;  3PPQ A;  2XX8 A;  1B4Z A;  2F3B A;  1DK4 A;  3RGY A;  1TT1 A;  4WEP A;  3D4G A;  4O7I A;  3H03 A;  4FAJ A;  2XXX A;  4O3C A;  2OWZ A;  4GX3 A;  3CFL A;  5JTY A;  2FIX A;  3MQ9 A;  2BJJ X;  1FPJ A;  4KD5 A;  5IM2 A;  3GXA A;  1D9V A;  3EHU A;  2F3D A;  2XXR A;  4PFI A;  5I58 A;  4QFK A;  3VV5 A;  1FW0 A;  3ONM A;  1LBY A;  3FJG A;  1A8F A;  3K02 A;  2DDK A;  3O6G A;  4NF8 B;  4GXS B;  1SW2 A;  4DCX A;  1B05 A;  4MIJ A;  2H5Y A;  5IAI A;  1POY 1;  2I3V A;  4L17 A;  1MDQ A;  3TZA A;  3EHS A;  1QKA A;  3C35 A;  5IKB A;  4NG7 A;  1FQF A;  3PMV A;  4JVD A;  4MHF A;  4N6D A;  2QMX A;  3KSX A;  4I62 A;  3SEY A;  2XXU A;  1LAH E;  5CRY A;  4EXK A;  3A3U A;  2ZNS A;  1KZ8 A;  2E1S A;  1MQJ A;  3PGF A;  4DIG A;  3VVD A;  4OES A;  1Y4C A;  2O7I A;  5BUU A;  5ET7 A;  3RT8 A;  3KC0 A;  1VSO A;  3KOT A;  3S9L C;  2ZMB A;  2WYK A;  4I3Y A;  4JB7 A;  3TEL A;  2H25 A;  1P1O A;  3VVF A;  3FZV A;  5F7V A;  2Y84 A;  3RQT A;  2PX1 A;  1JEV A;  5A5L A;  1Y9U A;  3PPN A;  2NXO A;  1LAG E;  3MP6 A;  5I3S A;  4ZEC A;  1MXU A;  2XXQ A;  1YYZ A;  1ZU0 A;  2OK2 A;  5ELV A;  3O29 A;  1TWY A;  4OFJ A;  4P9K A;  1FTJ A;  3RPW A;  4HW8 A;  1B51 A;  1MQH A;  1EYK A;  1BP5 A;  1S9T A;  4OER A;  1FTA A;  2R6G E;  3H7M A;  4G4P A;  5AA2 B;  2AL4 A;  1P1N A;  3LSX A;  3G3F A;  3RPL B;  1FRP A;  2F34 A;  1H43 A;  3CHG A;  1B6H A;  2GQ1 A;  4PAI A;  3ZSF A;  2ONS A;  2QS4 A;  1A55 A;  2Y7P A;  3FVG A;  1GTK A;  2WBB A;  2ZNT A;  2IEE A;  1D3K A;  1J1N A;  4AB6 A;  4OVJ A;  4EUO A;  4OHN A;  3MVX A;  5HBC A;  1AOV A;  3KN7 A;  2DOJ A;  5JTY B;  4XIG Q;  4LA9 A;  1BKA A;  5I56 A;  5AA4 A;  3GYY A;  1MQI A;  2PT2 A;  3MJN A;  5CM6 A;  2NWJ A;  1IMF A;  5I58 B;  2UYE A;  1MXV A;  5K2Y A;  4EDP A;  4FED A;  1ATG A;  1MRP A;  3FUZ A;  4R72 A;  5H8S A;  5F1Q A;  3CG1 A;  1Q9D A;  3TTR A;  2XHD A;  3C31 A;  1INP A;  1SW5 A;  1P1Q A;  3R26 A;  4LZ7 A;  1RYO A;  3VLU A;  2CZI A;  4KYE A;  3CIJ A;  4GIZ A;  1POT A;  3H4Z A;  1MDP 1;  4RYA A;  4X1D A;  3FXQ A;  3ILT B;  5ET5 A;  1LCT A;  3SEV A;  4OVS A;  1O63 A;  4MEV A;  3IX1 A;  4JWX A;  1LB8 A;  1SYI A;  3K00 A;  1B3G A;  2DE2 A;  4M4G A;  3FV2 A;  3K4U A;  1JVY A;  1ELJ A;  5FBP A;  1NFT A;  1NKX A;  3PMX A;  2HFB A;  2O69 A;  5IZZ A;  1B3L A;  3M3F A;  2F35 A;  3C36 A;  3HHG A;  5DTB A;  4X48 A;  1L5T A;  1YTV A;  2FA7 A;  1SYH A;  3I6V A;  1SW4 A;  3PD8 A;  4N8G A;  1ZIU A;  1H76 A;  1FPL A;  3K6V A;  4KHZ E;  2FIE A;  1B3F A;  1RDY A;  4XF5 A;  2HHM A;  3KBR A;  1DOT A;  1QUL A;  1LGB C;  2CMO A;  1B5H A;  3K1N A;  1HSJ A;  2XD2 A;  3UGW A;  3EKI A;  4MNC A;  4QXD A;  1B3E A;  3IOV A;  1OLA A;  5I57 A;  2O84 X;  1MY3 A;  5L9M A;  2RC9 A;  3FVO A;  1BLF A;  1DCU A;  2XX7 A;  2GFE A;  5AE4 A;  1EYJ A;  3TMG A;  1SD3 A;  4OAN A;  1NUY A;  1PB9 A;  2QJE A;  5H8F A;  2PYY A;  1FPB A;  1GVC A;  4XKR A;  2P3V A;  5CMC A;  5IZ3 A;  1K9Z A;  5AA4 B;  1JEU A;  4LZ5 A;  2O1M A;  2HPG A;  3IAZ A;  5EHS A;  3U65 A;  2V3Q A;  1NL5 A;  4X1B A;  2VD3 A;  4NAP A;  1PC3 A;  3KZG A;  2LAO A;  4OVQ A;  3KGC A;  2Z8E A;  3LBS A;  1JET A;  3QMF A;  3B50 A;  1LB9 A;  5ICQ A;  3G3G A;  3T93 B;  3IO4 A;  3DEL B;  4M1V A;  5H8Q A;  5M2V A;  5J1D A;  1IXC A;  2B3F A;  2L5V A;  4XKN A;  2XXP A;  4NF4 A;  2DSF A;  5KDT A;  1XI6 A;  3FVK A;  1XT8 A;  4GL0 A;  3OMB A;  4F18 A;  1O64 A;  4OVP A;  1UQW A;  3N94 A;  3MYU A;  1JP4 A;  3PV0 E;  4LVQ A;  3B6W A;  4ISU A;  3O6H A;  2Q9T A;  1Q35 A;  5I7I A;  1NH8 A;  1IMA A;  3PUV E;  3HST A;  3U94 A;  2VPO A;  5FHO A;  3TTN A;  1B7U A;  2B3B A;  1QJM A;  2D5W A;  4KYD A;  1NNK A;  2VOZ A;  3TPA A;  3IK6 B;  4KCD A;  4Q5T A;  2V93 A;  4PP0 A;  3B8B A;  3N5L A;  3K01 A;  5FTH A;  1IUD A;  3KOS A;  2BJI A;  2I49 A;  1A40 A;  3GBB A;  4P0I A;  4OET A;  1FBF A;  3FGS A;  4H1X A;  5I57 B;  1FPG A;  4G68 A;  4EF1 A;  2CZL A;  4KXP A;  2YJP A;  3PUZ E;  5DVI A;  3TCG A;  5LOM A;  3OOA A;  1I6A A;  1AH5 A;  4N4U A;  5H8F B;  1N7X A;  3MVW A;  4NHB A;  3RTF B;  3HO7 A;  5TPA A;  1M5C A;  4FOR A;  3MUQ A;  5T3J A;  3SZP A;  3EF7 A;  1H44 A;  5IZ3 B;  1SVX B;  4OVT A;  4XFE A;  3O66 A;  3MC2 A;  2QMW A;  4P11 A;  2ABH A;  3O6I A;  3VE1 B;  1MQG A;  5KZT A;  4KFQ A;  3T9X B;  4O3A A;  4EXL A;  2H4I A;  1SW1 A;  4IO4 A;  3EPE A;  4F22 A;  5EQ9 A;  3H3G A;  1NV3 A;  1II5 A;  2A5S A;  4PF8 A;  4U4X A;  1DTZ A;  3OD7 A;  4ONY A;  4NF4 B;  1IIT A;  5KDT B;  1SDX A;  1H45 A;  1B7Z A;  1I6B A;  1LCF A;  3GZG A;  1DMB A;  1NUW A;  2CZH A;  4HXV A;  5L8D A;  4GWO A;  3FAS A;  3UA8 A;  1G0H A;  2V4C A;  4F2Q A;  4THI A;  1PBP A;  1XVX A;  3O9P A;  2F6G A;  3MZ9 A;  4LUB A;  2Y7K A;  4GF8 A;  1VR5 A;  3L6G A;  3D4C A;  4U2R A;  2XXV A;  3N6T A;  4X9T A;  1B3H A;  5FHN A;  2B4L A;  5DVJ A;  3IOW A;  1Q1K A;  1MY2 A;  3LR1 A;  3N6U A;  3V5A A;  4Z0I A;  1QKB A;  3H6V A;  2HZK A;  2PT1 A;  3PU5 A;  3KN8 A;  3B7D A;  1Y3N A;  4F1Y A;  2V3T A;  3SET A;  4Z7E A;  4P1E A;  4IR8 A;  4GVO A;  4NX1 A;  2CEY A;  3IOR A;  1XC1 A;  3T9V A;  3KN3 A;  4QSC A;  4EQ9 A;  4H5G A;  4U1O A;  1LST A;  2QSX A;  3RY3 A;  2ZYM A;  2VHA A;  3BBR A;  3IB0 A;  4KI0 E;  4ND9 A;  2I58 A;  2I0B A;  3PTY A;  4MNP A;  3MP8 A;  2RF1 A;  3S2V A;  3KEI A;  3IFA A;  4DI4 B;  3W9W A;  4QSE A;  2I4C A;  3JYR A;  4XKP A;  4OA4 A;  2ZYN A;  1NV0 A;  3U8Q A;  4PFW A;  2QPQ A;  4LP2 B;  2AIX A;  2DXY A;  1IIW A;  3EN3 A;  3KJ7 A;  3S9M C;  2Q89 A;  2ONR A;  1NV2 A;  3CSG A;  1IZ1 A;  5DEX A;  3MVY A;  3TCH A;  1R9Q A;  3FJM A;  3T1B A;  4PDD A;  5EYF A;  5ITO A;  1A7L A;  4OEU A;  3TCF A;  1B9J A;  3MZB A;  3DP8 A;  4LQ5 A;  1MY0 A;  4OWD A;  2RIN A;  4FBP A;  4DXB A;  4QBA A;  4N8Y A;  2UVH A;  2DXR A;  2QS3 A;  3CR9 A;  2RCA A;  2Y5L A;  4U1Z A;  5ICT A;  3CFZ A;  5EYG A;  4LN5 A;  1RDX A;  4OVR A;  3TTM A;  1EU8 A;  4I3E A;  1B5J A;  2R9J A;  1M5D A;  1ZLQ A;  1M5F A;  3GLB A;  2P2A A;  2DVC A;  2G29 A;  4BDR A;  1NNF A;  5EYH A;  5ITP A;  4ECF A;  2I3W A;  1IXH A;  4H45 A;  4MX6 A;  2FYI A;  1IMD A;  1FTM A;  3W15 C;  1JW5 A;  2V84 A;  3Q26 A;  1OQH A;  3UP9 A;  3B6T A;  4YKI A;  3LSW A;  1HSE A;  2XWK A;  2XXY A;  4PBQ A;  3O28 A;  1R1N A;  5HPQ A;  3G3H A;  2XXK A;  3K1M A;  1R9L A;  3MVZ A;  3QUF A;  2Z8D A;  2ZZV A;  4JWY A;  3A09 A;  1MG1 A;  4IO2 A;  2XXW A;  4YMB A;  2OLB A;  2DP8 A;  3IFC A;  1FBE A;  4OFL A;  2WBD A;  5FHM A;  3SEW A;  2IA4 A;  4N91 A;  5DYH A;  4BDM A;  2YPN A;  2UVG A;  2F36 A;  4H65 A;  2F97 A;  4UA8 A;  3QK6 A;  4YU0 A;  4QFP A;  5KCJ A;  3A3C A;  4IO5 A;  3TEP A;  4GX4 A;  3VXC A;  1BK4 A;  3TFL A;  1FPE A;  3MST A;  4FJP A;  3RNN A;  1US4 A;  1P1U A;  3AXF A;  1B1X A;  2NOO A;  1URG A;  5HM4 B;  1WDN A;  4OEN A;  4ZZE A;  2Z22 A;  4U4S A;  1AMF A;  3Q29 A;  1MXZ A;  1DTG A;  1N3X A;  5DEX B;  4OQO A;  1N04 A;  2YLN A;  2OJT A;  3R7X A;  1LBC A;  4EF2 A;  2CEX A;  4H5F A;  4KYS A;  4XKQ A;  3H6W A;  2Y7I A;  4GFR A;  4NN3 A;  4YB7 A;  1ZKB A;  1R6Z A;  4H46 A;  4RNS A;  4RJZ A;  5EQ8 A;  4NF6 A;  2ONK E;  1B58 A;  2Q8M A;  4H6D A;  4PDH A;  2AYS A;  3PUW E;  1BIY A;  3WAF A;  2DE3 A;  4ZEF A;  4ZEI A;  1NV7 A;  1FQC A;  1B0L A;  3CI8 A;  1SPI A;  1FTK A;  3RUM A;  4YKJ A;  4BDO A;  3U72 A;  4IB2 A;  3C9H A;  2PVU A;  3THI A;  3FXR A;  4PC9 A;  4I9D A;  4DI3 D;  1LFG A;  4G8H A;  5K2X A;  3N26 A;  1SQY A;  2OBG A;  5F24 A;  3OO9 A;  4KQP A;  2QVR A;  4POW A;  2DE4 A;  1GV8 A;  3E3K A;  4F3B A;  1FPD A;  2RC8 A;  3V83 A;  3G7W A;  4X04 A;  4O8M A;  5I5P A;  5EQA A;  2QS1 A;  3E4R A;  1I6Q A;  4I8C A;  2PBW A;  1RYX A;  4JXI A;  1YZ0 A;  4F1U A;  4ZEB A;  3TDJ A;  5I56 B;  1PB7 A;  1NUX A;  3U92 A;  4N13 A;  3FV1 A;  5I59 A;  1OVT A;  2ESN A;  2VP1 A;  3EQ1 A;  4AQ4 A;  2DS9 A;  4N6P A;  3QUJ A;  1LBW A;  5KCJ B;  4E0X A;  4GXA A;  3K1P A;  1P99 A;  1XOC A;  1RDZ A;  4YZZ A;  2DVZ A;  4G2Z A;  3CFX A;  2HZL A;  5JEI A;  4RA1 A;  3IOT A;  4NED A;  1B0H A;  5CBS A;  4QSD A;  3TAJ A;  1B4H A;  1WVJ A;  2ZZW A;  1USY H;  1HSL A;  2OWT A;  1LEV A;  2ZZX A;  2NVU B;  4LQ2 A;  3IB1 A;  3T96 B;  3K0V A;  2GHB A;  4GL8 A;  4ZEK A;  5IZ1 A;  4NMY A;  4U21 A;  4GWX A;  2HAV A;  1MH3 A;  3FAT A;  1LAX A;  2R71 A;  2I4B A;  3P7I A;  2QRY A;  1MPC A;  1FPF A;  3GBA A;  3BFU A;  3T9H B;  1FBP A;  3UN6 A;  3F11 A;  4F2O A;  1LBB A;  4MF3 A;  4MCO A;  4JVC A;  4NWC A;  1VFD A;  4MFI A;  1YPN A;  4RK9 A;  2O68 A;  1FQB A;  1Z7M E;  3OEK A;  1FQE A;  4OXV A;  1AWB A;  4OZ9 A;  2VPN A;  3VDF A;  1MPD A;  1Y1M A;  3HCQ A;  1DBZ A;  1A8E A;  4X8R A;  3E78 A;  4F1V A;  1JW1 A;  4IGR A;  4ZS9 A;  4AS5 A;  1MY1 A;  2F7B A;  3IO6 A;  5B7D A;  2UYF A;  2HEU A;  3C33 A;  4KCC A;  1FPK A;  4QFO A;  1PB8 A;  2GRV A;  3BFT A;  3TTK A;  4G77 A;  1DPP A;  4JVI A;  5LDZ A;  4KR5 A;  4O3B A;  4H8I A;  2PFZ A;  4F31 B;  4ELP A;  2ZYK A;  4P0G A;  1ANF A;  1MQD A;  4DCY A;  4N17 A;  2HQ0 A;  3VXB A;  1IMB A;  4NWD A;  3CSB A;  3UK4 A;  4FE8 A;  3FIR A;  3IB2 A;  5EQ7 A;  3UOR A;  3ECR A;  2Z23 A;  2P1S A;  1QUK A;  4NQ8 A;  4R6H A;  2KLF A;  1GGG A;  3K6U A;  2VT5 A;  5H8Q B;  3A29 A;  1FBD A;  4R75 A;  2O6A A;  1N84 A;  3IJX B;  4RPN A;  2F78 A;  2I6E A;  2WKY A;  4FAT A;  4LZ8 A;  3PUY E;  3VLV A;  3G3J A;  2ALU A;  3USD A;  1LBZ A;  4YB6 A;  4AB5 A;  2VD2 A;  1IQ7 A;  1MXY A;  4JDF A;  5L9O A;  4U23 A;  3T66 A;  3SEX A;  1IEJ A;  3KG2 A;  4PF6 A;  2RKM A;  1FPI A;  2A5T A;  4EQB A;  2KQZ A;  3T0J A;  1LLS A;  4NF0 A;  3I5O A;  1OQG A;  2UVJ A;  3KBZ A;  3TUS A;  1MPB A;  4YMA A;  4R2B A;  4K3F A;  3H06 B;  1UTB A;  3MZ1 A;  1NH7 A;  3QYT A;  1VFE A;  1LBV A;  3MWB A;  3PUX E;  4LAT A;  1B5I A;  3BIH A;  2XWO A;  1LFH A;  2XXT A;  4YIC A;  2F8D A;  4Q8R A;  1B1H A;  1D9Q A;  1VE4 A;  4POX A;  5DW8 A;  3QXM A;  2F5X A;  4C1U A;  4WKM A;  5TU0 A;  1QGX A;  2UXA A;  2VGQ A;  1AL3 A;  4G68 B;  4H67 A;  4GX6 A;  1Y1Z A;  4F3P A;  3FBP A;  4UAB A;  3PPO A;  5AA2 D;  2X7P A;  5AA3 A;  1MXW A;  4IO3 A;  1B40 A;  3EHT A;  3IJO B;  1QW0 A;  4G68 C;  2QL3 A;  4PAF A;  2B65 A;  3MAM A;  4O7M A;  3U1O A;  4F29 A;  2FNC A;  4F19 A;  5TPA B;  2Q2A A;  5LTC A;  1MS7 A;  1WOD A;  4LON B;  1K9Y A;  4PQJ A;  2RCB A;  1USY E;  3O97 A;  5CMB A;  3S9E A;  3FXB A;  5IGA A;  4PFT A;  4UAC A;  4F39 A;  1S50 A;  1NUZ A;  1SI0 A;  4ZE9 A; 
#chains in the Genus database with same CATH homology
 3DLN A;  3M3K A;  4ZZA A;  2HCA A;  5L9S A;  5CI5 A;  2OWS A;  2I48 A;  4OEV A;  5H8N A;  3TTL A;  3WAE A;  3ODB A;  2REG A;  3SER A;  4IY6 A;  1KWH A;  3M3L A;  3KSJ A;  1TFD A;  5JK4 A;  5B70 A;  4NTL A;  3QIM A;  4HCW A;  4DXC A;  4DDD A;  3CVG A;  2DWH A;  2A5T B;  4ZED A;  1CE2 A;  3OSQ A;  2DQV A;  4XTC Q;  2OZZ A;  2H99 A;  1NMU A;  3CG3 A;  5CBR A;  4YKK A;  1ZBM A;  1ZMG A;  4RPO A;  1UTB B;  2HAU A;  1FTL A;  1B7H A;  4G8N A;  3QSL A;  1OVB A;  2V25 A;  1XS5 A;  5EHM A;  3RLF E;  1ZTY A;  4F3G A;  1B2H A;  3QAX A;  3HN0 A;  3RT6 B;  4KPT A;  4F3S A;  3I3V A;  4TOZ A;  3TQL A;  2H9B A;  4I1D A;  3MP1 A;  4ESW A;  4QRZ A;  3JV9 A;  2ZNU A;  1UIU A;  1JNF A;  1EZ9 A;  2OCU A;  4N07 A;  1JQF A;  4JBZ A;  5I84 A;  2V3U A;  3SKP A;  2G93 A;  3PPR A;  3OO8 A;  3FXU A;  1XVY A;  3HV1 A;  2RC7 A;  3JZJ A;  1URS A;  5ISU A;  3ILU B;  3G3K A;  1IXI A;  2NUV A;  4BDN A;  1F9B A;  2DWA A;  1D4N A;  4G8M A;  5H8N B;  5CMM A;  3DP4 A;  4OMB A;  1FQA A;  1FQD A;  4TQU Q;  2ZYO A;  3SEU A;  1IXG A;  5I2N A;  3MBP A;  1P1W A;  3R6U A;  4PFY A;  1SBP A;  2M8C A;  4HTG A;  1US5 A;  4ELQ A;  1D9Y A;  4GOT A;  4JSO A;  1ZJL A;  1H3D A;  4ELO A;  2AL5 A;  3E9X A;  1B52 A;  3LSL A;  4E0W A;  1UTH A;  4RK2 A;  3K6X A;  4WED A;  2Y7W A;  1UIV A;  1M5B A;  1MXX A;  4BLA A;  1I69 A;  2E0S A;  3O2A A;  2Q2C A;  1JVX A;  2Q88 A;  4NF5 A;  1QVS A;  2W7Y A;  5H8H A;  2REJ A;  1B46 A;  4GRK A;  1TFA A;  3MPK A;  2O1L A;  2XD3 A;  3H6T A;  3ZS6 A;  1O7T A;  4NE4 A;  1B32 A;  2DWI A;  3K6W A;  1Y4T A;  4GLI A;  3HPI A;  3PPP A;  4HCY A;  3PMW A;  3OEL A;  3B6Q A;  4GD5 A;  2ZXT A;  4QFN A;  5FTI A;  4BDL A;  5DVF A;  3ZKL A;  1CB6 A;  1YAE A;  1FCK A;  4RY1 A;  1N3W A;  5CMK A;  1JW4 A;  1T0K A;  4PE5 B;  2XX9 A;  3OO6 A;  2GH9 A;  3C34 A;  1PEB A;  2GHA A;  2XXH A;  4YAH X;  1A54 A;  3OEM A;  1N7W A;  2D21 A;  4Q0C A;  3SES A;  3MPL A;  2DYX A;  5A5X A;  4DLD A;  1SI1 A;  4OYV A;  4R6Y A;  3LC8 A;  3UIF A;  3PD9 A;  3W9V A;  1EZO A;  1EZP A;  4R2F A;  3BKI B;  4QFL A;  1NNP A;  5DT6 A;  2H98 A;  5I2N B;  5I2K A;  1TXF A;  3T9U A;  5BWJ A;  3OXN A;  4FEC A;  1PBQ A;  4ELR A;  4JWO A;  4NF6 B;  2DWJ A;  3KJT A;  4ESX A;  3C4M A;  5TP9 A;  1N76 A;  3FVN A;  4MLV A;  3T22 A;  2QS2 A;  1UTH B;  1BTJ A;  2XXI A;  3VLW A;  1DPE A;  3OSR A;  4R73 A;  2F7C A;  4R9F A;  3L6H A;  3SDF A;  1Y3P A;  1PDA A;  3IL1 B;  4ZDM A;  2Z8F A;  3RN8 A;  1OIB A;  4NF5 B;  3FJ7 A;  1NNT A;  5H8H B;  4ZE8 A;  4BDQ A;  4FIM A;  4TLL B;  2ANJ A;  1OMP A;  2F6P A;  3C32 A;  3Q27 A;  3IOU A;  3G3I A;  3E13 X;  1URD A;  3V89 B;  4EQ7 A;  1YCJ A;  4OFO A;  4JSD A;  3TOD A;  3S9N C;  1Y3Q A;  4MLQ A;  4PFU A;  3M8U A;  3DM0 A;  3K2D A;  3MW0 A;  3RTW B;  1RKM A;  5I59 B;  2O7U A;  5AA1 A;  3OO7 A;  4H8J A;  4IO7 A;  1MM6 A;  1Z7N E;  3LUY A;  3TYH A;  1OLC A;  2I0C A;  1A99 A;  3OEN A;  4NF8 A;  4U22 A;  4R9G A;  1LFI A;  2X26 A;  3VVE A;  4C0R A;  5A5X B;  3FD3 A;  1S7Y A;  4IO6 A;  3S4U A;  1Y20 A;  4DZ1 A;  2Y7R A;  4MH5 A;  4DE8 A;  1DSN A;  4FEB A;  4YB5 A;  3TKD A;  3IR1 A;  4GQO A;  2UVI A;  4C1T A;  1MH4 A;  4QHQ A;  3Q28 A;  3U93 A;  4MBP A;  3DP6 A;  3ZKK A;  5I2K B;  2HXW A;  4QF9 A;  2O51 A;  1M5E A;  3V8X B;  4PET A;  4R6K A;  5CC2 A;  1N0T A;  4RXL A;  3LSF B;  1MM7 A;  2THI A;  1GR2 A;  4R74 A;  4DXU A;  2Q8J A;  1FTO A;  3H6U A;  1LAF E;  3VFJ A;  4HS7 A;  5TP9 B;  3KFM A;  1MY4 A;  2D3I A;  1QUI A;  1AIV A;  4IGT A;  3CRB A;  4H0W A;  1XHY A;  3TQW A;  1QUJ A;  4YKP A;  2X7Q A;  2P0S A;  2PMS A;  4Q30 B;  4XXU A;  5AA2 A;  4OTE A;  4TLM B;  4WXJ A;  3HHF A;  1EH3 A;  4IY5 A;  2F7A A;  3Q25 A;  3PPQ A;  2XX8 A;  1B4Z A;  3RGY A;  1TT1 A;  4WEP A;  3D4G A;  3H03 A;  4FAJ A;  2XXX A;  4O3C A;  3CFL A;  5JTY A;  3MQ9 A;  2BJJ X;  4KD5 A;  3GXA A;  1D9V A;  3EHU A;  2XXR A;  5I58 A;  4QFK A;  3VV5 A;  1FW0 A;  3ONM A;  3FJG A;  1A8F A;  3K02 A;  3O6G A;  4NF8 B;  4GXS B;  1SW2 A;  4DCX A;  1B05 A;  2H5Y A;  5IAI A;  1POY 1;  2I3V A;  4L17 A;  1MDQ A;  3TZA A;  3EHS A;  1QKA A;  3C35 A;  5IKB A;  1FQF A;  3PMV A;  2QMX A;  3KSX A;  4I62 A;  3SEY A;  2XXU A;  1LAH E;  5CRY A;  4EXK A;  3A3U A;  2ZNS A;  2E1S A;  1MQJ A;  3PGF A;  4DIG A;  3VVD A;  4OES A;  1Y4C A;  2O7I A;  5BUU A;  3RT8 A;  1VSO A;  3KOT A;  3S9L C;  2ZMB A;  4JB7 A;  3TEL A;  2H25 A;  1P1O A;  3VVF A;  3FZV A;  5F7V A;  2Y84 A;  3RQT A;  2PX1 A;  1JEV A;  1Y9U A;  3PPN A;  2NXO A;  1LAG E;  3MP6 A;  4ZEC A;  1MXU A;  2XXQ A;  1ZU0 A;  2OK2 A;  5ELV A;  3O29 A;  1TWY A;  4OFJ A;  3RPW A;  1FTJ A;  4HW8 A;  1B51 A;  1MQH A;  1BP5 A;  1S9T A;  4OER A;  2R6G E;  3H7M A;  4G4P A;  5AA2 B;  2AL4 A;  1P1N A;  3LSX A;  3G3F A;  2F34 A;  1H43 A;  1B6H A;  3ZSF A;  2ONS A;  2QS4 A;  1A55 A;  2Y7P A;  3FVG A;  1GTK A;  2ZNT A;  2IEE A;  1D3K A;  1J1N A;  4AB6 A;  4OVJ A;  4EUO A;  4OHN A;  3MVX A;  5HBC A;  1AOV A;  3KN7 A;  2DOJ A;  5JTY B;  4XIG Q;  4LA9 A;  1BKA A;  5I56 A;  5AA4 A;  1MQI A;  2PT2 A;  3MJN A;  5CM6 A;  2NWJ A;  5I58 B;  2UYE A;  1MXV A;  5K2Y A;  4EDP A;  4FED A;  1ATG A;  1MRP A;  3FUZ A;  4R72 A;  5H8S A;  5F1Q A;  3CG1 A;  3TTR A;  2XHD A;  3C31 A;  1SW5 A;  1P1Q A;  3R26 A;  4LZ7 A;  1RYO A;  3VLU A;  4KYE A;  3CIJ A;  4GIZ A;  1POT A;  3H4Z A;  1MDP 1;  4RYA A;  4X1D A;  3FXQ A;  3ILT B;  1LCT A;  3SEV A;  1O63 A;  3IX1 A;  4JWX A;  1LB8 A;  1SYI A;  3K00 A;  1B3G A;  2DE2 A;  4M4G A;  3FV2 A;  3K4U A;  1JVY A;  1ELJ A;  1NFT A;  1NKX A;  3PMX A;  2HFB A;  2O69 A;  1B3L A;  3M3F A;  2F35 A;  3C36 A;  3HHG A;  5DTB A;  4X48 A;  1L5T A;  1YTV A;  2FA7 A;  1SYH A;  3I6V A;  1SW4 A;  3PD8 A;  1ZIU A;  1H76 A;  3K6V A;  4KHZ E;  1B3F A;  3KBR A;  1DOT A;  1QUL A;  1LGB C;  2CMO A;  1B5H A;  3K1N A;  1HSJ A;  2XD2 A;  3UGW A;  1B3E A;  3IOV A;  1OLA A;  5I57 A;  2O84 X;  1MY3 A;  5L9M A;  2RC9 A;  3FVO A;  1BLF A;  2XX7 A;  2GFE A;  5AE4 A;  3TMG A;  1SD3 A;  1PB9 A;  2QJE A;  5H8F A;  2PYY A;  1GVC A;  4XKR A;  5CMC A;  5AA4 B;  1JEU A;  4LZ5 A;  2O1M A;  3IAZ A;  5EHS A;  2V3Q A;  1NL5 A;  4X1B A;  2VD3 A;  1PC3 A;  3KZG A;  2LAO A;  3KGC A;  2Z8E A;  3LBS A;  1JET A;  1LB9 A;  5ICQ A;  3G3G A;  3T93 B;  3IO4 A;  3DEL B;  4M1V A;  5H8Q A;  5M2V A;  5J1D A;  1IXC A;  2B3F A;  4XKN A;  2XXP A;  4NF4 A;  2DSF A;  5KDT A;  3FVK A;  1XT8 A;  4GL0 A;  3OMB A;  4F18 A;  1O64 A;  1UQW A;  3N94 A;  3PV0 E;  4LVQ A;  3B6W A;  4ISU A;  3O6H A;  2Q9T A;  1Q35 A;  1NH8 A;  3PUV E;  3HST A;  3U94 A;  5FHO A;  3TTN A;  1B7U A;  2B3B A;  1QJM A;  2D5W A;  4KYD A;  1NNK A;  2VOZ A;  3TPA A;  3IK6 B;  4KCD A;  4Q5T A;  2V93 A;  4PP0 A;  3N5L A;  3K01 A;  5FTH A;  1IUD A;  3KOS A;  2I49 A;  1A40 A;  3GBB A;  4P0I A;  4OET A;  3FGS A;  4H1X A;  5I57 B;  4G68 A;  4EF1 A;  2CZL A;  2YJP A;  3PUZ E;  5DVI A;  3TCG A;  5LOM A;  3OOA A;  1I6A A;  1AH5 A;  5H8F B;  1N7X A;  3MVW A;  3RTF B;  3HO7 A;  5TPA A;  1M5C A;  4FOR A;  3MUQ A;  3EF7 A;  1H44 A;  1SVX B;  3O66 A;  3MC2 A;  2QMW A;  4P11 A;  2ABH A;  3O6I A;  3VE1 B;  1MQG A;  5KZT A;  4KFQ A;  3T9X B;  4O3A A;  4EXL A;  2H4I A;  1SW1 A;  4IO4 A;  3EPE A;  4F22 A;  3H3G A;  1II5 A;  2A5S A;  4U4X A;  1DTZ A;  3OD7 A;  4ONY A;  4NF4 B;  1IIT A;  5KDT B;  1SDX A;  1H45 A;  1B7Z A;  1I6B A;  1LCF A;  3GZG A;  1DMB A;  5L8D A;  4GWO A;  3FAS A;  3UA8 A;  4F2Q A;  4THI A;  1PBP A;  1XVX A;  3O9P A;  2F6G A;  3MZ9 A;  4LUB A;  2Y7K A;  4GF8 A;  1VR5 A;  3L6G A;  3D4C A;  4U2R A;  2XXV A;  3N6T A;  4X9T A;  1B3H A;  5FHN A;  5DVJ A;  3IOW A;  1Q1K A;  1MY2 A;  3LR1 A;  3N6U A;  3V5A A;  4Z0I A;  1QKB A;  3H6V A;  2HZK A;  2PT1 A;  3PU5 A;  3KN8 A;  3B7D A;  1Y3N A;  4F1Y A;  2V3T A;  3SET A;  4Z7E A;  4GVO A;  3IOR A;  1XC1 A;  3T9V A;  3KN3 A;  4QSC A;  4EQ9 A;  4H5G A;  4U1O A;  1LST A;  2QSX A;  3RY3 A;  2ZYM A;  2VHA A;  3BBR A;  3IB0 A;  4KI0 E;  4ND9 A;  2I58 A;  2I0B A;  3MP8 A;  2RF1 A;  3S2V A;  3KEI A;  3W9W A;  4QSE A;  2I4C A;  3JYR A;  4XKP A;  2ZYN A;  3U8Q A;  4PFW A;  2QPQ A;  4LP2 B;  2AIX A;  2DXY A;  1IIW A;  3EN3 A;  3KJ7 A;  3S9M C;  2Q89 A;  2ONR A;  3CSG A;  1IZ1 A;  5DEX A;  3MVY A;  3TCH A;  1R9Q A;  3FJM A;  5EYF A;  5ITO A;  1A7L A;  4OEU A;  3TCF A;  1B9J A;  3MZB A;  3DP8 A;  4LQ5 A;  1MY0 A;  4OWD A;  2RIN A;  4DXB A;  2UVH A;  2DXR A;  2QS3 A;  3CR9 A;  2RCA A;  4U1Z A;  5ICT A;  3CFZ A;  3TTM A;  1EU8 A;  1B5J A;  2R9J A;  1M5D A;  1ZLQ A;  1M5F A;  3GLB A;  2P2A A;  2DVC A;  2G29 A;  4BDR A;  1NNF A;  5ITP A;  4ECF A;  2I3W A;  1IXH A;  2FYI A;  1FTM A;  3W15 C;  1JW5 A;  2V84 A;  3Q26 A;  1OQH A;  3UP9 A;  3B6T A;  4YKI A;  3LSW A;  1HSE A;  2XXY A;  3O28 A;  1R1N A;  5HPQ A;  3G3H A;  3K1M A;  1R9L A;  3MVZ A;  3QUF A;  2Z8D A;  4JWY A;  3A09 A;  1MG1 A;  4IO2 A;  2XXW A;  4YMB A;  2OLB A;  2DP8 A;  4OFL A;  5FHM A;  3SEW A;  2IA4 A;  5DYH A;  4BDM A;  2YPN A;  2UVG A;  2F36 A;  4H65 A;  2F97 A;  4UA8 A;  3QK6 A;  4YU0 A;  4QFP A;  5KCJ A;  3A3C A;  4IO5 A;  3TEP A;  3VXC A;  3TFL A;  4FJP A;  3RNN A;  1US4 A;  1P1U A;  3AXF A;  1B1X A;  2NOO A;  1URG A;  5HM4 B;  1WDN A;  4OEN A;  4ZZE A;  2Z22 A;  4U4S A;  1AMF A;  3Q29 A;  1MXZ A;  1DTG A;  1N3X A;  5DEX B;  4OQO A;  1N04 A;  2YLN A;  2OJT A;  3R7X A;  1LBC A;  4EF2 A;  4H5F A;  4KYS A;  4XKQ A;  3H6W A;  2Y7I A;  4GFR A;  4YB7 A;  1ZKB A;  1R6Z A;  4RNS A;  4RJZ A;  4NF6 A;  2ONK E;  1B58 A;  4H6D A;  2AYS A;  3PUW E;  1BIY A;  3WAF A;  2DE3 A;  4ZEF A;  4ZEI A;  1FQC A;  1B0L A;  3CI8 A;  3RUM A;  1FTK A;  4YKJ A;  4BDO A;  3U72 A;  4IB2 A;  3C9H A;  2PVU A;  3THI A;  3FXR A;  4I9D A;  1LFG A;  4G8H A;  5K2X A;  3N26 A;  1SQY A;  2OBG A;  3OO9 A;  4KQP A;  4POW A;  2DE4 A;  1GV8 A;  3E3K A;  4F3B A;  2RC8 A;  3V83 A;  3G7W A;  2QS1 A;  3E4R A;  1I6Q A;  4I8C A;  2PBW A;  1RYX A;  4JXI A;  4F1U A;  4ZEB A;  3TDJ A;  5I56 B;  1PB7 A;  3U92 A;  4N13 A;  3FV1 A;  5I59 A;  1OVT A;  2ESN A;  2VP1 A;  3EQ1 A;  4AQ4 A;  2DS9 A;  4N6P A;  3QUJ A;  5KCJ B;  4E0X A;  4GXA A;  3K1P A;  1P99 A;  1XOC A;  4YZZ A;  2DVZ A;  4G2Z A;  3CFX A;  2HZL A;  5JEI A;  4RA1 A;  3IOT A;  4NED A;  1B0H A;  5CBS A;  4QSD A;  3TAJ A;  1B4H A;  1WVJ A;  1USY H;  1HSL A;  2OWT A;  2NVU B;  4LQ2 A;  3IB1 A;  3T96 B;  3K0V A;  2GHB A;  4GL8 A;  4ZEK A;  4NMY A;  4U21 A;  2HAV A;  1MH3 A;  3FAT A;  1LAX A;  2R71 A;  2I4B A;  3P7I A;  2QRY A;  1MPC A;  3GBA A;  3BFU A;  3T9H B;  3UN6 A;  3F11 A;  4F2O A;  1LBB A;  4MF3 A;  4NWC A;  1VFD A;  4MFI A;  1YPN A;  4RK9 A;  2O68 A;  1FQB A;  1Z7M E;  3OEK A;  1FQE A;  4OXV A;  4OZ9 A;  3VDF A;  1MPD A;  1Y1M A;  3HCQ A;  1A8E A;  4F1V A;  1JW1 A;  4IGR A;  4ZS9 A;  1MY1 A;  2F7B A;  3IO6 A;  5B7D A;  2UYF A;  2HEU A;  3C33 A;  4KCC A;  4QFO A;  1PB8 A;  2GRV A;  3BFT A;  3TTK A;  4G77 A;  1DPP A;  4KR5 A;  4O3B A;  4H8I A;  4F31 B;  4ELP A;  2ZYK A;  4P0G A;  1ANF A;  1MQD A;  4DCY A;  2HQ0 A;  3VXB A;  4NWD A;  3CSB A;  3UK4 A;  4FE8 A;  3FIR A;  3IB2 A;  3UOR A;  3ECR A;  2Z23 A;  2P1S A;  1QUK A;  4R6H A;  2KLF A;  1GGG A;  3K6U A;  5H8Q B;  4R75 A;  2O6A A;  1N84 A;  3IJX B;  4RPN A;  2F78 A;  2I6E A;  2WKY A;  4FAT A;  4LZ8 A;  3PUY E;  3VLV A;  3G3J A;  2ALU A;  3USD A;  4YB6 A;  4AB5 A;  2VD2 A;  1IQ7 A;  1MXY A;  4JDF A;  5L9O A;  4U23 A;  3T66 A;  3SEX A;  1IEJ A;  3KG2 A;  2RKM A;  2A5T A;  4EQB A;  1LLS A;  3I5O A;  1OQG A;  2UVJ A;  3TUS A;  1MPB A;  4YMA A;  4R2B A;  4K3F A;  3H06 B;  1UTB A;  3MZ1 A;  1NH7 A;  3QYT A;  1VFE A;  3MWB A;  3PUX E;  4LAT A;  1B5I A;  1LFH A;  2XXT A;  4YIC A;  2F8D A;  4Q8R A;  1B1H A;  1VE4 A;  4POX A;  3QXM A;  2F5X A;  4C1U A;  4WKM A;  5TU0 A;  2VGQ A;  2UXA A;  1AL3 A;  4G68 B;  4H67 A;  4F3P A;  1Y1Z A;  3PPO A;  5AA2 D;  2X7P A;  5AA3 A;  1MXW A;  4IO3 A;  1B40 A;  3EHT A;  3IJO B;  1QW0 A;  4G68 C;  2QL3 A;  2B65 A;  3MAM A;  3U1O A;  4F29 A;  2FNC A;  4F19 A;  5TPA B;  2Q2A A;  1MS7 A;  1WOD A;  4LON B;  4PQJ A;  2RCB A;  1USY E;  3O97 A;  5CMB A;  3S9E A;  4PFT A;  4UAC A;  4F39 A;  1S50 A;  1SI0 A;  4ZE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...