1PBQA

Crystal structure of the nr1 ligand binding core in complex with 5,7-dichlorokynurenic acid (dcka) at 1.90 angstroms resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
286
structure length
274
Chain Sequence
RLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms of activation, inhibition and specificity: crystal structures of the NMDA receptor NR1 ligand-binding core
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligand binding protein
molecule keywords N-methyl-D-aspartate Receptor Subunit 1
total genus 73
structure length 274
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pbqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pbqA02
4C0RA 2OWSA 3C35A 1IXHA 3PU5A 1JVYA 3TYHA 4FAJA 4R9FA 1ZU0A 2D3IA 2Z8DA 4F1UA 5A5XB 3EHUA 3L6HA 3CI8A 3SKPA 3OSQA 5DEXB 4F3PA 4OFOA 1D4NA 1PBPA 3FASA 4U22A 2IEEA 3O6GA 2REJA 4ELOA 1VFDA 4OFJA 3WAEA 5AA2A 4XKRA 1N7WA 4MLQA 4OVJA 1NH7A 1QVSA 5TP9A 4BDRA 3K0VA 2Q8JA 2DWJA 1MQGA 2Y84A 2KLFA 3DP4A 4BDQA 3FZVA 1RKMA 3MBPA 2O69A 4G68C 4G8MA 5TPAA 1LAGE 4TOZA 1SD3A 2ZYMA 4P11A 1L5TA 1UIUA 1P99A 4YKPA 5FTHA 3SDFA 3FV1A 3HCQA 1ZMGA 5ELVA 1OLCA 1LAHE 1CB6A 1B5HA 3DELB 3G3HA 5JEIA 1BLFA 3D4CA 3FXQA 3QXMA 3QAXA 4OQOA 4DCXA 1B3HA 3FXRA 4QFNA 1OVBA 4HW8A 2VD3A 2D5WA 3C32A 4NF4B 3BBRA 3DP6A 3JV9A 3UN6A 5ITPA 4DXUA 3FJ7A 4JB7A 4DCYA 3H4ZA 4PE5B 4G68B 1USYE 2QJEA 5B70A 3UORA 3A09A 1SW2A 3WAFA 5I58A 4IO3A 4X48A 3B6QA 4U4XA 3IOVA 2QS2A 4R74A 4EXLA 1CE2A 1LB9A 1YAEA 3KBRA 4OETA 4F3SA 2F97A 3U92A 3ZSFA 2QSXA 4ZEDA 3T9VA 2AYSA 1Q1KA 2H4IA 2I6EA 4NE4A 4YKIA 3S4UA 3TODA 3S9NC 4YMAA 4LP2B 2YPNA 1N0TA 3G3JA 1II5A 2O7IA 2UXAA 2DYXA 3PPRA 4DDDA 4F39A 5J1DA 1EZPA 3L6GA 3VDFA 1JW1A 1QUJA 1N04A 3MP6A 1NFTA 3B6WA 3JYRA 3OEKA 2NOOA 5K2YA 3VLWA 3ZKLA 1FTMA 2ONSA 1RYOA 2O6AA 4WKMA 1I6AA 3OD7A 4YB6A 3ECRA 1B7HA 4F31B 4IY6A 1A99A 1UTBA 3M3LA 1QUIA 4OXVA 3N26A 4F3GA 2QMXA 1MQHA 2F7CA 2XD3A 4ZE9A 3T93B 2GFEA 4NF4A 1ELJA 3KOTA 4Q8RA 3LSWA 3HHGA 1A8FA 5H8FA 3E4RA 1B40A 3CSBA 1LAFE 3N6TA 3USDA 2V3QA 2E0SA 4H5FA 4QSCA 1BIYA 3FIRA 3SEYA 4Q5TA 1MXWA 5H8QA 2XX9A 2I49A 3FUZA 4GL0A 4P0GA 2H5YA 3PMVA 4OENA 1LFHA 5H8NB 3R26A 5CMCA 3T96B 3MP8A 3V5AA 3K1MA 3MWBA 1ZTYA 3PUXE 1MQIA 4GD5A 3K00A 3GZGA 3QUJA 4M4GA 4R2FA 3Q26A 5AA3A 1N3XA 1NL5A 3EHSA 3H6VA 2HCAA 5LOMA 2VD2A 2XX8A 3GBAA 4FE8A 2I4CA 2Y7RA 2DP8A 2YJPA 4WXJA 2DE4A 5FHNA 4R72A 3W9WA 3C9HA 4KQPA 4OYVA 5H8NA 4ZZEA 4N07A 2HQ0A 1QULA 3PPNA 4NF6A 1MY0A 2ZYNA 2UVJA 3PPQA 3TUSA 3GXAA 3IOTA 4LQ2A 3FVKA 1FTKA 2R9JA 2HFBA 2I0CA 4ZEKA 1XVYA 3OELA 3PPPA 4POWA 1FTOA 5DTBA 3V89B 4YMBA 1YPNA 1B46A 2G29A 1R9LA 4H8JA 1EH3A 4YB7A 1D9VA 3K1NA 2Y7PA 1LLSA 1MY1A 4G4PA 4G8NA 4PETA 5JTYB 3UK4A 4F19A 1FQFA 3VVDA 3S9MC 2R71A 5TPAB 5DVIA 2PT2A 3C33A 1NKXA 4FECA 4R6KA 1B3FA 3ONMA 3K6WA 1MPBA 2ZNSA 2Y7KA 3MAMA 4I1DA 1DPPA 4LUBA 5EYFA 2HZLA 2RC7A 2W7YA 3LR1A 4OESA 5EHSA 3T9XB 3CRBA 1URGA 5DEXA 3JZJA 2DWIA 1P1QA 1OQGA 3MZ1A 2A5TA 2WKYA 2RKMA 3K01A 4GFRA 1A8EA 4GF8A 1FCKA 4PFTA 3RUMA 1O63A 3H03A 4YU0A 5CBRA 3C4MA 1S9TA 4E0WA 2Z22A 4OFLA 5I57A 4OTEA 1MPDA 3ILTB 4PFWA 4H5GA 4QHQA 4U21A 4KCCA 1B4ZA 3LBSA 3TAJA 5I58B 1DMBA 1MY2A 2H9BA 5H8QB 1H45A 1GGGA 1N7XA 1SW1A 1B2HA 3U93A 2OK2A 3A3UA 4OEUA 3O9PA 4ZEBA 4YICA 1LFIA 3B6TA 2REGA 4H0WA 3OO8A 1B5JA 3S9LC 1F9BA 3KOSA 3R6UA 2YLNA 3O6IA 3U72A 3B7DA 5FHOA 2OWTA 4NMYA 3MJNA 2FA7A 3PUWE 2B3BA 4ZE8A 1MXXA 3QSLA 2P1SA 5JK4A 3MVZA 4RXLA 1MH3A 2BJJX 4YZZA 1TXFA 4KYSA 2I4BA 4EUOA 2RINA 4KYEA 3FV2A 2O7UA 3K6VA 4FORA 5TP9B 2X7PA 3MVWA 4GRKA 4QFPA 3VLVA 1N84A 4GVOA 3TTRA 3C36A 4OMBA 2GHAA 3IJXB 4ESXA 2QPQA 1UTHB 3VLUA 4QF9A 1NNPA 1NMUA 1B5IA 3PMXA 3MZ9A 5IAIA 5A5XA 1Y3PA 4GIZA 1BKAA 1B58A 2ABHA 1I6QA 4HCWA 4KI0E 3KG2A 4RK9A 3TMGA 3QUFA 1LBBA 3O66A 1USYH 2AL5A 5JTYA 3KN7A 3N6UA 4H65A 1LCTA 1I6BA 1M5FA 3IORA 1POTA 3SEXA 1MM7A 1P1NA 1OVTA 3RPWA 4TLMB 4GXAA 1KWHA 2I3VA 1XHYA 2I48A 3U1OA 3C34A 5KZTA 3ILUB 3TZAA 3HO7A 3KGCA 4UACA 2X26A 4GLIA 4YB5A 5ICQA 2DXRA 1AIVA 2DS9A 2XXVA 2QS1A 3FVOA 4U1ZA 2DE2A 4ELQA 3IB2A 4M1VA 1QKAA 3MPKA 1B1XA 2F6PA 5FTIA 1R6ZA 2OBGA 4F1VA 2UVIA 4I62A 2Y7WA 3SEVA 3R7XA 5KCJA 4MLVA 4F22A 1H76A 4MH5A 1ZLQA 4ZDMA 1AL3A 3MZBA 4ZZAA 4POXA 4OHNA 1A7LA 1QW0A 1LAXA 2P2AA 5ICTA 4ZEIA 1B4HA 2DXYA 2GH9A 3CFXA 3H06B 3IB0A 4H67A 3S2VA 3E13X 3PD9A 2XX7A 4FJPA 3H6UA 2QS3A 3OMBA 1UIVA 1B7UA 1URDA 2PT1A 2UYFA 3M8UA 4RYAA 3IOUA 3VVEA 4RK2A 1JW4A 5H8FB 3BFTA 4U4SA 2ZXTA 3RT8A 4EQBA 1FQEA 2DE3A 4EF2A 3KJTA 2QL3A 4C1TA 3T9HB 3O97A 4DE8A 4LZ5A 3VE1B 3O6HA 4NF5B 2AL4A 1P1UA 2HEUA 2Q88A 2XXRA 3I3VA 3PUYE 4IO4A 4JSOA 2HZKA 3M3KA 3TDJA 1MPCA 3H6WA 3TELA 3HN0A 5KDTB 2A5SA 3E3KA 3P7IA 4H1XA 3OO6A 2D21A 4L17A 1PB7A 4PQJA 5CBSA 3H7MA 3OSRA 3PUVE 1JETA 2Q2AA 2HAVA 3IOWA 2PYYA 1B9JA 2ZNUA 1JNFA 3VXCA 1S50A 4G77A 5H8HB 3IO6A 4PP0A 2H98A 3G3IA 4F1YA 2QS4A 5CRYA 2ESNA 2F7BA 4GQOA 1SBPA 2UVGA 4DZ1A 1B6HA 1XS5A 1Y4CA 2NUVA 2X7QA 3KEIA 3AXFA 3G7WA 4ISUA 3S9EA 4N13A 1DSNA 4KCDA 2Z8FA 3EQ1A 3PGFA 1TWYA 1IXIA 4U23A 5I2KB 3VV5A 2NWJA 5CMKA 1T0KA 1PC3A 4FEBA 4NTLA 2QMWA 3K6UA 4JWYA 4JWXA 3IX1A 1EU8A 3SEUA 3VVFA 4NWDA 1NH8A 5HPQA 1N76A 5I2NB 3DLNA 4P0IA 1B52A 2XXTA 5AA2B 2H99A 3MPLA 3O2AA 2ZMBA 4QFLA 4Z0IA 2V93A 1FTJA 2H25A 4IO6A 1MDQA 2HXWA 5FHMA 1IXCA 2DOJA 2UYEA 4LQ5A 3RGYA 2Q9TA 4IGTA 3E9XA 2A5TB 1H3DA 3UA8A 4HCYA 5AE4A 3MP1A 3PV0E 3EPEA 3K02A 4MBPA 4BDNA 2F5XA 1Y3QA 4JXIA 3KN3A 4IO2A 3RQTA 4RJZA 4F3BA 4Z7EA 3CIJA 4AQ4A 1LFGA 1ZJLA 1PBQA 3GBBA 4C1UA 2QRYA 4XKPA 4X1DA 3TTLA 3VFJA 4QFKA 4R75A 5I56B 1B3EA 2F7AA 1AH5A 2XXHA 4O3CA 1M5DA 1MXZA 3Q27A 5DT6A 2ALUA 1B1HA 1BTJA 1MDP1 1OMPA 1SW5A 4G8HA 4OEVA 4YKJA 1SDXA 5DVJA 3RY3A 4H6DA 2OZZA 1UQWA 1B05A 2VP1A 3TFLA 1TFDA 1UTHA 3A3CA 3CSGA 3IB1A 3LUYA 4MF3A 2OJTA 3OXNA 5ITOA 3K1PA 3EHTA 2Z8EA 5I59B 1JEUA 1JW5A 2AIXA 4QRZA 4XTCQ 2DSFA 1I69A 3FGSA 4PFUA 4ELRA 2CZLA 3Q25A 3U8QA 2P0SA 4KPTA 2O84X 3KSXA 3PPOA 1ZBMA 2DVZA 1DTGA 2ZYOA 1FTLA 1YTVA 5AA4B 1MRPA 3G3KA 3GLBA 4JBZA 4WEPA 1VE4A 4YKKA 1NNKA 3IJOB 2XXIA 4KR5A 4F2OA 3N94A 1IIWA 1J1NA 1XVXA 1D3KA 5I2NA 3TEPA 2M8CA 5AA4A 1RYXA 1A54A 3CFZA 2V3TA 1ZKBA 3H6TA 4IGRA 3FATA 3IL1B 3LC8A 3H3GA 4IY5A 5CI5A 4XKQA 2F8DA 1PB9A 1LCFA 3KJ7A 5F7VA 1OIBA 5DYHA 1DOTA 1HSJA 1B3GA 3QIMA 4QSDA 1QJMA 3OOAA 3ZS6A 4ZECA 3MUQA 4GL8A 4G2ZA 4E0XA 2THIA 1Y9UA 4MFIA 3UGWA 1Y20A 2Q89A 3KN8A 3W15C 5I84A 4EF1A 5HBCA 1MG1A 2Y7IA 3DP8A 1B3LA 3G3FA 4GWOA 4YAHX 3K4UA 3PMWA 4F29A 3TQWA 2NXOA 2XXUA 1Y3NA 5HM4B 3TTNA 2ZYKA 3ZKKA 1ATGA 1QKBA 1XC1A 3TCHA 4EQ7A 3RLFE 2B3FA 3QYTA 1SVXB 3RN8A 5K2XA 3FJGA 3V8XB 1S7YA 5KDTA 2F34A 3TCFA 1MY4A 4IO5A 2V84A 1EZOA 1MM6A 1BP5A 5CM6A 1SYIA 1WVJA 1ZIUA 1FQCA 3MC2A 4U1OA 1PDAA 5L9OA 3N5LA 4QFOA 2DQVA 4JWOA 4RPNA 1GV8A 4TQUQ 2RF1A 1PB8A 2O1LA 2DWAA 2GRVA 2G93A 2R6GE 1M5EA 1WODA 1IQ7A 1SW4A 3PD8A 2E1SA 3IO4A 5B7DA 4ONYA 3OENA 1LGBC 1YCJA 2XXXA 4FEDA 4LA9A 3O28A 5I56A 1D9YA 1MQJA 1HSLA 3SERA 3U94A 2I58A 1JVXA 1DPEA 3CR9A 3OO9A 2VOZA 1M5CA 1FQBA 1NNFA 2UVHA 2V3UA 4I9DA 2CMOA 1LB8A 4JDFA 4DIGA 3MQ9A 4JSDA 4O3BA 4OZ9A 4R73A 3I6VA 2F78A 4X1BA 3SEWA 3TCGA 4RA1A 4KYDA 5KCJB 3HSTA 3QK6A 1POY1 3CG1A 1OQHA 1P1OA 4FIMA 3FVGA 4KFQA 3VXBA 1MXYA 2O68A 1IXGA 1O7TA 3LSLA 3EN3A 4NF8B 2XXYA 4KD5A 4O3AA 1H43A 4R6YA 3HPIA 4ND9A 4H8IA 3MVXA 1B0HA 1EZ9A 1IEJA 1TFAA 2VHAA 2XD2A 4KHZE 4LZ8A 5CMMA 2B65A 2RC8A 1IUDA 1MY3A 3EF7A 1AMFA 3HV1A 4NF5A 5AA1A 2I3WA 1US4A 3Q29A 1P1WA 5EHMA 3BKIB 3FXUA 1GTKA 4R2BA 3THIA 4F2QA 1VFEA 3T9UA 3BFUA 4BDMA 1MH4A 2F6GA 3ODBA 4QSEA 3Q28A 4ELPA 1US5A 5I2KA 4OWDA 4HTGA 1UTBB 1TT1A 3I5OA 2F36A 3UIFA 3MVYA 1FQAA 4EQ9A 1ANFA 4ZEFA 1SI0A 2DWHA 1R1NA 2HAUA 1VR5A 1N3WA 3MW0A 1FW0A 3IR1A 5H8HA 5AA2D 4R6HA 5TU0A 4RPOA 4XXUA 2PBWA 1SI1A 4LATA 3SETA 4AB6A 1LSTA 3K6XA 3TTKA 2XHDA 3UP9A 1Z7NE 3TPAA 4NWCA 5L8DA 1OLAA 4EXKA 4GXSB 1XOCA 1XT8A 2VGQA 2NVUB 3RTFB 1GR2A 2ONRA 1FQDA 1B7ZA 3W9VA 1WDNA 3FJMA 4XIGQ 1GVCA 1M5BA 3DM0A 1Y1ZA 2LAOA 2XXWA 3T66A 4I8CA 2RCAA 1H44A 3F11A 1AOVA 2Z23A 2PX1A 4ECFA 1JEVA 3K2DA 1LBCA 1O64A 4K3FA 4PFYA 1QUKA 1Y4TA 4BDOA 3KSJA 3CVGA 4LVQA 4X9TA 4GOTA 3RTWB 2Q2CA 2O51A 2DVCA 3RT6B 1VSOA 4RY1A 3OO7A 2RC9A 1B32A 3M3FA 1DTZA 4ZS9A 4Q30B 3SESA 4BDLA 4FATA 5CC2A 2I0BA 4DXCA 1PEBA 2ANJA 5M2VA 3TKDA 3KFMA 4R9GA 5I57B 3LSXA 2FNCA 4THIA 2GHBA 1SQYA 2ONKE 3C31A 3G3GA 1HSEA 4AB5A 4IO7A 4NEDA 4LZ7A 5H8SA 2O1MA 5F1QA 4N6PA 2PMSA 4NF8A 4TLLB 5IKBA 1IITA 3TTMA 1IZ1A 4IB2A 4F18A 3CFLA 3IAZA 4WEDA 2RCBA 1MXVA 2V25A 3KZGA 3V83A 3FD3A 2XXQA 4LONB 3LSFB 3CG3A 5DVFA 5BUUA 5ISUA 3T22A 2ZNTA 1A40A 4XKNA 1NNTA 4HS7A 4EDPA 2F35A 2OLBA 4G68A 3O29A 5L9MA 5I59A 1MS7A 4OERA 5CMBA 4Q0CA 3D4GA 5L9SA 3IK6B 3OEMA 1URSA 2PVUA 1JQFA 3PUZE 3TQLA 4ESWA 1Y1MA 4RNSA 4UA8A 1B0LA 3RNNA 5BWJA 1Z7ME 1MQDA 4DXBA 1Q35A 2FYIA 2OCUA 1SYHA 2XXPA 1A55A 1B51A 3HHFA 4NF6B 2IA4A 4BLAA 1MXUA 4DLDA 4U2RA 3FVNA 1R9QA
chains in the Genus database with same CATH superfamily
5A5XB 3CI8A 3SKPA 3OSQA 2Q8MA 3FASA 4U22A 2IEEA 3O6GA 2REJA 4OFJA 3WAEA 5AA2A 1RDXA 3K0VA 2Q8JA 2Y84A 2KLFA 4BDQA 1RKMA 2O69A 4N6DA 2ZYMA 1P99A 3SDFA 2B4MA 1B5HA 3FXQA 3FXRA 4QFNA 4JB7A 4FBPA 3H4ZA 4PE5B 1USYE 5I58A 4X48A 2QFLA 2QS2A 4EXLA 4ZEDA 4GBVA 3TODA 4NHBA 1II5A 2O7IA 3KC1A 3VDFA 1QUJA 3MP6A 1N04A 3JYRA 2F3DA 1FTMA 2ONSA 2O6AA 4WKMA 3OD7A 1A99A 3M3LA 4OXVA 4NF4A 4Q8RA 3HHGA 5H8FA 3E4RA 1B40A 4H5FA 3MSTA 2I49A 4P0GA 3E79A 2H5YA 4OENA 5CMCA 3MWBA 4M4GA 1N3XA 3H6VA 4FE8A 3T22A 5FHNA 1FPFA 3W9WA 3C9HA 4ZZEA 2HQ0A 4N17A 1QULA 1NV5A 4NF6A 1FTAA 2HFBA 3PPPA 3V89B 4YMBA 2G29A 1EH3A 1D9VA 1LLSA 2R71A 5A5LA 4R6KA 3MAMA 2Y7KA 4I1DA 5EYFA 5IZ1A 3LR1A 4OESA 2P3NA 2RKMA 1A8EA 1K9YA 4YU0A 1S9TA 4E0WA 1MPDA 3ILTB 4KCCA 2H9BA 5H8QB 1SW1A 1GGGA 4OEUA 4HXVA 5T3JA 4H0WA 3OO8A 2CEYA 1F9BA 3U72A 3PUWE 1MXXA 3MVZA 3D1RA 4YZZA 1MH3A 2BJJX 2I4BA 2O7UA 4GRKA 4MNIA 1UTHB 2XXKA 1NNPA 5A5XA 4P8BA 4KI0E 1I6QA 4HCWA 3QUFA 4PDHA 4H65A 1P1NA 4N6KA 1XHYA 3U1OA 3C34A 3TZAA 4UACA 1QGXA 2DE2A 4ELQA 3IB2A 2V4CA 2F6PA 1R6ZA 3FBPA 5EQ9A 4F1VA 2WYKA 1H76A 4ZZAA 1A7LA 2P2AA 5ICTA 1B4HA 1UIVA 3VVEA 3IOUA 4EQBA 3O97A 4LZ5A 2AL4A 2HEUA 4PFUA 3I3VA 4JSOA 2CZHA 2HZKA 3TDJA 4GWWA 3HN0A 2A5SA 4PQJA 1PB7A 1FJ6A 2ZNUA 1S50A 4PP0A 2H98A 3G3IA 2ESNA 5F24A 1SBPA 2NUVA 2PCRA 3AXFA 4ISUA 2Z8FA 4HE2A 1TWYA 1IXIA 1T0KA 4NTLA 2QMWA 3K6UA 1EU8A 3VVFA 5HPQA 1KA1A 4HE0A 3MPLA 2R8TA 2V93A 1FTJA 4IO6A 5FHMA 4N91A 1NV2A 3B8BA 3PV0E 4JXIA 3KN3A 3RQTA 4NN3A 3TTLA 4R75A 1B3EA 2F7AA 1M5DA 3Q27A 3TFLA 2HHMA 3IB1A 3LUYA 4MF3A 3OXNA 2Z8EA 4O94A 1JEUA 1JW5A 2AIXA 4ELRA 2ZYOA 5AA4B 1EYIA 1MRPA 4WEPA 2PFYA 1J1NA 1D3KA 5AA4A 2V3TA 4IGRA 3IL1B 3KJ7A 4OANA 2HXRA 3QIMA 3OOAA 4GL8A 4G2ZA 2THIA 2L5VA 4EF1A 3DP8A 2MKZA 3G3FA 3K4UA 3TQWA 2XXUA 5HM4B 3ZKKA 1XC1A 4EQ7A 3RLFE 3QYTA 3RN8A 3FJGA 2F34A 1EZOA 5CM6A 1SYIA 1WVJA 4RPNA 3K1PA 1PB8A 2O1LA 2DWAA 2R6GE 4BLAA 1WODA 1IQ7A 3PD8A 3IO4A 5B7DA 1YCJA 1MQJA 1DPEA 1FQBA 4I9DA 4JDFA 2CMOA 4F3PA 4R73A 4KYDA 2FHYA 3QK6A 3CG1A 3VXBA 2O68A 1IXGA 4JVDA 3EN3A 4OVQA 2VPNA 2VPOA 2B65A 4NF5A 1MY3A 3EF7A 1LBWA 3Q29A 1P1WA 3FXUA 4H46A 4R2BA 3THIA 4F2QA 1MH4A 2F6GA 1ANFA 1R1NA 1VR5A 5AA2D 3SETA 3FXBA 4AS5A 3K6XA 1XT8A 2VGQA 2ONRA 3U65A 1GVCA 2OWZA 1AOVA 1FBHA 4PFYA 3KSJA 3CVGA 4GWSA 3RTWB 2O51A 2DVCA 3KBZA 3RT6B 5I57B 5M2VA 1DCUA 3KFMA 4R9GA 4THIA 4IO7A 4NEDA 4NGUA 2O1MA 5F1QA 4NF8A 4F18A 4IB2A 1RDYA 3FD3A 5BUUA 4XFEA 1NNTA 4HS7A 4EDPA 4PBHA 1FPGA 3D4GA 3IK6B 3OEMA 2PVUA 1JQFA 5BWJA 1MQDA 4DXBA 1Q35A 2OCUA 1SYHA 1A55A 1FBCA 1NUZA 2IA4A 4DLDA 4U2RA 1NNKA 4FAJA 1IXHA 3TYHA 2Z8DA 4F1UA 3EHUA 3L6HA 3NOHA 1VFDA 1MQGA 3DP4A 4G8MA 1LAGE 1L5TA 1UIUA 4YKPA 5FTHA 2Q74A 3HCQA 5ELVA 3QXMA 5EQ7A 1B3HA 1NUYA 2VD3A 3C32A 4NF4B 3UN6A 3DP6A 3FJ7A 4G68B 5B70A 3WAFA 3B6QA 3U92A 2AYSA 2I6EA 4YKIA 4GWZA 4PFIA 4F39A 3L6GA 4GX4A 5K2YA 3B6WA 2NOOA 4GWUA 4F31B 4DI4B 4IY6A 1UTBA 1QUIA 2XD3A 2GFEA 4N81A 3N6TA 1LAFE 3USDA 1CNQA 1BIYA 3FIRA 1MXWA 5H8QA 2XX9A 3T96B 4GD5A 1MQIA 5AA3A 3K00A 3GZGA 3Q26A 3EHSA 2HCAA 2FIXA 2VD2A 4WXJA 2DP8A 4N07A 4N4UA 1MY0A 3IOTA 4LQ2A 3FVKA 2R9JA 3UIFA 5ET8A 5DTBA 4H8JA 4YB7A 3UK4A 5JTYB 2B4LA 2PT2A 1EYJA 1NV1A 2HZLA 2W7YA 5EHSA 4MHFA 3CRBA 1URGA 3JZJA 4GFRA 4GF8A 5CBRA 5I57A 4OTEA 4QHQA 3LBSA 3TAJA 5I58B 1MY2A 2XWVA 2OK2A 3O9PA 4YICA 2OX3A 3S9LC 3KOSA 3B7DA 2P1SA 4P47A 2X7PA 4QFPA 3VLVA 1N84A 4GVOA 3VLUA 3PMXA 3MZ9A 5IAIA 2BJIA 2ABHA 1B58A 3KG2A 4PE3A 4RK9A 1USYH 1FPLA 3N6UA 1LCTA 1I6BA 1M5FA 3IORA 1POTA 4NQ8A 5ICQA 3FVOA 3MPKA 5FTIA 2UVIA 4I62A 2Y7WA 5KCJA 4MH5A 4ZDMA 1AL3A 3MZBA 4GWXA 3H06B 4H67A 3S2VA 3E13X 4FJPA 3H6UA 2QS3A 3OMBA 1B7UA 2PT1A 5H8FB 5EQ8A 2QL3A 4C1TA 3T9HB 4NF5B 3RPLB 2XXRA 3BIHA 1IMBA 3M3KA 1MPCA 1IMAA 2KR0A 3TELA 5KDTB 3E3KA 4H1XA 3OO6A 2D21A 4L17A 5LDZA 2PYYA 1B9JA 4G77A 5H8HB 4F1YA 5CRYA 2F7BA 4DZ1A 1B6HA 1Y4CA 4PC9A 3S9EA 1DSNA 3VV5A 4JWYA 4JWXA 3SEUA 1FPDA 4OVRA 5AA2B 2ZZVA 4QFLA 2H25A 2HXWA 2UYEA 4LQ5A 4I40A 4OA4A 3UA8A 4HCYA 3MP1A 4BDNA 3K02A 4MBPA 2F5XA 1Y3QA 4Z7EA 4F3BA 3CIJA 1LFGA 4PAKA 4C1UA 4X1DA 3VFJA 5DT6A 1B1HA 4OEVA 3RY3A 1SDXA 2CEXA 5DVJA 1B05A 1UTHA 3A3CA 3B50A 3CSGA 2CZLA 3U8QA 3KSXA 1ZBMA 4JBZA 4YKKA 4NF0A 1IIWA 1LBZA 5I2NA 3TEPA 1G0IA 3FATA 4IY5A 3H3GA 5CI5A 1LCFA 5DYHA 4QSDA 4QBAA 3UGWA 1Y9UA 3W15C 5HBCA 2Y7IA 1B3LA 4YAHX 1NV4A 2NXOA 3TCHA 1SVXB 1S7YA 5KDTA 1MM6A 4U1OA 1FQCA 5L9OA 1GV8A 3C4MA 2RF1A 2GRVA 4F2OA 2G93A 2XWOA 2E1SA 2XXXA 4FEDA 3O28A 5I56A 1D9YA 3SERA 1JVXA 3OO9A 2VOZA 1LB8A 3MQ9A 4O3BA 4X1BA 5KCJB 3TCGA 3HSTA 1OQHA 1FPBA 1O7TA 1H43A 3HPIA 3R7XA 4H8IA 3MVXA 5CMMA 4PAIA 2RC8A 1IUDA 3GYYA 5AA1A 1AMFA 3HV1A 1LBVA 3BFUA 4BDMA 3ODBA 3I5OA 3MVYA 4ZEFA 2DWHA 3T1BA 1N3WA 1IMEA 1FW0A 5H8HA 4R6HA 5TU0A 4MNPA 4RPOA 4AB6A 1G0HA 1LSTA 4P1LA 1OLAA 4GXSB 2NVUB 1WDNA 1DK4A 4XIGQ 1M5BA 3DM0A 2LAOA 3T66A 1FBEA 1H44A 3F11A 2Z23A 1JEVA 3K2DA 1O64A 2Q2CA 4RY1A 3OO7A 4GBWA 2RC9A 1DTZA 3SESA 4Q30B 4BDLA 4DXCA 5DW8A 3TKDA 2GHBA 2WBBA 3C31A 3G3GA 1Q9DA 4LZ7A 2PMSA 4WEDA 3IAZA 2V25A 2XXQA 3LSFB 3CG3A 4G68A 1MS7A 3TQLA 4ESWA 4RNSA 2CZKA 4NF6B 3FVNA 5EYGA 2HPGA 3PU5A 3BIGA 1ZU0A 2D3IA 4XEQA 2F3BA 4I3YA 4ELOA 4MLQA 1QVSA 4H45A 5TP9A 4BDRA 2DWJA 3FZVA 5TPAA 4G68C 4P11A 4PFBA 4GX3A 1LAHE 1CB6A 3G3HA 5JEIA 2D5WA 3BBRA 2WEFA 1EYKA 1SW2A 5FBPA 4IO3A 4U4XA 3IOVA 3KBRA 2F97A 1JP4A 1Q1KA 2H4IA 4NE4A 3S4UA 4YMAA 2YPNA 3PPRA 3G3JA 2DYXA 1EZPA 1JW1A 4NAPA 3OEKA 4OVPA 1RYOA 4YB6A 3ECRA 3E78A 2QMXA 2F7CA 3KOTA 1A8FA 2E0SA 4QSCA 1FJ9A 3SEYA 4Q5TA 4GL0A 1LFHA 3PMVA 3R26A 3MP8A 3K1MA 1ZTYA 4R2FA 4P3LA 2I4CA 2DE4A 4R72A 4OYVA 3PPQA 1FTKA 4N8GA 1XVYA 1FTOA 3IFCA 1FRPA 1YPNA 1R9LA 2Y7PA 1MY1A 4G4PA 4PETA 3T0JA 4F19A 1FQFA 3VVDA 5ET7A 1NKXA 3K6WA 1MPBA 5IM2A 2RC7A 2A5TA 2WKYA 3U94A 1FCKA 3RUMA 1O63A 3H03A 2Z22A 4PBQA 1XI6A 1NI9A 4PFRA 4U21A 1B4ZA 4PCDA 1DMBA 1H45A 3U93A 1B2HA 4ZEBA 2REGA 1RDZA 4GX6A 1B5JA 3R6UA 3O6IA 5FHOA 4NMYA 3MJNA 2B3BA 4ZE8A 3QSLA 4RXLA 1FPEA 1TXFA 4KYSA 1IMDA 3FV2A 3K6VA 2WYPA 3TTRA 3C36A 1B5IA 1Y3PA 4GIZA 4MNCA 3TMGA 1LBBA 3O66A 4OVSA 2AL5A 5JTYA 3SEXA 1MM7A 3RPWA 4TLMB 1KWHA 2I48A 3KGCA 2X26A 4GLIA 2DS9A 2XXVA 2QS1A 4M1VA 1QKAA 4AS4A 3SEVA 4F22A 1ZLQA 4OHNA 2DXYA 3IB0A 2XX7A 1URDA 5ET5A 1JW4A 2DE3A 3KJTA 4DE8A 3VE1B 3O6HA 1KZ8A 1P1UA 2Q88A 3PUYE 1LBYA 3H6WA 3P7IA 5CBSA 5IZZA 3OSRA 3PUVE 1JETA 4QXDA 3VXCA 2WX9A 3IO6A 2QS4A 3CHGA 4GQOA 5ESYA 1XS5A 1FBDA 4N13A 3IFAA 3PGFA 5I2KB 1BK4A 5CMKA 4FEBA 1NV6A 4NWDA 5I2NB 4KXPA 3DLNA 3LV0A 1B52A 2H99A 1MDQA 1IXCA 2Q9TA 3E9XA 5AE4A 4RJZA 1ZJLA 4QFKA 4NG7A 2ALUA 1BTJA 1MDP1 1OMPA 4N15A 4YKJA 1UQWA 2VP1A 1TFDA 5KZTA 5I59B 2OJTA 3EHTA 4QRZA 4XTCQ 1I69A 3FGSA 3Q25A 5IZ3B 2P0SA 4KPTA 2O84X 3PPOA 2DVZA 1YTVA 3GLBA 3IJOB 4KR5A 3N94A 1YYZA 1A54A 3CFZA 4XF5A 1ZKBA 3H6TA 2Y5KA 3LC8A 4PAFA 4XKQA 1PB9A 5F7VA 1INPA 4IR8A 1HSJA 1B3GA 4ZECA 1Y20A 2Q89A 3KN8A 5I84A 4F29A 3PMWA 1QKBA 4HE1A 4IO5A 2V84A 3RPLA 1ZIUA 3MC2A 4QFOA 2DQVA 1LEVA 4TQUQ 2PFZA 1SW4A 4ONYA 1LGBC 1NV3A 4LA9A 1HSLA 2I58A 3CR9A 2V3UA 4DIGA 4RA1A 4FIMA 3FVGA 3PTYA 1MXYA 4KD5A 4O3AA 1B0HA 4LZ8A 1EZ9A 2XD2A 3HFUA 2I3WA 1US4A 5EHMA 3BKIB 1GTKA 3T9UA 3Q28A 1US5A 4OWDA 4PF6A 4EQ9A 2FBPA 3MW0A 4XXUA 1SI1A 3SZPA 3TTKA 2XHDA 1NV0A 3UP9A 3TPAA 4NWCA 1XOCA 3W9VA 3FJMA 1Y1ZA 4O7MA 4I8CA 4ECFA 4K3FA 1Y4TA 4X9TA 4GOTA 1NUWA 1VSOA 5CC2A 4P1EA 3LSXA 2FNCA 4N8YA 1SQYA 1HSEA 5J16A 4AB5A 5H8SA 4N6PA 4TLLB 1IZ1A 1FBGA 3CFLA 1MXVA 3KZGA 3EKIA 5ISUA 4XKNA 5I59A 3O29A 5CMBA 1FPJA 4OERA 4Q0CA 5L9SA 1URSA 2P3VA 3PUZE 4UA8A 3RNNA 4MAGA 2XXPA 1B51A 1MXUA 2JJKA 4C0RA 2OWSA 3C35A 3QMFA 1JVYA 4R9FA 5DEXB 4OFOA 1D4NA 1PBPA 4XKRA 1N7WA 4OVJA 1NH7A 5EYHA 2Y5LA 3MBPA 4X8RA 4TOZA 1SD3A 3FV1A 1ZMGA 1OLCA 3DELB 1BLFA 3D4CA 3QAXA 4OQOA 4DCXA 1KA0A 1OVBA 4HW8A 3JV9A 5ITPA 4DXUA 4DCYA 2QJEA 3A09A 4R74A 4F3SA 1CE2A 1LB9A 1YAEA 4OETA 2QSXA 3T9VA 3S9NC 4LP2B 4UABA 1N0TA 2UXAA 4DDDA 5J1DA 1NFTA 3VLWA 3ZKLA 1I6AA 1B7HA 4F3GA 3N26A 1MQHA 4ZE9A 4MX6A 3T93B 1ELJA 3LSWA 3CSBA 2V3QA 3FUZA 2KQZA 5H8NB 3ZSFA 3V5AA 3PUXE 1NUXA 2QVRA 3QUJA 1NL5A 5LOMA 2XX8A 3GBAA 2Y7RA 2YJPA 4KQPA 5H8NA 3PPNA 4G61A 2ZYNA 2UVJA 3TUSA 3GXAA 4ZEKA 2I0CA 3OELA 4POWA 1B46A 3K1NA 4G8NA 3S9MC 5TPAB 5DVIA 4MJOA 3C33A 4FECA 1B3FA 3ONMA 4LUBA 2ZNSA 3UORA 1DPPA 3T9XB 5DEXA 2DWIA 1P1QA 1OQGA 3MZ1A 3K01A 4PFTA 1LBXA 4OFLA 4PFWA 4H5GA 5I3SA 1N7XA 3A3UA 2QVVA 1LFIA 3B6TA 5I7IA 2ZZXA 4O7IA 2CZIA 2YLNA 2GQ1A 2OWTA 2FA7A 5JK4A 4EUOA 2RINA 4KYEA 5TP9B 4FORA 3MVWA 3RYDA 3LUZA 4OMBA 2GHAA 3IJXB 4ESXA 2QPQA 4QF9A 1NMUA 1BKAA 3ROJA 1FPIA 3KN7A 1OVTA 1FBFA 4GXAA 2I3VA 4OVTA 3ILUB 3HO7A 4YB5A 1AIVA 2DXRA 5I5PA 4U1ZA 4PDDA 2XWKA 1B1XA 4PF8A 2OBGA 2DDKA 1FSAA 4MLVA 1AWBA 4POXA 1QW0A 1LAXA 4ZEIA 2GH9A 4O8MA 1FBPA 3CFXA 3PD9A 3M8UA 2UYFA 4RYAA 2ZZWA 4RK2A 3BFTA 4U4SA 2ZXTA 3RT8A 1FQEA 4EF2A 2WBDA 2QVUA 3A29A 4IO4A 4JVIA 3H7MA 2VT5A 2Q2AA 2HAVA 3IOWA 1JNFA 2UVGA 2X7QA 3KEIA 3G7WA 5EQAA 1K9ZA 4KCDA 3EQ1A 4U23A 2NWJA 1PC3A 3IX1A 2FIEA 1NH8A 1N76A 4P0IA 2XXTA 3O2AA 2ZMBA 4Z0IA 2DOJA 3RGYA 4IGTA 2A5TB 1H3DA 3EPEA 4IO2A 1SPIA 4AQ4A 1PBQA 3KC0A 3GBBA 2QRYA 4XKPA 5I56B 4O3CA 1AH5A 2XXHA 1MXZA 1SW5A 4G8HA 4X04A 4H6DA 2OZZA 5ITOA 2DSFA 1DTGA 1FTLA 5LTCA 3G3KA 1VE4A 2XXIA 1XVXA 2M8CA 1RYXA 2F8DA 1OIBA 1DOTA 1YXIA 4GWYA 1QJMA 3ZS6A 3MUQA 4E0XA 4MFIA 1MG1A 4GWOA 1NV7A 1Y3NA 4PGNA 3TTNA 2ZYKA 1ATGA 2B3FA 5K2XA 3V8XB 3TCFA 1MY4A 5IGAA 4NX1A 4MIJA 1BP5A 1PDAA 3N5LA 4JWOA 1M5EA 3OENA 1FPKA 1M5CA 1NNFA 2UVHA 4LN5A 4OZ9A 4JSDA 3I6VA 2F78A 3SEWA 1POY1 1P1OA 4KFQA 3LSLA 4NF8B 2XXYA 4R6YA 4ND9A 2VHAA 1TFAA 1IEJA 4KHZE 4JVCA 2FVZA 3ISPA 1YZ0A 5IZ3A 1VFEA 4QSEA 4ELPA 5I2KA 4HTGA 1UTBB 1TT1A 2F36A 1FQAA 1SI0A 2HAUA 3IR1A 2PBWA 4LATA 1Z7NE 5L8DA 4EXKA 3RTFB 4MCOA 1IMFA 1GR2A 1FQDA 1B7ZA 4MMPA 2XXWA 4P56A 2RCAA 2PX1A 1LBCA 4BDOA 5ET6A 1QUKA 4LVQA 4MEVA 1B32A 3M3FA 4ZS9A 4FATA 2I0BA 1PEBA 2ANJA 4DI3D 1VDWA 2XWIA 2ONKE 4I3EA 5IKBA 1IITA 3TTMA 1D9QA 2RCBA 1IMCA 3V83A 4LONB 5DVFA 2ZNTA 1A40A 1DBZA 2F35A 2OLBA 5L9MA 2XA5A 3MYUA 4PTKA 1Y1MA 1B0LA 1Z7ME 2FYIA 4P9KA 3HHFA 4PGPA 1R9QA
chains in the Genus database with same CATH topology
4C0RA 2OWSA 3C35A 1IXHA 3PU5A 1JVYA 3TYHA 4FAJA 4R9FA 1ZU0A 2D3IA 2Z8DA 4F1UA 5A5XB 3EHUA 3L6HA 3CI8A 3SKPA 3OSQA 5DEXB 4F3PA 4OFOA 1D4NA 1PBPA 3FASA 4U22A 2IEEA 3O6GA 2REJA 4ELOA 1VFDA 4OFJA 3WAEA 5AA2A 4XKRA 1N7WA 4MLQA 4OVJA 1NH7A 1QVSA 5TP9A 4BDRA 3K0VA 2Q8JA 2DWJA 1MQGA 2Y84A 2KLFA 3DP4A 4BDQA 3FZVA 1RKMA 3MBPA 2O69A 4G68C 4G8MA 5TPAA 1LAGE 4TOZA 1SD3A 2ZYMA 4P11A 1L5TA 1UIUA 1P99A 4YKPA 5FTHA 3SDFA 3FV1A 3HCQA 1ZMGA 5ELVA 1OLCA 1LAHE 1CB6A 1B5HA 3DELB 3G3HA 5JEIA 1BLFA 3D4CA 3FXQA 3QXMA 3QAXA 4OQOA 4DCXA 1B3HA 3FXRA 4QFNA 1OVBA 4HW8A 2VD3A 2D5WA 3C32A 4NF4B 3BBRA 3DP6A 3JV9A 3UN6A 5ITPA 4DXUA 3FJ7A 4JB7A 4DCYA 3H4ZA 4PE5B 4G68B 1USYE 2QJEA 5B70A 3UORA 3A09A 1SW2A 3WAFA 5I58A 4IO3A 4X48A 3B6QA 4U4XA 3IOVA 2QS2A 4R74A 4EXLA 1CE2A 1LB9A 1YAEA 3KBRA 4OETA 4F3SA 2F97A 3U92A 3ZSFA 2QSXA 4ZEDA 3T9VA 2AYSA 1Q1KA 2H4IA 2I6EA 4NE4A 4YKIA 3S4UA 3TODA 3S9NC 4YMAA 4LP2B 2YPNA 1N0TA 3G3JA 1II5A 2O7IA 2UXAA 2DYXA 3PPRA 4DDDA 4F39A 5J1DA 1EZPA 3L6GA 3VDFA 1JW1A 1QUJA 1N04A 3MP6A 1NFTA 3B6WA 3JYRA 3OEKA 2NOOA 5K2YA 3VLWA 3ZKLA 1FTMA 2ONSA 1RYOA 2O6AA 4WKMA 1I6AA 3OD7A 4YB6A 3ECRA 1B7HA 4F31B 4IY6A 1A99A 1UTBA 3M3LA 1QUIA 4OXVA 3N26A 4F3GA 2QMXA 1MQHA 2F7CA 2XD3A 4ZE9A 3T93B 2GFEA 4NF4A 1ELJA 3KOTA 4Q8RA 3LSWA 3HHGA 1A8FA 5H8FA 3E4RA 1B40A 3CSBA 1LAFE 3N6TA 3USDA 2V3QA 2E0SA 4H5FA 4QSCA 1BIYA 3FIRA 3SEYA 4Q5TA 1MXWA 5H8QA 2XX9A 2I49A 3FUZA 4GL0A 4P0GA 2H5YA 3PMVA 4OENA 1LFHA 5H8NB 3R26A 5CMCA 3T96B 3MP8A 3V5AA 3K1MA 3MWBA 1ZTYA 3PUXE 1MQIA 4GD5A 3K00A 3GZGA 3QUJA 4M4GA 4R2FA 3Q26A 5AA3A 1N3XA 1NL5A 3EHSA 3H6VA 2HCAA 5LOMA 2VD2A 2XX8A 3GBAA 4FE8A 2I4CA 2Y7RA 2DP8A 2YJPA 4WXJA 2DE4A 5FHNA 4R72A 3W9WA 3C9HA 4KQPA 4OYVA 5H8NA 4ZZEA 4N07A 2HQ0A 1QULA 3PPNA 4NF6A 1MY0A 2ZYNA 2UVJA 3PPQA 3TUSA 3GXAA 3IOTA 4LQ2A 3FVKA 1FTKA 2R9JA 2HFBA 2I0CA 4ZEKA 1XVYA 3OELA 3PPPA 4POWA 1FTOA 5DTBA 3V89B 4YMBA 1YPNA 1B46A 2G29A 1R9LA 4H8JA 1EH3A 4YB7A 1D9VA 3K1NA 2Y7PA 1LLSA 1MY1A 4G4PA 4G8NA 4PETA 5JTYB 3UK4A 4F19A 1FQFA 3VVDA 3S9MC 2R71A 5TPAB 5DVIA 2PT2A 3C33A 1NKXA 4FECA 4R6KA 1B3FA 3ONMA 3K6WA 1MPBA 2ZNSA 2Y7KA 3MAMA 4I1DA 1DPPA 4LUBA 5EYFA 2HZLA 2RC7A 2W7YA 3LR1A 4OESA 5EHSA 3T9XB 3CRBA 1URGA 5DEXA 3JZJA 2DWIA 1P1QA 1OQGA 3MZ1A 2A5TA 2WKYA 2RKMA 3K01A 4GFRA 1A8EA 4GF8A 1FCKA 4PFTA 3RUMA 1O63A 3H03A 4YU0A 5CBRA 3C4MA 1S9TA 4E0WA 2Z22A 4OFLA 5I57A 4OTEA 1MPDA 3ILTB 4PFWA 4H5GA 4QHQA 4U21A 4KCCA 1B4ZA 3LBSA 3TAJA 5I58B 1DMBA 1MY2A 2H9BA 5H8QB 1H45A 1GGGA 1N7XA 1SW1A 1B2HA 3U93A 2OK2A 3A3UA 4OEUA 3O9PA 4ZEBA 4YICA 1LFIA 3B6TA 2REGA 4H0WA 3OO8A 1B5JA 3S9LC 1F9BA 3KOSA 3R6UA 2YLNA 3O6IA 3U72A 3B7DA 5FHOA 2OWTA 4NMYA 3MJNA 2FA7A 3PUWE 2B3BA 4ZE8A 1MXXA 3QSLA 2P1SA 5JK4A 3MVZA 4RXLA 1MH3A 2BJJX 4YZZA 1TXFA 4KYSA 2I4BA 4EUOA 2RINA 4KYEA 3FV2A 2O7UA 3K6VA 4FORA 5TP9B 2X7PA 3MVWA 4GRKA 4QFPA 3VLVA 1N84A 4GVOA 3TTRA 3C36A 4OMBA 2GHAA 3IJXB 4ESXA 2QPQA 1UTHB 3VLUA 4QF9A 1NNPA 1NMUA 1B5IA 3PMXA 3MZ9A 5IAIA 5A5XA 1Y3PA 4GIZA 1BKAA 1B58A 2ABHA 1I6QA 4HCWA 4KI0E 3KG2A 4RK9A 3TMGA 3QUFA 1LBBA 3O66A 1USYH 2AL5A 5JTYA 3KN7A 3N6UA 4H65A 1LCTA 1I6BA 1M5FA 3IORA 1POTA 3SEXA 1MM7A 1P1NA 1OVTA 3RPWA 4TLMB 4GXAA 1KWHA 2I3VA 1XHYA 2I48A 3U1OA 3C34A 5KZTA 3ILUB 3TZAA 3HO7A 3KGCA 4UACA 2X26A 4GLIA 4YB5A 5ICQA 2DXRA 1AIVA 2DS9A 2XXVA 2QS1A 3FVOA 4U1ZA 2DE2A 4ELQA 3IB2A 4M1VA 1QKAA 3MPKA 1B1XA 2F6PA 5FTIA 1R6ZA 2OBGA 4F1VA 2UVIA 4I62A 2Y7WA 3SEVA 3R7XA 5KCJA 4MLVA 4F22A 1H76A 4MH5A 1ZLQA 4ZDMA 1AL3A 3MZBA 4ZZAA 4POXA 4OHNA 1A7LA 1QW0A 1LAXA 2P2AA 5ICTA 4ZEIA 1B4HA 2DXYA 2GH9A 3CFXA 3H06B 3IB0A 4H67A 3S2VA 3E13X 3PD9A 2XX7A 4FJPA 3H6UA 2QS3A 3OMBA 1UIVA 1B7UA 1URDA 2PT1A 2UYFA 3M8UA 4RYAA 3IOUA 3VVEA 4RK2A 1JW4A 5H8FB 3BFTA 4U4SA 2ZXTA 3RT8A 4EQBA 1FQEA 2DE3A 4EF2A 3KJTA 2QL3A 4C1TA 3T9HB 3O97A 4DE8A 4LZ5A 3VE1B 3O6HA 4NF5B 2AL4A 1P1UA 2HEUA 2Q88A 2XXRA 3I3VA 3PUYE 4IO4A 4JSOA 2HZKA 3M3KA 3TDJA 1MPCA 3H6WA 3TELA 3HN0A 5KDTB 2A5SA 3E3KA 3P7IA 4H1XA 3OO6A 2D21A 4L17A 1PB7A 4PQJA 5CBSA 3H7MA 3OSRA 3PUVE 1JETA 2Q2AA 2HAVA 3IOWA 2PYYA 1B9JA 2ZNUA 1JNFA 3VXCA 1S50A 4G77A 5H8HB 3IO6A 4PP0A 2H98A 3G3IA 4F1YA 2QS4A 5CRYA 2ESNA 2F7BA 4GQOA 1SBPA 2UVGA 4DZ1A 1B6HA 1XS5A 1Y4CA 2NUVA 2X7QA 3KEIA 3AXFA 3G7WA 4ISUA 3S9EA 4N13A 1DSNA 4KCDA 2Z8FA 3EQ1A 3PGFA 1TWYA 1IXIA 4U23A 5I2KB 3VV5A 2NWJA 5CMKA 1T0KA 1PC3A 4FEBA 4NTLA 2QMWA 3K6UA 4JWYA 4JWXA 3IX1A 1EU8A 3SEUA 3VVFA 4NWDA 1NH8A 5HPQA 1N76A 5I2NB 3DLNA 4P0IA 1B52A 2XXTA 5AA2B 2H99A 3MPLA 3O2AA 2ZMBA 4QFLA 4Z0IA 2V93A 1FTJA 2H25A 4IO6A 1MDQA 2HXWA 5FHMA 1IXCA 2DOJA 2UYEA 4LQ5A 3RGYA 2Q9TA 4IGTA 3E9XA 2A5TB 1H3DA 3UA8A 4HCYA 5AE4A 3MP1A 3PV0E 3EPEA 3K02A 4MBPA 4BDNA 2F5XA 1Y3QA 4JXIA 3KN3A 4IO2A 3RQTA 4RJZA 4F3BA 4Z7EA 3CIJA 4AQ4A 1LFGA 1ZJLA 1PBQA 3GBBA 4C1UA 2QRYA 4XKPA 4X1DA 3TTLA 3VFJA 4QFKA 4R75A 5I56B 1B3EA 2F7AA 1AH5A 2XXHA 4O3CA 1M5DA 1MXZA 3Q27A 5DT6A 2ALUA 1B1HA 1BTJA 1MDP1 1OMPA 1SW5A 4G8HA 4OEVA 4YKJA 1SDXA 5DVJA 3RY3A 4H6DA 2OZZA 1UQWA 1B05A 2VP1A 3TFLA 1TFDA 1UTHA 3A3CA 3CSGA 3IB1A 3LUYA 4MF3A 2OJTA 3OXNA 5ITOA 3K1PA 3EHTA 2Z8EA 5I59B 1JEUA 1JW5A 2AIXA 4QRZA 4XTCQ 2DSFA 1I69A 3FGSA 4PFUA 4ELRA 2CZLA 3Q25A 3U8QA 2P0SA 4KPTA 2O84X 3KSXA 3PPOA 1ZBMA 2DVZA 1DTGA 2ZYOA 1FTLA 1YTVA 5AA4B 1MRPA 3G3KA 3GLBA 4JBZA 4WEPA 1VE4A 4YKKA 1NNKA 3IJOB 2XXIA 4KR5A 4F2OA 3N94A 1IIWA 1J1NA 1XVXA 1D3KA 5I2NA 3TEPA 2M8CA 5AA4A 1RYXA 1A54A 3CFZA 2V3TA 1ZKBA 3H6TA 4IGRA 3FATA 3IL1B 3LC8A 3H3GA 4IY5A 5CI5A 4XKQA 2F8DA 1PB9A 1LCFA 3KJ7A 5F7VA 1OIBA 5DYHA 1DOTA 1HSJA 1B3GA 3QIMA 4QSDA 1QJMA 3OOAA 3ZS6A 4ZECA 3MUQA 4GL8A 4G2ZA 4E0XA 2THIA 1Y9UA 4MFIA 3UGWA 1Y20A 2Q89A 3KN8A 3W15C 5I84A 4EF1A 5HBCA 1MG1A 2Y7IA 3DP8A 1B3LA 3G3FA 4GWOA 4YAHX 3K4UA 3PMWA 4F29A 3TQWA 2NXOA 2XXUA 1Y3NA 5HM4B 3TTNA 2ZYKA 3ZKKA 1ATGA 1QKBA 1XC1A 3TCHA 4EQ7A 3RLFE 2B3FA 3QYTA 1SVXB 3RN8A 5K2XA 3FJGA 3V8XB 1S7YA 5KDTA 2F34A 3TCFA 1MY4A 4IO5A 2V84A 1EZOA 1MM6A 1BP5A 5CM6A 1SYIA 1WVJA 1ZIUA 1FQCA 3MC2A 4U1OA 1PDAA 5L9OA 3N5LA 4QFOA 2DQVA 4JWOA 4RPNA 1GV8A 4TQUQ 2RF1A 1PB8A 2O1LA 2DWAA 2GRVA 2G93A 2R6GE 1M5EA 1WODA 1IQ7A 1SW4A 3PD8A 2E1SA 3IO4A 5B7DA 4ONYA 3OENA 1LGBC 1YCJA 2XXXA 4FEDA 4LA9A 3O28A 5I56A 1D9YA 1MQJA 1HSLA 3SERA 3U94A 2I58A 1JVXA 1DPEA 3CR9A 3OO9A 2VOZA 1M5CA 1FQBA 1NNFA 2UVHA 2V3UA 4I9DA 2CMOA 1LB8A 4JDFA 4DIGA 3MQ9A 4JSDA 4O3BA 4OZ9A 4R73A 3I6VA 2F78A 4X1BA 3SEWA 3TCGA 4RA1A 4KYDA 5KCJB 3HSTA 3QK6A 1POY1 3CG1A 1OQHA 1P1OA 4FIMA 3FVGA 4KFQA 3VXBA 1MXYA 2O68A 1IXGA 1O7TA 3LSLA 3EN3A 4NF8B 2XXYA 4KD5A 4O3AA 1H43A 4R6YA 3HPIA 4ND9A 4H8IA 3MVXA 1B0HA 1EZ9A 1IEJA 1TFAA 2VHAA 2XD2A 4KHZE 4LZ8A 5CMMA 2B65A 2RC8A 1IUDA 1MY3A 3EF7A 1AMFA 3HV1A 4NF5A 5AA1A 2I3WA 1US4A 3Q29A 1P1WA 5EHMA 3BKIB 3FXUA 1GTKA 4R2BA 3THIA 4F2QA 1VFEA 3T9UA 3BFUA 4BDMA 1MH4A 2F6GA 3ODBA 4QSEA 3Q28A 4ELPA 1US5A 5I2KA 4OWDA 4HTGA 1UTBB 1TT1A 3I5OA 2F36A 3UIFA 3MVYA 1FQAA 4EQ9A 1ANFA 4ZEFA 1SI0A 2DWHA 1R1NA 2HAUA 1VR5A 1N3WA 3MW0A 1FW0A 3IR1A 5H8HA 5AA2D 4R6HA 5TU0A 4RPOA 4XXUA 2PBWA 1SI1A 4LATA 3SETA 4AB6A 1LSTA 3K6XA 3TTKA 2XHDA 3UP9A 1Z7NE 3TPAA 4NWCA 5L8DA 1OLAA 4EXKA 4GXSB 1XOCA 1XT8A 2VGQA 2NVUB 3RTFB 1GR2A 2ONRA 1FQDA 1B7ZA 3W9VA 1WDNA 3FJMA 4XIGQ 1GVCA 1M5BA 3DM0A 1Y1ZA 2LAOA 2XXWA 3T66A 4I8CA 2RCAA 1H44A 3F11A 1AOVA 2Z23A 2PX1A 4ECFA 1JEVA 3K2DA 1LBCA 1O64A 4K3FA 4PFYA 1QUKA 1Y4TA 4BDOA 3KSJA 3CVGA 4LVQA 4X9TA 4GOTA 3RTWB 2Q2CA 2O51A 2DVCA 3RT6B 1VSOA 4RY1A 3OO7A 2RC9A 1B32A 3M3FA 1DTZA 4ZS9A 4Q30B 3SESA 4BDLA 4FATA 5CC2A 2I0BA 4DXCA 1PEBA 2ANJA 5M2VA 3TKDA 3KFMA 4R9GA 5I57B 3LSXA 2FNCA 4THIA 2GHBA 1SQYA 2ONKE 3C31A 3G3GA 1HSEA 4AB5A 4IO7A 4NEDA 4LZ7A 5H8SA 2O1MA 5F1QA 4N6PA 2PMSA 4NF8A 4TLLB 5IKBA 1IITA 3TTMA 1IZ1A 4IB2A 4F18A 3CFLA 3IAZA 4WEDA 2RCBA 1MXVA 2V25A 3KZGA 3V83A 3FD3A 2XXQA 4LONB 3LSFB 3CG3A 5DVFA 5BUUA 5ISUA 3T22A 2ZNTA 1A40A 4XKNA 1NNTA 4HS7A 4EDPA 2F35A 2OLBA 4G68A 3O29A 5L9MA 5I59A 1MS7A 4OERA 5CMBA 4Q0CA 3D4GA 5L9SA 3IK6B 3OEMA 1URSA 2PVUA 1JQFA 3PUZE 3TQLA 4ESWA 1Y1MA 4RNSA 4UA8A 1B0LA 3RNNA 5BWJA 1Z7ME 1MQDA 4DXBA 1Q35A 2FYIA 2OCUA 1SYHA 2XXPA 1A55A 1B51A 3HHFA 4NF6B 2IA4A 4BLAA 1MXUA 4DLDA 4U2RA 3FVNA 1R9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0R A;  2OWS A;  3C35 A;  1IXH A;  3PU5 A;  1JVY A;  3TYH A;  4FAJ A;  4R9F A;  1ZU0 A;  2D3I A;  2Z8D A;  4F1U A;  5A5X B;  3EHU A;  3L6H A;  3CI8 A;  3SKP A;  3OSQ A;  5DEX B;  4F3P A;  4OFO A;  1D4N A;  1PBP A;  3FAS A;  4U22 A;  2IEE A;  3O6G A;  2REJ A;  4ELO A;  1VFD A;  4OFJ A;  3WAE A;  5AA2 A;  4XKR A;  1N7W A;  4MLQ A;  4OVJ A;  1NH7 A;  1QVS A;  5TP9 A;  4BDR A;  3K0V A;  2Q8J A;  2DWJ A;  1MQG A;  2Y84 A;  2KLF A;  3DP4 A;  4BDQ A;  3FZV A;  1RKM A;  3MBP A;  2O69 A;  4G68 C;  4G8M A;  5TPA A;  1LAG E;  4TOZ A;  1SD3 A;  2ZYM A;  4P11 A;  1L5T A;  1UIU A;  1P99 A;  4YKP A;  5FTH A;  3SDF A;  3FV1 A;  3HCQ A;  1ZMG A;  5ELV A;  1OLC A;  1LAH E;  1CB6 A;  1B5H A;  3DEL B;  3G3H A;  5JEI A;  1BLF A;  3D4C A;  3FXQ A;  3QXM A;  3QAX A;  4OQO A;  4DCX A;  1B3H A;  3FXR A;  4QFN A;  1OVB A;  4HW8 A;  2VD3 A;  2D5W A;  3C32 A;  4NF4 B;  3BBR A;  3DP6 A;  3JV9 A;  3UN6 A;  5ITP A;  4DXU A;  3FJ7 A;  4JB7 A;  4DCY A;  3H4Z A;  4PE5 B;  4G68 B;  1USY E;  2QJE A;  5B70 A;  3UOR A;  3A09 A;  1SW2 A;  3WAF A;  5I58 A;  4IO3 A;  4X48 A;  3B6Q A;  4U4X A;  3IOV A;  2QS2 A;  4R74 A;  4EXL A;  1CE2 A;  1LB9 A;  1YAE A;  3KBR A;  4OET A;  4F3S A;  2F97 A;  3U92 A;  3ZSF A;  2QSX A;  4ZED A;  3T9V A;  2AYS A;  1Q1K A;  2H4I A;  2I6E A;  4NE4 A;  4YKI A;  3S4U A;  3TOD A;  3S9N C;  4YMA A;  4LP2 B;  2YPN A;  1N0T A;  3G3J A;  1II5 A;  2O7I A;  2UXA A;  2DYX A;  3PPR A;  4DDD A;  4F39 A;  5J1D A;  1EZP A;  3L6G A;  3VDF A;  1JW1 A;  1QUJ A;  1N04 A;  3MP6 A;  1NFT A;  3B6W A;  3JYR A;  3OEK A;  2NOO A;  5K2Y A;  3VLW A;  3ZKL A;  1FTM A;  2ONS A;  1RYO A;  2O6A A;  4WKM A;  1I6A A;  3OD7 A;  4YB6 A;  3ECR A;  1B7H A;  4F31 B;  4IY6 A;  1A99 A;  1UTB A;  3M3L A;  1QUI A;  4OXV A;  3N26 A;  4F3G A;  2QMX A;  1MQH A;  2F7C A;  2XD3 A;  4ZE9 A;  3T93 B;  2GFE A;  4NF4 A;  1ELJ A;  3KOT A;  4Q8R A;  3LSW A;  3HHG A;  1A8F A;  5H8F A;  3E4R A;  1B40 A;  3CSB A;  1LAF E;  3N6T A;  3USD A;  2V3Q A;  2E0S A;  4H5F A;  4QSC A;  1BIY A;  3FIR A;  3SEY A;  4Q5T A;  1MXW A;  5H8Q A;  2XX9 A;  2I49 A;  3FUZ A;  4GL0 A;  4P0G A;  2H5Y A;  3PMV A;  4OEN A;  1LFH A;  5H8N B;  3R26 A;  5CMC A;  3T96 B;  3MP8 A;  3V5A A;  3K1M A;  3MWB A;  1ZTY A;  3PUX E;  1MQI A;  4GD5 A;  3K00 A;  3GZG A;  3QUJ A;  4M4G A;  4R2F A;  3Q26 A;  5AA3 A;  1N3X A;  1NL5 A;  3EHS A;  3H6V A;  2HCA A;  5LOM A;  2VD2 A;  2XX8 A;  3GBA A;  4FE8 A;  2I4C A;  2Y7R A;  2DP8 A;  2YJP A;  4WXJ A;  2DE4 A;  5FHN A;  4R72 A;  3W9W A;  3C9H A;  4KQP A;  4OYV A;  5H8N A;  4ZZE A;  4N07 A;  2HQ0 A;  1QUL A;  3PPN A;  4NF6 A;  1MY0 A;  2ZYN A;  2UVJ A;  3PPQ A;  3TUS A;  3GXA A;  3IOT A;  4LQ2 A;  3FVK A;  1FTK A;  2R9J A;  2HFB A;  2I0C A;  4ZEK A;  1XVY A;  3OEL A;  3PPP A;  4POW A;  1FTO A;  5DTB A;  3V89 B;  4YMB A;  1YPN A;  1B46 A;  2G29 A;  1R9L A;  4H8J A;  1EH3 A;  4YB7 A;  1D9V A;  3K1N A;  2Y7P A;  1LLS A;  1MY1 A;  4G4P A;  4G8N A;  4PET A;  5JTY B;  3UK4 A;  4F19 A;  1FQF A;  3VVD A;  3S9M C;  2R71 A;  5TPA B;  5DVI A;  2PT2 A;  3C33 A;  1NKX A;  4FEC A;  4R6K A;  1B3F A;  3ONM A;  3K6W A;  1MPB A;  2ZNS A;  2Y7K A;  3MAM A;  4I1D A;  1DPP A;  4LUB A;  5EYF A;  2HZL A;  2RC7 A;  2W7Y A;  3LR1 A;  4OES A;  5EHS A;  3T9X B;  3CRB A;  1URG A;  5DEX A;  3JZJ A;  2DWI A;  1P1Q A;  1OQG A;  3MZ1 A;  2A5T A;  2WKY A;  2RKM A;  3K01 A;  4GFR A;  1A8E A;  4GF8 A;  1FCK A;  4PFT A;  3RUM A;  1O63 A;  3H03 A;  4YU0 A;  5CBR A;  3C4M A;  1S9T A;  4E0W A;  2Z22 A;  4OFL A;  5I57 A;  4OTE A;  1MPD A;  3ILT B;  4PFW A;  4H5G A;  4QHQ A;  4U21 A;  4KCC A;  1B4Z A;  3LBS A;  3TAJ A;  5I58 B;  1DMB A;  1MY2 A;  2H9B A;  5H8Q B;  1H45 A;  1GGG A;  1N7X A;  1SW1 A;  1B2H A;  3U93 A;  2OK2 A;  3A3U A;  4OEU A;  3O9P A;  4ZEB A;  4YIC A;  1LFI A;  3B6T A;  2REG A;  4H0W A;  3OO8 A;  1B5J A;  3S9L C;  1F9B A;  3KOS A;  3R6U A;  2YLN A;  3O6I A;  3U72 A;  3B7D A;  5FHO A;  2OWT A;  4NMY A;  3MJN A;  2FA7 A;  3PUW E;  2B3B A;  4ZE8 A;  1MXX A;  3QSL A;  2P1S A;  5JK4 A;  3MVZ A;  4RXL A;  1MH3 A;  2BJJ X;  4YZZ A;  1TXF A;  4KYS A;  2I4B A;  4EUO A;  2RIN A;  4KYE A;  3FV2 A;  2O7U A;  3K6V A;  4FOR A;  5TP9 B;  2X7P A;  3MVW A;  4GRK A;  4QFP A;  3VLV A;  1N84 A;  4GVO A;  3TTR A;  3C36 A;  4OMB A;  2GHA A;  3IJX B;  4ESX A;  2QPQ A;  1UTH B;  3VLU A;  4QF9 A;  1NNP A;  1NMU A;  1B5I A;  3PMX A;  3MZ9 A;  5IAI A;  5A5X A;  1Y3P A;  4GIZ A;  1BKA A;  1B58 A;  2ABH A;  1I6Q A;  4HCW A;  4KI0 E;  3KG2 A;  4RK9 A;  3TMG A;  3QUF A;  1LBB A;  3O66 A;  1USY H;  2AL5 A;  5JTY A;  3KN7 A;  3N6U A;  4H65 A;  1LCT A;  1I6B A;  1M5F A;  3IOR A;  1POT A;  3SEX A;  1MM7 A;  1P1N A;  1OVT A;  3RPW A;  4TLM B;  4GXA A;  1KWH A;  2I3V A;  1XHY A;  2I48 A;  3U1O A;  3C34 A;  5KZT A;  3ILU B;  3TZA A;  3HO7 A;  3KGC A;  4UAC A;  2X26 A;  4GLI A;  4YB5 A;  5ICQ A;  2DXR A;  1AIV A;  2DS9 A;  2XXV A;  2QS1 A;  3FVO A;  4U1Z A;  2DE2 A;  4ELQ A;  3IB2 A;  4M1V A;  1QKA A;  3MPK A;  1B1X A;  2F6P A;  5FTI A;  1R6Z A;  2OBG A;  4F1V A;  2UVI A;  4I62 A;  2Y7W A;  3SEV A;  3R7X A;  5KCJ A;  4MLV A;  4F22 A;  1H76 A;  4MH5 A;  1ZLQ A;  4ZDM A;  1AL3 A;  3MZB A;  4ZZA A;  4POX A;  4OHN A;  1A7L A;  1QW0 A;  1LAX A;  2P2A A;  5ICT A;  4ZEI A;  1B4H A;  2DXY A;  2GH9 A;  3CFX A;  3H06 B;  3IB0 A;  4H67 A;  3S2V A;  3E13 X;  3PD9 A;  2XX7 A;  4FJP A;  3H6U A;  2QS3 A;  3OMB A;  1UIV A;  1B7U A;  1URD A;  2PT1 A;  2UYF A;  3M8U A;  4RYA A;  3IOU A;  3VVE A;  4RK2 A;  1JW4 A;  5H8F B;  3BFT A;  4U4S A;  2ZXT A;  3RT8 A;  4EQB A;  1FQE A;  2DE3 A;  4EF2 A;  3KJT A;  2QL3 A;  4C1T A;  3T9H B;  3O97 A;  4DE8 A;  4LZ5 A;  3VE1 B;  3O6H A;  4NF5 B;  2AL4 A;  1P1U A;  2HEU A;  2Q88 A;  2XXR A;  3I3V A;  3PUY E;  4IO4 A;  4JSO A;  2HZK A;  3M3K A;  3TDJ A;  1MPC A;  3H6W A;  3TEL A;  3HN0 A;  5KDT B;  2A5S A;  3E3K A;  3P7I A;  4H1X A;  3OO6 A;  2D21 A;  4L17 A;  1PB7 A;  4PQJ A;  5CBS A;  3H7M A;  3OSR A;  3PUV E;  1JET A;  2Q2A A;  2HAV A;  3IOW A;  2PYY A;  1B9J A;  2ZNU A;  1JNF A;  3VXC A;  1S50 A;  4G77 A;  5H8H B;  3IO6 A;  4PP0 A;  2H98 A;  3G3I A;  4F1Y A;  2QS4 A;  5CRY A;  2ESN A;  2F7B A;  4GQO A;  1SBP A;  2UVG A;  4DZ1 A;  1B6H A;  1XS5 A;  1Y4C A;  2NUV A;  2X7Q A;  3KEI A;  3AXF A;  3G7W A;  4ISU A;  3S9E A;  4N13 A;  1DSN A;  4KCD A;  2Z8F A;  3EQ1 A;  3PGF A;  1TWY A;  1IXI A;  4U23 A;  5I2K B;  3VV5 A;  2NWJ A;  5CMK A;  1T0K A;  1PC3 A;  4FEB A;  4NTL A;  2QMW A;  3K6U A;  4JWY A;  4JWX A;  3IX1 A;  1EU8 A;  3SEU A;  3VVF A;  4NWD A;  1NH8 A;  5HPQ A;  1N76 A;  5I2N B;  3DLN A;  4P0I A;  1B52 A;  2XXT A;  5AA2 B;  2H99 A;  3MPL A;  3O2A A;  2ZMB A;  4QFL A;  4Z0I A;  2V93 A;  1FTJ A;  2H25 A;  4IO6 A;  1MDQ A;  2HXW A;  5FHM A;  1IXC A;  2DOJ A;  2UYE A;  4LQ5 A;  3RGY A;  2Q9T A;  4IGT A;  3E9X A;  2A5T B;  1H3D A;  3UA8 A;  4HCY A;  5AE4 A;  3MP1 A;  3PV0 E;  3EPE A;  3K02 A;  4MBP A;  4BDN A;  2F5X A;  1Y3Q A;  4JXI A;  3KN3 A;  4IO2 A;  3RQT A;  4RJZ A;  4F3B A;  4Z7E A;  3CIJ A;  4AQ4 A;  1LFG A;  1ZJL A;  1PBQ A;  3GBB A;  4C1U A;  2QRY A;  4XKP A;  4X1D A;  3TTL A;  3VFJ A;  4QFK A;  4R75 A;  5I56 B;  1B3E A;  2F7A A;  1AH5 A;  2XXH A;  4O3C A;  1M5D A;  1MXZ A;  3Q27 A;  5DT6 A;  2ALU A;  1B1H A;  1BTJ A;  1MDP 1;  1OMP A;  1SW5 A;  4G8H A;  4OEV A;  4YKJ A;  1SDX A;  5DVJ A;  3RY3 A;  4H6D A;  2OZZ A;  1UQW A;  1B05 A;  2VP1 A;  3TFL A;  1TFD A;  1UTH A;  3A3C A;  3CSG A;  3IB1 A;  3LUY A;  4MF3 A;  2OJT A;  3OXN A;  5ITO A;  3K1P A;  3EHT A;  2Z8E A;  5I59 B;  1JEU A;  1JW5 A;  2AIX A;  4QRZ A;  4XTC Q;  2DSF A;  1I69 A;  3FGS A;  4PFU A;  4ELR A;  2CZL A;  3Q25 A;  3U8Q A;  2P0S A;  4KPT A;  2O84 X;  3KSX A;  3PPO A;  1ZBM A;  2DVZ A;  1DTG A;  2ZYO A;  1FTL A;  1YTV A;  5AA4 B;  1MRP A;  3G3K A;  3GLB A;  4JBZ A;  4WEP A;  1VE4 A;  4YKK A;  1NNK A;  3IJO B;  2XXI A;  4KR5 A;  4F2O A;  3N94 A;  1IIW A;  1J1N A;  1XVX A;  1D3K A;  5I2N A;  3TEP A;  2M8C A;  5AA4 A;  1RYX A;  1A54 A;  3CFZ A;  2V3T A;  1ZKB A;  3H6T A;  4IGR A;  3FAT A;  3IL1 B;  3LC8 A;  3H3G A;  4IY5 A;  5CI5 A;  4XKQ A;  2F8D A;  1PB9 A;  1LCF A;  3KJ7 A;  5F7V A;  1OIB A;  5DYH A;  1DOT A;  1HSJ A;  1B3G A;  3QIM A;  4QSD A;  1QJM A;  3OOA A;  3ZS6 A;  4ZEC A;  3MUQ A;  4GL8 A;  4G2Z A;  4E0X A;  2THI A;  1Y9U A;  4MFI A;  3UGW A;  1Y20 A;  2Q89 A;  3KN8 A;  3W15 C;  5I84 A;  4EF1 A;  5HBC A;  1MG1 A;  2Y7I A;  3DP8 A;  1B3L A;  3G3F A;  4GWO A;  4YAH X;  3K4U A;  3PMW A;  4F29 A;  3TQW A;  2NXO A;  2XXU A;  1Y3N A;  5HM4 B;  3TTN A;  2ZYK A;  3ZKK A;  1ATG A;  1QKB A;  1XC1 A;  3TCH A;  4EQ7 A;  3RLF E;  2B3F A;  3QYT A;  1SVX B;  3RN8 A;  5K2X A;  3FJG A;  3V8X B;  1S7Y A;  5KDT A;  2F34 A;  3TCF A;  1MY4 A;  4IO5 A;  2V84 A;  1EZO A;  1MM6 A;  1BP5 A;  5CM6 A;  1SYI A;  1WVJ A;  1ZIU A;  1FQC A;  3MC2 A;  4U1O A;  1PDA A;  5L9O A;  3N5L A;  4QFO A;  2DQV A;  4JWO A;  4RPN A;  1GV8 A;  4TQU Q;  2RF1 A;  1PB8 A;  2O1L A;  2DWA A;  2GRV A;  2G93 A;  2R6G E;  1M5E A;  1WOD A;  1IQ7 A;  1SW4 A;  3PD8 A;  2E1S A;  3IO4 A;  5B7D A;  4ONY A;  3OEN A;  1LGB C;  1YCJ A;  2XXX A;  4FED A;  4LA9 A;  3O28 A;  5I56 A;  1D9Y A;  1MQJ A;  1HSL A;  3SER A;  3U94 A;  2I58 A;  1JVX A;  1DPE A;  3CR9 A;  3OO9 A;  2VOZ A;  1M5C A;  1FQB A;  1NNF A;  2UVH A;  2V3U A;  4I9D A;  2CMO A;  1LB8 A;  4JDF A;  4DIG A;  3MQ9 A;  4JSD A;  4O3B A;  4OZ9 A;  4R73 A;  3I6V A;  2F78 A;  4X1B A;  3SEW A;  3TCG A;  4RA1 A;  4KYD A;  5KCJ B;  3HST A;  3QK6 A;  1POY 1;  3CG1 A;  1OQH A;  1P1O A;  4FIM A;  3FVG A;  4KFQ A;  3VXB A;  1MXY A;  2O68 A;  1IXG A;  1O7T A;  3LSL A;  3EN3 A;  4NF8 B;  2XXY A;  4KD5 A;  4O3A A;  1H43 A;  4R6Y A;  3HPI A;  4ND9 A;  4H8I A;  3MVX A;  1B0H A;  1EZ9 A;  1IEJ A;  1TFA A;  2VHA A;  2XD2 A;  4KHZ E;  4LZ8 A;  5CMM A;  2B65 A;  2RC8 A;  1IUD A;  1MY3 A;  3EF7 A;  1AMF A;  3HV1 A;  4NF5 A;  5AA1 A;  2I3W A;  1US4 A;  3Q29 A;  1P1W A;  5EHM A;  3BKI B;  3FXU A;  1GTK A;  4R2B A;  3THI A;  4F2Q A;  1VFE A;  3T9U A;  3BFU A;  4BDM A;  1MH4 A;  2F6G A;  3ODB A;  4QSE A;  3Q28 A;  4ELP A;  1US5 A;  5I2K A;  4OWD A;  4HTG A;  1UTB B;  1TT1 A;  3I5O A;  2F36 A;  3UIF A;  3MVY A;  1FQA A;  4EQ9 A;  1ANF A;  4ZEF A;  1SI0 A;  2DWH A;  1R1N A;  2HAU A;  1VR5 A;  1N3W A;  3MW0 A;  1FW0 A;  3IR1 A;  5H8H A;  5AA2 D;  4R6H A;  5TU0 A;  4RPO A;  4XXU A;  2PBW A;  1SI1 A;  4LAT A;  3SET A;  4AB6 A;  1LST A;  3K6X A;  3TTK A;  2XHD A;  3UP9 A;  1Z7N E;  3TPA A;  4NWC A;  5L8D A;  1OLA A;  4EXK A;  4GXS B;  1XOC A;  1XT8 A;  2VGQ A;  2NVU B;  3RTF B;  1GR2 A;  2ONR A;  1FQD A;  1B7Z A;  3W9V A;  1WDN A;  3FJM A;  4XIG Q;  1GVC A;  1M5B A;  3DM0 A;  1Y1Z A;  2LAO A;  2XXW A;  3T66 A;  4I8C A;  2RCA A;  1H44 A;  3F11 A;  1AOV A;  2Z23 A;  2PX1 A;  4ECF A;  1JEV A;  3K2D A;  1LBC A;  1O64 A;  4K3F A;  4PFY A;  1QUK A;  1Y4T A;  4BDO A;  3KSJ A;  3CVG A;  4LVQ A;  4X9T A;  4GOT A;  3RTW B;  2Q2C A;  2O51 A;  2DVC A;  3RT6 B;  1VSO A;  4RY1 A;  3OO7 A;  2RC9 A;  1B32 A;  3M3F A;  1DTZ A;  4ZS9 A;  4Q30 B;  3SES A;  4BDL A;  4FAT A;  5CC2 A;  2I0B A;  4DXC A;  1PEB A;  2ANJ A;  5M2V A;  3TKD A;  3KFM A;  4R9G A;  5I57 B;  3LSX A;  2FNC A;  4THI A;  2GHB A;  1SQY A;  2ONK E;  3C31 A;  3G3G A;  1HSE A;  4AB5 A;  4IO7 A;  4NED A;  4LZ7 A;  5H8S A;  2O1M A;  5F1Q A;  4N6P A;  2PMS A;  4NF8 A;  4TLL B;  5IKB A;  1IIT A;  3TTM A;  1IZ1 A;  4IB2 A;  4F18 A;  3CFL A;  3IAZ A;  4WED A;  2RCB A;  1MXV A;  2V25 A;  3KZG A;  3V83 A;  3FD3 A;  2XXQ A;  4LON B;  3LSF B;  3CG3 A;  5DVF A;  5BUU A;  5ISU A;  3T22 A;  2ZNT A;  1A40 A;  4XKN A;  1NNT A;  4HS7 A;  4EDP A;  2F35 A;  2OLB A;  4G68 A;  3O29 A;  5L9M A;  5I59 A;  1MS7 A;  4OER A;  5CMB A;  4Q0C A;  3D4G A;  5L9S A;  3IK6 B;  3OEM A;  1URS A;  2PVU A;  1JQF A;  3PUZ E;  3TQL A;  4ESW A;  1Y1M A;  4RNS A;  4UA8 A;  1B0L A;  3RNN A;  5BWJ A;  1Z7M E;  1MQD A;  4DXB A;  1Q35 A;  2FYI A;  2OCU A;  1SYH A;  2XXP A;  1A55 A;  1B51 A;  3HHF A;  4NF6 B;  2IA4 A;  4BLA A;  1MXU A;  4DLD A;  4U2R A;  3FVN A;  1R9Q A; 
#chains in the Genus database with same CATH topology
 5A5X B;  3CI8 A;  3SKP A;  3OSQ A;  2Q8M A;  3FAS A;  4U22 A;  2IEE A;  3O6G A;  2REJ A;  4OFJ A;  3WAE A;  5AA2 A;  1RDX A;  3K0V A;  2Q8J A;  2Y84 A;  2KLF A;  4BDQ A;  1RKM A;  2O69 A;  4N6D A;  2ZYM A;  1P99 A;  3SDF A;  2B4M A;  1B5H A;  3FXQ A;  3FXR A;  4QFN A;  4JB7 A;  4FBP A;  3H4Z A;  4PE5 B;  1USY E;  5I58 A;  4X48 A;  2QFL A;  2QS2 A;  4EXL A;  4ZED A;  4GBV A;  3TOD A;  4NHB A;  1II5 A;  2O7I A;  3KC1 A;  3VDF A;  1QUJ A;  3MP6 A;  1N04 A;  3JYR A;  2F3D A;  1FTM A;  2ONS A;  2O6A A;  4WKM A;  3OD7 A;  1A99 A;  3M3L A;  4OXV A;  4NF4 A;  4Q8R A;  3HHG A;  5H8F A;  3E4R A;  1B40 A;  4H5F A;  3MST A;  2I49 A;  4P0G A;  3E79 A;  2H5Y A;  4OEN A;  5CMC A;  3MWB A;  4M4G A;  1N3X A;  3H6V A;  4FE8 A;  3T22 A;  5FHN A;  1FPF A;  3W9W A;  3C9H A;  4ZZE A;  2HQ0 A;  4N17 A;  1QUL A;  1NV5 A;  4NF6 A;  1FTA A;  2HFB A;  3PPP A;  3V89 B;  4YMB A;  2G29 A;  1EH3 A;  1D9V A;  1LLS A;  2R71 A;  5A5L A;  4R6K A;  3MAM A;  2Y7K A;  4I1D A;  5EYF A;  5IZ1 A;  3LR1 A;  4OES A;  2P3N A;  2RKM A;  1A8E A;  1K9Y A;  4YU0 A;  1S9T A;  4E0W A;  1MPD A;  3ILT B;  4KCC A;  2H9B A;  5H8Q B;  1SW1 A;  1GGG A;  4OEU A;  4HXV A;  5T3J A;  4H0W A;  3OO8 A;  2CEY A;  1F9B A;  3U72 A;  3PUW E;  1MXX A;  3MVZ A;  3D1R A;  4YZZ A;  1MH3 A;  2BJJ X;  2I4B A;  2O7U A;  4GRK A;  4MNI A;  1UTH B;  2XXK A;  1NNP A;  5A5X A;  4P8B A;  4KI0 E;  1I6Q A;  4HCW A;  3QUF A;  4PDH A;  4H65 A;  1P1N A;  4N6K A;  1XHY A;  3U1O A;  3C34 A;  3TZA A;  4UAC A;  1QGX A;  2DE2 A;  4ELQ A;  3IB2 A;  2V4C A;  2F6P A;  1R6Z A;  3FBP A;  5EQ9 A;  4F1V A;  2WYK A;  1H76 A;  4ZZA A;  1A7L A;  2P2A A;  5ICT A;  1B4H A;  1UIV A;  3VVE A;  3IOU A;  4EQB A;  3O97 A;  4LZ5 A;  2AL4 A;  2HEU A;  4PFU A;  3I3V A;  4JSO A;  2CZH A;  2HZK A;  3TDJ A;  4GWW A;  3HN0 A;  2A5S A;  4PQJ A;  1PB7 A;  1FJ6 A;  2ZNU A;  1S50 A;  4PP0 A;  2H98 A;  3G3I A;  2ESN A;  5F24 A;  1SBP A;  2NUV A;  2PCR A;  3AXF A;  4ISU A;  2Z8F A;  4HE2 A;  1TWY A;  1IXI A;  1T0K A;  4NTL A;  2QMW A;  3K6U A;  1EU8 A;  3VVF A;  5HPQ A;  1KA1 A;  4HE0 A;  3MPL A;  2R8T A;  2V93 A;  1FTJ A;  4IO6 A;  5FHM A;  4N91 A;  1NV2 A;  3B8B A;  3PV0 E;  4JXI A;  3KN3 A;  3RQT A;  4NN3 A;  3TTL A;  4R75 A;  1B3E A;  2F7A A;  1M5D A;  3Q27 A;  3TFL A;  2HHM A;  3IB1 A;  3LUY A;  4MF3 A;  3OXN A;  2Z8E A;  4O94 A;  1JEU A;  1JW5 A;  2AIX A;  4ELR A;  2ZYO A;  5AA4 B;  1EYI A;  1MRP A;  4WEP A;  2PFY A;  1J1N A;  1D3K A;  5AA4 A;  2V3T A;  4IGR A;  3IL1 B;  3KJ7 A;  4OAN A;  2HXR A;  3QIM A;  3OOA A;  4GL8 A;  4G2Z A;  2THI A;  2L5V A;  4EF1 A;  3DP8 A;  2MKZ A;  3G3F A;  3K4U A;  3TQW A;  2XXU A;  5HM4 B;  3ZKK A;  1XC1 A;  4EQ7 A;  3RLF E;  3QYT A;  3RN8 A;  3FJG A;  2F34 A;  1EZO A;  5CM6 A;  1SYI A;  1WVJ A;  4RPN A;  3K1P A;  1PB8 A;  2O1L A;  2DWA A;  2R6G E;  4BLA A;  1WOD A;  1IQ7 A;  3PD8 A;  3IO4 A;  5B7D A;  1YCJ A;  1MQJ A;  1DPE A;  1FQB A;  4I9D A;  4JDF A;  2CMO A;  4F3P A;  4R73 A;  4KYD A;  2FHY A;  3QK6 A;  3CG1 A;  3VXB A;  2O68 A;  1IXG A;  4JVD A;  3EN3 A;  4OVQ A;  2VPN A;  2VPO A;  2B65 A;  4NF5 A;  1MY3 A;  3EF7 A;  1LBW A;  3Q29 A;  1P1W A;  3FXU A;  4H46 A;  4R2B A;  3THI A;  4F2Q A;  1MH4 A;  2F6G A;  1ANF A;  1R1N A;  1VR5 A;  5AA2 D;  3SET A;  3FXB A;  4AS5 A;  3K6X A;  1XT8 A;  2VGQ A;  2ONR A;  3U65 A;  1GVC A;  2OWZ A;  1AOV A;  1FBH A;  4PFY A;  3KSJ A;  3CVG A;  4GWS A;  3RTW B;  2O51 A;  2DVC A;  3KBZ A;  3RT6 B;  5I57 B;  5M2V A;  1DCU A;  3KFM A;  4R9G A;  4THI A;  4IO7 A;  4NED A;  4NGU A;  2O1M A;  5F1Q A;  4NF8 A;  4F18 A;  4IB2 A;  1RDY A;  3FD3 A;  5BUU A;  4XFE A;  1NNT A;  4HS7 A;  4EDP A;  4PBH A;  1FPG A;  3D4G A;  3IK6 B;  3OEM A;  2PVU A;  1JQF A;  5BWJ A;  1MQD A;  4DXB A;  1Q35 A;  2OCU A;  1SYH A;  1A55 A;  1FBC A;  1NUZ A;  2IA4 A;  4DLD A;  4U2R A;  1NNK A;  4FAJ A;  1IXH A;  3TYH A;  2Z8D A;  4F1U A;  3EHU A;  3L6H A;  3NOH A;  1VFD A;  1MQG A;  3DP4 A;  4G8M A;  1LAG E;  1L5T A;  1UIU A;  4YKP A;  5FTH A;  2Q74 A;  3HCQ A;  5ELV A;  3QXM A;  5EQ7 A;  1B3H A;  1NUY A;  2VD3 A;  3C32 A;  4NF4 B;  3UN6 A;  3DP6 A;  3FJ7 A;  4G68 B;  5B70 A;  3WAF A;  3B6Q A;  3U92 A;  2AYS A;  2I6E A;  4YKI A;  4GWZ A;  4PFI A;  4F39 A;  3L6G A;  4GX4 A;  5K2Y A;  3B6W A;  2NOO A;  4GWU A;  4F31 B;  4DI4 B;  4IY6 A;  1UTB A;  1QUI A;  2XD3 A;  2GFE A;  4N81 A;  3N6T A;  1LAF E;  3USD A;  1CNQ A;  1BIY A;  3FIR A;  1MXW A;  5H8Q A;  2XX9 A;  3T96 B;  4GD5 A;  1MQI A;  5AA3 A;  3K00 A;  3GZG A;  3Q26 A;  3EHS A;  2HCA A;  2FIX A;  2VD2 A;  4WXJ A;  2DP8 A;  4N07 A;  4N4U A;  1MY0 A;  3IOT A;  4LQ2 A;  3FVK A;  2R9J A;  3UIF A;  5ET8 A;  5DTB A;  4H8J A;  4YB7 A;  3UK4 A;  5JTY B;  2B4L A;  2PT2 A;  1EYJ A;  1NV1 A;  2HZL A;  2W7Y A;  5EHS A;  4MHF A;  3CRB A;  1URG A;  3JZJ A;  4GFR A;  4GF8 A;  5CBR A;  5I57 A;  4OTE A;  4QHQ A;  3LBS A;  3TAJ A;  5I58 B;  1MY2 A;  2XWV A;  2OK2 A;  3O9P A;  4YIC A;  2OX3 A;  3S9L C;  3KOS A;  3B7D A;  2P1S A;  4P47 A;  2X7P A;  4QFP A;  3VLV A;  1N84 A;  4GVO A;  3VLU A;  3PMX A;  3MZ9 A;  5IAI A;  2BJI A;  2ABH A;  1B58 A;  3KG2 A;  4PE3 A;  4RK9 A;  1USY H;  1FPL A;  3N6U A;  1LCT A;  1I6B A;  1M5F A;  3IOR A;  1POT A;  4NQ8 A;  5ICQ A;  3FVO A;  3MPK A;  5FTI A;  2UVI A;  4I62 A;  2Y7W A;  5KCJ A;  4MH5 A;  4ZDM A;  1AL3 A;  3MZB A;  4GWX A;  3H06 B;  4H67 A;  3S2V A;  3E13 X;  4FJP A;  3H6U A;  2QS3 A;  3OMB A;  1B7U A;  2PT1 A;  5H8F B;  5EQ8 A;  2QL3 A;  4C1T A;  3T9H B;  4NF5 B;  3RPL B;  2XXR A;  3BIH A;  1IMB A;  3M3K A;  1MPC A;  1IMA A;  2KR0 A;  3TEL A;  5KDT B;  3E3K A;  4H1X A;  3OO6 A;  2D21 A;  4L17 A;  5LDZ A;  2PYY A;  1B9J A;  4G77 A;  5H8H B;  4F1Y A;  5CRY A;  2F7B A;  4DZ1 A;  1B6H A;  1Y4C A;  4PC9 A;  3S9E A;  1DSN A;  3VV5 A;  4JWY A;  4JWX A;  3SEU A;  1FPD A;  4OVR A;  5AA2 B;  2ZZV A;  4QFL A;  2H25 A;  2HXW A;  2UYE A;  4LQ5 A;  4I40 A;  4OA4 A;  3UA8 A;  4HCY A;  3MP1 A;  4BDN A;  3K02 A;  4MBP A;  2F5X A;  1Y3Q A;  4Z7E A;  4F3B A;  3CIJ A;  1LFG A;  4PAK A;  4C1U A;  4X1D A;  3VFJ A;  5DT6 A;  1B1H A;  4OEV A;  3RY3 A;  1SDX A;  2CEX A;  5DVJ A;  1B05 A;  1UTH A;  3A3C A;  3B50 A;  3CSG A;  2CZL A;  3U8Q A;  3KSX A;  1ZBM A;  4JBZ A;  4YKK A;  4NF0 A;  1IIW A;  1LBZ A;  5I2N A;  3TEP A;  1G0I A;  3FAT A;  4IY5 A;  3H3G A;  5CI5 A;  1LCF A;  5DYH A;  4QSD A;  4QBA A;  3UGW A;  1Y9U A;  3W15 C;  5HBC A;  2Y7I A;  1B3L A;  4YAH X;  1NV4 A;  2NXO A;  3TCH A;  1SVX B;  1S7Y A;  5KDT A;  1MM6 A;  4U1O A;  1FQC A;  5L9O A;  1GV8 A;  3C4M A;  2RF1 A;  2GRV A;  4F2O A;  2G93 A;  2XWO A;  2E1S A;  2XXX A;  4FED A;  3O28 A;  5I56 A;  1D9Y A;  3SER A;  1JVX A;  3OO9 A;  2VOZ A;  1LB8 A;  3MQ9 A;  4O3B A;  4X1B A;  5KCJ B;  3TCG A;  3HST A;  1OQH A;  1FPB A;  1O7T A;  1H43 A;  3HPI A;  3R7X A;  4H8I A;  3MVX A;  5CMM A;  4PAI A;  2RC8 A;  1IUD A;  3GYY A;  5AA1 A;  1AMF A;  3HV1 A;  1LBV A;  3BFU A;  4BDM A;  3ODB A;  3I5O A;  3MVY A;  4ZEF A;  2DWH A;  3T1B A;  1N3W A;  1IME A;  1FW0 A;  5H8H A;  4R6H A;  5TU0 A;  4MNP A;  4RPO A;  4AB6 A;  1G0H A;  1LST A;  4P1L A;  1OLA A;  4GXS B;  2NVU B;  1WDN A;  1DK4 A;  4XIG Q;  1M5B A;  3DM0 A;  2LAO A;  3T66 A;  1FBE A;  1H44 A;  3F11 A;  2Z23 A;  1JEV A;  3K2D A;  1O64 A;  2Q2C A;  4RY1 A;  3OO7 A;  4GBW A;  2RC9 A;  1DTZ A;  3SES A;  4Q30 B;  4BDL A;  4DXC A;  5DW8 A;  3TKD A;  2GHB A;  2WBB A;  3C31 A;  3G3G A;  1Q9D A;  4LZ7 A;  2PMS A;  4WED A;  3IAZ A;  2V25 A;  2XXQ A;  3LSF B;  3CG3 A;  4G68 A;  1MS7 A;  3TQL A;  4ESW A;  4RNS A;  2CZK A;  4NF6 B;  3FVN A;  5EYG A;  2HPG A;  3PU5 A;  3BIG A;  1ZU0 A;  2D3I A;  4XEQ A;  2F3B A;  4I3Y A;  4ELO A;  4MLQ A;  1QVS A;  4H45 A;  5TP9 A;  4BDR A;  2DWJ A;  3FZV A;  5TPA A;  4G68 C;  4P11 A;  4PFB A;  4GX3 A;  1LAH E;  1CB6 A;  3G3H A;  5JEI A;  2D5W A;  3BBR A;  2WEF A;  1EYK A;  1SW2 A;  5FBP A;  4IO3 A;  4U4X A;  3IOV A;  3KBR A;  2F97 A;  1JP4 A;  1Q1K A;  2H4I A;  4NE4 A;  3S4U A;  4YMA A;  2YPN A;  3PPR A;  3G3J A;  2DYX A;  1EZP A;  1JW1 A;  4NAP A;  3OEK A;  4OVP A;  1RYO A;  4YB6 A;  3ECR A;  3E78 A;  2QMX A;  2F7C A;  3KOT A;  1A8F A;  2E0S A;  4QSC A;  1FJ9 A;  3SEY A;  4Q5T A;  4GL0 A;  1LFH A;  3PMV A;  3R26 A;  3MP8 A;  3K1M A;  1ZTY A;  4R2F A;  4P3L A;  2I4C A;  2DE4 A;  4R72 A;  4OYV A;  3PPQ A;  1FTK A;  4N8G A;  1XVY A;  1FTO A;  3IFC A;  1FRP A;  1YPN A;  1R9L A;  2Y7P A;  1MY1 A;  4G4P A;  4PET A;  3T0J A;  4F19 A;  1FQF A;  3VVD A;  5ET7 A;  1NKX A;  3K6W A;  1MPB A;  5IM2 A;  2RC7 A;  2A5T A;  2WKY A;  3U94 A;  1FCK A;  3RUM A;  1O63 A;  3H03 A;  2Z22 A;  4PBQ A;  1XI6 A;  1NI9 A;  4PFR A;  4U21 A;  1B4Z A;  4PCD A;  1DMB A;  1H45 A;  3U93 A;  1B2H A;  4ZEB A;  2REG A;  1RDZ A;  4GX6 A;  1B5J A;  3R6U A;  3O6I A;  5FHO A;  4NMY A;  3MJN A;  2B3B A;  4ZE8 A;  3QSL A;  4RXL A;  1FPE A;  1TXF A;  4KYS A;  1IMD A;  3FV2 A;  3K6V A;  2WYP A;  3TTR A;  3C36 A;  1B5I A;  1Y3P A;  4GIZ A;  4MNC A;  3TMG A;  1LBB A;  3O66 A;  4OVS A;  2AL5 A;  5JTY A;  3SEX A;  1MM7 A;  3RPW A;  4TLM B;  1KWH A;  2I48 A;  3KGC A;  2X26 A;  4GLI A;  2DS9 A;  2XXV A;  2QS1 A;  4M1V A;  1QKA A;  4AS4 A;  3SEV A;  4F22 A;  1ZLQ A;  4OHN A;  2DXY A;  3IB0 A;  2XX7 A;  1URD A;  5ET5 A;  1JW4 A;  2DE3 A;  3KJT A;  4DE8 A;  3VE1 B;  3O6H A;  1KZ8 A;  1P1U A;  2Q88 A;  3PUY E;  1LBY A;  3H6W A;  3P7I A;  5CBS A;  5IZZ A;  3OSR A;  3PUV E;  1JET A;  4QXD A;  3VXC A;  2WX9 A;  3IO6 A;  2QS4 A;  3CHG A;  4GQO A;  5ESY A;  1XS5 A;  1FBD A;  4N13 A;  3IFA A;  3PGF A;  5I2K B;  1BK4 A;  5CMK A;  4FEB A;  1NV6 A;  4NWD A;  5I2N B;  4KXP A;  3DLN A;  3LV0 A;  1B52 A;  2H99 A;  1MDQ A;  1IXC A;  2Q9T A;  3E9X A;  5AE4 A;  4RJZ A;  1ZJL A;  4QFK A;  4NG7 A;  2ALU A;  1BTJ A;  1MDP 1;  1OMP A;  4N15 A;  4YKJ A;  1UQW A;  2VP1 A;  1TFD A;  5KZT A;  5I59 B;  2OJT A;  3EHT A;  4QRZ A;  4XTC Q;  1I69 A;  3FGS A;  3Q25 A;  5IZ3 B;  2P0S A;  4KPT A;  2O84 X;  3PPO A;  2DVZ A;  1YTV A;  3GLB A;  3IJO B;  4KR5 A;  3N94 A;  1YYZ A;  1A54 A;  3CFZ A;  4XF5 A;  1ZKB A;  3H6T A;  2Y5K A;  3LC8 A;  4PAF A;  4XKQ A;  1PB9 A;  5F7V A;  1INP A;  4IR8 A;  1HSJ A;  1B3G A;  4ZEC A;  1Y20 A;  2Q89 A;  3KN8 A;  5I84 A;  4F29 A;  3PMW A;  1QKB A;  4HE1 A;  4IO5 A;  2V84 A;  3RPL A;  1ZIU A;  3MC2 A;  4QFO A;  2DQV A;  1LEV A;  4TQU Q;  2PFZ A;  1SW4 A;  4ONY A;  1LGB C;  1NV3 A;  4LA9 A;  1HSL A;  2I58 A;  3CR9 A;  2V3U A;  4DIG A;  4RA1 A;  4FIM A;  3FVG A;  3PTY A;  1MXY A;  4KD5 A;  4O3A A;  1B0H A;  4LZ8 A;  1EZ9 A;  2XD2 A;  3HFU A;  2I3W A;  1US4 A;  5EHM A;  3BKI B;  1GTK A;  3T9U A;  3Q28 A;  1US5 A;  4OWD A;  4PF6 A;  4EQ9 A;  2FBP A;  3MW0 A;  4XXU A;  1SI1 A;  3SZP A;  3TTK A;  2XHD A;  1NV0 A;  3UP9 A;  3TPA A;  4NWC A;  1XOC A;  3W9V A;  3FJM A;  1Y1Z A;  4O7M A;  4I8C A;  4ECF A;  4K3F A;  1Y4T A;  4X9T A;  4GOT A;  1NUW A;  1VSO A;  5CC2 A;  4P1E A;  3LSX A;  2FNC A;  4N8Y A;  1SQY A;  1HSE A;  5J16 A;  4AB5 A;  5H8S A;  4N6P A;  4TLL B;  1IZ1 A;  1FBG A;  3CFL A;  1MXV A;  3KZG A;  3EKI A;  5ISU A;  4XKN A;  5I59 A;  3O29 A;  5CMB A;  1FPJ A;  4OER A;  4Q0C A;  5L9S A;  1URS A;  2P3V A;  3PUZ E;  4UA8 A;  3RNN A;  4MAG A;  2XXP A;  1B51 A;  1MXU A;  2JJK A;  4C0R A;  2OWS A;  3C35 A;  3QMF A;  1JVY A;  4R9F A;  5DEX B;  4OFO A;  1D4N A;  1PBP A;  4XKR A;  1N7W A;  4OVJ A;  1NH7 A;  5EYH A;  2Y5L A;  3MBP A;  4X8R A;  4TOZ A;  1SD3 A;  3FV1 A;  1ZMG A;  1OLC A;  3DEL B;  1BLF A;  3D4C A;  3QAX A;  4OQO A;  4DCX A;  1KA0 A;  1OVB A;  4HW8 A;  3JV9 A;  5ITP A;  4DXU A;  4DCY A;  2QJE A;  3A09 A;  4R74 A;  4F3S A;  1CE2 A;  1LB9 A;  1YAE A;  4OET A;  2QSX A;  3T9V A;  3S9N C;  4LP2 B;  4UAB A;  1N0T A;  2UXA A;  4DDD A;  5J1D A;  1NFT A;  3VLW A;  3ZKL A;  1I6A A;  1B7H A;  4F3G A;  3N26 A;  1MQH A;  4ZE9 A;  4MX6 A;  3T93 B;  1ELJ A;  3LSW A;  3CSB A;  2V3Q A;  3FUZ A;  2KQZ A;  5H8N B;  3ZSF A;  3V5A A;  3PUX E;  1NUX A;  2QVR A;  3QUJ A;  1NL5 A;  5LOM A;  2XX8 A;  3GBA A;  2Y7R A;  2YJP A;  4KQP A;  5H8N A;  3PPN A;  4G61 A;  2ZYN A;  2UVJ A;  3TUS A;  3GXA A;  4ZEK A;  2I0C A;  3OEL A;  4POW A;  1B46 A;  3K1N A;  4G8N A;  3S9M C;  5TPA B;  5DVI A;  4MJO A;  3C33 A;  4FEC A;  1B3F A;  3ONM A;  4LUB A;  2ZNS A;  3UOR A;  1DPP A;  3T9X B;  5DEX A;  2DWI A;  1P1Q A;  1OQG A;  3MZ1 A;  3K01 A;  4PFT A;  1LBX A;  4OFL A;  4PFW A;  4H5G A;  5I3S A;  1N7X A;  3A3U A;  2QVV A;  1LFI A;  3B6T A;  5I7I A;  2ZZX A;  4O7I A;  2CZI A;  2YLN A;  2GQ1 A;  2OWT A;  2FA7 A;  5JK4 A;  4EUO A;  2RIN A;  4KYE A;  5TP9 B;  4FOR A;  3MVW A;  3RYD A;  3LUZ A;  4OMB A;  2GHA A;  3IJX B;  4ESX A;  2QPQ A;  4QF9 A;  1NMU A;  1BKA A;  3ROJ A;  1FPI A;  3KN7 A;  1OVT A;  1FBF A;  4GXA A;  2I3V A;  4OVT A;  3ILU B;  3HO7 A;  4YB5 A;  1AIV A;  2DXR A;  5I5P A;  4U1Z A;  4PDD A;  2XWK A;  1B1X A;  4PF8 A;  2OBG A;  2DDK A;  1FSA A;  4MLV A;  1AWB A;  4POX A;  1QW0 A;  1LAX A;  4ZEI A;  2GH9 A;  4O8M A;  1FBP A;  3CFX A;  3PD9 A;  3M8U A;  2UYF A;  4RYA A;  2ZZW A;  4RK2 A;  3BFT A;  4U4S A;  2ZXT A;  3RT8 A;  1FQE A;  4EF2 A;  2WBD A;  2QVU A;  3A29 A;  4IO4 A;  4JVI A;  3H7M A;  2VT5 A;  2Q2A A;  2HAV A;  3IOW A;  1JNF A;  2UVG A;  2X7Q A;  3KEI A;  3G7W A;  5EQA A;  1K9Z A;  4KCD A;  3EQ1 A;  4U23 A;  2NWJ A;  1PC3 A;  3IX1 A;  2FIE A;  1NH8 A;  1N76 A;  4P0I A;  2XXT A;  3O2A A;  2ZMB A;  4Z0I A;  2DOJ A;  3RGY A;  4IGT A;  2A5T B;  1H3D A;  3EPE A;  4IO2 A;  1SPI A;  4AQ4 A;  1PBQ A;  3KC0 A;  3GBB A;  2QRY A;  4XKP A;  5I56 B;  4O3C A;  1AH5 A;  2XXH A;  1MXZ A;  1SW5 A;  4G8H A;  4X04 A;  4H6D A;  2OZZ A;  5ITO A;  2DSF A;  1DTG A;  1FTL A;  5LTC A;  3G3K A;  1VE4 A;  2XXI A;  1XVX A;  2M8C A;  1RYX A;  2F8D A;  1OIB A;  1DOT A;  1YXI A;  4GWY A;  1QJM A;  3ZS6 A;  3MUQ A;  4E0X A;  4MFI A;  1MG1 A;  4GWO A;  1NV7 A;  1Y3N A;  4PGN A;  3TTN A;  2ZYK A;  1ATG A;  2B3F A;  5K2X A;  3V8X B;  3TCF A;  1MY4 A;  5IGA A;  4NX1 A;  4MIJ A;  1BP5 A;  1PDA A;  3N5L A;  4JWO A;  1M5E A;  3OEN A;  1FPK A;  1M5C A;  1NNF A;  2UVH A;  4LN5 A;  4OZ9 A;  4JSD A;  3I6V A;  2F78 A;  3SEW A;  1POY 1;  1P1O A;  4KFQ A;  3LSL A;  4NF8 B;  2XXY A;  4R6Y A;  4ND9 A;  2VHA A;  1TFA A;  1IEJ A;  4KHZ E;  4JVC A;  2FVZ A;  3ISP A;  1YZ0 A;  5IZ3 A;  1VFE A;  4QSE A;  4ELP A;  5I2K A;  4HTG A;  1UTB B;  1TT1 A;  2F36 A;  1FQA A;  1SI0 A;  2HAU A;  3IR1 A;  2PBW A;  4LAT A;  1Z7N E;  5L8D A;  4EXK A;  3RTF B;  4MCO A;  1IMF A;  1GR2 A;  1FQD A;  1B7Z A;  4MMP A;  2XXW A;  4P56 A;  2RCA A;  2PX1 A;  1LBC A;  4BDO A;  5ET6 A;  1QUK A;  4LVQ A;  4MEV A;  1B32 A;  3M3F A;  4ZS9 A;  4FAT A;  2I0B A;  1PEB A;  2ANJ A;  4DI3 D;  1VDW A;  2XWI A;  2ONK E;  4I3E A;  5IKB A;  1IIT A;  3TTM A;  1D9Q A;  2RCB A;  1IMC A;  3V83 A;  4LON B;  5DVF A;  2ZNT A;  1A40 A;  1DBZ A;  2F35 A;  2OLB A;  5L9M A;  2XA5 A;  3MYU A;  4PTK A;  1Y1M A;  1B0L A;  1Z7M E;  2FYI A;  4P9K A;  3HHF A;  4PGP A;  1R9Q A; 
#chains in the Genus database with same CATH homology
 4C0R A;  2OWS A;  3C35 A;  1IXH A;  3PU5 A;  1JVY A;  3TYH A;  4FAJ A;  4R9F A;  1ZU0 A;  2D3I A;  2Z8D A;  4F1U A;  5A5X B;  3EHU A;  3L6H A;  3CI8 A;  3SKP A;  3OSQ A;  5DEX B;  4F3P A;  4OFO A;  1D4N A;  1PBP A;  3FAS A;  4U22 A;  2IEE A;  3O6G A;  2REJ A;  4ELO A;  1VFD A;  4OFJ A;  3WAE A;  5AA2 A;  4XKR A;  1N7W A;  4MLQ A;  4OVJ A;  1NH7 A;  1QVS A;  5TP9 A;  4BDR A;  3K0V A;  2Q8J A;  2DWJ A;  1MQG A;  2Y84 A;  2KLF A;  3DP4 A;  4BDQ A;  3FZV A;  1RKM A;  3MBP A;  2O69 A;  4G68 C;  4G8M A;  5TPA A;  1LAG E;  4TOZ A;  1SD3 A;  2ZYM A;  4P11 A;  1L5T A;  1UIU A;  1P99 A;  4YKP A;  5FTH A;  3SDF A;  3FV1 A;  3HCQ A;  1ZMG A;  5ELV A;  1OLC A;  1LAH E;  1CB6 A;  1B5H A;  3DEL B;  3G3H A;  5JEI A;  1BLF A;  3D4C A;  3FXQ A;  3QXM A;  3QAX A;  4OQO A;  4DCX A;  1B3H A;  3FXR A;  4QFN A;  1OVB A;  4HW8 A;  2VD3 A;  2D5W A;  3C32 A;  4NF4 B;  3BBR A;  3DP6 A;  3JV9 A;  3UN6 A;  5ITP A;  4DXU A;  3FJ7 A;  4JB7 A;  4DCY A;  3H4Z A;  4PE5 B;  4G68 B;  1USY E;  2QJE A;  5B70 A;  3UOR A;  3A09 A;  1SW2 A;  3WAF A;  5I58 A;  4IO3 A;  4X48 A;  3B6Q A;  4U4X A;  3IOV A;  2QS2 A;  4R74 A;  4EXL A;  1CE2 A;  1LB9 A;  1YAE A;  3KBR A;  4OET A;  4F3S A;  2F97 A;  3U92 A;  3ZSF A;  2QSX A;  4ZED A;  3T9V A;  2AYS A;  1Q1K A;  2H4I A;  2I6E A;  4NE4 A;  4YKI A;  3S4U A;  3TOD A;  3S9N C;  4YMA A;  4LP2 B;  2YPN A;  1N0T A;  3G3J A;  1II5 A;  2O7I A;  2UXA A;  2DYX A;  3PPR A;  4DDD A;  4F39 A;  5J1D A;  1EZP A;  3L6G A;  3VDF A;  1JW1 A;  1QUJ A;  1N04 A;  3MP6 A;  1NFT A;  3B6W A;  3JYR A;  3OEK A;  2NOO A;  5K2Y A;  3VLW A;  3ZKL A;  1FTM A;  2ONS A;  1RYO A;  2O6A A;  4WKM A;  1I6A A;  3OD7 A;  4YB6 A;  3ECR A;  1B7H A;  4F31 B;  4IY6 A;  1A99 A;  1UTB A;  3M3L A;  1QUI A;  4OXV A;  3N26 A;  4F3G A;  2QMX A;  1MQH A;  2F7C A;  2XD3 A;  4ZE9 A;  3T93 B;  2GFE A;  4NF4 A;  1ELJ A;  3KOT A;  4Q8R A;  3LSW A;  3HHG A;  1A8F A;  5H8F A;  3E4R A;  1B40 A;  3CSB A;  1LAF E;  3N6T A;  3USD A;  2V3Q A;  2E0S A;  4H5F A;  4QSC A;  1BIY A;  3FIR A;  3SEY A;  4Q5T A;  1MXW A;  5H8Q A;  2XX9 A;  2I49 A;  3FUZ A;  4GL0 A;  4P0G A;  2H5Y A;  3PMV A;  4OEN A;  1LFH A;  5H8N B;  3R26 A;  5CMC A;  3T96 B;  3MP8 A;  3V5A A;  3K1M A;  3MWB A;  1ZTY A;  3PUX E;  1MQI A;  4GD5 A;  3K00 A;  3GZG A;  3QUJ A;  4M4G A;  4R2F A;  3Q26 A;  5AA3 A;  1N3X A;  1NL5 A;  3EHS A;  3H6V A;  2HCA A;  5LOM A;  2VD2 A;  2XX8 A;  3GBA A;  4FE8 A;  2I4C A;  2Y7R A;  2DP8 A;  2YJP A;  4WXJ A;  2DE4 A;  5FHN A;  4R72 A;  3W9W A;  3C9H A;  4KQP A;  4OYV A;  5H8N A;  4ZZE A;  4N07 A;  2HQ0 A;  1QUL A;  3PPN A;  4NF6 A;  1MY0 A;  2ZYN A;  2UVJ A;  3PPQ A;  3TUS A;  3GXA A;  3IOT A;  4LQ2 A;  3FVK A;  1FTK A;  2R9J A;  2HFB A;  2I0C A;  4ZEK A;  1XVY A;  3OEL A;  3PPP A;  4POW A;  1FTO A;  5DTB A;  3V89 B;  4YMB A;  1YPN A;  1B46 A;  2G29 A;  1R9L A;  4H8J A;  1EH3 A;  4YB7 A;  1D9V A;  3K1N A;  2Y7P A;  1LLS A;  1MY1 A;  4G4P A;  4G8N A;  4PET A;  5JTY B;  3UK4 A;  4F19 A;  1FQF A;  3VVD A;  3S9M C;  2R71 A;  5TPA B;  5DVI A;  2PT2 A;  3C33 A;  1NKX A;  4FEC A;  4R6K A;  1B3F A;  3ONM A;  3K6W A;  1MPB A;  2ZNS A;  2Y7K A;  3MAM A;  4I1D A;  1DPP A;  4LUB A;  5EYF A;  2HZL A;  2RC7 A;  2W7Y A;  3LR1 A;  4OES A;  5EHS A;  3T9X B;  3CRB A;  1URG A;  5DEX A;  3JZJ A;  2DWI A;  1P1Q A;  1OQG A;  3MZ1 A;  2A5T A;  2WKY A;  2RKM A;  3K01 A;  4GFR A;  1A8E A;  4GF8 A;  1FCK A;  4PFT A;  3RUM A;  1O63 A;  3H03 A;  4YU0 A;  5CBR A;  3C4M A;  1S9T A;  4E0W A;  2Z22 A;  4OFL A;  5I57 A;  4OTE A;  1MPD A;  3ILT B;  4PFW A;  4H5G A;  4QHQ A;  4U21 A;  4KCC A;  1B4Z A;  3LBS A;  3TAJ A;  5I58 B;  1DMB A;  1MY2 A;  2H9B A;  5H8Q B;  1H45 A;  1GGG A;  1N7X A;  1SW1 A;  1B2H A;  3U93 A;  2OK2 A;  3A3U A;  4OEU A;  3O9P A;  4ZEB A;  4YIC A;  1LFI A;  3B6T A;  2REG A;  4H0W A;  3OO8 A;  1B5J A;  3S9L C;  1F9B A;  3KOS A;  3R6U A;  2YLN A;  3O6I A;  3U72 A;  3B7D A;  5FHO A;  2OWT A;  4NMY A;  3MJN A;  2FA7 A;  3PUW E;  2B3B A;  4ZE8 A;  1MXX A;  3QSL A;  2P1S A;  5JK4 A;  3MVZ A;  4RXL A;  1MH3 A;  2BJJ X;  4YZZ A;  1TXF A;  4KYS A;  2I4B A;  4EUO A;  2RIN A;  4KYE A;  3FV2 A;  2O7U A;  3K6V A;  4FOR A;  5TP9 B;  2X7P A;  3MVW A;  4GRK A;  4QFP A;  3VLV A;  1N84 A;  4GVO A;  3TTR A;  3C36 A;  4OMB A;  2GHA A;  3IJX B;  4ESX A;  2QPQ A;  1UTH B;  3VLU A;  4QF9 A;  1NNP A;  1NMU A;  1B5I A;  3PMX A;  3MZ9 A;  5IAI A;  5A5X A;  1Y3P A;  4GIZ A;  1BKA A;  1B58 A;  2ABH A;  1I6Q A;  4HCW A;  4KI0 E;  3KG2 A;  4RK9 A;  3TMG A;  3QUF A;  1LBB A;  3O66 A;  1USY H;  2AL5 A;  5JTY A;  3KN7 A;  3N6U A;  4H65 A;  1LCT A;  1I6B A;  1M5F A;  3IOR A;  1POT A;  3SEX A;  1MM7 A;  1P1N A;  1OVT A;  3RPW A;  4TLM B;  4GXA A;  1KWH A;  2I3V A;  1XHY A;  2I48 A;  3U1O A;  3C34 A;  5KZT A;  3ILU B;  3TZA A;  3HO7 A;  3KGC A;  4UAC A;  2X26 A;  4GLI A;  4YB5 A;  5ICQ A;  2DXR A;  1AIV A;  2DS9 A;  2XXV A;  2QS1 A;  3FVO A;  4U1Z A;  2DE2 A;  4ELQ A;  3IB2 A;  4M1V A;  1QKA A;  3MPK A;  1B1X A;  2F6P A;  5FTI A;  1R6Z A;  2OBG A;  4F1V A;  2UVI A;  4I62 A;  2Y7W A;  3SEV A;  3R7X A;  5KCJ A;  4MLV A;  4F22 A;  1H76 A;  4MH5 A;  1ZLQ A;  4ZDM A;  1AL3 A;  3MZB A;  4ZZA A;  4POX A;  4OHN A;  1A7L A;  1QW0 A;  1LAX A;  2P2A A;  5ICT A;  4ZEI A;  1B4H A;  2DXY A;  2GH9 A;  3CFX A;  3H06 B;  3IB0 A;  4H67 A;  3S2V A;  3E13 X;  3PD9 A;  2XX7 A;  4FJP A;  3H6U A;  2QS3 A;  3OMB A;  1UIV A;  1B7U A;  1URD A;  2PT1 A;  2UYF A;  3M8U A;  4RYA A;  3IOU A;  3VVE A;  4RK2 A;  1JW4 A;  5H8F B;  3BFT A;  4U4S A;  2ZXT A;  3RT8 A;  4EQB A;  1FQE A;  2DE3 A;  4EF2 A;  3KJT A;  2QL3 A;  4C1T A;  3T9H B;  3O97 A;  4DE8 A;  4LZ5 A;  3VE1 B;  3O6H A;  4NF5 B;  2AL4 A;  1P1U A;  2HEU A;  2Q88 A;  2XXR A;  3I3V A;  3PUY E;  4IO4 A;  4JSO A;  2HZK A;  3M3K A;  3TDJ A;  1MPC A;  3H6W A;  3TEL A;  3HN0 A;  5KDT B;  2A5S A;  3E3K A;  3P7I A;  4H1X A;  3OO6 A;  2D21 A;  4L17 A;  1PB7 A;  4PQJ A;  5CBS A;  3H7M A;  3OSR A;  3PUV E;  1JET A;  2Q2A A;  2HAV A;  3IOW A;  2PYY A;  1B9J A;  2ZNU A;  1JNF A;  3VXC A;  1S50 A;  4G77 A;  5H8H B;  3IO6 A;  4PP0 A;  2H98 A;  3G3I A;  4F1Y A;  2QS4 A;  5CRY A;  2ESN A;  2F7B A;  4GQO A;  1SBP A;  2UVG A;  4DZ1 A;  1B6H A;  1XS5 A;  1Y4C A;  2NUV A;  2X7Q A;  3KEI A;  3AXF A;  3G7W A;  4ISU A;  3S9E A;  4N13 A;  1DSN A;  4KCD A;  2Z8F A;  3EQ1 A;  3PGF A;  1TWY A;  1IXI A;  4U23 A;  5I2K B;  3VV5 A;  2NWJ A;  5CMK A;  1T0K A;  1PC3 A;  4FEB A;  4NTL A;  2QMW A;  3K6U A;  4JWY A;  4JWX A;  3IX1 A;  1EU8 A;  3SEU A;  3VVF A;  4NWD A;  1NH8 A;  5HPQ A;  1N76 A;  5I2N B;  3DLN A;  4P0I A;  1B52 A;  2XXT A;  5AA2 B;  2H99 A;  3MPL A;  3O2A A;  2ZMB A;  4QFL A;  4Z0I A;  2V93 A;  1FTJ A;  2H25 A;  4IO6 A;  1MDQ A;  2HXW A;  5FHM A;  1IXC A;  2DOJ A;  2UYE A;  4LQ5 A;  3RGY A;  2Q9T A;  4IGT A;  3E9X A;  2A5T B;  1H3D A;  3UA8 A;  4HCY A;  5AE4 A;  3MP1 A;  3PV0 E;  3EPE A;  3K02 A;  4MBP A;  4BDN A;  2F5X A;  1Y3Q A;  4JXI A;  3KN3 A;  4IO2 A;  3RQT A;  4RJZ A;  4F3B A;  4Z7E A;  3CIJ A;  4AQ4 A;  1LFG A;  1ZJL A;  1PBQ A;  3GBB A;  4C1U A;  2QRY A;  4XKP A;  4X1D A;  3TTL A;  3VFJ A;  4QFK A;  4R75 A;  5I56 B;  1B3E A;  2F7A A;  1AH5 A;  2XXH A;  4O3C A;  1M5D A;  1MXZ A;  3Q27 A;  5DT6 A;  2ALU A;  1B1H A;  1BTJ A;  1MDP 1;  1OMP A;  1SW5 A;  4G8H A;  4OEV A;  4YKJ A;  1SDX A;  5DVJ A;  3RY3 A;  4H6D A;  2OZZ A;  1UQW A;  1B05 A;  2VP1 A;  3TFL A;  1TFD A;  1UTH A;  3A3C A;  3CSG A;  3IB1 A;  3LUY A;  4MF3 A;  2OJT A;  3OXN A;  5ITO A;  3K1P A;  3EHT A;  2Z8E A;  5I59 B;  1JEU A;  1JW5 A;  2AIX A;  4QRZ A;  4XTC Q;  2DSF A;  1I69 A;  3FGS A;  4PFU A;  4ELR A;  2CZL A;  3Q25 A;  3U8Q A;  2P0S A;  4KPT A;  2O84 X;  3KSX A;  3PPO A;  1ZBM A;  2DVZ A;  1DTG A;  2ZYO A;  1FTL A;  1YTV A;  5AA4 B;  1MRP A;  3G3K A;  3GLB A;  4JBZ A;  4WEP A;  1VE4 A;  4YKK A;  1NNK A;  3IJO B;  2XXI A;  4KR5 A;  4F2O A;  3N94 A;  1IIW A;  1J1N A;  1XVX A;  1D3K A;  5I2N A;  3TEP A;  2M8C A;  5AA4 A;  1RYX A;  1A54 A;  3CFZ A;  2V3T A;  1ZKB A;  3H6T A;  4IGR A;  3FAT A;  3IL1 B;  3LC8 A;  3H3G A;  4IY5 A;  5CI5 A;  4XKQ A;  2F8D A;  1PB9 A;  1LCF A;  3KJ7 A;  5F7V A;  1OIB A;  5DYH A;  1DOT A;  1HSJ A;  1B3G A;  3QIM A;  4QSD A;  1QJM A;  3OOA A;  3ZS6 A;  4ZEC A;  3MUQ A;  4GL8 A;  4G2Z A;  4E0X A;  2THI A;  1Y9U A;  4MFI A;  3UGW A;  1Y20 A;  2Q89 A;  3KN8 A;  3W15 C;  5I84 A;  4EF1 A;  5HBC A;  1MG1 A;  2Y7I A;  3DP8 A;  1B3L A;  3G3F A;  4GWO A;  4YAH X;  3K4U A;  3PMW A;  4F29 A;  3TQW A;  2NXO A;  2XXU A;  1Y3N A;  5HM4 B;  3TTN A;  2ZYK A;  3ZKK A;  1ATG A;  1QKB A;  1XC1 A;  3TCH A;  4EQ7 A;  3RLF E;  2B3F A;  3QYT A;  1SVX B;  3RN8 A;  5K2X A;  3FJG A;  3V8X B;  1S7Y A;  5KDT A;  2F34 A;  3TCF A;  1MY4 A;  4IO5 A;  2V84 A;  1EZO A;  1MM6 A;  1BP5 A;  5CM6 A;  1SYI A;  1WVJ A;  1ZIU A;  1FQC A;  3MC2 A;  4U1O A;  1PDA A;  5L9O A;  3N5L A;  4QFO A;  2DQV A;  4JWO A;  4RPN A;  1GV8 A;  4TQU Q;  2RF1 A;  1PB8 A;  2O1L A;  2DWA A;  2GRV A;  2G93 A;  2R6G E;  1M5E A;  1WOD A;  1IQ7 A;  1SW4 A;  3PD8 A;  2E1S A;  3IO4 A;  5B7D A;  4ONY A;  3OEN A;  1LGB C;  1YCJ A;  2XXX A;  4FED A;  4LA9 A;  3O28 A;  5I56 A;  1D9Y A;  1MQJ A;  1HSL A;  3SER A;  3U94 A;  2I58 A;  1JVX A;  1DPE A;  3CR9 A;  3OO9 A;  2VOZ A;  1M5C A;  1FQB A;  1NNF A;  2UVH A;  2V3U A;  4I9D A;  2CMO A;  1LB8 A;  4JDF A;  4DIG A;  3MQ9 A;  4JSD A;  4O3B A;  4OZ9 A;  4R73 A;  3I6V A;  2F78 A;  4X1B A;  3SEW A;  3TCG A;  4RA1 A;  4KYD A;  5KCJ B;  3HST A;  3QK6 A;  1POY 1;  3CG1 A;  1OQH A;  1P1O A;  4FIM A;  3FVG A;  4KFQ A;  3VXB A;  1MXY A;  2O68 A;  1IXG A;  1O7T A;  3LSL A;  3EN3 A;  4NF8 B;  2XXY A;  4KD5 A;  4O3A A;  1H43 A;  4R6Y A;  3HPI A;  4ND9 A;  4H8I A;  3MVX A;  1B0H A;  1EZ9 A;  1IEJ A;  1TFA A;  2VHA A;  2XD2 A;  4KHZ E;  4LZ8 A;  5CMM A;  2B65 A;  2RC8 A;  1IUD A;  1MY3 A;  3EF7 A;  1AMF A;  3HV1 A;  4NF5 A;  5AA1 A;  2I3W A;  1US4 A;  3Q29 A;  1P1W A;  5EHM A;  3BKI B;  3FXU A;  1GTK A;  4R2B A;  3THI A;  4F2Q A;  1VFE A;  3T9U A;  3BFU A;  4BDM A;  1MH4 A;  2F6G A;  3ODB A;  4QSE A;  3Q28 A;  4ELP A;  1US5 A;  5I2K A;  4OWD A;  4HTG A;  1UTB B;  1TT1 A;  3I5O A;  2F36 A;  3UIF A;  3MVY A;  1FQA A;  4EQ9 A;  1ANF A;  4ZEF A;  1SI0 A;  2DWH A;  1R1N A;  2HAU A;  1VR5 A;  1N3W A;  3MW0 A;  1FW0 A;  3IR1 A;  5H8H A;  5AA2 D;  4R6H A;  5TU0 A;  4RPO A;  4XXU A;  2PBW A;  1SI1 A;  4LAT A;  3SET A;  4AB6 A;  1LST A;  3K6X A;  3TTK A;  2XHD A;  3UP9 A;  1Z7N E;  3TPA A;  4NWC A;  5L8D A;  1OLA A;  4EXK A;  4GXS B;  1XOC A;  1XT8 A;  2VGQ A;  2NVU B;  3RTF B;  1GR2 A;  2ONR A;  1FQD A;  1B7Z A;  3W9V A;  1WDN A;  3FJM A;  4XIG Q;  1GVC A;  1M5B A;  3DM0 A;  1Y1Z A;  2LAO A;  2XXW A;  3T66 A;  4I8C A;  2RCA A;  1H44 A;  3F11 A;  1AOV A;  2Z23 A;  2PX1 A;  4ECF A;  1JEV A;  3K2D A;  1LBC A;  1O64 A;  4K3F A;  4PFY A;  1QUK A;  1Y4T A;  4BDO A;  3KSJ A;  3CVG A;  4LVQ A;  4X9T A;  4GOT A;  3RTW B;  2Q2C A;  2O51 A;  2DVC A;  3RT6 B;  1VSO A;  4RY1 A;  3OO7 A;  2RC9 A;  1B32 A;  3M3F A;  1DTZ A;  4ZS9 A;  4Q30 B;  3SES A;  4BDL A;  4FAT A;  5CC2 A;  2I0B A;  4DXC A;  1PEB A;  2ANJ A;  5M2V A;  3TKD A;  3KFM A;  4R9G A;  5I57 B;  3LSX A;  2FNC A;  4THI A;  2GHB A;  1SQY A;  2ONK E;  3C31 A;  3G3G A;  1HSE A;  4AB5 A;  4IO7 A;  4NED A;  4LZ7 A;  5H8S A;  2O1M A;  5F1Q A;  4N6P A;  2PMS A;  4NF8 A;  4TLL B;  5IKB A;  1IIT A;  3TTM A;  1IZ1 A;  4IB2 A;  4F18 A;  3CFL A;  3IAZ A;  4WED A;  2RCB A;  1MXV A;  2V25 A;  3KZG A;  3V83 A;  3FD3 A;  2XXQ A;  4LON B;  3LSF B;  3CG3 A;  5DVF A;  5BUU A;  5ISU A;  3T22 A;  2ZNT A;  1A40 A;  4XKN A;  1NNT A;  4HS7 A;  4EDP A;  2F35 A;  2OLB A;  4G68 A;  3O29 A;  5L9M A;  5I59 A;  1MS7 A;  4OER A;  5CMB A;  4Q0C A;  3D4G A;  5L9S A;  3IK6 B;  3OEM A;  1URS A;  2PVU A;  1JQF A;  3PUZ E;  3TQL A;  4ESW A;  1Y1M A;  4RNS A;  4UA8 A;  1B0L A;  3RNN A;  5BWJ A;  1Z7M E;  1MQD A;  4DXB A;  1Q35 A;  2FYI A;  2OCU A;  1SYH A;  2XXP A;  1A55 A;  1B51 A;  3HHF A;  4NF6 B;  2IA4 A;  4BLA A;  1MXU A;  4DLD A;  4U2R A;  3FVN A;  1R9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...