1PBQA

Crystal structure of the nr1 ligand binding core in complex with 5,7-dichlorokynurenic acid (dcka) at 1.90 angstroms resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
286
structure length
274
Chain Sequence
RLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-methyl-D-aspartate Receptor Subunit 1
publication title Mechanisms of activation, inhibition and specificity: crystal structures of the NMDA receptor NR1 ligand-binding core
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligand binding protein
total genus 73
structure length 274
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pbqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pbqA02
5IKBA 2A5TB 1J1NA 3OSRA 3RNNA 4PE5B 4XTCQ 1FTMA 3Q27A 4JSOA 2Q2AA 3K2DA 3LR1A 1FQEA 2RINA 2HXWA 3SEXA 1SI1A 1P99A 1SW4A 2CZLA 1LAHE 3CFXA 4DXBA 2O1MA 4WKMA 3HO7A 1GR2A 1USYE 2ALUA 1CE2A 5J1DA 4JXIA 3PUXE 1QW0A 4RXLA 4KHZE 2H98A 3OO8A 1EZOA 4BDLA 1F9BA 4MF3A 4FORA 1PC3A 2ZYOA 4DCXA 3VE1B 2CMOA 3SEUA 3B6QA 3MUQA 4WEPA 3Q26A 1S7YA 4HCWA 4ISUA 4FECA 4U21A 3GXAA 1MPCA 3A3CA 1A99A 2A5SA 2DWJA 4LP2B 4GOTA 4F1VA 5TP9B 4OENA 4RK2A 4E0WA 5I2KA 2HAUA 2XXQA 3W15C 2E0SA 4E0XA 1B0HA 4IO7A 3MPLA 5DVJA 2LAOA 3O2AA 1SDXA 3ZS6A 4HCYA 3K00A 4BLAA 3THIA 1JVYA 4F31B 4LQ5A 4ZS9A 4BDQA 3RTFB 4JWXA 4KPTA 1SBPA 4O3AA 3IX1A 2Z8DA 1B2HA 1JW1A 1A54A 4G68B 3WAEA 1HSEA 3FZVA 2B3BA 4GIZA 3MVWA 2O7UA 1URSA 2DE2A 1QJMA 2D5WA 4X9TA 3SEWA 4RPNA 1MQDA 5AA1A 4QFPA 1I69A 2B65A 1MY1A 4F39A 1XVXA 3HV1A 4DLDA 3DELB 4ZE8A 4IGRA 1IXIA 4QFLA 4F3GA 4U1OA 3TMGA 1QVSA 1NNTA 1VFDA 2V3QA 1FTJA 1NKXA 1NNPA 2XXTA 2DE4A 2DS9A 2DSFA 4U23A 2ZNUA 3RT8A 4RPOA 3MVXA 4Q0CA 2H5YA 4U4XA 5BWJA 2RF1A 1Y3NA 5DT6A 2XX8A 3CSBA 1Y3QA 2OWSA 2ANJA 3QSLA 1S9TA 4OHNA 3FGSA 3MAMA 1DSNA 4DIGA 5AA2B 1RKMA 4BDOA 3JYRA 4POXA 2NUVA 5AA4B 2I0CA 2OK2A 2KLFA 3TELA 4R9GA 1MXUA 1XS5A 1Y20A 3C4MA 4ZEDA 3U92A 3QIMA 1TFAA 2VOZA 4I62A 4NF6B 3VLUA 2XX7A 3MVYA 2UXAA 3UORA 1DOTA 3CI8A 3QK6A 4G8HA 1NMUA 4JBZA 1MY0A 3ONMA 2THIA 4Z0IA 4QHQA 1OVTA 3MP8A 2G93A 5I59B 3PMWA 1NNFA 3U1OA 5ICTA 4ZEIA 4YMBA 3EN3A 1OQGA 1EH3A 5EYFA 4OFLA 3CG1A 3PPRA 2Y7WA 3PV0E 4R75A 4ECFA 3EQ1A 3G3KA 3IORA 1PB9A 2RC8A 4NWCA 1N04A 1FQFA 2ZXTA 2YJPA 4H6DA 1MQIA 4PP0A 3S9MC 3MZ9A 2QMXA 4NF5B 4NF8A 4ZZAA 4LZ8A 1B4ZA 3OXNA 4NMYA 3RT6B 5K2YA 3FIRA 4JWYA 3H6WA 4KR5A 2XXWA 1WDNA 4TOZA 2XXVA 3G3IA 4ZEKA 1SW5A 2VD2A 4POWA 1PBQA 1UTHA 2DVZA 1SW2A 2I49A 1ZMGA 2V84A 4U1ZA 3PD8A 4Q8RA 3OO9A 4C1UA 4OXVA 2XXYA 1FTKA 1O64A 4OQOA 2Z22A 2P2AA 5JTYA 4GXAA 4DXCA 2ONKE 1LFIA 2XD2A 3S9NC 3H6UA 1LSTA 1IUDA 4G4PA 1P1WA 3RQTA 3K01A 4HW8A 3DM0A 3U8QA 2NVUB 1LCFA 4HS7A 4RNSA 4U4SA 3N6UA 2Q2CA 3ILTB 1Y9UA 4LVQA 3RN8A 3K6XA 3JZJA 5EHMA 2F6GA 3ZKKA 1Y1MA 3Q28A 2I58A 3O6IA 4OWDA 4KCDA 1B3FA 4JWOA 4EXLA 1EZ9A 5A5XA 3VVEA 5ICQA 3U72A 3IOTA 1MH3A 1MQJA 2ESNA 3TPAA 3UK4A 3B6TA 1IXCA 1MY2A 1ATGA 3KOSA 3IO6A 3SEYA 5CMCA 3FUZA 4X1DA 3LSLA 2Q9TA 4YZZA 4F22A 3TQLA 1O7TA 4F2OA 5CI5A 3H4ZA 1B1XA 3VVFA 4QFNA 4RJZA 2QS4A 5I56B 1DPEA 5I2KB 3QUJA 1PDAA 2REJA 2F8DA 1XVYA 1ZJLA 5F1QA 3TFLA 2NXOA 4GFRA 4IY6A 1IITA 3KGCA 4OYVA 1QUKA 2RCBA 1UQWA 2RCAA 2I4CA 2DXYA 3FXUA 1BIYA 3FASA 4XXUA 4PQJA 1QUJA 5ISUA 3LSFB 2F7AA 5AE4A 1ZBMA 3LBSA 4O3CA 1O63A 3IJOB 2M8CA 4C1TA 5FHMA 4LUBA 3H7MA 3VXBA 3I3VA 3V8XB 4IGTA 4OTEA 1OLAA 3L6GA 5DVFA 2ZNSA 4F1YA 4X1BA 3G3FA 5H8FB 3PPNA 5I57A 1M5CA 3LSXA 2DWAA 1MDP1 4LQ2A 4YMAA 1LAXA 4IO6A 3UGWA 4DE8A 5M2VA 4H8JA 1MRPA 3E13X 4XKNA 3MW0A 1D9VA 5KDTA 2XHDA 1FTLA 3OSQA 1H44A 3H3GA 2F7BA 4G77A 1M5EA 4DZ1A 1LFGA 1LAGE 4F3SA 1Z7NE 2UVHA 4OEVA 4ZECA 2FA7A 2VP1A 4OEUA 1PEBA 4H65A 3IOUA 4ZDMA 3VV5A 3PPQA 4KYEA 4F3BA 1M5DA 4TQUQ 1FTOA 1YAEA 2O51A 4LATA 1IZ1A 4IB2A 1ZTYA 1N3WA 3WAFA 3FVNA 4MLVA 1I6AA 4FIMA 1Y1ZA 3TTMA 5JK4A 1PB7A 5CC2A 3KJ7A 3TUSA 3SESA 3T9XB 1BLFA 1H43A 3K0VA 3FJMA 4WXJA 3IR1A 2DYXA 3R26A 4GQOA 5H8QA 4N07A 1T0KA 3Q29A 4I9DA 1BP5A 3IK6B 2F7CA 3IB1A 2BJJX 2GH9A 4FATA 4AB5A 3SEVA 3MZBA 3OENA 2QS1A 3C33A 2O84X 2YLNA 3O6HA 1M5FA 3BKIB 3HHGA 3O9PA 5H8SA 3A09A 3T22A 1MM6A 3T93B 4KFQA 3S9LC 2XXRA 3HN0A 1YTVA 1B3GA 2DVCA 3U93A 2I0BA 5KCJB 3RY3A 2V3UA 3M3FA 4PFWA 4F18A 1US4A 4QF9A 2XX9A 1OLCA 1IQ7A 2F35A 4PFYA 2FNCA 1MPDA 2X7PA 1N7WA 1B5IA 3K4UA 1Q35A 2H99A 4G68C 1MY4A 3G3GA 2DQVA 4YICA 1B51A 2PT1A 3K6WA 1MXXA 2DWIA 4K3FA 4H0WA 3RUMA 3CRBA 3E9XA 2Y7PA 3PUVE 1MQGA 2AL5A 4XKRA 2XD3A 1B3EA 3EPEA 1HSLA 3MWBA 3GLBA 4QFOA 1ELJA 1D4NA 4QSCA 3PUWE 4HTGA 4UACA 1B3HA 1UTBA 2Q88A 2Y7KA 3PPPA 4X48A 1TXFA 3RLFE 3IJXB 1VR5A 2UVGA 3KEIA 4RA1A 1EU8A 2XXIA 4AB6A 3K6UA 3R6UA 3IB0A 4IO2A 3TODA 3V83A 5DVIA 4GXSB 4GRKA 4EXKA 2VGQA 4LZ5A 3N26A 5FHNA 3AXFA 5B7DA 3I5OA 5JEIA 3SERA 1JQFA 4H1XA 1JW5A 1IXHA 3SKPA 2AIXA 3CG3A 4R2BA 2V93A 1H45A 4OVJA 2V3TA 4JB7A 3ECRA 3KOTA 2G29A 4RK9A 3M3LA 4YB7A 3FVKA 1MQHA 3C32A 4R72A 4ZEFA 1H3DA 3OO6A 4MFIA 4R73A 4YAHX 4KD5A 4OFOA 5I2NB 3T66A 5L8DA 4AQ4A 3BBRA 2GHBA 2D3IA 3DP8A 3IOVA 3PPOA 4G68A 1BTJA 1NH7A 2HEUA 3EHTA 3KZGA 1ANFA 4PFTA 4ZEBA 5H8NA 4NE4A 1POY1 4FJPA 3K1MA 1WVJA 2QRYA 3G7WA 5H8HA 1QULA 4GVOA 3B7DA 4ELPA 2X26A 4N13A 1I6QA 4QSDA 4KYSA 3VLVA 4F2QA 3RGYA 3MVZA 1NL5A 3O28A 5LOMA 3IO4A 3IL1B 5FHOA 1CB6A 4UA8A 1P1UA 3I6VA 1DTZA 2PX1A 1R1NA 1B5JA 3CR9A 3TTNA 3VFJA 1FCKA 4N6PA 5I58A 2NOOA 3G3JA 4FEBA 3PU5A 3N5LA 5DEXA 3TDJA 5DYHA 5KDTB 1AOVA 3C35A 3CVGA 1SYHA 1D9YA 2UYFA 1OVBA 4EF1A 3SDFA 3BFUA 5AA2A 4YB5A 2O7IA 1FW0A 1Y4CA 3K02A 3TAJA 5AA4A 1A55A 3GBBA 2P0SA 4GL0A 4ELRA 5FTIA 1FQBA 5AA3A 3VXCA 3RTWB 4RY1A 1Y3PA 5BUUA 1VSOA 4GD5A 5CBSA 5CRYA 2ABHA 2QS2A 3OO7A 4L17A 2IA4A 1OMPA 1DTGA 3F11A 4IO4A 3FATA 3M3KA 1JNFA 3PGFA 1N3XA 1A8EA 2NWJA 1MXYA 2Y7IA 3T9UA 1N84A 3OOAA 4XKPA 4F29A 5CM6A 2QMWA 1FQCA 2XXHA 3UIFA 2OBGA 3USDA 1H76A 1NNKA 3E3KA 1MXZA 1Q1KA 3GBAA 2VD3A 1TWYA 5HM4B 1A7LA 5L9SA 4P0IA 4EF2A 4OMBA 1II5A 4MBPA 4NF5A 4OETA 3KN3A 4TLLB 4DXUA 3ILUB 3MQ9A 2F36A 1S50A 1WODA 2I3WA 2HZLA 4OZ9A 3LUYA 4JDFA 1TFDA 2PBWA 1MXWA 4DCYA 3TTLA 1DPPA 1US5A 4I1DA 2WKYA 4ELQA 4NEDA 4F3PA 4PFUA 2B3FA 1LLSA 4YKIA 3CSGA 2Y7RA 2PYYA 1JW4A 1B46A 3CFLA 4LA9A 1QUIA 1JEUA 1SQYA 3T9VA 3MP6A 3OEMA 3P7IA 1URDA 1AL3A 4LONB 4Z7EA 4ESWA 2F78A 1IEJA 4M4GA 2VHAA 4DDDA 3C36A 4KI0E 2OCUA 3OMBA 2Z8FA 1QKAA 1UIUA 3W9VA 5ELVA 1IIWA 4BDRA 2PT2A 4F19A 3KJTA 3H6TA 3KN8A 1GVCA 1GTKA 5L9MA 2HQ0A 4QRZA 1ZU0A 1L5TA 5CMMA 1UTBB 3O66A 3D4CA 4R9FA 3VDFA 4H5GA 1B7UA 1MG1A 1URGA 1R9LA 1Z7ME 5TPAA 3T96B 3B6WA 3VVDA 3KG2A 2ZYKA 3TCFA 1ZIUA 3MBPA 4FE8A 1HSJA 1SI0A 5FTHA 3UN6A 4NWDA 2H9BA 3O6GA 4EDPA 1N7XA 3N94A 2X7QA 4C0RA 3EHSA 4ZE9A 4GLIA 5I56A 2F34A 2FYIA 4YKJA 3C34A 3PMVA 3RPWA 1KWHA 1LBCA 1MS7A 1OQHA 4EQ7A 3SETA 3H06B 3MZ1A 3TYHA 2I4BA 3V5AA 3GZGA 3O97A 4JSDA 1N0TA 1GV8A 2P1SA 4I8CA 3W9WA 1LGBC 1B7HA 3O29A 5CMBA 1GGGA 5EHSA 1B32A 4ONYA 1P1QA 2RC7A 2V25A 3KSJA 2HAVA 3G3HA 5CMKA 2HZKA 3HSTA 2I6EA 3BFTA 4P11A 2O1LA 4THIA 4NF4A 5H8NB 3H6VA 3K6VA 5H8FA 1JETA 2RKMA 1MDQA 4YKKA 2UYEA 1FQAA 3E4RA 3IB2A 2A5TA 2Z23A 4NF8B 1B1HA 3UA8A 3ZSFA 4H5FA 3OEKA 5H8HB 2HFBA 3TZAA 3FXQA 2D21A 4H67A 1B58A 4KCCA 3H03A 3UP9A 1SYIA 2IEEA 3D4GA 2O68A 2XXXA 1UTHB 4OERA 1LCTA 1PBPA 2QPQA 3L6HA 2H4IA 2UVIA 2QS3A 1JEVA 2YPNA 2AYSA 2XXPA 3IOWA 3PUYE 1USYH 3PMXA 3EF7A 5JTYB 1Y4TA 2O6AA 1PB8A 3FVGA 4R6KA 3ODBA 3V89B 3Q25A 1B9JA 2OZZA 2O69A 5I58B 3C9HA 4G2ZA 1LB9A 2PMSA 2W7YA 1B52A 1B4HA 5DEXB 5AA2D 3DP4A 3T9HB 3FV1A 1BKAA 2ZNTA 2QJEA 2E1SA 2DOJA 1D3KA 1SW1A 4XKQA 1LB8A 2UVJA 5TP9A 3OELA 4R6YA 2H25A 3M8UA 4P0GA 1XHYA 1IXGA 2OWTA 3HCQA 2QL3A 4R6HA 5I84A 1VFEA 1RYOA 4G8NA 4TLMB 1VE4A 2F5XA 3KN7A 1B40A 5A5XB 1DMBA 4OFJA 3TQWA 1B6HA 4Q30B 3MJNA 4EUOA 4ESXA 1R6ZA 1SVXB 3N6TA 3TTRA 4Q5TA 1YPNA 4XIGQ 3FVOA 5DTBA 3QUFA 2DXRA 4MH5A 1AIVA 1UIVA 1SD3A 1ZKBA 2Y84A 4WEDA 5KZTA 1RYXA 4R2FA 5B70A 4GWOA 1P1OA 4PETA 5KCJA 1ZLQA 2R6GE 3VLWA 3FXRA 2HCAA 2R9JA 1MH4A 4RYAA 4QSEA 3FJ7A 2AL4A 1MM7A 5K2XA 5F7VA 1JVXA 4EQBA 3LC8A 1I6BA 4H8IA 2I3VA 2PVUA 1YCJA 1N76A 3HPIA 4KQPA 4EQ9A 3CIJA 3FJGA 3KFMA 2DP8A 1A40A 1AMFA 3S2VA 2I48A 1XOCA 5I57B 1R9QA 1B7ZA 3C31A 1EZPA 3OD7A 4YKPA 5L9OA 4O3BA 1FQDA 4NTLA 4YU0A 4IY5A 2REGA 4ELOA 4OESA 1B5HA 2F97A 1MXVA 3TTKA 1AH5A 2Q8JA 2DE3A 3FV2A 2ZMBA 1A8FA 3EHUA 1LBBA 3KSXA 5ITOA 2QSXA 3MP1A 4GL8A 3R7XA 4MLQA 1MY3A 1NH8A 3S9EA 3KBRA 1MPBA 4KYDA 2OLBA 3K1NA 4F1UA 4NF6A 3K1PA 3MC2A 3TCHA 2ZYMA 1XT8A 4BDMA 4FAJA 1B3LA 2OJTA 3QYTA 5IAIA 3HHFA 3QAXA 2ZYNA 5HPQA 4IO5A 1B05A 3ZKLA 1QKBA 5TPAB 5ITPA 2Z8EA 5I59A 1LFHA 1POTA 1OIBA 5I2NA 4R74A 3TKDA 3FD3A 5H8QB 4U2RA 2GRVA 3A3UA 4ND9A 4G8MA 1TT1A 2DWHA 4LZ7A 1LAFE 2RC9A 3JV9A 3PUZE 4FEDA 4YB6A 3PD9A 1XC1A 4GF8A 2ONRA 3DP6A 5CBRA 5HBCA 3S4UA 1M5BA 4QFKA 1NFTA 3IAZA 3TCGA 2XXUA 3CFZA 4BDNA 2GFEA 4ZZEA 3MPKA 3U94A 1B0LA 2ONSA 2F6PA 4U22A 3DLNA 2Q89A 2GHAA 1P1NA 3QXMA 3LSWA 3TEPA 4M1VA 2R71A 4NF4B 4IO3A 5TU0A
chains in the Genus database with same CATH superfamily
5IKBA 2A5TB 1J1NA 2ZZVA 4GWYA 3OSRA 3RNNA 4PE5B 4XTCQ 1FTMA 3Q27A 4JSOA 2Q2AA 3K2DA 3LR1A 1FQEA 2RINA 1FJ6A 2HXWA 3SEXA 1SI1A 1P99A 1SW4A 1IMEA 2CZLA 1LAHE 3CFXA 4DXBA 2OX3A 4X8RA 2O1MA 4WKMA 4I3EA 3HO7A 1GR2A 5DW8A 1FBHA 1USYE 4GBWA 2ALUA 4G61A 1CE2A 5J1DA 4JXIA 3PUXE 1QW0A 4RXLA 4MMPA 4KHZE 2H98A 4HE0A 3OO8A 1EZOA 4BDLA 1F9BA 4MF3A 4FORA 1PC3A 2ZYOA 1IMCA 4DCXA 1XI6A 3VE1B 2CMOA 3SEUA 4MIJA 3B6QA 1FBCA 3MUQA 4WEPA 3Q26A 1S7YA 4HCWA 4ISUA 4FECA 4U21A 3GXAA 1MPCA 3A3CA 1A99A 2A5SA 2DWJA 4LP2B 4GOTA 4F1VA 5TP9B 4OENA 4RK2A 4E0WA 5I2KA 2HAUA 2XXQA 1QGXA 2OWZA 3W15C 2E0SA 4E0XA 1B0HA 4IO7A 3MPLA 5DVJA 2LAOA 5T3JA 3O2AA 1FPJA 1SDXA 3NOHA 3ZS6A 2Q8MA 4AS5A 4HCYA 3K00A 4BLAA 3THIA 1JVYA 4I40A 4F31B 4LQ5A 4ZS9A 4BDQA 3RTFB 4JWXA 4KPTA 1SBPA 4O3AA 3IX1A 2Z8DA 1B2HA 1JW1A 1NV4A 1A54A 4O7MA 4G68B 3WAEA 4NAPA 1HSEA 3FZVA 2B3BA 4NX1A 4GIZA 3MVWA 2O7UA 4N91A 1URSA 5EQ7A 2DE2A 1QJMA 3PTYA 2D5WA 4X9TA 3SEWA 4RPNA 4MNCA 1MQDA 5AA1A 4QFPA 1I69A 2B65A 1MY1A 4F39A 2P3NA 1XVXA 3HV1A 4DLDA 3DELB 4ZE8A 4IGRA 1IXIA 4QFLA 4F3GA 1EYKA 4U1OA 3TMGA 1QVSA 1NNTA 2JJKA 1VFDA 2V3QA 1FTJA 1NKXA 1NNPA 2XXTA 1FPDA 2DE4A 2DS9A 4P3LA 2DSFA 1NUYA 4U23A 2ZNUA 3RT8A 4RPOA 3MVXA 4Q0CA 2H5YA 4GX6A 4U4XA 4XF5A 5BWJA 4NQ8A 2RF1A 1Y3NA 5DT6A 2XX8A 3CSBA 1FTAA 5I7IA 1Y3QA 2OWSA 2ANJA 3QSLA 1S9TA 4OHNA 3FGSA 3MAMA 1DSNA 4DIGA 5AA2B 1RKMA 4BDOA 3JYRA 4POXA 2NUVA 2QVVA 2I0CA 5AA4B 2OK2A 2KLFA 3TELA 4R9GA 1MXUA 1XS5A 1Y20A 3C4MA 2QVUA 4ZEDA 3U92A 3QIMA 1TFAA 2VOZA 4I62A 4NF6B 3VLUA 3A29A 1FPBA 3T0JA 2XX7A 3MVYA 4LN5A 2UXAA 3UORA 1DOTA 3CI8A 3QK6A 4G8HA 1NMUA 5ESYA 4JBZA 1MY0A 2WEFA 3ONMA 2THIA 4Z0IA 4QHQA 2HHMA 1OVTA 3MP8A 2G93A 5I59B 3PMWA 1NNFA 3U1OA 2KR0A 5ICTA 4ZEIA 4YMBA 3EN3A 1OQGA 1EH3A 5EYFA 4OFLA 4JVIA 3CG1A 3PPRA 2Y7WA 3PV0E 2CEYA 4R75A 4ECFA 3EQ1A 3G3KA 3IORA 1PB9A 2RC8A 5IZ1A 4NWCA 1N04A 1FQFA 2ZXTA 3D1RA 2YJPA 4H6DA 5EQ8A 1MQIA 4PP0A 3S9MC 1D9QA 2WYKA 2Y5LA 3MZ9A 5J16A 2QMXA 4NF5B 4NF8A 4PC9A 4ZZAA 4LZ8A 1B4ZA 3OXNA 4NMYA 3RT6B 5K2YA 3FIRA 4QXDA 1IMAA 4JWYA 3H6WA 4OVTA 4KR5A 1FRPA 2XXWA 1WDNA 4TOZA 2XXVA 3G3IA 4ZEKA 1SW5A 2VD2A 4POWA 1PBQA 1UTHA 2DVZA 1SW2A 2I49A 1ZMGA 4U1ZA 2V84A 4GWZA 4PCDA 3PD8A 4Q8RA 3OO9A 4C1UA 4OXVA 2XXYA 1FTKA 1O64A 4OQOA 2Z22A 4XEQA 3ISPA 4JVDA 2P2AA 5JTYA 4GXAA 2GQ1A 4DXCA 2ONKE 1LFIA 2XD2A 3S9NC 3H6UA 5EQ9A 1LSTA 1IUDA 4G4PA 1P1WA 3RQTA 3K01A 4HW8A 3DM0A 3U8QA 2NVUB 1FBPA 3CHGA 1LCFA 4HS7A 4RNSA 4U4SA 3N6UA 2Q2CA 3ILTB 1LBWA 1Y9UA 4LVQA 3RN8A 3K6XA 3JZJA 5EHMA 2F6GA 3ZKKA 1Y1MA 3Q28A 2I58A 3O6IA 4OWDA 4KCDA 4MEVA 1B3FA 4JWOA 4EXLA 1EZ9A 5A5XA 3VVEA 5ICQA 3U72A 3IOTA 2VT5A 1MH3A 1MQJA 2ESNA 3TPAA 5F24A 3UK4A 3B6TA 1IXCA 3MYUA 1MY2A 1ATGA 3KOSA 4HE2A 3IO6A 1G0IA 3SEYA 5CMCA 1VDWA 3FUZA 4X1DA 3LSLA 2Q9TA 4YZZA 4F22A 3TQLA 1O7TA 4F2OA 5CI5A 3H4ZA 1B1XA 3VVFA 4QFNA 4RJZA 2QS4A 5I56B 1DPEA 4KXPA 5I2KB 3QUJA 1PDAA 2REJA 1FBEA 1FBDA 2F8DA 4P1LA 1XVYA 1ZJLA 1NUXA 5F1QA 3TFLA 2NXOA 4GFRA 4IY6A 4P1EA 1IITA 3KGCA 4OVSA 4OYVA 1QUKA 2RCBA 1UQWA 2RCAA 2F3DA 2I4CA 4GWUA 2DXYA 1FSAA 1BIYA 3FXUA 3FASA 5EYHA 4XXUA 4PQJA 1QUJA 5ISUA 3LSFB 2F7AA 5AE4A 1ZBMA 3LBSA 4N8YA 4GBVA 4O3CA 1O63A 3IJOB 2M8CA 4C1TA 3T1BA 5FHMA 4LUBA 3H7MA 2WX9A 3VXBA 1NI9A 3I3VA 1EYJA 3V8XB 4IGTA 4DI4B 4OTEA 3RPLA 1OLAA 3L6GA 5DVFA 2ZNSA 4F1YA 4PE3A 4X1BA 3G3FA 5H8FB 3PPNA 5I57A 1M5CA 3LSXA 2DWAA 1MDP1 4LQ2A 4YMAA 1LAXA 4IO6A 3UGWA 4DE8A 5M2VA 4H8JA 1MRPA 3E13X 4XKNA 3MW0A 1D9VA 5KDTA 2XHDA 1FTLA 3OSQA 1H44A 3H3GA 2F7BA 4G77A 1M5EA 4DZ1A 1LFGA 1LAGE 4F3SA 4DI3D 1Z7NE 2UVHA 4OEVA 4GWSA 4ZECA 2FA7A 2VP1A 4OEUA 1PEBA 3EKIA 4PFIA 4H65A 3IOUA 5EQAA 4ZDMA 3VV5A 3PPQA 1FPEA 4KYEA 4F3BA 1M5DA 4TQUQ 1FTOA 1YAEA 2O51A 4LATA 1IZ1A 4IB2A 1N3WA 1ZTYA 3WAFA 2VPOA 3FVNA 4MLVA 1JP4A 3LV0A 1I6AA 4FIMA 1Y1ZA 3TTMA 5JK4A 1PB7A 5CC2A 3KJ7A 4I3YA 3TUSA 4PFBA 3SESA 3T9XB 1BLFA 1H43A 3K0VA 3FJMA 4WXJA 5LDZA 3IR1A 2DYXA 3R26A 1IMFA 4GQOA 5H8QA 4N07A 1T0KA 5ET8A 3Q29A 4I9DA 1BP5A 3IK6B 2F7CA 4PAFA 3IB1A 2BJJX 1NV1A 2GH9A 2B4LA 4FATA 4O7IA 4AB5A 3SEVA 3MZBA 3OENA 2QS1A 3C33A 2O84X 2YLNA 3O6HA 1M5FA 3BKIB 3HHGA 3O9PA 5H8SA 3A09A 1NV0A 3T22A 1MM6A 3T93B 4KFQA 3S9LC 2XXRA 3HN0A 1YTVA 2V4CA 1B3GA 2DVCA 4PBQA 3U93A 2I0BA 4AS4A 2HXRA 5KCJB 3RY3A 2V3UA 3M3FA 1CNQA 1SPIA 4PFWA 4F18A 1US4A 4QF9A 2XX9A 1OLCA 1IQ7A 2F35A 4PFYA 2FNCA 1Q9DA 1MPDA 2X7PA 4IR8A 1N7WA 1B5IA 3E79A 3K4UA 1Q35A 4MAGA 2CZIA 2H99A 4G68C 1MY4A 3G3GA 2DQVA 4YICA 4PTKA 1B51A 2PT1A 5FBPA 3K6WA 4O94A 1MXXA 2DWIA 4K3FA 4H0WA 3RUMA 3CRBA 3E9XA 2Y7PA 3PUVE 1MQGA 2AL5A 4XKRA 2XD3A 1B3EA 3EPEA 1HSLA 3MWBA 3GLBA 4QFOA 1ELJA 1D4NA 4N6KA 2XWOA 4OVQA 4QSCA 1DCUA 3PUWE 4HTGA 4UACA 1B3HA 1UTBA 2Q88A 4PDDA 2Y7KA 3PPPA 4X48A 1TXFA 3RLFE 1INPA 3IJXB 1VR5A 4N81A 2UVGA 3KEIA 4RA1A 1EU8A 4N4UA 2XXIA 4N8GA 4AB6A 3K6UA 3R6UA 3IB0A 4IO2A 3TODA 3V83A 5DVIA 4GXSB 4GRKA 4EXKA 5IZ3A 2VGQA 4MJOA 4LZ5A 4PGPA 3N26A 5FHNA 1FBFA 3AXFA 5B7DA 3I5OA 5JEIA 3SERA 1JQFA 4H1XA 4OANA 1JW5A 1IXHA 3GYYA 3SKPA 2AIXA 3CG3A 1FPLA 4R2BA 2V93A 1H45A 2FIXA 4OVJA 1RDZA 2V3TA 4JB7A 2QVRA 3ECRA 3KOTA 2G29A 4RK9A 3M3LA 4YB7A 3FVKA 4MHFA 1MQHA 5A5LA 2XWKA 3C32A 4R72A 3B50A 4ZEFA 1H3DA 3OO6A 5I5PA 4MFIA 4R73A 4YAHX 4KD5A 4OFOA 5I2NB 2Q74A 3T66A 5L8DA 4AQ4A 3BBRA 2GHBA 2D3IA 3DP8A 1IMDA 3IOVA 3PPOA 4G68A 1BTJA 1NH7A 2HEUA 3EHTA 3KZGA 1ANFA 4P56A 4PFTA 4ZEBA 5H8NA 4PF6A 4NE4A 1POY1 4FJPA 3K1MA 1WVJA 2QRYA 3G7WA 1LBZA 5H8HA 1QULA 2XA5A 4GVOA 3B7DA 4ELPA 2X26A 2PFYA 4N13A 1I6QA 4QSDA 4KYSA 1AWBA 3LUZA 3VLVA 4F2QA 3RGYA 3MVZA 1NL5A 3O28A 3RYDA 5LOMA 3IO4A 3IL1B 5FHOA 1CB6A 4MX6A 3U65A 4PDHA 4UA8A 1P1UA 3I6VA 1DTZA 2PX1A 1R1NA 1KZ8A 1FPFA 1NV5A 1B5JA 3CR9A 3TTNA 3VFJA 1FCKA 4N6PA 5I58A 2NOOA 3G3JA 4FEBA 5IGAA 3PU5A 3N5LA 5DEXA 3TDJA 5DYHA 5KDTB 1AOVA 3C35A 1YZ0A 3CVGA 1SYHA 1DBZA 1YXIA 4PF8A 1D9YA 2UYFA 1OVBA 4EF1A 3SDFA 1KA0A 3BFUA 3SZPA 5AA2A 4YB5A 4PGNA 2O7IA 1FW0A 1Y4CA 2ZZXA 3K02A 3TAJA 5AA4A 1A55A 3GBBA 2P0SA 4GL0A 4ELRA 5FTIA 1FQBA 5AA3A 3VXCA 3RTWB 4RY1A 1Y3PA 5BUUA 1VSOA 4GWXA 4GD5A 5CBSA 5CRYA 2ABHA 2QS2A 3OO7A 4L17A 2IA4A 1OMPA 1DTGA 3F11A 2BJIA 4IO4A 3FATA 4P9KA 3M3KA 1JNFA 3PGFA 2MKZA 4N15A 1N3XA 4GWWA 1A8EA 2NWJA 1MXYA 2Y7IA 4N6DA 3T9UA 1N84A 3OOAA 4XKPA 4F29A 3HFUA 5CM6A 2QMWA 1FQCA 2XXHA 3UIFA 2OBGA 3USDA 1H76A 1NNKA 3E3KA 1MXZA 1KA1A 1Q1KA 3GBAA 2VD3A 1TWYA 5HM4B 1A7LA 5L9SA 4P0IA 4EF2A 4OMBA 1II5A 1IMBA 4MBPA 4NF5A 4OETA 5ET6A 3KN3A 4TLLB 4MNPA 3FBPA 4DXUA 3ILUB 3E78A 3MQ9A 2F36A 1S50A 1WODA 2I3WA 2HZLA 4OZ9A 3KC1A 3LUYA 4JDFA 1TFDA 2PBWA 1FBGA 1MXWA 4DCYA 3ROJA 3TTLA 1DPPA 1US5A 4I1DA 2WKYA 4ELQA 4NEDA 4F3PA 4PFUA 2B3FA 1LLSA 4YKIA 3CSGA 2Y7RA 2PYYA 1JW4A 1B46A 3CFLA 4LA9A 1QUIA 1JEUA 1SQYA 1FPIA 3T9VA 3MP6A 3OEMA 3P7IA 1URDA 1AL3A 4LONB 4Z7EA 4ESWA 2F78A 1IEJA 4M4GA 2VHAA 4DDDA 3C36A 3FXBA 4KI0E 2OCUA 3OMBA 2Z8FA 1QKAA 1YYZA 1UIUA 3W9VA 5ELVA 1IIWA 3B8BA 4BDRA 1LBXA 2PT2A 4F19A 3KJTA 3H6TA 3KN8A 1GVCA 1GTKA 5L9MA 2HQ0A 4NGUA 4QRZA 1ZU0A 2FVZA 1L5TA 2B4MA 1FPGA 5CMMA 2Y5KA 1UTBB 1NV3A 3D4CA 3O66A 4R9FA 3VDFA 4H5GA 1B7UA 1MG1A 1URGA 5ET5A 1R9LA 1Z7ME 2FBPA 5TPAA 3T96B 3B6WA 3VVDA 2FHYA 3KG2A 2ZYKA 3TCFA 1ZIUA 3MBPA 4FE8A 1HSJA 1SI0A 5FTHA 5IZ3B 3UN6A 4NWDA 2H9BA 3O6GA 4EDPA 1N7XA 3N94A 2X7QA 4C0RA 3EHSA 4ZE9A 4GLIA 5IM2A 5I56A 2F34A 2FYIA 4YKJA 3C34A 3PMVA 3RPWA 1KWHA 1LBCA 1MS7A 1OQHA 4EQ7A 3SETA 2P3VA 3H06B 4MCOA 3MZ1A 3TYHA 2I4BA 4NG7A 3V5AA 3GZGA 3O97A 3BIHA 4JSDA 1N0TA 1GV8A 2P1SA 4FBPA 4I8CA 3W9WA 1LGBC 1B7HA 3O29A 5CMBA 1GGGA 5EHSA 1B32A 4ONYA 1P1QA 2RC7A 2V25A 1NUWA 3KSJA 4NF0A 2HAVA 3G3HA 5CMKA 1RDYA 2HZKA 3HSTA 2I6EA 4HXVA 4P8BA 3BFTA 4P11A 2O1LA 4THIA 2WBBA 4NF4A 5H8NB 3H6VA 3K6VA 5H8FA 1JETA 2RKMA 1MDQA 4YKKA 2UYEA 1FQAA 3E4RA 3IB2A 2A5TA 2Z23A 4NF8B 4GX3A 1B1HA 3UA8A 3ZSFA 4H46A 4H5FA 3OEKA 5H8HB 2HFBA 3TZAA 3FXQA 2D21A 4H67A 1B58A 4KCCA 3H03A 3UP9A 1SYIA 2IEEA 3D4GA 2O68A 2XXXA 1UTHB 4OERA 1LCTA 4X04A 1PBPA 2QPQA 3L6HA 4N17A 2H4IA 2UVIA 2QS3A 1JEVA 2YPNA 2AYSA 2XXPA 3IOWA 3MSTA 3PUYE 4UABA 1USYH 3PMXA 3EF7A 5JTYB 1NV2A 1Y4TA 2O6AA 4MNIA 1PB8A 3FVGA 4R6KA 3ODBA 3V89B 3Q25A 1B9JA 2OZZA 2CZHA 2O69A 5I58B 3C9HA 4G2ZA 1LB9A 2PMSA 2W7YA 1B52A 1B4HA 5DEXB 4OA4A 5AA2D 3DP4A 3T9HB 3FV1A 1BKAA 2ZNTA 2QJEA 2E1SA 2DOJA 1D3KA 1SW1A 4XKQA 1LB8A 2UVJA 4JVCA 2PCRA 5TP9A 2ZZWA 3OELA 2HPGA 4R6YA 2H25A 3M8UA 4P0GA 2KQZA 1XHYA 1IXGA 2OWTA 3HCQA 2QL3A 4R6HA 5I84A 1VFEA 1RYOA 4G8NA 4TLMB 1VE4A 2F5XA 2PFZA 3KN7A 1B40A 5A5XB 1DMBA 4OFJA 2CZKA 4PFRA 3BIGA 3TQWA 1NV6A 1B6HA 4Q30B 3MJNA 4EUOA 4ESXA 1R6ZA 1SVXB 3N6TA 3TTRA 1NV7A 2F3BA 4Q5TA 1YPNA 1K9ZA 4XIGQ 3FVOA 5DTBA 3QUFA 2DXRA 4MH5A 1AIVA 1UIVA 4O8MA 5I3SA 4PBHA 1SD3A 1ZKBA 1G0HA 2Y84A 4WEDA 5KZTA 1RYXA 4R2FA 5B70A 4GWOA 1P1OA 4PETA 5KCJA 1ZLQA 2R6GE 3VLWA 3FXRA 2HCAA 1LBYA 2R9JA 1MH4A 5EYGA 4RYAA 4QSEA 3FJ7A 2AL4A 1MM7A 5K2XA 5F7VA 1JVXA 4EQBA 4NN3A 4OVRA 3LC8A 1I6BA 1RDXA 4H8IA 1FPKA 2I3VA 1K9YA 2CEXA 2PVUA 2XWVA 1YCJA 1N76A 3HPIA 4KQPA 3QMFA 4EQ9A 3CIJA 3RPLB 3FJGA 3KBZA 3KFMA 2R8TA 2DP8A 1A40A 1AMFA 3S2VA 2I48A 1XOCA 4HE1A 1R9QA 1B7ZA 3C31A 5I57B 1EZPA 3OD7A 4YKPA 5L9OA 4O3BA 1FQDA 2FIEA 4NTLA 1LEVA 4GX4A 4YU0A 4IY5A 2REGA 4ELOA 4OESA 1B5HA 2F97A 1MXVA 3TTKA 1AH5A 4QBAA 2Q8JA 2DE3A 3FV2A 2WYPA 2ZMBA 1A8FA 3EHUA 1LBBA 3KSXA 5ITOA 2QSXA 3MP1A 4GL8A 3R7XA 4MLQA 1MY3A 1NH8A 3S9EA 3KBRA 1MPBA 4KYDA 2OLBA 3K1NA 4F1UA 4NF6A 3K1PA 2XWIA 3MC2A 3TCHA 2ZYMA 1XT8A 4BDMA 4FAJA 1B3LA 2OJTA 3QYTA 5IAIA 3HHFA 3QAXA 4NHBA 2ZYNA 5HPQA 4IO5A 1B05A 3ZKLA 1QKBA 1FJ9A 5TPAB 5ITPA 2Z8EA 5I59A 1NUZA 5ET7A 1LFHA 1POTA 1OIBA 5I2NA 4R74A 4H45A 5LTCA 1BK4A 3TKDA 3FD3A 5H8QB 4U2RA 2GRVA 3A3UA 1LBVA 4OVPA 4ND9A 4G8MA 2XXKA 1TT1A 3IFCA 2QFLA 2DWHA 4LZ7A 1LAFE 2RC9A 3JV9A 5IZZA 1EYIA 2WBDA 4PAKA 3PUZE 4FEDA 4YB6A 3PD9A 3IFAA 1DK4A 1XC1A 4GF8A 2ONRA 3DP6A 5CBRA 5HBCA 3S4UA 1M5BA 4QFKA 1NFTA 4P47A 3IAZA 4PAIA 3TCGA 2XXUA 2VPNA 2L5VA 3CFZA 4BDNA 2GFEA 4ZZEA 3MPKA 3U94A 1B0LA 2DDKA 2ONSA 2F6PA 4U22A 3DLNA 2Q89A 2GHAA 1P1NA 3QXMA 3LSWA 3TEPA 4M1VA 2R71A 4XFEA 4NF4B 4IO3A 3KC0A 5TU0A
chains in the Genus database with same CATH topology
5IKBA 2A5TB 1J1NA 3OSRA 3RNNA 4PE5B 4XTCQ 1FTMA 3Q27A 4JSOA 2Q2AA 3K2DA 3LR1A 1FQEA 2RINA 2HXWA 3SEXA 1SI1A 1P99A 1SW4A 2CZLA 1LAHE 3CFXA 4DXBA 2O1MA 4WKMA 3HO7A 1GR2A 1USYE 2ALUA 1CE2A 5J1DA 4JXIA 3PUXE 1QW0A 4RXLA 4KHZE 2H98A 3OO8A 1EZOA 4BDLA 1F9BA 4MF3A 4FORA 1PC3A 2ZYOA 4DCXA 3VE1B 2CMOA 3SEUA 3B6QA 3MUQA 4WEPA 3Q26A 1S7YA 4HCWA 4ISUA 4FECA 4U21A 3GXAA 1MPCA 3A3CA 1A99A 2A5SA 2DWJA 4LP2B 4GOTA 4F1VA 5TP9B 4OENA 4RK2A 4E0WA 5I2KA 2HAUA 2XXQA 3W15C 2E0SA 4E0XA 1B0HA 4IO7A 3MPLA 5DVJA 2LAOA 3O2AA 1SDXA 3ZS6A 4HCYA 3K00A 4BLAA 3THIA 1JVYA 4F31B 4LQ5A 4ZS9A 4BDQA 3RTFB 4JWXA 4KPTA 1SBPA 4O3AA 3IX1A 2Z8DA 1B2HA 1JW1A 1A54A 4G68B 3WAEA 1HSEA 3FZVA 2B3BA 4GIZA 3MVWA 2O7UA 1URSA 2DE2A 1QJMA 2D5WA 4X9TA 3SEWA 4RPNA 1MQDA 5AA1A 4QFPA 1I69A 2B65A 1MY1A 4F39A 1XVXA 3HV1A 4DLDA 3DELB 4ZE8A 4IGRA 1IXIA 4QFLA 4F3GA 4U1OA 3TMGA 1QVSA 1NNTA 1VFDA 2V3QA 1FTJA 1NKXA 1NNPA 2XXTA 2DE4A 2DS9A 2DSFA 4U23A 2ZNUA 3RT8A 4RPOA 3MVXA 4Q0CA 2H5YA 4U4XA 5BWJA 2RF1A 1Y3NA 5DT6A 2XX8A 3CSBA 1Y3QA 2OWSA 2ANJA 3QSLA 1S9TA 4OHNA 3FGSA 3MAMA 1DSNA 4DIGA 5AA2B 1RKMA 4BDOA 3JYRA 4POXA 2NUVA 5AA4B 2I0CA 2OK2A 2KLFA 3TELA 4R9GA 1MXUA 1XS5A 1Y20A 3C4MA 4ZEDA 3U92A 3QIMA 1TFAA 2VOZA 4I62A 4NF6B 3VLUA 2XX7A 3MVYA 2UXAA 3UORA 1DOTA 3CI8A 3QK6A 4G8HA 1NMUA 4JBZA 1MY0A 3ONMA 2THIA 4Z0IA 4QHQA 1OVTA 3MP8A 2G93A 5I59B 3PMWA 1NNFA 3U1OA 5ICTA 4ZEIA 4YMBA 3EN3A 1OQGA 1EH3A 5EYFA 4OFLA 3CG1A 3PPRA 2Y7WA 3PV0E 4R75A 4ECFA 3EQ1A 3G3KA 3IORA 1PB9A 2RC8A 4NWCA 1N04A 1FQFA 2ZXTA 2YJPA 4H6DA 1MQIA 4PP0A 3S9MC 3MZ9A 2QMXA 4NF5B 4NF8A 4ZZAA 4LZ8A 1B4ZA 3OXNA 4NMYA 3RT6B 5K2YA 3FIRA 4JWYA 3H6WA 4KR5A 2XXWA 1WDNA 4TOZA 2XXVA 3G3IA 4ZEKA 1SW5A 2VD2A 4POWA 1PBQA 1UTHA 2DVZA 1SW2A 2I49A 1ZMGA 2V84A 4U1ZA 3PD8A 4Q8RA 3OO9A 4C1UA 4OXVA 2XXYA 1FTKA 1O64A 4OQOA 2Z22A 2P2AA 5JTYA 4GXAA 4DXCA 2ONKE 1LFIA 2XD2A 3S9NC 3H6UA 1LSTA 1IUDA 4G4PA 1P1WA 3RQTA 3K01A 4HW8A 3DM0A 3U8QA 2NVUB 1LCFA 4HS7A 4RNSA 4U4SA 3N6UA 2Q2CA 3ILTB 1Y9UA 4LVQA 3RN8A 3K6XA 3JZJA 5EHMA 2F6GA 3ZKKA 1Y1MA 3Q28A 2I58A 3O6IA 4OWDA 4KCDA 1B3FA 4JWOA 4EXLA 1EZ9A 5A5XA 3VVEA 5ICQA 3U72A 3IOTA 1MH3A 1MQJA 2ESNA 3TPAA 3UK4A 3B6TA 1IXCA 1MY2A 1ATGA 3KOSA 3IO6A 3SEYA 5CMCA 3FUZA 4X1DA 3LSLA 2Q9TA 4YZZA 4F22A 3TQLA 1O7TA 4F2OA 5CI5A 3H4ZA 1B1XA 3VVFA 4QFNA 4RJZA 2QS4A 5I56B 1DPEA 5I2KB 3QUJA 1PDAA 2REJA 2F8DA 1XVYA 1ZJLA 5F1QA 3TFLA 2NXOA 4GFRA 4IY6A 1IITA 3KGCA 4OYVA 1QUKA 2RCBA 1UQWA 2RCAA 2I4CA 2DXYA 3FXUA 1BIYA 3FASA 4XXUA 4PQJA 1QUJA 5ISUA 3LSFB 2F7AA 5AE4A 1ZBMA 3LBSA 4O3CA 1O63A 3IJOB 2M8CA 4C1TA 5FHMA 4LUBA 3H7MA 3VXBA 3I3VA 3V8XB 4IGTA 4OTEA 1OLAA 3L6GA 5DVFA 2ZNSA 4F1YA 4X1BA 3G3FA 5H8FB 3PPNA 5I57A 1M5CA 3LSXA 2DWAA 1MDP1 4LQ2A 4YMAA 1LAXA 4IO6A 3UGWA 4DE8A 5M2VA 4H8JA 1MRPA 3E13X 4XKNA 3MW0A 1D9VA 5KDTA 2XHDA 1FTLA 3OSQA 1H44A 3H3GA 2F7BA 4G77A 1M5EA 4DZ1A 1LFGA 1LAGE 4F3SA 1Z7NE 2UVHA 4OEVA 4ZECA 2FA7A 2VP1A 4OEUA 1PEBA 4H65A 3IOUA 4ZDMA 3VV5A 3PPQA 4KYEA 4F3BA 1M5DA 4TQUQ 1FTOA 1YAEA 2O51A 4LATA 1IZ1A 4IB2A 1ZTYA 1N3WA 3WAFA 3FVNA 4MLVA 1I6AA 4FIMA 1Y1ZA 3TTMA 5JK4A 1PB7A 5CC2A 3KJ7A 3TUSA 3SESA 3T9XB 1BLFA 1H43A 3K0VA 3FJMA 4WXJA 3IR1A 2DYXA 3R26A 4GQOA 5H8QA 4N07A 1T0KA 3Q29A 4I9DA 1BP5A 3IK6B 2F7CA 3IB1A 2BJJX 2GH9A 4FATA 4AB5A 3SEVA 3MZBA 3OENA 2QS1A 3C33A 2O84X 2YLNA 3O6HA 1M5FA 3BKIB 3HHGA 3O9PA 5H8SA 3A09A 3T22A 1MM6A 3T93B 4KFQA 3S9LC 2XXRA 3HN0A 1YTVA 1B3GA 2DVCA 3U93A 2I0BA 5KCJB 3RY3A 2V3UA 3M3FA 4PFWA 4F18A 1US4A 4QF9A 2XX9A 1OLCA 1IQ7A 2F35A 4PFYA 2FNCA 1MPDA 2X7PA 1N7WA 1B5IA 3K4UA 1Q35A 2H99A 4G68C 1MY4A 3G3GA 2DQVA 4YICA 1B51A 2PT1A 3K6WA 1MXXA 2DWIA 4K3FA 4H0WA 3RUMA 3CRBA 3E9XA 2Y7PA 3PUVE 1MQGA 2AL5A 4XKRA 2XD3A 1B3EA 3EPEA 1HSLA 3MWBA 3GLBA 4QFOA 1ELJA 1D4NA 4QSCA 3PUWE 4HTGA 4UACA 1B3HA 1UTBA 2Q88A 2Y7KA 3PPPA 4X48A 1TXFA 3RLFE 3IJXB 1VR5A 2UVGA 3KEIA 4RA1A 1EU8A 2XXIA 4AB6A 3K6UA 3R6UA 3IB0A 4IO2A 3TODA 3V83A 5DVIA 4GXSB 4GRKA 4EXKA 2VGQA 4LZ5A 3N26A 5FHNA 3AXFA 5B7DA 3I5OA 5JEIA 3SERA 1JQFA 4H1XA 1JW5A 1IXHA 3SKPA 2AIXA 3CG3A 4R2BA 2V93A 1H45A 4OVJA 2V3TA 4JB7A 3ECRA 3KOTA 2G29A 4RK9A 3M3LA 4YB7A 3FVKA 1MQHA 3C32A 4R72A 4ZEFA 1H3DA 3OO6A 4MFIA 4R73A 4YAHX 4KD5A 4OFOA 5I2NB 3T66A 5L8DA 4AQ4A 3BBRA 2GHBA 2D3IA 3DP8A 3IOVA 3PPOA 4G68A 1BTJA 1NH7A 2HEUA 3EHTA 3KZGA 1ANFA 4PFTA 4ZEBA 5H8NA 4NE4A 1POY1 4FJPA 3K1MA 1WVJA 2QRYA 3G7WA 5H8HA 1QULA 4GVOA 3B7DA 4ELPA 2X26A 4N13A 1I6QA 4QSDA 4KYSA 3VLVA 4F2QA 3RGYA 3MVZA 1NL5A 3O28A 5LOMA 3IO4A 3IL1B 5FHOA 1CB6A 4UA8A 1P1UA 3I6VA 1DTZA 2PX1A 1R1NA 1B5JA 3CR9A 3TTNA 3VFJA 1FCKA 4N6PA 5I58A 2NOOA 3G3JA 4FEBA 3PU5A 3N5LA 5DEXA 3TDJA 5DYHA 5KDTB 1AOVA 3C35A 3CVGA 1SYHA 1D9YA 2UYFA 1OVBA 4EF1A 3SDFA 3BFUA 5AA2A 4YB5A 2O7IA 1FW0A 1Y4CA 3K02A 3TAJA 5AA4A 1A55A 3GBBA 2P0SA 4GL0A 4ELRA 5FTIA 1FQBA 5AA3A 3VXCA 3RTWB 4RY1A 1Y3PA 5BUUA 1VSOA 4GD5A 5CBSA 5CRYA 2ABHA 2QS2A 3OO7A 4L17A 2IA4A 1OMPA 1DTGA 3F11A 4IO4A 3FATA 3M3KA 1JNFA 3PGFA 1N3XA 1A8EA 2NWJA 1MXYA 2Y7IA 3T9UA 1N84A 3OOAA 4XKPA 4F29A 5CM6A 2QMWA 1FQCA 2XXHA 3UIFA 2OBGA 3USDA 1H76A 1NNKA 3E3KA 1MXZA 1Q1KA 3GBAA 2VD3A 1TWYA 5HM4B 1A7LA 5L9SA 4P0IA 4EF2A 4OMBA 1II5A 4MBPA 4NF5A 4OETA 3KN3A 4TLLB 4DXUA 3ILUB 3MQ9A 2F36A 1S50A 1WODA 2I3WA 2HZLA 4OZ9A 3LUYA 4JDFA 1TFDA 2PBWA 1MXWA 4DCYA 3TTLA 1DPPA 1US5A 4I1DA 2WKYA 4ELQA 4NEDA 4F3PA 4PFUA 2B3FA 1LLSA 4YKIA 3CSGA 2Y7RA 2PYYA 1JW4A 1B46A 3CFLA 4LA9A 1QUIA 1JEUA 1SQYA 3T9VA 3MP6A 3OEMA 3P7IA 1URDA 1AL3A 4LONB 4Z7EA 4ESWA 2F78A 1IEJA 4M4GA 2VHAA 4DDDA 3C36A 4KI0E 2OCUA 3OMBA 2Z8FA 1QKAA 1UIUA 3W9VA 5ELVA 1IIWA 4BDRA 2PT2A 4F19A 3KJTA 3H6TA 3KN8A 1GVCA 1GTKA 5L9MA 2HQ0A 4QRZA 1ZU0A 1L5TA 5CMMA 1UTBB 3O66A 3D4CA 4R9FA 3VDFA 4H5GA 1B7UA 1MG1A 1URGA 1R9LA 1Z7ME 5TPAA 3T96B 3B6WA 3VVDA 3KG2A 2ZYKA 3TCFA 1ZIUA 3MBPA 4FE8A 1HSJA 1SI0A 5FTHA 3UN6A 4NWDA 2H9BA 3O6GA 4EDPA 1N7XA 3N94A 2X7QA 4C0RA 3EHSA 4ZE9A 4GLIA 5I56A 2F34A 2FYIA 4YKJA 3C34A 3PMVA 3RPWA 1KWHA 1LBCA 1MS7A 1OQHA 4EQ7A 3SETA 3H06B 3MZ1A 3TYHA 2I4BA 3V5AA 3GZGA 3O97A 4JSDA 1N0TA 1GV8A 2P1SA 4I8CA 3W9WA 1LGBC 1B7HA 3O29A 5CMBA 1GGGA 5EHSA 1B32A 4ONYA 1P1QA 2RC7A 2V25A 3KSJA 2HAVA 3G3HA 5CMKA 2HZKA 3HSTA 2I6EA 3BFTA 4P11A 2O1LA 4THIA 4NF4A 5H8NB 3H6VA 3K6VA 5H8FA 1JETA 2RKMA 1MDQA 4YKKA 2UYEA 1FQAA 3E4RA 3IB2A 2A5TA 2Z23A 4NF8B 1B1HA 3UA8A 3ZSFA 4H5FA 3OEKA 5H8HB 2HFBA 3TZAA 3FXQA 2D21A 4H67A 1B58A 4KCCA 3H03A 3UP9A 1SYIA 2IEEA 3D4GA 2O68A 2XXXA 1UTHB 4OERA 1LCTA 1PBPA 2QPQA 3L6HA 2H4IA 2UVIA 2QS3A 1JEVA 2YPNA 2AYSA 2XXPA 3IOWA 3PUYE 1USYH 3PMXA 3EF7A 5JTYB 1Y4TA 2O6AA 1PB8A 3FVGA 4R6KA 3ODBA 3V89B 3Q25A 1B9JA 2OZZA 2O69A 5I58B 3C9HA 4G2ZA 1LB9A 2PMSA 2W7YA 1B52A 1B4HA 5DEXB 5AA2D 3DP4A 3T9HB 3FV1A 1BKAA 2ZNTA 2QJEA 2E1SA 2DOJA 1D3KA 1SW1A 4XKQA 1LB8A 2UVJA 5TP9A 3OELA 4R6YA 2H25A 3M8UA 4P0GA 1XHYA 1IXGA 2OWTA 3HCQA 2QL3A 4R6HA 5I84A 1VFEA 1RYOA 4G8NA 4TLMB 1VE4A 2F5XA 3KN7A 1B40A 5A5XB 1DMBA 4OFJA 3TQWA 1B6HA 4Q30B 3MJNA 4EUOA 4ESXA 1R6ZA 1SVXB 3N6TA 3TTRA 4Q5TA 1YPNA 4XIGQ 3FVOA 5DTBA 3QUFA 2DXRA 4MH5A 1AIVA 1UIVA 1SD3A 1ZKBA 2Y84A 4WEDA 5KZTA 1RYXA 4R2FA 5B70A 4GWOA 1P1OA 4PETA 5KCJA 1ZLQA 2R6GE 3VLWA 3FXRA 2HCAA 2R9JA 1MH4A 4RYAA 4QSEA 3FJ7A 2AL4A 1MM7A 5K2XA 5F7VA 1JVXA 4EQBA 3LC8A 1I6BA 4H8IA 2I3VA 2PVUA 1YCJA 1N76A 3HPIA 4KQPA 4EQ9A 3CIJA 3FJGA 3KFMA 2DP8A 1A40A 1AMFA 3S2VA 2I48A 1XOCA 5I57B 1R9QA 1B7ZA 3C31A 1EZPA 3OD7A 4YKPA 5L9OA 4O3BA 1FQDA 4NTLA 4YU0A 4IY5A 2REGA 4ELOA 4OESA 1B5HA 2F97A 1MXVA 3TTKA 1AH5A 2Q8JA 2DE3A 3FV2A 2ZMBA 1A8FA 3EHUA 1LBBA 3KSXA 5ITOA 2QSXA 3MP1A 4GL8A 3R7XA 4MLQA 1MY3A 1NH8A 3S9EA 3KBRA 1MPBA 4KYDA 2OLBA 3K1NA 4F1UA 4NF6A 3K1PA 3MC2A 3TCHA 2ZYMA 1XT8A 4BDMA 4FAJA 1B3LA 2OJTA 3QYTA 5IAIA 3HHFA 3QAXA 2ZYNA 5HPQA 4IO5A 1B05A 3ZKLA 1QKBA 5TPAB 5ITPA 2Z8EA 5I59A 1LFHA 1POTA 1OIBA 5I2NA 4R74A 3TKDA 3FD3A 5H8QB 4U2RA 2GRVA 3A3UA 4ND9A 4G8MA 1TT1A 2DWHA 4LZ7A 1LAFE 2RC9A 3JV9A 3PUZE 4FEDA 4YB6A 3PD9A 1XC1A 4GF8A 2ONRA 3DP6A 5CBRA 5HBCA 3S4UA 1M5BA 4QFKA 1NFTA 3IAZA 3TCGA 2XXUA 3CFZA 4BDNA 2GFEA 4ZZEA 3MPKA 3U94A 1B0LA 2ONSA 2F6PA 4U22A 3DLNA 2Q89A 2GHAA 1P1NA 3QXMA 3LSWA 3TEPA 4M1VA 2R71A 4NF4B 4IO3A 5TU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IKB A;  2A5T B;  1J1N A;  3OSR A;  3RNN A;  4PE5 B;  4XTC Q;  1FTM A;  3Q27 A;  4JSO A;  2Q2A A;  3K2D A;  3LR1 A;  1FQE A;  2RIN A;  2HXW A;  3SEX A;  1SI1 A;  1P99 A;  1SW4 A;  2CZL A;  1LAH E;  3CFX A;  4DXB A;  2O1M A;  4WKM A;  3HO7 A;  1GR2 A;  1USY E;  2ALU A;  1CE2 A;  5J1D A;  4JXI A;  3PUX E;  1QW0 A;  4RXL A;  4KHZ E;  2H98 A;  3OO8 A;  1EZO A;  4BDL A;  1F9B A;  4MF3 A;  4FOR A;  1PC3 A;  2ZYO A;  4DCX A;  3VE1 B;  2CMO A;  3SEU A;  3B6Q A;  3MUQ A;  4WEP A;  3Q26 A;  1S7Y A;  4HCW A;  4ISU A;  4FEC A;  4U21 A;  3GXA A;  1MPC A;  3A3C A;  1A99 A;  2A5S A;  2DWJ A;  4LP2 B;  4GOT A;  4F1V A;  5TP9 B;  4OEN A;  4RK2 A;  4E0W A;  5I2K A;  2HAU A;  2XXQ A;  3W15 C;  2E0S A;  4E0X A;  1B0H A;  4IO7 A;  3MPL A;  5DVJ A;  2LAO A;  3O2A A;  1SDX A;  3ZS6 A;  4HCY A;  3K00 A;  4BLA A;  3THI A;  1JVY A;  4F31 B;  4LQ5 A;  4ZS9 A;  4BDQ A;  3RTF B;  4JWX A;  4KPT A;  1SBP A;  4O3A A;  3IX1 A;  2Z8D A;  1B2H A;  1JW1 A;  1A54 A;  4G68 B;  3WAE A;  1HSE A;  3FZV A;  2B3B A;  4GIZ A;  3MVW A;  2O7U A;  1URS A;  2DE2 A;  1QJM A;  2D5W A;  4X9T A;  3SEW A;  4RPN A;  1MQD A;  5AA1 A;  4QFP A;  1I69 A;  2B65 A;  1MY1 A;  4F39 A;  1XVX A;  3HV1 A;  4DLD A;  3DEL B;  4ZE8 A;  4IGR A;  1IXI A;  4QFL A;  4F3G A;  4U1O A;  3TMG A;  1QVS A;  1NNT A;  1VFD A;  2V3Q A;  1FTJ A;  1NKX A;  1NNP A;  2XXT A;  2DE4 A;  2DS9 A;  2DSF A;  4U23 A;  2ZNU A;  3RT8 A;  4RPO A;  3MVX A;  4Q0C A;  2H5Y A;  4U4X A;  5BWJ A;  2RF1 A;  1Y3N A;  5DT6 A;  2XX8 A;  3CSB A;  1Y3Q A;  2OWS A;  2ANJ A;  3QSL A;  1S9T A;  4OHN A;  3FGS A;  3MAM A;  1DSN A;  4DIG A;  5AA2 B;  1RKM A;  4BDO A;  3JYR A;  4POX A;  2NUV A;  5AA4 B;  2I0C A;  2OK2 A;  2KLF A;  3TEL A;  4R9G A;  1MXU A;  1XS5 A;  1Y20 A;  3C4M A;  4ZED A;  3U92 A;  3QIM A;  1TFA A;  2VOZ A;  4I62 A;  4NF6 B;  3VLU A;  2XX7 A;  3MVY A;  2UXA A;  3UOR A;  1DOT A;  3CI8 A;  3QK6 A;  4G8H A;  1NMU A;  4JBZ A;  1MY0 A;  3ONM A;  2THI A;  4Z0I A;  4QHQ A;  1OVT A;  3MP8 A;  2G93 A;  5I59 B;  3PMW A;  1NNF A;  3U1O A;  5ICT A;  4ZEI A;  4YMB A;  3EN3 A;  1OQG A;  1EH3 A;  5EYF A;  4OFL A;  3CG1 A;  3PPR A;  2Y7W A;  3PV0 E;  4R75 A;  4ECF A;  3EQ1 A;  3G3K A;  3IOR A;  1PB9 A;  2RC8 A;  4NWC A;  1N04 A;  1FQF A;  2ZXT A;  2YJP A;  4H6D A;  1MQI A;  4PP0 A;  3S9M C;  3MZ9 A;  2QMX A;  4NF5 B;  4NF8 A;  4ZZA A;  4LZ8 A;  1B4Z A;  3OXN A;  4NMY A;  3RT6 B;  5K2Y A;  3FIR A;  4JWY A;  3H6W A;  4KR5 A;  2XXW A;  1WDN A;  4TOZ A;  2XXV A;  3G3I A;  4ZEK A;  1SW5 A;  2VD2 A;  4POW A;  1PBQ A;  1UTH A;  2DVZ A;  1SW2 A;  2I49 A;  1ZMG A;  2V84 A;  4U1Z A;  3PD8 A;  4Q8R A;  3OO9 A;  4C1U A;  4OXV A;  2XXY A;  1FTK A;  1O64 A;  4OQO A;  2Z22 A;  2P2A A;  5JTY A;  4GXA A;  4DXC A;  2ONK E;  1LFI A;  2XD2 A;  3S9N C;  3H6U A;  1LST A;  1IUD A;  4G4P A;  1P1W A;  3RQT A;  3K01 A;  4HW8 A;  3DM0 A;  3U8Q A;  2NVU B;  1LCF A;  4HS7 A;  4RNS A;  4U4S A;  3N6U A;  2Q2C A;  3ILT B;  1Y9U A;  4LVQ A;  3RN8 A;  3K6X A;  3JZJ A;  5EHM A;  2F6G A;  3ZKK A;  1Y1M A;  3Q28 A;  2I58 A;  3O6I A;  4OWD A;  4KCD A;  1B3F A;  4JWO A;  4EXL A;  1EZ9 A;  5A5X A;  3VVE A;  5ICQ A;  3U72 A;  3IOT A;  1MH3 A;  1MQJ A;  2ESN A;  3TPA A;  3UK4 A;  3B6T A;  1IXC A;  1MY2 A;  1ATG A;  3KOS A;  3IO6 A;  3SEY A;  5CMC A;  3FUZ A;  4X1D A;  3LSL A;  2Q9T A;  4YZZ A;  4F22 A;  3TQL A;  1O7T A;  4F2O A;  5CI5 A;  3H4Z A;  1B1X A;  3VVF A;  4QFN A;  4RJZ A;  2QS4 A;  5I56 B;  1DPE A;  5I2K B;  3QUJ A;  1PDA A;  2REJ A;  2F8D A;  1XVY A;  1ZJL A;  5F1Q A;  3TFL A;  2NXO A;  4GFR A;  4IY6 A;  1IIT A;  3KGC A;  4OYV A;  1QUK A;  2RCB A;  1UQW A;  2RCA A;  2I4C A;  2DXY A;  3FXU A;  1BIY A;  3FAS A;  4XXU A;  4PQJ A;  1QUJ A;  5ISU A;  3LSF B;  2F7A A;  5AE4 A;  1ZBM A;  3LBS A;  4O3C A;  1O63 A;  3IJO B;  2M8C A;  4C1T A;  5FHM A;  4LUB A;  3H7M A;  3VXB A;  3I3V A;  3V8X B;  4IGT A;  4OTE A;  1OLA A;  3L6G A;  5DVF A;  2ZNS A;  4F1Y A;  4X1B A;  3G3F A;  5H8F B;  3PPN A;  5I57 A;  1M5C A;  3LSX A;  2DWA A;  1MDP 1;  4LQ2 A;  4YMA A;  1LAX A;  4IO6 A;  3UGW A;  4DE8 A;  5M2V A;  4H8J A;  1MRP A;  3E13 X;  4XKN A;  3MW0 A;  1D9V A;  5KDT A;  2XHD A;  1FTL A;  3OSQ A;  1H44 A;  3H3G A;  2F7B A;  4G77 A;  1M5E A;  4DZ1 A;  1LFG A;  1LAG E;  4F3S A;  1Z7N E;  2UVH A;  4OEV A;  4ZEC A;  2FA7 A;  2VP1 A;  4OEU A;  1PEB A;  4H65 A;  3IOU A;  4ZDM A;  3VV5 A;  3PPQ A;  4KYE A;  4F3B A;  1M5D A;  4TQU Q;  1FTO A;  1YAE A;  2O51 A;  4LAT A;  1IZ1 A;  4IB2 A;  1ZTY A;  1N3W A;  3WAF A;  3FVN A;  4MLV A;  1I6A A;  4FIM A;  1Y1Z A;  3TTM A;  5JK4 A;  1PB7 A;  5CC2 A;  3KJ7 A;  3TUS A;  3SES A;  3T9X B;  1BLF A;  1H43 A;  3K0V A;  3FJM A;  4WXJ A;  3IR1 A;  2DYX A;  3R26 A;  4GQO A;  5H8Q A;  4N07 A;  1T0K A;  3Q29 A;  4I9D A;  1BP5 A;  3IK6 B;  2F7C A;  3IB1 A;  2BJJ X;  2GH9 A;  4FAT A;  4AB5 A;  3SEV A;  3MZB A;  3OEN A;  2QS1 A;  3C33 A;  2O84 X;  2YLN A;  3O6H A;  1M5F A;  3BKI B;  3HHG A;  3O9P A;  5H8S A;  3A09 A;  3T22 A;  1MM6 A;  3T93 B;  4KFQ A;  3S9L C;  2XXR A;  3HN0 A;  1YTV A;  1B3G A;  2DVC A;  3U93 A;  2I0B A;  5KCJ B;  3RY3 A;  2V3U A;  3M3F A;  4PFW A;  4F18 A;  1US4 A;  4QF9 A;  2XX9 A;  1OLC A;  1IQ7 A;  2F35 A;  4PFY A;  2FNC A;  1MPD A;  2X7P A;  1N7W A;  1B5I A;  3K4U A;  1Q35 A;  2H99 A;  4G68 C;  1MY4 A;  3G3G A;  2DQV A;  4YIC A;  1B51 A;  2PT1 A;  3K6W A;  1MXX A;  2DWI A;  4K3F A;  4H0W A;  3RUM A;  3CRB A;  3E9X A;  2Y7P A;  3PUV E;  1MQG A;  2AL5 A;  4XKR A;  2XD3 A;  1B3E A;  3EPE A;  1HSL A;  3MWB A;  3GLB A;  4QFO A;  1ELJ A;  1D4N A;  4QSC A;  3PUW E;  4HTG A;  4UAC A;  1B3H A;  1UTB A;  2Q88 A;  2Y7K A;  3PPP A;  4X48 A;  1TXF A;  3RLF E;  3IJX B;  1VR5 A;  2UVG A;  3KEI A;  4RA1 A;  1EU8 A;  2XXI A;  4AB6 A;  3K6U A;  3R6U A;  3IB0 A;  4IO2 A;  3TOD A;  3V83 A;  5DVI A;  4GXS B;  4GRK A;  4EXK A;  2VGQ A;  4LZ5 A;  3N26 A;  5FHN A;  3AXF A;  5B7D A;  3I5O A;  5JEI A;  3SER A;  1JQF A;  4H1X A;  1JW5 A;  1IXH A;  3SKP A;  2AIX A;  3CG3 A;  4R2B A;  2V93 A;  1H45 A;  4OVJ A;  2V3T A;  4JB7 A;  3ECR A;  3KOT A;  2G29 A;  4RK9 A;  3M3L A;  4YB7 A;  3FVK A;  1MQH A;  3C32 A;  4R72 A;  4ZEF A;  1H3D A;  3OO6 A;  4MFI A;  4R73 A;  4YAH X;  4KD5 A;  4OFO A;  5I2N B;  3T66 A;  5L8D A;  4AQ4 A;  3BBR A;  2GHB A;  2D3I A;  3DP8 A;  3IOV A;  3PPO A;  4G68 A;  1BTJ A;  1NH7 A;  2HEU A;  3EHT A;  3KZG A;  1ANF A;  4PFT A;  4ZEB A;  5H8N A;  4NE4 A;  1POY 1;  4FJP A;  3K1M A;  1WVJ A;  2QRY A;  3G7W A;  5H8H A;  1QUL A;  4GVO A;  3B7D A;  4ELP A;  2X26 A;  4N13 A;  1I6Q A;  4QSD A;  4KYS A;  3VLV A;  4F2Q A;  3RGY A;  3MVZ A;  1NL5 A;  3O28 A;  5LOM A;  3IO4 A;  3IL1 B;  5FHO A;  1CB6 A;  4UA8 A;  1P1U A;  3I6V A;  1DTZ A;  2PX1 A;  1R1N A;  1B5J A;  3CR9 A;  3TTN A;  3VFJ A;  1FCK A;  4N6P A;  5I58 A;  2NOO A;  3G3J A;  4FEB A;  3PU5 A;  3N5L A;  5DEX A;  3TDJ A;  5DYH A;  5KDT B;  1AOV A;  3C35 A;  3CVG A;  1SYH A;  1D9Y A;  2UYF A;  1OVB A;  4EF1 A;  3SDF A;  3BFU A;  5AA2 A;  4YB5 A;  2O7I A;  1FW0 A;  1Y4C A;  3K02 A;  3TAJ A;  5AA4 A;  1A55 A;  3GBB A;  2P0S A;  4GL0 A;  4ELR A;  5FTI A;  1FQB A;  5AA3 A;  3VXC A;  3RTW B;  4RY1 A;  1Y3P A;  5BUU A;  1VSO A;  4GD5 A;  5CBS A;  5CRY A;  2ABH A;  2QS2 A;  3OO7 A;  4L17 A;  2IA4 A;  1OMP A;  1DTG A;  3F11 A;  4IO4 A;  3FAT A;  3M3K A;  1JNF A;  3PGF A;  1N3X A;  1A8E A;  2NWJ A;  1MXY A;  2Y7I A;  3T9U A;  1N84 A;  3OOA A;  4XKP A;  4F29 A;  5CM6 A;  2QMW A;  1FQC A;  2XXH A;  3UIF A;  2OBG A;  3USD A;  1H76 A;  1NNK A;  3E3K A;  1MXZ A;  1Q1K A;  3GBA A;  2VD3 A;  1TWY A;  5HM4 B;  1A7L A;  5L9S A;  4P0I A;  4EF2 A;  4OMB A;  1II5 A;  4MBP A;  4NF5 A;  4OET A;  3KN3 A;  4TLL B;  4DXU A;  3ILU B;  3MQ9 A;  2F36 A;  1S50 A;  1WOD A;  2I3W A;  2HZL A;  4OZ9 A;  3LUY A;  4JDF A;  1TFD A;  2PBW A;  1MXW A;  4DCY A;  3TTL A;  1DPP A;  1US5 A;  4I1D A;  2WKY A;  4ELQ A;  4NED A;  4F3P A;  4PFU A;  2B3F A;  1LLS A;  4YKI A;  3CSG A;  2Y7R A;  2PYY A;  1JW4 A;  1B46 A;  3CFL A;  4LA9 A;  1QUI A;  1JEU A;  1SQY A;  3T9V A;  3MP6 A;  3OEM A;  3P7I A;  1URD A;  1AL3 A;  4LON B;  4Z7E A;  4ESW A;  2F78 A;  1IEJ A;  4M4G A;  2VHA A;  4DDD A;  3C36 A;  4KI0 E;  2OCU A;  3OMB A;  2Z8F A;  1QKA A;  1UIU A;  3W9V A;  5ELV A;  1IIW A;  4BDR A;  2PT2 A;  4F19 A;  3KJT A;  3H6T A;  3KN8 A;  1GVC A;  1GTK A;  5L9M A;  2HQ0 A;  4QRZ A;  1ZU0 A;  1L5T A;  5CMM A;  1UTB B;  3O66 A;  3D4C A;  4R9F A;  3VDF A;  4H5G A;  1B7U A;  1MG1 A;  1URG A;  1R9L A;  1Z7M E;  5TPA A;  3T96 B;  3B6W A;  3VVD A;  3KG2 A;  2ZYK A;  3TCF A;  1ZIU A;  3MBP A;  4FE8 A;  1HSJ A;  1SI0 A;  5FTH A;  3UN6 A;  4NWD A;  2H9B A;  3O6G A;  4EDP A;  1N7X A;  3N94 A;  2X7Q A;  4C0R A;  3EHS A;  4ZE9 A;  4GLI A;  5I56 A;  2F34 A;  2FYI A;  4YKJ A;  3C34 A;  3PMV A;  3RPW A;  1KWH A;  1LBC A;  1MS7 A;  1OQH A;  4EQ7 A;  3SET A;  3H06 B;  3MZ1 A;  3TYH A;  2I4B A;  3V5A A;  3GZG A;  3O97 A;  4JSD A;  1N0T A;  1GV8 A;  2P1S A;  4I8C A;  3W9W A;  1LGB C;  1B7H A;  3O29 A;  5CMB A;  1GGG A;  5EHS A;  1B32 A;  4ONY A;  1P1Q A;  2RC7 A;  2V25 A;  3KSJ A;  2HAV A;  3G3H A;  5CMK A;  2HZK A;  3HST A;  2I6E A;  3BFT A;  4P11 A;  2O1L A;  4THI A;  4NF4 A;  5H8N B;  3H6V A;  3K6V A;  5H8F A;  1JET A;  2RKM A;  1MDQ A;  4YKK A;  2UYE A;  1FQA A;  3E4R A;  3IB2 A;  2A5T A;  2Z23 A;  4NF8 B;  1B1H A;  3UA8 A;  3ZSF A;  4H5F A;  3OEK A;  5H8H B;  2HFB A;  3TZA A;  3FXQ A;  2D21 A;  4H67 A;  1B58 A;  4KCC A;  3H03 A;  3UP9 A;  1SYI A;  2IEE A;  3D4G A;  2O68 A;  2XXX A;  1UTH B;  4OER A;  1LCT A;  1PBP A;  2QPQ A;  3L6H A;  2H4I A;  2UVI A;  2QS3 A;  1JEV A;  2YPN A;  2AYS A;  2XXP A;  3IOW A;  3PUY E;  1USY H;  3PMX A;  3EF7 A;  5JTY B;  1Y4T A;  2O6A A;  1PB8 A;  3FVG A;  4R6K A;  3ODB A;  3V89 B;  3Q25 A;  1B9J A;  2OZZ A;  2O69 A;  5I58 B;  3C9H A;  4G2Z A;  1LB9 A;  2PMS A;  2W7Y A;  1B52 A;  1B4H A;  5DEX B;  5AA2 D;  3DP4 A;  3T9H B;  3FV1 A;  1BKA A;  2ZNT A;  2QJE A;  2E1S A;  2DOJ A;  1D3K A;  1SW1 A;  4XKQ A;  1LB8 A;  2UVJ A;  5TP9 A;  3OEL A;  4R6Y A;  2H25 A;  3M8U A;  4P0G A;  1XHY A;  1IXG A;  2OWT A;  3HCQ A;  2QL3 A;  4R6H A;  5I84 A;  1VFE A;  1RYO A;  4G8N A;  4TLM B;  1VE4 A;  2F5X A;  3KN7 A;  1B40 A;  5A5X B;  1DMB A;  4OFJ A;  3TQW A;  1B6H A;  4Q30 B;  3MJN A;  4EUO A;  4ESX A;  1R6Z A;  1SVX B;  3N6T A;  3TTR A;  4Q5T A;  1YPN A;  4XIG Q;  3FVO A;  5DTB A;  3QUF A;  2DXR A;  4MH5 A;  1AIV A;  1UIV A;  1SD3 A;  1ZKB A;  2Y84 A;  4WED A;  5KZT A;  1RYX A;  4R2F A;  5B70 A;  4GWO A;  1P1O A;  4PET A;  5KCJ A;  1ZLQ A;  2R6G E;  3VLW A;  3FXR A;  2HCA A;  2R9J A;  1MH4 A;  4RYA A;  4QSE A;  3FJ7 A;  2AL4 A;  1MM7 A;  5K2X A;  5F7V A;  1JVX A;  4EQB A;  3LC8 A;  1I6B A;  4H8I A;  2I3V A;  2PVU A;  1YCJ A;  1N76 A;  3HPI A;  4KQP A;  4EQ9 A;  3CIJ A;  3FJG A;  3KFM A;  2DP8 A;  1A40 A;  1AMF A;  3S2V A;  2I48 A;  1XOC A;  5I57 B;  1R9Q A;  1B7Z A;  3C31 A;  1EZP A;  3OD7 A;  4YKP A;  5L9O A;  4O3B A;  1FQD A;  4NTL A;  4YU0 A;  4IY5 A;  2REG A;  4ELO A;  4OES A;  1B5H A;  2F97 A;  1MXV A;  3TTK A;  1AH5 A;  2Q8J A;  2DE3 A;  3FV2 A;  2ZMB A;  1A8F A;  3EHU A;  1LBB A;  3KSX A;  5ITO A;  2QSX A;  3MP1 A;  4GL8 A;  3R7X A;  4MLQ A;  1MY3 A;  1NH8 A;  3S9E A;  3KBR A;  1MPB A;  4KYD A;  2OLB A;  3K1N A;  4F1U A;  4NF6 A;  3K1P A;  3MC2 A;  3TCH A;  2ZYM A;  1XT8 A;  4BDM A;  4FAJ A;  1B3L A;  2OJT A;  3QYT A;  5IAI A;  3HHF A;  3QAX A;  2ZYN A;  5HPQ A;  4IO5 A;  1B05 A;  3ZKL A;  1QKB A;  5TPA B;  5ITP A;  2Z8E A;  5I59 A;  1LFH A;  1POT A;  1OIB A;  5I2N A;  4R74 A;  3TKD A;  3FD3 A;  5H8Q B;  4U2R A;  2GRV A;  3A3U A;  4ND9 A;  4G8M A;  1TT1 A;  2DWH A;  4LZ7 A;  1LAF E;  2RC9 A;  3JV9 A;  3PUZ E;  4FED A;  4YB6 A;  3PD9 A;  1XC1 A;  4GF8 A;  2ONR A;  3DP6 A;  5CBR A;  5HBC A;  3S4U A;  1M5B A;  4QFK A;  1NFT A;  3IAZ A;  3TCG A;  2XXU A;  3CFZ A;  4BDN A;  2GFE A;  4ZZE A;  3MPK A;  3U94 A;  1B0L A;  2ONS A;  2F6P A;  4U22 A;  3DLN A;  2Q89 A;  2GHA A;  1P1N A;  3QXM A;  3LSW A;  3TEP A;  4M1V A;  2R71 A;  4NF4 B;  4IO3 A;  5TU0 A; 
#chains in the Genus database with same CATH topology
 5IKB A;  2A5T B;  1J1N A;  2ZZV A;  4GWY A;  3OSR A;  3RNN A;  4PE5 B;  4XTC Q;  1FTM A;  3Q27 A;  4JSO A;  2Q2A A;  3K2D A;  3LR1 A;  1FQE A;  2RIN A;  1FJ6 A;  2HXW A;  3SEX A;  1SI1 A;  1P99 A;  1SW4 A;  1IME A;  2CZL A;  1LAH E;  3CFX A;  4DXB A;  2OX3 A;  4X8R A;  2O1M A;  4WKM A;  4I3E A;  3HO7 A;  1GR2 A;  5DW8 A;  1FBH A;  1USY E;  4GBW A;  2ALU A;  4G61 A;  1CE2 A;  5J1D A;  4JXI A;  3PUX E;  1QW0 A;  4RXL A;  4MMP A;  4KHZ E;  2H98 A;  4HE0 A;  3OO8 A;  1EZO A;  4BDL A;  1F9B A;  4MF3 A;  4FOR A;  1PC3 A;  2ZYO A;  1IMC A;  4DCX A;  1XI6 A;  3VE1 B;  2CMO A;  3SEU A;  4MIJ A;  3B6Q A;  1FBC A;  3MUQ A;  4WEP A;  3Q26 A;  1S7Y A;  4HCW A;  4ISU A;  4FEC A;  4U21 A;  3GXA A;  1MPC A;  3A3C A;  1A99 A;  2A5S A;  2DWJ A;  4LP2 B;  4GOT A;  4F1V A;  5TP9 B;  4OEN A;  4RK2 A;  4E0W A;  5I2K A;  2HAU A;  2XXQ A;  1QGX A;  2OWZ A;  3W15 C;  2E0S A;  4E0X A;  1B0H A;  4IO7 A;  3MPL A;  5DVJ A;  2LAO A;  5T3J A;  3O2A A;  1FPJ A;  1SDX A;  3NOH A;  3ZS6 A;  2Q8M A;  4AS5 A;  4HCY A;  3K00 A;  4BLA A;  3THI A;  1JVY A;  4I40 A;  4F31 B;  4LQ5 A;  4ZS9 A;  4BDQ A;  3RTF B;  4JWX A;  4KPT A;  1SBP A;  4O3A A;  3IX1 A;  2Z8D A;  1B2H A;  1JW1 A;  1NV4 A;  1A54 A;  4O7M A;  4G68 B;  3WAE A;  4NAP A;  1HSE A;  3FZV A;  2B3B A;  4NX1 A;  4GIZ A;  3MVW A;  2O7U A;  4N91 A;  1URS A;  5EQ7 A;  2DE2 A;  1QJM A;  3PTY A;  2D5W A;  4X9T A;  3SEW A;  4RPN A;  4MNC A;  1MQD A;  5AA1 A;  4QFP A;  1I69 A;  2B65 A;  1MY1 A;  4F39 A;  2P3N A;  1XVX A;  3HV1 A;  4DLD A;  3DEL B;  4ZE8 A;  4IGR A;  1IXI A;  4QFL A;  4F3G A;  1EYK A;  4U1O A;  3TMG A;  1QVS A;  1NNT A;  2JJK A;  1VFD A;  2V3Q A;  1FTJ A;  1NKX A;  1NNP A;  2XXT A;  1FPD A;  2DE4 A;  2DS9 A;  4P3L A;  2DSF A;  1NUY A;  4U23 A;  2ZNU A;  3RT8 A;  4RPO A;  3MVX A;  4Q0C A;  2H5Y A;  4GX6 A;  4U4X A;  4XF5 A;  5BWJ A;  4NQ8 A;  2RF1 A;  1Y3N A;  5DT6 A;  2XX8 A;  3CSB A;  1FTA A;  5I7I A;  1Y3Q A;  2OWS A;  2ANJ A;  3QSL A;  1S9T A;  4OHN A;  3FGS A;  3MAM A;  1DSN A;  4DIG A;  5AA2 B;  1RKM A;  4BDO A;  3JYR A;  4POX A;  2NUV A;  2QVV A;  2I0C A;  5AA4 B;  2OK2 A;  2KLF A;  3TEL A;  4R9G A;  1MXU A;  1XS5 A;  1Y20 A;  3C4M A;  2QVU A;  4ZED A;  3U92 A;  3QIM A;  1TFA A;  2VOZ A;  4I62 A;  4NF6 B;  3VLU A;  3A29 A;  1FPB A;  3T0J A;  2XX7 A;  3MVY A;  4LN5 A;  2UXA A;  3UOR A;  1DOT A;  3CI8 A;  3QK6 A;  4G8H A;  1NMU A;  5ESY A;  4JBZ A;  1MY0 A;  2WEF A;  3ONM A;  2THI A;  4Z0I A;  4QHQ A;  2HHM A;  1OVT A;  3MP8 A;  2G93 A;  5I59 B;  3PMW A;  1NNF A;  3U1O A;  2KR0 A;  5ICT A;  4ZEI A;  4YMB A;  3EN3 A;  1OQG A;  1EH3 A;  5EYF A;  4OFL A;  4JVI A;  3CG1 A;  3PPR A;  2Y7W A;  3PV0 E;  2CEY A;  4R75 A;  4ECF A;  3EQ1 A;  3G3K A;  3IOR A;  1PB9 A;  2RC8 A;  5IZ1 A;  4NWC A;  1N04 A;  1FQF A;  2ZXT A;  3D1R A;  2YJP A;  4H6D A;  5EQ8 A;  1MQI A;  4PP0 A;  3S9M C;  1D9Q A;  2WYK A;  2Y5L A;  3MZ9 A;  5J16 A;  2QMX A;  4NF5 B;  4NF8 A;  4PC9 A;  4ZZA A;  4LZ8 A;  1B4Z A;  3OXN A;  4NMY A;  3RT6 B;  5K2Y A;  3FIR A;  4QXD A;  1IMA A;  4JWY A;  3H6W A;  4OVT A;  4KR5 A;  1FRP A;  2XXW A;  1WDN A;  4TOZ A;  2XXV A;  3G3I A;  4ZEK A;  1SW5 A;  2VD2 A;  4POW A;  1PBQ A;  1UTH A;  2DVZ A;  1SW2 A;  2I49 A;  1ZMG A;  4U1Z A;  2V84 A;  4GWZ A;  4PCD A;  3PD8 A;  4Q8R A;  3OO9 A;  4C1U A;  4OXV A;  2XXY A;  1FTK A;  1O64 A;  4OQO A;  2Z22 A;  4XEQ A;  3ISP A;  4JVD A;  2P2A A;  5JTY A;  4GXA A;  2GQ1 A;  4DXC A;  2ONK E;  1LFI A;  2XD2 A;  3S9N C;  3H6U A;  5EQ9 A;  1LST A;  1IUD A;  4G4P A;  1P1W A;  3RQT A;  3K01 A;  4HW8 A;  3DM0 A;  3U8Q A;  2NVU B;  1FBP A;  3CHG A;  1LCF A;  4HS7 A;  4RNS A;  4U4S A;  3N6U A;  2Q2C A;  3ILT B;  1LBW A;  1Y9U A;  4LVQ A;  3RN8 A;  3K6X A;  3JZJ A;  5EHM A;  2F6G A;  3ZKK A;  1Y1M A;  3Q28 A;  2I58 A;  3O6I A;  4OWD A;  4KCD A;  4MEV A;  1B3F A;  4JWO A;  4EXL A;  1EZ9 A;  5A5X A;  3VVE A;  5ICQ A;  3U72 A;  3IOT A;  2VT5 A;  1MH3 A;  1MQJ A;  2ESN A;  3TPA A;  5F24 A;  3UK4 A;  3B6T A;  1IXC A;  3MYU A;  1MY2 A;  1ATG A;  3KOS A;  4HE2 A;  3IO6 A;  1G0I A;  3SEY A;  5CMC A;  1VDW A;  3FUZ A;  4X1D A;  3LSL A;  2Q9T A;  4YZZ A;  4F22 A;  3TQL A;  1O7T A;  4F2O A;  5CI5 A;  3H4Z A;  1B1X A;  3VVF A;  4QFN A;  4RJZ A;  2QS4 A;  5I56 B;  1DPE A;  4KXP A;  5I2K B;  3QUJ A;  1PDA A;  2REJ A;  1FBE A;  1FBD A;  2F8D A;  4P1L A;  1XVY A;  1ZJL A;  1NUX A;  5F1Q A;  3TFL A;  2NXO A;  4GFR A;  4IY6 A;  4P1E A;  1IIT A;  3KGC A;  4OVS A;  4OYV A;  1QUK A;  2RCB A;  1UQW A;  2RCA A;  2F3D A;  2I4C A;  4GWU A;  2DXY A;  1FSA A;  1BIY A;  3FXU A;  3FAS A;  5EYH A;  4XXU A;  4PQJ A;  1QUJ A;  5ISU A;  3LSF B;  2F7A A;  5AE4 A;  1ZBM A;  3LBS A;  4N8Y A;  4GBV A;  4O3C A;  1O63 A;  3IJO B;  2M8C A;  4C1T A;  3T1B A;  5FHM A;  4LUB A;  3H7M A;  2WX9 A;  3VXB A;  1NI9 A;  3I3V A;  1EYJ A;  3V8X B;  4IGT A;  4DI4 B;  4OTE A;  3RPL A;  1OLA A;  3L6G A;  5DVF A;  2ZNS A;  4F1Y A;  4PE3 A;  4X1B A;  3G3F A;  5H8F B;  3PPN A;  5I57 A;  1M5C A;  3LSX A;  2DWA A;  1MDP 1;  4LQ2 A;  4YMA A;  1LAX A;  4IO6 A;  3UGW A;  4DE8 A;  5M2V A;  4H8J A;  1MRP A;  3E13 X;  4XKN A;  3MW0 A;  1D9V A;  5KDT A;  2XHD A;  1FTL A;  3OSQ A;  1H44 A;  3H3G A;  2F7B A;  4G77 A;  1M5E A;  4DZ1 A;  1LFG A;  1LAG E;  4F3S A;  4DI3 D;  1Z7N E;  2UVH A;  4OEV A;  4GWS A;  4ZEC A;  2FA7 A;  2VP1 A;  4OEU A;  1PEB A;  3EKI A;  4PFI A;  4H65 A;  3IOU A;  5EQA A;  4ZDM A;  3VV5 A;  3PPQ A;  1FPE A;  4KYE A;  4F3B A;  1M5D A;  4TQU Q;  1FTO A;  1YAE A;  2O51 A;  4LAT A;  1IZ1 A;  4IB2 A;  1N3W A;  1ZTY A;  3WAF A;  2VPO A;  3FVN A;  4MLV A;  1JP4 A;  3LV0 A;  1I6A A;  4FIM A;  1Y1Z A;  3TTM A;  5JK4 A;  1PB7 A;  5CC2 A;  3KJ7 A;  4I3Y A;  3TUS A;  4PFB A;  3SES A;  3T9X B;  1BLF A;  1H43 A;  3K0V A;  3FJM A;  4WXJ A;  5LDZ A;  3IR1 A;  2DYX A;  3R26 A;  1IMF A;  4GQO A;  5H8Q A;  4N07 A;  1T0K A;  5ET8 A;  3Q29 A;  4I9D A;  1BP5 A;  3IK6 B;  2F7C A;  4PAF A;  3IB1 A;  2BJJ X;  1NV1 A;  2GH9 A;  2B4L A;  4FAT A;  4O7I A;  4AB5 A;  3SEV A;  3MZB A;  3OEN A;  2QS1 A;  3C33 A;  2O84 X;  2YLN A;  3O6H A;  1M5F A;  3BKI B;  3HHG A;  3O9P A;  5H8S A;  3A09 A;  1NV0 A;  3T22 A;  1MM6 A;  3T93 B;  4KFQ A;  3S9L C;  2XXR A;  3HN0 A;  1YTV A;  2V4C A;  1B3G A;  2DVC A;  4PBQ A;  3U93 A;  2I0B A;  4AS4 A;  2HXR A;  5KCJ B;  3RY3 A;  2V3U A;  3M3F A;  1CNQ A;  1SPI A;  4PFW A;  4F18 A;  1US4 A;  4QF9 A;  2XX9 A;  1OLC A;  1IQ7 A;  2F35 A;  4PFY A;  2FNC A;  1Q9D A;  1MPD A;  2X7P A;  4IR8 A;  1N7W A;  1B5I A;  3E79 A;  3K4U A;  1Q35 A;  4MAG A;  2CZI A;  2H99 A;  4G68 C;  1MY4 A;  3G3G A;  2DQV A;  4YIC A;  4PTK A;  1B51 A;  2PT1 A;  5FBP A;  3K6W A;  4O94 A;  1MXX A;  2DWI A;  4K3F A;  4H0W A;  3RUM A;  3CRB A;  3E9X A;  2Y7P A;  3PUV E;  1MQG A;  2AL5 A;  4XKR A;  2XD3 A;  1B3E A;  3EPE A;  1HSL A;  3MWB A;  3GLB A;  4QFO A;  1ELJ A;  1D4N A;  4N6K A;  2XWO A;  4OVQ A;  4QSC A;  1DCU A;  3PUW E;  4HTG A;  4UAC A;  1B3H A;  1UTB A;  2Q88 A;  4PDD A;  2Y7K A;  3PPP A;  4X48 A;  1TXF A;  3RLF E;  1INP A;  3IJX B;  1VR5 A;  4N81 A;  2UVG A;  3KEI A;  4RA1 A;  1EU8 A;  4N4U A;  2XXI A;  4N8G A;  4AB6 A;  3K6U A;  3R6U A;  3IB0 A;  4IO2 A;  3TOD A;  3V83 A;  5DVI A;  4GXS B;  4GRK A;  4EXK A;  5IZ3 A;  2VGQ A;  4MJO A;  4LZ5 A;  4PGP A;  3N26 A;  5FHN A;  1FBF A;  3AXF A;  5B7D A;  3I5O A;  5JEI A;  3SER A;  1JQF A;  4H1X A;  4OAN A;  1JW5 A;  1IXH A;  3GYY A;  3SKP A;  2AIX A;  3CG3 A;  1FPL A;  4R2B A;  2V93 A;  1H45 A;  2FIX A;  4OVJ A;  1RDZ A;  2V3T A;  4JB7 A;  2QVR A;  3ECR A;  3KOT A;  2G29 A;  4RK9 A;  3M3L A;  4YB7 A;  3FVK A;  4MHF A;  1MQH A;  5A5L A;  2XWK A;  3C32 A;  4R72 A;  3B50 A;  4ZEF A;  1H3D A;  3OO6 A;  5I5P A;  4MFI A;  4R73 A;  4YAH X;  4KD5 A;  4OFO A;  5I2N B;  2Q74 A;  3T66 A;  5L8D A;  4AQ4 A;  3BBR A;  2GHB A;  2D3I A;  3DP8 A;  1IMD A;  3IOV A;  3PPO A;  4G68 A;  1BTJ A;  1NH7 A;  2HEU A;  3EHT A;  3KZG A;  1ANF A;  4P56 A;  4PFT A;  4ZEB A;  5H8N A;  4PF6 A;  4NE4 A;  1POY 1;  4FJP A;  3K1M A;  1WVJ A;  2QRY A;  3G7W A;  1LBZ A;  5H8H A;  1QUL A;  2XA5 A;  4GVO A;  3B7D A;  4ELP A;  2X26 A;  2PFY A;  4N13 A;  1I6Q A;  4QSD A;  4KYS A;  1AWB A;  3LUZ A;  3VLV A;  4F2Q A;  3RGY A;  3MVZ A;  1NL5 A;  3O28 A;  3RYD A;  5LOM A;  3IO4 A;  3IL1 B;  5FHO A;  1CB6 A;  4MX6 A;  3U65 A;  4PDH A;  4UA8 A;  1P1U A;  3I6V A;  1DTZ A;  2PX1 A;  1R1N A;  1KZ8 A;  1FPF A;  1NV5 A;  1B5J A;  3CR9 A;  3TTN A;  3VFJ A;  1FCK A;  4N6P A;  5I58 A;  2NOO A;  3G3J A;  4FEB A;  5IGA A;  3PU5 A;  3N5L A;  5DEX A;  3TDJ A;  5DYH A;  5KDT B;  1AOV A;  3C35 A;  1YZ0 A;  3CVG A;  1SYH A;  1DBZ A;  1YXI A;  4PF8 A;  1D9Y A;  2UYF A;  1OVB A;  4EF1 A;  3SDF A;  1KA0 A;  3BFU A;  3SZP A;  5AA2 A;  4YB5 A;  4PGN A;  2O7I A;  1FW0 A;  1Y4C A;  2ZZX A;  3K02 A;  3TAJ A;  5AA4 A;  1A55 A;  3GBB A;  2P0S A;  4GL0 A;  4ELR A;  5FTI A;  1FQB A;  5AA3 A;  3VXC A;  3RTW B;  4RY1 A;  1Y3P A;  5BUU A;  1VSO A;  4GWX A;  4GD5 A;  5CBS A;  5CRY A;  2ABH A;  2QS2 A;  3OO7 A;  4L17 A;  2IA4 A;  1OMP A;  1DTG A;  3F11 A;  2BJI A;  4IO4 A;  3FAT A;  4P9K A;  3M3K A;  1JNF A;  3PGF A;  2MKZ A;  4N15 A;  1N3X A;  4GWW A;  1A8E A;  2NWJ A;  1MXY A;  2Y7I A;  4N6D A;  3T9U A;  1N84 A;  3OOA A;  4XKP A;  4F29 A;  3HFU A;  5CM6 A;  2QMW A;  1FQC A;  2XXH A;  3UIF A;  2OBG A;  3USD A;  1H76 A;  1NNK A;  3E3K A;  1MXZ A;  1KA1 A;  1Q1K A;  3GBA A;  2VD3 A;  1TWY A;  5HM4 B;  1A7L A;  5L9S A;  4P0I A;  4EF2 A;  4OMB A;  1II5 A;  1IMB A;  4MBP A;  4NF5 A;  4OET A;  5ET6 A;  3KN3 A;  4TLL B;  4MNP A;  3FBP A;  4DXU A;  3ILU B;  3E78 A;  3MQ9 A;  2F36 A;  1S50 A;  1WOD A;  2I3W A;  2HZL A;  4OZ9 A;  3KC1 A;  3LUY A;  4JDF A;  1TFD A;  2PBW A;  1FBG A;  1MXW A;  4DCY A;  3ROJ A;  3TTL A;  1DPP A;  1US5 A;  4I1D A;  2WKY A;  4ELQ A;  4NED A;  4F3P A;  4PFU A;  2B3F A;  1LLS A;  4YKI A;  3CSG A;  2Y7R A;  2PYY A;  1JW4 A;  1B46 A;  3CFL A;  4LA9 A;  1QUI A;  1JEU A;  1SQY A;  1FPI A;  3T9V A;  3MP6 A;  3OEM A;  3P7I A;  1URD A;  1AL3 A;  4LON B;  4Z7E A;  4ESW A;  2F78 A;  1IEJ A;  4M4G A;  2VHA A;  4DDD A;  3C36 A;  3FXB A;  4KI0 E;  2OCU A;  3OMB A;  2Z8F A;  1QKA A;  1YYZ A;  1UIU A;  3W9V A;  5ELV A;  1IIW A;  3B8B A;  4BDR A;  1LBX A;  2PT2 A;  4F19 A;  3KJT A;  3H6T A;  3KN8 A;  1GVC A;  1GTK A;  5L9M A;  2HQ0 A;  4NGU A;  4QRZ A;  1ZU0 A;  2FVZ A;  1L5T A;  2B4M A;  1FPG A;  5CMM A;  2Y5K A;  1UTB B;  1NV3 A;  3D4C A;  3O66 A;  4R9F A;  3VDF A;  4H5G A;  1B7U A;  1MG1 A;  1URG A;  5ET5 A;  1R9L A;  1Z7M E;  2FBP A;  5TPA A;  3T96 B;  3B6W A;  3VVD A;  2FHY A;  3KG2 A;  2ZYK A;  3TCF A;  1ZIU A;  3MBP A;  4FE8 A;  1HSJ A;  1SI0 A;  5FTH A;  5IZ3 B;  3UN6 A;  4NWD A;  2H9B A;  3O6G A;  4EDP A;  1N7X A;  3N94 A;  2X7Q A;  4C0R A;  3EHS A;  4ZE9 A;  4GLI A;  5IM2 A;  5I56 A;  2F34 A;  2FYI A;  4YKJ A;  3C34 A;  3PMV A;  3RPW A;  1KWH A;  1LBC A;  1MS7 A;  1OQH A;  4EQ7 A;  3SET A;  2P3V A;  3H06 B;  4MCO A;  3MZ1 A;  3TYH A;  2I4B A;  4NG7 A;  3V5A A;  3GZG A;  3O97 A;  3BIH A;  4JSD A;  1N0T A;  1GV8 A;  2P1S A;  4FBP A;  4I8C A;  3W9W A;  1LGB C;  1B7H A;  3O29 A;  5CMB A;  1GGG A;  5EHS A;  1B32 A;  4ONY A;  1P1Q A;  2RC7 A;  2V25 A;  1NUW A;  3KSJ A;  4NF0 A;  2HAV A;  3G3H A;  5CMK A;  1RDY A;  2HZK A;  3HST A;  2I6E A;  4HXV A;  4P8B A;  3BFT A;  4P11 A;  2O1L A;  4THI A;  2WBB A;  4NF4 A;  5H8N B;  3H6V A;  3K6V A;  5H8F A;  1JET A;  2RKM A;  1MDQ A;  4YKK A;  2UYE A;  1FQA A;  3E4R A;  3IB2 A;  2A5T A;  2Z23 A;  4NF8 B;  4GX3 A;  1B1H A;  3UA8 A;  3ZSF A;  4H46 A;  4H5F A;  3OEK A;  5H8H B;  2HFB A;  3TZA A;  3FXQ A;  2D21 A;  4H67 A;  1B58 A;  4KCC A;  3H03 A;  3UP9 A;  1SYI A;  2IEE A;  3D4G A;  2O68 A;  2XXX A;  1UTH B;  4OER A;  1LCT A;  4X04 A;  1PBP A;  2QPQ A;  3L6H A;  4N17 A;  2H4I A;  2UVI A;  2QS3 A;  1JEV A;  2YPN A;  2AYS A;  2XXP A;  3IOW A;  3MST A;  3PUY E;  4UAB A;  1USY H;  3PMX A;  3EF7 A;  5JTY B;  1NV2 A;  1Y4T A;  2O6A A;  4MNI A;  1PB8 A;  3FVG A;  4R6K A;  3ODB A;  3V89 B;  3Q25 A;  1B9J A;  2OZZ A;  2CZH A;  2O69 A;  5I58 B;  3C9H A;  4G2Z A;  1LB9 A;  2PMS A;  2W7Y A;  1B52 A;  1B4H A;  5DEX B;  4OA4 A;  5AA2 D;  3DP4 A;  3T9H B;  3FV1 A;  1BKA A;  2ZNT A;  2QJE A;  2E1S A;  2DOJ A;  1D3K A;  1SW1 A;  4XKQ A;  1LB8 A;  2UVJ A;  4JVC A;  2PCR A;  5TP9 A;  2ZZW A;  3OEL A;  2HPG A;  4R6Y A;  2H25 A;  3M8U A;  4P0G A;  2KQZ A;  1XHY A;  1IXG A;  2OWT A;  3HCQ A;  2QL3 A;  4R6H A;  5I84 A;  1VFE A;  1RYO A;  4G8N A;  4TLM B;  1VE4 A;  2F5X A;  2PFZ A;  3KN7 A;  1B40 A;  5A5X B;  1DMB A;  4OFJ A;  2CZK A;  4PFR A;  3BIG A;  3TQW A;  1NV6 A;  1B6H A;  4Q30 B;  3MJN A;  4EUO A;  4ESX A;  1R6Z A;  1SVX B;  3N6T A;  3TTR A;  1NV7 A;  2F3B A;  4Q5T A;  1YPN A;  1K9Z A;  4XIG Q;  3FVO A;  5DTB A;  3QUF A;  2DXR A;  4MH5 A;  1AIV A;  1UIV A;  4O8M A;  5I3S A;  4PBH A;  1SD3 A;  1ZKB A;  1G0H A;  2Y84 A;  4WED A;  5KZT A;  1RYX A;  4R2F A;  5B70 A;  4GWO A;  1P1O A;  4PET A;  5KCJ A;  1ZLQ A;  2R6G E;  3VLW A;  3FXR A;  2HCA A;  1LBY A;  2R9J A;  1MH4 A;  5EYG A;  4RYA A;  4QSE A;  3FJ7 A;  2AL4 A;  1MM7 A;  5K2X A;  5F7V A;  1JVX A;  4EQB A;  4NN3 A;  4OVR A;  3LC8 A;  1I6B A;  1RDX A;  4H8I A;  1FPK A;  2I3V A;  1K9Y A;  2CEX A;  2PVU A;  2XWV A;  1YCJ A;  1N76 A;  3HPI A;  4KQP A;  3QMF A;  4EQ9 A;  3CIJ A;  3RPL B;  3FJG A;  3KBZ A;  3KFM A;  2R8T A;  2DP8 A;  1A40 A;  1AMF A;  3S2V A;  2I48 A;  1XOC A;  4HE1 A;  1R9Q A;  1B7Z A;  3C31 A;  5I57 B;  1EZP A;  3OD7 A;  4YKP A;  5L9O A;  4O3B A;  1FQD A;  2FIE A;  4NTL A;  1LEV A;  4GX4 A;  4YU0 A;  4IY5 A;  2REG A;  4ELO A;  4OES A;  1B5H A;  2F97 A;  1MXV A;  3TTK A;  1AH5 A;  4QBA A;  2Q8J A;  2DE3 A;  3FV2 A;  2WYP A;  2ZMB A;  1A8F A;  3EHU A;  1LBB A;  3KSX A;  5ITO A;  2QSX A;  3MP1 A;  4GL8 A;  3R7X A;  4MLQ A;  1MY3 A;  1NH8 A;  3S9E A;  3KBR A;  1MPB A;  4KYD A;  2OLB A;  3K1N A;  4F1U A;  4NF6 A;  3K1P A;  2XWI A;  3MC2 A;  3TCH A;  2ZYM A;  1XT8 A;  4BDM A;  4FAJ A;  1B3L A;  2OJT A;  3QYT A;  5IAI A;  3HHF A;  3QAX A;  4NHB A;  2ZYN A;  5HPQ A;  4IO5 A;  1B05 A;  3ZKL A;  1QKB A;  1FJ9 A;  5TPA B;  5ITP A;  2Z8E A;  5I59 A;  1NUZ A;  5ET7 A;  1LFH A;  1POT A;  1OIB A;  5I2N A;  4R74 A;  4H45 A;  5LTC A;  1BK4 A;  3TKD A;  3FD3 A;  5H8Q B;  4U2R A;  2GRV A;  3A3U A;  1LBV A;  4OVP A;  4ND9 A;  4G8M A;  2XXK A;  1TT1 A;  3IFC A;  2QFL A;  2DWH A;  4LZ7 A;  1LAF E;  2RC9 A;  3JV9 A;  5IZZ A;  1EYI A;  2WBD A;  4PAK A;  3PUZ E;  4FED A;  4YB6 A;  3PD9 A;  3IFA A;  1DK4 A;  1XC1 A;  4GF8 A;  2ONR A;  3DP6 A;  5CBR A;  5HBC A;  3S4U A;  1M5B A;  4QFK A;  1NFT A;  4P47 A;  3IAZ A;  4PAI A;  3TCG A;  2XXU A;  2VPN A;  2L5V A;  3CFZ A;  4BDN A;  2GFE A;  4ZZE A;  3MPK A;  3U94 A;  1B0L A;  2DDK A;  2ONS A;  2F6P A;  4U22 A;  3DLN A;  2Q89 A;  2GHA A;  1P1N A;  3QXM A;  3LSW A;  3TEP A;  4M1V A;  2R71 A;  4XFE A;  4NF4 B;  4IO3 A;  3KC0 A;  5TU0 A; 
#chains in the Genus database with same CATH homology
 5IKB A;  2A5T B;  1J1N A;  3OSR A;  3RNN A;  4PE5 B;  4XTC Q;  1FTM A;  3Q27 A;  4JSO A;  2Q2A A;  3K2D A;  3LR1 A;  1FQE A;  2RIN A;  2HXW A;  3SEX A;  1SI1 A;  1P99 A;  1SW4 A;  2CZL A;  1LAH E;  3CFX A;  4DXB A;  2O1M A;  4WKM A;  3HO7 A;  1GR2 A;  1USY E;  2ALU A;  1CE2 A;  5J1D A;  4JXI A;  3PUX E;  1QW0 A;  4RXL A;  4KHZ E;  2H98 A;  3OO8 A;  1EZO A;  4BDL A;  1F9B A;  4MF3 A;  4FOR A;  1PC3 A;  2ZYO A;  4DCX A;  3VE1 B;  2CMO A;  3SEU A;  3B6Q A;  3MUQ A;  4WEP A;  3Q26 A;  1S7Y A;  4HCW A;  4ISU A;  4FEC A;  4U21 A;  3GXA A;  1MPC A;  3A3C A;  1A99 A;  2A5S A;  2DWJ A;  4LP2 B;  4GOT A;  4F1V A;  5TP9 B;  4OEN A;  4RK2 A;  4E0W A;  5I2K A;  2HAU A;  2XXQ A;  3W15 C;  2E0S A;  4E0X A;  1B0H A;  4IO7 A;  3MPL A;  5DVJ A;  2LAO A;  3O2A A;  1SDX A;  3ZS6 A;  4HCY A;  3K00 A;  4BLA A;  3THI A;  1JVY A;  4F31 B;  4LQ5 A;  4ZS9 A;  4BDQ A;  3RTF B;  4JWX A;  4KPT A;  1SBP A;  4O3A A;  3IX1 A;  2Z8D A;  1B2H A;  1JW1 A;  1A54 A;  4G68 B;  3WAE A;  1HSE A;  3FZV A;  2B3B A;  4GIZ A;  3MVW A;  2O7U A;  1URS A;  2DE2 A;  1QJM A;  2D5W A;  4X9T A;  3SEW A;  4RPN A;  1MQD A;  5AA1 A;  4QFP A;  1I69 A;  2B65 A;  1MY1 A;  4F39 A;  1XVX A;  3HV1 A;  4DLD A;  3DEL B;  4ZE8 A;  4IGR A;  1IXI A;  4QFL A;  4F3G A;  4U1O A;  3TMG A;  1QVS A;  1NNT A;  1VFD A;  2V3Q A;  1FTJ A;  1NKX A;  1NNP A;  2XXT A;  2DE4 A;  2DS9 A;  2DSF A;  4U23 A;  2ZNU A;  3RT8 A;  4RPO A;  3MVX A;  4Q0C A;  2H5Y A;  4U4X A;  5BWJ A;  2RF1 A;  1Y3N A;  5DT6 A;  2XX8 A;  3CSB A;  1Y3Q A;  2OWS A;  2ANJ A;  3QSL A;  1S9T A;  4OHN A;  3FGS A;  3MAM A;  1DSN A;  4DIG A;  5AA2 B;  1RKM A;  4BDO A;  3JYR A;  4POX A;  2NUV A;  5AA4 B;  2I0C A;  2OK2 A;  2KLF A;  3TEL A;  4R9G A;  1MXU A;  1XS5 A;  1Y20 A;  3C4M A;  4ZED A;  3U92 A;  3QIM A;  1TFA A;  2VOZ A;  4I62 A;  4NF6 B;  3VLU A;  2XX7 A;  3MVY A;  2UXA A;  3UOR A;  1DOT A;  3CI8 A;  3QK6 A;  4G8H A;  1NMU A;  4JBZ A;  1MY0 A;  3ONM A;  2THI A;  4Z0I A;  4QHQ A;  1OVT A;  3MP8 A;  2G93 A;  5I59 B;  3PMW A;  1NNF A;  3U1O A;  5ICT A;  4ZEI A;  4YMB A;  3EN3 A;  1OQG A;  1EH3 A;  5EYF A;  4OFL A;  3CG1 A;  3PPR A;  2Y7W A;  3PV0 E;  4R75 A;  4ECF A;  3EQ1 A;  3G3K A;  3IOR A;  1PB9 A;  2RC8 A;  4NWC A;  1N04 A;  1FQF A;  2ZXT A;  2YJP A;  4H6D A;  1MQI A;  4PP0 A;  3S9M C;  3MZ9 A;  2QMX A;  4NF5 B;  4NF8 A;  4ZZA A;  4LZ8 A;  1B4Z A;  3OXN A;  4NMY A;  3RT6 B;  5K2Y A;  3FIR A;  4JWY A;  3H6W A;  4KR5 A;  2XXW A;  1WDN A;  4TOZ A;  2XXV A;  3G3I A;  4ZEK A;  1SW5 A;  2VD2 A;  4POW A;  1PBQ A;  1UTH A;  2DVZ A;  1SW2 A;  2I49 A;  1ZMG A;  2V84 A;  4U1Z A;  3PD8 A;  4Q8R A;  3OO9 A;  4C1U A;  4OXV A;  2XXY A;  1FTK A;  1O64 A;  4OQO A;  2Z22 A;  2P2A A;  5JTY A;  4GXA A;  4DXC A;  2ONK E;  1LFI A;  2XD2 A;  3S9N C;  3H6U A;  1LST A;  1IUD A;  4G4P A;  1P1W A;  3RQT A;  3K01 A;  4HW8 A;  3DM0 A;  3U8Q A;  2NVU B;  1LCF A;  4HS7 A;  4RNS A;  4U4S A;  3N6U A;  2Q2C A;  3ILT B;  1Y9U A;  4LVQ A;  3RN8 A;  3K6X A;  3JZJ A;  5EHM A;  2F6G A;  3ZKK A;  1Y1M A;  3Q28 A;  2I58 A;  3O6I A;  4OWD A;  4KCD A;  1B3F A;  4JWO A;  4EXL A;  1EZ9 A;  5A5X A;  3VVE A;  5ICQ A;  3U72 A;  3IOT A;  1MH3 A;  1MQJ A;  2ESN A;  3TPA A;  3UK4 A;  3B6T A;  1IXC A;  1MY2 A;  1ATG A;  3KOS A;  3IO6 A;  3SEY A;  5CMC A;  3FUZ A;  4X1D A;  3LSL A;  2Q9T A;  4YZZ A;  4F22 A;  3TQL A;  1O7T A;  4F2O A;  5CI5 A;  3H4Z A;  1B1X A;  3VVF A;  4QFN A;  4RJZ A;  2QS4 A;  5I56 B;  1DPE A;  5I2K B;  3QUJ A;  1PDA A;  2REJ A;  2F8D A;  1XVY A;  1ZJL A;  5F1Q A;  3TFL A;  2NXO A;  4GFR A;  4IY6 A;  1IIT A;  3KGC A;  4OYV A;  1QUK A;  2RCB A;  1UQW A;  2RCA A;  2I4C A;  2DXY A;  3FXU A;  1BIY A;  3FAS A;  4XXU A;  4PQJ A;  1QUJ A;  5ISU A;  3LSF B;  2F7A A;  5AE4 A;  1ZBM A;  3LBS A;  4O3C A;  1O63 A;  3IJO B;  2M8C A;  4C1T A;  5FHM A;  4LUB A;  3H7M A;  3VXB A;  3I3V A;  3V8X B;  4IGT A;  4OTE A;  1OLA A;  3L6G A;  5DVF A;  2ZNS A;  4F1Y A;  4X1B A;  3G3F A;  5H8F B;  3PPN A;  5I57 A;  1M5C A;  3LSX A;  2DWA A;  1MDP 1;  4LQ2 A;  4YMA A;  1LAX A;  4IO6 A;  3UGW A;  4DE8 A;  5M2V A;  4H8J A;  1MRP A;  3E13 X;  4XKN A;  3MW0 A;  1D9V A;  5KDT A;  2XHD A;  1FTL A;  3OSQ A;  1H44 A;  3H3G A;  2F7B A;  4G77 A;  1M5E A;  4DZ1 A;  1LFG A;  1LAG E;  4F3S A;  1Z7N E;  2UVH A;  4OEV A;  4ZEC A;  2FA7 A;  2VP1 A;  4OEU A;  1PEB A;  4H65 A;  3IOU A;  4ZDM A;  3VV5 A;  3PPQ A;  4KYE A;  4F3B A;  1M5D A;  4TQU Q;  1FTO A;  1YAE A;  2O51 A;  4LAT A;  1IZ1 A;  4IB2 A;  1ZTY A;  1N3W A;  3WAF A;  3FVN A;  4MLV A;  1I6A A;  4FIM A;  1Y1Z A;  3TTM A;  5JK4 A;  1PB7 A;  5CC2 A;  3KJ7 A;  3TUS A;  3SES A;  3T9X B;  1BLF A;  1H43 A;  3K0V A;  3FJM A;  4WXJ A;  3IR1 A;  2DYX A;  3R26 A;  4GQO A;  5H8Q A;  4N07 A;  1T0K A;  3Q29 A;  4I9D A;  1BP5 A;  3IK6 B;  2F7C A;  3IB1 A;  2BJJ X;  2GH9 A;  4FAT A;  4AB5 A;  3SEV A;  3MZB A;  3OEN A;  2QS1 A;  3C33 A;  2O84 X;  2YLN A;  3O6H A;  1M5F A;  3BKI B;  3HHG A;  3O9P A;  5H8S A;  3A09 A;  3T22 A;  1MM6 A;  3T93 B;  4KFQ A;  3S9L C;  2XXR A;  3HN0 A;  1YTV A;  1B3G A;  2DVC A;  3U93 A;  2I0B A;  5KCJ B;  3RY3 A;  2V3U A;  3M3F A;  4PFW A;  4F18 A;  1US4 A;  4QF9 A;  2XX9 A;  1OLC A;  1IQ7 A;  2F35 A;  4PFY A;  2FNC A;  1MPD A;  2X7P A;  1N7W A;  1B5I A;  3K4U A;  1Q35 A;  2H99 A;  4G68 C;  1MY4 A;  3G3G A;  2DQV A;  4YIC A;  1B51 A;  2PT1 A;  3K6W A;  1MXX A;  2DWI A;  4K3F A;  4H0W A;  3RUM A;  3CRB A;  3E9X A;  2Y7P A;  3PUV E;  1MQG A;  2AL5 A;  4XKR A;  2XD3 A;  1B3E A;  3EPE A;  1HSL A;  3MWB A;  3GLB A;  4QFO A;  1ELJ A;  1D4N A;  4QSC A;  3PUW E;  4HTG A;  4UAC A;  1B3H A;  1UTB A;  2Q88 A;  2Y7K A;  3PPP A;  4X48 A;  1TXF A;  3RLF E;  3IJX B;  1VR5 A;  2UVG A;  3KEI A;  4RA1 A;  1EU8 A;  2XXI A;  4AB6 A;  3K6U A;  3R6U A;  3IB0 A;  4IO2 A;  3TOD A;  3V83 A;  5DVI A;  4GXS B;  4GRK A;  4EXK A;  2VGQ A;  4LZ5 A;  3N26 A;  5FHN A;  3AXF A;  5B7D A;  3I5O A;  5JEI A;  3SER A;  1JQF A;  4H1X A;  1JW5 A;  1IXH A;  3SKP A;  2AIX A;  3CG3 A;  4R2B A;  2V93 A;  1H45 A;  4OVJ A;  2V3T A;  4JB7 A;  3ECR A;  3KOT A;  2G29 A;  4RK9 A;  3M3L A;  4YB7 A;  3FVK A;  1MQH A;  3C32 A;  4R72 A;  4ZEF A;  1H3D A;  3OO6 A;  4MFI A;  4R73 A;  4YAH X;  4KD5 A;  4OFO A;  5I2N B;  3T66 A;  5L8D A;  4AQ4 A;  3BBR A;  2GHB A;  2D3I A;  3DP8 A;  3IOV A;  3PPO A;  4G68 A;  1BTJ A;  1NH7 A;  2HEU A;  3EHT A;  3KZG A;  1ANF A;  4PFT A;  4ZEB A;  5H8N A;  4NE4 A;  1POY 1;  4FJP A;  3K1M A;  1WVJ A;  2QRY A;  3G7W A;  5H8H A;  1QUL A;  4GVO A;  3B7D A;  4ELP A;  2X26 A;  4N13 A;  1I6Q A;  4QSD A;  4KYS A;  3VLV A;  4F2Q A;  3RGY A;  3MVZ A;  1NL5 A;  3O28 A;  5LOM A;  3IO4 A;  3IL1 B;  5FHO A;  1CB6 A;  4UA8 A;  1P1U A;  3I6V A;  1DTZ A;  2PX1 A;  1R1N A;  1B5J A;  3CR9 A;  3TTN A;  3VFJ A;  1FCK A;  4N6P A;  5I58 A;  2NOO A;  3G3J A;  4FEB A;  3PU5 A;  3N5L A;  5DEX A;  3TDJ A;  5DYH A;  5KDT B;  1AOV A;  3C35 A;  3CVG A;  1SYH A;  1D9Y A;  2UYF A;  1OVB A;  4EF1 A;  3SDF A;  3BFU A;  5AA2 A;  4YB5 A;  2O7I A;  1FW0 A;  1Y4C A;  3K02 A;  3TAJ A;  5AA4 A;  1A55 A;  3GBB A;  2P0S A;  4GL0 A;  4ELR A;  5FTI A;  1FQB A;  5AA3 A;  3VXC A;  3RTW B;  4RY1 A;  1Y3P A;  5BUU A;  1VSO A;  4GD5 A;  5CBS A;  5CRY A;  2ABH A;  2QS2 A;  3OO7 A;  4L17 A;  2IA4 A;  1OMP A;  1DTG A;  3F11 A;  4IO4 A;  3FAT A;  3M3K A;  1JNF A;  3PGF A;  1N3X A;  1A8E A;  2NWJ A;  1MXY A;  2Y7I A;  3T9U A;  1N84 A;  3OOA A;  4XKP A;  4F29 A;  5CM6 A;  2QMW A;  1FQC A;  2XXH A;  3UIF A;  2OBG A;  3USD A;  1H76 A;  1NNK A;  3E3K A;  1MXZ A;  1Q1K A;  3GBA A;  2VD3 A;  1TWY A;  5HM4 B;  1A7L A;  5L9S A;  4P0I A;  4EF2 A;  4OMB A;  1II5 A;  4MBP A;  4NF5 A;  4OET A;  3KN3 A;  4TLL B;  4DXU A;  3ILU B;  3MQ9 A;  2F36 A;  1S50 A;  1WOD A;  2I3W A;  2HZL A;  4OZ9 A;  3LUY A;  4JDF A;  1TFD A;  2PBW A;  1MXW A;  4DCY A;  3TTL A;  1DPP A;  1US5 A;  4I1D A;  2WKY A;  4ELQ A;  4NED A;  4F3P A;  4PFU A;  2B3F A;  1LLS A;  4YKI A;  3CSG A;  2Y7R A;  2PYY A;  1JW4 A;  1B46 A;  3CFL A;  4LA9 A;  1QUI A;  1JEU A;  1SQY A;  3T9V A;  3MP6 A;  3OEM A;  3P7I A;  1URD A;  1AL3 A;  4LON B;  4Z7E A;  4ESW A;  2F78 A;  1IEJ A;  4M4G A;  2VHA A;  4DDD A;  3C36 A;  4KI0 E;  2OCU A;  3OMB A;  2Z8F A;  1QKA A;  1UIU A;  3W9V A;  5ELV A;  1IIW A;  4BDR A;  2PT2 A;  4F19 A;  3KJT A;  3H6T A;  3KN8 A;  1GVC A;  1GTK A;  5L9M A;  2HQ0 A;  4QRZ A;  1ZU0 A;  1L5T A;  5CMM A;  1UTB B;  3O66 A;  3D4C A;  4R9F A;  3VDF A;  4H5G A;  1B7U A;  1MG1 A;  1URG A;  1R9L A;  1Z7M E;  5TPA A;  3T96 B;  3B6W A;  3VVD A;  3KG2 A;  2ZYK A;  3TCF A;  1ZIU A;  3MBP A;  4FE8 A;  1HSJ A;  1SI0 A;  5FTH A;  3UN6 A;  4NWD A;  2H9B A;  3O6G A;  4EDP A;  1N7X A;  3N94 A;  2X7Q A;  4C0R A;  3EHS A;  4ZE9 A;  4GLI A;  5I56 A;  2F34 A;  2FYI A;  4YKJ A;  3C34 A;  3PMV A;  3RPW A;  1KWH A;  1LBC A;  1MS7 A;  1OQH A;  4EQ7 A;  3SET A;  3H06 B;  3MZ1 A;  3TYH A;  2I4B A;  3V5A A;  3GZG A;  3O97 A;  4JSD A;  1N0T A;  1GV8 A;  2P1S A;  4I8C A;  3W9W A;  1LGB C;  1B7H A;  3O29 A;  5CMB A;  1GGG A;  5EHS A;  1B32 A;  4ONY A;  1P1Q A;  2RC7 A;  2V25 A;  3KSJ A;  2HAV A;  3G3H A;  5CMK A;  2HZK A;  3HST A;  2I6E A;  3BFT A;  4P11 A;  2O1L A;  4THI A;  4NF4 A;  5H8N B;  3H6V A;  3K6V A;  5H8F A;  1JET A;  2RKM A;  1MDQ A;  4YKK A;  2UYE A;  1FQA A;  3E4R A;  3IB2 A;  2A5T A;  2Z23 A;  4NF8 B;  1B1H A;  3UA8 A;  3ZSF A;  4H5F A;  3OEK A;  5H8H B;  2HFB A;  3TZA A;  3FXQ A;  2D21 A;  4H67 A;  1B58 A;  4KCC A;  3H03 A;  3UP9 A;  1SYI A;  2IEE A;  3D4G A;  2O68 A;  2XXX A;  1UTH B;  4OER A;  1LCT A;  1PBP A;  2QPQ A;  3L6H A;  2H4I A;  2UVI A;  2QS3 A;  1JEV A;  2YPN A;  2AYS A;  2XXP A;  3IOW A;  3PUY E;  1USY H;  3PMX A;  3EF7 A;  5JTY B;  1Y4T A;  2O6A A;  1PB8 A;  3FVG A;  4R6K A;  3ODB A;  3V89 B;  3Q25 A;  1B9J A;  2OZZ A;  2O69 A;  5I58 B;  3C9H A;  4G2Z A;  1LB9 A;  2PMS A;  2W7Y A;  1B52 A;  1B4H A;  5DEX B;  5AA2 D;  3DP4 A;  3T9H B;  3FV1 A;  1BKA A;  2ZNT A;  2QJE A;  2E1S A;  2DOJ A;  1D3K A;  1SW1 A;  4XKQ A;  1LB8 A;  2UVJ A;  5TP9 A;  3OEL A;  4R6Y A;  2H25 A;  3M8U A;  4P0G A;  1XHY A;  1IXG A;  2OWT A;  3HCQ A;  2QL3 A;  4R6H A;  5I84 A;  1VFE A;  1RYO A;  4G8N A;  4TLM B;  1VE4 A;  2F5X A;  3KN7 A;  1B40 A;  5A5X B;  1DMB A;  4OFJ A;  3TQW A;  1B6H A;  4Q30 B;  3MJN A;  4EUO A;  4ESX A;  1R6Z A;  1SVX B;  3N6T A;  3TTR A;  4Q5T A;  1YPN A;  4XIG Q;  3FVO A;  5DTB A;  3QUF A;  2DXR A;  4MH5 A;  1AIV A;  1UIV A;  1SD3 A;  1ZKB A;  2Y84 A;  4WED A;  5KZT A;  1RYX A;  4R2F A;  5B70 A;  4GWO A;  1P1O A;  4PET A;  5KCJ A;  1ZLQ A;  2R6G E;  3VLW A;  3FXR A;  2HCA A;  2R9J A;  1MH4 A;  4RYA A;  4QSE A;  3FJ7 A;  2AL4 A;  1MM7 A;  5K2X A;  5F7V A;  1JVX A;  4EQB A;  3LC8 A;  1I6B A;  4H8I A;  2I3V A;  2PVU A;  1YCJ A;  1N76 A;  3HPI A;  4KQP A;  4EQ9 A;  3CIJ A;  3FJG A;  3KFM A;  2DP8 A;  1A40 A;  1AMF A;  3S2V A;  2I48 A;  1XOC A;  5I57 B;  1R9Q A;  1B7Z A;  3C31 A;  1EZP A;  3OD7 A;  4YKP A;  5L9O A;  4O3B A;  1FQD A;  4NTL A;  4YU0 A;  4IY5 A;  2REG A;  4ELO A;  4OES A;  1B5H A;  2F97 A;  1MXV A;  3TTK A;  1AH5 A;  2Q8J A;  2DE3 A;  3FV2 A;  2ZMB A;  1A8F A;  3EHU A;  1LBB A;  3KSX A;  5ITO A;  2QSX A;  3MP1 A;  4GL8 A;  3R7X A;  4MLQ A;  1MY3 A;  1NH8 A;  3S9E A;  3KBR A;  1MPB A;  4KYD A;  2OLB A;  3K1N A;  4F1U A;  4NF6 A;  3K1P A;  3MC2 A;  3TCH A;  2ZYM A;  1XT8 A;  4BDM A;  4FAJ A;  1B3L A;  2OJT A;  3QYT A;  5IAI A;  3HHF A;  3QAX A;  2ZYN A;  5HPQ A;  4IO5 A;  1B05 A;  3ZKL A;  1QKB A;  5TPA B;  5ITP A;  2Z8E A;  5I59 A;  1LFH A;  1POT A;  1OIB A;  5I2N A;  4R74 A;  3TKD A;  3FD3 A;  5H8Q B;  4U2R A;  2GRV A;  3A3U A;  4ND9 A;  4G8M A;  1TT1 A;  2DWH A;  4LZ7 A;  1LAF E;  2RC9 A;  3JV9 A;  3PUZ E;  4FED A;  4YB6 A;  3PD9 A;  1XC1 A;  4GF8 A;  2ONR A;  3DP6 A;  5CBR A;  5HBC A;  3S4U A;  1M5B A;  4QFK A;  1NFT A;  3IAZ A;  3TCG A;  2XXU A;  3CFZ A;  4BDN A;  2GFE A;  4ZZE A;  3MPK A;  3U94 A;  1B0L A;  2ONS A;  2F6P A;  4U22 A;  3DLN A;  2Q89 A;  2GHA A;  1P1N A;  3QXM A;  3LSW A;  3TEP A;  4M1V A;  2R71 A;  4NF4 B;  4IO3 A;  5TU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...