4WXJA

Drosophila muscle gluriib complex with glutamate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
260
structure length
252
Chain Sequence
IRYTVATRVGKPYFSWREEPYEGNERFEGYAVDLIYMLAQECKFDFNFEPVRDNKYGSYDANTDEWDGIIRQLIDNNAQIGICDLTITQARRSVVDFTVPFMQLGISILSYKGTDIGSLHDLVDQNKVQFGTIRGGATSVYFSESNDTDNRMAWNKMLSFKPDAFTKNNEEGVDRVKLSKGTYAFLMETTNLQYYVQRNCELTQIGESFGEKHYGIAVPLNADFRSNLSVGILRLSERGELFKLRNKWFNSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate receptor IIB,Glutamate receptor IIB
publication title Functional reconstitution of Drosophila melanogaster NMJ glutamate receptors.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 82
structure length 252
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4wxjA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4wxjA02
4R75A 1Z7NE 4XKNA 4OHNA 3CFLA 4RXLA 2CZLA 2XHDA 4F19A 3O6HA 2HZLA 3G3KA 5CMMA 5H8NB 2ALUA 5FHOA 1B05A 4F3GA 4PFWA 4EQBA 1NH8A 5B7DA 2AL5A 1SQYA 3B6WA 4NEDA 3FV2A 3M3KA 5I57B 2D21A 3SEYA 3OO9A 3PMXA 2UVHA 3DM0A 1JNFA 1RYOA 4LZ7A 4LZ8A 2ZNUA 4IY5A 4NF4B 2RINA 1MQDA 3UIFA 4KHZE 3HV1A 4G68C 5LOMA 3HHFA 1QJMA 3MVZA 2V3UA 1VR5A 3TTLA 3W15C 4PQJA 1AOVA 2I6EA 2ANJA 4BDRA 1B0LA 1Y3QA 1Y3NA 4EF2A 2UYEA 1LAHE 5CBRA 1NNFA 3VVEA 1HSJA 4NF6A 3KJTA 4JWOA 4G4PA 2G29A 4DXCA 4F3BA 2PYYA 3MW0A 3R7XA 2Q9TA 3DELB 3TTKA 4OTEA 4U4SA 2XXQA 1N7WA 3IB2A 4OMBA 3C34A 1HSLA 1QUJA 1B52A 3TPAA 2PX1A 3IL1B 3TDJA 5H8SA 3EHSA 1VSOA 4LQ2A 1Y4TA 2THIA 1OQGA 3S9LC 3EF7A 1OVTA 5CI5A 3B6QA 1H3DA 4H8IA 3L6HA 3MBPA 4FIMA 4R9FA 3VE1B 4F2OA 3OO8A 1D9YA 3H4ZA 3O97A 4UA8A 1MY0A 3QXMA 1LAGE 3OD7A 1LSTA 3K6UA 1QW0A 1SBPA 4KD5A 3C36A 1A8FA 3SEWA 3FXQA 4KI0E 2ZYNA 5AA4B 3H06B 2GHBA 3OSQA 4WXJA 3H6TA 2PBWA 3GBAA 1SW2A 2Y7RA 1Y3PA 3LSXA 3PPRA 3K4UA 3K6WA 4QFNA 1IEJA 3U8QA 4OFLA 1N3WA 5TP9B 3RTFB 4NF8B 2ZXTA 3PMVA 3K6XA 2VHAA 1A40A 4R6HA 2VOZA 4ZS9A 5FHNA 5CMCA 1LBBA 5DYHA 1JQFA 3JZJA 3OENA 3V89B 3PUZE 2REJA 1B7HA 3L6GA 5AA2D 3O2AA 1MPBA 1JW5A 4JSDA 3CG3A 1H45A 3VXCA 3E9XA 4JDFA 3N6TA 4IGTA 3RNNA 3FATA 2XXUA 1JEVA 5KDTB 2O1MA 3PPPA 4KR5A 1AH5A 5AA2B 1XC1A 2OLBA 3SERA 1R1NA 3FV1A 2I0CA 2I49A 1IXHA 2OWSA 3C35A 3QAXA 4GXSB 1FW0A 1N3XA 3UP9A 3OXNA 3IOWA 4GIZA 2RF1A 3BFTA 3PUYE 3EQ1A 3UGWA 2QPQA 3VDFA 1MRPA 5TPAA 5CC2A 2Q2CA 2HEUA 5ITPA 4P0IA 4GFRA 3CR9A 5H8QB 1ZMGA 1USYH 3KSXA 3U92A 4BDMA 1PBPA 5I2KA 3CRBA 3TZAA 2B65A 3SEXA 4KQPA 3Q25A 2YLNA 5DEXB 4KPTA 1UQWA 4G8HA 4DCYA 5I56A 3K1NA 3QUFA 1Y20A 2UYFA 2V84A 1OMPA 4C1UA 4PETA 2F6PA 1OIBA 1MPCA 4ZECA 2A5TA 4H6DA 3R6UA 2QSXA 2I0BA 4QFPA 4R6YA 5DVIA 4XIGQ 3C9HA 3FXRA 4I8CA 4X1BA 3ZS6A 2DWAA 1M5BA 2QS3A 1VFDA 2Y7KA 1N84A 4M4GA 3N94A 4MLQA 3MP8A 1D9VA 4QSDA 5A5XA 3E13X 1M5CA 1FCKA 4ESXA 1ANFA 5F7VA 4FAJA 4GQOA 3MPLA 1QULA 1B6HA 1MS7A 4EF1A 1H76A 4POWA 4L17A 2Y7PA 4DIGA 4XKRA 2PT2A 2P2AA 4G68A 2VGQA 2UVIA 1UTBA 1A54A 3G3IA 3I3VA 2OK2A 2Z8DA 2DS9A 4R6KA 3ONMA 1JETA 2ZNTA 1Y1ZA 3ODBA 1QUKA 1B32A 5ICTA 4H5GA 2P1SA 4F31B 2NWJA 3LUYA 4O3BA 4U1ZA 3I6VA 3MJNA 4Q30B 3RY3A 1B3FA 3LBSA 1B7UA 2H4IA 4F1UA 4MF3A 3SEUA 3MC2A 1EZOA 1URSA 1KWHA 5ITOA 5CRYA 2NUVA 4DXBA 1Y9UA 4Q5TA 4X48A 4EXKA 2QS1A 2NOOA 2O1LA 3TTNA 3IOVA 4KYSA 4X1DA 5HM4B 2XXXA 3HSTA 2XD3A 2O51A 4ND9A 1XVYA 3E3KA 4ELRA 4OYVA 5I2NA 1XVXA 3T22A 3VVFA 2PVUA 3A09A 1VFEA 1N7XA 4Z0IA 1QKAA 1I6AA 3PUWE 1MXYA 4MLVA 1WVJA 1MY2A 5JK4A 4O3CA 1PBQA 3HCQA 2I48A 1TXFA 2DWHA 4FEDA 4OWDA 2HZKA 4F29A 1A55A 4BDQA 1R9QA 3SETA 1MXVA 5JTYA 3UA8A 4DLDA 3TMGA 3MP1A 2W7YA 1DSNA 4ELPA 3T9XB 2Z22A 2XXTA 1IXGA 4R73A 1LCTA 1NKXA 2AYSA 4FECA 5EHMA 1B58A 2DE3A 4BDLA 4K3FA 4WKMA 5I59B 4NF6B 1RKMA 4GWOA 3VXBA 2HCAA 3T9HB 1R9LA 4TLMB 5H8HA 4RNSA 1MG1A 5BUUA 3KSJA 3IORA 4QFKA 3MWBA 5JEIA 3OSRA 4IO4A 3N5LA 1GV8A 4EUOA 1EZ9A 4HS7A 4F22A 3KFMA 5EHSA 4IO3A 4QFLA 4LVQA 1IITA 4C0RA 1MY3A 2I3VA 2YJPA 1B46A 3V83A 4JWYA 3USDA 2D5WA 1CB6A 3LSLA 1SW1A 1N76A 3KN7A 4XXUA 4GL0A 1USYE 2OBGA 1MQGA 5DVJA 1FQFA 4DCXA 3FJMA 3PPQA 1QVSA 3KBRA 2DYXA 3G3GA 3IO6A 4ZZEA 3SESA 1EZPA 4HCWA 2OZZA 4QSCA 1SYHA 3LSWA 1FQEA 1FQAA 4N13A 4NWCA 4GD5A 3QSLA 3KN8A 4P11A 2I58A 2X7PA 4RPNA 4U1OA 4G8MA 1LCFA 4YKIA 5F1QA 4R9GA 2QS4A 3KG2A 1BIYA 1LAFE 3PUXE 5ICQA 3DLNA 1OQHA 4H0WA 4NF5A 2KLFA 2GRVA 4I1DA 4MH5A 3KGCA 4GOTA 2XXIA 4DDDA 4F18A 2H5YA 4U22A 4ZEDA 3VVDA 1Q35A 2XXVA 2E0SA 3OMBA 1P1WA 2Q89A 2HQ0A 1NH7A 4U23A 3MZ9A 3GXAA 3C4MA 3FVGA 3JV9A 3HO7A 3RGYA 2AL4A 3TCFA 3IOUA 3TFLA 1BKAA 2F36A 2O69A 3CG1A 1OLAA 3A3CA 4WEDA 3VFJA 3U93A 3K2DA 2XD2A 4AB5A 5HBCA 1PB8A 3ZKLA 2V3QA 1LBCA 2HXWA 2H25A 3TUSA 3MVYA 5I58B 1O64A 1CE2A 2O68A 3RN8A 4IGRA 1XOCA 1J1NA 3Q26A 1IQ7A 3FVNA 5DTBA 1FTLA 3N26A 3ZKKA 4C1TA 3BFUA 1D3KA 3CIJA 4H65A 1DPPA 5H8FA 3UN6A 4U4XA 2ONSA 3T9VA 5I2KB 4KCDA 1TFAA 3U1OA 2V3TA 5TP9A 4ONYA 1S7YA 2F8DA 5IAIA 4PP0A 1BTJA 4HW8A 4GL8A 1FTJA 4JXIA 3EPEA 3HN0A 1MPDA 1FQDA 3C33A 3FVKA 2ZNSA 3Q29A 2A5TB 1JVYA 1Y4CA 2RC9A 1BLFA 2D3IA 3FASA 4YKKA 3H6UA 3EN3A 5K2XA 1IXCA 5KCJA 1RYXA 3ZSFA 1IZ1A 3SEVA 3G3JA 3N6UA 5KDTA 3K00A 3TODA 4YKJA 5A5XB 4F39A 1B5JA 3KOTA 2G93A 3TELA 2ZMBA 4RPOA 3PGFA 2REGA 2V25A 2FA7A 4GRKA 1QUIA 4OEUA 4G68B 3OELA 2ABHA 4DZ1A 1UTBB 1ZKBA 2DOJA 1A8EA 2XXPA 3MZBA 1Q1KA 4OETA 3VV5A 3K02A 3K0VA 1P1UA 3GZGA 1ZU0A 5BWJA 4F3SA 3T9UA 2HAVA 2GFEA 2F7CA 3G7WA 2F78A 4OFJA 3CVGA 2IA4A 4G8NA 2B3FA 3O29A 4EQ9A 5DEXA 2GH9A 3QK6A 4YU0A 3UK4A 3BKIB 3MPKA 3SDFA 1NMUA 2F34A 3V5AA 4LUBA 1SW4A 5DVFA 2DWJA 4XKQA 3GLBA 4JSOA 3RUMA 2O7IA 2OWTA 2DXRA 1MXWA 5TU0A 3FVOA 3FIRA 1AL3A 1URDA 3HHGA 4MFIA 4I62A 2Q8JA 1LFIA 4R72A 4GF8A 4ZEKA 3VLVA 1P1NA 1MH3A 2HAUA 1AIVA 4IB2A 2ONKE 2DE2A 3K6VA 4BLAA 4FE8A 1MM7A 3IB1A 5I2NB 3OEKA 2R9JA 1MXUA 1GTKA 5B70A 3W9VA 2VP1A 4KFQA 1S50A 4YB5A 1PC3A 2XX8A 4Q8RA 2XXYA 4GVOA 3KN3A 4OZ9A 4DXUA 2Z8FA 2I4BA 3B7DA 2NXOA 3IX1A 4LATA 4LP2B 1I6QA 2R6GE 1B3LA 3O9PA 4O3AA 4YB7A 5EYFA 1B2HA 1AMFA 3S2VA 5AA3A 3MUQA 3PUVE 4OERA 2F6GA 1H43A 1SI1A 1WDNA 2ONRA 2QMWA 1SI0A 4HCYA 4JWXA 2F5XA 4M1VA 2DXYA 1JW4A 4XKPA 4PFYA 1S9TA 1R6ZA 1P99A 4OEVA 1JEUA 3VLUA 2F7BA 2FNCA 4N6PA 4RA1A 1UTHA 2XXHA 3E4RA 4G2ZA 3PD9A 4OQOA 2DE4A 3IOTA 4G77A 4YAHX 3I5OA 1B0HA 1UIVA 4JB7A 2WKYA 2ZYOA 3RLFE 2Q2AA 2BJJX 4NMYA 3PD8A 4IO5A 4JBZA 1O7TA 3GBBA 2ZYMA 3P7IA 1ELJA 1B4HA 2X26A 4YKPA 5FTIA 1L5TA 1MY4A 5HPQA 3KOSA 4FJPA 2O84X 1WODA 3MZ1A 1XS5A 4H67A 1MM6A 2NVUB 1UIUA 3W9WA 1MDP1 3F11A 3TTMA 1YAEA 3THIA 2DWIA 1HSEA 4OFOA 1DOTA 4ZEBA 3IJOB 3V8XB 4R2BA 2QMXA 2RC7A 2QJEA 3T66A 4IO2A 4N07A 3OO7A 2RKMA 3PPOA 2ESNA 4ECFA 3U94A 3EHUA 2LAOA 1LB9A 3TCHA 1N0TA 3VLWA 4F2QA 3B6TA 3RT6B 2XX7A 1M5DA 5FTHA 3IB0A 4OENA 2M8CA 2Q88A 1ZJLA 5L8DA 2FYIA 1OLCA 1PEBA 3O6GA 1ATGA 3MVWA 5H8NA 2Z8EA 4QF9A 1FTKA 3WAEA 2YPNA 4NF5B 1NNPA 1B3EA 2OJTA 1B1HA 5I59A 5I57A 3S9NC 3H6VA 1TT1A 3S9EA 1EH3A 3H7MA 4RK9A 1EU8A 1MY1A 2H9BA 4OVJA 1LGBC 4NF4A 2F97A 3K01A 4AQ4A 3KEIA 3MQ9A 4QSEA 1YTVA 2IEEA 1PB7A 3U72A 4LONB 3O28A 1Y1MA 1B9JA 5FHMA 5IKBA 1P1OA 3JYRA 3IJXB 2PT1A 3DP4A 4EXLA 3A3UA 3T96B 1MXXA 3LSFB 5L9MA 1XT8A 3R26A 3M3FA 1QKBA 1LFGA 4R74A 3H6WA 4E0XA 3O66A 3IAZA 1US5A 2HFBA 4BDOA 1B3GA 4YMBA 3SKPA 4THIA 4ELOA 1MQJA 4H1XA 2OCUA 5ELVA 1LLSA 4EQ7A 2CMOA 2E1SA 1POY1 1T0KA 2GHAA 4ELQA 3TQWA 3FZVA 4KYDA 1FTOA 1M5FA 1FQCA 4NWDA 1Z7ME 5H8FB 1ZBMA 4IO7A 1B7ZA 1DMBA 2I4CA 1DTZA 5CMBA 1VE4A 4ZDMA 3FXUA 2XXRA 4LZ5A 1YPNA 1SW5A 4FATA 2F35A 5TPAB 4IO6A 1FQBA 4AB6A 1MQHA 3Q27A 3CSGA 4KYEA 1OVBA 1SVXB 3IR1A 1US4A 2RCAA 5AA4A 4P0GA 1TFDA 2XXWA 3EHTA 3FGSA 3S9MC 2O6AA 1MXZA 4X9TA 5KCJB 1ZIUA 1PB9A 3TCGA 2ZYKA 4ZE9A 3QUJA 1N04A 1H44A 1IUDA 4H5FA 4NF8A 1P1QA 1SD3A 1YCJA 1O63A 5I56B 3M3LA 1LFHA 3S4UA 1LB8A 4QRZA 3TTRA 5L9SA 2DQVA 1FTMA 2F7AA 2A5SA 4Z7EA 1LAXA 1A7LA 3T93B 3QIMA 4ISUA 4QFOA 5L9OA 3RQTA 4F1YA 4E0WA 5I58A 2Y7WA 3CFXA 1B4ZA 4BDNA 4NE4A 1DTGA 3DP6A 4EDPA 5AA2A 4FEBA 4WEPA 3RT8A 1JVXA 2AIXA 2P0SA 1B5HA 3CSBA 1XHYA 1GVCA 3KZGA 4ZEFA 2QL3A 1DPEA 3D4CA 1F9BA 3FJGA 1JW1A 4PE5B 1D4NA 3MVXA 1IIWA 4PFTA 1PDAA 2QS2A 3CI8A 4F3PA 1MQIA 2H99A 4I9DA 3O6IA 3LC8A 5AA1A 1IXIA 5H8QA 3K1MA 4YB6A 3ILUB 2O7UA 3QYTA 5CMKA 1II5A 1MDQA 3WAFA 2QRYA 5AE4A 1NNKA 4RY1A 1SYIA 2DP8A 4FORA 2H98A 3TYHA 2DVZA 3G3FA 3Q28A 4MBPA 3D4GA 2DVCA 3TAJA 2R71A 3PMWA 3UORA 5K2YA 1B1XA 1B51A 4U21A 4ZZAA 5DT6A 3DP8A 4IY6A 1GR2A 1MH4A 4OESA 5CBSA 4ZE8A 3RTWB 3G3HA 1I69A 1SDXA 3FJ7A 2Z23A 3CFZA 4OXVA 5ISUA 3KJ7A 3PPNA 4YICA 2Y84A 4RYAA 2UXAA 3H3GA 4U2RA 1M5EA 2RC8A 1URGA 3TQLA 1I6BA 3HPIA 4LQ5A 4QHQA 3ILTB 4RJZA 2XX9A 3BBRA 1B40A 4UACA 1UTHB 5CM6A 4YMAA 4DE8A 4LA9A 3IO4A 4HTGA 3PU5A 3MAMA 2UVGA 2V93A 1NFTA 2VD2A 3K1PA 2DSFA 1B5IA 3M8UA 1NL5A 2VD3A 1ZTYA 5JTYB 3TKDA 4TQUQ 2UVJA 3IK6B 1BP5A 3OEMA 3PV0E 4RK2A 5M2VA 4TLLB 3OO6A 4H8JA 4YZZA 3LR1A 3RPWA 1NNTA 5J1DA 4F1VA 4R2FA 4Q0CA 2PMSA 1A99A 4XTCQ 3FUZA 4TOZA 3H03A 5H8HB 4KCCA 2Y7IA 3OOAA 4ESWA 3AXFA 5KZTA 2I3WA 3ECRA 1ZLQA 1TWYA 1POTA 3TEPA 2X7QA 3MP6A 3FD3A 4NTLA 3C31A 2RCBA 1GGGA 4PFUA 1B3HA 4GLIA 4POXA 4ZEIA 3C32A 5I84A 4GXAA 2B3BA
chains in the Genus database with same CATH superfamily
1NV7A 4P56A 4R75A 1Z7NE 4XKNA 4PDDA 4OHNA 3CFLA 4RXLA 2CZLA 2XHDA 2BJIA 4PCDA 4F19A 3O6HA 2HZLA 3G3KA 3BIGA 5CMMA 1XI6A 5H8NB 2ALUA 5FHOA 1B05A 4F3GA 4PFWA 4EQBA 1SPIA 1NH8A 5B7DA 2AL5A 1SQYA 3B6WA 4NEDA 4QXDA 3FV2A 3M3KA 5I7IA 5I57B 2D21A 3SEYA 3OO9A 3PMXA 2UVHA 2DDKA 3DM0A 1JNFA 1RYOA 4LZ7A 4LZ8A 2ZNUA 4IY5A 4NF4B 2RINA 2PFZA 1MQDA 3UIFA 4KHZE 3HV1A 4G68C 3T0JA 5ET7A 5LOMA 3HHFA 1QJMA 3MVZA 2V3UA 1DK4A 1VR5A 3TTLA 1LBVA 3W15C 4PQJA 1AOVA 2I6EA 2ANJA 4BDRA 2V4CA 1B0LA 1Y3QA 1Y3NA 4EF2A 2UYEA 1LAHE 5CBRA 2GQ1A 1NNFA 3VVEA 1HSJA 4NF6A 3MYUA 3KJTA 4JWOA 1INPA 4G4PA 2G29A 4DXCA 4F3BA 2PYYA 1LBWA 3MW0A 3R7XA 2Q9TA 3DELB 3TTKA 4OTEA 4U4SA 2XXQA 1N7WA 3IB2A 4OMBA 3C34A 1HSLA 1QUJA 1B52A 3TPAA 2PX1A 3IL1B 3TDJA 5H8SA 3EHSA 1VSOA 4GBVA 4LQ2A 1Y4TA 2THIA 1OQGA 3S9LC 3EF7A 1OVTA 1FTAA 4PBHA 3KBZA 3BIHA 5CI5A 3B6QA 1H3DA 4H8IA 3L6HA 3MBPA 4FIMA 4R9FA 3VE1B 4F2OA 3OO8A 1D9YA 3H4ZA 4AS4A 3O97A 4UA8A 1MY0A 1AWBA 3QXMA 1LAGE 3OD7A 1LSTA 3K6UA 1QW0A 1SBPA 4KD5A 3C36A 2XXKA 1A8FA 2OWZA 4JVCA 3SEWA 3FXQA 4KI0E 2FIEA 2ZYNA 5AA4B 3H06B 2GHBA 4PAKA 4P9KA 3OSQA 4WXJA 3H6TA 2PBWA 3GBAA 1SW2A 5I5PA 2Y7RA 1Y3PA 3LSXA 3PPRA 3K4UA 4QFNA 3K6WA 1IEJA 3U8QA 1NUZA 4OFLA 1N3WA 5TP9B 3RTFB 1FPFA 4NF8B 2ZXTA 1FJ6A 3PMVA 3K6XA 2VHAA 1A40A 4R6HA 2VOZA 1JP4A 4ZS9A 2XA5A 5FHNA 5CMCA 1LBBA 4I3EA 5DYHA 1JQFA 3JZJA 3OENA 3V89B 3ROJA 3PUZE 2REJA 1B7HA 3L6GA 1IMAA 2CEXA 5AA2D 3O2AA 1MPBA 1JW5A 1NV2A 4JSDA 3CG3A 1H45A 4PAFA 3VXCA 3E9XA 4JDFA 3N6TA 4GWUA 4IGTA 3RNNA 2Q8MA 3FATA 2XXUA 1JEVA 5KDTB 2O1MA 3PPPA 4KR5A 1AH5A 5AA2B 1XC1A 2OLBA 3SERA 1R1NA 3FV1A 2I0CA 2I49A 1IXHA 1LBXA 4MHFA 2OWSA 3C35A 3QAXA 4GXSB 1FW0A 1N3XA 3UP9A 3OXNA 1G0HA 3IOWA 4GIZA 4PFIA 2RF1A 3BFTA 3PUYE 3EQ1A 3UGWA 2QPQA 2F3BA 3VDFA 1MRPA 5TPAA 1YYZA 4PC9A 5CC2A 4NG7A 4XEQA 2Q2CA 2CZHA 2FVZA 2HEUA 5ITPA 2P3VA 4P0IA 2WYKA 4GFRA 2Y5LA 4DI4B 4GWZA 3CR9A 5H8QB 1ZMGA 5T3JA 1FBCA 1USYH 3KSXA 3U92A 4BDMA 1PBPA 5I2KA 3CRBA 3TZAA 2B65A 3SEXA 4MAGA 2WBBA 4KQPA 1DCUA 3Q25A 2YLNA 5DEXB 4KPTA 1UQWA 4G8HA 4DCYA 5I56A 3K1NA 2KQZA 3QUFA 3RYDA 1Y20A 2UYFA 3E79A 2V84A 1OMPA 4C1UA 4FBPA 4PETA 2F6PA 1OIBA 1MPCA 5IZ3B 4ZECA 2A5TA 4N15A 3RPLA 4H6DA 3R6UA 2QSXA 2I0BA 4QFPA 4R6YA 5DVIA 4XIGQ 3C9HA 1EYKA 3FXRA 4I8CA 4X1BA 3ZS6A 2DWAA 1M5BA 2QS3A 1VFDA 2Y7KA 1N84A 4M4GA 3N94A 4MLQA 3MP8A 2VPNA 1D9VA 4QSDA 5A5XA 4LN5A 3E13X 1M5CA 1FCKA 4ESXA 1VDWA 1ANFA 5F7VA 4FAJA 4GQOA 3MPLA 1QULA 1B6HA 1MS7A 4EF1A 1NV1A 1H76A 5IZZA 4POWA 4L17A 2Y7PA 1KZ8A 4DIGA 4XKRA 2PT2A 2P2AA 4G68A 2VGQA 2UVIA 1D9QA 1UTBA 1A54A 3G3IA 3I3VA 2OK2A 2Z8DA 2DS9A 4R6KA 3ONMA 1JETA 1IMEA 2ZNTA 1Y1ZA 4PBQA 3ODBA 1QUKA 1FPGA 4HE0A 4G61A 1B32A 5ICTA 4H5GA 2P1SA 2F3DA 4F31B 2NWJA 3LUYA 2CZIA 4GWSA 2QFLA 4O3BA 4U1ZA 1QGXA 2FHYA 3I6VA 4PAIA 3MJNA 4Q30B 3RY3A 1B3FA 3LBSA 1B7UA 2H4IA 4F1UA 4MF3A 3SEUA 3MC2A 1EZOA 1URSA 1KWHA 5ITOA 5CRYA 2NUVA 1FBEA 4DXBA 1Y9UA 4Q5TA 4X48A 4GX3A 4EXKA 2QS1A 2NOOA 2O1LA 3TTNA 3IOVA 4KYSA 4X1DA 4AS5A 2PFYA 2WYPA 5HM4B 3IFCA 2XXXA 3HSTA 2XD3A 2O51A 4ND9A 1XVYA 3E3KA 1RDZA 4ELRA 4OYVA 5I2NA 1XVXA 3T22A 5EYGA 3VVFA 2PVUA 3A09A 1VFEA 1N7XA 4Z0IA 1QKAA 1I6AA 3PUWE 1MXYA 3PTYA 4MLVA 1WVJA 2FBPA 1MY2A 5JK4A 4O3CA 1PBQA 3HCQA 2I48A 4XFEA 1EYIA 1TXFA 2DWHA 4FEDA 4OWDA 2HZKA 4F29A 1A55A 1FPBA 4BDQA 1R9QA 4KXPA 3SETA 1MXVA 5JTYA 3UA8A 4DLDA 3TMGA 3MP1A 1NI9A 2W7YA 1DSNA 4ELPA 4N8GA 3T9XB 2Z22A 2XXTA 1IXGA 4R73A 1LCTA 1NKXA 4I40A 2AYSA 4FECA 5EHMA 1B58A 2DE3A 4BDLA 4K3FA 4WKMA 5I59B 4NF6B 1RKMA 4GWOA 3VXBA 2HCAA 3T9HB 1R9LA 4TLMB 5H8HA 3U65A 4RNSA 1MG1A 5BUUA 3KSJA 3IORA 4QFKA 3MWBA 5JEIA 3OSRA 1DBZA 1CNQA 4P1EA 4IO4A 3N5LA 1GV8A 4EUOA 1EZ9A 4HS7A 4F22A 2PCRA 3KFMA 2FIXA 5EHSA 4IO3A 4QFLA 4LVQA 4N8YA 1IITA 1MY3A 2I3VA 2YJPA 4C0RA 1B46A 3V83A 4JWYA 3USDA 2D5WA 1CB6A 3LSLA 1SW1A 5EYHA 1N76A 3KN7A 4XXUA 5IGAA 2ZZXA 4GL0A 1USYE 3FXBA 2OBGA 4JVDA 3ISPA 4N91A 1MQGA 5DVJA 4H45A 1FQFA 4DCXA 4PGNA 3FJMA 3PPQA 1QVSA 3KBRA 1FBHA 2DYXA 3G3GA 3IO6A 3CHGA 4IR8A 4ZZEA 3SESA 4HE2A 4P47A 1EZPA 4HCWA 2OZZA 4QSCA 1SYHA 3LSWA 1FQEA 1FQAA 4N13A 4NWCA 1LEVA 4GD5A 3QSLA 3KC0A 3KN8A 4P11A 2I58A 2X7PA 4RPNA 2XWVA 3QMFA 4U1OA 4G8MA 1LCFA 4YKIA 4PFBA 5F1QA 4R9GA 2QS4A 3KG2A 1BIYA 1LAFE 3PUXE 5ICQA 3DLNA 4QBAA 4GBWA 1OQHA 1RDXA 4H0WA 5J16A 4NF5A 5EQAA 2KLFA 1NV4A 2GRVA 4GWYA 4I1DA 4MH5A 5FBPA 3KGCA 4GOTA 2XXIA 2CZKA 4GX4A 4DDDA 4F18A 4PF8A 2H5YA 4U22A 1FBGA 2HHMA 4ZEDA 3VVDA 1Q35A 2XXVA 2E0SA 3OMBA 1P1WA 2Q89A 2HQ0A 1NH7A 4U23A 3MZ9A 3GXAA 1IMFA 3C4MA 3FVGA 3JV9A 3HO7A 3RGYA 2AL4A 4O94A 3TCFA 3IOUA 3TFLA 5LTCA 1Q9DA 2VT5A 1BKAA 2F36A 1RDYA 2O69A 3CG1A 1OLAA 5IZ1A 3A3CA 4WEDA 3VFJA 3U93A 3K2DA 2XD2A 4AB5A 5HBCA 1PB8A 4O8MA 4GWWA 3ZKLA 2V3QA 1LBCA 2HXWA 2H25A 3TUSA 3MVYA 5I58B 1O64A 1CE2A 2O68A 3RN8A 4IGRA 1XOCA 1J1NA 3Q26A 1IQ7A 3FVNA 5DTBA 1FTLA 3N26A 5ET6A 3ZKKA 4C1TA 3BFUA 1D3KA 3CIJA 4H65A 1FRPA 1DPPA 5H8FA 1FBFA 3UN6A 4U4XA 2ONSA 3T9VA 5I2KB 4KCDA 1TFAA 3U1OA 2V3TA 5TP9A 4OVSA 4ONYA 1S7YA 2F8DA 5IAIA 4PP0A 1BTJA 4GL8A 1KA1A 4HW8A 4X04A 1FTJA 4P8BA 4JXIA 3EPEA 4P1LA 3HN0A 1MPDA 1FQDA 3C33A 3FVKA 2ZNSA 3Q29A 2A5TB 2HPGA 1JVYA 1Y4CA 2JJKA 2RC9A 1BLFA 2D3IA 3FASA 2WBDA 4O7IA 4YKKA 3H6UA 3EN3A 4PGPA 5K2XA 1IXCA 5KCJA 1RYXA 1FSAA 3ZSFA 1IZ1A 4X8RA 3SEVA 3G3JA 3N6UA 5KDTA 3K00A 3TODA 2VPOA 4YKJA 5A5XB 4F39A 1B5JA 3KOTA 2G93A 1NUXA 3TELA 2ZMBA 4RPOA 3PGFA 4N81A 2REGA 2V25A 2FA7A 4GRKA 1QUIA 4OEUA 4PE3A 1G0IA 4G68B 3OELA 2ABHA 2XWKA 4DZ1A 1UTBB 1ZKBA 2DOJA 1A8EA 2XXPA 3MZBA 1Q1KA 4OETA 3VV5A 3K02A 3K0VA 1P1UA 3GZGA 1ZU0A 5BWJA 4F3SA 3T9UA 2HAVA 2GFEA 4NAPA 2F7CA 4XF5A 3G7WA 2F78A 4OFJA 3CVGA 2IA4A 4G8NA 1K9ZA 2B3FA 3O29A 4EQ9A 4OA4A 5DEXA 2GH9A 3QK6A 4YU0A 3UK4A 3BKIB 3MPKA 3SDFA 1NMUA 2F34A 3V5AA 4LUBA 1SW4A 5DVFA 2DWJA 4XKQA 3GLBA 4JSOA 1FPLA 5IZ3A 3E78A 3RUMA 2O7IA 2OWTA 2DXRA 1MXWA 5TU0A 3FVOA 3FIRA 1AL3A 4OANA 1URDA 3HHGA 4MFIA 4I62A 2Q8JA 5F24A 1LFIA 4R72A 4GF8A 4ZEKA 3VLVA 1P1NA 1MH3A 2HAUA 1AIVA 4IB2A 2ONKE 2DE2A 3K6VA 4BLAA 4FE8A 1MM7A 3IB1A 5I2NB 3OEKA 2R9JA 1MXUA 1GTKA 5B70A 3W9VA 2VP1A 4KFQA 1S50A 4YB5A 1PC3A 2XX8A 2XXYA 4Q8RA 4GVOA 3KN3A 4PFRA 4OZ9A 2ZZVA 4DXUA 2Z8FA 2I4BA 3B7DA 2NXOA 3IX1A 4LATA 4LP2B 4I3YA 1I6QA 2R6GE 1B3LA 3O9PA 4O3AA 4YB7A 5EYFA 1B2HA 1AMFA 3S2VA 5AA3A 5DW8A 2KR0A 3MUQA 3PUVE 4OERA 2F6GA 1H43A 1SI1A 1WDNA 2ONRA 2QMWA 1SI0A 4HCYA 4JWXA 2F5XA 4M1VA 2DXYA 1JW4A 4XKPA 4PFYA 1S9TA 1R6ZA 1P99A 4OEVA 1JEUA 3VLUA 2F7BA 2FNCA 4N6PA 1FPEA 4DI3D 4RA1A 1UTHA 2XXHA 3E4RA 4G2ZA 3PD9A 4OQOA 2DE4A 5ET5A 3IOTA 4G77A 4YAHX 3I5OA 1B0HA 1UIVA 4JB7A 2WKYA 2ZYOA 3RLFE 2Q2AA 2BJJX 4NMYA 3PD8A 4IO5A 4JBZA 1O7TA 3GBBA 3B50A 1EYJA 2QVUA 2ZYMA 3P7IA 1ELJA 1B4HA 2X26A 4YKPA 5FTIA 1L5TA 1MY4A 5HPQA 3KOSA 4FJPA 2O84X 1WODA 3MZ1A 1XS5A 4H67A 1MM6A 2NVUB 1UIUA 3W9WA 1MDP1 3F11A 1IMCA 3TTMA 3SZPA 1YAEA 3THIA 2DWIA 1HSEA 4OVPA 4OFOA 4PF6A 1DOTA 4ZEBA 3IJOB 3HFUA 4GWXA 3V8XB 4R2BA 2QMXA 2RC7A 1NV3A 2QJEA 3T66A 1FPDA 4IO2A 2HXRA 4N07A 3OO7A 2RKMA 3PPOA 2WEFA 2ESNA 4ECFA 3U94A 3EHUA 2LAOA 1LB9A 4HXVA 3TCHA 1N0TA 3VLWA 4F2QA 3B6TA 3RT6B 2XX7A 1M5DA 5FTHA 3IB0A 4OENA 2M8CA 2Q88A 1ZJLA 5L8DA 1FJ9A 2CEYA 2FYIA 1OLCA 1PEBA 4H46A 3O6GA 1ATGA 3MVWA 5H8NA 2Z8EA 4QF9A 1FTKA 3WAEA 2YPNA 4NF5B 1NNPA 1B3EA 2OJTA 1B1HA 5EQ8A 5I59A 5I57A 3S9NC 5I3SA 4MMPA 3H6VA 1TT1A 3S9EA 1EH3A 3H7MA 4RK9A 1EU8A 1MY1A 2H9BA 4OVJA 1LGBC 4NF4A 4NX1A 2F97A 3K01A 4OVTA 4AQ4A 3KEIA 3MQ9A 4QSEA 1YTVA 2IEEA 1PB7A 3U72A 4LONB 4OVQA 4O7MA 3O28A 1Y1MA 1B9JA 5FHMA 4OVRA 5IKBA 1P1OA 3JYRA 3IJXB 2PT1A 3DP4A 4EXLA 3A3UA 1NV6A 3T96B 1MXXA 3LSFB 5L9MA 1XT8A 3R26A 3M3FA 1FPIA 1QKBA 1LFGA 4R74A 3H6WA 4NQ8A 4E0XA 5A5LA 3O66A 3IAZA 1US5A 2HFBA 2P3NA 4BDOA 1B3GA 2MKZA 4YMBA 3SKPA 4THIA 4ELOA 1MQJA 4H1XA 2OCUA 5ELVA 1LLSA 3IFAA 1FPKA 4EQ7A 2CMOA 2E1SA 1POY1 1T0KA 2Q74A 2GHAA 4ELQA 3TQWA 2XWIA 4PTKA 3FZVA 4KYDA 1FTOA 1M5FA 1FQCA 4N17A 4NWDA 3LUZA 1Z7ME 5H8FB 1ZBMA 4IO7A 1B7ZA 1DMBA 1KA0A 2I4CA 1DTZA 5CMBA 1VE4A 4ZDMA 1BK4A 3FXUA 2XXRA 4LZ5A 1YPNA 3T1BA 3NOHA 5IM2A 1SW5A 4FATA 2F35A 5TPAB 4IO6A 1FQBA 4AB6A 3D1RA 4UABA 1MQHA 4JVIA 3Q27A 3CSGA 4KYEA 1OVBA 1SVXB 3FBPA 1NUWA 3IR1A 1US4A 2RCAA 5AA4A 5ESYA 4P0GA 1TFDA 2XXWA 4MJOA 3EHTA 3FGSA 3S9MC 2O6AA 1MXZA 4MEVA 4X9TA 5KCJB 4P3LA 1ZIUA 1PB9A 3TCGA 2ZYKA 4ZE9A 3QUJA 1N04A 1H44A 1IUDA 1NUYA 4H5FA 1K9YA 4MX6A 4NF8A 1P1QA 1SD3A 1YCJA 1O63A 5I56B 3M3LA 3EKIA 1LFHA 3S4UA 1LB8A 4QRZA 4MNIA 3TTRA 5L9SA 1NV0A 2DQVA 1FTMA 4NF0A 3LV0A 2F7AA 2A5SA 4Z7EA 1LAXA 3RPLB 1A7LA 3T93B 3QIMA 5LDZA 4ISUA 2ZZWA 4QFOA 5L9OA 3RQTA 4F1YA 4E0WA 5I58A 2Y7WA 3CFXA 1B4ZA 4BDNA 4NE4A 1DTGA 3DP6A 4EDPA 2Y5KA 2R8TA 3KC1A 5AA2A 4MNCA 4FEBA 4WEPA 3RT8A 1JVXA 2AIXA 2P0SA 1B5HA 3CSBA 1XHYA 1GVCA 3KZGA 4ZEFA 2QL3A 1DPEA 5EQ9A 3D4CA 1YXIA 1F9BA 3FJGA 1JW1A 4PE5B 1D4NA 3MVXA 1IIWA 4PFTA 1PDAA 2QS2A 1NV5A 3CI8A 4F3PA 1MQIA 2H99A 4N4UA 4I9DA 3O6IA 3LC8A 5AA1A 4MIJA 4N6KA 1IXIA 3K1MA 2B4LA 4YB6A 5H8QA 3MSTA 3ILUB 1FPJA 2O7UA 3QYTA 5CMKA 1II5A 1MDQA 3WAFA 2QRYA 5EQ7A 1NNKA 5AE4A 4RY1A 1SYIA 2DP8A 4FORA 2H98A 4PDHA 3TYHA 4NHBA 2DVZA 2QVVA 3G3FA 3Q28A 4MBPA 3D4GA 2DVCA 2R71A 3PMWA 3TAJA 3UORA 5K2YA 1B1XA 1B51A 4U21A 4ZZAA 5DT6A 3DP8A 4IY6A 1GR2A 1MH4A 4OESA 5CBSA 1LBZA 4ZE8A 3RTWB 3G3HA 1I69A 1SDXA 3FJ7A 2Z23A 3CFZA 4OXVA 5ISUA 3KJ7A 4GX6A 3PPNA 4YICA 2Y84A 4RYAA 5ET8A 2UXAA 3H3GA 1IMDA 4U2RA 1M5EA 2RC8A 1URGA 2L5VA 3TQLA 1I6BA 3HPIA 4LQ5A 4QHQA 3ILTB 3GYYA 4RJZA 2XX9A 3BBRA 1B40A 4UACA 1UTHB 5CM6A 4YMAA 4DE8A 4LA9A 3IO4A 4HTGA 3PU5A 3MAMA 2UVGA 2V93A 1NFTA 2VD2A 1FBPA 3K1PA 1FBDA 2DSFA 2OX3A 1B5IA 3M8UA 1NL5A 2VD3A 1ZTYA 5JTYB 3TKDA 4TQUQ 2UVJA 3IK6B 1BP5A 4HE1A 4MNPA 3OEMA 3PV0E 4RK2A 3A29A 4TLLB 5M2VA 3OO6A 4H8JA 4YZZA 3LR1A 3RPWA 1IMBA 1NNTA 2B4MA 4NGUA 5J1DA 4F1VA 4R2FA 4Q0CA 2PMSA 1A99A 4XTCQ 3FUZA 4TOZA 3H03A 4NN3A 5H8HB 4KCCA 2Y7IA 3OOAA 4ESWA 3AXFA 4MCOA 5KZTA 2I3WA 3ECRA 1ZLQA 2QVRA 2XWOA 1TWYA 1LBYA 1POTA 3TEPA 2X7QA 3MP6A 2WX9A 3FD3A 4NTLA 3C31A 3B8BA 1YZ0A 2RCBA 1GGGA 4PFUA 1B3HA 4GLIA 4POXA 4ZEIA 3C32A 4N6DA 5I84A 4GXAA 2B3BA
chains in the Genus database with same CATH topology
4R75A 1Z7NE 4XKNA 4OHNA 3CFLA 4RXLA 2CZLA 2XHDA 4F19A 3O6HA 2HZLA 3G3KA 5CMMA 5H8NB 2ALUA 5FHOA 1B05A 4F3GA 4PFWA 4EQBA 1NH8A 5B7DA 2AL5A 1SQYA 3B6WA 4NEDA 3FV2A 3M3KA 5I57B 2D21A 3SEYA 3OO9A 3PMXA 2UVHA 3DM0A 1JNFA 1RYOA 4LZ7A 4LZ8A 2ZNUA 4IY5A 4NF4B 2RINA 1MQDA 3UIFA 4KHZE 3HV1A 4G68C 5LOMA 3HHFA 1QJMA 3MVZA 2V3UA 1VR5A 3TTLA 3W15C 4PQJA 1AOVA 2I6EA 2ANJA 4BDRA 1B0LA 1Y3QA 1Y3NA 4EF2A 2UYEA 1LAHE 5CBRA 1NNFA 3VVEA 1HSJA 4NF6A 3KJTA 4JWOA 4G4PA 2G29A 4DXCA 4F3BA 2PYYA 3MW0A 3R7XA 2Q9TA 3DELB 3TTKA 4OTEA 4U4SA 2XXQA 1N7WA 3IB2A 4OMBA 3C34A 1HSLA 1QUJA 1B52A 3TPAA 2PX1A 3IL1B 3TDJA 5H8SA 3EHSA 1VSOA 4LQ2A 1Y4TA 2THIA 1OQGA 3S9LC 3EF7A 1OVTA 5CI5A 3B6QA 1H3DA 4H8IA 3L6HA 3MBPA 4FIMA 4R9FA 3VE1B 4F2OA 3OO8A 1D9YA 3H4ZA 3O97A 4UA8A 1MY0A 3QXMA 1LAGE 3OD7A 1LSTA 3K6UA 1QW0A 1SBPA 4KD5A 3C36A 1A8FA 3SEWA 3FXQA 4KI0E 2ZYNA 5AA4B 3H06B 2GHBA 3OSQA 4WXJA 3H6TA 2PBWA 3GBAA 1SW2A 2Y7RA 1Y3PA 3LSXA 3PPRA 3K4UA 3K6WA 4QFNA 1IEJA 3U8QA 4OFLA 1N3WA 5TP9B 3RTFB 4NF8B 2ZXTA 3PMVA 3K6XA 2VHAA 1A40A 4R6HA 2VOZA 4ZS9A 5FHNA 5CMCA 1LBBA 5DYHA 1JQFA 3JZJA 3OENA 3V89B 3PUZE 2REJA 1B7HA 3L6GA 5AA2D 3O2AA 1MPBA 1JW5A 4JSDA 3CG3A 1H45A 3VXCA 3E9XA 4JDFA 3N6TA 4IGTA 3RNNA 3FATA 2XXUA 1JEVA 5KDTB 2O1MA 3PPPA 4KR5A 1AH5A 5AA2B 1XC1A 2OLBA 3SERA 1R1NA 3FV1A 2I0CA 2I49A 1IXHA 2OWSA 3C35A 3QAXA 4GXSB 1FW0A 1N3XA 3UP9A 3OXNA 3IOWA 4GIZA 2RF1A 3BFTA 3PUYE 3EQ1A 3UGWA 2QPQA 3VDFA 1MRPA 5TPAA 5CC2A 2Q2CA 2HEUA 5ITPA 4P0IA 4GFRA 3CR9A 5H8QB 1ZMGA 1USYH 3KSXA 3U92A 4BDMA 1PBPA 5I2KA 3CRBA 3TZAA 2B65A 3SEXA 4KQPA 3Q25A 2YLNA 5DEXB 4KPTA 1UQWA 4G8HA 4DCYA 5I56A 3K1NA 3QUFA 1Y20A 2UYFA 2V84A 1OMPA 4C1UA 4PETA 2F6PA 1OIBA 1MPCA 4ZECA 2A5TA 4H6DA 3R6UA 2QSXA 2I0BA 4QFPA 4R6YA 5DVIA 4XIGQ 3C9HA 3FXRA 4I8CA 4X1BA 3ZS6A 2DWAA 1M5BA 2QS3A 1VFDA 2Y7KA 1N84A 4M4GA 3N94A 4MLQA 3MP8A 1D9VA 4QSDA 5A5XA 3E13X 1M5CA 1FCKA 4ESXA 1ANFA 5F7VA 4FAJA 4GQOA 3MPLA 1QULA 1B6HA 1MS7A 4EF1A 1H76A 4POWA 4L17A 2Y7PA 4DIGA 4XKRA 2PT2A 2P2AA 4G68A 2VGQA 2UVIA 1UTBA 1A54A 3G3IA 3I3VA 2OK2A 2Z8DA 2DS9A 4R6KA 3ONMA 1JETA 2ZNTA 1Y1ZA 3ODBA 1QUKA 1B32A 5ICTA 4H5GA 2P1SA 4F31B 2NWJA 3LUYA 4O3BA 4U1ZA 3I6VA 3MJNA 4Q30B 3RY3A 1B3FA 3LBSA 1B7UA 2H4IA 4F1UA 4MF3A 3SEUA 3MC2A 1EZOA 1URSA 1KWHA 5ITOA 5CRYA 2NUVA 4DXBA 1Y9UA 4Q5TA 4X48A 4EXKA 2QS1A 2NOOA 2O1LA 3TTNA 3IOVA 4KYSA 4X1DA 5HM4B 2XXXA 3HSTA 2XD3A 2O51A 4ND9A 1XVYA 3E3KA 4ELRA 4OYVA 5I2NA 1XVXA 3T22A 3VVFA 2PVUA 3A09A 1VFEA 1N7XA 4Z0IA 1QKAA 1I6AA 3PUWE 1MXYA 4MLVA 1WVJA 1MY2A 5JK4A 4O3CA 1PBQA 3HCQA 2I48A 1TXFA 2DWHA 4FEDA 4OWDA 2HZKA 4F29A 1A55A 4BDQA 1R9QA 3SETA 1MXVA 5JTYA 3UA8A 4DLDA 3TMGA 3MP1A 2W7YA 1DSNA 4ELPA 3T9XB 2Z22A 2XXTA 1IXGA 4R73A 1LCTA 1NKXA 2AYSA 4FECA 5EHMA 1B58A 2DE3A 4BDLA 4K3FA 4WKMA 5I59B 4NF6B 1RKMA 4GWOA 3VXBA 2HCAA 3T9HB 1R9LA 4TLMB 5H8HA 4RNSA 1MG1A 5BUUA 3KSJA 3IORA 4QFKA 3MWBA 5JEIA 3OSRA 4IO4A 3N5LA 1GV8A 4EUOA 1EZ9A 4HS7A 4F22A 3KFMA 5EHSA 4IO3A 4QFLA 4LVQA 1IITA 4C0RA 1MY3A 2I3VA 2YJPA 1B46A 3V83A 4JWYA 3USDA 2D5WA 1CB6A 3LSLA 1SW1A 1N76A 3KN7A 4XXUA 4GL0A 1USYE 2OBGA 1MQGA 5DVJA 1FQFA 4DCXA 3FJMA 3PPQA 1QVSA 3KBRA 2DYXA 3G3GA 3IO6A 4ZZEA 3SESA 1EZPA 4HCWA 2OZZA 4QSCA 1SYHA 3LSWA 1FQEA 1FQAA 4N13A 4NWCA 4GD5A 3QSLA 3KN8A 4P11A 2I58A 2X7PA 4RPNA 4U1OA 4G8MA 1LCFA 4YKIA 5F1QA 4R9GA 2QS4A 3KG2A 1BIYA 1LAFE 3PUXE 5ICQA 3DLNA 1OQHA 4H0WA 4NF5A 2KLFA 2GRVA 4I1DA 4MH5A 3KGCA 4GOTA 2XXIA 4DDDA 4F18A 2H5YA 4U22A 4ZEDA 3VVDA 1Q35A 2XXVA 2E0SA 3OMBA 1P1WA 2Q89A 2HQ0A 1NH7A 4U23A 3MZ9A 3GXAA 3C4MA 3FVGA 3JV9A 3HO7A 3RGYA 2AL4A 3TCFA 3IOUA 3TFLA 1BKAA 2F36A 2O69A 3CG1A 1OLAA 3A3CA 4WEDA 3VFJA 3U93A 3K2DA 2XD2A 4AB5A 5HBCA 1PB8A 3ZKLA 2V3QA 1LBCA 2HXWA 2H25A 3TUSA 3MVYA 5I58B 1O64A 1CE2A 2O68A 3RN8A 4IGRA 1XOCA 1J1NA 3Q26A 1IQ7A 3FVNA 5DTBA 1FTLA 3N26A 3ZKKA 4C1TA 3BFUA 1D3KA 3CIJA 4H65A 1DPPA 5H8FA 3UN6A 4U4XA 2ONSA 3T9VA 5I2KB 4KCDA 1TFAA 3U1OA 2V3TA 5TP9A 4ONYA 1S7YA 2F8DA 5IAIA 4PP0A 1BTJA 4HW8A 4GL8A 1FTJA 4JXIA 3EPEA 3HN0A 1MPDA 1FQDA 3C33A 3FVKA 2ZNSA 3Q29A 2A5TB 1JVYA 1Y4CA 2RC9A 1BLFA 2D3IA 3FASA 4YKKA 3H6UA 3EN3A 5K2XA 1IXCA 5KCJA 1RYXA 3ZSFA 1IZ1A 3SEVA 3G3JA 3N6UA 5KDTA 3K00A 3TODA 4YKJA 5A5XB 4F39A 1B5JA 3KOTA 2G93A 3TELA 2ZMBA 4RPOA 3PGFA 2REGA 2V25A 2FA7A 4GRKA 1QUIA 4OEUA 4G68B 3OELA 2ABHA 4DZ1A 1UTBB 1ZKBA 2DOJA 1A8EA 2XXPA 3MZBA 1Q1KA 4OETA 3VV5A 3K02A 3K0VA 1P1UA 3GZGA 1ZU0A 5BWJA 4F3SA 3T9UA 2HAVA 2GFEA 2F7CA 3G7WA 2F78A 4OFJA 3CVGA 2IA4A 4G8NA 2B3FA 3O29A 4EQ9A 5DEXA 2GH9A 3QK6A 4YU0A 3UK4A 3BKIB 3MPKA 3SDFA 1NMUA 2F34A 3V5AA 4LUBA 1SW4A 5DVFA 2DWJA 4XKQA 3GLBA 4JSOA 3RUMA 2O7IA 2OWTA 2DXRA 1MXWA 5TU0A 3FVOA 3FIRA 1AL3A 1URDA 3HHGA 4MFIA 4I62A 2Q8JA 1LFIA 4R72A 4GF8A 4ZEKA 3VLVA 1P1NA 1MH3A 2HAUA 1AIVA 4IB2A 2ONKE 2DE2A 3K6VA 4BLAA 4FE8A 1MM7A 3IB1A 5I2NB 3OEKA 2R9JA 1MXUA 1GTKA 5B70A 3W9VA 2VP1A 4KFQA 1S50A 4YB5A 1PC3A 2XX8A 4Q8RA 2XXYA 4GVOA 3KN3A 4OZ9A 4DXUA 2Z8FA 2I4BA 3B7DA 2NXOA 3IX1A 4LATA 4LP2B 1I6QA 2R6GE 1B3LA 3O9PA 4O3AA 4YB7A 5EYFA 1B2HA 1AMFA 3S2VA 5AA3A 3MUQA 3PUVE 4OERA 2F6GA 1H43A 1SI1A 1WDNA 2ONRA 2QMWA 1SI0A 4HCYA 4JWXA 2F5XA 4M1VA 2DXYA 1JW4A 4XKPA 4PFYA 1S9TA 1R6ZA 1P99A 4OEVA 1JEUA 3VLUA 2F7BA 2FNCA 4N6PA 4RA1A 1UTHA 2XXHA 3E4RA 4G2ZA 3PD9A 4OQOA 2DE4A 3IOTA 4G77A 4YAHX 3I5OA 1B0HA 1UIVA 4JB7A 2WKYA 2ZYOA 3RLFE 2Q2AA 2BJJX 4NMYA 3PD8A 4IO5A 4JBZA 1O7TA 3GBBA 2ZYMA 3P7IA 1ELJA 1B4HA 2X26A 4YKPA 5FTIA 1L5TA 1MY4A 5HPQA 3KOSA 4FJPA 2O84X 1WODA 3MZ1A 1XS5A 4H67A 1MM6A 2NVUB 1UIUA 3W9WA 1MDP1 3F11A 3TTMA 1YAEA 3THIA 2DWIA 1HSEA 4OFOA 1DOTA 4ZEBA 3IJOB 3V8XB 4R2BA 2QMXA 2RC7A 2QJEA 3T66A 4IO2A 4N07A 3OO7A 2RKMA 3PPOA 2ESNA 4ECFA 3U94A 3EHUA 2LAOA 1LB9A 3TCHA 1N0TA 3VLWA 4F2QA 3B6TA 3RT6B 2XX7A 1M5DA 5FTHA 3IB0A 4OENA 2M8CA 2Q88A 1ZJLA 5L8DA 2FYIA 1OLCA 1PEBA 3O6GA 1ATGA 3MVWA 5H8NA 2Z8EA 4QF9A 1FTKA 3WAEA 2YPNA 4NF5B 1NNPA 1B3EA 2OJTA 1B1HA 5I59A 5I57A 3S9NC 3H6VA 1TT1A 3S9EA 1EH3A 3H7MA 4RK9A 1EU8A 1MY1A 2H9BA 4OVJA 1LGBC 4NF4A 2F97A 3K01A 4AQ4A 3KEIA 3MQ9A 4QSEA 1YTVA 2IEEA 1PB7A 3U72A 4LONB 3O28A 1Y1MA 1B9JA 5FHMA 5IKBA 1P1OA 3JYRA 3IJXB 2PT1A 3DP4A 4EXLA 3A3UA 3T96B 1MXXA 3LSFB 5L9MA 1XT8A 3R26A 3M3FA 1QKBA 1LFGA 4R74A 3H6WA 4E0XA 3O66A 3IAZA 1US5A 2HFBA 4BDOA 1B3GA 4YMBA 3SKPA 4THIA 4ELOA 1MQJA 4H1XA 2OCUA 5ELVA 1LLSA 4EQ7A 2CMOA 2E1SA 1POY1 1T0KA 2GHAA 4ELQA 3TQWA 3FZVA 4KYDA 1FTOA 1M5FA 1FQCA 4NWDA 1Z7ME 5H8FB 1ZBMA 4IO7A 1B7ZA 1DMBA 2I4CA 1DTZA 5CMBA 1VE4A 4ZDMA 3FXUA 2XXRA 4LZ5A 1YPNA 1SW5A 4FATA 2F35A 5TPAB 4IO6A 1FQBA 4AB6A 1MQHA 3Q27A 3CSGA 4KYEA 1OVBA 1SVXB 3IR1A 1US4A 2RCAA 5AA4A 4P0GA 1TFDA 2XXWA 3EHTA 3FGSA 3S9MC 2O6AA 1MXZA 4X9TA 5KCJB 1ZIUA 1PB9A 3TCGA 2ZYKA 4ZE9A 3QUJA 1N04A 1H44A 1IUDA 4H5FA 4NF8A 1P1QA 1SD3A 1YCJA 1O63A 5I56B 3M3LA 1LFHA 3S4UA 1LB8A 4QRZA 3TTRA 5L9SA 2DQVA 1FTMA 2F7AA 2A5SA 4Z7EA 1LAXA 1A7LA 3T93B 3QIMA 4ISUA 4QFOA 5L9OA 3RQTA 4F1YA 4E0WA 5I58A 2Y7WA 3CFXA 1B4ZA 4BDNA 4NE4A 1DTGA 3DP6A 4EDPA 5AA2A 4FEBA 4WEPA 3RT8A 1JVXA 2AIXA 2P0SA 1B5HA 3CSBA 1XHYA 1GVCA 3KZGA 4ZEFA 2QL3A 1DPEA 3D4CA 1F9BA 3FJGA 1JW1A 4PE5B 1D4NA 3MVXA 1IIWA 4PFTA 1PDAA 2QS2A 3CI8A 4F3PA 1MQIA 2H99A 4I9DA 3O6IA 3LC8A 5AA1A 1IXIA 5H8QA 3K1MA 4YB6A 3ILUB 2O7UA 3QYTA 5CMKA 1II5A 1MDQA 3WAFA 2QRYA 5AE4A 1NNKA 4RY1A 1SYIA 2DP8A 4FORA 2H98A 3TYHA 2DVZA 3G3FA 3Q28A 4MBPA 3D4GA 2DVCA 3TAJA 2R71A 3PMWA 3UORA 5K2YA 1B1XA 1B51A 4U21A 4ZZAA 5DT6A 3DP8A 4IY6A 1GR2A 1MH4A 4OESA 5CBSA 4ZE8A 3RTWB 3G3HA 1I69A 1SDXA 3FJ7A 2Z23A 3CFZA 4OXVA 5ISUA 3KJ7A 3PPNA 4YICA 2Y84A 4RYAA 2UXAA 3H3GA 4U2RA 1M5EA 2RC8A 1URGA 3TQLA 1I6BA 3HPIA 4LQ5A 4QHQA 3ILTB 4RJZA 2XX9A 3BBRA 1B40A 4UACA 1UTHB 5CM6A 4YMAA 4DE8A 4LA9A 3IO4A 4HTGA 3PU5A 3MAMA 2UVGA 2V93A 1NFTA 2VD2A 3K1PA 2DSFA 1B5IA 3M8UA 1NL5A 2VD3A 1ZTYA 5JTYB 3TKDA 4TQUQ 2UVJA 3IK6B 1BP5A 3OEMA 3PV0E 4RK2A 5M2VA 4TLLB 3OO6A 4H8JA 4YZZA 3LR1A 3RPWA 1NNTA 5J1DA 4F1VA 4R2FA 4Q0CA 2PMSA 1A99A 4XTCQ 3FUZA 4TOZA 3H03A 5H8HB 4KCCA 2Y7IA 3OOAA 4ESWA 3AXFA 5KZTA 2I3WA 3ECRA 1ZLQA 1TWYA 1POTA 3TEPA 2X7QA 3MP6A 3FD3A 4NTLA 3C31A 2RCBA 1GGGA 4PFUA 1B3HA 4GLIA 4POXA 4ZEIA 3C32A 5I84A 4GXAA 2B3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R75 A;  1Z7N E;  4XKN A;  4OHN A;  3CFL A;  4RXL A;  2CZL A;  2XHD A;  4F19 A;  3O6H A;  2HZL A;  3G3K A;  5CMM A;  5H8N B;  2ALU A;  5FHO A;  1B05 A;  4F3G A;  4PFW A;  4EQB A;  1NH8 A;  5B7D A;  2AL5 A;  1SQY A;  3B6W A;  4NED A;  3FV2 A;  3M3K A;  5I57 B;  2D21 A;  3SEY A;  3OO9 A;  3PMX A;  2UVH A;  3DM0 A;  1JNF A;  1RYO A;  4LZ7 A;  4LZ8 A;  2ZNU A;  4IY5 A;  4NF4 B;  2RIN A;  1MQD A;  3UIF A;  4KHZ E;  3HV1 A;  4G68 C;  5LOM A;  3HHF A;  1QJM A;  3MVZ A;  2V3U A;  1VR5 A;  3TTL A;  3W15 C;  4PQJ A;  1AOV A;  2I6E A;  2ANJ A;  4BDR A;  1B0L A;  1Y3Q A;  1Y3N A;  4EF2 A;  2UYE A;  1LAH E;  5CBR A;  1NNF A;  3VVE A;  1HSJ A;  4NF6 A;  3KJT A;  4JWO A;  4G4P A;  2G29 A;  4DXC A;  4F3B A;  2PYY A;  3MW0 A;  3R7X A;  2Q9T A;  3DEL B;  3TTK A;  4OTE A;  4U4S A;  2XXQ A;  1N7W A;  3IB2 A;  4OMB A;  3C34 A;  1HSL A;  1QUJ A;  1B52 A;  3TPA A;  2PX1 A;  3IL1 B;  3TDJ A;  5H8S A;  3EHS A;  1VSO A;  4LQ2 A;  1Y4T A;  2THI A;  1OQG A;  3S9L C;  3EF7 A;  1OVT A;  5CI5 A;  3B6Q A;  1H3D A;  4H8I A;  3L6H A;  3MBP A;  4FIM A;  4R9F A;  3VE1 B;  4F2O A;  3OO8 A;  1D9Y A;  3H4Z A;  3O97 A;  4UA8 A;  1MY0 A;  3QXM A;  1LAG E;  3OD7 A;  1LST A;  3K6U A;  1QW0 A;  1SBP A;  4KD5 A;  3C36 A;  1A8F A;  3SEW A;  3FXQ A;  4KI0 E;  2ZYN A;  5AA4 B;  3H06 B;  2GHB A;  3OSQ A;  4WXJ A;  3H6T A;  2PBW A;  3GBA A;  1SW2 A;  2Y7R A;  1Y3P A;  3LSX A;  3PPR A;  3K4U A;  3K6W A;  4QFN A;  1IEJ A;  3U8Q A;  4OFL A;  1N3W A;  5TP9 B;  3RTF B;  4NF8 B;  2ZXT A;  3PMV A;  3K6X A;  2VHA A;  1A40 A;  4R6H A;  2VOZ A;  4ZS9 A;  5FHN A;  5CMC A;  1LBB A;  5DYH A;  1JQF A;  3JZJ A;  3OEN A;  3V89 B;  3PUZ E;  2REJ A;  1B7H A;  3L6G A;  5AA2 D;  3O2A A;  1MPB A;  1JW5 A;  4JSD A;  3CG3 A;  1H45 A;  3VXC A;  3E9X A;  4JDF A;  3N6T A;  4IGT A;  3RNN A;  3FAT A;  2XXU A;  1JEV A;  5KDT B;  2O1M A;  3PPP A;  4KR5 A;  1AH5 A;  5AA2 B;  1XC1 A;  2OLB A;  3SER A;  1R1N A;  3FV1 A;  2I0C A;  2I49 A;  1IXH A;  2OWS A;  3C35 A;  3QAX A;  4GXS B;  1FW0 A;  1N3X A;  3UP9 A;  3OXN A;  3IOW A;  4GIZ A;  2RF1 A;  3BFT A;  3PUY E;  3EQ1 A;  3UGW A;  2QPQ A;  3VDF A;  1MRP A;  5TPA A;  5CC2 A;  2Q2C A;  2HEU A;  5ITP A;  4P0I A;  4GFR A;  3CR9 A;  5H8Q B;  1ZMG A;  1USY H;  3KSX A;  3U92 A;  4BDM A;  1PBP A;  5I2K A;  3CRB A;  3TZA A;  2B65 A;  3SEX A;  4KQP A;  3Q25 A;  2YLN A;  5DEX B;  4KPT A;  1UQW A;  4G8H A;  4DCY A;  5I56 A;  3K1N A;  3QUF A;  1Y20 A;  2UYF A;  2V84 A;  1OMP A;  4C1U A;  4PET A;  2F6P A;  1OIB A;  1MPC A;  4ZEC A;  2A5T A;  4H6D A;  3R6U A;  2QSX A;  2I0B A;  4QFP A;  4R6Y A;  5DVI A;  4XIG Q;  3C9H A;  3FXR A;  4I8C A;  4X1B A;  3ZS6 A;  2DWA A;  1M5B A;  2QS3 A;  1VFD A;  2Y7K A;  1N84 A;  4M4G A;  3N94 A;  4MLQ A;  3MP8 A;  1D9V A;  4QSD A;  5A5X A;  3E13 X;  1M5C A;  1FCK A;  4ESX A;  1ANF A;  5F7V A;  4FAJ A;  4GQO A;  3MPL A;  1QUL A;  1B6H A;  1MS7 A;  4EF1 A;  1H76 A;  4POW A;  4L17 A;  2Y7P A;  4DIG A;  4XKR A;  2PT2 A;  2P2A A;  4G68 A;  2VGQ A;  2UVI A;  1UTB A;  1A54 A;  3G3I A;  3I3V A;  2OK2 A;  2Z8D A;  2DS9 A;  4R6K A;  3ONM A;  1JET A;  2ZNT A;  1Y1Z A;  3ODB A;  1QUK A;  1B32 A;  5ICT A;  4H5G A;  2P1S A;  4F31 B;  2NWJ A;  3LUY A;  4O3B A;  4U1Z A;  3I6V A;  3MJN A;  4Q30 B;  3RY3 A;  1B3F A;  3LBS A;  1B7U A;  2H4I A;  4F1U A;  4MF3 A;  3SEU A;  3MC2 A;  1EZO A;  1URS A;  1KWH A;  5ITO A;  5CRY A;  2NUV A;  4DXB A;  1Y9U A;  4Q5T A;  4X48 A;  4EXK A;  2QS1 A;  2NOO A;  2O1L A;  3TTN A;  3IOV A;  4KYS A;  4X1D A;  5HM4 B;  2XXX A;  3HST A;  2XD3 A;  2O51 A;  4ND9 A;  1XVY A;  3E3K A;  4ELR A;  4OYV A;  5I2N A;  1XVX A;  3T22 A;  3VVF A;  2PVU A;  3A09 A;  1VFE A;  1N7X A;  4Z0I A;  1QKA A;  1I6A A;  3PUW E;  1MXY A;  4MLV A;  1WVJ A;  1MY2 A;  5JK4 A;  4O3C A;  1PBQ A;  3HCQ A;  2I48 A;  1TXF A;  2DWH A;  4FED A;  4OWD A;  2HZK A;  4F29 A;  1A55 A;  4BDQ A;  1R9Q A;  3SET A;  1MXV A;  5JTY A;  3UA8 A;  4DLD A;  3TMG A;  3MP1 A;  2W7Y A;  1DSN A;  4ELP A;  3T9X B;  2Z22 A;  2XXT A;  1IXG A;  4R73 A;  1LCT A;  1NKX A;  2AYS A;  4FEC A;  5EHM A;  1B58 A;  2DE3 A;  4BDL A;  4K3F A;  4WKM A;  5I59 B;  4NF6 B;  1RKM A;  4GWO A;  3VXB A;  2HCA A;  3T9H B;  1R9L A;  4TLM B;  5H8H A;  4RNS A;  1MG1 A;  5BUU A;  3KSJ A;  3IOR A;  4QFK A;  3MWB A;  5JEI A;  3OSR A;  4IO4 A;  3N5L A;  1GV8 A;  4EUO A;  1EZ9 A;  4HS7 A;  4F22 A;  3KFM A;  5EHS A;  4IO3 A;  4QFL A;  4LVQ A;  1IIT A;  4C0R A;  1MY3 A;  2I3V A;  2YJP A;  1B46 A;  3V83 A;  4JWY A;  3USD A;  2D5W A;  1CB6 A;  3LSL A;  1SW1 A;  1N76 A;  3KN7 A;  4XXU A;  4GL0 A;  1USY E;  2OBG A;  1MQG A;  5DVJ A;  1FQF A;  4DCX A;  3FJM A;  3PPQ A;  1QVS A;  3KBR A;  2DYX A;  3G3G A;  3IO6 A;  4ZZE A;  3SES A;  1EZP A;  4HCW A;  2OZZ A;  4QSC A;  1SYH A;  3LSW A;  1FQE A;  1FQA A;  4N13 A;  4NWC A;  4GD5 A;  3QSL A;  3KN8 A;  4P11 A;  2I58 A;  2X7P A;  4RPN A;  4U1O A;  4G8M A;  1LCF A;  4YKI A;  5F1Q A;  4R9G A;  2QS4 A;  3KG2 A;  1BIY A;  1LAF E;  3PUX E;  5ICQ A;  3DLN A;  1OQH A;  4H0W A;  4NF5 A;  2KLF A;  2GRV A;  4I1D A;  4MH5 A;  3KGC A;  4GOT A;  2XXI A;  4DDD A;  4F18 A;  2H5Y A;  4U22 A;  4ZED A;  3VVD A;  1Q35 A;  2XXV A;  2E0S A;  3OMB A;  1P1W A;  2Q89 A;  2HQ0 A;  1NH7 A;  4U23 A;  3MZ9 A;  3GXA A;  3C4M A;  3FVG A;  3JV9 A;  3HO7 A;  3RGY A;  2AL4 A;  3TCF A;  3IOU A;  3TFL A;  1BKA A;  2F36 A;  2O69 A;  3CG1 A;  1OLA A;  3A3C A;  4WED A;  3VFJ A;  3U93 A;  3K2D A;  2XD2 A;  4AB5 A;  5HBC A;  1PB8 A;  3ZKL A;  2V3Q A;  1LBC A;  2HXW A;  2H25 A;  3TUS A;  3MVY A;  5I58 B;  1O64 A;  1CE2 A;  2O68 A;  3RN8 A;  4IGR A;  1XOC A;  1J1N A;  3Q26 A;  1IQ7 A;  3FVN A;  5DTB A;  1FTL A;  3N26 A;  3ZKK A;  4C1T A;  3BFU A;  1D3K A;  3CIJ A;  4H65 A;  1DPP A;  5H8F A;  3UN6 A;  4U4X A;  2ONS A;  3T9V A;  5I2K B;  4KCD A;  1TFA A;  3U1O A;  2V3T A;  5TP9 A;  4ONY A;  1S7Y A;  2F8D A;  5IAI A;  4PP0 A;  1BTJ A;  4HW8 A;  4GL8 A;  1FTJ A;  4JXI A;  3EPE A;  3HN0 A;  1MPD A;  1FQD A;  3C33 A;  3FVK A;  2ZNS A;  3Q29 A;  2A5T B;  1JVY A;  1Y4C A;  2RC9 A;  1BLF A;  2D3I A;  3FAS A;  4YKK A;  3H6U A;  3EN3 A;  5K2X A;  1IXC A;  5KCJ A;  1RYX A;  3ZSF A;  1IZ1 A;  3SEV A;  3G3J A;  3N6U A;  5KDT A;  3K00 A;  3TOD A;  4YKJ A;  5A5X B;  4F39 A;  1B5J A;  3KOT A;  2G93 A;  3TEL A;  2ZMB A;  4RPO A;  3PGF A;  2REG A;  2V25 A;  2FA7 A;  4GRK A;  1QUI A;  4OEU A;  4G68 B;  3OEL A;  2ABH A;  4DZ1 A;  1UTB B;  1ZKB A;  2DOJ A;  1A8E A;  2XXP A;  3MZB A;  1Q1K A;  4OET A;  3VV5 A;  3K02 A;  3K0V A;  1P1U A;  3GZG A;  1ZU0 A;  5BWJ A;  4F3S A;  3T9U A;  2HAV A;  2GFE A;  2F7C A;  3G7W A;  2F78 A;  4OFJ A;  3CVG A;  2IA4 A;  4G8N A;  2B3F A;  3O29 A;  4EQ9 A;  5DEX A;  2GH9 A;  3QK6 A;  4YU0 A;  3UK4 A;  3BKI B;  3MPK A;  3SDF A;  1NMU A;  2F34 A;  3V5A A;  4LUB A;  1SW4 A;  5DVF A;  2DWJ A;  4XKQ A;  3GLB A;  4JSO A;  3RUM A;  2O7I A;  2OWT A;  2DXR A;  1MXW A;  5TU0 A;  3FVO A;  3FIR A;  1AL3 A;  1URD A;  3HHG A;  4MFI A;  4I62 A;  2Q8J A;  1LFI A;  4R72 A;  4GF8 A;  4ZEK A;  3VLV A;  1P1N A;  1MH3 A;  2HAU A;  1AIV A;  4IB2 A;  2ONK E;  2DE2 A;  3K6V A;  4BLA A;  4FE8 A;  1MM7 A;  3IB1 A;  5I2N B;  3OEK A;  2R9J A;  1MXU A;  1GTK A;  5B70 A;  3W9V A;  2VP1 A;  4KFQ A;  1S50 A;  4YB5 A;  1PC3 A;  2XX8 A;  4Q8R A;  2XXY A;  4GVO A;  3KN3 A;  4OZ9 A;  4DXU A;  2Z8F A;  2I4B A;  3B7D A;  2NXO A;  3IX1 A;  4LAT A;  4LP2 B;  1I6Q A;  2R6G E;  1B3L A;  3O9P A;  4O3A A;  4YB7 A;  5EYF A;  1B2H A;  1AMF A;  3S2V A;  5AA3 A;  3MUQ A;  3PUV E;  4OER A;  2F6G A;  1H43 A;  1SI1 A;  1WDN A;  2ONR A;  2QMW A;  1SI0 A;  4HCY A;  4JWX A;  2F5X A;  4M1V A;  2DXY A;  1JW4 A;  4XKP A;  4PFY A;  1S9T A;  1R6Z A;  1P99 A;  4OEV A;  1JEU A;  3VLU A;  2F7B A;  2FNC A;  4N6P A;  4RA1 A;  1UTH A;  2XXH A;  3E4R A;  4G2Z A;  3PD9 A;  4OQO A;  2DE4 A;  3IOT A;  4G77 A;  4YAH X;  3I5O A;  1B0H A;  1UIV A;  4JB7 A;  2WKY A;  2ZYO A;  3RLF E;  2Q2A A;  2BJJ X;  4NMY A;  3PD8 A;  4IO5 A;  4JBZ A;  1O7T A;  3GBB A;  2ZYM A;  3P7I A;  1ELJ A;  1B4H A;  2X26 A;  4YKP A;  5FTI A;  1L5T A;  1MY4 A;  5HPQ A;  3KOS A;  4FJP A;  2O84 X;  1WOD A;  3MZ1 A;  1XS5 A;  4H67 A;  1MM6 A;  2NVU B;  1UIU A;  3W9W A;  1MDP 1;  3F11 A;  3TTM A;  1YAE A;  3THI A;  2DWI A;  1HSE A;  4OFO A;  1DOT A;  4ZEB A;  3IJO B;  3V8X B;  4R2B A;  2QMX A;  2RC7 A;  2QJE A;  3T66 A;  4IO2 A;  4N07 A;  3OO7 A;  2RKM A;  3PPO A;  2ESN A;  4ECF A;  3U94 A;  3EHU A;  2LAO A;  1LB9 A;  3TCH A;  1N0T A;  3VLW A;  4F2Q A;  3B6T A;  3RT6 B;  2XX7 A;  1M5D A;  5FTH A;  3IB0 A;  4OEN A;  2M8C A;  2Q88 A;  1ZJL A;  5L8D A;  2FYI A;  1OLC A;  1PEB A;  3O6G A;  1ATG A;  3MVW A;  5H8N A;  2Z8E A;  4QF9 A;  1FTK A;  3WAE A;  2YPN A;  4NF5 B;  1NNP A;  1B3E A;  2OJT A;  1B1H A;  5I59 A;  5I57 A;  3S9N C;  3H6V A;  1TT1 A;  3S9E A;  1EH3 A;  3H7M A;  4RK9 A;  1EU8 A;  1MY1 A;  2H9B A;  4OVJ A;  1LGB C;  4NF4 A;  2F97 A;  3K01 A;  4AQ4 A;  3KEI A;  3MQ9 A;  4QSE A;  1YTV A;  2IEE A;  1PB7 A;  3U72 A;  4LON B;  3O28 A;  1Y1M A;  1B9J A;  5FHM A;  5IKB A;  1P1O A;  3JYR A;  3IJX B;  2PT1 A;  3DP4 A;  4EXL A;  3A3U A;  3T96 B;  1MXX A;  3LSF B;  5L9M A;  1XT8 A;  3R26 A;  3M3F A;  1QKB A;  1LFG A;  4R74 A;  3H6W A;  4E0X A;  3O66 A;  3IAZ A;  1US5 A;  2HFB A;  4BDO A;  1B3G A;  4YMB A;  3SKP A;  4THI A;  4ELO A;  1MQJ A;  4H1X A;  2OCU A;  5ELV A;  1LLS A;  4EQ7 A;  2CMO A;  2E1S A;  1POY 1;  1T0K A;  2GHA A;  4ELQ A;  3TQW A;  3FZV A;  4KYD A;  1FTO A;  1M5F A;  1FQC A;  4NWD A;  1Z7M E;  5H8F B;  1ZBM A;  4IO7 A;  1B7Z A;  1DMB A;  2I4C A;  1DTZ A;  5CMB A;  1VE4 A;  4ZDM A;  3FXU A;  2XXR A;  4LZ5 A;  1YPN A;  1SW5 A;  4FAT A;  2F35 A;  5TPA B;  4IO6 A;  1FQB A;  4AB6 A;  1MQH A;  3Q27 A;  3CSG A;  4KYE A;  1OVB A;  1SVX B;  3IR1 A;  1US4 A;  2RCA A;  5AA4 A;  4P0G A;  1TFD A;  2XXW A;  3EHT A;  3FGS A;  3S9M C;  2O6A A;  1MXZ A;  4X9T A;  5KCJ B;  1ZIU A;  1PB9 A;  3TCG A;  2ZYK A;  4ZE9 A;  3QUJ A;  1N04 A;  1H44 A;  1IUD A;  4H5F A;  4NF8 A;  1P1Q A;  1SD3 A;  1YCJ A;  1O63 A;  5I56 B;  3M3L A;  1LFH A;  3S4U A;  1LB8 A;  4QRZ A;  3TTR A;  5L9S A;  2DQV A;  1FTM A;  2F7A A;  2A5S A;  4Z7E A;  1LAX A;  1A7L A;  3T93 B;  3QIM A;  4ISU A;  4QFO A;  5L9O A;  3RQT A;  4F1Y A;  4E0W A;  5I58 A;  2Y7W A;  3CFX A;  1B4Z A;  4BDN A;  4NE4 A;  1DTG A;  3DP6 A;  4EDP A;  5AA2 A;  4FEB A;  4WEP A;  3RT8 A;  1JVX A;  2AIX A;  2P0S A;  1B5H A;  3CSB A;  1XHY A;  1GVC A;  3KZG A;  4ZEF A;  2QL3 A;  1DPE A;  3D4C A;  1F9B A;  3FJG A;  1JW1 A;  4PE5 B;  1D4N A;  3MVX A;  1IIW A;  4PFT A;  1PDA A;  2QS2 A;  3CI8 A;  4F3P A;  1MQI A;  2H99 A;  4I9D A;  3O6I A;  3LC8 A;  5AA1 A;  1IXI A;  5H8Q A;  3K1M A;  4YB6 A;  3ILU B;  2O7U A;  3QYT A;  5CMK A;  1II5 A;  1MDQ A;  3WAF A;  2QRY A;  5AE4 A;  1NNK A;  4RY1 A;  1SYI A;  2DP8 A;  4FOR A;  2H98 A;  3TYH A;  2DVZ A;  3G3F A;  3Q28 A;  4MBP A;  3D4G A;  2DVC A;  3TAJ A;  2R71 A;  3PMW A;  3UOR A;  5K2Y A;  1B1X A;  1B51 A;  4U21 A;  4ZZA A;  5DT6 A;  3DP8 A;  4IY6 A;  1GR2 A;  1MH4 A;  4OES A;  5CBS A;  4ZE8 A;  3RTW B;  3G3H A;  1I69 A;  1SDX A;  3FJ7 A;  2Z23 A;  3CFZ A;  4OXV A;  5ISU A;  3KJ7 A;  3PPN A;  4YIC A;  2Y84 A;  4RYA A;  2UXA A;  3H3G A;  4U2R A;  1M5E A;  2RC8 A;  1URG A;  3TQL A;  1I6B A;  3HPI A;  4LQ5 A;  4QHQ A;  3ILT B;  4RJZ A;  2XX9 A;  3BBR A;  1B40 A;  4UAC A;  1UTH B;  5CM6 A;  4YMA A;  4DE8 A;  4LA9 A;  3IO4 A;  4HTG A;  3PU5 A;  3MAM A;  2UVG A;  2V93 A;  1NFT A;  2VD2 A;  3K1P A;  2DSF A;  1B5I A;  3M8U A;  1NL5 A;  2VD3 A;  1ZTY A;  5JTY B;  3TKD A;  4TQU Q;  2UVJ A;  3IK6 B;  1BP5 A;  3OEM A;  3PV0 E;  4RK2 A;  5M2V A;  4TLL B;  3OO6 A;  4H8J A;  4YZZ A;  3LR1 A;  3RPW A;  1NNT A;  5J1D A;  4F1V A;  4R2F A;  4Q0C A;  2PMS A;  1A99 A;  4XTC Q;  3FUZ A;  4TOZ A;  3H03 A;  5H8H B;  4KCC A;  2Y7I A;  3OOA A;  4ESW A;  3AXF A;  5KZT A;  2I3W A;  3ECR A;  1ZLQ A;  1TWY A;  1POT A;  3TEP A;  2X7Q A;  3MP6 A;  3FD3 A;  4NTL A;  3C31 A;  2RCB A;  1GGG A;  4PFU A;  1B3H A;  4GLI A;  4POX A;  4ZEI A;  3C32 A;  5I84 A;  4GXA A;  2B3B A; 
#chains in the Genus database with same CATH topology
 1NV7 A;  4P56 A;  4R75 A;  1Z7N E;  4XKN A;  4PDD A;  4OHN A;  3CFL A;  4RXL A;  2CZL A;  2XHD A;  2BJI A;  4PCD A;  4F19 A;  3O6H A;  2HZL A;  3G3K A;  3BIG A;  5CMM A;  1XI6 A;  5H8N B;  2ALU A;  5FHO A;  1B05 A;  4F3G A;  4PFW A;  4EQB A;  1SPI A;  1NH8 A;  5B7D A;  2AL5 A;  1SQY A;  3B6W A;  4NED A;  4QXD A;  3FV2 A;  3M3K A;  5I7I A;  5I57 B;  2D21 A;  3SEY A;  3OO9 A;  3PMX A;  2UVH A;  2DDK A;  3DM0 A;  1JNF A;  1RYO A;  4LZ7 A;  4LZ8 A;  2ZNU A;  4IY5 A;  4NF4 B;  2RIN A;  2PFZ A;  1MQD A;  3UIF A;  4KHZ E;  3HV1 A;  4G68 C;  3T0J A;  5ET7 A;  5LOM A;  3HHF A;  1QJM A;  3MVZ A;  2V3U A;  1DK4 A;  1VR5 A;  3TTL A;  1LBV A;  3W15 C;  4PQJ A;  1AOV A;  2I6E A;  2ANJ A;  4BDR A;  2V4C A;  1B0L A;  1Y3Q A;  1Y3N A;  4EF2 A;  2UYE A;  1LAH E;  5CBR A;  2GQ1 A;  1NNF A;  3VVE A;  1HSJ A;  4NF6 A;  3MYU A;  3KJT A;  4JWO A;  1INP A;  4G4P A;  2G29 A;  4DXC A;  4F3B A;  2PYY A;  1LBW A;  3MW0 A;  3R7X A;  2Q9T A;  3DEL B;  3TTK A;  4OTE A;  4U4S A;  2XXQ A;  1N7W A;  3IB2 A;  4OMB A;  3C34 A;  1HSL A;  1QUJ A;  1B52 A;  3TPA A;  2PX1 A;  3IL1 B;  3TDJ A;  5H8S A;  3EHS A;  1VSO A;  4GBV A;  4LQ2 A;  1Y4T A;  2THI A;  1OQG A;  3S9L C;  3EF7 A;  1OVT A;  1FTA A;  4PBH A;  3KBZ A;  3BIH A;  5CI5 A;  3B6Q A;  1H3D A;  4H8I A;  3L6H A;  3MBP A;  4FIM A;  4R9F A;  3VE1 B;  4F2O A;  3OO8 A;  1D9Y A;  3H4Z A;  4AS4 A;  3O97 A;  4UA8 A;  1MY0 A;  1AWB A;  3QXM A;  1LAG E;  3OD7 A;  1LST A;  3K6U A;  1QW0 A;  1SBP A;  4KD5 A;  3C36 A;  2XXK A;  1A8F A;  2OWZ A;  4JVC A;  3SEW A;  3FXQ A;  4KI0 E;  2FIE A;  2ZYN A;  5AA4 B;  3H06 B;  2GHB A;  4PAK A;  4P9K A;  3OSQ A;  4WXJ A;  3H6T A;  2PBW A;  3GBA A;  1SW2 A;  5I5P A;  2Y7R A;  1Y3P A;  3LSX A;  3PPR A;  3K4U A;  4QFN A;  3K6W A;  1IEJ A;  3U8Q A;  1NUZ A;  4OFL A;  1N3W A;  5TP9 B;  3RTF B;  1FPF A;  4NF8 B;  2ZXT A;  1FJ6 A;  3PMV A;  3K6X A;  2VHA A;  1A40 A;  4R6H A;  2VOZ A;  1JP4 A;  4ZS9 A;  2XA5 A;  5FHN A;  5CMC A;  1LBB A;  4I3E A;  5DYH A;  1JQF A;  3JZJ A;  3OEN A;  3V89 B;  3ROJ A;  3PUZ E;  2REJ A;  1B7H A;  3L6G A;  1IMA A;  2CEX A;  5AA2 D;  3O2A A;  1MPB A;  1JW5 A;  1NV2 A;  4JSD A;  3CG3 A;  1H45 A;  4PAF A;  3VXC A;  3E9X A;  4JDF A;  3N6T A;  4GWU A;  4IGT A;  3RNN A;  2Q8M A;  3FAT A;  2XXU A;  1JEV A;  5KDT B;  2O1M A;  3PPP A;  4KR5 A;  1AH5 A;  5AA2 B;  1XC1 A;  2OLB A;  3SER A;  1R1N A;  3FV1 A;  2I0C A;  2I49 A;  1IXH A;  1LBX A;  4MHF A;  2OWS A;  3C35 A;  3QAX A;  4GXS B;  1FW0 A;  1N3X A;  3UP9 A;  3OXN A;  1G0H A;  3IOW A;  4GIZ A;  4PFI A;  2RF1 A;  3BFT A;  3PUY E;  3EQ1 A;  3UGW A;  2QPQ A;  2F3B A;  3VDF A;  1MRP A;  5TPA A;  1YYZ A;  4PC9 A;  5CC2 A;  4NG7 A;  4XEQ A;  2Q2C A;  2CZH A;  2FVZ A;  2HEU A;  5ITP A;  2P3V A;  4P0I A;  2WYK A;  4GFR A;  2Y5L A;  4DI4 B;  4GWZ A;  3CR9 A;  5H8Q B;  1ZMG A;  5T3J A;  1FBC A;  1USY H;  3KSX A;  3U92 A;  4BDM A;  1PBP A;  5I2K A;  3CRB A;  3TZA A;  2B65 A;  3SEX A;  4MAG A;  2WBB A;  4KQP A;  1DCU A;  3Q25 A;  2YLN A;  5DEX B;  4KPT A;  1UQW A;  4G8H A;  4DCY A;  5I56 A;  3K1N A;  2KQZ A;  3QUF A;  3RYD A;  1Y20 A;  2UYF A;  3E79 A;  2V84 A;  1OMP A;  4C1U A;  4FBP A;  4PET A;  2F6P A;  1OIB A;  1MPC A;  5IZ3 B;  4ZEC A;  2A5T A;  4N15 A;  3RPL A;  4H6D A;  3R6U A;  2QSX A;  2I0B A;  4QFP A;  4R6Y A;  5DVI A;  4XIG Q;  3C9H A;  1EYK A;  3FXR A;  4I8C A;  4X1B A;  3ZS6 A;  2DWA A;  1M5B A;  2QS3 A;  1VFD A;  2Y7K A;  1N84 A;  4M4G A;  3N94 A;  4MLQ A;  3MP8 A;  2VPN A;  1D9V A;  4QSD A;  5A5X A;  4LN5 A;  3E13 X;  1M5C A;  1FCK A;  4ESX A;  1VDW A;  1ANF A;  5F7V A;  4FAJ A;  4GQO A;  3MPL A;  1QUL A;  1B6H A;  1MS7 A;  4EF1 A;  1NV1 A;  1H76 A;  5IZZ A;  4POW A;  4L17 A;  2Y7P A;  1KZ8 A;  4DIG A;  4XKR A;  2PT2 A;  2P2A A;  4G68 A;  2VGQ A;  2UVI A;  1D9Q A;  1UTB A;  1A54 A;  3G3I A;  3I3V A;  2OK2 A;  2Z8D A;  2DS9 A;  4R6K A;  3ONM A;  1JET A;  1IME A;  2ZNT A;  1Y1Z A;  4PBQ A;  3ODB A;  1QUK A;  1FPG A;  4HE0 A;  4G61 A;  1B32 A;  5ICT A;  4H5G A;  2P1S A;  2F3D A;  4F31 B;  2NWJ A;  3LUY A;  2CZI A;  4GWS A;  2QFL A;  4O3B A;  4U1Z A;  1QGX A;  2FHY A;  3I6V A;  4PAI A;  3MJN A;  4Q30 B;  3RY3 A;  1B3F A;  3LBS A;  1B7U A;  2H4I A;  4F1U A;  4MF3 A;  3SEU A;  3MC2 A;  1EZO A;  1URS A;  1KWH A;  5ITO A;  5CRY A;  2NUV A;  1FBE A;  4DXB A;  1Y9U A;  4Q5T A;  4X48 A;  4GX3 A;  4EXK A;  2QS1 A;  2NOO A;  2O1L A;  3TTN A;  3IOV A;  4KYS A;  4X1D A;  4AS5 A;  2PFY A;  2WYP A;  5HM4 B;  3IFC A;  2XXX A;  3HST A;  2XD3 A;  2O51 A;  4ND9 A;  1XVY A;  3E3K A;  1RDZ A;  4ELR A;  4OYV A;  5I2N A;  1XVX A;  3T22 A;  5EYG A;  3VVF A;  2PVU A;  3A09 A;  1VFE A;  1N7X A;  4Z0I A;  1QKA A;  1I6A A;  3PUW E;  1MXY A;  3PTY A;  4MLV A;  1WVJ A;  2FBP A;  1MY2 A;  5JK4 A;  4O3C A;  1PBQ A;  3HCQ A;  2I48 A;  4XFE A;  1EYI A;  1TXF A;  2DWH A;  4FED A;  4OWD A;  2HZK A;  4F29 A;  1A55 A;  1FPB A;  4BDQ A;  1R9Q A;  4KXP A;  3SET A;  1MXV A;  5JTY A;  3UA8 A;  4DLD A;  3TMG A;  3MP1 A;  1NI9 A;  2W7Y A;  1DSN A;  4ELP A;  4N8G A;  3T9X B;  2Z22 A;  2XXT A;  1IXG A;  4R73 A;  1LCT A;  1NKX A;  4I40 A;  2AYS A;  4FEC A;  5EHM A;  1B58 A;  2DE3 A;  4BDL A;  4K3F A;  4WKM A;  5I59 B;  4NF6 B;  1RKM A;  4GWO A;  3VXB A;  2HCA A;  3T9H B;  1R9L A;  4TLM B;  5H8H A;  3U65 A;  4RNS A;  1MG1 A;  5BUU A;  3KSJ A;  3IOR A;  4QFK A;  3MWB A;  5JEI A;  3OSR A;  1DBZ A;  1CNQ A;  4P1E A;  4IO4 A;  3N5L A;  1GV8 A;  4EUO A;  1EZ9 A;  4HS7 A;  4F22 A;  2PCR A;  3KFM A;  2FIX A;  5EHS A;  4IO3 A;  4QFL A;  4LVQ A;  4N8Y A;  1IIT A;  1MY3 A;  2I3V A;  2YJP A;  4C0R A;  1B46 A;  3V83 A;  4JWY A;  3USD A;  2D5W A;  1CB6 A;  3LSL A;  1SW1 A;  5EYH A;  1N76 A;  3KN7 A;  4XXU A;  5IGA A;  2ZZX A;  4GL0 A;  1USY E;  3FXB A;  2OBG A;  4JVD A;  3ISP A;  4N91 A;  1MQG A;  5DVJ A;  4H45 A;  1FQF A;  4DCX A;  4PGN A;  3FJM A;  3PPQ A;  1QVS A;  3KBR A;  1FBH A;  2DYX A;  3G3G A;  3IO6 A;  3CHG A;  4IR8 A;  4ZZE A;  3SES A;  4HE2 A;  4P47 A;  1EZP A;  4HCW A;  2OZZ A;  4QSC A;  1SYH A;  3LSW A;  1FQE A;  1FQA A;  4N13 A;  4NWC A;  1LEV A;  4GD5 A;  3QSL A;  3KC0 A;  3KN8 A;  4P11 A;  2I58 A;  2X7P A;  4RPN A;  2XWV A;  3QMF A;  4U1O A;  4G8M A;  1LCF A;  4YKI A;  4PFB A;  5F1Q A;  4R9G A;  2QS4 A;  3KG2 A;  1BIY A;  1LAF E;  3PUX E;  5ICQ A;  3DLN A;  4QBA A;  4GBW A;  1OQH A;  1RDX A;  4H0W A;  5J16 A;  4NF5 A;  5EQA A;  2KLF A;  1NV4 A;  2GRV A;  4GWY A;  4I1D A;  4MH5 A;  5FBP A;  3KGC A;  4GOT A;  2XXI A;  2CZK A;  4GX4 A;  4DDD A;  4F18 A;  4PF8 A;  2H5Y A;  4U22 A;  1FBG A;  2HHM A;  4ZED A;  3VVD A;  1Q35 A;  2XXV A;  2E0S A;  3OMB A;  1P1W A;  2Q89 A;  2HQ0 A;  1NH7 A;  4U23 A;  3MZ9 A;  3GXA A;  1IMF A;  3C4M A;  3FVG A;  3JV9 A;  3HO7 A;  3RGY A;  2AL4 A;  4O94 A;  3TCF A;  3IOU A;  3TFL A;  5LTC A;  1Q9D A;  2VT5 A;  1BKA A;  2F36 A;  1RDY A;  2O69 A;  3CG1 A;  1OLA A;  5IZ1 A;  3A3C A;  4WED A;  3VFJ A;  3U93 A;  3K2D A;  2XD2 A;  4AB5 A;  5HBC A;  1PB8 A;  4O8M A;  4GWW A;  3ZKL A;  2V3Q A;  1LBC A;  2HXW A;  2H25 A;  3TUS A;  3MVY A;  5I58 B;  1O64 A;  1CE2 A;  2O68 A;  3RN8 A;  4IGR A;  1XOC A;  1J1N A;  3Q26 A;  1IQ7 A;  3FVN A;  5DTB A;  1FTL A;  3N26 A;  5ET6 A;  3ZKK A;  4C1T A;  3BFU A;  1D3K A;  3CIJ A;  4H65 A;  1FRP A;  1DPP A;  5H8F A;  1FBF A;  3UN6 A;  4U4X A;  2ONS A;  3T9V A;  5I2K B;  4KCD A;  1TFA A;  3U1O A;  2V3T A;  5TP9 A;  4OVS A;  4ONY A;  1S7Y A;  2F8D A;  5IAI A;  4PP0 A;  1BTJ A;  4GL8 A;  1KA1 A;  4HW8 A;  4X04 A;  1FTJ A;  4P8B A;  4JXI A;  3EPE A;  4P1L A;  3HN0 A;  1MPD A;  1FQD A;  3C33 A;  3FVK A;  2ZNS A;  3Q29 A;  2A5T B;  2HPG A;  1JVY A;  1Y4C A;  2JJK A;  2RC9 A;  1BLF A;  2D3I A;  3FAS A;  2WBD A;  4O7I A;  4YKK A;  3H6U A;  3EN3 A;  4PGP A;  5K2X A;  1IXC A;  5KCJ A;  1RYX A;  1FSA A;  3ZSF A;  1IZ1 A;  4X8R A;  3SEV A;  3G3J A;  3N6U A;  5KDT A;  3K00 A;  3TOD A;  2VPO A;  4YKJ A;  5A5X B;  4F39 A;  1B5J A;  3KOT A;  2G93 A;  1NUX A;  3TEL A;  2ZMB A;  4RPO A;  3PGF A;  4N81 A;  2REG A;  2V25 A;  2FA7 A;  4GRK A;  1QUI A;  4OEU A;  4PE3 A;  1G0I A;  4G68 B;  3OEL A;  2ABH A;  2XWK A;  4DZ1 A;  1UTB B;  1ZKB A;  2DOJ A;  1A8E A;  2XXP A;  3MZB A;  1Q1K A;  4OET A;  3VV5 A;  3K02 A;  3K0V A;  1P1U A;  3GZG A;  1ZU0 A;  5BWJ A;  4F3S A;  3T9U A;  2HAV A;  2GFE A;  4NAP A;  2F7C A;  4XF5 A;  3G7W A;  2F78 A;  4OFJ A;  3CVG A;  2IA4 A;  4G8N A;  1K9Z A;  2B3F A;  3O29 A;  4EQ9 A;  4OA4 A;  5DEX A;  2GH9 A;  3QK6 A;  4YU0 A;  3UK4 A;  3BKI B;  3MPK A;  3SDF A;  1NMU A;  2F34 A;  3V5A A;  4LUB A;  1SW4 A;  5DVF A;  2DWJ A;  4XKQ A;  3GLB A;  4JSO A;  1FPL A;  5IZ3 A;  3E78 A;  3RUM A;  2O7I A;  2OWT A;  2DXR A;  1MXW A;  5TU0 A;  3FVO A;  3FIR A;  1AL3 A;  4OAN A;  1URD A;  3HHG A;  4MFI A;  4I62 A;  2Q8J A;  5F24 A;  1LFI A;  4R72 A;  4GF8 A;  4ZEK A;  3VLV A;  1P1N A;  1MH3 A;  2HAU A;  1AIV A;  4IB2 A;  2ONK E;  2DE2 A;  3K6V A;  4BLA A;  4FE8 A;  1MM7 A;  3IB1 A;  5I2N B;  3OEK A;  2R9J A;  1MXU A;  1GTK A;  5B70 A;  3W9V A;  2VP1 A;  4KFQ A;  1S50 A;  4YB5 A;  1PC3 A;  2XX8 A;  2XXY A;  4Q8R A;  4GVO A;  3KN3 A;  4PFR A;  4OZ9 A;  2ZZV A;  4DXU A;  2Z8F A;  2I4B A;  3B7D A;  2NXO A;  3IX1 A;  4LAT A;  4LP2 B;  4I3Y A;  1I6Q A;  2R6G E;  1B3L A;  3O9P A;  4O3A A;  4YB7 A;  5EYF A;  1B2H A;  1AMF A;  3S2V A;  5AA3 A;  5DW8 A;  2KR0 A;  3MUQ A;  3PUV E;  4OER A;  2F6G A;  1H43 A;  1SI1 A;  1WDN A;  2ONR A;  2QMW A;  1SI0 A;  4HCY A;  4JWX A;  2F5X A;  4M1V A;  2DXY A;  1JW4 A;  4XKP A;  4PFY A;  1S9T A;  1R6Z A;  1P99 A;  4OEV A;  1JEU A;  3VLU A;  2F7B A;  2FNC A;  4N6P A;  1FPE A;  4DI3 D;  4RA1 A;  1UTH A;  2XXH A;  3E4R A;  4G2Z A;  3PD9 A;  4OQO A;  2DE4 A;  5ET5 A;  3IOT A;  4G77 A;  4YAH X;  3I5O A;  1B0H A;  1UIV A;  4JB7 A;  2WKY A;  2ZYO A;  3RLF E;  2Q2A A;  2BJJ X;  4NMY A;  3PD8 A;  4IO5 A;  4JBZ A;  1O7T A;  3GBB A;  3B50 A;  1EYJ A;  2QVU A;  2ZYM A;  3P7I A;  1ELJ A;  1B4H A;  2X26 A;  4YKP A;  5FTI A;  1L5T A;  1MY4 A;  5HPQ A;  3KOS A;  4FJP A;  2O84 X;  1WOD A;  3MZ1 A;  1XS5 A;  4H67 A;  1MM6 A;  2NVU B;  1UIU A;  3W9W A;  1MDP 1;  3F11 A;  1IMC A;  3TTM A;  3SZP A;  1YAE A;  3THI A;  2DWI A;  1HSE A;  4OVP A;  4OFO A;  4PF6 A;  1DOT A;  4ZEB A;  3IJO B;  3HFU A;  4GWX A;  3V8X B;  4R2B A;  2QMX A;  2RC7 A;  1NV3 A;  2QJE A;  3T66 A;  1FPD A;  4IO2 A;  2HXR A;  4N07 A;  3OO7 A;  2RKM A;  3PPO A;  2WEF A;  2ESN A;  4ECF A;  3U94 A;  3EHU A;  2LAO A;  1LB9 A;  4HXV A;  3TCH A;  1N0T A;  3VLW A;  4F2Q A;  3B6T A;  3RT6 B;  2XX7 A;  1M5D A;  5FTH A;  3IB0 A;  4OEN A;  2M8C A;  2Q88 A;  1ZJL A;  5L8D A;  1FJ9 A;  2CEY A;  2FYI A;  1OLC A;  1PEB A;  4H46 A;  3O6G A;  1ATG A;  3MVW A;  5H8N A;  2Z8E A;  4QF9 A;  1FTK A;  3WAE A;  2YPN A;  4NF5 B;  1NNP A;  1B3E A;  2OJT A;  1B1H A;  5EQ8 A;  5I59 A;  5I57 A;  3S9N C;  5I3S A;  4MMP A;  3H6V A;  1TT1 A;  3S9E A;  1EH3 A;  3H7M A;  4RK9 A;  1EU8 A;  1MY1 A;  2H9B A;  4OVJ A;  1LGB C;  4NF4 A;  4NX1 A;  2F97 A;  3K01 A;  4OVT A;  4AQ4 A;  3KEI A;  3MQ9 A;  4QSE A;  1YTV A;  2IEE A;  1PB7 A;  3U72 A;  4LON B;  4OVQ A;  4O7M A;  3O28 A;  1Y1M A;  1B9J A;  5FHM A;  4OVR A;  5IKB A;  1P1O A;  3JYR A;  3IJX B;  2PT1 A;  3DP4 A;  4EXL A;  3A3U A;  1NV6 A;  3T96 B;  1MXX A;  3LSF B;  5L9M A;  1XT8 A;  3R26 A;  3M3F A;  1FPI A;  1QKB A;  1LFG A;  4R74 A;  3H6W A;  4NQ8 A;  4E0X A;  5A5L A;  3O66 A;  3IAZ A;  1US5 A;  2HFB A;  2P3N A;  4BDO A;  1B3G A;  2MKZ A;  4YMB A;  3SKP A;  4THI A;  4ELO A;  1MQJ A;  4H1X A;  2OCU A;  5ELV A;  1LLS A;  3IFA A;  1FPK A;  4EQ7 A;  2CMO A;  2E1S A;  1POY 1;  1T0K A;  2Q74 A;  2GHA A;  4ELQ A;  3TQW A;  2XWI A;  4PTK A;  3FZV A;  4KYD A;  1FTO A;  1M5F A;  1FQC A;  4N17 A;  4NWD A;  3LUZ A;  1Z7M E;  5H8F B;  1ZBM A;  4IO7 A;  1B7Z A;  1DMB A;  1KA0 A;  2I4C A;  1DTZ A;  5CMB A;  1VE4 A;  4ZDM A;  1BK4 A;  3FXU A;  2XXR A;  4LZ5 A;  1YPN A;  3T1B A;  3NOH A;  5IM2 A;  1SW5 A;  4FAT A;  2F35 A;  5TPA B;  4IO6 A;  1FQB A;  4AB6 A;  3D1R A;  4UAB A;  1MQH A;  4JVI A;  3Q27 A;  3CSG A;  4KYE A;  1OVB A;  1SVX B;  3FBP A;  1NUW A;  3IR1 A;  1US4 A;  2RCA A;  5AA4 A;  5ESY A;  4P0G A;  1TFD A;  2XXW A;  4MJO A;  3EHT A;  3FGS A;  3S9M C;  2O6A A;  1MXZ A;  4MEV A;  4X9T A;  5KCJ B;  4P3L A;  1ZIU A;  1PB9 A;  3TCG A;  2ZYK A;  4ZE9 A;  3QUJ A;  1N04 A;  1H44 A;  1IUD A;  1NUY A;  4H5F A;  1K9Y A;  4MX6 A;  4NF8 A;  1P1Q A;  1SD3 A;  1YCJ A;  1O63 A;  5I56 B;  3M3L A;  3EKI A;  1LFH A;  3S4U A;  1LB8 A;  4QRZ A;  4MNI A;  3TTR A;  5L9S A;  1NV0 A;  2DQV A;  1FTM A;  4NF0 A;  3LV0 A;  2F7A A;  2A5S A;  4Z7E A;  1LAX A;  3RPL B;  1A7L A;  3T93 B;  3QIM A;  5LDZ A;  4ISU A;  2ZZW A;  4QFO A;  5L9O A;  3RQT A;  4F1Y A;  4E0W A;  5I58 A;  2Y7W A;  3CFX A;  1B4Z A;  4BDN A;  4NE4 A;  1DTG A;  3DP6 A;  4EDP A;  2Y5K A;  2R8T A;  3KC1 A;  5AA2 A;  4MNC A;  4FEB A;  4WEP A;  3RT8 A;  1JVX A;  2AIX A;  2P0S A;  1B5H A;  3CSB A;  1XHY A;  1GVC A;  3KZG A;  4ZEF A;  2QL3 A;  1DPE A;  5EQ9 A;  3D4C A;  1YXI A;  1F9B A;  3FJG A;  1JW1 A;  4PE5 B;  1D4N A;  3MVX A;  1IIW A;  4PFT A;  1PDA A;  2QS2 A;  1NV5 A;  3CI8 A;  4F3P A;  1MQI A;  2H99 A;  4N4U A;  4I9D A;  3O6I A;  3LC8 A;  5AA1 A;  4MIJ A;  4N6K A;  1IXI A;  3K1M A;  2B4L A;  4YB6 A;  5H8Q A;  3MST A;  3ILU B;  1FPJ A;  2O7U A;  3QYT A;  5CMK A;  1II5 A;  1MDQ A;  3WAF A;  2QRY A;  5EQ7 A;  1NNK A;  5AE4 A;  4RY1 A;  1SYI A;  2DP8 A;  4FOR A;  2H98 A;  4PDH A;  3TYH A;  4NHB A;  2DVZ A;  2QVV A;  3G3F A;  3Q28 A;  4MBP A;  3D4G A;  2DVC A;  2R71 A;  3PMW A;  3TAJ A;  3UOR A;  5K2Y A;  1B1X A;  1B51 A;  4U21 A;  4ZZA A;  5DT6 A;  3DP8 A;  4IY6 A;  1GR2 A;  1MH4 A;  4OES A;  5CBS A;  1LBZ A;  4ZE8 A;  3RTW B;  3G3H A;  1I69 A;  1SDX A;  3FJ7 A;  2Z23 A;  3CFZ A;  4OXV A;  5ISU A;  3KJ7 A;  4GX6 A;  3PPN A;  4YIC A;  2Y84 A;  4RYA A;  5ET8 A;  2UXA A;  3H3G A;  1IMD A;  4U2R A;  1M5E A;  2RC8 A;  1URG A;  2L5V A;  3TQL A;  1I6B A;  3HPI A;  4LQ5 A;  4QHQ A;  3ILT B;  3GYY A;  4RJZ A;  2XX9 A;  3BBR A;  1B40 A;  4UAC A;  1UTH B;  5CM6 A;  4YMA A;  4DE8 A;  4LA9 A;  3IO4 A;  4HTG A;  3PU5 A;  3MAM A;  2UVG A;  2V93 A;  1NFT A;  2VD2 A;  1FBP A;  3K1P A;  1FBD A;  2DSF A;  2OX3 A;  1B5I A;  3M8U A;  1NL5 A;  2VD3 A;  1ZTY A;  5JTY B;  3TKD A;  4TQU Q;  2UVJ A;  3IK6 B;  1BP5 A;  4HE1 A;  4MNP A;  3OEM A;  3PV0 E;  4RK2 A;  3A29 A;  4TLL B;  5M2V A;  3OO6 A;  4H8J A;  4YZZ A;  3LR1 A;  3RPW A;  1IMB A;  1NNT A;  2B4M A;  4NGU A;  5J1D A;  4F1V A;  4R2F A;  4Q0C A;  2PMS A;  1A99 A;  4XTC Q;  3FUZ A;  4TOZ A;  3H03 A;  4NN3 A;  5H8H B;  4KCC A;  2Y7I A;  3OOA A;  4ESW A;  3AXF A;  4MCO A;  5KZT A;  2I3W A;  3ECR A;  1ZLQ A;  2QVR A;  2XWO A;  1TWY A;  1LBY A;  1POT A;  3TEP A;  2X7Q A;  3MP6 A;  2WX9 A;  3FD3 A;  4NTL A;  3C31 A;  3B8B A;  1YZ0 A;  2RCB A;  1GGG A;  4PFU A;  1B3H A;  4GLI A;  4POX A;  4ZEI A;  3C32 A;  4N6D A;  5I84 A;  4GXA A;  2B3B A; 
#chains in the Genus database with same CATH homology
 4R75 A;  1Z7N E;  4XKN A;  4OHN A;  3CFL A;  4RXL A;  2CZL A;  2XHD A;  4F19 A;  3O6H A;  2HZL A;  3G3K A;  5CMM A;  5H8N B;  2ALU A;  5FHO A;  1B05 A;  4F3G A;  4PFW A;  4EQB A;  1NH8 A;  5B7D A;  2AL5 A;  1SQY A;  3B6W A;  4NED A;  3FV2 A;  3M3K A;  5I57 B;  2D21 A;  3SEY A;  3OO9 A;  3PMX A;  2UVH A;  3DM0 A;  1JNF A;  1RYO A;  4LZ7 A;  4LZ8 A;  2ZNU A;  4IY5 A;  4NF4 B;  2RIN A;  1MQD A;  3UIF A;  4KHZ E;  3HV1 A;  4G68 C;  5LOM A;  3HHF A;  1QJM A;  3MVZ A;  2V3U A;  1VR5 A;  3TTL A;  3W15 C;  4PQJ A;  1AOV A;  2I6E A;  2ANJ A;  4BDR A;  1B0L A;  1Y3Q A;  1Y3N A;  4EF2 A;  2UYE A;  1LAH E;  5CBR A;  1NNF A;  3VVE A;  1HSJ A;  4NF6 A;  3KJT A;  4JWO A;  4G4P A;  2G29 A;  4DXC A;  4F3B A;  2PYY A;  3MW0 A;  3R7X A;  2Q9T A;  3DEL B;  3TTK A;  4OTE A;  4U4S A;  2XXQ A;  1N7W A;  3IB2 A;  4OMB A;  3C34 A;  1HSL A;  1QUJ A;  1B52 A;  3TPA A;  2PX1 A;  3IL1 B;  3TDJ A;  5H8S A;  3EHS A;  1VSO A;  4LQ2 A;  1Y4T A;  2THI A;  1OQG A;  3S9L C;  3EF7 A;  1OVT A;  5CI5 A;  3B6Q A;  1H3D A;  4H8I A;  3L6H A;  3MBP A;  4FIM A;  4R9F A;  3VE1 B;  4F2O A;  3OO8 A;  1D9Y A;  3H4Z A;  3O97 A;  4UA8 A;  1MY0 A;  3QXM A;  1LAG E;  3OD7 A;  1LST A;  3K6U A;  1QW0 A;  1SBP A;  4KD5 A;  3C36 A;  1A8F A;  3SEW A;  3FXQ A;  4KI0 E;  2ZYN A;  5AA4 B;  3H06 B;  2GHB A;  3OSQ A;  4WXJ A;  3H6T A;  2PBW A;  3GBA A;  1SW2 A;  2Y7R A;  1Y3P A;  3LSX A;  3PPR A;  3K4U A;  3K6W A;  4QFN A;  1IEJ A;  3U8Q A;  4OFL A;  1N3W A;  5TP9 B;  3RTF B;  4NF8 B;  2ZXT A;  3PMV A;  3K6X A;  2VHA A;  1A40 A;  4R6H A;  2VOZ A;  4ZS9 A;  5FHN A;  5CMC A;  1LBB A;  5DYH A;  1JQF A;  3JZJ A;  3OEN A;  3V89 B;  3PUZ E;  2REJ A;  1B7H A;  3L6G A;  5AA2 D;  3O2A A;  1MPB A;  1JW5 A;  4JSD A;  3CG3 A;  1H45 A;  3VXC A;  3E9X A;  4JDF A;  3N6T A;  4IGT A;  3RNN A;  3FAT A;  2XXU A;  1JEV A;  5KDT B;  2O1M A;  3PPP A;  4KR5 A;  1AH5 A;  5AA2 B;  1XC1 A;  2OLB A;  3SER A;  1R1N A;  3FV1 A;  2I0C A;  2I49 A;  1IXH A;  2OWS A;  3C35 A;  3QAX A;  4GXS B;  1FW0 A;  1N3X A;  3UP9 A;  3OXN A;  3IOW A;  4GIZ A;  2RF1 A;  3BFT A;  3PUY E;  3EQ1 A;  3UGW A;  2QPQ A;  3VDF A;  1MRP A;  5TPA A;  5CC2 A;  2Q2C A;  2HEU A;  5ITP A;  4P0I A;  4GFR A;  3CR9 A;  5H8Q B;  1ZMG A;  1USY H;  3KSX A;  3U92 A;  4BDM A;  1PBP A;  5I2K A;  3CRB A;  3TZA A;  2B65 A;  3SEX A;  4KQP A;  3Q25 A;  2YLN A;  5DEX B;  4KPT A;  1UQW A;  4G8H A;  4DCY A;  5I56 A;  3K1N A;  3QUF A;  1Y20 A;  2UYF A;  2V84 A;  1OMP A;  4C1U A;  4PET A;  2F6P A;  1OIB A;  1MPC A;  4ZEC A;  2A5T A;  4H6D A;  3R6U A;  2QSX A;  2I0B A;  4QFP A;  4R6Y A;  5DVI A;  4XIG Q;  3C9H A;  3FXR A;  4I8C A;  4X1B A;  3ZS6 A;  2DWA A;  1M5B A;  2QS3 A;  1VFD A;  2Y7K A;  1N84 A;  4M4G A;  3N94 A;  4MLQ A;  3MP8 A;  1D9V A;  4QSD A;  5A5X A;  3E13 X;  1M5C A;  1FCK A;  4ESX A;  1ANF A;  5F7V A;  4FAJ A;  4GQO A;  3MPL A;  1QUL A;  1B6H A;  1MS7 A;  4EF1 A;  1H76 A;  4POW A;  4L17 A;  2Y7P A;  4DIG A;  4XKR A;  2PT2 A;  2P2A A;  4G68 A;  2VGQ A;  2UVI A;  1UTB A;  1A54 A;  3G3I A;  3I3V A;  2OK2 A;  2Z8D A;  2DS9 A;  4R6K A;  3ONM A;  1JET A;  2ZNT A;  1Y1Z A;  3ODB A;  1QUK A;  1B32 A;  5ICT A;  4H5G A;  2P1S A;  4F31 B;  2NWJ A;  3LUY A;  4O3B A;  4U1Z A;  3I6V A;  3MJN A;  4Q30 B;  3RY3 A;  1B3F A;  3LBS A;  1B7U A;  2H4I A;  4F1U A;  4MF3 A;  3SEU A;  3MC2 A;  1EZO A;  1URS A;  1KWH A;  5ITO A;  5CRY A;  2NUV A;  4DXB A;  1Y9U A;  4Q5T A;  4X48 A;  4EXK A;  2QS1 A;  2NOO A;  2O1L A;  3TTN A;  3IOV A;  4KYS A;  4X1D A;  5HM4 B;  2XXX A;  3HST A;  2XD3 A;  2O51 A;  4ND9 A;  1XVY A;  3E3K A;  4ELR A;  4OYV A;  5I2N A;  1XVX A;  3T22 A;  3VVF A;  2PVU A;  3A09 A;  1VFE A;  1N7X A;  4Z0I A;  1QKA A;  1I6A A;  3PUW E;  1MXY A;  4MLV A;  1WVJ A;  1MY2 A;  5JK4 A;  4O3C A;  1PBQ A;  3HCQ A;  2I48 A;  1TXF A;  2DWH A;  4FED A;  4OWD A;  2HZK A;  4F29 A;  1A55 A;  4BDQ A;  1R9Q A;  3SET A;  1MXV A;  5JTY A;  3UA8 A;  4DLD A;  3TMG A;  3MP1 A;  2W7Y A;  1DSN A;  4ELP A;  3T9X B;  2Z22 A;  2XXT A;  1IXG A;  4R73 A;  1LCT A;  1NKX A;  2AYS A;  4FEC A;  5EHM A;  1B58 A;  2DE3 A;  4BDL A;  4K3F A;  4WKM A;  5I59 B;  4NF6 B;  1RKM A;  4GWO A;  3VXB A;  2HCA A;  3T9H B;  1R9L A;  4TLM B;  5H8H A;  4RNS A;  1MG1 A;  5BUU A;  3KSJ A;  3IOR A;  4QFK A;  3MWB A;  5JEI A;  3OSR A;  4IO4 A;  3N5L A;  1GV8 A;  4EUO A;  1EZ9 A;  4HS7 A;  4F22 A;  3KFM A;  5EHS A;  4IO3 A;  4QFL A;  4LVQ A;  1IIT A;  4C0R A;  1MY3 A;  2I3V A;  2YJP A;  1B46 A;  3V83 A;  4JWY A;  3USD A;  2D5W A;  1CB6 A;  3LSL A;  1SW1 A;  1N76 A;  3KN7 A;  4XXU A;  4GL0 A;  1USY E;  2OBG A;  1MQG A;  5DVJ A;  1FQF A;  4DCX A;  3FJM A;  3PPQ A;  1QVS A;  3KBR A;  2DYX A;  3G3G A;  3IO6 A;  4ZZE A;  3SES A;  1EZP A;  4HCW A;  2OZZ A;  4QSC A;  1SYH A;  3LSW A;  1FQE A;  1FQA A;  4N13 A;  4NWC A;  4GD5 A;  3QSL A;  3KN8 A;  4P11 A;  2I58 A;  2X7P A;  4RPN A;  4U1O A;  4G8M A;  1LCF A;  4YKI A;  5F1Q A;  4R9G A;  2QS4 A;  3KG2 A;  1BIY A;  1LAF E;  3PUX E;  5ICQ A;  3DLN A;  1OQH A;  4H0W A;  4NF5 A;  2KLF A;  2GRV A;  4I1D A;  4MH5 A;  3KGC A;  4GOT A;  2XXI A;  4DDD A;  4F18 A;  2H5Y A;  4U22 A;  4ZED A;  3VVD A;  1Q35 A;  2XXV A;  2E0S A;  3OMB A;  1P1W A;  2Q89 A;  2HQ0 A;  1NH7 A;  4U23 A;  3MZ9 A;  3GXA A;  3C4M A;  3FVG A;  3JV9 A;  3HO7 A;  3RGY A;  2AL4 A;  3TCF A;  3IOU A;  3TFL A;  1BKA A;  2F36 A;  2O69 A;  3CG1 A;  1OLA A;  3A3C A;  4WED A;  3VFJ A;  3U93 A;  3K2D A;  2XD2 A;  4AB5 A;  5HBC A;  1PB8 A;  3ZKL A;  2V3Q A;  1LBC A;  2HXW A;  2H25 A;  3TUS A;  3MVY A;  5I58 B;  1O64 A;  1CE2 A;  2O68 A;  3RN8 A;  4IGR A;  1XOC A;  1J1N A;  3Q26 A;  1IQ7 A;  3FVN A;  5DTB A;  1FTL A;  3N26 A;  3ZKK A;  4C1T A;  3BFU A;  1D3K A;  3CIJ A;  4H65 A;  1DPP A;  5H8F A;  3UN6 A;  4U4X A;  2ONS A;  3T9V A;  5I2K B;  4KCD A;  1TFA A;  3U1O A;  2V3T A;  5TP9 A;  4ONY A;  1S7Y A;  2F8D A;  5IAI A;  4PP0 A;  1BTJ A;  4HW8 A;  4GL8 A;  1FTJ A;  4JXI A;  3EPE A;  3HN0 A;  1MPD A;  1FQD A;  3C33 A;  3FVK A;  2ZNS A;  3Q29 A;  2A5T B;  1JVY A;  1Y4C A;  2RC9 A;  1BLF A;  2D3I A;  3FAS A;  4YKK A;  3H6U A;  3EN3 A;  5K2X A;  1IXC A;  5KCJ A;  1RYX A;  3ZSF A;  1IZ1 A;  3SEV A;  3G3J A;  3N6U A;  5KDT A;  3K00 A;  3TOD A;  4YKJ A;  5A5X B;  4F39 A;  1B5J A;  3KOT A;  2G93 A;  3TEL A;  2ZMB A;  4RPO A;  3PGF A;  2REG A;  2V25 A;  2FA7 A;  4GRK A;  1QUI A;  4OEU A;  4G68 B;  3OEL A;  2ABH A;  4DZ1 A;  1UTB B;  1ZKB A;  2DOJ A;  1A8E A;  2XXP A;  3MZB A;  1Q1K A;  4OET A;  3VV5 A;  3K02 A;  3K0V A;  1P1U A;  3GZG A;  1ZU0 A;  5BWJ A;  4F3S A;  3T9U A;  2HAV A;  2GFE A;  2F7C A;  3G7W A;  2F78 A;  4OFJ A;  3CVG A;  2IA4 A;  4G8N A;  2B3F A;  3O29 A;  4EQ9 A;  5DEX A;  2GH9 A;  3QK6 A;  4YU0 A;  3UK4 A;  3BKI B;  3MPK A;  3SDF A;  1NMU A;  2F34 A;  3V5A A;  4LUB A;  1SW4 A;  5DVF A;  2DWJ A;  4XKQ A;  3GLB A;  4JSO A;  3RUM A;  2O7I A;  2OWT A;  2DXR A;  1MXW A;  5TU0 A;  3FVO A;  3FIR A;  1AL3 A;  1URD A;  3HHG A;  4MFI A;  4I62 A;  2Q8J A;  1LFI A;  4R72 A;  4GF8 A;  4ZEK A;  3VLV A;  1P1N A;  1MH3 A;  2HAU A;  1AIV A;  4IB2 A;  2ONK E;  2DE2 A;  3K6V A;  4BLA A;  4FE8 A;  1MM7 A;  3IB1 A;  5I2N B;  3OEK A;  2R9J A;  1MXU A;  1GTK A;  5B70 A;  3W9V A;  2VP1 A;  4KFQ A;  1S50 A;  4YB5 A;  1PC3 A;  2XX8 A;  4Q8R A;  2XXY A;  4GVO A;  3KN3 A;  4OZ9 A;  4DXU A;  2Z8F A;  2I4B A;  3B7D A;  2NXO A;  3IX1 A;  4LAT A;  4LP2 B;  1I6Q A;  2R6G E;  1B3L A;  3O9P A;  4O3A A;  4YB7 A;  5EYF A;  1B2H A;  1AMF A;  3S2V A;  5AA3 A;  3MUQ A;  3PUV E;  4OER A;  2F6G A;  1H43 A;  1SI1 A;  1WDN A;  2ONR A;  2QMW A;  1SI0 A;  4HCY A;  4JWX A;  2F5X A;  4M1V A;  2DXY A;  1JW4 A;  4XKP A;  4PFY A;  1S9T A;  1R6Z A;  1P99 A;  4OEV A;  1JEU A;  3VLU A;  2F7B A;  2FNC A;  4N6P A;  4RA1 A;  1UTH A;  2XXH A;  3E4R A;  4G2Z A;  3PD9 A;  4OQO A;  2DE4 A;  3IOT A;  4G77 A;  4YAH X;  3I5O A;  1B0H A;  1UIV A;  4JB7 A;  2WKY A;  2ZYO A;  3RLF E;  2Q2A A;  2BJJ X;  4NMY A;  3PD8 A;  4IO5 A;  4JBZ A;  1O7T A;  3GBB A;  2ZYM A;  3P7I A;  1ELJ A;  1B4H A;  2X26 A;  4YKP A;  5FTI A;  1L5T A;  1MY4 A;  5HPQ A;  3KOS A;  4FJP A;  2O84 X;  1WOD A;  3MZ1 A;  1XS5 A;  4H67 A;  1MM6 A;  2NVU B;  1UIU A;  3W9W A;  1MDP 1;  3F11 A;  3TTM A;  1YAE A;  3THI A;  2DWI A;  1HSE A;  4OFO A;  1DOT A;  4ZEB A;  3IJO B;  3V8X B;  4R2B A;  2QMX A;  2RC7 A;  2QJE A;  3T66 A;  4IO2 A;  4N07 A;  3OO7 A;  2RKM A;  3PPO A;  2ESN A;  4ECF A;  3U94 A;  3EHU A;  2LAO A;  1LB9 A;  3TCH A;  1N0T A;  3VLW A;  4F2Q A;  3B6T A;  3RT6 B;  2XX7 A;  1M5D A;  5FTH A;  3IB0 A;  4OEN A;  2M8C A;  2Q88 A;  1ZJL A;  5L8D A;  2FYI A;  1OLC A;  1PEB A;  3O6G A;  1ATG A;  3MVW A;  5H8N A;  2Z8E A;  4QF9 A;  1FTK A;  3WAE A;  2YPN A;  4NF5 B;  1NNP A;  1B3E A;  2OJT A;  1B1H A;  5I59 A;  5I57 A;  3S9N C;  3H6V A;  1TT1 A;  3S9E A;  1EH3 A;  3H7M A;  4RK9 A;  1EU8 A;  1MY1 A;  2H9B A;  4OVJ A;  1LGB C;  4NF4 A;  2F97 A;  3K01 A;  4AQ4 A;  3KEI A;  3MQ9 A;  4QSE A;  1YTV A;  2IEE A;  1PB7 A;  3U72 A;  4LON B;  3O28 A;  1Y1M A;  1B9J A;  5FHM A;  5IKB A;  1P1O A;  3JYR A;  3IJX B;  2PT1 A;  3DP4 A;  4EXL A;  3A3U A;  3T96 B;  1MXX A;  3LSF B;  5L9M A;  1XT8 A;  3R26 A;  3M3F A;  1QKB A;  1LFG A;  4R74 A;  3H6W A;  4E0X A;  3O66 A;  3IAZ A;  1US5 A;  2HFB A;  4BDO A;  1B3G A;  4YMB A;  3SKP A;  4THI A;  4ELO A;  1MQJ A;  4H1X A;  2OCU A;  5ELV A;  1LLS A;  4EQ7 A;  2CMO A;  2E1S A;  1POY 1;  1T0K A;  2GHA A;  4ELQ A;  3TQW A;  3FZV A;  4KYD A;  1FTO A;  1M5F A;  1FQC A;  4NWD A;  1Z7M E;  5H8F B;  1ZBM A;  4IO7 A;  1B7Z A;  1DMB A;  2I4C A;  1DTZ A;  5CMB A;  1VE4 A;  4ZDM A;  3FXU A;  2XXR A;  4LZ5 A;  1YPN A;  1SW5 A;  4FAT A;  2F35 A;  5TPA B;  4IO6 A;  1FQB A;  4AB6 A;  1MQH A;  3Q27 A;  3CSG A;  4KYE A;  1OVB A;  1SVX B;  3IR1 A;  1US4 A;  2RCA A;  5AA4 A;  4P0G A;  1TFD A;  2XXW A;  3EHT A;  3FGS A;  3S9M C;  2O6A A;  1MXZ A;  4X9T A;  5KCJ B;  1ZIU A;  1PB9 A;  3TCG A;  2ZYK A;  4ZE9 A;  3QUJ A;  1N04 A;  1H44 A;  1IUD A;  4H5F A;  4NF8 A;  1P1Q A;  1SD3 A;  1YCJ A;  1O63 A;  5I56 B;  3M3L A;  1LFH A;  3S4U A;  1LB8 A;  4QRZ A;  3TTR A;  5L9S A;  2DQV A;  1FTM A;  2F7A A;  2A5S A;  4Z7E A;  1LAX A;  1A7L A;  3T93 B;  3QIM A;  4ISU A;  4QFO A;  5L9O A;  3RQT A;  4F1Y A;  4E0W A;  5I58 A;  2Y7W A;  3CFX A;  1B4Z A;  4BDN A;  4NE4 A;  1DTG A;  3DP6 A;  4EDP A;  5AA2 A;  4FEB A;  4WEP A;  3RT8 A;  1JVX A;  2AIX A;  2P0S A;  1B5H A;  3CSB A;  1XHY A;  1GVC A;  3KZG A;  4ZEF A;  2QL3 A;  1DPE A;  3D4C A;  1F9B A;  3FJG A;  1JW1 A;  4PE5 B;  1D4N A;  3MVX A;  1IIW A;  4PFT A;  1PDA A;  2QS2 A;  3CI8 A;  4F3P A;  1MQI A;  2H99 A;  4I9D A;  3O6I A;  3LC8 A;  5AA1 A;  1IXI A;  5H8Q A;  3K1M A;  4YB6 A;  3ILU B;  2O7U A;  3QYT A;  5CMK A;  1II5 A;  1MDQ A;  3WAF A;  2QRY A;  5AE4 A;  1NNK A;  4RY1 A;  1SYI A;  2DP8 A;  4FOR A;  2H98 A;  3TYH A;  2DVZ A;  3G3F A;  3Q28 A;  4MBP A;  3D4G A;  2DVC A;  3TAJ A;  2R71 A;  3PMW A;  3UOR A;  5K2Y A;  1B1X A;  1B51 A;  4U21 A;  4ZZA A;  5DT6 A;  3DP8 A;  4IY6 A;  1GR2 A;  1MH4 A;  4OES A;  5CBS A;  4ZE8 A;  3RTW B;  3G3H A;  1I69 A;  1SDX A;  3FJ7 A;  2Z23 A;  3CFZ A;  4OXV A;  5ISU A;  3KJ7 A;  3PPN A;  4YIC A;  2Y84 A;  4RYA A;  2UXA A;  3H3G A;  4U2R A;  1M5E A;  2RC8 A;  1URG A;  3TQL A;  1I6B A;  3HPI A;  4LQ5 A;  4QHQ A;  3ILT B;  4RJZ A;  2XX9 A;  3BBR A;  1B40 A;  4UAC A;  1UTH B;  5CM6 A;  4YMA A;  4DE8 A;  4LA9 A;  3IO4 A;  4HTG A;  3PU5 A;  3MAM A;  2UVG A;  2V93 A;  1NFT A;  2VD2 A;  3K1P A;  2DSF A;  1B5I A;  3M8U A;  1NL5 A;  2VD3 A;  1ZTY A;  5JTY B;  3TKD A;  4TQU Q;  2UVJ A;  3IK6 B;  1BP5 A;  3OEM A;  3PV0 E;  4RK2 A;  5M2V A;  4TLL B;  3OO6 A;  4H8J A;  4YZZ A;  3LR1 A;  3RPW A;  1NNT A;  5J1D A;  4F1V A;  4R2F A;  4Q0C A;  2PMS A;  1A99 A;  4XTC Q;  3FUZ A;  4TOZ A;  3H03 A;  5H8H B;  4KCC A;  2Y7I A;  3OOA A;  4ESW A;  3AXF A;  5KZT A;  2I3W A;  3ECR A;  1ZLQ A;  1TWY A;  1POT A;  3TEP A;  2X7Q A;  3MP6 A;  3FD3 A;  4NTL A;  3C31 A;  2RCB A;  1GGG A;  4PFU A;  1B3H A;  4GLI A;  4POX A;  4ZEI A;  3C32 A;  5I84 A;  4GXA A;  2B3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...