4BDQA

Crystal structure of the gluk2 r775a lbd dimer in complex with glutamate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
253
structure length
250
Chain Sequence
SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYADKITIAILQLQEEGKLHMMKEKWWRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
publication title Correlating Efficacy and Desensitization with Gluk2 Ligand-Binding Domain Movements.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport
total genus 85
structure length 250
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdqA02
4KHZE 1DTGA 5KCJB 1L5TA 4KYSA 1NKXA 2X7PA 4F3PA 2HAUA 4GRKA 1B5IA 3QK6A 2V3UA 2UYEA 2DE2A 2AYSA 1MXWA 4BDOA 3TMGA 3C4MA 3S9LC 3T9UA 1RYOA 5H8FB 5FTHA 2ZYKA 1B52A 4FJPA 1YCJA 3SEXA 3IB2A 4F22A 3U8QA 1KWHA 5KDTB 1IITA 4FEDA 4ZECA 1B2HA 3USDA 4Q5TA 1POY1 3MP1A 3HO7A 3TELA 2XX9A 1BLFA 3FXRA 2AL5A 5ISUA 1FCKA 3C9HA 4X1DA 3ECRA 3HV1A 2Q2CA 2D5WA 3R6UA 4U23A 3LUYA 4C1UA 3TTLA 1SVXB 1M5CA 3V89B 5JK4A 1UTHA 4RK9A 1EH3A 1IUDA 4YKKA 1VE4A 3B7DA 2H25A 5ICTA 4NF6B 4KPTA 3UA8A 3FVOA 3E4RA 1YPNA 4PFYA 3C35A 5I59B 3R26A 2NOOA 3UIFA 3T93B 1SW5A 3B6QA 1GV8A 3DP4A 4E0XA 1B3LA 3EHSA 3R7XA 3GBAA 3I5OA 4MF3A 2RCBA 5KCJA 3KSJA 1ZTYA 1A8EA 4MLQA 4IY5A 1AOVA 1B4HA 2DXYA 3PU5A 2QS4A 3VLVA 1JW4A 5L8DA 4U2RA 5CM6A 1FQBA 3PPPA 4EF1A 3TKDA 4DCYA 2RCAA 2OLBA 5K2YA 4JXIA 3PPQA 5CC2A 1D4NA 1USYE 4R2FA 4LQ5A 5JEIA 4Z7EA 4H65A 1B32A 4NF4B 3THIA 3GXAA 1AIVA 4G8NA 2QS1A 5AA4B 3UN6A 3FATA 3OOAA 3QUFA 4R9GA 3PPOA 3KG2A 2I0BA 5TP9A 2GH9A 2PYYA 2PMSA 3U94A 2F97A 3I6VA 2QRYA 4IO4A 4WKMA 2ZXTA 3QUJA 2I49A 4ESWA 2AL4A 2DWIA 4U1ZA 1ZBMA 4H0WA 4FORA 1LFIA 4ZEFA 1TWYA 4Q30B 3PPRA 1FQDA 1LSTA 3PUZE 5FHNA 3G3HA 2QSXA 2QMWA 2I3WA 2QJEA 2CMOA 1FTJA 3VVDA 2UVHA 1N0TA 4XKQA 4DLDA 3UK4A 3MVXA 2DYXA 2KLFA 1CE2A 1UTBB 4U21A 2HZLA 4FAJA 3GBBA 4YAHX 1IIWA 5AA3A 1D9YA 1XT8A 4NMYA 3G3KA 3E3KA 5A5XB 1EZPA 3LR1A 3LBSA 5I57A 3AXFA 4KCCA 2Y7WA 1R9QA 2R71A 3G3IA 3GLBA 3IR1A 4Q8RA 1N7WA 2Z8DA 2OZZA 3K4UA 4NWCA 3JZJA 4I62A 4OEVA 1WVJA 4JB7A 1ATGA 3K02A 3VFJA 3N94A 4NF4A 3OENA 1R9LA 3MVWA 5JTYA 1DTZA 2F8DA 3K1NA 1MPBA 3KOSA 4P0GA 3ZKKA 5I2KB 5AA4A 3MPKA 3HN0A 2ZMBA 4PETA 2UYFA 1FQEA 1S50A 5EYFA 3RTFB 1SW2A 4DIGA 2A5SA 3TZAA 4BDNA 3FIRA 5I58A 4ZE8A 5I56B 3E13X 4L17A 3C31A 1N84A 3TPAA 5H8SA 3V83A 4IY6A 2F7AA 3SEVA 4QHQA 1PB9A 2Y7KA 3E9XA 3O9PA 1DPPA 5L9OA 2O84X 3MVZA 1QKAA 1A7LA 5TU0A 1AMFA 4HS7A 3EHUA 2HCAA 1FTLA 2DOJA 1Y3QA 3ZSFA 3S9MC 1N76A 3O6IA 4ELRA 2H4IA 1UTBA 1WDNA 3H6VA 2YPNA 3T9XB 3U72A 4FECA 1PBQA 2OBGA 3N5LA 4DXUA 4PFUA 2O1MA 3MVYA 1I6QA 3KEIA 4EQ9A 1D3KA 5A5XA 3S9NC 1XVXA 1LGBC 2YJPA 4NE4A 3U93A 3LC8A 2O6AA 3SKPA 5CMBA 3N6UA 2ZNTA 2I58A 2H5YA 4YKPA 1B3HA 3FVNA 4WEDA 4ZDMA 2UVIA 4PFTA 1UQWA 3W9VA 5ELVA 4OESA 5H8NB 1I6AA 2UVGA 1P1OA 1SBPA 2DQVA 2GHBA 5DT6A 4IO5A 4X9TA 1O64A 1MH4A 5I2KA 3CG3A 2ESNA 1UIUA 4MFIA 4EQBA 4ZE9A 4NTLA 2P1SA 4OFLA 1S7YA 2VD2A 1MXZA 1PB8A 1P1QA 5L9MA 4R6KA 4U4SA 1R6ZA 3ILTB 2XXUA 1B4ZA 4F2QA 5I2NB 3VDFA 2PT1A 2PT2A 3KGCA 3C33A 3MW0A 5CMMA 1NMUA 2CZLA 3IO4A 5I56A 1N3XA 1ZLQA 1MS7A 3IB0A 2G29A 1SYHA 3LSLA 1MY2A 2H99A 3DLNA 2M8CA 3ILUB 5L9SA 4XKRA 5FHOA 1Y3PA 4PFWA 4OFOA 1VR5A 1TFAA 4P0IA 2XX8A 3MP8A 4F1VA 1HSEA 1TXFA 2GHAA 3CFZA 3RQTA 3ODBA 2F34A 1MXVA 2V84A 2Y7RA 3O6HA 4KYDA 3TCHA 3BBRA 3O97A 4F1YA 1MQHA 1RYXA 1VFEA 4H8JA 4G77A 1LFHA 1MQGA 3A3UA 3C34A 5H8NA 1LB9A 1Y4TA 1MG1A 4R2BA 2DS9A 3N6TA 3VV5A 2DWJA 2XXHA 4OYVA 3C36A 4DZ1A 2E0SA 3KN8A 4KFQA 1Z7NE 3PUXE 4GQOA 1SD3A 2DE3A 2XXYA 3FV1A 3M3LA 4UACA 1Y20A 2QPQA 3FVKA 3KJ7A 1B9JA 4OEUA 4FE8A 1B40A 4E0WA 1J1NA 3VXCA 5ITOA 3JYRA 2REJA 4RJZA 5I2NA 4GF8A 5HBCA 4TOZA 2RF1A 1ZU0A 3QIMA 1URGA 4R9FA 2H98A 4JSDA 5M2VA 1QUJA 4M1VA 1A99A 4YMAA 4KCDA 3QYTA 3M3KA 4F18A 1OLCA 4O3AA 2ANJA 5TPAB 2REGA 4GL8A 4ZEIA 3PD8A 4YU0A 3Q26A 2A5TB 3TTRA 2O7UA 4R73A 1XVYA 3FD3A 4BDRA 1P1NA 3CFXA 4BDQA 5ITPA 4PQJA 1AL3A 1H3DA 3OSRA 1OMPA 3CSBA 4JWXA 4AB6A 1M5BA 4K3FA 5H8FA 5CBSA 2Y7PA 3EQ1A 4NWDA 4PP0A 4ZEDA 2NUVA 4GD5A 5KDTA 4R75A 4LZ8A 4RXLA 1TT1A 1LAXA 4LP2B 3H6UA 3PPNA 1P1UA 4G68B 1H45A 3RGYA 3F11A 3O6GA 4NF5B 1MM6A 3TCFA 5HM4B 1M5DA 2I4BA 4GXAA 2HXWA 1JEVA 1TFDA 4YZZA 4BDMA 4LZ5A 4OFJA 3OO7A 1Y9UA 3UP9A 2Z23A 4YB7A 2B3BA 3TQWA 1MPCA 3HHFA 1LBCA 4NF6A 3CI8A 1USYH 1B58A 2O1LA 3PMVA 1HSLA 1MH3A 2QS3A 4JWOA 1WODA 5CBRA 3TDJA 5I59A 1A40A 1ZIUA 1LBBA 3PMWA 4N07A 2V3TA 2I6EA 1MXXA 3HCQA 3H3GA 4UA8A 4OXVA 1O7TA 5DVFA 5TPAA 3P7IA 2Q9TA 1HSJA 3OELA 1T0KA 1H76A 1B46A 4BLAA 2DVZA 2I3VA 3PV0E 4AB5A 3O29A 4GOTA 4FEBA 4RPOA 4R72A 3BFUA 1GR2A 5F1QA 5IAIA 1IZ1A 3Q28A 2G93A 5H8HB 3CIJA 4N6PA 4YKIA 5HPQA 1MQIA 4G4PA 1ZKBA 5EHMA 4GXSB 1BP5A 1FTKA 4BDLA 2HEUA 1B7HA 3IO6A 5EHSA 2F78A 2NVUB 1ELJA 4KD5A 4LUBA 3KFMA 1LFGA 1MQJA 3TTMA 4G68A 2OWSA 4OETA 4TLMB 2RINA 1JVYA 1OVTA 2XD3A 4XIGQ 2DP8A 3SEUA 5AA1A 4EXLA 2Z22A 1POTA 3IOVA 3OO8A 1Y4CA 2RKMA 5KZTA 3I3VA 2ALUA 1B3EA 2I4CA 3T9HB 4H67A 4OENA 3MZ1A 4EXKA 3HHGA 2Q88A 1JETA 5AA2D 3IX1A 3HSTA 3CVGA 4GWOA 1EZOA 3ZKLA 1SDXA 4IO2A 3RPWA 3LSXA 4G8HA 3FJ7A 1NNFA 4IGTA 3G3JA 3TAJA 3KBRA 4NF8B 2HQ0A 1SQYA 5CI5A 1DOTA 2DSFA 4MBPA 1LAFE 3K6XA 1JW5A 4XXUA 4ESXA 3VLWA 4IO7A 3MP6A 2ZYMA 2XX7A 3RNNA 4QSDA 4KYEA 2B3FA 4PE5B 4U4XA 3DELB 4YMBA 2PVUA 4X48A 1QULA 1Z7ME 3K6UA 3IOUA 1MY1A 3OEMA 1PEBA 3D4GA 5H8HA 3K6VA 5CRYA 4DCXA 4QRZA 1XOCA 1DMBA 3OD7A 3QXMA 1YTVA 3T66A 4F3SA 2VOZA 1OLAA 3MWBA 1GTKA 2HZKA 2QL3A 4QFOA 1OIBA 4GLIA 2IA4A 2OWTA 4R6HA 4XKPA 4DXCA 3IB1A 1OVBA 3Q25A 3O28A 3PD9A 1R1NA 4H8IA 1JNFA 3MJNA 3TCGA 4IGRA 1Q1KA 4TLLB 3L6HA 4I1DA 4XKNA 4YICA 1ZMGA 4LZ7A 3KOTA 1M5FA 3PUWE 2RC8A 2XXPA 5DTBA 1VFDA 1IXCA 4ZS9A 4GVOA 2THIA 2V93A 2Q8JA 4GL0A 1B1XA 3RTWB 2X7QA 3MBPA 1QUKA 4RY1A 2F36A 1NL5A 1B5HA 1SI1A 4QF9A 3DP6A 4KR5A 1FQAA 4ND9A 1H44A 4ELPA 1N3WA 3PGFA 2X26A 2PBWA 2H9BA 1PDAA 3K2DA 1ANFA 3OEKA 3IJXB 1FQFA 4QFKA 3CFLA 4IO3A 4C1TA 3S4UA 2LAOA 1Y1MA 3FUZA 4LVQA 5DEXB 4FATA 1OQHA 3LSFB 3BFTA 3LSWA 5IKBA 4R74A 3CSGA 2VHAA 1NNTA 3H6TA 4X1BA 3FGSA 4U22A 5F7VA 1LB8A 1S9TA 4O3BA 2OCUA 1N7XA 2XXVA 4HW8A 4DXBA 4YB5A 5BUUA 1B51A 4ECFA 3L6GA 3MZBA 2P2AA 1IEJA 3A09A 1MY3A 3U1OA 4OQOA 1NH7A 2Z8EA 3K6WA 5AA2B 3H4ZA 5H8QB 3RT6B 1SYIA 4P11A 5FHMA 2FA7A 3Q27A 2O69A 4ELQA 2R6GE 5TP9B 1LCFA 3JV9A 5I84A 3W15C 1B05A 4KI0E 2F5XA 3VLUA 1MPDA 2ONKE 3ZS6A 1B0HA 2E1SA 1GVCA 4F29A 1LAHE 4H6DA 3TODA 1D9VA 1BTJA 3MZ9A 2XXQA 4ELOA 1Q35A 4C0RA 2XXTA 4G2ZA 2ZNSA 3QAXA 1FW0A 2F6PA 5DYHA 2V25A 4NEDA 1FTOA 3H6WA 1B7ZA 3H03A 2NXOA 2AIXA 4H1XA 1NFTA 2ONRA 3KN7A 2Q2AA 3H7MA 2UVJA 3SESA 4WEPA 5DEXA 1I69A 3A3CA 3MUQA 2VD3A 2VGQA 4LA9A 3SDFA 4LONB 3OMBA 3DM0A 3FJMA 1EU8A 1N04A 3V5AA 4QFPA 3IK6B 1US4A 3PUYE 5I57B 5BWJA 3UGWA 1A55A 1PC3A 1MY4A 4H5FA 4LATA 3EHTA 1B1HA 4ZZEA 1UIVA 1MDP1 3DP8A 3MPLA 3S9EA 4N13A 4QSCA 1DSNA 4O3CA 5DVJA 2XXRA 1NH8A 5JTYB 1BIYA 3KN3A 1QVSA 4G68C 3WAEA 2RC7A 1IXIA 3IJOB 5AA2A 3TEPA 1P1WA 5H8QA 2DXRA 3FASA 3G3FA 3T96B 1US5A 3MAMA 1MRPA 3D4CA 3MQ9A 4ZEBA 3CR9A 3VVFA 1QW0A 4JSOA 4Q0CA 2VP1A 5AE4A 4I9DA 2PX1A 2Y7IA 4QSEA 4ONYA 5I58B 1LLSA 2XD2A 2XXIA 4IB2A 2ZYNA 3WAFA 4DDDA 2D21A 4R6YA 4EQ7A 4OERA 4HCYA 3G7WA 2ONSA 1SI0A 4OVJA 1H43A 5K2XA 5ICQA 2UXAA 3KSXA 3M3FA 2GRVA 2A5TA 2XHDA 4ZEKA 3T22A 3TQLA 4RNSA 1M5EA 3O66A 1MY0A 4ISUA 5FTIA 3K1PA 2DE4A 3PMXA 3SEYA 4GIZA 3FVGA 3FXUA 1JEUA 3SETA 3C32A 4EF2A 2OK2A 2I0CA 3TTNA 4RPNA 2OJTA 4F39A 1VSOA 1ZJLA 3Q29A 4ZZAA 1MDQA 4THIA 1II5A 2B65A 1RKMA 1MXUA 1NNPA 3GZGA 2DWAA 4JWYA 1URSA 4Z0IA 1MXYA 4JDFA 4NF5A 1Y1ZA 2QMXA 1LCTA 2F7CA 3G3GA 2QS2A 1P99A 2HFBA 3IAZA 3TTKA 3IORA 1Y3NA 2ZYOA 2DWHA 3ONMA 4XTCQ 1BKAA 3TYHA 4M4GA 2W7YA 3KZGA 4EUOA 4GFRA 3RY3A 1XHYA 4OHNA 3K0VA 5B7DA 4DE8A 2WKYA 1JVXA 3FZVA 4F3BA 4MH5A 4OZ9A 3CG1A 3EN3A 3S2VA 3IOTA 2Z8FA 3H06B 4FIMA 3HPIA 1DPEA 3B6TA 1XC1A 2R9JA 3IL1B 3PUVE 1EZ9A 4YB6A 1A8FA 1PBPA 3OO9A 3U92A 4G8MA 3RLFE 1B5JA 2RC9A 3EPEA 4AQ4A 2Q89A 4KQPA 1B6HA 4RYAA 2DVCA 1FQCA 1PB7A 1B0LA 3O2AA 3VVEA 1AH5A 1QUIA 3B6WA 3T9VA 1LAGE 4F31B 4QFNA 2NWJA 4I8CA 2FNCA 3MC2A 1F9BA 1NNKA 2F6GA 3IOWA 4QFLA 3SERA 2XXWA 5CMKA 1YAEA 2P0SA 4F1UA 2FYIA 2ABHA 3KJTA 4MLVA 2BJJX 1XS5A 2GFEA 3EF7A 1IXHA 4F2OA 3K1MA 1B3FA 2O51A 1IQ7A 1OQGA 5DVIA 3RN8A 3TFLA 3OXNA 4H5GA 4TQUQ 4F19A 3OO6A 2YLNA 1QKBA 1MQDA 4LQ2A 1JW1A 3UORA 4RA1A 1CB6A 2O68A 3VE1B 2I48A 3W9WA 5J1DA 1B7UA 4JBZA 4WXJA 1IXGA 2F35A 5B70A 3M8UA 3RT8A 4EDPA 5LOMA 3QSLA 1MM7A 4OTEA 3K00A 4HTGA 2IEEA 1URDA 2ZNUA 3V8XB 1A54A 2F7BA 1UTHB 3CRBA 3SEWA 3TUSA 4IO6A 3N26A 3BKIB 3RUMA 2Y84A 1QJMA 1GGGA 4POWA 4F3GA 3K01A 1I6BA 2V3QA 4HCWA 1SW4A 1B3GA 4YKJA 4OWDA 4NF8A 1SW1A 4U1OA 4RK2A 1O63A 2HAVA 3FV2A 1JQFA 3OSQA 1FTMA 3FJGA 2O7IA 2XXXA 4OMBA 3VXBA 4POXA 3FXQA 2D3IA 5CMCA
chains in the Genus database with same CATH superfamily
4KHZE 2CZIA 1DTGA 4PGPA 5KCJB 1L5TA 4KYSA 1NKXA 2X7PA 4F3PA 2HAUA 4GRKA 1B5IA 1NV1A 3QK6A 2V3UA 2UYEA 2DE2A 2AYSA 1MXWA 4BDOA 3TMGA 3C4MA 3S9LC 3T9UA 1RYOA 2WYKA 5H8FB 5FTHA 2ZYKA 1B52A 4FJPA 1YCJA 3SEXA 3IB2A 4F22A 3U8QA 2Q8MA 1KWHA 1NV3A 5KDTB 1IITA 4FEDA 4ZECA 1B2HA 3USDA 4Q5TA 1POY1 3MP1A 2ZZWA 3HO7A 3TELA 2FHYA 2XX9A 1BLFA 3FXRA 2AL5A 5ISUA 1FCKA 3C9HA 4X1DA 4MMPA 2KR0A 3ECRA 3HV1A 2Q2CA 2D5WA 3R6UA 4U23A 3LUYA 4HE0A 4C1UA 3TTLA 1SVXB 1M5CA 3V89B 5JK4A 1UTHA 4RK9A 1EH3A 1IUDA 4YKKA 4UABA 1VE4A 3B7DA 4P47A 2H25A 2P3VA 4PDHA 5ICTA 4NF6B 4KPTA 3UA8A 3FVOA 3E4RA 1YPNA 4PFYA 3C35A 5I59B 3R26A 2NOOA 3UIFA 1YXIA 1VDWA 3T93B 1SW5A 3B6QA 1GV8A 1FBGA 3DP4A 4E0XA 5EQ8A 1B3LA 3EHSA 3R7XA 3GBAA 3I5OA 4MF3A 1FPEA 2RCBA 5KCJA 3KSJA 1ZTYA 1A8EA 4MLQA 4IY5A 1AOVA 1B4HA 2DXYA 3PU5A 5J16A 2QS4A 3VLVA 1JW4A 2F3DA 5L8DA 4U2RA 4OVTA 5CM6A 1FQBA 3D1RA 3PPPA 4EF1A 3TKDA 4PAKA 4DCYA 4XEQA 2RCAA 2OLBA 5K2YA 4JXIA 3PPQA 5CC2A 1D4NA 1USYE 4R2FA 4LQ5A 5JEIA 4Z7EA 4H65A 1B32A 4NF4B 3THIA 3GXAA 1AIVA 4G8NA 4I40A 1YYZA 2QS1A 3KC1A 5AA4B 3UN6A 3FATA 3OOAA 3QUFA 4R9GA 3PPOA 3KG2A 4NG7A 5ET8A 2I0BA 5TP9A 2GH9A 2PYYA 2PMSA 1FJ9A 3U94A 2F97A 3I6VA 2QRYA 4IO4A 4WKMA 2ZXTA 3QUJA 2I49A 4ESWA 2AL4A 2DWIA 4U1ZA 1ZBMA 4O7IA 4H0WA 4FORA 1LFIA 4ZEFA 2FBPA 1TWYA 4Q30B 2ZZXA 3PPRA 1FQDA 1LSTA 3PUZE 5FHNA 3MSTA 3G3HA 2QSXA 2QMWA 1EYIA 2I3WA 2B4MA 2QJEA 2CMOA 1FTJA 3VVDA 2UVHA 1N0TA 4XKQA 4DLDA 4NAPA 3UK4A 2CEXA 4N15A 3MVXA 2DYXA 2KLFA 1CE2A 1UTBB 4U21A 2HZLA 4FAJA 5ET7A 3GBBA 4YAHX 1IMDA 1IIWA 5AA3A 1D9YA 1XT8A 4NMYA 3G3KA 3E3KA 5A5XB 1SPIA 1EZPA 3LR1A 3LBSA 5I57A 3AXFA 4KCCA 2Y7WA 1R9QA 2R71A 3G3IA 2Q74A 1G0IA 3GLBA 3IR1A 5IZ1A 1LBXA 4Q8RA 1N7WA 2VPOA 2Z8DA 2OZZA 3K4UA 4NWCA 3JZJA 4I62A 4OEVA 1NV6A 1WVJA 4JB7A 1ATGA 3K02A 1D9QA 2QFLA 3VFJA 2FVZA 3N94A 4NF4A 3OENA 1DBZA 1R9LA 3MVWA 5JTYA 3KBZA 1DTZA 2F8DA 3K1NA 1MPBA 3KOSA 1FBHA 4P0GA 3ZKKA 5I2KB 5AA4A 3MPKA 2HHMA 3HN0A 4MIJA 2ZMBA 4PETA 4NF0A 2UYFA 1FQEA 1S50A 5EYFA 3RTFB 1SW2A 4DIGA 2A5SA 3TZAA 4BDNA 3FIRA 2HXRA 5I58A 4ZE8A 5I56B 3E13X 4L17A 3C31A 1N84A 3TPAA 5H8SA 3V83A 4IY6A 3E78A 2F7AA 3SEVA 4QHQA 5LTCA 3PTYA 2XXKA 1PB9A 2Y7KA 3E9XA 3O9PA 1DPPA 5L9OA 2O84X 3MVZA 1QKAA 1A7LA 5TU0A 1FRPA 1AMFA 4HS7A 3EHUA 2MKZA 2HCAA 1FTLA 2DOJA 1Y3QA 3ZSFA 3S9MC 1N76A 3O6IA 5ET5A 4ELRA 2H4IA 1UTBA 1WDNA 3H6VA 2YPNA 3T9XB 3U72A 4FECA 1PBQA 2OBGA 3N5LA 4GBVA 4DXUA 4PFUA 2O1MA 3MVYA 1I6QA 3KEIA 4EQ9A 1D3KA 5A5XA 3S9NC 1XVXA 1EYKA 1LGBC 2YJPA 4NE4A 3U93A 3LC8A 2O6AA 2CEYA 1FPJA 3SKPA 5CMBA 4PGNA 3N6UA 2ZNTA 4JVDA 2I58A 2H5YA 4YKPA 1B3HA 3FVNA 4WEDA 4ZDMA 4PAIA 2UVIA 4PFTA 2VT5A 1UQWA 3W9VA 5ELVA 4PE3A 4OESA 5H8NB 2PFYA 1I6AA 2UVGA 1P1OA 1SBPA 2DQVA 5EYGA 2GHBA 5DT6A 1FBFA 4IO5A 4X9TA 2PFZA 1O64A 1NUYA 1MH4A 5I2KA 3CG3A 2ESNA 1UIUA 4MFIA 4EQBA 4ZE9A 4NTLA 2P1SA 4OFLA 1S7YA 2VD2A 1FPIA 1MXZA 1PB8A 1P1QA 5L9MA 4R6KA 4U4SA 1R6ZA 3ILTB 2XXUA 1B4ZA 4F2QA 5I2NB 2F3BA 3VDFA 2PT1A 2PT2A 3KGCA 3C33A 1FBPA 4X8RA 3MW0A 5CMMA 1NMUA 2QVVA 2CZLA 3IO4A 5I56A 1N3XA 1ZLQA 1MS7A 5IGAA 3IB0A 2G29A 1KA1A 1SYHA 3LSLA 1MY2A 2H99A 2ZZVA 3DLNA 2M8CA 1FPLA 1FPBA 3ILUB 5L9SA 4XKRA 5FHOA 1Y3PA 4PFWA 4OFOA 1VR5A 1TFAA 1Q9DA 1FBDA 4P0IA 2XX8A 3MP8A 4F1VA 1HSEA 1TXFA 2GHAA 3CFZA 3RQTA 3ODBA 2F34A 3A29A 1MXVA 2V84A 2Y7RA 4OVSA 3O6HA 4KYDA 4MJOA 3BBRA 3TCHA 1DK4A 3O97A 4MNCA 4HXVA 4F1YA 1MQHA 1RYXA 1VFEA 4H8JA 4G77A 1LFHA 1MQGA 3A3UA 3C34A 5H8NA 1LB9A 1Y4TA 1MG1A 3NOHA 4R2BA 2CZKA 2DS9A 3N6TA 2KQZA 3BIHA 3VV5A 2DWJA 3RPLA 2XXHA 4OYVA 3C36A 4DZ1A 2E0SA 3KN8A 1NUXA 4KFQA 4PAFA 1Z7NE 4OVPA 3PUXE 4GQOA 1SD3A 2DE3A 2XXYA 3FV1A 3M3LA 4UACA 1Y20A 2QPQA 3HFUA 4N8YA 3FVKA 3KJ7A 1B9JA 4OEUA 4FE8A 1B40A 4E0WA 1J1NA 3VXCA 5ITOA 3JYRA 2REJA 4RJZA 5I2NA 4GF8A 5HBCA 4TOZA 2RF1A 1ZU0A 3QIMA 1URGA 3U65A 4R9FA 2H98A 4JSDA 5M2VA 4PFRA 1QUJA 4M1VA 1A99A 4N17A 4YMAA 4KCDA 3QYTA 3M3KA 3T1BA 4XF5A 4F18A 1OLCA 4O3AA 2ANJA 5TPAB 2REGA 4GL8A 4ZEIA 3PD8A 4YU0A 3Q26A 2A5TB 3TTRA 2O7UA 4R73A 1LEVA 1XVYA 3FD3A 4BDRA 1P1NA 3CFXA 4BDQA 5ITPA 1FBEA 4PQJA 1AL3A 1H3DA 3OSRA 4NGUA 1OMPA 3CSBA 4JWXA 4LN5A 4AB6A 1M5BA 1FPDA 4MCOA 4K3FA 5H8FA 5CBSA 2Y7PA 3EQ1A 4NWDA 4PP0A 4ZEDA 2NUVA 4PF6A 4GD5A 5KDTA 4R75A 4LZ8A 4RXLA 1TT1A 1LAXA 4LP2B 3H6UA 3PPNA 1P1UA 3IFAA 4G68B 1H45A 3RGYA 3F11A 4PDDA 4NF5B 3O6GA 1MM6A 3TCFA 1QGXA 5HM4B 1M5DA 2I4BA 1IMFA 4GXAA 4O7MA 2HXWA 5ET6A 4N8GA 3CHGA 1JEVA 2GQ1A 1TFDA 4YZZA 4BDMA 4LZ5A 4OFJA 3OO7A 1Y9UA 4MAGA 3UP9A 2Z23A 4YB7A 2B3BA 3TQWA 1MPCA 3HHFA 1LBCA 4NF6A 3CI8A 2WYPA 1USYH 1FBCA 1YZ0A 1B58A 4OA4A 2O1LA 3PMVA 1HSLA 1MH3A 2QS3A 4JWOA 1LBVA 1WODA 5CBRA 3TDJA 5I59A 1A40A 1ZIUA 1LBBA 3PMWA 1JP4A 4N07A 2V3TA 2I6EA 1MXXA 3HCQA 3H3GA 4UA8A 4OXVA 1O7TA 5I3SA 5DVFA 1EYJA 1FSAA 5TPAA 3P7IA 2Q9TA 1HSJA 3OELA 1T0KA 1H76A 1B46A 4BLAA 2DVZA 2I3VA 3PV0E 4AB5A 3O29A 4GOTA 4H46A 4FEBA 4RPOA 2QVRA 1RDYA 4R72A 1FJ6A 3IFCA 3BFUA 1GR2A 5F1QA 5IAIA 1IZ1A 3Q28A 4PFIA 3ROJA 2G93A 5H8HB 4N6DA 3CIJA 4N6PA 4YKIA 1IMAA 5HPQA 1MQIA 4G4PA 1NUZA 1ZKBA 5EHMA 4GXSB 1BP5A 1FTKA 4BDLA 2HEUA 1B7HA 3LUZA 3IO6A 5EHSA 2F78A 4PBHA 2NVUB 2L5VA 1ELJA 4NX1A 4KD5A 4LUBA 3KFMA 1LFGA 1MQJA 3TTMA 4G68A 4AS5A 2OWSA 4OETA 4TLMB 4OVQA 2RINA 1JVYA 1OVTA 2XD3A 4XIGQ 2DP8A 3SEUA 5AA1A 4EXLA 2Z22A 1POTA 4GWSA 3IOVA 1FTAA 3OO8A 1Y4CA 2RKMA 5KZTA 4HE1A 3I3VA 2ALUA 1B3EA 2I4CA 1RDXA 4N6KA 3T9HB 4H67A 4OENA 3MZ1A 4EXKA 3HHGA 2Q88A 1JETA 2R8TA 5AA2D 3IX1A 1AWBA 3HSTA 3CVGA 4GWOA 1EZOA 3ZKLA 1SDXA 4IO2A 3RPWA 3LSXA 4IR8A 4G8HA 4DI3D 3FJ7A 1NNFA 4IGTA 3G3JA 3TAJA 3MYUA 3KBRA 4NF8B 2HQ0A 1SQYA 5CI5A 1DOTA 2DSFA 1FPFA 4MBPA 1LAFE 3K6XA 1JW5A 4XXUA 1LBWA 1K9YA 4ESXA 5FBPA 3VLWA 4IO7A 3MP6A 2ZYMA 2XX7A 5EYHA 3RNNA 4QSDA 1INPA 3RYDA 4KYEA 2B3FA 4PE5B 4N4UA 4U4XA 3DELB 4YMBA 2PVUA 4X48A 1QULA 1Z7ME 3K6UA 3IOUA 1MY1A 3OEMA 1PEBA 3D4GA 5H8HA 3K6VA 5CRYA 4DCXA 4QRZA 1XOCA 1DMBA 4FBPA 3OD7A 3QXMA 1YTVA 3T66A 4F3SA 2VOZA 1OLAA 3MWBA 1NV2A 3SZPA 1GTKA 2HZKA 4PFBA 2QL3A 4GBWA 3GYYA 4PC9A 4QFOA 1OIBA 4GLIA 2IA4A 2OWTA 4R6HA 4XKPA 4DXCA 4GWYA 3IB1A 1OVBA 3Q25A 3O28A 3PD9A 1R1NA 4H8IA 4JVCA 1JNFA 3MJNA 3TCGA 1BK4A 4IGRA 4QBAA 1Q1KA 4TLLB 3L6HA 3ISPA 4I1DA 4XKNA 4YICA 1ZMGA 4LZ7A 3KOTA 1M5FA 2XWIA 3PUWE 2RC8A 2XXPA 4G61A 4GX4A 5DTBA 4GWWA 1VFDA 1IXCA 5T3JA 4ZS9A 2VPNA 4GVOA 2THIA 2V93A 2Q8JA 4MEVA 4GL0A 1B1XA 4GWUA 3RTWB 2X7QA 3MBPA 1QUKA 4JVIA 4RY1A 2F36A 1NL5A 1B5HA 1SI1A 5IM2A 4QF9A 3DP6A 1LBZA 4KR5A 1FQAA 4ND9A 1H44A 4ELPA 1N3WA 3PGFA 2X26A 2PBWA 2H9BA 1PDAA 3K2DA 4MX6A 1ANFA 3OEKA 3IJXB 1FQFA 4QFKA 3CFLA 4IO3A 4C1TA 3S4UA 2LAOA 1Y1MA 3FUZA 4LVQA 4P3LA 5DEXB 4FATA 1OQHA 2V4CA 3LSFB 2HPGA 3BFTA 3LSWA 5IKBA 4R74A 3CSGA 4MNIA 2VHAA 1NNTA 3H6TA 4X1BA 3FGSA 2XA5A 4U22A 5F7VA 5IZ3B 1CNQA 4P56A 1LB8A 1S9TA 4O3BA 2OCUA 4NN3A 1N7XA 5DW8A 4OANA 2XXVA 4HW8A 4DXBA 4YB5A 1B51A 5BUUA 4ECFA 3L6GA 3MZBA 2P2AA 2WEFA 1IEJA 3A09A 1MY3A 3U1OA 4OQOA 5I5PA 3QMFA 1NH7A 2Z8EA 4PBQA 3EKIA 4O94A 3K6WA 2FIXA 5AA2B 3H4ZA 5H8QB 3RT6B 1SYIA 4P11A 4OVRA 1G0HA 5FHMA 2FA7A 3Q27A 2O69A 4ELQA 4MNPA 2Y5LA 5A5LA 2R6GE 5TP9B 1LCFA 3JV9A 5I84A 3W15C 1B05A 4DI4B 4KI0E 2F5XA 3VLUA 1KZ8A 1MPDA 2ONKE 3ZS6A 1B0HA 3KC0A 2E1SA 1GVCA 4F29A 1LAHE 4H6DA 3TODA 4PCDA 1D9VA 1BTJA 3MZ9A 2XXQA 4ELOA 1Q35A 4C0RA 1NI9A 2XXTA 4G2ZA 2ZNSA 3QAXA 1FW0A 4MHFA 2F6PA 5DYHA 2V25A 4NEDA 1FTOA 3H6WA 1B7ZA 3H03A 2NXOA 2AIXA 4H1XA 1NFTA 2ONRA 3KN7A 2Q2AA 3H7MA 2UVJA 3SESA 4WEPA 5DEXA 1I69A 3A3CA 3MUQA 1IMBA 2QVUA 2VD3A 2VGQA 4LA9A 3SDFA 4LONB 3OMBA 3DM0A 3FJMA 1EU8A 1N04A 3V5AA 4QFPA 3IK6B 2CZHA 4N91A 4QXDA 2PCRA 5IZ3A 1US4A 3PUYE 5ESYA 5I57B 5BWJA 2WBBA 3UGWA 2XWOA 1A55A 1PC3A 1MY4A 4H5FA 4LATA 3EHTA 1B1HA 4ZZEA 1UIVA 1MDP1 1NV5A 4XFEA 3DP8A 3MPLA 3S9EA 4N13A 4QSCA 1DSNA 4O3CA 5DVJA 4N81A 2XXRA 3LV0A 2Y5KA 1NH8A 5JTYB 1BIYA 3KN3A 1QVSA 4G68C 4PTKA 3WAEA 2RC7A 1IXIA 4O8MA 2JJKA 3IJOB 5AA2A 3TEPA 1P1WA 5H8QA 2DXRA 3FASA 3G3FA 3T96B 1US5A 3MAMA 1MRPA 3D4CA 3MQ9A 4ZEBA 3CR9A 3VVFA 1QW0A 4JSOA 4Q0CA 2VP1A 5AE4A 4I9DA 1XI6A 2P3NA 2PX1A 2Y7IA 4QSEA 4ONYA 5I58B 4KXPA 5EQ9A 4P1EA 1LLSA 2XD2A 2XXIA 4IB2A 2ZYNA 3WAFA 4DDDA 2D21A 4R6YA 2B4LA 3T0JA 4EQ7A 4OERA 4HCYA 3G7WA 2ONSA 1SI0A 4OVJA 1H43A 5K2XA 5ICQA 5LDZA 4P1LA 2UXAA 3KSXA 3M3FA 2GRVA 2A5TA 4GX6A 2XHDA 5F24A 4GWZA 4ZEKA 3T22A 3TQLA 4RNSA 1M5EA 3O66A 1MY0A 4ISUA 5FTIA 2XWVA 3K1PA 2DE4A 3PMXA 3SEYA 4GIZA 4I3EA 3FVGA 3FXUA 1JEUA 3SETA 3C32A 2WX9A 4EF2A 2OK2A 2I0CA 3TTNA 4RPNA 2OJTA 4H45A 1NV4A 4F39A 3FBPA 1VSOA 1ZJLA 3Q29A 4ZZAA 1MDQA 2OX3A 4THIA 1II5A 2B65A 1RKMA 1MXUA 1NNPA 3GZGA 2DWAA 4JWYA 1URSA 4Z0IA 3B50A 1MXYA 1LBYA 4JDFA 4NF5A 1Y1ZA 2QMXA 4AS4A 1LCTA 2F7CA 3G3GA 2QS2A 1P99A 2HFBA 3IAZA 3TTKA 3IORA 2OWZA 1Y3NA 2ZYOA 2DWHA 3ONMA 4XTCQ 1BKAA 3TYHA 4M4GA 2W7YA 3KZGA 4EUOA 4GFRA 3RY3A 1XHYA 4OHNA 3K0VA 5B7DA 4DE8A 2WKYA 1JVXA 2FIEA 1IMCA 3FZVA 1IMEA 4F3BA 4MH5A 4OZ9A 3CG1A 3EN3A 3S2VA 3IOTA 2Z8FA 3H06B 4FIMA 3HPIA 1DPEA 3B6TA 3E79A 4I3YA 1XC1A 2R9JA 3IL1B 2WBDA 3PUVE 1EZ9A 4YB6A 1A8FA 1PBPA 3OO9A 3U92A 4G8MA 3RLFE 1B5JA 2RC9A 3EPEA 4AQ4A 2Q89A 4KQPA 1B6HA 4RYAA 2DVCA 1FQCA 1PB7A 1B0LA 3O2AA 3VVEA 1AH5A 1QUIA 3B6WA 1KA0A 3T9VA 1LAGE 4F31B 4QFNA 2NWJA 4I8CA 2FNCA 3MC2A 4X04A 1F9BA 1NNKA 2F6GA 4GX3A 3IOWA 4HE2A 4QFLA 3SERA 2XXWA 4P9KA 5EQ7A 5CMKA 1YAEA 2P0SA 5I7IA 4F1UA 2FYIA 2BJIA 2ABHA 3KJTA 4MLVA 2BJJX 1XS5A 4GWXA 2GFEA 3EF7A 1NV0A 1IXHA 4F2OA 3K1MA 1B3FA 2O51A 1IQ7A 1OQGA 5DVIA 2XWKA 3RN8A 3TFLA 3OXNA 4H5GA 4TQUQ 1K9ZA 4P8BA 4F19A 1NV7A 3OO6A 2YLNA 1QKBA 1MQDA 1FPKA 4LQ2A 1JW1A 3UORA 4RA1A 1CB6A 2O68A 3VE1B 2I48A 3W9WA 5J1DA 2DDKA 1B7UA 4NQ8A 4JBZA 4WXJA 1IXGA 1DCUA 2F35A 5B70A 3M8UA 3RPLB 3RT8A 1FPGA 5EQAA 4EDPA 5LOMA 3QSLA 1MM7A 4OTEA 3K00A 4HTGA 2IEEA 1URDA 2ZNUA 3V8XB 1A54A 2F7BA 4PF8A 5IZZA 1UTHB 3CRBA 3SEWA 3TUSA 4IO6A 3N26A 3BIGA 4NHBA 3BKIB 3RUMA 2Y84A 1NUWA 1RDZA 1QJMA 3FXBA 1GGGA 4POWA 4F3GA 3K01A 1I6BA 2V3QA 4HCWA 1SW4A 1B3GA 4YKJA 4OWDA 4NF8A 1SW1A 4U1OA 4RK2A 1O63A 2HAVA 3FV2A 3B8BA 1JQFA 3OSQA 1FTMA 3FJGA 2O7IA 2XXXA 4OMBA 3VXBA 4POXA 3FXQA 2D3IA 5CMCA
chains in the Genus database with same CATH topology
4KHZE 1DTGA 5KCJB 1L5TA 4KYSA 1NKXA 2X7PA 4F3PA 2HAUA 4GRKA 1B5IA 3QK6A 2V3UA 2UYEA 2DE2A 2AYSA 1MXWA 4BDOA 3TMGA 3C4MA 3S9LC 3T9UA 1RYOA 5H8FB 5FTHA 2ZYKA 1B52A 4FJPA 1YCJA 3SEXA 3IB2A 4F22A 3U8QA 1KWHA 5KDTB 1IITA 4FEDA 4ZECA 1B2HA 3USDA 4Q5TA 1POY1 3MP1A 3HO7A 3TELA 2XX9A 1BLFA 3FXRA 2AL5A 5ISUA 1FCKA 3C9HA 4X1DA 3ECRA 3HV1A 2Q2CA 2D5WA 3R6UA 4U23A 3LUYA 4C1UA 3TTLA 1SVXB 1M5CA 3V89B 5JK4A 1UTHA 4RK9A 1EH3A 1IUDA 4YKKA 1VE4A 3B7DA 2H25A 5ICTA 4NF6B 4KPTA 3UA8A 3FVOA 3E4RA 1YPNA 4PFYA 3C35A 5I59B 3R26A 2NOOA 3UIFA 3T93B 1SW5A 3B6QA 1GV8A 3DP4A 4E0XA 1B3LA 3EHSA 3R7XA 3GBAA 3I5OA 4MF3A 2RCBA 5KCJA 3KSJA 1ZTYA 1A8EA 4MLQA 4IY5A 1AOVA 1B4HA 2DXYA 3PU5A 2QS4A 3VLVA 1JW4A 5L8DA 4U2RA 5CM6A 1FQBA 3PPPA 4EF1A 3TKDA 4DCYA 2RCAA 2OLBA 5K2YA 4JXIA 3PPQA 5CC2A 1D4NA 1USYE 4R2FA 4LQ5A 5JEIA 4Z7EA 4H65A 1B32A 4NF4B 3THIA 3GXAA 1AIVA 4G8NA 2QS1A 5AA4B 3UN6A 3FATA 3OOAA 3QUFA 4R9GA 3PPOA 3KG2A 2I0BA 5TP9A 2GH9A 2PYYA 2PMSA 3U94A 2F97A 3I6VA 2QRYA 4IO4A 4WKMA 2ZXTA 3QUJA 2I49A 4ESWA 2AL4A 2DWIA 4U1ZA 1ZBMA 4H0WA 4FORA 1LFIA 4ZEFA 1TWYA 4Q30B 3PPRA 1FQDA 1LSTA 3PUZE 5FHNA 3G3HA 2QSXA 2QMWA 2I3WA 2QJEA 2CMOA 1FTJA 3VVDA 2UVHA 1N0TA 4XKQA 4DLDA 3UK4A 3MVXA 2DYXA 2KLFA 1CE2A 1UTBB 4U21A 2HZLA 4FAJA 3GBBA 4YAHX 1IIWA 5AA3A 1D9YA 1XT8A 4NMYA 3G3KA 3E3KA 5A5XB 1EZPA 3LR1A 3LBSA 5I57A 3AXFA 4KCCA 2Y7WA 1R9QA 2R71A 3G3IA 3GLBA 3IR1A 4Q8RA 1N7WA 2Z8DA 2OZZA 3K4UA 4NWCA 3JZJA 4I62A 4OEVA 1WVJA 4JB7A 1ATGA 3K02A 3VFJA 3N94A 4NF4A 3OENA 1R9LA 3MVWA 5JTYA 1DTZA 2F8DA 3K1NA 1MPBA 3KOSA 4P0GA 3ZKKA 5I2KB 5AA4A 3MPKA 3HN0A 2ZMBA 4PETA 2UYFA 1FQEA 1S50A 5EYFA 3RTFB 1SW2A 4DIGA 2A5SA 3TZAA 4BDNA 3FIRA 5I58A 4ZE8A 5I56B 3E13X 4L17A 3C31A 1N84A 3TPAA 5H8SA 3V83A 4IY6A 2F7AA 3SEVA 4QHQA 1PB9A 2Y7KA 3E9XA 3O9PA 1DPPA 5L9OA 2O84X 3MVZA 1QKAA 1A7LA 5TU0A 1AMFA 4HS7A 3EHUA 2HCAA 1FTLA 2DOJA 1Y3QA 3ZSFA 3S9MC 1N76A 3O6IA 4ELRA 2H4IA 1UTBA 1WDNA 3H6VA 2YPNA 3T9XB 3U72A 4FECA 1PBQA 2OBGA 3N5LA 4DXUA 4PFUA 2O1MA 3MVYA 1I6QA 3KEIA 4EQ9A 1D3KA 5A5XA 3S9NC 1XVXA 1LGBC 2YJPA 4NE4A 3U93A 3LC8A 2O6AA 3SKPA 5CMBA 3N6UA 2ZNTA 2I58A 2H5YA 4YKPA 1B3HA 3FVNA 4WEDA 4ZDMA 2UVIA 4PFTA 1UQWA 3W9VA 5ELVA 4OESA 5H8NB 1I6AA 2UVGA 1P1OA 1SBPA 2DQVA 2GHBA 5DT6A 4IO5A 4X9TA 1O64A 1MH4A 5I2KA 3CG3A 2ESNA 1UIUA 4MFIA 4EQBA 4ZE9A 4NTLA 2P1SA 4OFLA 1S7YA 2VD2A 1MXZA 1PB8A 1P1QA 5L9MA 4R6KA 4U4SA 1R6ZA 3ILTB 2XXUA 1B4ZA 4F2QA 5I2NB 3VDFA 2PT1A 2PT2A 3KGCA 3C33A 3MW0A 5CMMA 1NMUA 2CZLA 3IO4A 5I56A 1N3XA 1ZLQA 1MS7A 3IB0A 2G29A 1SYHA 3LSLA 1MY2A 2H99A 3DLNA 2M8CA 3ILUB 5L9SA 4XKRA 5FHOA 1Y3PA 4PFWA 4OFOA 1VR5A 1TFAA 4P0IA 2XX8A 3MP8A 4F1VA 1HSEA 1TXFA 2GHAA 3CFZA 3RQTA 3ODBA 2F34A 1MXVA 2V84A 2Y7RA 3O6HA 4KYDA 3TCHA 3BBRA 3O97A 4F1YA 1MQHA 1RYXA 1VFEA 4H8JA 4G77A 1LFHA 1MQGA 3A3UA 3C34A 5H8NA 1LB9A 1Y4TA 1MG1A 4R2BA 2DS9A 3N6TA 3VV5A 2DWJA 2XXHA 4OYVA 3C36A 4DZ1A 2E0SA 3KN8A 4KFQA 1Z7NE 3PUXE 4GQOA 1SD3A 2DE3A 2XXYA 3FV1A 3M3LA 4UACA 1Y20A 2QPQA 3FVKA 3KJ7A 1B9JA 4OEUA 4FE8A 1B40A 4E0WA 1J1NA 3VXCA 5ITOA 3JYRA 2REJA 4RJZA 5I2NA 4GF8A 5HBCA 4TOZA 2RF1A 1ZU0A 3QIMA 1URGA 4R9FA 2H98A 4JSDA 5M2VA 1QUJA 4M1VA 1A99A 4YMAA 4KCDA 3QYTA 3M3KA 4F18A 1OLCA 4O3AA 2ANJA 5TPAB 2REGA 4GL8A 4ZEIA 3PD8A 4YU0A 3Q26A 2A5TB 3TTRA 2O7UA 4R73A 1XVYA 3FD3A 4BDRA 1P1NA 3CFXA 4BDQA 5ITPA 4PQJA 1AL3A 1H3DA 3OSRA 1OMPA 3CSBA 4JWXA 4AB6A 1M5BA 4K3FA 5H8FA 5CBSA 2Y7PA 3EQ1A 4NWDA 4PP0A 4ZEDA 2NUVA 4GD5A 5KDTA 4R75A 4LZ8A 4RXLA 1TT1A 1LAXA 4LP2B 3H6UA 3PPNA 1P1UA 4G68B 1H45A 3RGYA 3F11A 3O6GA 4NF5B 1MM6A 3TCFA 5HM4B 1M5DA 2I4BA 4GXAA 2HXWA 1JEVA 1TFDA 4YZZA 4BDMA 4LZ5A 4OFJA 3OO7A 1Y9UA 3UP9A 2Z23A 4YB7A 2B3BA 3TQWA 1MPCA 3HHFA 1LBCA 4NF6A 3CI8A 1USYH 1B58A 2O1LA 3PMVA 1HSLA 1MH3A 2QS3A 4JWOA 1WODA 5CBRA 3TDJA 5I59A 1A40A 1ZIUA 1LBBA 3PMWA 4N07A 2V3TA 2I6EA 1MXXA 3HCQA 3H3GA 4UA8A 4OXVA 1O7TA 5DVFA 5TPAA 3P7IA 2Q9TA 1HSJA 3OELA 1T0KA 1H76A 1B46A 4BLAA 2DVZA 2I3VA 3PV0E 4AB5A 3O29A 4GOTA 4FEBA 4RPOA 4R72A 3BFUA 1GR2A 5F1QA 5IAIA 1IZ1A 3Q28A 2G93A 5H8HB 3CIJA 4N6PA 4YKIA 5HPQA 1MQIA 4G4PA 1ZKBA 5EHMA 4GXSB 1BP5A 1FTKA 4BDLA 2HEUA 1B7HA 3IO6A 5EHSA 2F78A 2NVUB 1ELJA 4KD5A 4LUBA 3KFMA 1LFGA 1MQJA 3TTMA 4G68A 2OWSA 4OETA 4TLMB 2RINA 1JVYA 1OVTA 2XD3A 4XIGQ 2DP8A 3SEUA 5AA1A 4EXLA 2Z22A 1POTA 3IOVA 3OO8A 1Y4CA 2RKMA 5KZTA 3I3VA 2ALUA 1B3EA 2I4CA 3T9HB 4H67A 4OENA 3MZ1A 4EXKA 3HHGA 2Q88A 1JETA 5AA2D 3IX1A 3HSTA 3CVGA 4GWOA 1EZOA 3ZKLA 1SDXA 4IO2A 3RPWA 3LSXA 4G8HA 3FJ7A 1NNFA 4IGTA 3G3JA 3TAJA 3KBRA 4NF8B 2HQ0A 1SQYA 5CI5A 1DOTA 2DSFA 4MBPA 1LAFE 3K6XA 1JW5A 4XXUA 4ESXA 3VLWA 4IO7A 3MP6A 2ZYMA 2XX7A 3RNNA 4QSDA 4KYEA 2B3FA 4PE5B 4U4XA 3DELB 4YMBA 2PVUA 4X48A 1QULA 1Z7ME 3K6UA 3IOUA 1MY1A 3OEMA 1PEBA 3D4GA 5H8HA 3K6VA 5CRYA 4DCXA 4QRZA 1XOCA 1DMBA 3OD7A 3QXMA 1YTVA 3T66A 4F3SA 2VOZA 1OLAA 3MWBA 1GTKA 2HZKA 2QL3A 4QFOA 1OIBA 4GLIA 2IA4A 2OWTA 4R6HA 4XKPA 4DXCA 3IB1A 1OVBA 3Q25A 3O28A 3PD9A 1R1NA 4H8IA 1JNFA 3MJNA 3TCGA 4IGRA 1Q1KA 4TLLB 3L6HA 4I1DA 4XKNA 4YICA 1ZMGA 4LZ7A 3KOTA 1M5FA 3PUWE 2RC8A 2XXPA 5DTBA 1VFDA 1IXCA 4ZS9A 4GVOA 2THIA 2V93A 2Q8JA 4GL0A 1B1XA 3RTWB 2X7QA 3MBPA 1QUKA 4RY1A 2F36A 1NL5A 1B5HA 1SI1A 4QF9A 3DP6A 4KR5A 1FQAA 4ND9A 1H44A 4ELPA 1N3WA 3PGFA 2X26A 2PBWA 2H9BA 1PDAA 3K2DA 1ANFA 3OEKA 3IJXB 1FQFA 4QFKA 3CFLA 4IO3A 4C1TA 3S4UA 2LAOA 1Y1MA 3FUZA 4LVQA 5DEXB 4FATA 1OQHA 3LSFB 3BFTA 3LSWA 5IKBA 4R74A 3CSGA 2VHAA 1NNTA 3H6TA 4X1BA 3FGSA 4U22A 5F7VA 1LB8A 1S9TA 4O3BA 2OCUA 1N7XA 2XXVA 4HW8A 4DXBA 4YB5A 5BUUA 1B51A 4ECFA 3L6GA 3MZBA 2P2AA 1IEJA 3A09A 1MY3A 3U1OA 4OQOA 1NH7A 2Z8EA 3K6WA 5AA2B 3H4ZA 5H8QB 3RT6B 1SYIA 4P11A 5FHMA 2FA7A 3Q27A 2O69A 4ELQA 2R6GE 5TP9B 1LCFA 3JV9A 5I84A 3W15C 1B05A 4KI0E 2F5XA 3VLUA 1MPDA 2ONKE 3ZS6A 1B0HA 2E1SA 1GVCA 4F29A 1LAHE 4H6DA 3TODA 1D9VA 1BTJA 3MZ9A 2XXQA 4ELOA 1Q35A 4C0RA 2XXTA 4G2ZA 2ZNSA 3QAXA 1FW0A 2F6PA 5DYHA 2V25A 4NEDA 1FTOA 3H6WA 1B7ZA 3H03A 2NXOA 2AIXA 4H1XA 1NFTA 2ONRA 3KN7A 2Q2AA 3H7MA 2UVJA 3SESA 4WEPA 5DEXA 1I69A 3A3CA 3MUQA 2VD3A 2VGQA 4LA9A 3SDFA 4LONB 3OMBA 3DM0A 3FJMA 1EU8A 1N04A 3V5AA 4QFPA 3IK6B 1US4A 3PUYE 5I57B 5BWJA 3UGWA 1A55A 1PC3A 1MY4A 4H5FA 4LATA 3EHTA 1B1HA 4ZZEA 1UIVA 1MDP1 3DP8A 3MPLA 3S9EA 4N13A 4QSCA 1DSNA 4O3CA 5DVJA 2XXRA 1NH8A 5JTYB 1BIYA 3KN3A 1QVSA 4G68C 3WAEA 2RC7A 1IXIA 3IJOB 5AA2A 3TEPA 1P1WA 5H8QA 2DXRA 3FASA 3G3FA 3T96B 1US5A 3MAMA 1MRPA 3D4CA 3MQ9A 4ZEBA 3CR9A 3VVFA 1QW0A 4JSOA 4Q0CA 2VP1A 5AE4A 4I9DA 2PX1A 2Y7IA 4QSEA 4ONYA 5I58B 1LLSA 2XD2A 2XXIA 4IB2A 2ZYNA 3WAFA 4DDDA 2D21A 4R6YA 4EQ7A 4OERA 4HCYA 3G7WA 2ONSA 1SI0A 4OVJA 1H43A 5K2XA 5ICQA 2UXAA 3KSXA 3M3FA 2GRVA 2A5TA 2XHDA 4ZEKA 3T22A 3TQLA 4RNSA 1M5EA 3O66A 1MY0A 4ISUA 5FTIA 3K1PA 2DE4A 3PMXA 3SEYA 4GIZA 3FVGA 3FXUA 1JEUA 3SETA 3C32A 4EF2A 2OK2A 2I0CA 3TTNA 4RPNA 2OJTA 4F39A 1VSOA 1ZJLA 3Q29A 4ZZAA 1MDQA 4THIA 1II5A 2B65A 1RKMA 1MXUA 1NNPA 3GZGA 2DWAA 4JWYA 1URSA 4Z0IA 1MXYA 4JDFA 4NF5A 1Y1ZA 2QMXA 1LCTA 2F7CA 3G3GA 2QS2A 1P99A 2HFBA 3IAZA 3TTKA 3IORA 1Y3NA 2ZYOA 2DWHA 3ONMA 4XTCQ 1BKAA 3TYHA 4M4GA 2W7YA 3KZGA 4EUOA 4GFRA 3RY3A 1XHYA 4OHNA 3K0VA 5B7DA 4DE8A 2WKYA 1JVXA 3FZVA 4F3BA 4MH5A 4OZ9A 3CG1A 3EN3A 3S2VA 3IOTA 2Z8FA 3H06B 4FIMA 3HPIA 1DPEA 3B6TA 1XC1A 2R9JA 3IL1B 3PUVE 1EZ9A 4YB6A 1A8FA 1PBPA 3OO9A 3U92A 4G8MA 3RLFE 1B5JA 2RC9A 3EPEA 4AQ4A 2Q89A 4KQPA 1B6HA 4RYAA 2DVCA 1FQCA 1PB7A 1B0LA 3O2AA 3VVEA 1AH5A 1QUIA 3B6WA 3T9VA 1LAGE 4F31B 4QFNA 2NWJA 4I8CA 2FNCA 3MC2A 1F9BA 1NNKA 2F6GA 3IOWA 4QFLA 3SERA 2XXWA 5CMKA 1YAEA 2P0SA 4F1UA 2FYIA 2ABHA 3KJTA 4MLVA 2BJJX 1XS5A 2GFEA 3EF7A 1IXHA 4F2OA 3K1MA 1B3FA 2O51A 1IQ7A 1OQGA 5DVIA 3RN8A 3TFLA 3OXNA 4H5GA 4TQUQ 4F19A 3OO6A 2YLNA 1QKBA 1MQDA 4LQ2A 1JW1A 3UORA 4RA1A 1CB6A 2O68A 3VE1B 2I48A 3W9WA 5J1DA 1B7UA 4JBZA 4WXJA 1IXGA 2F35A 5B70A 3M8UA 3RT8A 4EDPA 5LOMA 3QSLA 1MM7A 4OTEA 3K00A 4HTGA 2IEEA 1URDA 2ZNUA 3V8XB 1A54A 2F7BA 1UTHB 3CRBA 3SEWA 3TUSA 4IO6A 3N26A 3BKIB 3RUMA 2Y84A 1QJMA 1GGGA 4POWA 4F3GA 3K01A 1I6BA 2V3QA 4HCWA 1SW4A 1B3GA 4YKJA 4OWDA 4NF8A 1SW1A 4U1OA 4RK2A 1O63A 2HAVA 3FV2A 1JQFA 3OSQA 1FTMA 3FJGA 2O7IA 2XXXA 4OMBA 3VXBA 4POXA 3FXQA 2D3IA 5CMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHZ E;  1DTG A;  5KCJ B;  1L5T A;  4KYS A;  1NKX A;  2X7P A;  4F3P A;  2HAU A;  4GRK A;  1B5I A;  3QK6 A;  2V3U A;  2UYE A;  2DE2 A;  2AYS A;  1MXW A;  4BDO A;  3TMG A;  3C4M A;  3S9L C;  3T9U A;  1RYO A;  5H8F B;  5FTH A;  2ZYK A;  1B52 A;  4FJP A;  1YCJ A;  3SEX A;  3IB2 A;  4F22 A;  3U8Q A;  1KWH A;  5KDT B;  1IIT A;  4FED A;  4ZEC A;  1B2H A;  3USD A;  4Q5T A;  1POY 1;  3MP1 A;  3HO7 A;  3TEL A;  2XX9 A;  1BLF A;  3FXR A;  2AL5 A;  5ISU A;  1FCK A;  3C9H A;  4X1D A;  3ECR A;  3HV1 A;  2Q2C A;  2D5W A;  3R6U A;  4U23 A;  3LUY A;  4C1U A;  3TTL A;  1SVX B;  1M5C A;  3V89 B;  5JK4 A;  1UTH A;  4RK9 A;  1EH3 A;  1IUD A;  4YKK A;  1VE4 A;  3B7D A;  2H25 A;  5ICT A;  4NF6 B;  4KPT A;  3UA8 A;  3FVO A;  3E4R A;  1YPN A;  4PFY A;  3C35 A;  5I59 B;  3R26 A;  2NOO A;  3UIF A;  3T93 B;  1SW5 A;  3B6Q A;  1GV8 A;  3DP4 A;  4E0X A;  1B3L A;  3EHS A;  3R7X A;  3GBA A;  3I5O A;  4MF3 A;  2RCB A;  5KCJ A;  3KSJ A;  1ZTY A;  1A8E A;  4MLQ A;  4IY5 A;  1AOV A;  1B4H A;  2DXY A;  3PU5 A;  2QS4 A;  3VLV A;  1JW4 A;  5L8D A;  4U2R A;  5CM6 A;  1FQB A;  3PPP A;  4EF1 A;  3TKD A;  4DCY A;  2RCA A;  2OLB A;  5K2Y A;  4JXI A;  3PPQ A;  5CC2 A;  1D4N A;  1USY E;  4R2F A;  4LQ5 A;  5JEI A;  4Z7E A;  4H65 A;  1B32 A;  4NF4 B;  3THI A;  3GXA A;  1AIV A;  4G8N A;  2QS1 A;  5AA4 B;  3UN6 A;  3FAT A;  3OOA A;  3QUF A;  4R9G A;  3PPO A;  3KG2 A;  2I0B A;  5TP9 A;  2GH9 A;  2PYY A;  2PMS A;  3U94 A;  2F97 A;  3I6V A;  2QRY A;  4IO4 A;  4WKM A;  2ZXT A;  3QUJ A;  2I49 A;  4ESW A;  2AL4 A;  2DWI A;  4U1Z A;  1ZBM A;  4H0W A;  4FOR A;  1LFI A;  4ZEF A;  1TWY A;  4Q30 B;  3PPR A;  1FQD A;  1LST A;  3PUZ E;  5FHN A;  3G3H A;  2QSX A;  2QMW A;  2I3W A;  2QJE A;  2CMO A;  1FTJ A;  3VVD A;  2UVH A;  1N0T A;  4XKQ A;  4DLD A;  3UK4 A;  3MVX A;  2DYX A;  2KLF A;  1CE2 A;  1UTB B;  4U21 A;  2HZL A;  4FAJ A;  3GBB A;  4YAH X;  1IIW A;  5AA3 A;  1D9Y A;  1XT8 A;  4NMY A;  3G3K A;  3E3K A;  5A5X B;  1EZP A;  3LR1 A;  3LBS A;  5I57 A;  3AXF A;  4KCC A;  2Y7W A;  1R9Q A;  2R71 A;  3G3I A;  3GLB A;  3IR1 A;  4Q8R A;  1N7W A;  2Z8D A;  2OZZ A;  3K4U A;  4NWC A;  3JZJ A;  4I62 A;  4OEV A;  1WVJ A;  4JB7 A;  1ATG A;  3K02 A;  3VFJ A;  3N94 A;  4NF4 A;  3OEN A;  1R9L A;  3MVW A;  5JTY A;  1DTZ A;  2F8D A;  3K1N A;  1MPB A;  3KOS A;  4P0G A;  3ZKK A;  5I2K B;  5AA4 A;  3MPK A;  3HN0 A;  2ZMB A;  4PET A;  2UYF A;  1FQE A;  1S50 A;  5EYF A;  3RTF B;  1SW2 A;  4DIG A;  2A5S A;  3TZA A;  4BDN A;  3FIR A;  5I58 A;  4ZE8 A;  5I56 B;  3E13 X;  4L17 A;  3C31 A;  1N84 A;  3TPA A;  5H8S A;  3V83 A;  4IY6 A;  2F7A A;  3SEV A;  4QHQ A;  1PB9 A;  2Y7K A;  3E9X A;  3O9P A;  1DPP A;  5L9O A;  2O84 X;  3MVZ A;  1QKA A;  1A7L A;  5TU0 A;  1AMF A;  4HS7 A;  3EHU A;  2HCA A;  1FTL A;  2DOJ A;  1Y3Q A;  3ZSF A;  3S9M C;  1N76 A;  3O6I A;  4ELR A;  2H4I A;  1UTB A;  1WDN A;  3H6V A;  2YPN A;  3T9X B;  3U72 A;  4FEC A;  1PBQ A;  2OBG A;  3N5L A;  4DXU A;  4PFU A;  2O1M A;  3MVY A;  1I6Q A;  3KEI A;  4EQ9 A;  1D3K A;  5A5X A;  3S9N C;  1XVX A;  1LGB C;  2YJP A;  4NE4 A;  3U93 A;  3LC8 A;  2O6A A;  3SKP A;  5CMB A;  3N6U A;  2ZNT A;  2I58 A;  2H5Y A;  4YKP A;  1B3H A;  3FVN A;  4WED A;  4ZDM A;  2UVI A;  4PFT A;  1UQW A;  3W9V A;  5ELV A;  4OES A;  5H8N B;  1I6A A;  2UVG A;  1P1O A;  1SBP A;  2DQV A;  2GHB A;  5DT6 A;  4IO5 A;  4X9T A;  1O64 A;  1MH4 A;  5I2K A;  3CG3 A;  2ESN A;  1UIU A;  4MFI A;  4EQB A;  4ZE9 A;  4NTL A;  2P1S A;  4OFL A;  1S7Y A;  2VD2 A;  1MXZ A;  1PB8 A;  1P1Q A;  5L9M A;  4R6K A;  4U4S A;  1R6Z A;  3ILT B;  2XXU A;  1B4Z A;  4F2Q A;  5I2N B;  3VDF A;  2PT1 A;  2PT2 A;  3KGC A;  3C33 A;  3MW0 A;  5CMM A;  1NMU A;  2CZL A;  3IO4 A;  5I56 A;  1N3X A;  1ZLQ A;  1MS7 A;  3IB0 A;  2G29 A;  1SYH A;  3LSL A;  1MY2 A;  2H99 A;  3DLN A;  2M8C A;  3ILU B;  5L9S A;  4XKR A;  5FHO A;  1Y3P A;  4PFW A;  4OFO A;  1VR5 A;  1TFA A;  4P0I A;  2XX8 A;  3MP8 A;  4F1V A;  1HSE A;  1TXF A;  2GHA A;  3CFZ A;  3RQT A;  3ODB A;  2F34 A;  1MXV A;  2V84 A;  2Y7R A;  3O6H A;  4KYD A;  3TCH A;  3BBR A;  3O97 A;  4F1Y A;  1MQH A;  1RYX A;  1VFE A;  4H8J A;  4G77 A;  1LFH A;  1MQG A;  3A3U A;  3C34 A;  5H8N A;  1LB9 A;  1Y4T A;  1MG1 A;  4R2B A;  2DS9 A;  3N6T A;  3VV5 A;  2DWJ A;  2XXH A;  4OYV A;  3C36 A;  4DZ1 A;  2E0S A;  3KN8 A;  4KFQ A;  1Z7N E;  3PUX E;  4GQO A;  1SD3 A;  2DE3 A;  2XXY A;  3FV1 A;  3M3L A;  4UAC A;  1Y20 A;  2QPQ A;  3FVK A;  3KJ7 A;  1B9J A;  4OEU A;  4FE8 A;  1B40 A;  4E0W A;  1J1N A;  3VXC A;  5ITO A;  3JYR A;  2REJ A;  4RJZ A;  5I2N A;  4GF8 A;  5HBC A;  4TOZ A;  2RF1 A;  1ZU0 A;  3QIM A;  1URG A;  4R9F A;  2H98 A;  4JSD A;  5M2V A;  1QUJ A;  4M1V A;  1A99 A;  4YMA A;  4KCD A;  3QYT A;  3M3K A;  4F18 A;  1OLC A;  4O3A A;  2ANJ A;  5TPA B;  2REG A;  4GL8 A;  4ZEI A;  3PD8 A;  4YU0 A;  3Q26 A;  2A5T B;  3TTR A;  2O7U A;  4R73 A;  1XVY A;  3FD3 A;  4BDR A;  1P1N A;  3CFX A;  4BDQ A;  5ITP A;  4PQJ A;  1AL3 A;  1H3D A;  3OSR A;  1OMP A;  3CSB A;  4JWX A;  4AB6 A;  1M5B A;  4K3F A;  5H8F A;  5CBS A;  2Y7P A;  3EQ1 A;  4NWD A;  4PP0 A;  4ZED A;  2NUV A;  4GD5 A;  5KDT A;  4R75 A;  4LZ8 A;  4RXL A;  1TT1 A;  1LAX A;  4LP2 B;  3H6U A;  3PPN A;  1P1U A;  4G68 B;  1H45 A;  3RGY A;  3F11 A;  3O6G A;  4NF5 B;  1MM6 A;  3TCF A;  5HM4 B;  1M5D A;  2I4B A;  4GXA A;  2HXW A;  1JEV A;  1TFD A;  4YZZ A;  4BDM A;  4LZ5 A;  4OFJ A;  3OO7 A;  1Y9U A;  3UP9 A;  2Z23 A;  4YB7 A;  2B3B A;  3TQW A;  1MPC A;  3HHF A;  1LBC A;  4NF6 A;  3CI8 A;  1USY H;  1B58 A;  2O1L A;  3PMV A;  1HSL A;  1MH3 A;  2QS3 A;  4JWO A;  1WOD A;  5CBR A;  3TDJ A;  5I59 A;  1A40 A;  1ZIU A;  1LBB A;  3PMW A;  4N07 A;  2V3T A;  2I6E A;  1MXX A;  3HCQ A;  3H3G A;  4UA8 A;  4OXV A;  1O7T A;  5DVF A;  5TPA A;  3P7I A;  2Q9T A;  1HSJ A;  3OEL A;  1T0K A;  1H76 A;  1B46 A;  4BLA A;  2DVZ A;  2I3V A;  3PV0 E;  4AB5 A;  3O29 A;  4GOT A;  4FEB A;  4RPO A;  4R72 A;  3BFU A;  1GR2 A;  5F1Q A;  5IAI A;  1IZ1 A;  3Q28 A;  2G93 A;  5H8H B;  3CIJ A;  4N6P A;  4YKI A;  5HPQ A;  1MQI A;  4G4P A;  1ZKB A;  5EHM A;  4GXS B;  1BP5 A;  1FTK A;  4BDL A;  2HEU A;  1B7H A;  3IO6 A;  5EHS A;  2F78 A;  2NVU B;  1ELJ A;  4KD5 A;  4LUB A;  3KFM A;  1LFG A;  1MQJ A;  3TTM A;  4G68 A;  2OWS A;  4OET A;  4TLM B;  2RIN A;  1JVY A;  1OVT A;  2XD3 A;  4XIG Q;  2DP8 A;  3SEU A;  5AA1 A;  4EXL A;  2Z22 A;  1POT A;  3IOV A;  3OO8 A;  1Y4C A;  2RKM A;  5KZT A;  3I3V A;  2ALU A;  1B3E A;  2I4C A;  3T9H B;  4H67 A;  4OEN A;  3MZ1 A;  4EXK A;  3HHG A;  2Q88 A;  1JET A;  5AA2 D;  3IX1 A;  3HST A;  3CVG A;  4GWO A;  1EZO A;  3ZKL A;  1SDX A;  4IO2 A;  3RPW A;  3LSX A;  4G8H A;  3FJ7 A;  1NNF A;  4IGT A;  3G3J A;  3TAJ A;  3KBR A;  4NF8 B;  2HQ0 A;  1SQY A;  5CI5 A;  1DOT A;  2DSF A;  4MBP A;  1LAF E;  3K6X A;  1JW5 A;  4XXU A;  4ESX A;  3VLW A;  4IO7 A;  3MP6 A;  2ZYM A;  2XX7 A;  3RNN A;  4QSD A;  4KYE A;  2B3F A;  4PE5 B;  4U4X A;  3DEL B;  4YMB A;  2PVU A;  4X48 A;  1QUL A;  1Z7M E;  3K6U A;  3IOU A;  1MY1 A;  3OEM A;  1PEB A;  3D4G A;  5H8H A;  3K6V A;  5CRY A;  4DCX A;  4QRZ A;  1XOC A;  1DMB A;  3OD7 A;  3QXM A;  1YTV A;  3T66 A;  4F3S A;  2VOZ A;  1OLA A;  3MWB A;  1GTK A;  2HZK A;  2QL3 A;  4QFO A;  1OIB A;  4GLI A;  2IA4 A;  2OWT A;  4R6H A;  4XKP A;  4DXC A;  3IB1 A;  1OVB A;  3Q25 A;  3O28 A;  3PD9 A;  1R1N A;  4H8I A;  1JNF A;  3MJN A;  3TCG A;  4IGR A;  1Q1K A;  4TLL B;  3L6H A;  4I1D A;  4XKN A;  4YIC A;  1ZMG A;  4LZ7 A;  3KOT A;  1M5F A;  3PUW E;  2RC8 A;  2XXP A;  5DTB A;  1VFD A;  1IXC A;  4ZS9 A;  4GVO A;  2THI A;  2V93 A;  2Q8J A;  4GL0 A;  1B1X A;  3RTW B;  2X7Q A;  3MBP A;  1QUK A;  4RY1 A;  2F36 A;  1NL5 A;  1B5H A;  1SI1 A;  4QF9 A;  3DP6 A;  4KR5 A;  1FQA A;  4ND9 A;  1H44 A;  4ELP A;  1N3W A;  3PGF A;  2X26 A;  2PBW A;  2H9B A;  1PDA A;  3K2D A;  1ANF A;  3OEK A;  3IJX B;  1FQF A;  4QFK A;  3CFL A;  4IO3 A;  4C1T A;  3S4U A;  2LAO A;  1Y1M A;  3FUZ A;  4LVQ A;  5DEX B;  4FAT A;  1OQH A;  3LSF B;  3BFT A;  3LSW A;  5IKB A;  4R74 A;  3CSG A;  2VHA A;  1NNT A;  3H6T A;  4X1B A;  3FGS A;  4U22 A;  5F7V A;  1LB8 A;  1S9T A;  4O3B A;  2OCU A;  1N7X A;  2XXV A;  4HW8 A;  4DXB A;  4YB5 A;  5BUU A;  1B51 A;  4ECF A;  3L6G A;  3MZB A;  2P2A A;  1IEJ A;  3A09 A;  1MY3 A;  3U1O A;  4OQO A;  1NH7 A;  2Z8E A;  3K6W A;  5AA2 B;  3H4Z A;  5H8Q B;  3RT6 B;  1SYI A;  4P11 A;  5FHM A;  2FA7 A;  3Q27 A;  2O69 A;  4ELQ A;  2R6G E;  5TP9 B;  1LCF A;  3JV9 A;  5I84 A;  3W15 C;  1B05 A;  4KI0 E;  2F5X A;  3VLU A;  1MPD A;  2ONK E;  3ZS6 A;  1B0H A;  2E1S A;  1GVC A;  4F29 A;  1LAH E;  4H6D A;  3TOD A;  1D9V A;  1BTJ A;  3MZ9 A;  2XXQ A;  4ELO A;  1Q35 A;  4C0R A;  2XXT A;  4G2Z A;  2ZNS A;  3QAX A;  1FW0 A;  2F6P A;  5DYH A;  2V25 A;  4NED A;  1FTO A;  3H6W A;  1B7Z A;  3H03 A;  2NXO A;  2AIX A;  4H1X A;  1NFT A;  2ONR A;  3KN7 A;  2Q2A A;  3H7M A;  2UVJ A;  3SES A;  4WEP A;  5DEX A;  1I69 A;  3A3C A;  3MUQ A;  2VD3 A;  2VGQ A;  4LA9 A;  3SDF A;  4LON B;  3OMB A;  3DM0 A;  3FJM A;  1EU8 A;  1N04 A;  3V5A A;  4QFP A;  3IK6 B;  1US4 A;  3PUY E;  5I57 B;  5BWJ A;  3UGW A;  1A55 A;  1PC3 A;  1MY4 A;  4H5F A;  4LAT A;  3EHT A;  1B1H A;  4ZZE A;  1UIV A;  1MDP 1;  3DP8 A;  3MPL A;  3S9E A;  4N13 A;  4QSC A;  1DSN A;  4O3C A;  5DVJ A;  2XXR A;  1NH8 A;  5JTY B;  1BIY A;  3KN3 A;  1QVS A;  4G68 C;  3WAE A;  2RC7 A;  1IXI A;  3IJO B;  5AA2 A;  3TEP A;  1P1W A;  5H8Q A;  2DXR A;  3FAS A;  3G3F A;  3T96 B;  1US5 A;  3MAM A;  1MRP A;  3D4C A;  3MQ9 A;  4ZEB A;  3CR9 A;  3VVF A;  1QW0 A;  4JSO A;  4Q0C A;  2VP1 A;  5AE4 A;  4I9D A;  2PX1 A;  2Y7I A;  4QSE A;  4ONY A;  5I58 B;  1LLS A;  2XD2 A;  2XXI A;  4IB2 A;  2ZYN A;  3WAF A;  4DDD A;  2D21 A;  4R6Y A;  4EQ7 A;  4OER A;  4HCY A;  3G7W A;  2ONS A;  1SI0 A;  4OVJ A;  1H43 A;  5K2X A;  5ICQ A;  2UXA A;  3KSX A;  3M3F A;  2GRV A;  2A5T A;  2XHD A;  4ZEK A;  3T22 A;  3TQL A;  4RNS A;  1M5E A;  3O66 A;  1MY0 A;  4ISU A;  5FTI A;  3K1P A;  2DE4 A;  3PMX A;  3SEY A;  4GIZ A;  3FVG A;  3FXU A;  1JEU A;  3SET A;  3C32 A;  4EF2 A;  2OK2 A;  2I0C A;  3TTN A;  4RPN A;  2OJT A;  4F39 A;  1VSO A;  1ZJL A;  3Q29 A;  4ZZA A;  1MDQ A;  4THI A;  1II5 A;  2B65 A;  1RKM A;  1MXU A;  1NNP A;  3GZG A;  2DWA A;  4JWY A;  1URS A;  4Z0I A;  1MXY A;  4JDF A;  4NF5 A;  1Y1Z A;  2QMX A;  1LCT A;  2F7C A;  3G3G A;  2QS2 A;  1P99 A;  2HFB A;  3IAZ A;  3TTK A;  3IOR A;  1Y3N A;  2ZYO A;  2DWH A;  3ONM A;  4XTC Q;  1BKA A;  3TYH A;  4M4G A;  2W7Y A;  3KZG A;  4EUO A;  4GFR A;  3RY3 A;  1XHY A;  4OHN A;  3K0V A;  5B7D A;  4DE8 A;  2WKY A;  1JVX A;  3FZV A;  4F3B A;  4MH5 A;  4OZ9 A;  3CG1 A;  3EN3 A;  3S2V A;  3IOT A;  2Z8F A;  3H06 B;  4FIM A;  3HPI A;  1DPE A;  3B6T A;  1XC1 A;  2R9J A;  3IL1 B;  3PUV E;  1EZ9 A;  4YB6 A;  1A8F A;  1PBP A;  3OO9 A;  3U92 A;  4G8M A;  3RLF E;  1B5J A;  2RC9 A;  3EPE A;  4AQ4 A;  2Q89 A;  4KQP A;  1B6H A;  4RYA A;  2DVC A;  1FQC A;  1PB7 A;  1B0L A;  3O2A A;  3VVE A;  1AH5 A;  1QUI A;  3B6W A;  3T9V A;  1LAG E;  4F31 B;  4QFN A;  2NWJ A;  4I8C A;  2FNC A;  3MC2 A;  1F9B A;  1NNK A;  2F6G A;  3IOW A;  4QFL A;  3SER A;  2XXW A;  5CMK A;  1YAE A;  2P0S A;  4F1U A;  2FYI A;  2ABH A;  3KJT A;  4MLV A;  2BJJ X;  1XS5 A;  2GFE A;  3EF7 A;  1IXH A;  4F2O A;  3K1M A;  1B3F A;  2O51 A;  1IQ7 A;  1OQG A;  5DVI A;  3RN8 A;  3TFL A;  3OXN A;  4H5G A;  4TQU Q;  4F19 A;  3OO6 A;  2YLN A;  1QKB A;  1MQD A;  4LQ2 A;  1JW1 A;  3UOR A;  4RA1 A;  1CB6 A;  2O68 A;  3VE1 B;  2I48 A;  3W9W A;  5J1D A;  1B7U A;  4JBZ A;  4WXJ A;  1IXG A;  2F35 A;  5B70 A;  3M8U A;  3RT8 A;  4EDP A;  5LOM A;  3QSL A;  1MM7 A;  4OTE A;  3K00 A;  4HTG A;  2IEE A;  1URD A;  2ZNU A;  3V8X B;  1A54 A;  2F7B A;  1UTH B;  3CRB A;  3SEW A;  3TUS A;  4IO6 A;  3N26 A;  3BKI B;  3RUM A;  2Y84 A;  1QJM A;  1GGG A;  4POW A;  4F3G A;  3K01 A;  1I6B A;  2V3Q A;  4HCW A;  1SW4 A;  1B3G A;  4YKJ A;  4OWD A;  4NF8 A;  1SW1 A;  4U1O A;  4RK2 A;  1O63 A;  2HAV A;  3FV2 A;  1JQF A;  3OSQ A;  1FTM A;  3FJG A;  2O7I A;  2XXX A;  4OMB A;  3VXB A;  4POX A;  3FXQ A;  2D3I A;  5CMC A; 
#chains in the Genus database with same CATH topology
 4KHZ E;  2CZI A;  1DTG A;  4PGP A;  5KCJ B;  1L5T A;  4KYS A;  1NKX A;  2X7P A;  4F3P A;  2HAU A;  4GRK A;  1B5I A;  1NV1 A;  3QK6 A;  2V3U A;  2UYE A;  2DE2 A;  2AYS A;  1MXW A;  4BDO A;  3TMG A;  3C4M A;  3S9L C;  3T9U A;  1RYO A;  2WYK A;  5H8F B;  5FTH A;  2ZYK A;  1B52 A;  4FJP A;  1YCJ A;  3SEX A;  3IB2 A;  4F22 A;  3U8Q A;  2Q8M A;  1KWH A;  1NV3 A;  5KDT B;  1IIT A;  4FED A;  4ZEC A;  1B2H A;  3USD A;  4Q5T A;  1POY 1;  3MP1 A;  2ZZW A;  3HO7 A;  3TEL A;  2FHY A;  2XX9 A;  1BLF A;  3FXR A;  2AL5 A;  5ISU A;  1FCK A;  3C9H A;  4X1D A;  4MMP A;  2KR0 A;  3ECR A;  3HV1 A;  2Q2C A;  2D5W A;  3R6U A;  4U23 A;  3LUY A;  4HE0 A;  4C1U A;  3TTL A;  1SVX B;  1M5C A;  3V89 B;  5JK4 A;  1UTH A;  4RK9 A;  1EH3 A;  1IUD A;  4YKK A;  4UAB A;  1VE4 A;  3B7D A;  4P47 A;  2H25 A;  2P3V A;  4PDH A;  5ICT A;  4NF6 B;  4KPT A;  3UA8 A;  3FVO A;  3E4R A;  1YPN A;  4PFY A;  3C35 A;  5I59 B;  3R26 A;  2NOO A;  3UIF A;  1YXI A;  1VDW A;  3T93 B;  1SW5 A;  3B6Q A;  1GV8 A;  1FBG A;  3DP4 A;  4E0X A;  5EQ8 A;  1B3L A;  3EHS A;  3R7X A;  3GBA A;  3I5O A;  4MF3 A;  1FPE A;  2RCB A;  5KCJ A;  3KSJ A;  1ZTY A;  1A8E A;  4MLQ A;  4IY5 A;  1AOV A;  1B4H A;  2DXY A;  3PU5 A;  5J16 A;  2QS4 A;  3VLV A;  1JW4 A;  2F3D A;  5L8D A;  4U2R A;  4OVT A;  5CM6 A;  1FQB A;  3D1R A;  3PPP A;  4EF1 A;  3TKD A;  4PAK A;  4DCY A;  4XEQ A;  2RCA A;  2OLB A;  5K2Y A;  4JXI A;  3PPQ A;  5CC2 A;  1D4N A;  1USY E;  4R2F A;  4LQ5 A;  5JEI A;  4Z7E A;  4H65 A;  1B32 A;  4NF4 B;  3THI A;  3GXA A;  1AIV A;  4G8N A;  4I40 A;  1YYZ A;  2QS1 A;  3KC1 A;  5AA4 B;  3UN6 A;  3FAT A;  3OOA A;  3QUF A;  4R9G A;  3PPO A;  3KG2 A;  4NG7 A;  5ET8 A;  2I0B A;  5TP9 A;  2GH9 A;  2PYY A;  2PMS A;  1FJ9 A;  3U94 A;  2F97 A;  3I6V A;  2QRY A;  4IO4 A;  4WKM A;  2ZXT A;  3QUJ A;  2I49 A;  4ESW A;  2AL4 A;  2DWI A;  4U1Z A;  1ZBM A;  4O7I A;  4H0W A;  4FOR A;  1LFI A;  4ZEF A;  2FBP A;  1TWY A;  4Q30 B;  2ZZX A;  3PPR A;  1FQD A;  1LST A;  3PUZ E;  5FHN A;  3MST A;  3G3H A;  2QSX A;  2QMW A;  1EYI A;  2I3W A;  2B4M A;  2QJE A;  2CMO A;  1FTJ A;  3VVD A;  2UVH A;  1N0T A;  4XKQ A;  4DLD A;  4NAP A;  3UK4 A;  2CEX A;  4N15 A;  3MVX A;  2DYX A;  2KLF A;  1CE2 A;  1UTB B;  4U21 A;  2HZL A;  4FAJ A;  5ET7 A;  3GBB A;  4YAH X;  1IMD A;  1IIW A;  5AA3 A;  1D9Y A;  1XT8 A;  4NMY A;  3G3K A;  3E3K A;  5A5X B;  1SPI A;  1EZP A;  3LR1 A;  3LBS A;  5I57 A;  3AXF A;  4KCC A;  2Y7W A;  1R9Q A;  2R71 A;  3G3I A;  2Q74 A;  1G0I A;  3GLB A;  3IR1 A;  5IZ1 A;  1LBX A;  4Q8R A;  1N7W A;  2VPO A;  2Z8D A;  2OZZ A;  3K4U A;  4NWC A;  3JZJ A;  4I62 A;  4OEV A;  1NV6 A;  1WVJ A;  4JB7 A;  1ATG A;  3K02 A;  1D9Q A;  2QFL A;  3VFJ A;  2FVZ A;  3N94 A;  4NF4 A;  3OEN A;  1DBZ A;  1R9L A;  3MVW A;  5JTY A;  3KBZ A;  1DTZ A;  2F8D A;  3K1N A;  1MPB A;  3KOS A;  1FBH A;  4P0G A;  3ZKK A;  5I2K B;  5AA4 A;  3MPK A;  2HHM A;  3HN0 A;  4MIJ A;  2ZMB A;  4PET A;  4NF0 A;  2UYF A;  1FQE A;  1S50 A;  5EYF A;  3RTF B;  1SW2 A;  4DIG A;  2A5S A;  3TZA A;  4BDN A;  3FIR A;  2HXR A;  5I58 A;  4ZE8 A;  5I56 B;  3E13 X;  4L17 A;  3C31 A;  1N84 A;  3TPA A;  5H8S A;  3V83 A;  4IY6 A;  3E78 A;  2F7A A;  3SEV A;  4QHQ A;  5LTC A;  3PTY A;  2XXK A;  1PB9 A;  2Y7K A;  3E9X A;  3O9P A;  1DPP A;  5L9O A;  2O84 X;  3MVZ A;  1QKA A;  1A7L A;  5TU0 A;  1FRP A;  1AMF A;  4HS7 A;  3EHU A;  2MKZ A;  2HCA A;  1FTL A;  2DOJ A;  1Y3Q A;  3ZSF A;  3S9M C;  1N76 A;  3O6I A;  5ET5 A;  4ELR A;  2H4I A;  1UTB A;  1WDN A;  3H6V A;  2YPN A;  3T9X B;  3U72 A;  4FEC A;  1PBQ A;  2OBG A;  3N5L A;  4GBV A;  4DXU A;  4PFU A;  2O1M A;  3MVY A;  1I6Q A;  3KEI A;  4EQ9 A;  1D3K A;  5A5X A;  3S9N C;  1XVX A;  1EYK A;  1LGB C;  2YJP A;  4NE4 A;  3U93 A;  3LC8 A;  2O6A A;  2CEY A;  1FPJ A;  3SKP A;  5CMB A;  4PGN A;  3N6U A;  2ZNT A;  4JVD A;  2I58 A;  2H5Y A;  4YKP A;  1B3H A;  3FVN A;  4WED A;  4ZDM A;  4PAI A;  2UVI A;  4PFT A;  2VT5 A;  1UQW A;  3W9V A;  5ELV A;  4PE3 A;  4OES A;  5H8N B;  2PFY A;  1I6A A;  2UVG A;  1P1O A;  1SBP A;  2DQV A;  5EYG A;  2GHB A;  5DT6 A;  1FBF A;  4IO5 A;  4X9T A;  2PFZ A;  1O64 A;  1NUY A;  1MH4 A;  5I2K A;  3CG3 A;  2ESN A;  1UIU A;  4MFI A;  4EQB A;  4ZE9 A;  4NTL A;  2P1S A;  4OFL A;  1S7Y A;  2VD2 A;  1FPI A;  1MXZ A;  1PB8 A;  1P1Q A;  5L9M A;  4R6K A;  4U4S A;  1R6Z A;  3ILT B;  2XXU A;  1B4Z A;  4F2Q A;  5I2N B;  2F3B A;  3VDF A;  2PT1 A;  2PT2 A;  3KGC A;  3C33 A;  1FBP A;  4X8R A;  3MW0 A;  5CMM A;  1NMU A;  2QVV A;  2CZL A;  3IO4 A;  5I56 A;  1N3X A;  1ZLQ A;  1MS7 A;  5IGA A;  3IB0 A;  2G29 A;  1KA1 A;  1SYH A;  3LSL A;  1MY2 A;  2H99 A;  2ZZV A;  3DLN A;  2M8C A;  1FPL A;  1FPB A;  3ILU B;  5L9S A;  4XKR A;  5FHO A;  1Y3P A;  4PFW A;  4OFO A;  1VR5 A;  1TFA A;  1Q9D A;  1FBD A;  4P0I A;  2XX8 A;  3MP8 A;  4F1V A;  1HSE A;  1TXF A;  2GHA A;  3CFZ A;  3RQT A;  3ODB A;  2F34 A;  3A29 A;  1MXV A;  2V84 A;  2Y7R A;  4OVS A;  3O6H A;  4KYD A;  4MJO A;  3BBR A;  3TCH A;  1DK4 A;  3O97 A;  4MNC A;  4HXV A;  4F1Y A;  1MQH A;  1RYX A;  1VFE A;  4H8J A;  4G77 A;  1LFH A;  1MQG A;  3A3U A;  3C34 A;  5H8N A;  1LB9 A;  1Y4T A;  1MG1 A;  3NOH A;  4R2B A;  2CZK A;  2DS9 A;  3N6T A;  2KQZ A;  3BIH A;  3VV5 A;  2DWJ A;  3RPL A;  2XXH A;  4OYV A;  3C36 A;  4DZ1 A;  2E0S A;  3KN8 A;  1NUX A;  4KFQ A;  4PAF A;  1Z7N E;  4OVP A;  3PUX E;  4GQO A;  1SD3 A;  2DE3 A;  2XXY A;  3FV1 A;  3M3L A;  4UAC A;  1Y20 A;  2QPQ A;  3HFU A;  4N8Y A;  3FVK A;  3KJ7 A;  1B9J A;  4OEU A;  4FE8 A;  1B40 A;  4E0W A;  1J1N A;  3VXC A;  5ITO A;  3JYR A;  2REJ A;  4RJZ A;  5I2N A;  4GF8 A;  5HBC A;  4TOZ A;  2RF1 A;  1ZU0 A;  3QIM A;  1URG A;  3U65 A;  4R9F A;  2H98 A;  4JSD A;  5M2V A;  4PFR A;  1QUJ A;  4M1V A;  1A99 A;  4N17 A;  4YMA A;  4KCD A;  3QYT A;  3M3K A;  3T1B A;  4XF5 A;  4F18 A;  1OLC A;  4O3A A;  2ANJ A;  5TPA B;  2REG A;  4GL8 A;  4ZEI A;  3PD8 A;  4YU0 A;  3Q26 A;  2A5T B;  3TTR A;  2O7U A;  4R73 A;  1LEV A;  1XVY A;  3FD3 A;  4BDR A;  1P1N A;  3CFX A;  4BDQ A;  5ITP A;  1FBE A;  4PQJ A;  1AL3 A;  1H3D A;  3OSR A;  4NGU A;  1OMP A;  3CSB A;  4JWX A;  4LN5 A;  4AB6 A;  1M5B A;  1FPD A;  4MCO A;  4K3F A;  5H8F A;  5CBS A;  2Y7P A;  3EQ1 A;  4NWD A;  4PP0 A;  4ZED A;  2NUV A;  4PF6 A;  4GD5 A;  5KDT A;  4R75 A;  4LZ8 A;  4RXL A;  1TT1 A;  1LAX A;  4LP2 B;  3H6U A;  3PPN A;  1P1U A;  3IFA A;  4G68 B;  1H45 A;  3RGY A;  3F11 A;  4PDD A;  4NF5 B;  3O6G A;  1MM6 A;  3TCF A;  1QGX A;  5HM4 B;  1M5D A;  2I4B A;  1IMF A;  4GXA A;  4O7M A;  2HXW A;  5ET6 A;  4N8G A;  3CHG A;  1JEV A;  2GQ1 A;  1TFD A;  4YZZ A;  4BDM A;  4LZ5 A;  4OFJ A;  3OO7 A;  1Y9U A;  4MAG A;  3UP9 A;  2Z23 A;  4YB7 A;  2B3B A;  3TQW A;  1MPC A;  3HHF A;  1LBC A;  4NF6 A;  3CI8 A;  2WYP A;  1USY H;  1FBC A;  1YZ0 A;  1B58 A;  4OA4 A;  2O1L A;  3PMV A;  1HSL A;  1MH3 A;  2QS3 A;  4JWO A;  1LBV A;  1WOD A;  5CBR A;  3TDJ A;  5I59 A;  1A40 A;  1ZIU A;  1LBB A;  3PMW A;  1JP4 A;  4N07 A;  2V3T A;  2I6E A;  1MXX A;  3HCQ A;  3H3G A;  4UA8 A;  4OXV A;  1O7T A;  5I3S A;  5DVF A;  1EYJ A;  1FSA A;  5TPA A;  3P7I A;  2Q9T A;  1HSJ A;  3OEL A;  1T0K A;  1H76 A;  1B46 A;  4BLA A;  2DVZ A;  2I3V A;  3PV0 E;  4AB5 A;  3O29 A;  4GOT A;  4H46 A;  4FEB A;  4RPO A;  2QVR A;  1RDY A;  4R72 A;  1FJ6 A;  3IFC A;  3BFU A;  1GR2 A;  5F1Q A;  5IAI A;  1IZ1 A;  3Q28 A;  4PFI A;  3ROJ A;  2G93 A;  5H8H B;  4N6D A;  3CIJ A;  4N6P A;  4YKI A;  1IMA A;  5HPQ A;  1MQI A;  4G4P A;  1NUZ A;  1ZKB A;  5EHM A;  4GXS B;  1BP5 A;  1FTK A;  4BDL A;  2HEU A;  1B7H A;  3LUZ A;  3IO6 A;  5EHS A;  2F78 A;  4PBH A;  2NVU B;  2L5V A;  1ELJ A;  4NX1 A;  4KD5 A;  4LUB A;  3KFM A;  1LFG A;  1MQJ A;  3TTM A;  4G68 A;  4AS5 A;  2OWS A;  4OET A;  4TLM B;  4OVQ A;  2RIN A;  1JVY A;  1OVT A;  2XD3 A;  4XIG Q;  2DP8 A;  3SEU A;  5AA1 A;  4EXL A;  2Z22 A;  1POT A;  4GWS A;  3IOV A;  1FTA A;  3OO8 A;  1Y4C A;  2RKM A;  5KZT A;  4HE1 A;  3I3V A;  2ALU A;  1B3E A;  2I4C A;  1RDX A;  4N6K A;  3T9H B;  4H67 A;  4OEN A;  3MZ1 A;  4EXK A;  3HHG A;  2Q88 A;  1JET A;  2R8T A;  5AA2 D;  3IX1 A;  1AWB A;  3HST A;  3CVG A;  4GWO A;  1EZO A;  3ZKL A;  1SDX A;  4IO2 A;  3RPW A;  3LSX A;  4IR8 A;  4G8H A;  4DI3 D;  3FJ7 A;  1NNF A;  4IGT A;  3G3J A;  3TAJ A;  3MYU A;  3KBR A;  4NF8 B;  2HQ0 A;  1SQY A;  5CI5 A;  1DOT A;  2DSF A;  1FPF A;  4MBP A;  1LAF E;  3K6X A;  1JW5 A;  4XXU A;  1LBW A;  1K9Y A;  4ESX A;  5FBP A;  3VLW A;  4IO7 A;  3MP6 A;  2ZYM A;  2XX7 A;  5EYH A;  3RNN A;  4QSD A;  1INP A;  3RYD A;  4KYE A;  2B3F A;  4PE5 B;  4N4U A;  4U4X A;  3DEL B;  4YMB A;  2PVU A;  4X48 A;  1QUL A;  1Z7M E;  3K6U A;  3IOU A;  1MY1 A;  3OEM A;  1PEB A;  3D4G A;  5H8H A;  3K6V A;  5CRY A;  4DCX A;  4QRZ A;  1XOC A;  1DMB A;  4FBP A;  3OD7 A;  3QXM A;  1YTV A;  3T66 A;  4F3S A;  2VOZ A;  1OLA A;  3MWB A;  1NV2 A;  3SZP A;  1GTK A;  2HZK A;  4PFB A;  2QL3 A;  4GBW A;  3GYY A;  4PC9 A;  4QFO A;  1OIB A;  4GLI A;  2IA4 A;  2OWT A;  4R6H A;  4XKP A;  4DXC A;  4GWY A;  3IB1 A;  1OVB A;  3Q25 A;  3O28 A;  3PD9 A;  1R1N A;  4H8I A;  4JVC A;  1JNF A;  3MJN A;  3TCG A;  1BK4 A;  4IGR A;  4QBA A;  1Q1K A;  4TLL B;  3L6H A;  3ISP A;  4I1D A;  4XKN A;  4YIC A;  1ZMG A;  4LZ7 A;  3KOT A;  1M5F A;  2XWI A;  3PUW E;  2RC8 A;  2XXP A;  4G61 A;  4GX4 A;  5DTB A;  4GWW A;  1VFD A;  1IXC A;  5T3J A;  4ZS9 A;  2VPN A;  4GVO A;  2THI A;  2V93 A;  2Q8J A;  4MEV A;  4GL0 A;  1B1X A;  4GWU A;  3RTW B;  2X7Q A;  3MBP A;  1QUK A;  4JVI A;  4RY1 A;  2F36 A;  1NL5 A;  1B5H A;  1SI1 A;  5IM2 A;  4QF9 A;  3DP6 A;  1LBZ A;  4KR5 A;  1FQA A;  4ND9 A;  1H44 A;  4ELP A;  1N3W A;  3PGF A;  2X26 A;  2PBW A;  2H9B A;  1PDA A;  3K2D A;  4MX6 A;  1ANF A;  3OEK A;  3IJX B;  1FQF A;  4QFK A;  3CFL A;  4IO3 A;  4C1T A;  3S4U A;  2LAO A;  1Y1M A;  3FUZ A;  4LVQ A;  4P3L A;  5DEX B;  4FAT A;  1OQH A;  2V4C A;  3LSF B;  2HPG A;  3BFT A;  3LSW A;  5IKB A;  4R74 A;  3CSG A;  4MNI A;  2VHA A;  1NNT A;  3H6T A;  4X1B A;  3FGS A;  2XA5 A;  4U22 A;  5F7V A;  5IZ3 B;  1CNQ A;  4P56 A;  1LB8 A;  1S9T A;  4O3B A;  2OCU A;  4NN3 A;  1N7X A;  5DW8 A;  4OAN A;  2XXV A;  4HW8 A;  4DXB A;  4YB5 A;  1B51 A;  5BUU A;  4ECF A;  3L6G A;  3MZB A;  2P2A A;  2WEF A;  1IEJ A;  3A09 A;  1MY3 A;  3U1O A;  4OQO A;  5I5P A;  3QMF A;  1NH7 A;  2Z8E A;  4PBQ A;  3EKI A;  4O94 A;  3K6W A;  2FIX A;  5AA2 B;  3H4Z A;  5H8Q B;  3RT6 B;  1SYI A;  4P11 A;  4OVR A;  1G0H A;  5FHM A;  2FA7 A;  3Q27 A;  2O69 A;  4ELQ A;  4MNP A;  2Y5L A;  5A5L A;  2R6G E;  5TP9 B;  1LCF A;  3JV9 A;  5I84 A;  3W15 C;  1B05 A;  4DI4 B;  4KI0 E;  2F5X A;  3VLU A;  1KZ8 A;  1MPD A;  2ONK E;  3ZS6 A;  1B0H A;  3KC0 A;  2E1S A;  1GVC A;  4F29 A;  1LAH E;  4H6D A;  3TOD A;  4PCD A;  1D9V A;  1BTJ A;  3MZ9 A;  2XXQ A;  4ELO A;  1Q35 A;  4C0R A;  1NI9 A;  2XXT A;  4G2Z A;  2ZNS A;  3QAX A;  1FW0 A;  4MHF A;  2F6P A;  5DYH A;  2V25 A;  4NED A;  1FTO A;  3H6W A;  1B7Z A;  3H03 A;  2NXO A;  2AIX A;  4H1X A;  1NFT A;  2ONR A;  3KN7 A;  2Q2A A;  3H7M A;  2UVJ A;  3SES A;  4WEP A;  5DEX A;  1I69 A;  3A3C A;  3MUQ A;  1IMB A;  2QVU A;  2VD3 A;  2VGQ A;  4LA9 A;  3SDF A;  4LON B;  3OMB A;  3DM0 A;  3FJM A;  1EU8 A;  1N04 A;  3V5A A;  4QFP A;  3IK6 B;  2CZH A;  4N91 A;  4QXD A;  2PCR A;  5IZ3 A;  1US4 A;  3PUY E;  5ESY A;  5I57 B;  5BWJ A;  2WBB A;  3UGW A;  2XWO A;  1A55 A;  1PC3 A;  1MY4 A;  4H5F A;  4LAT A;  3EHT A;  1B1H A;  4ZZE A;  1UIV A;  1MDP 1;  1NV5 A;  4XFE A;  3DP8 A;  3MPL A;  3S9E A;  4N13 A;  4QSC A;  1DSN A;  4O3C A;  5DVJ A;  4N81 A;  2XXR A;  3LV0 A;  2Y5K A;  1NH8 A;  5JTY B;  1BIY A;  3KN3 A;  1QVS A;  4G68 C;  4PTK A;  3WAE A;  2RC7 A;  1IXI A;  4O8M A;  2JJK A;  3IJO B;  5AA2 A;  3TEP A;  1P1W A;  5H8Q A;  2DXR A;  3FAS A;  3G3F A;  3T96 B;  1US5 A;  3MAM A;  1MRP A;  3D4C A;  3MQ9 A;  4ZEB A;  3CR9 A;  3VVF A;  1QW0 A;  4JSO A;  4Q0C A;  2VP1 A;  5AE4 A;  4I9D A;  1XI6 A;  2P3N A;  2PX1 A;  2Y7I A;  4QSE A;  4ONY A;  5I58 B;  4KXP A;  5EQ9 A;  4P1E A;  1LLS A;  2XD2 A;  2XXI A;  4IB2 A;  2ZYN A;  3WAF A;  4DDD A;  2D21 A;  4R6Y A;  2B4L A;  3T0J A;  4EQ7 A;  4OER A;  4HCY A;  3G7W A;  2ONS A;  1SI0 A;  4OVJ A;  1H43 A;  5K2X A;  5ICQ A;  5LDZ A;  4P1L A;  2UXA A;  3KSX A;  3M3F A;  2GRV A;  2A5T A;  4GX6 A;  2XHD A;  5F24 A;  4GWZ A;  4ZEK A;  3T22 A;  3TQL A;  4RNS A;  1M5E A;  3O66 A;  1MY0 A;  4ISU A;  5FTI A;  2XWV A;  3K1P A;  2DE4 A;  3PMX A;  3SEY A;  4GIZ A;  4I3E A;  3FVG A;  3FXU A;  1JEU A;  3SET A;  3C32 A;  2WX9 A;  4EF2 A;  2OK2 A;  2I0C A;  3TTN A;  4RPN A;  2OJT A;  4H45 A;  1NV4 A;  4F39 A;  3FBP A;  1VSO A;  1ZJL A;  3Q29 A;  4ZZA A;  1MDQ A;  2OX3 A;  4THI A;  1II5 A;  2B65 A;  1RKM A;  1MXU A;  1NNP A;  3GZG A;  2DWA A;  4JWY A;  1URS A;  4Z0I A;  3B50 A;  1MXY A;  1LBY A;  4JDF A;  4NF5 A;  1Y1Z A;  2QMX A;  4AS4 A;  1LCT A;  2F7C A;  3G3G A;  2QS2 A;  1P99 A;  2HFB A;  3IAZ A;  3TTK A;  3IOR A;  2OWZ A;  1Y3N A;  2ZYO A;  2DWH A;  3ONM A;  4XTC Q;  1BKA A;  3TYH A;  4M4G A;  2W7Y A;  3KZG A;  4EUO A;  4GFR A;  3RY3 A;  1XHY A;  4OHN A;  3K0V A;  5B7D A;  4DE8 A;  2WKY A;  1JVX A;  2FIE A;  1IMC A;  3FZV A;  1IME A;  4F3B A;  4MH5 A;  4OZ9 A;  3CG1 A;  3EN3 A;  3S2V A;  3IOT A;  2Z8F A;  3H06 B;  4FIM A;  3HPI A;  1DPE A;  3B6T A;  3E79 A;  4I3Y A;  1XC1 A;  2R9J A;  3IL1 B;  2WBD A;  3PUV E;  1EZ9 A;  4YB6 A;  1A8F A;  1PBP A;  3OO9 A;  3U92 A;  4G8M A;  3RLF E;  1B5J A;  2RC9 A;  3EPE A;  4AQ4 A;  2Q89 A;  4KQP A;  1B6H A;  4RYA A;  2DVC A;  1FQC A;  1PB7 A;  1B0L A;  3O2A A;  3VVE A;  1AH5 A;  1QUI A;  3B6W A;  1KA0 A;  3T9V A;  1LAG E;  4F31 B;  4QFN A;  2NWJ A;  4I8C A;  2FNC A;  3MC2 A;  4X04 A;  1F9B A;  1NNK A;  2F6G A;  4GX3 A;  3IOW A;  4HE2 A;  4QFL A;  3SER A;  2XXW A;  4P9K A;  5EQ7 A;  5CMK A;  1YAE A;  2P0S A;  5I7I A;  4F1U A;  2FYI A;  2BJI A;  2ABH A;  3KJT A;  4MLV A;  2BJJ X;  1XS5 A;  4GWX A;  2GFE A;  3EF7 A;  1NV0 A;  1IXH A;  4F2O A;  3K1M A;  1B3F A;  2O51 A;  1IQ7 A;  1OQG A;  5DVI A;  2XWK A;  3RN8 A;  3TFL A;  3OXN A;  4H5G A;  4TQU Q;  1K9Z A;  4P8B A;  4F19 A;  1NV7 A;  3OO6 A;  2YLN A;  1QKB A;  1MQD A;  1FPK A;  4LQ2 A;  1JW1 A;  3UOR A;  4RA1 A;  1CB6 A;  2O68 A;  3VE1 B;  2I48 A;  3W9W A;  5J1D A;  2DDK A;  1B7U A;  4NQ8 A;  4JBZ A;  4WXJ A;  1IXG A;  1DCU A;  2F35 A;  5B70 A;  3M8U A;  3RPL B;  3RT8 A;  1FPG A;  5EQA A;  4EDP A;  5LOM A;  3QSL A;  1MM7 A;  4OTE A;  3K00 A;  4HTG A;  2IEE A;  1URD A;  2ZNU A;  3V8X B;  1A54 A;  2F7B A;  4PF8 A;  5IZZ A;  1UTH B;  3CRB A;  3SEW A;  3TUS A;  4IO6 A;  3N26 A;  3BIG A;  4NHB A;  3BKI B;  3RUM A;  2Y84 A;  1NUW A;  1RDZ A;  1QJM A;  3FXB A;  1GGG A;  4POW A;  4F3G A;  3K01 A;  1I6B A;  2V3Q A;  4HCW A;  1SW4 A;  1B3G A;  4YKJ A;  4OWD A;  4NF8 A;  1SW1 A;  4U1O A;  4RK2 A;  1O63 A;  2HAV A;  3FV2 A;  3B8B A;  1JQF A;  3OSQ A;  1FTM A;  3FJG A;  2O7I A;  2XXX A;  4OMB A;  3VXB A;  4POX A;  3FXQ A;  2D3I A;  5CMC A; 
#chains in the Genus database with same CATH homology
 4KHZ E;  1DTG A;  5KCJ B;  1L5T A;  4KYS A;  1NKX A;  2X7P A;  4F3P A;  2HAU A;  4GRK A;  1B5I A;  3QK6 A;  2V3U A;  2UYE A;  2DE2 A;  2AYS A;  1MXW A;  4BDO A;  3TMG A;  3C4M A;  3S9L C;  3T9U A;  1RYO A;  5H8F B;  5FTH A;  2ZYK A;  1B52 A;  4FJP A;  1YCJ A;  3SEX A;  3IB2 A;  4F22 A;  3U8Q A;  1KWH A;  5KDT B;  1IIT A;  4FED A;  4ZEC A;  1B2H A;  3USD A;  4Q5T A;  1POY 1;  3MP1 A;  3HO7 A;  3TEL A;  2XX9 A;  1BLF A;  3FXR A;  2AL5 A;  5ISU A;  1FCK A;  3C9H A;  4X1D A;  3ECR A;  3HV1 A;  2Q2C A;  2D5W A;  3R6U A;  4U23 A;  3LUY A;  4C1U A;  3TTL A;  1SVX B;  1M5C A;  3V89 B;  5JK4 A;  1UTH A;  4RK9 A;  1EH3 A;  1IUD A;  4YKK A;  1VE4 A;  3B7D A;  2H25 A;  5ICT A;  4NF6 B;  4KPT A;  3UA8 A;  3FVO A;  3E4R A;  1YPN A;  4PFY A;  3C35 A;  5I59 B;  3R26 A;  2NOO A;  3UIF A;  3T93 B;  1SW5 A;  3B6Q A;  1GV8 A;  3DP4 A;  4E0X A;  1B3L A;  3EHS A;  3R7X A;  3GBA A;  3I5O A;  4MF3 A;  2RCB A;  5KCJ A;  3KSJ A;  1ZTY A;  1A8E A;  4MLQ A;  4IY5 A;  1AOV A;  1B4H A;  2DXY A;  3PU5 A;  2QS4 A;  3VLV A;  1JW4 A;  5L8D A;  4U2R A;  5CM6 A;  1FQB A;  3PPP A;  4EF1 A;  3TKD A;  4DCY A;  2RCA A;  2OLB A;  5K2Y A;  4JXI A;  3PPQ A;  5CC2 A;  1D4N A;  1USY E;  4R2F A;  4LQ5 A;  5JEI A;  4Z7E A;  4H65 A;  1B32 A;  4NF4 B;  3THI A;  3GXA A;  1AIV A;  4G8N A;  2QS1 A;  5AA4 B;  3UN6 A;  3FAT A;  3OOA A;  3QUF A;  4R9G A;  3PPO A;  3KG2 A;  2I0B A;  5TP9 A;  2GH9 A;  2PYY A;  2PMS A;  3U94 A;  2F97 A;  3I6V A;  2QRY A;  4IO4 A;  4WKM A;  2ZXT A;  3QUJ A;  2I49 A;  4ESW A;  2AL4 A;  2DWI A;  4U1Z A;  1ZBM A;  4H0W A;  4FOR A;  1LFI A;  4ZEF A;  1TWY A;  4Q30 B;  3PPR A;  1FQD A;  1LST A;  3PUZ E;  5FHN A;  3G3H A;  2QSX A;  2QMW A;  2I3W A;  2QJE A;  2CMO A;  1FTJ A;  3VVD A;  2UVH A;  1N0T A;  4XKQ A;  4DLD A;  3UK4 A;  3MVX A;  2DYX A;  2KLF A;  1CE2 A;  1UTB B;  4U21 A;  2HZL A;  4FAJ A;  3GBB A;  4YAH X;  1IIW A;  5AA3 A;  1D9Y A;  1XT8 A;  4NMY A;  3G3K A;  3E3K A;  5A5X B;  1EZP A;  3LR1 A;  3LBS A;  5I57 A;  3AXF A;  4KCC A;  2Y7W A;  1R9Q A;  2R71 A;  3G3I A;  3GLB A;  3IR1 A;  4Q8R A;  1N7W A;  2Z8D A;  2OZZ A;  3K4U A;  4NWC A;  3JZJ A;  4I62 A;  4OEV A;  1WVJ A;  4JB7 A;  1ATG A;  3K02 A;  3VFJ A;  3N94 A;  4NF4 A;  3OEN A;  1R9L A;  3MVW A;  5JTY A;  1DTZ A;  2F8D A;  3K1N A;  1MPB A;  3KOS A;  4P0G A;  3ZKK A;  5I2K B;  5AA4 A;  3MPK A;  3HN0 A;  2ZMB A;  4PET A;  2UYF A;  1FQE A;  1S50 A;  5EYF A;  3RTF B;  1SW2 A;  4DIG A;  2A5S A;  3TZA A;  4BDN A;  3FIR A;  5I58 A;  4ZE8 A;  5I56 B;  3E13 X;  4L17 A;  3C31 A;  1N84 A;  3TPA A;  5H8S A;  3V83 A;  4IY6 A;  2F7A A;  3SEV A;  4QHQ A;  1PB9 A;  2Y7K A;  3E9X A;  3O9P A;  1DPP A;  5L9O A;  2O84 X;  3MVZ A;  1QKA A;  1A7L A;  5TU0 A;  1AMF A;  4HS7 A;  3EHU A;  2HCA A;  1FTL A;  2DOJ A;  1Y3Q A;  3ZSF A;  3S9M C;  1N76 A;  3O6I A;  4ELR A;  2H4I A;  1UTB A;  1WDN A;  3H6V A;  2YPN A;  3T9X B;  3U72 A;  4FEC A;  1PBQ A;  2OBG A;  3N5L A;  4DXU A;  4PFU A;  2O1M A;  3MVY A;  1I6Q A;  3KEI A;  4EQ9 A;  1D3K A;  5A5X A;  3S9N C;  1XVX A;  1LGB C;  2YJP A;  4NE4 A;  3U93 A;  3LC8 A;  2O6A A;  3SKP A;  5CMB A;  3N6U A;  2ZNT A;  2I58 A;  2H5Y A;  4YKP A;  1B3H A;  3FVN A;  4WED A;  4ZDM A;  2UVI A;  4PFT A;  1UQW A;  3W9V A;  5ELV A;  4OES A;  5H8N B;  1I6A A;  2UVG A;  1P1O A;  1SBP A;  2DQV A;  2GHB A;  5DT6 A;  4IO5 A;  4X9T A;  1O64 A;  1MH4 A;  5I2K A;  3CG3 A;  2ESN A;  1UIU A;  4MFI A;  4EQB A;  4ZE9 A;  4NTL A;  2P1S A;  4OFL A;  1S7Y A;  2VD2 A;  1MXZ A;  1PB8 A;  1P1Q A;  5L9M A;  4R6K A;  4U4S A;  1R6Z A;  3ILT B;  2XXU A;  1B4Z A;  4F2Q A;  5I2N B;  3VDF A;  2PT1 A;  2PT2 A;  3KGC A;  3C33 A;  3MW0 A;  5CMM A;  1NMU A;  2CZL A;  3IO4 A;  5I56 A;  1N3X A;  1ZLQ A;  1MS7 A;  3IB0 A;  2G29 A;  1SYH A;  3LSL A;  1MY2 A;  2H99 A;  3DLN A;  2M8C A;  3ILU B;  5L9S A;  4XKR A;  5FHO A;  1Y3P A;  4PFW A;  4OFO A;  1VR5 A;  1TFA A;  4P0I A;  2XX8 A;  3MP8 A;  4F1V A;  1HSE A;  1TXF A;  2GHA A;  3CFZ A;  3RQT A;  3ODB A;  2F34 A;  1MXV A;  2V84 A;  2Y7R A;  3O6H A;  4KYD A;  3TCH A;  3BBR A;  3O97 A;  4F1Y A;  1MQH A;  1RYX A;  1VFE A;  4H8J A;  4G77 A;  1LFH A;  1MQG A;  3A3U A;  3C34 A;  5H8N A;  1LB9 A;  1Y4T A;  1MG1 A;  4R2B A;  2DS9 A;  3N6T A;  3VV5 A;  2DWJ A;  2XXH A;  4OYV A;  3C36 A;  4DZ1 A;  2E0S A;  3KN8 A;  4KFQ A;  1Z7N E;  3PUX E;  4GQO A;  1SD3 A;  2DE3 A;  2XXY A;  3FV1 A;  3M3L A;  4UAC A;  1Y20 A;  2QPQ A;  3FVK A;  3KJ7 A;  1B9J A;  4OEU A;  4FE8 A;  1B40 A;  4E0W A;  1J1N A;  3VXC A;  5ITO A;  3JYR A;  2REJ A;  4RJZ A;  5I2N A;  4GF8 A;  5HBC A;  4TOZ A;  2RF1 A;  1ZU0 A;  3QIM A;  1URG A;  4R9F A;  2H98 A;  4JSD A;  5M2V A;  1QUJ A;  4M1V A;  1A99 A;  4YMA A;  4KCD A;  3QYT A;  3M3K A;  4F18 A;  1OLC A;  4O3A A;  2ANJ A;  5TPA B;  2REG A;  4GL8 A;  4ZEI A;  3PD8 A;  4YU0 A;  3Q26 A;  2A5T B;  3TTR A;  2O7U A;  4R73 A;  1XVY A;  3FD3 A;  4BDR A;  1P1N A;  3CFX A;  4BDQ A;  5ITP A;  4PQJ A;  1AL3 A;  1H3D A;  3OSR A;  1OMP A;  3CSB A;  4JWX A;  4AB6 A;  1M5B A;  4K3F A;  5H8F A;  5CBS A;  2Y7P A;  3EQ1 A;  4NWD A;  4PP0 A;  4ZED A;  2NUV A;  4GD5 A;  5KDT A;  4R75 A;  4LZ8 A;  4RXL A;  1TT1 A;  1LAX A;  4LP2 B;  3H6U A;  3PPN A;  1P1U A;  4G68 B;  1H45 A;  3RGY A;  3F11 A;  3O6G A;  4NF5 B;  1MM6 A;  3TCF A;  5HM4 B;  1M5D A;  2I4B A;  4GXA A;  2HXW A;  1JEV A;  1TFD A;  4YZZ A;  4BDM A;  4LZ5 A;  4OFJ A;  3OO7 A;  1Y9U A;  3UP9 A;  2Z23 A;  4YB7 A;  2B3B A;  3TQW A;  1MPC A;  3HHF A;  1LBC A;  4NF6 A;  3CI8 A;  1USY H;  1B58 A;  2O1L A;  3PMV A;  1HSL A;  1MH3 A;  2QS3 A;  4JWO A;  1WOD A;  5CBR A;  3TDJ A;  5I59 A;  1A40 A;  1ZIU A;  1LBB A;  3PMW A;  4N07 A;  2V3T A;  2I6E A;  1MXX A;  3HCQ A;  3H3G A;  4UA8 A;  4OXV A;  1O7T A;  5DVF A;  5TPA A;  3P7I A;  2Q9T A;  1HSJ A;  3OEL A;  1T0K A;  1H76 A;  1B46 A;  4BLA A;  2DVZ A;  2I3V A;  3PV0 E;  4AB5 A;  3O29 A;  4GOT A;  4FEB A;  4RPO A;  4R72 A;  3BFU A;  1GR2 A;  5F1Q A;  5IAI A;  1IZ1 A;  3Q28 A;  2G93 A;  5H8H B;  3CIJ A;  4N6P A;  4YKI A;  5HPQ A;  1MQI A;  4G4P A;  1ZKB A;  5EHM A;  4GXS B;  1BP5 A;  1FTK A;  4BDL A;  2HEU A;  1B7H A;  3IO6 A;  5EHS A;  2F78 A;  2NVU B;  1ELJ A;  4KD5 A;  4LUB A;  3KFM A;  1LFG A;  1MQJ A;  3TTM A;  4G68 A;  2OWS A;  4OET A;  4TLM B;  2RIN A;  1JVY A;  1OVT A;  2XD3 A;  4XIG Q;  2DP8 A;  3SEU A;  5AA1 A;  4EXL A;  2Z22 A;  1POT A;  3IOV A;  3OO8 A;  1Y4C A;  2RKM A;  5KZT A;  3I3V A;  2ALU A;  1B3E A;  2I4C A;  3T9H B;  4H67 A;  4OEN A;  3MZ1 A;  4EXK A;  3HHG A;  2Q88 A;  1JET A;  5AA2 D;  3IX1 A;  3HST A;  3CVG A;  4GWO A;  1EZO A;  3ZKL A;  1SDX A;  4IO2 A;  3RPW A;  3LSX A;  4G8H A;  3FJ7 A;  1NNF A;  4IGT A;  3G3J A;  3TAJ A;  3KBR A;  4NF8 B;  2HQ0 A;  1SQY A;  5CI5 A;  1DOT A;  2DSF A;  4MBP A;  1LAF E;  3K6X A;  1JW5 A;  4XXU A;  4ESX A;  3VLW A;  4IO7 A;  3MP6 A;  2ZYM A;  2XX7 A;  3RNN A;  4QSD A;  4KYE A;  2B3F A;  4PE5 B;  4U4X A;  3DEL B;  4YMB A;  2PVU A;  4X48 A;  1QUL A;  1Z7M E;  3K6U A;  3IOU A;  1MY1 A;  3OEM A;  1PEB A;  3D4G A;  5H8H A;  3K6V A;  5CRY A;  4DCX A;  4QRZ A;  1XOC A;  1DMB A;  3OD7 A;  3QXM A;  1YTV A;  3T66 A;  4F3S A;  2VOZ A;  1OLA A;  3MWB A;  1GTK A;  2HZK A;  2QL3 A;  4QFO A;  1OIB A;  4GLI A;  2IA4 A;  2OWT A;  4R6H A;  4XKP A;  4DXC A;  3IB1 A;  1OVB A;  3Q25 A;  3O28 A;  3PD9 A;  1R1N A;  4H8I A;  1JNF A;  3MJN A;  3TCG A;  4IGR A;  1Q1K A;  4TLL B;  3L6H A;  4I1D A;  4XKN A;  4YIC A;  1ZMG A;  4LZ7 A;  3KOT A;  1M5F A;  3PUW E;  2RC8 A;  2XXP A;  5DTB A;  1VFD A;  1IXC A;  4ZS9 A;  4GVO A;  2THI A;  2V93 A;  2Q8J A;  4GL0 A;  1B1X A;  3RTW B;  2X7Q A;  3MBP A;  1QUK A;  4RY1 A;  2F36 A;  1NL5 A;  1B5H A;  1SI1 A;  4QF9 A;  3DP6 A;  4KR5 A;  1FQA A;  4ND9 A;  1H44 A;  4ELP A;  1N3W A;  3PGF A;  2X26 A;  2PBW A;  2H9B A;  1PDA A;  3K2D A;  1ANF A;  3OEK A;  3IJX B;  1FQF A;  4QFK A;  3CFL A;  4IO3 A;  4C1T A;  3S4U A;  2LAO A;  1Y1M A;  3FUZ A;  4LVQ A;  5DEX B;  4FAT A;  1OQH A;  3LSF B;  3BFT A;  3LSW A;  5IKB A;  4R74 A;  3CSG A;  2VHA A;  1NNT A;  3H6T A;  4X1B A;  3FGS A;  4U22 A;  5F7V A;  1LB8 A;  1S9T A;  4O3B A;  2OCU A;  1N7X A;  2XXV A;  4HW8 A;  4DXB A;  4YB5 A;  5BUU A;  1B51 A;  4ECF A;  3L6G A;  3MZB A;  2P2A A;  1IEJ A;  3A09 A;  1MY3 A;  3U1O A;  4OQO A;  1NH7 A;  2Z8E A;  3K6W A;  5AA2 B;  3H4Z A;  5H8Q B;  3RT6 B;  1SYI A;  4P11 A;  5FHM A;  2FA7 A;  3Q27 A;  2O69 A;  4ELQ A;  2R6G E;  5TP9 B;  1LCF A;  3JV9 A;  5I84 A;  3W15 C;  1B05 A;  4KI0 E;  2F5X A;  3VLU A;  1MPD A;  2ONK E;  3ZS6 A;  1B0H A;  2E1S A;  1GVC A;  4F29 A;  1LAH E;  4H6D A;  3TOD A;  1D9V A;  1BTJ A;  3MZ9 A;  2XXQ A;  4ELO A;  1Q35 A;  4C0R A;  2XXT A;  4G2Z A;  2ZNS A;  3QAX A;  1FW0 A;  2F6P A;  5DYH A;  2V25 A;  4NED A;  1FTO A;  3H6W A;  1B7Z A;  3H03 A;  2NXO A;  2AIX A;  4H1X A;  1NFT A;  2ONR A;  3KN7 A;  2Q2A A;  3H7M A;  2UVJ A;  3SES A;  4WEP A;  5DEX A;  1I69 A;  3A3C A;  3MUQ A;  2VD3 A;  2VGQ A;  4LA9 A;  3SDF A;  4LON B;  3OMB A;  3DM0 A;  3FJM A;  1EU8 A;  1N04 A;  3V5A A;  4QFP A;  3IK6 B;  1US4 A;  3PUY E;  5I57 B;  5BWJ A;  3UGW A;  1A55 A;  1PC3 A;  1MY4 A;  4H5F A;  4LAT A;  3EHT A;  1B1H A;  4ZZE A;  1UIV A;  1MDP 1;  3DP8 A;  3MPL A;  3S9E A;  4N13 A;  4QSC A;  1DSN A;  4O3C A;  5DVJ A;  2XXR A;  1NH8 A;  5JTY B;  1BIY A;  3KN3 A;  1QVS A;  4G68 C;  3WAE A;  2RC7 A;  1IXI A;  3IJO B;  5AA2 A;  3TEP A;  1P1W A;  5H8Q A;  2DXR A;  3FAS A;  3G3F A;  3T96 B;  1US5 A;  3MAM A;  1MRP A;  3D4C A;  3MQ9 A;  4ZEB A;  3CR9 A;  3VVF A;  1QW0 A;  4JSO A;  4Q0C A;  2VP1 A;  5AE4 A;  4I9D A;  2PX1 A;  2Y7I A;  4QSE A;  4ONY A;  5I58 B;  1LLS A;  2XD2 A;  2XXI A;  4IB2 A;  2ZYN A;  3WAF A;  4DDD A;  2D21 A;  4R6Y A;  4EQ7 A;  4OER A;  4HCY A;  3G7W A;  2ONS A;  1SI0 A;  4OVJ A;  1H43 A;  5K2X A;  5ICQ A;  2UXA A;  3KSX A;  3M3F A;  2GRV A;  2A5T A;  2XHD A;  4ZEK A;  3T22 A;  3TQL A;  4RNS A;  1M5E A;  3O66 A;  1MY0 A;  4ISU A;  5FTI A;  3K1P A;  2DE4 A;  3PMX A;  3SEY A;  4GIZ A;  3FVG A;  3FXU A;  1JEU A;  3SET A;  3C32 A;  4EF2 A;  2OK2 A;  2I0C A;  3TTN A;  4RPN A;  2OJT A;  4F39 A;  1VSO A;  1ZJL A;  3Q29 A;  4ZZA A;  1MDQ A;  4THI A;  1II5 A;  2B65 A;  1RKM A;  1MXU A;  1NNP A;  3GZG A;  2DWA A;  4JWY A;  1URS A;  4Z0I A;  1MXY A;  4JDF A;  4NF5 A;  1Y1Z A;  2QMX A;  1LCT A;  2F7C A;  3G3G A;  2QS2 A;  1P99 A;  2HFB A;  3IAZ A;  3TTK A;  3IOR A;  1Y3N A;  2ZYO A;  2DWH A;  3ONM A;  4XTC Q;  1BKA A;  3TYH A;  4M4G A;  2W7Y A;  3KZG A;  4EUO A;  4GFR A;  3RY3 A;  1XHY A;  4OHN A;  3K0V A;  5B7D A;  4DE8 A;  2WKY A;  1JVX A;  3FZV A;  4F3B A;  4MH5 A;  4OZ9 A;  3CG1 A;  3EN3 A;  3S2V A;  3IOT A;  2Z8F A;  3H06 B;  4FIM A;  3HPI A;  1DPE A;  3B6T A;  1XC1 A;  2R9J A;  3IL1 B;  3PUV E;  1EZ9 A;  4YB6 A;  1A8F A;  1PBP A;  3OO9 A;  3U92 A;  4G8M A;  3RLF E;  1B5J A;  2RC9 A;  3EPE A;  4AQ4 A;  2Q89 A;  4KQP A;  1B6H A;  4RYA A;  2DVC A;  1FQC A;  1PB7 A;  1B0L A;  3O2A A;  3VVE A;  1AH5 A;  1QUI A;  3B6W A;  3T9V A;  1LAG E;  4F31 B;  4QFN A;  2NWJ A;  4I8C A;  2FNC A;  3MC2 A;  1F9B A;  1NNK A;  2F6G A;  3IOW A;  4QFL A;  3SER A;  2XXW A;  5CMK A;  1YAE A;  2P0S A;  4F1U A;  2FYI A;  2ABH A;  3KJT A;  4MLV A;  2BJJ X;  1XS5 A;  2GFE A;  3EF7 A;  1IXH A;  4F2O A;  3K1M A;  1B3F A;  2O51 A;  1IQ7 A;  1OQG A;  5DVI A;  3RN8 A;  3TFL A;  3OXN A;  4H5G A;  4TQU Q;  4F19 A;  3OO6 A;  2YLN A;  1QKB A;  1MQD A;  4LQ2 A;  1JW1 A;  3UOR A;  4RA1 A;  1CB6 A;  2O68 A;  3VE1 B;  2I48 A;  3W9W A;  5J1D A;  1B7U A;  4JBZ A;  4WXJ A;  1IXG A;  2F35 A;  5B70 A;  3M8U A;  3RT8 A;  4EDP A;  5LOM A;  3QSL A;  1MM7 A;  4OTE A;  3K00 A;  4HTG A;  2IEE A;  1URD A;  2ZNU A;  3V8X B;  1A54 A;  2F7B A;  1UTH B;  3CRB A;  3SEW A;  3TUS A;  4IO6 A;  3N26 A;  3BKI B;  3RUM A;  2Y84 A;  1QJM A;  1GGG A;  4POW A;  4F3G A;  3K01 A;  1I6B A;  2V3Q A;  4HCW A;  1SW4 A;  1B3G A;  4YKJ A;  4OWD A;  4NF8 A;  1SW1 A;  4U1O A;  4RK2 A;  1O63 A;  2HAV A;  3FV2 A;  1JQF A;  3OSQ A;  1FTM A;  3FJG A;  2O7I A;  2XXX A;  4OMB A;  3VXB A;  4POX A;  3FXQ A;  2D3I A;  5CMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...