4BDQA

Crystal structure of the gluk2 r775a lbd dimer in complex with glutamate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
253
structure length
250
Chain Sequence
SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYADKITIAILQLQEEGKLHMMKEKWWRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Correlating Efficacy and Desensitization with Gluk2 Ligand-Binding Domain Movements.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport
molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
total genus 85
structure length 250
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdqA02
4I62A 1DTGA 3H3GA 3RUMA 3FIRA 4N13A 4OWDA 4U21A 2HQ0A 3PPPA 2QL3A 1IXIA 4F1VA 3IOUA 3UN6A 3CG1A 3CIJA 3K6VA 4FIMA 3IOWA 1I6QA 2H98A 2O68A 4XXUA 3HPIA 1B1HA 1SYIA 4R6KA 4O3BA 4F19A 3TQLA 1A8FA 3EQ1A 4DXUA 4FORA 2PT2A 3TTKA 4Q8RA 5I59A 1B2HA 1SW1A 2REGA 3MBPA 3R26A 1MY4A 1A99A 5TU0A 2O51A 1LB8A 4OVJA 4NWCA 1B05A 1QW0A 2H4IA 2YLNA 4WEDA 3TELA 3U93A 5I2NB 1QJMA 2I4BA 3M3KA 4GL8A 2F6GA 4OMBA 2REJA 4RNSA 4DXBA 3S2VA 1XVXA 2XXYA 1ZLQA 1B32A 3KSJA 1AIVA 4R9FA 1LB9A 1MS7A 4F3PA 4TQUQ 3SESA 3EHTA 3R6UA 3C4MA 2HEUA 4N07A 3ECRA 2RINA 2R9JA 4ELRA 1I6AA 3TAJA 1JQFA 5EHMA 2FA7A 1MQIA 1SW4A 3G3IA 3TCFA 1JVXA 3IO4A 1NL5A 1OVBA 4DIGA 2Y7IA 4KQPA 2QS1A 1MXWA 3DP4A 4Z0IA 3H6VA 2DP8A 3SEWA 3ZS6A 4LP2B 1QUKA 5DVJA 3KZGA 3BBRA 4QRZA 3KG2A 1EZOA 3OXNA 4NF5A 2V3TA 1XT8A 3C36A 3K6WA 4OETA 2O84X 2F5XA 2HXWA 4NF4B 2D3IA 3FJMA 2F7CA 3IORA 3W9VA 1MXUA 3ILTB 4DLDA 4KFQA 5I58B 3VE1B 2ZMBA 4RA1A 4EXKA 1EH3A 1GVCA 1FTJA 3PMVA 2F35A 4IO7A 2H5YA 3O6IA 3QUFA 4NMYA 4THIA 3RPWA 3UORA 2XXUA 3PUXE 5CMKA 1URDA 1DPEA 1POTA 2F78A 3N94A 4RY1A 3THIA 1LLSA 1BIYA 2RC9A 1EZ9A 3DELB 1ELJA 4KYEA 2P0SA 1FTOA 4UA8A 3T9UA 3V89B 1VE4A 2A5TA 4ONYA 1XS5A 4IGRA 1GV8A 2XXXA 4KI0E 4DE8A 2Q9TA 1P99A 4JXIA 3K6UA 3PPOA 5CRYA 4LATA 4G77A 1MY2A 2Y84A 1PDAA 4R73A 5AA1A 4YU0A 5H8NB 3TTMA 4AB5A 2ABHA 1XHYA 3G3FA 3HHGA 1DTZA 2XXQA 5JTYA 4GD5A 2A5TB 4R6YA 4H8IA 2Z23A 4U4XA 4DDDA 4EXLA 4R9GA 3TPAA 1MXXA 2XX7A 3PUVE 1UTBB 1D9YA 3G7WA 4M1VA 3RTWB 1GTKA 4BDQA 2W7YA 4FECA 4QFNA 4E0WA 4F3BA 4ZEDA 4I8CA 3U92A 1LCTA 5DT6A 4OFOA 1MQJA 2F6PA 2RC8A 3JZJA 1ZTYA 3UP9A 4XIGQ 4BDOA 1ZBMA 4R72A 1FTMA 2ZXTA 1BTJA 4H6DA 4MLQA 1RKMA 4R6HA 1IXGA 2HFBA 3M3LA 1I69A 4IO5A 2ZYNA 4YKKA 2QS3A 3HV1A 5JEIA 1FQDA 1MY3A 4EF1A 5I2NA 3OO9A 4NTLA 3H7MA 5DEXA 5LOMA 3FXRA 1IUDA 1KWHA 1VFEA 2H99A 2R71A 3FXQA 1USYH 3JV9A 3L6GA 4H0WA 4ND9A 2ZYMA 4GF8A 1LAGE 3M8UA 5I56B 1IXHA 1MY0A 1B51A 1JEVA 1LGBC 1MPCA 5AE4A 4F29A 2QS2A 3N6UA 1Z7NE 4K3FA 1MH4A 3Q28A 2O6AA 3I6VA 2X7PA 1MDP1 1TT1A 1T0KA 3CRBA 1L5TA 1BLFA 1QVSA 4NF8A 1NMUA 1LSTA 2I58A 2XXVA 3IOTA 3MPKA 2RCBA 3QXMA 1ZIUA 2OJTA 3T66A 3C32A 3FASA 3TMGA 4OESA 3ZSFA 1MQGA 4ZECA 4PQJA 2RKMA 2LAOA 2X7QA 1UIUA 3G3JA 3PD9A 4PFWA 4PP0A 4ELOA 5CBSA 3S4UA 3T9VA 3TCHA 3UGWA 4WEPA 5H8QA 4JB7A 2FNCA 4ZE9A 5HM4B 1LBBA 5TPAA 1B4HA 3MVXA 1US5A 4RK2A 1XOCA 1FCKA 3RT8A 4GL0A 4QSEA 1FQBA 5EYFA 3V8XB 1Y3PA 3VLUA 1PBPA 1MM6A 2D5WA 3C35A 2I3WA 3K01A 3K4UA 4H65A 5HBCA 3LSWA 1QKBA 3TKDA 1B3FA 2NWJA 3I5OA 3N6TA 4QSDA 1VFDA 2OZZA 3DP8A 3E3KA 3KOSA 3OO8A 4G8NA 1DOTA 4QSCA 4XKRA 4ESXA 3C34A 4I1DA 5JK4A 2DWHA 1UTHA 2UYFA 3A3CA 4M4GA 5CI5A 5KZTA 3S9NC 1B6HA 2OBGA 2QRYA 4X1BA 1A54A 1QKAA 2Y7PA 2I49A 1B1XA 1HSJA 3ONMA 1MPDA 3VLWA 3SEXA 5B70A 3A09A 4U1OA 5F1QA 1B0LA 1B7ZA 2ESNA 2P1SA 5IKBA 3MVYA 1TFDA 2OWSA 4GXSB 3B6TA 3RLFE 4IO3A 4PFTA 2B3FA 3B6WA 4DCXA 3SEYA 2I48A 5AA2A 2DWJA 4KCDA 2RC7A 1SI0A 4H67A 1B3LA 3K1NA 3R7XA 2O1LA 4DXCA 1CE2A 3OSRA 4ZZAA 2NVUB 3O66A 1MQHA 2AIXA 3MZBA 3OELA 2DQVA 3E9XA 3QAXA 4G2ZA 3T22A 1YAEA 3MVWA 4OTEA 3VXBA 2DS9A 3PUYE 1Y1ZA 4G68A 2ZNUA 3I3VA 2V25A 3O29A 3Q26A 3W9WA 1BKAA 1PB7A 2DXYA 2HCAA 2UYEA 4IGTA 4QF9A 2PMSA 1H76A 5KCJA 1D9VA 2V3UA 4O3CA 2UXAA 4MH5A 4RYAA 3CG3A 4XKQA 3FGSA 5AA3A 4TOZA 4JWYA 1SI1A 4JWXA 4F22A 3B6QA 2PBWA 4GWOA 3QYTA 3DLNA 4YKIA 3OOAA 4G8HA 4HTGA 1M5EA 1N7XA 5H8FB 3OEMA 5DTBA 1WDNA 4YMBA 3H6UA 4RK9A 1PC3A 4XKPA 5ICQA 4DZ1A 1ZMGA 1R9LA 2CZLA 3LSLA 4F2QA 2V84A 2XD3A 4X9TA 2Q89A 4FJPA 3PUWE 4RJZA 2I6EA 1NNPA 1QULA 1ZU0A 1IEJA 2YJPA 1Y20A 1Y3NA 1O7TA 1SYHA 1B40A 3CFZA 3EPEA 3MP1A 4KYDA 1IZ1A 3E4RA 2VHAA 5H8QB 4QHQA 4TLMB 1MQDA 1UTBA 4U2RA 5M2VA 2B3BA 5J1DA 4ZS9A 1B9JA 1AMFA 3MZ1A 3KFMA 2OLBA 2ZNTA 3W15C 4NF6B 1Q35A 5KDTA 2G29A 4P11A 2RF1A 4NF8B 3TEPA 3RNNA 2H9BA 4BDLA 1MPBA 3V83A 1UQWA 1OLAA 2I3VA 2I4CA 2XX8A 3BFUA 2AL5A 3IB0A 3MWBA 3MZ9A 2DVCA 4IO6A 4QFLA 4YZZA 1SQYA 1DMBA 4F1YA 3T96B 1Y9UA 1MH3A 3D4GA 3MW0A 4BDRA 4ZEFA 2YPNA 2I0CA 2Q88A 4KCCA 2F7AA 3TQWA 1A55A 3FZVA 4G68C 4C1TA 3O9PA 4POWA 1CB6A 2E1SA 4IB2A 2O1MA 1OQHA 4BDMA 5A5XA 3H03A 3HHFA 1Y4TA 3RQTA 3C33A 2KLFA 1IIWA 4RPNA 3S9MC 1ZKBA 5A5XB 4JSDA 2DSFA 2P2AA 3A3UA 4ZEBA 4NF5B 3KJTA 1LBCA 4YICA 3VV5A 4BLAA 1LAHE 1USYE 5DVIA 4KR5A 4U4SA 1XVYA 2B65A 3LBSA 3PU5A 3UA8A 4FATA 2HZLA 2I0BA 3CFLA 3ZKLA 3EHSA 3Q25A 4IY5A 1N3XA 3FVGA 1NNKA 2GHBA 2R6GE 3FVKA 3GBBA 1SW2A 1JVYA 3O28A 4OXVA 3K2DA 5I2KA 4JWOA 5JTYB 3EHUA 4IY6A 2DYXA 2UVJA 3K6XA 3LSFB 1H43A 1MY1A 2X26A 4H5GA 4GRKA 1N04A 4FEBA 4Q30B 1URSA 4R74A 2XHDA 4OEUA 4OFLA 3TODA 4EQ9A 4ESWA 5TP9B 3MQ9A 1WODA 3EN3A 4XTCQ 3RT6B 4AQ4A 4GLIA 4FE8A 5AA2D 1YTVA 1AL3A 1DPPA 3IJXB 4POXA 3RTFB 4KD5A 2ONSA 2DWAA 2ONRA 4EQBA 2XXPA 1SD3A 3OENA 1N76A 1JW1A 1DSNA 4OQOA 3VDFA 1AOVA 4RXLA 1P1UA 3CVGA 3KOTA 3OMBA 1ATGA 2THIA 2A5SA 3VVEA 4EQ7A 3KGCA 4R2FA 3FV1A 3LR1A 1VR5A 1R1NA 2DVZA 4L17A 2Z8DA 3SETA 3TTNA 4Q0CA 1MM7A 2O69A 3KBRA 3PUZE 5F7VA 1B5JA 3RN8A 4BDNA 1UIVA 2PT1A 4KHZE 4ELPA 3OD7A 2F36A 3IB2A 3FV2A 4H5FA 2XXRA 4FAJA 3TTRA 5L9OA 1NH8A 1EZPA 3G3KA 1J1NA 3JYRA 4LZ8A 4ZZEA 2OWTA 3TFLA 3SDFA 3OO7A 3PV0E 4F39A 2PVUA 4RPOA 1I6BA 1UTHB 2WKYA 2NUVA 4WKMA 3VFJA 5ITPA 5CM6A 1FQFA 3MC2A 3HCQA 1OIBA 1QUJA 4TLLB 3T9XB 2QS4A 2AYSA 4WXJA 1LAFE 3BFTA 1HSEA 3SEVA 4IO4A 1A40A 2FYIA 3GXAA 3IK6B 3O2AA 2ANJA 4GVOA 4MBPA 3T93B 3CFXA 3TZAA 5FTHA 2NOOA 5FHMA 1R6ZA 4JDFA 3VVFA 1PBQA 1BP5A 3KN7A 1Y4CA 3FVNA 2H25A 1Y1MA 3VVDA 3LUYA 1SBPA 2UVHA 2ZYOA 2VOZA 3FD3A 3FJGA 2DE2A 3G3HA 3LSXA 3LC8A 4PETA 5L9MA 1R9QA 3CSBA 3KSXA 1MDQA 3TTLA 5HPQA 1VSOA 1B3GA 1YCJA 1SVXB 2ZNSA 3MUQA 1Q1KA 5AA2B 5I59B 4I9DA 4X48A 1POY1 1D4NA 1JW5A 3SKPA 2XXTA 3K0VA 3TDJA 2F8DA 4MFIA 5FHNA 5IAIA 1H3DA 4FEDA 4UACA 3QIMA 3SEUA 1B5IA 1RYXA 3WAFA 4AB6A 4YMAA 3PPNA 2BJJX 3PGFA 4QFPA 1Z7ME 5KCJB 1N0TA 3DM0A 3K1PA 5BWJA 1FW0A 3BKIB 3WAEA 1B4ZA 2XXHA 4O3AA 4QFKA 5CMBA 4GOTA 4F1UA 5AA4B 1OVTA 1EU8A 1NNFA 5DEXB 1S9TA 3IR1A 3U1OA 1S50A 4OENA 1M5BA 1N84A 2QSXA 3K00A 5H8HA 2OK2A 2Z8FA 4LUBA 1B46A 5CMCA 1AH5A 2XXIA 3C9HA 3H4ZA 1MG1A 4YKPA 2M8CA 1NKXA 1B3EA 4YKJA 3U72A 3S9LC 1GGGA 4LQ5A 2F97A 4ZEIA 2XXWA 3GZGA 2QMXA 5CBRA 1US4A 4EF2A 2Z22A 3UIFA 1FQAA 1URGA 4PFUA 3U8QA 3ZKKA 3HO7A 3TCGA 1FTLA 1B0HA 1B7HA 2ALUA 1FQEA 2RCAA 2Q8JA 2PYYA 1ZJLA 4H1XA 3FJ7A 3N5LA 4LONB 1M5CA 5ITOA 2GRVA 5BUUA 2D21A 4F3GA 3MJNA 4NF6A 4LVQA 1S7YA 1Y3QA 1LCFA 2HZKA 4LA9A 1M5FA 4OEVA 3GLBA 4YB7A 2VD2A 4LZ5A 1JETA 3SERA 4GXAA 4EDPA 2G93A 3KJ7A 1H44A 3KN3A 3MP6A 5I57B 4LQ2A 3U94A 1IQ7A 3MP8A 4NE4A 3FUZA 2HAVA 2VD3A 3MPLA 4R2BA 4OERA 1B7UA 3H6WA 1A7LA 3IX1A 5ELVA 4OFJA 4GIZA 3VLVA 4C1UA 4ECFA 3OEKA 3IOVA 4U22A 1MXVA 5I57A 2VGQA 1B52A 4OHNA 1MRPA 3K1MA 3OSQA 4YB5A 1D3KA 2F34A 3O6GA 3GBAA 1PEBA 2GHAA 1MXZA 4IO2A 1OQGA 3ODBA 1P1NA 1HSLA 5TP9A 5CC2A 2OCUA 2Y7RA 1LAXA 1XC1A 1B3HA 5EHSA 4ZDMA 5H8FA 4F31B 3OO6A 3RY3A 1YPNA 3MAMA 5ICTA 5ISUA 2F7BA 4MLVA 1NFTA 3MVZA 4F2OA 5L9SA 1IITA 3T9HB 4F3SA 1O64A 3CI8A 2O7UA 3D4CA 4G4PA 2UVIA 1N7WA 3H6TA 2XD2A 4PE5B 5I56A 2IA4A 3IL1B 5K2YA 3DP6A 1RYOA 3M3FA 1SDXA 3IB1A 4P0IA 1LFGA 4GQOA 2ZYKA 1FTKA 1TFAA 4Q5TA 3TUSA 2XX9A 2VP1A 2IEEA 4G68B 3QK6A 5I84A 1LFHA 1O63A 1IXCA 4HCWA 1JW4A 1NH7A 2NXOA 3O6HA 3N26A 4U1ZA 5CMMA 5H8HB 3G3GA 3PMWA 1ANFA 2V3QA 2V93A 2E0SA 2DE4A 3CR9A 4N6PA 1LFIA 1B5HA 1TWYA 3UK4A 2QJEA 2Z8EA 1GR2A 4HCYA 2DWIA 3S9EA 4H8JA 3K02A 4P0GA 2DXRA 3C31A 3KEIA 3VXCA 1II5A 1P1WA 3QSLA 4OYVA 3V5AA 5B7DA 2O7IA 1NNTA 3PPQA 4YB6A 3FATA 2UVGA 3H06B 1H45A 5H8NA 4MF3A 1JNFA 1PB9A 2Y7KA 2CMOA 1OLCA 4Z7EA 4U23A 5KDTB 4GFRA 4G8MA 3QUJA 3PPRA 5K2XA 5FTIA 5L8DA 4EUOA 2PX1A 4KYSA 4NEDA 1MXYA 2Y7WA 3FXUA 3HSTA 4JBZA 4PFYA 5FHOA 4C0RA 1OMPA 3B7DA 3IJOB 3ILUB 2Q2CA 3RGYA 4ZEKA 3IAZA 2QPQA 4ISUA 4JSOA 3P7IA 4OZ9A 1SW5A 5DVFA 4ZE8A 3PMXA 1N3WA 1P1QA 2AL4A 3IO6A 3EF7A 3KN8A 4E0XA 3PD8A 4HS7A 4X1DA 1A8EA 4NWDA 5TPAB 1M5DA 3Q29A 3O97A 4QFOA 4HW8A 5I58A 1JEUA 3USDA 1FQCA 3Q27A 1TXFA 4DCYA 4LZ7A 4NF4A 1PB8A 4F18A 3HN0A 2DOJA 2HAUA 4XKNA 5H8SA 5DYHA 1QUIA 3L6HA 4KPTA 3E13X 2DE3A 2GFEA 3AXFA 3CSGA 2QMWA 4ELQA 4R75A 4YAHX 2ONKE 5AA4A 3F11A 3FVOA 1F9BA 3TYHA 2GH9A 1WVJA 1P1OA 2Q2AA 5I2KB 1B58A
chains in the Genus database with same CATH superfamily
3H3GA 3RUMA 4OWDA 1LEVA 3UN6A 3CG1A 1I6QA 3RPLA 3HPIA 1B1HA 2VPNA 1A8FA 4Q8RA 5I59A 3MBPA 1MY4A 5TU0A 1LB8A 1B05A 2H4IA 5I2NB 1ZLQA 1B32A 1AIVA 4TQUQ 1NV2A 2HEUA 4N07A 4XF5A 2RINA 4AS4A 1I6AA 1SW4A 3G3IA 3IO4A 3H6VA 4LP2B 3KZGA 4QRZA 1EZOA 3OXNA 2V3TA 3K6WA 4NF4B 3ILTB 4O7MA 1RDXA 3PMVA 4IO7A 3O6IA 1POTA 3N94A 3THIA 2RC9A 1ELJA 3V89B 2HHMA 4JXIA 5CRYA 1MY2A 2QVUA 2Y84A 4AB5A 1XHYA 1DTZA 4GD5A 1FPEA 1MXXA 3PUVE 1UTBB 4F3BA 2FHYA 4QFNA 3SZPA 4I8CA 1LCTA 2F6PA 4H6DA 4MHFA 4IO5A 2QS3A 1FQDA 1MY3A 3OO9A 3FXRA 1KWHA 3R7XA 5F24A 3FXQA 4GF8A 5I56B 3MYUA 1B51A 1MPCA 1Z7NE 4K3FA 1MH4A 3Q28A 1MDP1 3CRBA 1BLFA 2L5VA 2I58A 1LSTA 2XXVA 3QXMA 3ZSFA 3C32A 4OESA 4N6DA 2LAOA 4PFWA 3S4UA 3UGWA 4WEPA 4JB7A 1LBBA 4RK2A 1FQBA 3V8XB 1PBPA 1MM6A 3K01A 5HBCA 3RPLB 3TKDA 3I5OA 3N6TA 4QSDA 2OZZA 3E3KA 3KOSA 3OO8A 4I1DA 2DWHA 4M4GA 1QKAA 1HSJA 3ONMA 3A09A 1B7ZA 5IKBA 4IO3A 3B6WA 3SEYA 4KCDA 3E78A 3K1NA 4DXCA 1CE2A 3D1RA 2AIXA 3MZBA 2DQVA 3T22A 3VXBA 4MCOA 2DS9A 1Y1ZA 2VPOA 2HCAA 4QF9A 2WBBA 2V3UA 4RYAA 3CG3A 4XKQA 3FGSA 4JWXA 4G8HA 1WDNA 4YMBA 3H6UA 1PC3A 5ICQA 4DZ1A 5J16A 4GL8A 2YJPA 1Y20A 5EQ8A 1QGXA 5M2VA 2XXKA 3B50A 1AMFA 2OLBA 2H9BA 4LN5A 1DCUA 1UQWA 2XX8A 3BFUA 2AL5A 2B4LA 1DMBA 1FJ6A 2YPNA 1LBVA 4KCCA 1A55A 4PFRA 2CEYA 4JVCA 4JSDA 2P2AA 4NF5B 5ET8A 4YICA 3VV5A 1XVYA 4I3EA 3UA8A 4FATA 2HZLA 3CFLA 2QVRA 2GHBA 5JTYB 3LSFB 1MY1A 4O94A 2XHDA 4ESWA 4XTCQ 4FE8A 5AA2D 1AL3A 2DWAA 2ONRA 1AOVA 1JW1A 1DSNA 1FPKA 2PFYA 3OMBA 1ATGA 2THIA 3SETA 1R1NA 3TTNA 5CM6A 2Z8DA 3S9MC 3PUZE 4BDNA 1UIVA 4I3YA 2QVVA 2XXRA 1NH8A 1EZPA 3G3KA 4ZZEA 2OWTA 3SDFA 2PVUA 1UTHB 4NAPA 4WKMA 5T3JA 1FQFA 3SEVA 4IO4A 5FTHA 3KN7A 3FVNA 2H25A 1Y1MA 3VVDA 2ZYOA 4PETA 5L9MA 1R9QA 3CSBA 5IZZA 1MDQA 5HPQA 1VSOA 1K9ZA 1SVXB 4I9DA 3K0VA 4MFIA 5FHNA 5IAIA 4AB6A 4X8RA 2DDKA 5KCJB 3K1PA 3WAEA 2XXHA 4F1UA 4QBAA 3U1OA 1S50A 1FPLA 2XXIA 1YYZA 4YKPA 3U72A 1DBZA 1GGGA 3A29A 5CBRA 1US4A 4PFUA 3ZKKA 3HO7A 1FTLA 1B0HA 1B7HA 4H1XA 5ITOA 4NF6A 3LUZA 1NUXA 2HZKA 4LA9A 1M5FA 3GLBA 1H44A 4LQ2A 2F3DA 1IQ7A 4NE4A 3H6WA 4OFJA 4U22A 1MXVA 3K1MA 4YB5A 3O6GA 3ODBA 2GQ1A 3RY3A 5I5PA 2XWIA 5ICTA 5ISUA 2F7BA 4G4PA 2UVIA 1N7WA 2IA4A 3IL1B 1FBDA 3IB1A 4GQOA 3TUSA 3BIGA 2VP1A 2IEEA 5I84A 1JW4A 5H8HB 4DI3D 4N6PA 2E0SA 1TWYA 2DWIA 1FPBA 2VT5A 4OYVA 5B7DA 1NNTA 2XWOA 1JNFA 2CMOA 4Z7EA 4U23A 4G8MA 4EUOA 4NEDA 5FHOA 3FBPA 3PMXA 1N3WA 4NHBA 3PD8A 4X1DA 5TPAB 1M5DA 3O97A 1NV7A 3USDA 4DCYA 4LZ7A 1PB8A 2R8TA 2DOJA 3MSTA 4KPTA 3CSGA 3AXFA 1JP4A 4YAHX 3F11A 3FVOA 3A3UA 2Q2AA 5I2KB 4I62A 4N13A 1KA0A 1IXIA 2O68A 4R6KA 1IMDA 4FORA 3TTKA 3R26A 2O51A 2YLNA 3M3KA 4OMBA 4RNSA 4PAFA 1XVXA 4R9FA 3C4MA 1K9YA 1JQFA 2FA7A 3TCFA 2WEFA 1NL5A 1OVBA 4DIGA 2QS1A 4MNPA 1MXWA 4UABA 5DVJA 3KG2A 1XT8A 2KR0A 2D3IA 3FJMA 3IORA 3W9VA 1MXUA 1FTJA 4IR8A 3QUFA 2F78A 1DPEA 1BIYA 4KYEA 2P0SA 4HE1A 1VE4A 1XS5A 2Q9TA 1P99A 5AA1A 3TTMA 4R6YA 2A5TB 4H8IA 2Z23A 4DDDA 3TPAA 3G7WA 4BDQA 4E0WA 1GTKA 4ZEDA 4FECA 2JJKA 3JZJA 2RC8A 1ZTYA 3UP9A 1ZBMA 4GWZA 3M3LA 5IZ1A 5JEIA 3H7MA 5DEXA 1IUDA 1VFEA 4ND9A 3JV9A 1USYH 3L6GA 3M8UA 1IXHA 5AE4A 2QS2A 2O6AA 1IMEA 1L5TA 3IOTA 2RCBA 1ZIUA 3TMGA 1LBXA 4PQJA 2X7QA 3PD9A 3TCHA 5HM4B 5TPAA 3MVXA 3U65A 3C35A 3K4UA 1YZ0A 1QKBA 3DP8A 4G8NA 5ET5A 5CI5A 2Y7PA 1B1XA 4U1OA 5F1QA 2ESNA 4GXSB 3B6TA 2B3FA 5AA2A 2I48A 2DWJA 4H67A 1B3LA 3O66A 1MQHA 4G2ZA 3E9XA 3MVWA 4OTEA 5I3SA 3PUYE 2WBDA 4IGTA 1H76A 4MH5A 4JWYA 1SI1A 4GBWA 3B6QA 2WX9A 1LBZA 3OEMA 5DTBA 4RK9A 5IM2A 2P3VA 4XKPA 1ZMGA 2CZLA 4F2QA 2V84A 2Q89A 4FJPA 4RJZA 1NNPA 1ZU0A 1O7TA 1SYHA 1B40A 3CFZA 4KYDA 2PFZA 3CHGA 4QHQA 4TLMB 4PGPA 4ZS9A 1B9JA 4N8YA 3GYYA 2Q8MA 4NF6B 2G29A 3TEPA 2FBPA 4BDLA 4XFEA 1MPBA 3V83A 2I4CA 3IB0A 4QFLA 4F1YA 3D4GA 4BDRA 2I0CA 2Q88A 4C1TA 3O9PA 4BDMA 1AWBA 2E1SA 2O1MA 3QMFA 5EQ7A 5A5XB 4BLAA 1LBCA 1LAHE 1USYE 1G0HA 3PU5A 4O7IA 2I0BA 4IO6A 4YZZA 1N3XA 3O28A 4OXVA 1JVYA 4MJOA 3EHUA 5DVIA 4H5GA 4R73A 4OVRA 1N04A 4FEBA 1URSA 4EQ9A 4GX4A 4AQ4A 4GLIA 1YTVA 3RTFB 4NF0A 4EQBA 2XXPA 4OQOA 1P1UA 3KOTA 2A5SA 4P56A 4EQ7A 4R2FA 3LR1A 1NV6A 2O69A 3IB2A 4FAJA 2ZZWA 5L9OA 3TFLA 5I2KA 3PV0E 1I6BA 1FJ9A 3VFJA 3T9XB 2QS4A 2AYSA 3T93B 3GXAA 3IK6B 3CFXA 1PBQA 1BP5A 1VDWA 1Y4CA 4N91A 1SBPA 3G3HA 3LC8A 3MUQA 1Q1KA 1POY1 1D4NA 3SKPA 3TDJA 1FPGA 2F8DA 1H3DA 3SEUA 1RYXA 2BJJX 1Z7ME 1N0TA 1FW0A 3BKIB 4O3AA 5ET7A 1S9TA 3IR1A 5H8HA 3KBZA 1NKXA 4LQ5A 2F97A 4EF2A 2Z22A 3UIFA 1URGA 3U8QA 1IMFA 4P47A 4OVTA 2PYYA 1ZJLA 3FJ7A 4LONB 4JVIA 2GRVA 5BUUA 5ET6A 3MJNA 1Y3QA 4GXAA 3MP8A 4R2BA 2VD3A 4MEVA 4OERA 4NG7A 3OEKA 2ZZXA 1FBPA 1MRPA 1CNQA 1D3KA 2F34A 3GBAA 4IO2A 1MXZA 1OQGA 5TP9A 1HSLA 3E79A 2Y7RA 1B3HA 4ZDMA 2O7UA 1NI9A 1LFGA 2ZYKA 1FTKA 1TFAA 4P9KA 1O63A 4HCWA 1NH7A 2NXOA 4H45A 3O6HA 3N26A 4U1ZA 5CMMA 3CR9A 5EYGA 3UK4A 2Z8EA 1GR2A 4H8JA 2DXRA 1II5A 1INPA 1P1WA 3QSLA 3V5AA 2O7IA 3PPQA 3KC0A 3H06B 5KDTB 5FTIA 5L8DA 1MXYA 2Y7WA 3FXUA 1OMPA 2QPQA 4OZ9A 1P1QA 3IO6A 4HS7A 3HFUA 4QFOA 2Y5LA 1TXFA 3HN0A 2HAUA 5DYHA 1QUIA 3L6HA 1FPDA 2FVZA 2QMWA 1NV3A 4R74A 4OEUA 3EKIA 1DTGA 3FIRA 2HQ0A 2QL3A 3IOUA 2CZIA 3K6VA 4FIMA 4XEQA 1SYIA 4O3BA 4DXUA 3EQ1A 2PT2A 1SW1A 4NWCA 1QW0A 3TELA 3U93A 4WEDA 1QJMA 4HXVA 4PFBA 2REJA 3KSJA 1LB9A 4F3PA 3EHTA 4I40A 3ECRA 2R9JA 4P3LA 4KQPA 3DP4A 3ZS6A 2DP8A 1XI6A 4NF5A 4OETA 4DLDA 3VE1B 4RA1A 4GWYA 4EXKA 1EH3A 4PDDA 2F35A 1NUWA 2H5YA 3UORA 2XXUA 5CMKA 3PTYA 1URDA 1LLSA 3ROJA 3DELB 4IGRA 1KZ8A 1GV8A 2XXXA 1FPIA 4KI0E 4LATA 3G3FA 5JTYA 4U4XA 4EXLA 4R9GA 4M1VA 4PBQA 2W7YA 2F3BA 3U92A 5DT6A 4OFOA 1MQJA 4XIGQ 4BDOA 1FPFA 1FTMA 2ZXTA 4MLQA 4R6HA 4YKKA 1IMAA 2ZYNA 4JVDA 5DW8A 5I2NA 2CEXA 5LOMA 2H99A 2CZKA 4H0WA 2ZYMA 4HE0A 1LAGE 1NUYA 1JEVA 1LGBC 3N6UA 4PAIA 2X7PA 1TT1A 1T0KA 1QVSA 4PBHA 1NMUA 3MPKA 4ZECA 1MQGA 2RKMA 1UIUA 4PP0A 5CBSA 3T9VA 3NOHA 2FNCA 4ZE9A 1B4HA 3RT8A 4ELPA 1XOCA 1FCKA 4GL0A 5EYFA 3VLUA 4H65A 1B3FA 1EYKA 2NWJA 4ESXA 1DOTA 4XKRA 3C34A 5JK4A 1LBYA 2UYFA 5KZTA 1B6HA 2OBGA 4X1BA 1A54A 2I49A 1MPDA 3VLWA 1B0LA 2P1SA 3MVYA 1TFDA 2OWSA 3RLFE 4N6KA 4OANA 4PFTA 2RC7A 4N8GA 2O1LA 3OSRA 2NVUB 3QAXA 1YAEA 3O29A 1BKAA 1PB7A 2DXYA 2PMSA 5KCJA 2PBWA 3QYTA 3OOAA 4HTGA 1N7XA 5H8FB 4PDHA 5A5LA 3LSLA 2XD3A 3PUWE 4PF6A 2I6EA 1QULA 1IEJA 3MP1A 3E4RA 4MNCA 1UTBA 1MQDA 4U2RA 2B3BA 5J1DA 3MZ1A 3W15C 1Q35A 3RNNA 4X04A 1OLAA 2I3VA 4Z0IA 3MWBA 4MNIA 3T96B 1MH3A 3MW0A 4G68C 2WYPA 1OQHA 3H03A 4RPNA 1ZKBA 4ZEBA 2Y5KA 3BIHA 4KR5A 4U4SA 2B65A 3LBSA 4U21A 3EHSA 4IY5A 1FBFA 3FVGA 3GBBA 2R6GE 4JWOA 1Q9DA 2DYXA 2UVJA 3SESA 4OFLA 3TODA 1WODA 3EN3A 3LV0A 4POXA 2ONSA 4G61A 3OENA 3CVGA 3FV1A 1VR5A 2DVZA 5FBPA 4Q0CA 1MM7A 5F7VA 3KBRA 3RN8A 2PT1A 3OD7A 1J1NA 3JYRA 4LZ8A 4N15A 3OO7A 4F39A 4RPOA 4NN3A 2WKYA 2NUVA 2B4MA 3MC2A 1OIBA 4TLLB 1A40A 4PTKA 4GVOA 4MBPA 2ANJA 3TZAA 2QFLA 5FHMA 1R6ZA 4JDFA 3FJGA 2VOZA 3FD3A 2DE2A 1B3GA 1YCJA 2ZNSA 5I59B 1JW5A 1RDYA 4UACA 3QIMA 1B5IA 3WAFA 3PPNA 3PGFA 3DM0A 5BWJA 4PE3A 4QFKA 5CMBA 1EU8A 5DEXB 1M5BA 2QSXA 2OK2A 2Z8FA 4LUBA 5CMCA 1B46A 4OVQA 2BJIA 3H4ZA 2XWKA 4YKJA 3S9LC 2XXWA 3GZGA 2QMXA 1FQAA 3KC1A 3TCGA 2RCAA 1G0IA 1FBGA 5LDZA 3N5LA 3IFCA 1M5CA 2HXRA 4F3GA 1S7YA 1KA1A 1LCFA 4OEVA 4YB7A 4EDPA 1JETA 5I57B 2G93A 3MP6A 3U94A 4OA4A 1GVCA 5ELVA 3MPLA 4C1UA 1A7LA 3IX1A 3VLVA 4ECFA 2VGQA 4OHNA 1EYIA 4PFIA 5CC2A 2OCUA 1LAXA 1XC1A 5EHSA 1YPNA 3MAMA 2WYKA 4MLVA 1NFTA 3MVZA 4F2OA 5L9SA 1IITA 4F3SA 3H6TA 4PE5B 5I56A 3DP6A 4P0IA 2XX9A 1LFHA 4G68B 3QK6A 4GBVA 4P8BA 3G3GA 3PMWA 2DE4A 1LFIA 1B5HA 2QJEA 2OX3A 4HCYA 4GWSA 4P0GA 3VXCA 4PAKA 3FATA 2UVGA 1IMBA 1BK4A 2Y7KA 4GFRA 3QUJA 3PPRA 5K2XA 3HSTA 4JBZA 4N4UA 3B7DA 3IJOB 3RGYA 3ILUB 4ZEKA 3IAZA 4ISUA 1SW5A 4E0XA 3EF7A 1A8EA 1NV1A 4HE2A 1JEUA 4NF4A 4F18A 2GFEA 5AA4A 5IGAA 4KD5A 1F9BA 3TYHA 1P1OA 3PPPA 4F1VA 3CIJA 3IOWA 2H98A 4XXUA 4F19A 3TQLA 1FBEA 1B2HA 2REGA 1A99A 4OVJA 2I4BA 2F6GA 4DXBA 2V4CA 3S2VA 2XXYA 1MS7A 3R6UA 1FTAA 5IZ3A 4ELRA 3TAJA 5EHMA 1MQIA 1JVXA 2Y7IA 3SEWA 1QUKA 3BBRA 3RYDA 2ZZVA 3C36A 2O84X 2F5XA 2HXWA 2F7CA 4KFQA 5I58B 2ZMBA 3RPWA 4NMYA 4THIA 4OVPA 3PUXE 4RY1A 1EZ9A 4UA8A 1FTOA 3T9UA 2A5TA 4ONYA 3IFAA 4DE8A 3K6UA 3PPOA 4G77A 1PDAA 4YU0A 5H8NB 2ABHA 3HHGA 2XXQA 4P1LA 2XX7A 3RTWB 1D9YA 5ESYA 2KQZA 4PF8A 4R72A 1BTJA 1RKMA 1IXGA 2HFBA 1I69A 1FPJA 3HV1A 4EF1A 4NTLA 2R71A 1YXIA 4MAGA 1MY0A 2P3NA 4F29A 3I6VA 4GWXA 4NF8A 4QXDA 3T66A 2OJTA 3FASA 3T0JA 3G3JA 4ELOA 2FIEA 5H8QA 1US5A 4QSEA 2OWZA 1Y3PA 2D5WA 2I3WA 3LSWA 1FBCA 4FBPA 1VFDA 4QSCA 1UTHA 3A3CA 3S9NC 2QRYA 2HPGA 4H46A 3SEXA 5B70A 4AS5A 4DCXA 1SI0A 4ZZAA 3OELA 1IMCA 4N81A 4G68A 2ZNUA 3I3VA 2V25A 3Q26A 3W9WA 1NUZA 4PC9A 2UYEA 1FSAA 1D9VA 4O3CA 2UXAA 5AA3A 4N17A 4TOZA 4F22A 3DLNA 4YKIA 1M5EA 2XWVA 1R9LA 4X9TA 4GWOA 1Y3NA 1NV0A 3EPEA 4DI4B 1IZ1A 2VHAA 5H8QB 3KFMA 2ZNTA 4MIJA 5KDTA 4P11A 2RF1A 4NF8B 3MZ9A 2DVCA 1SQYA 4GX3A 1Y9UA 3FXBA 4ZEFA 2F7AA 3TQWA 3FZVA 4POWA 1CB6A 4IB2A 5A5XA 3HHFA 1Y4TA 3RQTA 3C33A 2KLFA 1IIWA 2DSFA 3KJTA 4NGUA 3ZKLA 3Q25A 3FVKA 1NNKA 1SW2A 3K2DA 1FRPA 4IY6A 3K6XA 4Q30B 1H43A 1NV5A 2X26A 4GRKA 5TP9B 3MQ9A 3RT6B 1DPPA 3IJXB 5I7IA 4PCDA 1SD3A 3VDFA 1N76A 4RXLA 4MX6A 3VVEA 3KGCA 4L17A 1LBWA 1B5JA 4KHZE 5EQAA 2F36A 4H5FA 3FV2A 3TTRA 4NQ8A 1DK4A 5ITPA 2Q74A 3HCQA 1QUJA 4WXJA 1LAFE 3BFTA 1HSEA 5IZ3B 1D9QA 3O2AA 2FYIA 2NOOA 3VVFA 3LUYA 2UVHA 3LSXA 3KSXA 3TTLA 5AA2B 4X48A 4O8MA 2XXTA 4MMPA 1RDZA 1NV4A 4FEDA 4YMAA 4QFPA 3T1BA 1B4ZA 4GOTA 5AA4B 1OVTA 1NNFA 4OENA 4PGNA 1N84A 3K00A 1AH5A 3C9HA 1MG1A 2M8CA 1B3EA 4GWWA 2XA5A 4ZEIA 5EYHA 2ALUA 1FQEA 2Q8JA 3ISPA 2D21A 4LVQA 4KXPA 2VD2A 4LZ5A 3SERA 3KJ7A 3KN3A 3FUZA 2HAVA 1B7UA 4GIZA 3IOVA 5I57A 1B52A 3OSQA 1SPIA 1PEBA 2GHAA 1P1NA 1FBHA 5H8FA 4F31B 3OO6A 4GX6A 3T9HB 1O64A 3CI8A 3D4CA 4GWUA 2XD2A 5K2YA 1RYOA 2MKZA 3M3FA 1SDXA 4Q5TA 2CZHA 1IXCA 1ANFA 2V3QA 2V93A 4NX1A 5EQ9A 4OVSA 3S9EA 3K02A 3KEIA 3C31A 4YB6A 1EYJA 1H45A 5H8NA 4MF3A 1PB9A 1OLCA 2FIXA 2PX1A 4KYSA 4PFYA 4C0RA 2Q2CA 4JSOA 3B8BA 3P7IA 5DVFA 4ZE8A 2AL4A 3KN8A 4P1EA 4NWDA 3Q29A 4HW8A 5I58A 1FQCA 3Q27A 5LTCA 4XKNA 5H8SA 3E13X 2DE3A 2PCRA 4ELQA 4R75A 2ONKE 2GH9A 1WVJA 1B58A
chains in the Genus database with same CATH topology
4I62A 1DTGA 3H3GA 3RUMA 3FIRA 4N13A 4OWDA 4U21A 2HQ0A 3PPPA 2QL3A 1IXIA 4F1VA 3IOUA 3UN6A 3CG1A 3CIJA 3K6VA 4FIMA 3IOWA 1I6QA 2H98A 2O68A 4XXUA 3HPIA 1B1HA 1SYIA 4R6KA 4O3BA 4F19A 3TQLA 1A8FA 3EQ1A 4DXUA 4FORA 2PT2A 3TTKA 4Q8RA 5I59A 1B2HA 1SW1A 2REGA 3MBPA 3R26A 1MY4A 1A99A 5TU0A 2O51A 1LB8A 4OVJA 4NWCA 1B05A 1QW0A 2H4IA 2YLNA 4WEDA 3TELA 3U93A 5I2NB 1QJMA 2I4BA 3M3KA 4GL8A 2F6GA 4OMBA 2REJA 4RNSA 4DXBA 3S2VA 1XVXA 2XXYA 1ZLQA 1B32A 3KSJA 1AIVA 4R9FA 1LB9A 1MS7A 4F3PA 4TQUQ 3SESA 3EHTA 3R6UA 3C4MA 2HEUA 4N07A 3ECRA 2RINA 2R9JA 4ELRA 1I6AA 3TAJA 1JQFA 5EHMA 2FA7A 1MQIA 1SW4A 3G3IA 3TCFA 1JVXA 3IO4A 1NL5A 1OVBA 4DIGA 2Y7IA 4KQPA 2QS1A 1MXWA 3DP4A 4Z0IA 3H6VA 2DP8A 3SEWA 3ZS6A 4LP2B 1QUKA 5DVJA 3KZGA 3BBRA 4QRZA 3KG2A 1EZOA 3OXNA 4NF5A 2V3TA 1XT8A 3C36A 3K6WA 4OETA 2O84X 2F5XA 2HXWA 4NF4B 2D3IA 3FJMA 2F7CA 3IORA 3W9VA 1MXUA 3ILTB 4DLDA 4KFQA 5I58B 3VE1B 2ZMBA 4RA1A 4EXKA 1EH3A 1GVCA 1FTJA 3PMVA 2F35A 4IO7A 2H5YA 3O6IA 3QUFA 4NMYA 4THIA 3RPWA 3UORA 2XXUA 3PUXE 5CMKA 1URDA 1DPEA 1POTA 2F78A 3N94A 4RY1A 3THIA 1LLSA 1BIYA 2RC9A 1EZ9A 3DELB 1ELJA 4KYEA 2P0SA 1FTOA 4UA8A 3T9UA 3V89B 1VE4A 2A5TA 4ONYA 1XS5A 4IGRA 1GV8A 2XXXA 4KI0E 4DE8A 2Q9TA 1P99A 4JXIA 3K6UA 3PPOA 5CRYA 4LATA 4G77A 1MY2A 2Y84A 1PDAA 4R73A 5AA1A 4YU0A 5H8NB 3TTMA 4AB5A 2ABHA 1XHYA 3G3FA 3HHGA 1DTZA 2XXQA 5JTYA 4GD5A 2A5TB 4R6YA 4H8IA 2Z23A 4U4XA 4DDDA 4EXLA 4R9GA 3TPAA 1MXXA 2XX7A 3PUVE 1UTBB 1D9YA 3G7WA 4M1VA 3RTWB 1GTKA 4BDQA 2W7YA 4FECA 4QFNA 4E0WA 4F3BA 4ZEDA 4I8CA 3U92A 1LCTA 5DT6A 4OFOA 1MQJA 2F6PA 2RC8A 3JZJA 1ZTYA 3UP9A 4XIGQ 4BDOA 1ZBMA 4R72A 1FTMA 2ZXTA 1BTJA 4H6DA 4MLQA 1RKMA 4R6HA 1IXGA 2HFBA 3M3LA 1I69A 4IO5A 2ZYNA 4YKKA 2QS3A 3HV1A 5JEIA 1FQDA 1MY3A 4EF1A 5I2NA 3OO9A 4NTLA 3H7MA 5DEXA 5LOMA 3FXRA 1IUDA 1KWHA 1VFEA 2H99A 2R71A 3FXQA 1USYH 3JV9A 3L6GA 4H0WA 4ND9A 2ZYMA 4GF8A 1LAGE 3M8UA 5I56B 1IXHA 1MY0A 1B51A 1JEVA 1LGBC 1MPCA 5AE4A 4F29A 2QS2A 3N6UA 1Z7NE 4K3FA 1MH4A 3Q28A 2O6AA 3I6VA 2X7PA 1MDP1 1TT1A 1T0KA 3CRBA 1L5TA 1BLFA 1QVSA 4NF8A 1NMUA 1LSTA 2I58A 2XXVA 3IOTA 3MPKA 2RCBA 3QXMA 1ZIUA 2OJTA 3T66A 3C32A 3FASA 3TMGA 4OESA 3ZSFA 1MQGA 4ZECA 4PQJA 2RKMA 2LAOA 2X7QA 1UIUA 3G3JA 3PD9A 4PFWA 4PP0A 4ELOA 5CBSA 3S4UA 3T9VA 3TCHA 3UGWA 4WEPA 5H8QA 4JB7A 2FNCA 4ZE9A 5HM4B 1LBBA 5TPAA 1B4HA 3MVXA 1US5A 4RK2A 1XOCA 1FCKA 3RT8A 4GL0A 4QSEA 1FQBA 5EYFA 3V8XB 1Y3PA 3VLUA 1PBPA 1MM6A 2D5WA 3C35A 2I3WA 3K01A 3K4UA 4H65A 5HBCA 3LSWA 1QKBA 3TKDA 1B3FA 2NWJA 3I5OA 3N6TA 4QSDA 1VFDA 2OZZA 3DP8A 3E3KA 3KOSA 3OO8A 4G8NA 1DOTA 4QSCA 4XKRA 4ESXA 3C34A 4I1DA 5JK4A 2DWHA 1UTHA 2UYFA 3A3CA 4M4GA 5CI5A 5KZTA 3S9NC 1B6HA 2OBGA 2QRYA 4X1BA 1A54A 1QKAA 2Y7PA 2I49A 1B1XA 1HSJA 3ONMA 1MPDA 3VLWA 3SEXA 5B70A 3A09A 4U1OA 5F1QA 1B0LA 1B7ZA 2ESNA 2P1SA 5IKBA 3MVYA 1TFDA 2OWSA 4GXSB 3B6TA 3RLFE 4IO3A 4PFTA 2B3FA 3B6WA 4DCXA 3SEYA 2I48A 5AA2A 2DWJA 4KCDA 2RC7A 1SI0A 4H67A 1B3LA 3K1NA 3R7XA 2O1LA 4DXCA 1CE2A 3OSRA 4ZZAA 2NVUB 3O66A 1MQHA 2AIXA 3MZBA 3OELA 2DQVA 3E9XA 3QAXA 4G2ZA 3T22A 1YAEA 3MVWA 4OTEA 3VXBA 2DS9A 3PUYE 1Y1ZA 4G68A 2ZNUA 3I3VA 2V25A 3O29A 3Q26A 3W9WA 1BKAA 1PB7A 2DXYA 2HCAA 2UYEA 4IGTA 4QF9A 2PMSA 1H76A 5KCJA 1D9VA 2V3UA 4O3CA 2UXAA 4MH5A 4RYAA 3CG3A 4XKQA 3FGSA 5AA3A 4TOZA 4JWYA 1SI1A 4JWXA 4F22A 3B6QA 2PBWA 4GWOA 3QYTA 3DLNA 4YKIA 3OOAA 4G8HA 4HTGA 1M5EA 1N7XA 5H8FB 3OEMA 5DTBA 1WDNA 4YMBA 3H6UA 4RK9A 1PC3A 4XKPA 5ICQA 4DZ1A 1ZMGA 1R9LA 2CZLA 3LSLA 4F2QA 2V84A 2XD3A 4X9TA 2Q89A 4FJPA 3PUWE 4RJZA 2I6EA 1NNPA 1QULA 1ZU0A 1IEJA 2YJPA 1Y20A 1Y3NA 1O7TA 1SYHA 1B40A 3CFZA 3EPEA 3MP1A 4KYDA 1IZ1A 3E4RA 2VHAA 5H8QB 4QHQA 4TLMB 1MQDA 1UTBA 4U2RA 5M2VA 2B3BA 5J1DA 4ZS9A 1B9JA 1AMFA 3MZ1A 3KFMA 2OLBA 2ZNTA 3W15C 4NF6B 1Q35A 5KDTA 2G29A 4P11A 2RF1A 4NF8B 3TEPA 3RNNA 2H9BA 4BDLA 1MPBA 3V83A 1UQWA 1OLAA 2I3VA 2I4CA 2XX8A 3BFUA 2AL5A 3IB0A 3MWBA 3MZ9A 2DVCA 4IO6A 4QFLA 4YZZA 1SQYA 1DMBA 4F1YA 3T96B 1Y9UA 1MH3A 3D4GA 3MW0A 4BDRA 4ZEFA 2YPNA 2I0CA 2Q88A 4KCCA 2F7AA 3TQWA 1A55A 3FZVA 4G68C 4C1TA 3O9PA 4POWA 1CB6A 2E1SA 4IB2A 2O1MA 1OQHA 4BDMA 5A5XA 3H03A 3HHFA 1Y4TA 3RQTA 3C33A 2KLFA 1IIWA 4RPNA 3S9MC 1ZKBA 5A5XB 4JSDA 2DSFA 2P2AA 3A3UA 4ZEBA 4NF5B 3KJTA 1LBCA 4YICA 3VV5A 4BLAA 1LAHE 1USYE 5DVIA 4KR5A 4U4SA 1XVYA 2B65A 3LBSA 3PU5A 3UA8A 4FATA 2HZLA 2I0BA 3CFLA 3ZKLA 3EHSA 3Q25A 4IY5A 1N3XA 3FVGA 1NNKA 2GHBA 2R6GE 3FVKA 3GBBA 1SW2A 1JVYA 3O28A 4OXVA 3K2DA 5I2KA 4JWOA 5JTYB 3EHUA 4IY6A 2DYXA 2UVJA 3K6XA 3LSFB 1H43A 1MY1A 2X26A 4H5GA 4GRKA 1N04A 4FEBA 4Q30B 1URSA 4R74A 2XHDA 4OEUA 4OFLA 3TODA 4EQ9A 4ESWA 5TP9B 3MQ9A 1WODA 3EN3A 4XTCQ 3RT6B 4AQ4A 4GLIA 4FE8A 5AA2D 1YTVA 1AL3A 1DPPA 3IJXB 4POXA 3RTFB 4KD5A 2ONSA 2DWAA 2ONRA 4EQBA 2XXPA 1SD3A 3OENA 1N76A 1JW1A 1DSNA 4OQOA 3VDFA 1AOVA 4RXLA 1P1UA 3CVGA 3KOTA 3OMBA 1ATGA 2THIA 2A5SA 3VVEA 4EQ7A 3KGCA 4R2FA 3FV1A 3LR1A 1VR5A 1R1NA 2DVZA 4L17A 2Z8DA 3SETA 3TTNA 4Q0CA 1MM7A 2O69A 3KBRA 3PUZE 5F7VA 1B5JA 3RN8A 4BDNA 1UIVA 2PT1A 4KHZE 4ELPA 3OD7A 2F36A 3IB2A 3FV2A 4H5FA 2XXRA 4FAJA 3TTRA 5L9OA 1NH8A 1EZPA 3G3KA 1J1NA 3JYRA 4LZ8A 4ZZEA 2OWTA 3TFLA 3SDFA 3OO7A 3PV0E 4F39A 2PVUA 4RPOA 1I6BA 1UTHB 2WKYA 2NUVA 4WKMA 3VFJA 5ITPA 5CM6A 1FQFA 3MC2A 3HCQA 1OIBA 1QUJA 4TLLB 3T9XB 2QS4A 2AYSA 4WXJA 1LAFE 3BFTA 1HSEA 3SEVA 4IO4A 1A40A 2FYIA 3GXAA 3IK6B 3O2AA 2ANJA 4GVOA 4MBPA 3T93B 3CFXA 3TZAA 5FTHA 2NOOA 5FHMA 1R6ZA 4JDFA 3VVFA 1PBQA 1BP5A 3KN7A 1Y4CA 3FVNA 2H25A 1Y1MA 3VVDA 3LUYA 1SBPA 2UVHA 2ZYOA 2VOZA 3FD3A 3FJGA 2DE2A 3G3HA 3LSXA 3LC8A 4PETA 5L9MA 1R9QA 3CSBA 3KSXA 1MDQA 3TTLA 5HPQA 1VSOA 1B3GA 1YCJA 1SVXB 2ZNSA 3MUQA 1Q1KA 5AA2B 5I59B 4I9DA 4X48A 1POY1 1D4NA 1JW5A 3SKPA 2XXTA 3K0VA 3TDJA 2F8DA 4MFIA 5FHNA 5IAIA 1H3DA 4FEDA 4UACA 3QIMA 3SEUA 1B5IA 1RYXA 3WAFA 4AB6A 4YMAA 3PPNA 2BJJX 3PGFA 4QFPA 1Z7ME 5KCJB 1N0TA 3DM0A 3K1PA 5BWJA 1FW0A 3BKIB 3WAEA 1B4ZA 2XXHA 4O3AA 4QFKA 5CMBA 4GOTA 4F1UA 5AA4B 1OVTA 1EU8A 1NNFA 5DEXB 1S9TA 3IR1A 3U1OA 1S50A 4OENA 1M5BA 1N84A 2QSXA 3K00A 5H8HA 2OK2A 2Z8FA 4LUBA 1B46A 5CMCA 1AH5A 2XXIA 3C9HA 3H4ZA 1MG1A 4YKPA 2M8CA 1NKXA 1B3EA 4YKJA 3U72A 3S9LC 1GGGA 4LQ5A 2F97A 4ZEIA 2XXWA 3GZGA 2QMXA 5CBRA 1US4A 4EF2A 2Z22A 3UIFA 1FQAA 1URGA 4PFUA 3U8QA 3ZKKA 3HO7A 3TCGA 1FTLA 1B0HA 1B7HA 2ALUA 1FQEA 2RCAA 2Q8JA 2PYYA 1ZJLA 4H1XA 3FJ7A 3N5LA 4LONB 1M5CA 5ITOA 2GRVA 5BUUA 2D21A 4F3GA 3MJNA 4NF6A 4LVQA 1S7YA 1Y3QA 1LCFA 2HZKA 4LA9A 1M5FA 4OEVA 3GLBA 4YB7A 2VD2A 4LZ5A 1JETA 3SERA 4GXAA 4EDPA 2G93A 3KJ7A 1H44A 3KN3A 3MP6A 5I57B 4LQ2A 3U94A 1IQ7A 3MP8A 4NE4A 3FUZA 2HAVA 2VD3A 3MPLA 4R2BA 4OERA 1B7UA 3H6WA 1A7LA 3IX1A 5ELVA 4OFJA 4GIZA 3VLVA 4C1UA 4ECFA 3OEKA 3IOVA 4U22A 1MXVA 5I57A 2VGQA 1B52A 4OHNA 1MRPA 3K1MA 3OSQA 4YB5A 1D3KA 2F34A 3O6GA 3GBAA 1PEBA 2GHAA 1MXZA 4IO2A 1OQGA 3ODBA 1P1NA 1HSLA 5TP9A 5CC2A 2OCUA 2Y7RA 1LAXA 1XC1A 1B3HA 5EHSA 4ZDMA 5H8FA 4F31B 3OO6A 3RY3A 1YPNA 3MAMA 5ICTA 5ISUA 2F7BA 4MLVA 1NFTA 3MVZA 4F2OA 5L9SA 1IITA 3T9HB 4F3SA 1O64A 3CI8A 2O7UA 3D4CA 4G4PA 2UVIA 1N7WA 3H6TA 2XD2A 4PE5B 5I56A 2IA4A 3IL1B 5K2YA 3DP6A 1RYOA 3M3FA 1SDXA 3IB1A 4P0IA 1LFGA 4GQOA 2ZYKA 1FTKA 1TFAA 4Q5TA 3TUSA 2XX9A 2VP1A 2IEEA 4G68B 3QK6A 5I84A 1LFHA 1O63A 1IXCA 4HCWA 1JW4A 1NH7A 2NXOA 3O6HA 3N26A 4U1ZA 5CMMA 5H8HB 3G3GA 3PMWA 1ANFA 2V3QA 2V93A 2E0SA 2DE4A 3CR9A 4N6PA 1LFIA 1B5HA 1TWYA 3UK4A 2QJEA 2Z8EA 1GR2A 4HCYA 2DWIA 3S9EA 4H8JA 3K02A 4P0GA 2DXRA 3C31A 3KEIA 3VXCA 1II5A 1P1WA 3QSLA 4OYVA 3V5AA 5B7DA 2O7IA 1NNTA 3PPQA 4YB6A 3FATA 2UVGA 3H06B 1H45A 5H8NA 4MF3A 1JNFA 1PB9A 2Y7KA 2CMOA 1OLCA 4Z7EA 4U23A 5KDTB 4GFRA 4G8MA 3QUJA 3PPRA 5K2XA 5FTIA 5L8DA 4EUOA 2PX1A 4KYSA 4NEDA 1MXYA 2Y7WA 3FXUA 3HSTA 4JBZA 4PFYA 5FHOA 4C0RA 1OMPA 3B7DA 3IJOB 3ILUB 2Q2CA 3RGYA 4ZEKA 3IAZA 2QPQA 4ISUA 4JSOA 3P7IA 4OZ9A 1SW5A 5DVFA 4ZE8A 3PMXA 1N3WA 1P1QA 2AL4A 3IO6A 3EF7A 3KN8A 4E0XA 3PD8A 4HS7A 4X1DA 1A8EA 4NWDA 5TPAB 1M5DA 3Q29A 3O97A 4QFOA 4HW8A 5I58A 1JEUA 3USDA 1FQCA 3Q27A 1TXFA 4DCYA 4LZ7A 4NF4A 1PB8A 4F18A 3HN0A 2DOJA 2HAUA 4XKNA 5H8SA 5DYHA 1QUIA 3L6HA 4KPTA 3E13X 2DE3A 2GFEA 3AXFA 3CSGA 2QMWA 4ELQA 4R75A 4YAHX 2ONKE 5AA4A 3F11A 3FVOA 1F9BA 3TYHA 2GH9A 1WVJA 1P1OA 2Q2AA 5I2KB 1B58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I62 A;  1DTG A;  3H3G A;  3RUM A;  3FIR A;  4N13 A;  4OWD A;  4U21 A;  2HQ0 A;  3PPP A;  2QL3 A;  1IXI A;  4F1V A;  3IOU A;  3UN6 A;  3CG1 A;  3CIJ A;  3K6V A;  4FIM A;  3IOW A;  1I6Q A;  2H98 A;  2O68 A;  4XXU A;  3HPI A;  1B1H A;  1SYI A;  4R6K A;  4O3B A;  4F19 A;  3TQL A;  1A8F A;  3EQ1 A;  4DXU A;  4FOR A;  2PT2 A;  3TTK A;  4Q8R A;  5I59 A;  1B2H A;  1SW1 A;  2REG A;  3MBP A;  3R26 A;  1MY4 A;  1A99 A;  5TU0 A;  2O51 A;  1LB8 A;  4OVJ A;  4NWC A;  1B05 A;  1QW0 A;  2H4I A;  2YLN A;  4WED A;  3TEL A;  3U93 A;  5I2N B;  1QJM A;  2I4B A;  3M3K A;  4GL8 A;  2F6G A;  4OMB A;  2REJ A;  4RNS A;  4DXB A;  3S2V A;  1XVX A;  2XXY A;  1ZLQ A;  1B32 A;  3KSJ A;  1AIV A;  4R9F A;  1LB9 A;  1MS7 A;  4F3P A;  4TQU Q;  3SES A;  3EHT A;  3R6U A;  3C4M A;  2HEU A;  4N07 A;  3ECR A;  2RIN A;  2R9J A;  4ELR A;  1I6A A;  3TAJ A;  1JQF A;  5EHM A;  2FA7 A;  1MQI A;  1SW4 A;  3G3I A;  3TCF A;  1JVX A;  3IO4 A;  1NL5 A;  1OVB A;  4DIG A;  2Y7I A;  4KQP A;  2QS1 A;  1MXW A;  3DP4 A;  4Z0I A;  3H6V A;  2DP8 A;  3SEW A;  3ZS6 A;  4LP2 B;  1QUK A;  5DVJ A;  3KZG A;  3BBR A;  4QRZ A;  3KG2 A;  1EZO A;  3OXN A;  4NF5 A;  2V3T A;  1XT8 A;  3C36 A;  3K6W A;  4OET A;  2O84 X;  2F5X A;  2HXW A;  4NF4 B;  2D3I A;  3FJM A;  2F7C A;  3IOR A;  3W9V A;  1MXU A;  3ILT B;  4DLD A;  4KFQ A;  5I58 B;  3VE1 B;  2ZMB A;  4RA1 A;  4EXK A;  1EH3 A;  1GVC A;  1FTJ A;  3PMV A;  2F35 A;  4IO7 A;  2H5Y A;  3O6I A;  3QUF A;  4NMY A;  4THI A;  3RPW A;  3UOR A;  2XXU A;  3PUX E;  5CMK A;  1URD A;  1DPE A;  1POT A;  2F78 A;  3N94 A;  4RY1 A;  3THI A;  1LLS A;  1BIY A;  2RC9 A;  1EZ9 A;  3DEL B;  1ELJ A;  4KYE A;  2P0S A;  1FTO A;  4UA8 A;  3T9U A;  3V89 B;  1VE4 A;  2A5T A;  4ONY A;  1XS5 A;  4IGR A;  1GV8 A;  2XXX A;  4KI0 E;  4DE8 A;  2Q9T A;  1P99 A;  4JXI A;  3K6U A;  3PPO A;  5CRY A;  4LAT A;  4G77 A;  1MY2 A;  2Y84 A;  1PDA A;  4R73 A;  5AA1 A;  4YU0 A;  5H8N B;  3TTM A;  4AB5 A;  2ABH A;  1XHY A;  3G3F A;  3HHG A;  1DTZ A;  2XXQ A;  5JTY A;  4GD5 A;  2A5T B;  4R6Y A;  4H8I A;  2Z23 A;  4U4X A;  4DDD A;  4EXL A;  4R9G A;  3TPA A;  1MXX A;  2XX7 A;  3PUV E;  1UTB B;  1D9Y A;  3G7W A;  4M1V A;  3RTW B;  1GTK A;  4BDQ A;  2W7Y A;  4FEC A;  4QFN A;  4E0W A;  4F3B A;  4ZED A;  4I8C A;  3U92 A;  1LCT A;  5DT6 A;  4OFO A;  1MQJ A;  2F6P A;  2RC8 A;  3JZJ A;  1ZTY A;  3UP9 A;  4XIG Q;  4BDO A;  1ZBM A;  4R72 A;  1FTM A;  2ZXT A;  1BTJ A;  4H6D A;  4MLQ A;  1RKM A;  4R6H A;  1IXG A;  2HFB A;  3M3L A;  1I69 A;  4IO5 A;  2ZYN A;  4YKK A;  2QS3 A;  3HV1 A;  5JEI A;  1FQD A;  1MY3 A;  4EF1 A;  5I2N A;  3OO9 A;  4NTL A;  3H7M A;  5DEX A;  5LOM A;  3FXR A;  1IUD A;  1KWH A;  1VFE A;  2H99 A;  2R71 A;  3FXQ A;  1USY H;  3JV9 A;  3L6G A;  4H0W A;  4ND9 A;  2ZYM A;  4GF8 A;  1LAG E;  3M8U A;  5I56 B;  1IXH A;  1MY0 A;  1B51 A;  1JEV A;  1LGB C;  1MPC A;  5AE4 A;  4F29 A;  2QS2 A;  3N6U A;  1Z7N E;  4K3F A;  1MH4 A;  3Q28 A;  2O6A A;  3I6V A;  2X7P A;  1MDP 1;  1TT1 A;  1T0K A;  3CRB A;  1L5T A;  1BLF A;  1QVS A;  4NF8 A;  1NMU A;  1LST A;  2I58 A;  2XXV A;  3IOT A;  3MPK A;  2RCB A;  3QXM A;  1ZIU A;  2OJT A;  3T66 A;  3C32 A;  3FAS A;  3TMG A;  4OES A;  3ZSF A;  1MQG A;  4ZEC A;  4PQJ A;  2RKM A;  2LAO A;  2X7Q A;  1UIU A;  3G3J A;  3PD9 A;  4PFW A;  4PP0 A;  4ELO A;  5CBS A;  3S4U A;  3T9V A;  3TCH A;  3UGW A;  4WEP A;  5H8Q A;  4JB7 A;  2FNC A;  4ZE9 A;  5HM4 B;  1LBB A;  5TPA A;  1B4H A;  3MVX A;  1US5 A;  4RK2 A;  1XOC A;  1FCK A;  3RT8 A;  4GL0 A;  4QSE A;  1FQB A;  5EYF A;  3V8X B;  1Y3P A;  3VLU A;  1PBP A;  1MM6 A;  2D5W A;  3C35 A;  2I3W A;  3K01 A;  3K4U A;  4H65 A;  5HBC A;  3LSW A;  1QKB A;  3TKD A;  1B3F A;  2NWJ A;  3I5O A;  3N6T A;  4QSD A;  1VFD A;  2OZZ A;  3DP8 A;  3E3K A;  3KOS A;  3OO8 A;  4G8N A;  1DOT A;  4QSC A;  4XKR A;  4ESX A;  3C34 A;  4I1D A;  5JK4 A;  2DWH A;  1UTH A;  2UYF A;  3A3C A;  4M4G A;  5CI5 A;  5KZT A;  3S9N C;  1B6H A;  2OBG A;  2QRY A;  4X1B A;  1A54 A;  1QKA A;  2Y7P A;  2I49 A;  1B1X A;  1HSJ A;  3ONM A;  1MPD A;  3VLW A;  3SEX A;  5B70 A;  3A09 A;  4U1O A;  5F1Q A;  1B0L A;  1B7Z A;  2ESN A;  2P1S A;  5IKB A;  3MVY A;  1TFD A;  2OWS A;  4GXS B;  3B6T A;  3RLF E;  4IO3 A;  4PFT A;  2B3F A;  3B6W A;  4DCX A;  3SEY A;  2I48 A;  5AA2 A;  2DWJ A;  4KCD A;  2RC7 A;  1SI0 A;  4H67 A;  1B3L A;  3K1N A;  3R7X A;  2O1L A;  4DXC A;  1CE2 A;  3OSR A;  4ZZA A;  2NVU B;  3O66 A;  1MQH A;  2AIX A;  3MZB A;  3OEL A;  2DQV A;  3E9X A;  3QAX A;  4G2Z A;  3T22 A;  1YAE A;  3MVW A;  4OTE A;  3VXB A;  2DS9 A;  3PUY E;  1Y1Z A;  4G68 A;  2ZNU A;  3I3V A;  2V25 A;  3O29 A;  3Q26 A;  3W9W A;  1BKA A;  1PB7 A;  2DXY A;  2HCA A;  2UYE A;  4IGT A;  4QF9 A;  2PMS A;  1H76 A;  5KCJ A;  1D9V A;  2V3U A;  4O3C A;  2UXA A;  4MH5 A;  4RYA A;  3CG3 A;  4XKQ A;  3FGS A;  5AA3 A;  4TOZ A;  4JWY A;  1SI1 A;  4JWX A;  4F22 A;  3B6Q A;  2PBW A;  4GWO A;  3QYT A;  3DLN A;  4YKI A;  3OOA A;  4G8H A;  4HTG A;  1M5E A;  1N7X A;  5H8F B;  3OEM A;  5DTB A;  1WDN A;  4YMB A;  3H6U A;  4RK9 A;  1PC3 A;  4XKP A;  5ICQ A;  4DZ1 A;  1ZMG A;  1R9L A;  2CZL A;  3LSL A;  4F2Q A;  2V84 A;  2XD3 A;  4X9T A;  2Q89 A;  4FJP A;  3PUW E;  4RJZ A;  2I6E A;  1NNP A;  1QUL A;  1ZU0 A;  1IEJ A;  2YJP A;  1Y20 A;  1Y3N A;  1O7T A;  1SYH A;  1B40 A;  3CFZ A;  3EPE A;  3MP1 A;  4KYD A;  1IZ1 A;  3E4R A;  2VHA A;  5H8Q B;  4QHQ A;  4TLM B;  1MQD A;  1UTB A;  4U2R A;  5M2V A;  2B3B A;  5J1D A;  4ZS9 A;  1B9J A;  1AMF A;  3MZ1 A;  3KFM A;  2OLB A;  2ZNT A;  3W15 C;  4NF6 B;  1Q35 A;  5KDT A;  2G29 A;  4P11 A;  2RF1 A;  4NF8 B;  3TEP A;  3RNN A;  2H9B A;  4BDL A;  1MPB A;  3V83 A;  1UQW A;  1OLA A;  2I3V A;  2I4C A;  2XX8 A;  3BFU A;  2AL5 A;  3IB0 A;  3MWB A;  3MZ9 A;  2DVC A;  4IO6 A;  4QFL A;  4YZZ A;  1SQY A;  1DMB A;  4F1Y A;  3T96 B;  1Y9U A;  1MH3 A;  3D4G A;  3MW0 A;  4BDR A;  4ZEF A;  2YPN A;  2I0C A;  2Q88 A;  4KCC A;  2F7A A;  3TQW A;  1A55 A;  3FZV A;  4G68 C;  4C1T A;  3O9P A;  4POW A;  1CB6 A;  2E1S A;  4IB2 A;  2O1M A;  1OQH A;  4BDM A;  5A5X A;  3H03 A;  3HHF A;  1Y4T A;  3RQT A;  3C33 A;  2KLF A;  1IIW A;  4RPN A;  3S9M C;  1ZKB A;  5A5X B;  4JSD A;  2DSF A;  2P2A A;  3A3U A;  4ZEB A;  4NF5 B;  3KJT A;  1LBC A;  4YIC A;  3VV5 A;  4BLA A;  1LAH E;  1USY E;  5DVI A;  4KR5 A;  4U4S A;  1XVY A;  2B65 A;  3LBS A;  3PU5 A;  3UA8 A;  4FAT A;  2HZL A;  2I0B A;  3CFL A;  3ZKL A;  3EHS A;  3Q25 A;  4IY5 A;  1N3X A;  3FVG A;  1NNK A;  2GHB A;  2R6G E;  3FVK A;  3GBB A;  1SW2 A;  1JVY A;  3O28 A;  4OXV A;  3K2D A;  5I2K A;  4JWO A;  5JTY B;  3EHU A;  4IY6 A;  2DYX A;  2UVJ A;  3K6X A;  3LSF B;  1H43 A;  1MY1 A;  2X26 A;  4H5G A;  4GRK A;  1N04 A;  4FEB A;  4Q30 B;  1URS A;  4R74 A;  2XHD A;  4OEU A;  4OFL A;  3TOD A;  4EQ9 A;  4ESW A;  5TP9 B;  3MQ9 A;  1WOD A;  3EN3 A;  4XTC Q;  3RT6 B;  4AQ4 A;  4GLI A;  4FE8 A;  5AA2 D;  1YTV A;  1AL3 A;  1DPP A;  3IJX B;  4POX A;  3RTF B;  4KD5 A;  2ONS A;  2DWA A;  2ONR A;  4EQB A;  2XXP A;  1SD3 A;  3OEN A;  1N76 A;  1JW1 A;  1DSN A;  4OQO A;  3VDF A;  1AOV A;  4RXL A;  1P1U A;  3CVG A;  3KOT A;  3OMB A;  1ATG A;  2THI A;  2A5S A;  3VVE A;  4EQ7 A;  3KGC A;  4R2F A;  3FV1 A;  3LR1 A;  1VR5 A;  1R1N A;  2DVZ A;  4L17 A;  2Z8D A;  3SET A;  3TTN A;  4Q0C A;  1MM7 A;  2O69 A;  3KBR A;  3PUZ E;  5F7V A;  1B5J A;  3RN8 A;  4BDN A;  1UIV A;  2PT1 A;  4KHZ E;  4ELP A;  3OD7 A;  2F36 A;  3IB2 A;  3FV2 A;  4H5F A;  2XXR A;  4FAJ A;  3TTR A;  5L9O A;  1NH8 A;  1EZP A;  3G3K A;  1J1N A;  3JYR A;  4LZ8 A;  4ZZE A;  2OWT A;  3TFL A;  3SDF A;  3OO7 A;  3PV0 E;  4F39 A;  2PVU A;  4RPO A;  1I6B A;  1UTH B;  2WKY A;  2NUV A;  4WKM A;  3VFJ A;  5ITP A;  5CM6 A;  1FQF A;  3MC2 A;  3HCQ A;  1OIB A;  1QUJ A;  4TLL B;  3T9X B;  2QS4 A;  2AYS A;  4WXJ A;  1LAF E;  3BFT A;  1HSE A;  3SEV A;  4IO4 A;  1A40 A;  2FYI A;  3GXA A;  3IK6 B;  3O2A A;  2ANJ A;  4GVO A;  4MBP A;  3T93 B;  3CFX A;  3TZA A;  5FTH A;  2NOO A;  5FHM A;  1R6Z A;  4JDF A;  3VVF A;  1PBQ A;  1BP5 A;  3KN7 A;  1Y4C A;  3FVN A;  2H25 A;  1Y1M A;  3VVD A;  3LUY A;  1SBP A;  2UVH A;  2ZYO A;  2VOZ A;  3FD3 A;  3FJG A;  2DE2 A;  3G3H A;  3LSX A;  3LC8 A;  4PET A;  5L9M A;  1R9Q A;  3CSB A;  3KSX A;  1MDQ A;  3TTL A;  5HPQ A;  1VSO A;  1B3G A;  1YCJ A;  1SVX B;  2ZNS A;  3MUQ A;  1Q1K A;  5AA2 B;  5I59 B;  4I9D A;  4X48 A;  1POY 1;  1D4N A;  1JW5 A;  3SKP A;  2XXT A;  3K0V A;  3TDJ A;  2F8D A;  4MFI A;  5FHN A;  5IAI A;  1H3D A;  4FED A;  4UAC A;  3QIM A;  3SEU A;  1B5I A;  1RYX A;  3WAF A;  4AB6 A;  4YMA A;  3PPN A;  2BJJ X;  3PGF A;  4QFP A;  1Z7M E;  5KCJ B;  1N0T A;  3DM0 A;  3K1P A;  5BWJ A;  1FW0 A;  3BKI B;  3WAE A;  1B4Z A;  2XXH A;  4O3A A;  4QFK A;  5CMB A;  4GOT A;  4F1U A;  5AA4 B;  1OVT A;  1EU8 A;  1NNF A;  5DEX B;  1S9T A;  3IR1 A;  3U1O A;  1S50 A;  4OEN A;  1M5B A;  1N84 A;  2QSX A;  3K00 A;  5H8H A;  2OK2 A;  2Z8F A;  4LUB A;  1B46 A;  5CMC A;  1AH5 A;  2XXI A;  3C9H A;  3H4Z A;  1MG1 A;  4YKP A;  2M8C A;  1NKX A;  1B3E A;  4YKJ A;  3U72 A;  3S9L C;  1GGG A;  4LQ5 A;  2F97 A;  4ZEI A;  2XXW A;  3GZG A;  2QMX A;  5CBR A;  1US4 A;  4EF2 A;  2Z22 A;  3UIF A;  1FQA A;  1URG A;  4PFU A;  3U8Q A;  3ZKK A;  3HO7 A;  3TCG A;  1FTL A;  1B0H A;  1B7H A;  2ALU A;  1FQE A;  2RCA A;  2Q8J A;  2PYY A;  1ZJL A;  4H1X A;  3FJ7 A;  3N5L A;  4LON B;  1M5C A;  5ITO A;  2GRV A;  5BUU A;  2D21 A;  4F3G A;  3MJN A;  4NF6 A;  4LVQ A;  1S7Y A;  1Y3Q A;  1LCF A;  2HZK A;  4LA9 A;  1M5F A;  4OEV A;  3GLB A;  4YB7 A;  2VD2 A;  4LZ5 A;  1JET A;  3SER A;  4GXA A;  4EDP A;  2G93 A;  3KJ7 A;  1H44 A;  3KN3 A;  3MP6 A;  5I57 B;  4LQ2 A;  3U94 A;  1IQ7 A;  3MP8 A;  4NE4 A;  3FUZ A;  2HAV A;  2VD3 A;  3MPL A;  4R2B A;  4OER A;  1B7U A;  3H6W A;  1A7L A;  3IX1 A;  5ELV A;  4OFJ A;  4GIZ A;  3VLV A;  4C1U A;  4ECF A;  3OEK A;  3IOV A;  4U22 A;  1MXV A;  5I57 A;  2VGQ A;  1B52 A;  4OHN A;  1MRP A;  3K1M A;  3OSQ A;  4YB5 A;  1D3K A;  2F34 A;  3O6G A;  3GBA A;  1PEB A;  2GHA A;  1MXZ A;  4IO2 A;  1OQG A;  3ODB A;  1P1N A;  1HSL A;  5TP9 A;  5CC2 A;  2OCU A;  2Y7R A;  1LAX A;  1XC1 A;  1B3H A;  5EHS A;  4ZDM A;  5H8F A;  4F31 B;  3OO6 A;  3RY3 A;  1YPN A;  3MAM A;  5ICT A;  5ISU A;  2F7B A;  4MLV A;  1NFT A;  3MVZ A;  4F2O A;  5L9S A;  1IIT A;  3T9H B;  4F3S A;  1O64 A;  3CI8 A;  2O7U A;  3D4C A;  4G4P A;  2UVI A;  1N7W A;  3H6T A;  2XD2 A;  4PE5 B;  5I56 A;  2IA4 A;  3IL1 B;  5K2Y A;  3DP6 A;  1RYO A;  3M3F A;  1SDX A;  3IB1 A;  4P0I A;  1LFG A;  4GQO A;  2ZYK A;  1FTK A;  1TFA A;  4Q5T A;  3TUS A;  2XX9 A;  2VP1 A;  2IEE A;  4G68 B;  3QK6 A;  5I84 A;  1LFH A;  1O63 A;  1IXC A;  4HCW A;  1JW4 A;  1NH7 A;  2NXO A;  3O6H A;  3N26 A;  4U1Z A;  5CMM A;  5H8H B;  3G3G A;  3PMW A;  1ANF A;  2V3Q A;  2V93 A;  2E0S A;  2DE4 A;  3CR9 A;  4N6P A;  1LFI A;  1B5H A;  1TWY A;  3UK4 A;  2QJE A;  2Z8E A;  1GR2 A;  4HCY A;  2DWI A;  3S9E A;  4H8J A;  3K02 A;  4P0G A;  2DXR A;  3C31 A;  3KEI A;  3VXC A;  1II5 A;  1P1W A;  3QSL A;  4OYV A;  3V5A A;  5B7D A;  2O7I A;  1NNT A;  3PPQ A;  4YB6 A;  3FAT A;  2UVG A;  3H06 B;  1H45 A;  5H8N A;  4MF3 A;  1JNF A;  1PB9 A;  2Y7K A;  2CMO A;  1OLC A;  4Z7E A;  4U23 A;  5KDT B;  4GFR A;  4G8M A;  3QUJ A;  3PPR A;  5K2X A;  5FTI A;  5L8D A;  4EUO A;  2PX1 A;  4KYS A;  4NED A;  1MXY A;  2Y7W A;  3FXU A;  3HST A;  4JBZ A;  4PFY A;  5FHO A;  4C0R A;  1OMP A;  3B7D A;  3IJO B;  3ILU B;  2Q2C A;  3RGY A;  4ZEK A;  3IAZ A;  2QPQ A;  4ISU A;  4JSO A;  3P7I A;  4OZ9 A;  1SW5 A;  5DVF A;  4ZE8 A;  3PMX A;  1N3W A;  1P1Q A;  2AL4 A;  3IO6 A;  3EF7 A;  3KN8 A;  4E0X A;  3PD8 A;  4HS7 A;  4X1D A;  1A8E A;  4NWD A;  5TPA B;  1M5D A;  3Q29 A;  3O97 A;  4QFO A;  4HW8 A;  5I58 A;  1JEU A;  3USD A;  1FQC A;  3Q27 A;  1TXF A;  4DCY A;  4LZ7 A;  4NF4 A;  1PB8 A;  4F18 A;  3HN0 A;  2DOJ A;  2HAU A;  4XKN A;  5H8S A;  5DYH A;  1QUI A;  3L6H A;  4KPT A;  3E13 X;  2DE3 A;  2GFE A;  3AXF A;  3CSG A;  2QMW A;  4ELQ A;  4R75 A;  4YAH X;  2ONK E;  5AA4 A;  3F11 A;  3FVO A;  1F9B A;  3TYH A;  2GH9 A;  1WVJ A;  1P1O A;  2Q2A A;  5I2K B;  1B58 A; 
#chains in the Genus database with same CATH topology
 3H3G A;  3RUM A;  4OWD A;  1LEV A;  3UN6 A;  3CG1 A;  1I6Q A;  3RPL A;  3HPI A;  1B1H A;  2VPN A;  1A8F A;  4Q8R A;  5I59 A;  3MBP A;  1MY4 A;  5TU0 A;  1LB8 A;  1B05 A;  2H4I A;  5I2N B;  1ZLQ A;  1B32 A;  1AIV A;  4TQU Q;  1NV2 A;  2HEU A;  4N07 A;  4XF5 A;  2RIN A;  4AS4 A;  1I6A A;  1SW4 A;  3G3I A;  3IO4 A;  3H6V A;  4LP2 B;  3KZG A;  4QRZ A;  1EZO A;  3OXN A;  2V3T A;  3K6W A;  4NF4 B;  3ILT B;  4O7M A;  1RDX A;  3PMV A;  4IO7 A;  3O6I A;  1POT A;  3N94 A;  3THI A;  2RC9 A;  1ELJ A;  3V89 B;  2HHM A;  4JXI A;  5CRY A;  1MY2 A;  2QVU A;  2Y84 A;  4AB5 A;  1XHY A;  1DTZ A;  4GD5 A;  1FPE A;  1MXX A;  3PUV E;  1UTB B;  4F3B A;  2FHY A;  4QFN A;  3SZP A;  4I8C A;  1LCT A;  2F6P A;  4H6D A;  4MHF A;  4IO5 A;  2QS3 A;  1FQD A;  1MY3 A;  3OO9 A;  3FXR A;  1KWH A;  3R7X A;  5F24 A;  3FXQ A;  4GF8 A;  5I56 B;  3MYU A;  1B51 A;  1MPC A;  1Z7N E;  4K3F A;  1MH4 A;  3Q28 A;  1MDP 1;  3CRB A;  1BLF A;  2L5V A;  2I58 A;  1LST A;  2XXV A;  3QXM A;  3ZSF A;  3C32 A;  4OES A;  4N6D A;  2LAO A;  4PFW A;  3S4U A;  3UGW A;  4WEP A;  4JB7 A;  1LBB A;  4RK2 A;  1FQB A;  3V8X B;  1PBP A;  1MM6 A;  3K01 A;  5HBC A;  3RPL B;  3TKD A;  3I5O A;  3N6T A;  4QSD A;  2OZZ A;  3E3K A;  3KOS A;  3OO8 A;  4I1D A;  2DWH A;  4M4G A;  1QKA A;  1HSJ A;  3ONM A;  3A09 A;  1B7Z A;  5IKB A;  4IO3 A;  3B6W A;  3SEY A;  4KCD A;  3E78 A;  3K1N A;  4DXC A;  1CE2 A;  3D1R A;  2AIX A;  3MZB A;  2DQV A;  3T22 A;  3VXB A;  4MCO A;  2DS9 A;  1Y1Z A;  2VPO A;  2HCA A;  4QF9 A;  2WBB A;  2V3U A;  4RYA A;  3CG3 A;  4XKQ A;  3FGS A;  4JWX A;  4G8H A;  1WDN A;  4YMB A;  3H6U A;  1PC3 A;  5ICQ A;  4DZ1 A;  5J16 A;  4GL8 A;  2YJP A;  1Y20 A;  5EQ8 A;  1QGX A;  5M2V A;  2XXK A;  3B50 A;  1AMF A;  2OLB A;  2H9B A;  4LN5 A;  1DCU A;  1UQW A;  2XX8 A;  3BFU A;  2AL5 A;  2B4L A;  1DMB A;  1FJ6 A;  2YPN A;  1LBV A;  4KCC A;  1A55 A;  4PFR A;  2CEY A;  4JVC A;  4JSD A;  2P2A A;  4NF5 B;  5ET8 A;  4YIC A;  3VV5 A;  1XVY A;  4I3E A;  3UA8 A;  4FAT A;  2HZL A;  3CFL A;  2QVR A;  2GHB A;  5JTY B;  3LSF B;  1MY1 A;  4O94 A;  2XHD A;  4ESW A;  4XTC Q;  4FE8 A;  5AA2 D;  1AL3 A;  2DWA A;  2ONR A;  1AOV A;  1JW1 A;  1DSN A;  1FPK A;  2PFY A;  3OMB A;  1ATG A;  2THI A;  3SET A;  1R1N A;  3TTN A;  5CM6 A;  2Z8D A;  3S9M C;  3PUZ E;  4BDN A;  1UIV A;  4I3Y A;  2QVV A;  2XXR A;  1NH8 A;  1EZP A;  3G3K A;  4ZZE A;  2OWT A;  3SDF A;  2PVU A;  1UTH B;  4NAP A;  4WKM A;  5T3J A;  1FQF A;  3SEV A;  4IO4 A;  5FTH A;  3KN7 A;  3FVN A;  2H25 A;  1Y1M A;  3VVD A;  2ZYO A;  4PET A;  5L9M A;  1R9Q A;  3CSB A;  5IZZ A;  1MDQ A;  5HPQ A;  1VSO A;  1K9Z A;  1SVX B;  4I9D A;  3K0V A;  4MFI A;  5FHN A;  5IAI A;  4AB6 A;  4X8R A;  2DDK A;  5KCJ B;  3K1P A;  3WAE A;  2XXH A;  4F1U A;  4QBA A;  3U1O A;  1S50 A;  1FPL A;  2XXI A;  1YYZ A;  4YKP A;  3U72 A;  1DBZ A;  1GGG A;  3A29 A;  5CBR A;  1US4 A;  4PFU A;  3ZKK A;  3HO7 A;  1FTL A;  1B0H A;  1B7H A;  4H1X A;  5ITO A;  4NF6 A;  3LUZ A;  1NUX A;  2HZK A;  4LA9 A;  1M5F A;  3GLB A;  1H44 A;  4LQ2 A;  2F3D A;  1IQ7 A;  4NE4 A;  3H6W A;  4OFJ A;  4U22 A;  1MXV A;  3K1M A;  4YB5 A;  3O6G A;  3ODB A;  2GQ1 A;  3RY3 A;  5I5P A;  2XWI A;  5ICT A;  5ISU A;  2F7B A;  4G4P A;  2UVI A;  1N7W A;  2IA4 A;  3IL1 B;  1FBD A;  3IB1 A;  4GQO A;  3TUS A;  3BIG A;  2VP1 A;  2IEE A;  5I84 A;  1JW4 A;  5H8H B;  4DI3 D;  4N6P A;  2E0S A;  1TWY A;  2DWI A;  1FPB A;  2VT5 A;  4OYV A;  5B7D A;  1NNT A;  2XWO A;  1JNF A;  2CMO A;  4Z7E A;  4U23 A;  4G8M A;  4EUO A;  4NED A;  5FHO A;  3FBP A;  3PMX A;  1N3W A;  4NHB A;  3PD8 A;  4X1D A;  5TPA B;  1M5D A;  3O97 A;  1NV7 A;  3USD A;  4DCY A;  4LZ7 A;  1PB8 A;  2R8T A;  2DOJ A;  3MST A;  4KPT A;  3CSG A;  3AXF A;  1JP4 A;  4YAH X;  3F11 A;  3FVO A;  3A3U A;  2Q2A A;  5I2K B;  4I62 A;  4N13 A;  1KA0 A;  1IXI A;  2O68 A;  4R6K A;  1IMD A;  4FOR A;  3TTK A;  3R26 A;  2O51 A;  2YLN A;  3M3K A;  4OMB A;  4RNS A;  4PAF A;  1XVX A;  4R9F A;  3C4M A;  1K9Y A;  1JQF A;  2FA7 A;  3TCF A;  2WEF A;  1NL5 A;  1OVB A;  4DIG A;  2QS1 A;  4MNP A;  1MXW A;  4UAB A;  5DVJ A;  3KG2 A;  1XT8 A;  2KR0 A;  2D3I A;  3FJM A;  3IOR A;  3W9V A;  1MXU A;  1FTJ A;  4IR8 A;  3QUF A;  2F78 A;  1DPE A;  1BIY A;  4KYE A;  2P0S A;  4HE1 A;  1VE4 A;  1XS5 A;  2Q9T A;  1P99 A;  5AA1 A;  3TTM A;  4R6Y A;  2A5T B;  4H8I A;  2Z23 A;  4DDD A;  3TPA A;  3G7W A;  4BDQ A;  4E0W A;  1GTK A;  4ZED A;  4FEC A;  2JJK A;  3JZJ A;  2RC8 A;  1ZTY A;  3UP9 A;  1ZBM A;  4GWZ A;  3M3L A;  5IZ1 A;  5JEI A;  3H7M A;  5DEX A;  1IUD A;  1VFE A;  4ND9 A;  3JV9 A;  1USY H;  3L6G A;  3M8U A;  1IXH A;  5AE4 A;  2QS2 A;  2O6A A;  1IME A;  1L5T A;  3IOT A;  2RCB A;  1ZIU A;  3TMG A;  1LBX A;  4PQJ A;  2X7Q A;  3PD9 A;  3TCH A;  5HM4 B;  5TPA A;  3MVX A;  3U65 A;  3C35 A;  3K4U A;  1YZ0 A;  1QKB A;  3DP8 A;  4G8N A;  5ET5 A;  5CI5 A;  2Y7P A;  1B1X A;  4U1O A;  5F1Q A;  2ESN A;  4GXS B;  3B6T A;  2B3F A;  5AA2 A;  2I48 A;  2DWJ A;  4H67 A;  1B3L A;  3O66 A;  1MQH A;  4G2Z A;  3E9X A;  3MVW A;  4OTE A;  5I3S A;  3PUY E;  2WBD A;  4IGT A;  1H76 A;  4MH5 A;  4JWY A;  1SI1 A;  4GBW A;  3B6Q A;  2WX9 A;  1LBZ A;  3OEM A;  5DTB A;  4RK9 A;  5IM2 A;  2P3V A;  4XKP A;  1ZMG A;  2CZL A;  4F2Q A;  2V84 A;  2Q89 A;  4FJP A;  4RJZ A;  1NNP A;  1ZU0 A;  1O7T A;  1SYH A;  1B40 A;  3CFZ A;  4KYD A;  2PFZ A;  3CHG A;  4QHQ A;  4TLM B;  4PGP A;  4ZS9 A;  1B9J A;  4N8Y A;  3GYY A;  2Q8M A;  4NF6 B;  2G29 A;  3TEP A;  2FBP A;  4BDL A;  4XFE A;  1MPB A;  3V83 A;  2I4C A;  3IB0 A;  4QFL A;  4F1Y A;  3D4G A;  4BDR A;  2I0C A;  2Q88 A;  4C1T A;  3O9P A;  4BDM A;  1AWB A;  2E1S A;  2O1M A;  3QMF A;  5EQ7 A;  5A5X B;  4BLA A;  1LBC A;  1LAH E;  1USY E;  1G0H A;  3PU5 A;  4O7I A;  2I0B A;  4IO6 A;  4YZZ A;  1N3X A;  3O28 A;  4OXV A;  1JVY A;  4MJO A;  3EHU A;  5DVI A;  4H5G A;  4R73 A;  4OVR A;  1N04 A;  4FEB A;  1URS A;  4EQ9 A;  4GX4 A;  4AQ4 A;  4GLI A;  1YTV A;  3RTF B;  4NF0 A;  4EQB A;  2XXP A;  4OQO A;  1P1U A;  3KOT A;  2A5S A;  4P56 A;  4EQ7 A;  4R2F A;  3LR1 A;  1NV6 A;  2O69 A;  3IB2 A;  4FAJ A;  2ZZW A;  5L9O A;  3TFL A;  5I2K A;  3PV0 E;  1I6B A;  1FJ9 A;  3VFJ A;  3T9X B;  2QS4 A;  2AYS A;  3T93 B;  3GXA A;  3IK6 B;  3CFX A;  1PBQ A;  1BP5 A;  1VDW A;  1Y4C A;  4N91 A;  1SBP A;  3G3H A;  3LC8 A;  3MUQ A;  1Q1K A;  1POY 1;  1D4N A;  3SKP A;  3TDJ A;  1FPG A;  2F8D A;  1H3D A;  3SEU A;  1RYX A;  2BJJ X;  1Z7M E;  1N0T A;  1FW0 A;  3BKI B;  4O3A A;  5ET7 A;  1S9T A;  3IR1 A;  5H8H A;  3KBZ A;  1NKX A;  4LQ5 A;  2F97 A;  4EF2 A;  2Z22 A;  3UIF A;  1URG A;  3U8Q A;  1IMF A;  4P47 A;  4OVT A;  2PYY A;  1ZJL A;  3FJ7 A;  4LON B;  4JVI A;  2GRV A;  5BUU A;  5ET6 A;  3MJN A;  1Y3Q A;  4GXA A;  3MP8 A;  4R2B A;  2VD3 A;  4MEV A;  4OER A;  4NG7 A;  3OEK A;  2ZZX A;  1FBP A;  1MRP A;  1CNQ A;  1D3K A;  2F34 A;  3GBA A;  4IO2 A;  1MXZ A;  1OQG A;  5TP9 A;  1HSL A;  3E79 A;  2Y7R A;  1B3H A;  4ZDM A;  2O7U A;  1NI9 A;  1LFG A;  2ZYK A;  1FTK A;  1TFA A;  4P9K A;  1O63 A;  4HCW A;  1NH7 A;  2NXO A;  4H45 A;  3O6H A;  3N26 A;  4U1Z A;  5CMM A;  3CR9 A;  5EYG A;  3UK4 A;  2Z8E A;  1GR2 A;  4H8J A;  2DXR A;  1II5 A;  1INP A;  1P1W A;  3QSL A;  3V5A A;  2O7I A;  3PPQ A;  3KC0 A;  3H06 B;  5KDT B;  5FTI A;  5L8D A;  1MXY A;  2Y7W A;  3FXU A;  1OMP A;  2QPQ A;  4OZ9 A;  1P1Q A;  3IO6 A;  4HS7 A;  3HFU A;  4QFO A;  2Y5L A;  1TXF A;  3HN0 A;  2HAU A;  5DYH A;  1QUI A;  3L6H A;  1FPD A;  2FVZ A;  2QMW A;  1NV3 A;  4R74 A;  4OEU A;  3EKI A;  1DTG A;  3FIR A;  2HQ0 A;  2QL3 A;  3IOU A;  2CZI A;  3K6V A;  4FIM A;  4XEQ A;  1SYI A;  4O3B A;  4DXU A;  3EQ1 A;  2PT2 A;  1SW1 A;  4NWC A;  1QW0 A;  3TEL A;  3U93 A;  4WED A;  1QJM A;  4HXV A;  4PFB A;  2REJ A;  3KSJ A;  1LB9 A;  4F3P A;  3EHT A;  4I40 A;  3ECR A;  2R9J A;  4P3L A;  4KQP A;  3DP4 A;  3ZS6 A;  2DP8 A;  1XI6 A;  4NF5 A;  4OET A;  4DLD A;  3VE1 B;  4RA1 A;  4GWY A;  4EXK A;  1EH3 A;  4PDD A;  2F35 A;  1NUW A;  2H5Y A;  3UOR A;  2XXU A;  5CMK A;  3PTY A;  1URD A;  1LLS A;  3ROJ A;  3DEL B;  4IGR A;  1KZ8 A;  1GV8 A;  2XXX A;  1FPI A;  4KI0 E;  4LAT A;  3G3F A;  5JTY A;  4U4X A;  4EXL A;  4R9G A;  4M1V A;  4PBQ A;  2W7Y A;  2F3B A;  3U92 A;  5DT6 A;  4OFO A;  1MQJ A;  4XIG Q;  4BDO A;  1FPF A;  1FTM A;  2ZXT A;  4MLQ A;  4R6H A;  4YKK A;  1IMA A;  2ZYN A;  4JVD A;  5DW8 A;  5I2N A;  2CEX A;  5LOM A;  2H99 A;  2CZK A;  4H0W A;  2ZYM A;  4HE0 A;  1LAG E;  1NUY A;  1JEV A;  1LGB C;  3N6U A;  4PAI A;  2X7P A;  1TT1 A;  1T0K A;  1QVS A;  4PBH A;  1NMU A;  3MPK A;  4ZEC A;  1MQG A;  2RKM A;  1UIU A;  4PP0 A;  5CBS A;  3T9V A;  3NOH A;  2FNC A;  4ZE9 A;  1B4H A;  3RT8 A;  4ELP A;  1XOC A;  1FCK A;  4GL0 A;  5EYF A;  3VLU A;  4H65 A;  1B3F A;  1EYK A;  2NWJ A;  4ESX A;  1DOT A;  4XKR A;  3C34 A;  5JK4 A;  1LBY A;  2UYF A;  5KZT A;  1B6H A;  2OBG A;  4X1B A;  1A54 A;  2I49 A;  1MPD A;  3VLW A;  1B0L A;  2P1S A;  3MVY A;  1TFD A;  2OWS A;  3RLF E;  4N6K A;  4OAN A;  4PFT A;  2RC7 A;  4N8G A;  2O1L A;  3OSR A;  2NVU B;  3QAX A;  1YAE A;  3O29 A;  1BKA A;  1PB7 A;  2DXY A;  2PMS A;  5KCJ A;  2PBW A;  3QYT A;  3OOA A;  4HTG A;  1N7X A;  5H8F B;  4PDH A;  5A5L A;  3LSL A;  2XD3 A;  3PUW E;  4PF6 A;  2I6E A;  1QUL A;  1IEJ A;  3MP1 A;  3E4R A;  4MNC A;  1UTB A;  1MQD A;  4U2R A;  2B3B A;  5J1D A;  3MZ1 A;  3W15 C;  1Q35 A;  3RNN A;  4X04 A;  1OLA A;  2I3V A;  4Z0I A;  3MWB A;  4MNI A;  3T96 B;  1MH3 A;  3MW0 A;  4G68 C;  2WYP A;  1OQH A;  3H03 A;  4RPN A;  1ZKB A;  4ZEB A;  2Y5K A;  3BIH A;  4KR5 A;  4U4S A;  2B65 A;  3LBS A;  4U21 A;  3EHS A;  4IY5 A;  1FBF A;  3FVG A;  3GBB A;  2R6G E;  4JWO A;  1Q9D A;  2DYX A;  2UVJ A;  3SES A;  4OFL A;  3TOD A;  1WOD A;  3EN3 A;  3LV0 A;  4POX A;  2ONS A;  4G61 A;  3OEN A;  3CVG A;  3FV1 A;  1VR5 A;  2DVZ A;  5FBP A;  4Q0C A;  1MM7 A;  5F7V A;  3KBR A;  3RN8 A;  2PT1 A;  3OD7 A;  1J1N A;  3JYR A;  4LZ8 A;  4N15 A;  3OO7 A;  4F39 A;  4RPO A;  4NN3 A;  2WKY A;  2NUV A;  2B4M A;  3MC2 A;  1OIB A;  4TLL B;  1A40 A;  4PTK A;  4GVO A;  4MBP A;  2ANJ A;  3TZA A;  2QFL A;  5FHM A;  1R6Z A;  4JDF A;  3FJG A;  2VOZ A;  3FD3 A;  2DE2 A;  1B3G A;  1YCJ A;  2ZNS A;  5I59 B;  1JW5 A;  1RDY A;  4UAC A;  3QIM A;  1B5I A;  3WAF A;  3PPN A;  3PGF A;  3DM0 A;  5BWJ A;  4PE3 A;  4QFK A;  5CMB A;  1EU8 A;  5DEX B;  1M5B A;  2QSX A;  2OK2 A;  2Z8F A;  4LUB A;  5CMC A;  1B46 A;  4OVQ A;  2BJI A;  3H4Z A;  2XWK A;  4YKJ A;  3S9L C;  2XXW A;  3GZG A;  2QMX A;  1FQA A;  3KC1 A;  3TCG A;  2RCA A;  1G0I A;  1FBG A;  5LDZ A;  3N5L A;  3IFC A;  1M5C A;  2HXR A;  4F3G A;  1S7Y A;  1KA1 A;  1LCF A;  4OEV A;  4YB7 A;  4EDP A;  1JET A;  5I57 B;  2G93 A;  3MP6 A;  3U94 A;  4OA4 A;  1GVC A;  5ELV A;  3MPL A;  4C1U A;  1A7L A;  3IX1 A;  3VLV A;  4ECF A;  2VGQ A;  4OHN A;  1EYI A;  4PFI A;  5CC2 A;  2OCU A;  1LAX A;  1XC1 A;  5EHS A;  1YPN A;  3MAM A;  2WYK A;  4MLV A;  1NFT A;  3MVZ A;  4F2O A;  5L9S A;  1IIT A;  4F3S A;  3H6T A;  4PE5 B;  5I56 A;  3DP6 A;  4P0I A;  2XX9 A;  1LFH A;  4G68 B;  3QK6 A;  4GBV A;  4P8B A;  3G3G A;  3PMW A;  2DE4 A;  1LFI A;  1B5H A;  2QJE A;  2OX3 A;  4HCY A;  4GWS A;  4P0G A;  3VXC A;  4PAK A;  3FAT A;  2UVG A;  1IMB A;  1BK4 A;  2Y7K A;  4GFR A;  3QUJ A;  3PPR A;  5K2X A;  3HST A;  4JBZ A;  4N4U A;  3B7D A;  3IJO B;  3RGY A;  3ILU B;  4ZEK A;  3IAZ A;  4ISU A;  1SW5 A;  4E0X A;  3EF7 A;  1A8E A;  1NV1 A;  4HE2 A;  1JEU A;  4NF4 A;  4F18 A;  2GFE A;  5AA4 A;  5IGA A;  4KD5 A;  1F9B A;  3TYH A;  1P1O A;  3PPP A;  4F1V A;  3CIJ A;  3IOW A;  2H98 A;  4XXU A;  4F19 A;  3TQL A;  1FBE A;  1B2H A;  2REG A;  1A99 A;  4OVJ A;  2I4B A;  2F6G A;  4DXB A;  2V4C A;  3S2V A;  2XXY A;  1MS7 A;  3R6U A;  1FTA A;  5IZ3 A;  4ELR A;  3TAJ A;  5EHM A;  1MQI A;  1JVX A;  2Y7I A;  3SEW A;  1QUK A;  3BBR A;  3RYD A;  2ZZV A;  3C36 A;  2O84 X;  2F5X A;  2HXW A;  2F7C A;  4KFQ A;  5I58 B;  2ZMB A;  3RPW A;  4NMY A;  4THI A;  4OVP A;  3PUX E;  4RY1 A;  1EZ9 A;  4UA8 A;  1FTO A;  3T9U A;  2A5T A;  4ONY A;  3IFA A;  4DE8 A;  3K6U A;  3PPO A;  4G77 A;  1PDA A;  4YU0 A;  5H8N B;  2ABH A;  3HHG A;  2XXQ A;  4P1L A;  2XX7 A;  3RTW B;  1D9Y A;  5ESY A;  2KQZ A;  4PF8 A;  4R72 A;  1BTJ A;  1RKM A;  1IXG A;  2HFB A;  1I69 A;  1FPJ A;  3HV1 A;  4EF1 A;  4NTL A;  2R71 A;  1YXI A;  4MAG A;  1MY0 A;  2P3N A;  4F29 A;  3I6V A;  4GWX A;  4NF8 A;  4QXD A;  3T66 A;  2OJT A;  3FAS A;  3T0J A;  3G3J A;  4ELO A;  2FIE A;  5H8Q A;  1US5 A;  4QSE A;  2OWZ A;  1Y3P A;  2D5W A;  2I3W A;  3LSW A;  1FBC A;  4FBP A;  1VFD A;  4QSC A;  1UTH A;  3A3C A;  3S9N C;  2QRY A;  2HPG A;  4H46 A;  3SEX A;  5B70 A;  4AS5 A;  4DCX A;  1SI0 A;  4ZZA A;  3OEL A;  1IMC A;  4N81 A;  4G68 A;  2ZNU A;  3I3V A;  2V25 A;  3Q26 A;  3W9W A;  1NUZ A;  4PC9 A;  2UYE A;  1FSA A;  1D9V A;  4O3C A;  2UXA A;  5AA3 A;  4N17 A;  4TOZ A;  4F22 A;  3DLN A;  4YKI A;  1M5E A;  2XWV A;  1R9L A;  4X9T A;  4GWO A;  1Y3N A;  1NV0 A;  3EPE A;  4DI4 B;  1IZ1 A;  2VHA A;  5H8Q B;  3KFM A;  2ZNT A;  4MIJ A;  5KDT A;  4P11 A;  2RF1 A;  4NF8 B;  3MZ9 A;  2DVC A;  1SQY A;  4GX3 A;  1Y9U A;  3FXB A;  4ZEF A;  2F7A A;  3TQW A;  3FZV A;  4POW A;  1CB6 A;  4IB2 A;  5A5X A;  3HHF A;  1Y4T A;  3RQT A;  3C33 A;  2KLF A;  1IIW A;  2DSF A;  3KJT A;  4NGU A;  3ZKL A;  3Q25 A;  3FVK A;  1NNK A;  1SW2 A;  3K2D A;  1FRP A;  4IY6 A;  3K6X A;  4Q30 B;  1H43 A;  1NV5 A;  2X26 A;  4GRK A;  5TP9 B;  3MQ9 A;  3RT6 B;  1DPP A;  3IJX B;  5I7I A;  4PCD A;  1SD3 A;  3VDF A;  1N76 A;  4RXL A;  4MX6 A;  3VVE A;  3KGC A;  4L17 A;  1LBW A;  1B5J A;  4KHZ E;  5EQA A;  2F36 A;  4H5F A;  3FV2 A;  3TTR A;  4NQ8 A;  1DK4 A;  5ITP A;  2Q74 A;  3HCQ A;  1QUJ A;  4WXJ A;  1LAF E;  3BFT A;  1HSE A;  5IZ3 B;  1D9Q A;  3O2A A;  2FYI A;  2NOO A;  3VVF A;  3LUY A;  2UVH A;  3LSX A;  3KSX A;  3TTL A;  5AA2 B;  4X48 A;  4O8M A;  2XXT A;  4MMP A;  1RDZ A;  1NV4 A;  4FED A;  4YMA A;  4QFP A;  3T1B A;  1B4Z A;  4GOT A;  5AA4 B;  1OVT A;  1NNF A;  4OEN A;  4PGN A;  1N84 A;  3K00 A;  1AH5 A;  3C9H A;  1MG1 A;  2M8C A;  1B3E A;  4GWW A;  2XA5 A;  4ZEI A;  5EYH A;  2ALU A;  1FQE A;  2Q8J A;  3ISP A;  2D21 A;  4LVQ A;  4KXP A;  2VD2 A;  4LZ5 A;  3SER A;  3KJ7 A;  3KN3 A;  3FUZ A;  2HAV A;  1B7U A;  4GIZ A;  3IOV A;  5I57 A;  1B52 A;  3OSQ A;  1SPI A;  1PEB A;  2GHA A;  1P1N A;  1FBH A;  5H8F A;  4F31 B;  3OO6 A;  4GX6 A;  3T9H B;  1O64 A;  3CI8 A;  3D4C A;  4GWU A;  2XD2 A;  5K2Y A;  1RYO A;  2MKZ A;  3M3F A;  1SDX A;  4Q5T A;  2CZH A;  1IXC A;  1ANF A;  2V3Q A;  2V93 A;  4NX1 A;  5EQ9 A;  4OVS A;  3S9E A;  3K02 A;  3KEI A;  3C31 A;  4YB6 A;  1EYJ A;  1H45 A;  5H8N A;  4MF3 A;  1PB9 A;  1OLC A;  2FIX A;  2PX1 A;  4KYS A;  4PFY A;  4C0R A;  2Q2C A;  4JSO A;  3B8B A;  3P7I A;  5DVF A;  4ZE8 A;  2AL4 A;  3KN8 A;  4P1E A;  4NWD A;  3Q29 A;  4HW8 A;  5I58 A;  1FQC A;  3Q27 A;  5LTC A;  4XKN A;  5H8S A;  3E13 X;  2DE3 A;  2PCR A;  4ELQ A;  4R75 A;  2ONK E;  2GH9 A;  1WVJ A;  1B58 A; 
#chains in the Genus database with same CATH homology
 4I62 A;  1DTG A;  3H3G A;  3RUM A;  3FIR A;  4N13 A;  4OWD A;  4U21 A;  2HQ0 A;  3PPP A;  2QL3 A;  1IXI A;  4F1V A;  3IOU A;  3UN6 A;  3CG1 A;  3CIJ A;  3K6V A;  4FIM A;  3IOW A;  1I6Q A;  2H98 A;  2O68 A;  4XXU A;  3HPI A;  1B1H A;  1SYI A;  4R6K A;  4O3B A;  4F19 A;  3TQL A;  1A8F A;  3EQ1 A;  4DXU A;  4FOR A;  2PT2 A;  3TTK A;  4Q8R A;  5I59 A;  1B2H A;  1SW1 A;  2REG A;  3MBP A;  3R26 A;  1MY4 A;  1A99 A;  5TU0 A;  2O51 A;  1LB8 A;  4OVJ A;  4NWC A;  1B05 A;  1QW0 A;  2H4I A;  2YLN A;  4WED A;  3TEL A;  3U93 A;  5I2N B;  1QJM A;  2I4B A;  3M3K A;  4GL8 A;  2F6G A;  4OMB A;  2REJ A;  4RNS A;  4DXB A;  3S2V A;  1XVX A;  2XXY A;  1ZLQ A;  1B32 A;  3KSJ A;  1AIV A;  4R9F A;  1LB9 A;  1MS7 A;  4F3P A;  4TQU Q;  3SES A;  3EHT A;  3R6U A;  3C4M A;  2HEU A;  4N07 A;  3ECR A;  2RIN A;  2R9J A;  4ELR A;  1I6A A;  3TAJ A;  1JQF A;  5EHM A;  2FA7 A;  1MQI A;  1SW4 A;  3G3I A;  3TCF A;  1JVX A;  3IO4 A;  1NL5 A;  1OVB A;  4DIG A;  2Y7I A;  4KQP A;  2QS1 A;  1MXW A;  3DP4 A;  4Z0I A;  3H6V A;  2DP8 A;  3SEW A;  3ZS6 A;  4LP2 B;  1QUK A;  5DVJ A;  3KZG A;  3BBR A;  4QRZ A;  3KG2 A;  1EZO A;  3OXN A;  4NF5 A;  2V3T A;  1XT8 A;  3C36 A;  3K6W A;  4OET A;  2O84 X;  2F5X A;  2HXW A;  4NF4 B;  2D3I A;  3FJM A;  2F7C A;  3IOR A;  3W9V A;  1MXU A;  3ILT B;  4DLD A;  4KFQ A;  5I58 B;  3VE1 B;  2ZMB A;  4RA1 A;  4EXK A;  1EH3 A;  1GVC A;  1FTJ A;  3PMV A;  2F35 A;  4IO7 A;  2H5Y A;  3O6I A;  3QUF A;  4NMY A;  4THI A;  3RPW A;  3UOR A;  2XXU A;  3PUX E;  5CMK A;  1URD A;  1DPE A;  1POT A;  2F78 A;  3N94 A;  4RY1 A;  3THI A;  1LLS A;  1BIY A;  2RC9 A;  1EZ9 A;  3DEL B;  1ELJ A;  4KYE A;  2P0S A;  1FTO A;  4UA8 A;  3T9U A;  3V89 B;  1VE4 A;  2A5T A;  4ONY A;  1XS5 A;  4IGR A;  1GV8 A;  2XXX A;  4KI0 E;  4DE8 A;  2Q9T A;  1P99 A;  4JXI A;  3K6U A;  3PPO A;  5CRY A;  4LAT A;  4G77 A;  1MY2 A;  2Y84 A;  1PDA A;  4R73 A;  5AA1 A;  4YU0 A;  5H8N B;  3TTM A;  4AB5 A;  2ABH A;  1XHY A;  3G3F A;  3HHG A;  1DTZ A;  2XXQ A;  5JTY A;  4GD5 A;  2A5T B;  4R6Y A;  4H8I A;  2Z23 A;  4U4X A;  4DDD A;  4EXL A;  4R9G A;  3TPA A;  1MXX A;  2XX7 A;  3PUV E;  1UTB B;  1D9Y A;  3G7W A;  4M1V A;  3RTW B;  1GTK A;  4BDQ A;  2W7Y A;  4FEC A;  4QFN A;  4E0W A;  4F3B A;  4ZED A;  4I8C A;  3U92 A;  1LCT A;  5DT6 A;  4OFO A;  1MQJ A;  2F6P A;  2RC8 A;  3JZJ A;  1ZTY A;  3UP9 A;  4XIG Q;  4BDO A;  1ZBM A;  4R72 A;  1FTM A;  2ZXT A;  1BTJ A;  4H6D A;  4MLQ A;  1RKM A;  4R6H A;  1IXG A;  2HFB A;  3M3L A;  1I69 A;  4IO5 A;  2ZYN A;  4YKK A;  2QS3 A;  3HV1 A;  5JEI A;  1FQD A;  1MY3 A;  4EF1 A;  5I2N A;  3OO9 A;  4NTL A;  3H7M A;  5DEX A;  5LOM A;  3FXR A;  1IUD A;  1KWH A;  1VFE A;  2H99 A;  2R71 A;  3FXQ A;  1USY H;  3JV9 A;  3L6G A;  4H0W A;  4ND9 A;  2ZYM A;  4GF8 A;  1LAG E;  3M8U A;  5I56 B;  1IXH A;  1MY0 A;  1B51 A;  1JEV A;  1LGB C;  1MPC A;  5AE4 A;  4F29 A;  2QS2 A;  3N6U A;  1Z7N E;  4K3F A;  1MH4 A;  3Q28 A;  2O6A A;  3I6V A;  2X7P A;  1MDP 1;  1TT1 A;  1T0K A;  3CRB A;  1L5T A;  1BLF A;  1QVS A;  4NF8 A;  1NMU A;  1LST A;  2I58 A;  2XXV A;  3IOT A;  3MPK A;  2RCB A;  3QXM A;  1ZIU A;  2OJT A;  3T66 A;  3C32 A;  3FAS A;  3TMG A;  4OES A;  3ZSF A;  1MQG A;  4ZEC A;  4PQJ A;  2RKM A;  2LAO A;  2X7Q A;  1UIU A;  3G3J A;  3PD9 A;  4PFW A;  4PP0 A;  4ELO A;  5CBS A;  3S4U A;  3T9V A;  3TCH A;  3UGW A;  4WEP A;  5H8Q A;  4JB7 A;  2FNC A;  4ZE9 A;  5HM4 B;  1LBB A;  5TPA A;  1B4H A;  3MVX A;  1US5 A;  4RK2 A;  1XOC A;  1FCK A;  3RT8 A;  4GL0 A;  4QSE A;  1FQB A;  5EYF A;  3V8X B;  1Y3P A;  3VLU A;  1PBP A;  1MM6 A;  2D5W A;  3C35 A;  2I3W A;  3K01 A;  3K4U A;  4H65 A;  5HBC A;  3LSW A;  1QKB A;  3TKD A;  1B3F A;  2NWJ A;  3I5O A;  3N6T A;  4QSD A;  1VFD A;  2OZZ A;  3DP8 A;  3E3K A;  3KOS A;  3OO8 A;  4G8N A;  1DOT A;  4QSC A;  4XKR A;  4ESX A;  3C34 A;  4I1D A;  5JK4 A;  2DWH A;  1UTH A;  2UYF A;  3A3C A;  4M4G A;  5CI5 A;  5KZT A;  3S9N C;  1B6H A;  2OBG A;  2QRY A;  4X1B A;  1A54 A;  1QKA A;  2Y7P A;  2I49 A;  1B1X A;  1HSJ A;  3ONM A;  1MPD A;  3VLW A;  3SEX A;  5B70 A;  3A09 A;  4U1O A;  5F1Q A;  1B0L A;  1B7Z A;  2ESN A;  2P1S A;  5IKB A;  3MVY A;  1TFD A;  2OWS A;  4GXS B;  3B6T A;  3RLF E;  4IO3 A;  4PFT A;  2B3F A;  3B6W A;  4DCX A;  3SEY A;  2I48 A;  5AA2 A;  2DWJ A;  4KCD A;  2RC7 A;  1SI0 A;  4H67 A;  1B3L A;  3K1N A;  3R7X A;  2O1L A;  4DXC A;  1CE2 A;  3OSR A;  4ZZA A;  2NVU B;  3O66 A;  1MQH A;  2AIX A;  3MZB A;  3OEL A;  2DQV A;  3E9X A;  3QAX A;  4G2Z A;  3T22 A;  1YAE A;  3MVW A;  4OTE A;  3VXB A;  2DS9 A;  3PUY E;  1Y1Z A;  4G68 A;  2ZNU A;  3I3V A;  2V25 A;  3O29 A;  3Q26 A;  3W9W A;  1BKA A;  1PB7 A;  2DXY A;  2HCA A;  2UYE A;  4IGT A;  4QF9 A;  2PMS A;  1H76 A;  5KCJ A;  1D9V A;  2V3U A;  4O3C A;  2UXA A;  4MH5 A;  4RYA A;  3CG3 A;  4XKQ A;  3FGS A;  5AA3 A;  4TOZ A;  4JWY A;  1SI1 A;  4JWX A;  4F22 A;  3B6Q A;  2PBW A;  4GWO A;  3QYT A;  3DLN A;  4YKI A;  3OOA A;  4G8H A;  4HTG A;  1M5E A;  1N7X A;  5H8F B;  3OEM A;  5DTB A;  1WDN A;  4YMB A;  3H6U A;  4RK9 A;  1PC3 A;  4XKP A;  5ICQ A;  4DZ1 A;  1ZMG A;  1R9L A;  2CZL A;  3LSL A;  4F2Q A;  2V84 A;  2XD3 A;  4X9T A;  2Q89 A;  4FJP A;  3PUW E;  4RJZ A;  2I6E A;  1NNP A;  1QUL A;  1ZU0 A;  1IEJ A;  2YJP A;  1Y20 A;  1Y3N A;  1O7T A;  1SYH A;  1B40 A;  3CFZ A;  3EPE A;  3MP1 A;  4KYD A;  1IZ1 A;  3E4R A;  2VHA A;  5H8Q B;  4QHQ A;  4TLM B;  1MQD A;  1UTB A;  4U2R A;  5M2V A;  2B3B A;  5J1D A;  4ZS9 A;  1B9J A;  1AMF A;  3MZ1 A;  3KFM A;  2OLB A;  2ZNT A;  3W15 C;  4NF6 B;  1Q35 A;  5KDT A;  2G29 A;  4P11 A;  2RF1 A;  4NF8 B;  3TEP A;  3RNN A;  2H9B A;  4BDL A;  1MPB A;  3V83 A;  1UQW A;  1OLA A;  2I3V A;  2I4C A;  2XX8 A;  3BFU A;  2AL5 A;  3IB0 A;  3MWB A;  3MZ9 A;  2DVC A;  4IO6 A;  4QFL A;  4YZZ A;  1SQY A;  1DMB A;  4F1Y A;  3T96 B;  1Y9U A;  1MH3 A;  3D4G A;  3MW0 A;  4BDR A;  4ZEF A;  2YPN A;  2I0C A;  2Q88 A;  4KCC A;  2F7A A;  3TQW A;  1A55 A;  3FZV A;  4G68 C;  4C1T A;  3O9P A;  4POW A;  1CB6 A;  2E1S A;  4IB2 A;  2O1M A;  1OQH A;  4BDM A;  5A5X A;  3H03 A;  3HHF A;  1Y4T A;  3RQT A;  3C33 A;  2KLF A;  1IIW A;  4RPN A;  3S9M C;  1ZKB A;  5A5X B;  4JSD A;  2DSF A;  2P2A A;  3A3U A;  4ZEB A;  4NF5 B;  3KJT A;  1LBC A;  4YIC A;  3VV5 A;  4BLA A;  1LAH E;  1USY E;  5DVI A;  4KR5 A;  4U4S A;  1XVY A;  2B65 A;  3LBS A;  3PU5 A;  3UA8 A;  4FAT A;  2HZL A;  2I0B A;  3CFL A;  3ZKL A;  3EHS A;  3Q25 A;  4IY5 A;  1N3X A;  3FVG A;  1NNK A;  2GHB A;  2R6G E;  3FVK A;  3GBB A;  1SW2 A;  1JVY A;  3O28 A;  4OXV A;  3K2D A;  5I2K A;  4JWO A;  5JTY B;  3EHU A;  4IY6 A;  2DYX A;  2UVJ A;  3K6X A;  3LSF B;  1H43 A;  1MY1 A;  2X26 A;  4H5G A;  4GRK A;  1N04 A;  4FEB A;  4Q30 B;  1URS A;  4R74 A;  2XHD A;  4OEU A;  4OFL A;  3TOD A;  4EQ9 A;  4ESW A;  5TP9 B;  3MQ9 A;  1WOD A;  3EN3 A;  4XTC Q;  3RT6 B;  4AQ4 A;  4GLI A;  4FE8 A;  5AA2 D;  1YTV A;  1AL3 A;  1DPP A;  3IJX B;  4POX A;  3RTF B;  4KD5 A;  2ONS A;  2DWA A;  2ONR A;  4EQB A;  2XXP A;  1SD3 A;  3OEN A;  1N76 A;  1JW1 A;  1DSN A;  4OQO A;  3VDF A;  1AOV A;  4RXL A;  1P1U A;  3CVG A;  3KOT A;  3OMB A;  1ATG A;  2THI A;  2A5S A;  3VVE A;  4EQ7 A;  3KGC A;  4R2F A;  3FV1 A;  3LR1 A;  1VR5 A;  1R1N A;  2DVZ A;  4L17 A;  2Z8D A;  3SET A;  3TTN A;  4Q0C A;  1MM7 A;  2O69 A;  3KBR A;  3PUZ E;  5F7V A;  1B5J A;  3RN8 A;  4BDN A;  1UIV A;  2PT1 A;  4KHZ E;  4ELP A;  3OD7 A;  2F36 A;  3IB2 A;  3FV2 A;  4H5F A;  2XXR A;  4FAJ A;  3TTR A;  5L9O A;  1NH8 A;  1EZP A;  3G3K A;  1J1N A;  3JYR A;  4LZ8 A;  4ZZE A;  2OWT A;  3TFL A;  3SDF A;  3OO7 A;  3PV0 E;  4F39 A;  2PVU A;  4RPO A;  1I6B A;  1UTH B;  2WKY A;  2NUV A;  4WKM A;  3VFJ A;  5ITP A;  5CM6 A;  1FQF A;  3MC2 A;  3HCQ A;  1OIB A;  1QUJ A;  4TLL B;  3T9X B;  2QS4 A;  2AYS A;  4WXJ A;  1LAF E;  3BFT A;  1HSE A;  3SEV A;  4IO4 A;  1A40 A;  2FYI A;  3GXA A;  3IK6 B;  3O2A A;  2ANJ A;  4GVO A;  4MBP A;  3T93 B;  3CFX A;  3TZA A;  5FTH A;  2NOO A;  5FHM A;  1R6Z A;  4JDF A;  3VVF A;  1PBQ A;  1BP5 A;  3KN7 A;  1Y4C A;  3FVN A;  2H25 A;  1Y1M A;  3VVD A;  3LUY A;  1SBP A;  2UVH A;  2ZYO A;  2VOZ A;  3FD3 A;  3FJG A;  2DE2 A;  3G3H A;  3LSX A;  3LC8 A;  4PET A;  5L9M A;  1R9Q A;  3CSB A;  3KSX A;  1MDQ A;  3TTL A;  5HPQ A;  1VSO A;  1B3G A;  1YCJ A;  1SVX B;  2ZNS A;  3MUQ A;  1Q1K A;  5AA2 B;  5I59 B;  4I9D A;  4X48 A;  1POY 1;  1D4N A;  1JW5 A;  3SKP A;  2XXT A;  3K0V A;  3TDJ A;  2F8D A;  4MFI A;  5FHN A;  5IAI A;  1H3D A;  4FED A;  4UAC A;  3QIM A;  3SEU A;  1B5I A;  1RYX A;  3WAF A;  4AB6 A;  4YMA A;  3PPN A;  2BJJ X;  3PGF A;  4QFP A;  1Z7M E;  5KCJ B;  1N0T A;  3DM0 A;  3K1P A;  5BWJ A;  1FW0 A;  3BKI B;  3WAE A;  1B4Z A;  2XXH A;  4O3A A;  4QFK A;  5CMB A;  4GOT A;  4F1U A;  5AA4 B;  1OVT A;  1EU8 A;  1NNF A;  5DEX B;  1S9T A;  3IR1 A;  3U1O A;  1S50 A;  4OEN A;  1M5B A;  1N84 A;  2QSX A;  3K00 A;  5H8H A;  2OK2 A;  2Z8F A;  4LUB A;  1B46 A;  5CMC A;  1AH5 A;  2XXI A;  3C9H A;  3H4Z A;  1MG1 A;  4YKP A;  2M8C A;  1NKX A;  1B3E A;  4YKJ A;  3U72 A;  3S9L C;  1GGG A;  4LQ5 A;  2F97 A;  4ZEI A;  2XXW A;  3GZG A;  2QMX A;  5CBR A;  1US4 A;  4EF2 A;  2Z22 A;  3UIF A;  1FQA A;  1URG A;  4PFU A;  3U8Q A;  3ZKK A;  3HO7 A;  3TCG A;  1FTL A;  1B0H A;  1B7H A;  2ALU A;  1FQE A;  2RCA A;  2Q8J A;  2PYY A;  1ZJL A;  4H1X A;  3FJ7 A;  3N5L A;  4LON B;  1M5C A;  5ITO A;  2GRV A;  5BUU A;  2D21 A;  4F3G A;  3MJN A;  4NF6 A;  4LVQ A;  1S7Y A;  1Y3Q A;  1LCF A;  2HZK A;  4LA9 A;  1M5F A;  4OEV A;  3GLB A;  4YB7 A;  2VD2 A;  4LZ5 A;  1JET A;  3SER A;  4GXA A;  4EDP A;  2G93 A;  3KJ7 A;  1H44 A;  3KN3 A;  3MP6 A;  5I57 B;  4LQ2 A;  3U94 A;  1IQ7 A;  3MP8 A;  4NE4 A;  3FUZ A;  2HAV A;  2VD3 A;  3MPL A;  4R2B A;  4OER A;  1B7U A;  3H6W A;  1A7L A;  3IX1 A;  5ELV A;  4OFJ A;  4GIZ A;  3VLV A;  4C1U A;  4ECF A;  3OEK A;  3IOV A;  4U22 A;  1MXV A;  5I57 A;  2VGQ A;  1B52 A;  4OHN A;  1MRP A;  3K1M A;  3OSQ A;  4YB5 A;  1D3K A;  2F34 A;  3O6G A;  3GBA A;  1PEB A;  2GHA A;  1MXZ A;  4IO2 A;  1OQG A;  3ODB A;  1P1N A;  1HSL A;  5TP9 A;  5CC2 A;  2OCU A;  2Y7R A;  1LAX A;  1XC1 A;  1B3H A;  5EHS A;  4ZDM A;  5H8F A;  4F31 B;  3OO6 A;  3RY3 A;  1YPN A;  3MAM A;  5ICT A;  5ISU A;  2F7B A;  4MLV A;  1NFT A;  3MVZ A;  4F2O A;  5L9S A;  1IIT A;  3T9H B;  4F3S A;  1O64 A;  3CI8 A;  2O7U A;  3D4C A;  4G4P A;  2UVI A;  1N7W A;  3H6T A;  2XD2 A;  4PE5 B;  5I56 A;  2IA4 A;  3IL1 B;  5K2Y A;  3DP6 A;  1RYO A;  3M3F A;  1SDX A;  3IB1 A;  4P0I A;  1LFG A;  4GQO A;  2ZYK A;  1FTK A;  1TFA A;  4Q5T A;  3TUS A;  2XX9 A;  2VP1 A;  2IEE A;  4G68 B;  3QK6 A;  5I84 A;  1LFH A;  1O63 A;  1IXC A;  4HCW A;  1JW4 A;  1NH7 A;  2NXO A;  3O6H A;  3N26 A;  4U1Z A;  5CMM A;  5H8H B;  3G3G A;  3PMW A;  1ANF A;  2V3Q A;  2V93 A;  2E0S A;  2DE4 A;  3CR9 A;  4N6P A;  1LFI A;  1B5H A;  1TWY A;  3UK4 A;  2QJE A;  2Z8E A;  1GR2 A;  4HCY A;  2DWI A;  3S9E A;  4H8J A;  3K02 A;  4P0G A;  2DXR A;  3C31 A;  3KEI A;  3VXC A;  1II5 A;  1P1W A;  3QSL A;  4OYV A;  3V5A A;  5B7D A;  2O7I A;  1NNT A;  3PPQ A;  4YB6 A;  3FAT A;  2UVG A;  3H06 B;  1H45 A;  5H8N A;  4MF3 A;  1JNF A;  1PB9 A;  2Y7K A;  2CMO A;  1OLC A;  4Z7E A;  4U23 A;  5KDT B;  4GFR A;  4G8M A;  3QUJ A;  3PPR A;  5K2X A;  5FTI A;  5L8D A;  4EUO A;  2PX1 A;  4KYS A;  4NED A;  1MXY A;  2Y7W A;  3FXU A;  3HST A;  4JBZ A;  4PFY A;  5FHO A;  4C0R A;  1OMP A;  3B7D A;  3IJO B;  3ILU B;  2Q2C A;  3RGY A;  4ZEK A;  3IAZ A;  2QPQ A;  4ISU A;  4JSO A;  3P7I A;  4OZ9 A;  1SW5 A;  5DVF A;  4ZE8 A;  3PMX A;  1N3W A;  1P1Q A;  2AL4 A;  3IO6 A;  3EF7 A;  3KN8 A;  4E0X A;  3PD8 A;  4HS7 A;  4X1D A;  1A8E A;  4NWD A;  5TPA B;  1M5D A;  3Q29 A;  3O97 A;  4QFO A;  4HW8 A;  5I58 A;  1JEU A;  3USD A;  1FQC A;  3Q27 A;  1TXF A;  4DCY A;  4LZ7 A;  4NF4 A;  1PB8 A;  4F18 A;  3HN0 A;  2DOJ A;  2HAU A;  4XKN A;  5H8S A;  5DYH A;  1QUI A;  3L6H A;  4KPT A;  3E13 X;  2DE3 A;  2GFE A;  3AXF A;  3CSG A;  2QMW A;  4ELQ A;  4R75 A;  4YAH X;  2ONK E;  5AA4 A;  3F11 A;  3FVO A;  1F9B A;  3TYH A;  2GH9 A;  1WVJ A;  1P1O A;  2Q2A A;  5I2K B;  1B58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...