4BDQA

Crystal structure of the gluk2 r775a lbd dimer in complex with glutamate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
253
structure length
250
Chain Sequence
SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYADKITIAILQLQEEGKLHMMKEKWWRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal transport
molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
publication title Correlating Efficacy and Desensitization with Gluk2 Ligand-Binding Domain Movements.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 85
structure length 250
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdqA02
4QSEA 2O84X 3U92A 5I84A 2RC9A 3TEPA 3FUZA 4M1VA 3IB0A 1PEBA 4QSDA 3OSRA 1Y1ZA 3K1PA 1MXYA 3EPEA 3BBRA 4ESWA 3IOVA 5L9MA 4F3GA 4L17A 1IXIA 1B40A 2A5TA 3S9MC 1JVXA 3MBPA 1MY3A 3K6XA 1DSNA 2DOJA 3GBAA 3HHFA 3KG2A 4OYVA 1OLCA 2XXHA 4N13A 5I58B 4UA8A 1MQHA 1ZU0A 3S4UA 3OOAA 1YAEA 3HSTA 1S7YA 1LFHA 1B7HA 2GH9A 1B6HA 4WEPA 4OENA 4FJPA 5I2NB 1LSTA 1ZBMA 1MS7A 3G3KA 1BP5A 2V3TA 1N3WA 2AIXA 3ZKLA 2M8CA 4U4SA 3OMBA 2B3BA 3OD7A 4DXBA 1OVTA 1FTLA 3JV9A 4K3FA 3CRBA 5M2VA 1PC3A 2UVJA 5I59A 4ISUA 2R6GE 2UYEA 3FVGA 3MC2A 3N26A 4RA1A 5TPAB 4OERA 1JQFA 2F35A 4F3BA 1MPCA 2DSFA 4EQ9A 4RPNA 4OMBA 2THIA 4AQ4A 1MDP1 4FEBA 1D9YA 1VE4A 3L6HA 4JDFA 4R6HA 1N3XA 1FQAA 4C1TA 1PDAA 4NF6B 3RNNA 3C32A 4YB7A 5DEXB 3VLVA 5CC2A 2H9BA 3Q26A 1FQBA 2B65A 1H3DA 3VVDA 3EHUA 4BDMA 3OEKA 4R6YA 2PVUA 2O1LA 3ODBA 3M8UA 3EHTA 4WEDA 4R73A 3EQ1A 3SDFA 3KN3A 1MM6A 1URGA 4NF4A 5B7DA 4YZZA 3VE1B 5CMMA 5CMBA 4FE8A 3LSFB 2QSXA 1XVXA 4XTCQ 5IAIA 1A55A 1JEVA 2DWJA 3H6UA 2DXYA 2UVHA 1SD3A 2XXIA 3PPQA 1LB9A 1QKAA 3MP6A 4YAHX 4E0XA 3O6IA 1UTHB 4FORA 1B7UA 2UYFA 1VSOA 1JNFA 1LLSA 4KI0E 4LQ2A 1MH4A 2Q88A 2QS2A 4FEDA 1RYOA 1JW5A 3DLNA 1F9BA 3KJ7A 3FJ7A 3K1MA 3LSXA 3FV1A 5DVJA 4LZ5A 4RYAA 3UORA 3JYRA 4G8MA 1MY0A 4ONYA 1MM7A 1BTJA 4WXJA 5KCJA 3IAZA 3IOTA 3K0VA 2ZNSA 4BDLA 1B3LA 2V93A 2A5SA 2I48A 4IO3A 4KYSA 4MH5A 2NOOA 4GL0A 3EF7A 2XXYA 3N6UA 4ZEIA 1YTVA 1Q35A 1I6AA 4JSOA 3BFTA 4DIGA 1OIBA 3ECRA 1LCTA 1URDA 4OFLA 1QUKA 4OVJA 3MZ9A 3UA8A 2ABHA 4OXVA 4ZEBA 1B46A 4G2ZA 4NF8B 5FTHA 4DCXA 1I6BA 3LBSA 3K6VA 3CFZA 3CSBA 3CSGA 2CMOA 4RPOA 1MXXA 5AE4A 4F1UA 4XXUA 3GLBA 2XHDA 3U72A 4GFRA 5I58A 3KJTA 2HEUA 1FW0A 2PX1A 4QHQA 2I4BA 3A09A 1NNFA 1ZKBA 2RINA 3IJOB 4R9GA 4IY6A 3TTMA 2BJJX 1UIVA 3TYHA 4JXIA 3Q29A 2Y7PA 4TLLB 2ZYNA 4ZZAA 4QFLA 1JW4A 1R9QA 3RTFB 3RY3A 2OCUA 4Q30B 1ZIUA 4WKMA 3H6VA 4QFOA 1OLAA 1CE2A 4NTLA 2W7YA 2PYYA 5BWJA 3TODA 1UIUA 1MY1A 1XVYA 3UK4A 5DVIA 2F6GA 1SYIA 2VHAA 1A8FA 3CG3A 2ZNUA 4LQ5A 4OESA 5TPAA 2O1MA 2ANJA 1I6QA 2I0BA 1P1NA 5ITOA 4MLVA 4ZDMA 3VXBA 3KOTA 4N07A 3USDA 3FV2A 1OMPA 4JB7A 4GRKA 2F7CA 2OK2A 4EQBA 3JZJA 1EH3A 3HO7A 1IQ7A 2E0SA 4F3SA 3OO7A 4OFOA 2X26A 1PB7A 1QKBA 4EF1A 1AOVA 2WKYA 3FVKA 2DXRA 1DTGA 3ILTB 4Z0IA 3TELA 3CI8A 1DOTA 4HW8A 2DP8A 3MPLA 3M3KA 5H8HA 5FTIA 3Q27A 5JEIA 4Z7EA 3PUYE 2XX9A 4N6PA 1SW1A 5F7VA 3MQ9A 4RJZA 4RNSA 4BDQA 3PPPA 3OO8A 3TTRA 4BLAA 1EZPA 2XXUA 2V84A 4YKIA 2I49A 1ELJA 1N7WA 3PMVA 4R2FA 5CRYA 2QMXA 2YLNA 1IZ1A 3C35A 1XT8A 3C4MA 4H8IA 1URSA 3KGCA 1B3GA 1P1UA 1LGBC 3CVGA 2ZYOA 1M5EA 4AB5A 2QJEA 1GR2A 4JWXA 2XD3A 4R9FA 1TXFA 3U94A 4NWDA 5I2KB 5HM4B 5KCJB 3IORA 5HBCA 2RKMA 4H5FA 3UGWA 4LONB 2Y7KA 4X9TA 5J1DA 3BKIB 1Y4TA 2VD3A 4QRZA 3B7DA 1NMUA 3A3CA 2PT1A 3QSLA 1B2HA 4OEUA 4QSCA 4XIGQ 4ZE9A 3KSJA 2VP1A 4IO2A 3MW0A 3K1NA 2XXQA 1A40A 4U1OA 5ISUA 4NF8A 1NFTA 2DE2A 1B5IA 4YKKA 4OTEA 3U8QA 4ECFA 2HZKA 5DYHA 1L5TA 4FAJA 2LAOA 4F22A 4LATA 4GLIA 2FYIA 3FATA 4JWOA 1SDXA 4LVQA 5AA4A 3KEIA 4IGTA 2NVUB 4OQOA 5ITPA 4POWA 4C0RA 2E1SA 4GVOA 1B5JA 3TKDA 3IB1A 3S9NC 3MVWA 4F1YA 1B3EA 1USYE 2UXAA 3RUMA 3IO4A 4KYEA 1M5BA 3L6GA 3KFMA 3BFUA 2O68A 4G4PA 1EZ9A 3O6GA 1OQGA 2F36A 2QPQA 4EXLA 2OBGA 2XX7A 2I3WA 1MQIA 3T96B 4KHZE 4AB6A 4OETA 5DT6A 4RK9A 3H7MA 4UACA 4KQPA 1R9LA 1DMBA 4F19A 4EF2A 1NNPA 2HZLA 4OFJA 5CMKA 4ZEKA 3IX1A 5KDTB 3VV5A 3OENA 1ATGA 3A3UA 3E3KA 3TUSA 3PUVE 4H1XA 3RPWA 3OO6A 3FJMA 2OZZA 1B1HA 1B3HA 4EUOA 2FA7A 3WAFA 4IY5A 5AA2D 2I0CA 3RLFE 1TWYA 4P0IA 1FQFA 3K6UA 2YPNA 2ZYMA 2UVGA 4KFQA 3PUXE 2REGA 3B6TA 1Y20A 1O7TA 5ELVA 5K2YA 1B3FA 4HCYA 1SW4A 5H8HB 5IKBA 1LAGE 4PQJA 1N76A 4R72A 1LFIA 5KZTA 3FXQA 3T9HB 2RCAA 1JW1A 1LCFA 1S50A 2DYXA 1P1QA 1AIVA 3MWBA 3U93A 1MPBA 3T9XB 2PMSA 1MH3A 3V83A 2DWHA 1H44A 4FECA 3TCHA 1IXHA 1OVBA 4IO6A 1HSEA 1MG1A 3IL1B 3IJXB 1EZOA 1VFEA 3LSLA 4YICA 3H06B 5F1QA 4BDNA 4NF5B 3V89B 3O29A 3HV1A 2Y7WA 4LA9A 5I2KA 1VR5A 5I56B 4PFYA 4F31B 4GOTA 1Y9UA 3O2AA 5H8SA 1Y4CA 3AXFA 4NE4A 4Q5TA 3R6UA 2O6AA 3FVOA 2H5YA 5LOMA 1Z7ME 3FD3A 3PGFA 3QIMA 2DS9A 4OEVA 1H45A 1FQCA 3K01A 1WVJA 4THIA 3E13X 4DLDA 4ZZEA 1BLFA 3QXMA 5TP9B 1LAFE 2I3VA 3SEWA 1JVYA 1NH8A 1ZMGA 3VLUA 2Q8JA 4OHNA 2QL3A 3QUJA 2G93A 2UVIA 4KPTA 1LFGA 2OLBA 2ESNA 5FHOA 1TT1A 1A54A 5A5XB 2O7IA 3KSXA 2DE3A 5AA4B 2F5XA 3SEXA 2X7PA 1BIYA 1AMFA 4U22A 1Y3PA 1LBCA 1B51A 2I4CA 3DP4A 3KBRA 4R75A 5CM6A 2Z8DA 2OWTA 1IUDA 3PU5A 3FXRA 3LR1A 1RKMA 2XXPA 3N94A 2V3UA 2AYSA 1TFAA 3TAJA 3WAEA 3D4CA 3CG1A 2ONSA 1NH7A 5JK4A 4DCYA 4F2QA 3C9HA 3PV0E 3PD9A 3EN3A 1JEUA 1DTZA 3TTLA 4JSDA 2P1SA 1B7ZA 2GFEA 2H99A 3H6WA 1FTJA 4PETA 5KDTA 1N7XA 2RC7A 3S9EA 1SYHA 4GWOA 1GTKA 2VGQA 3EHSA 3P7IA 4HCWA 3PUWE 4YB6A 4O3CA 4QFPA 1FTKA 1NNKA 4DXUA 1FTMA 4G68C 3CFLA 1QULA 3GXAA 4IO5A 3W15C 3IOUA 1IIWA 3TCFA 3O97A 4ZEDA 2DQVA 1MQDA 1SI0A 3O6HA 4GIZA 1SW2A 4PE5B 1ANFA 2ZNTA 4PFTA 5ICTA 1JETA 1MPDA 1YCJA 4R6KA 1S9TA 4H65A 3RN8A 2F6PA 2IEEA 2OJTA 3MPKA 3SEUA 3O28A 4YMBA 5DVFA 2HFBA 5EYFA 1B1XA 2D3IA 1VFDA 2O51A 5CI5A 4YKJA 1GGGA 1M5FA 5JTYB 1KWHA 1FQDA 3T66A 3V5AA 3K4UA 5I57B 4KR5A 4H6DA 5L8DA 1XHYA 4G8NA 3C33A 4LZ7A 1MRPA 1QW0A 4DDDA 2P0SA 1WDNA 4OWDA 1B5HA 4NF5A 3V8XB 3DP8A 3FGSA 2ALUA 4ZEFA 4G68B 3RGYA 2XXXA 2I6EA 3B6WA 4F18A 5I56A 1Y3NA 3OO9A 1LAHE 1O63A 4YKPA 4MF3A 4JBZA 3QUFA 5BUUA 3ZKKA 4U1ZA 1USYH 4KD5A 1SI1A 3VXCA 4LUBA 2XXVA 1PBPA 1DPEA 4I62A 1RYXA 5ICQA 3VLWA 1MXUA 1US5A 1IEJA 3R7XA 3E4RA 4C1UA 1AH5A 3GZGA 1N0TA 4DE8A 3VFJA 1B32A 3OEMA 2XXRA 4F39A 3SERA 4YB5A 2AL5A 5TP9A 3PPNA 4Q0CA 3CR9A 1A8EA 3PMXA 2KLFA 3OXNA 4PFWA 3PUZE 3O9PA 2XXTA 3KN7A 1O64A 2XXWA 4U23A 3SEYA 2QS3A 1D9VA 3TZAA 5A5XA 3HHGA 4G8HA 4ELOA 2D21A 4KYDA 2FNCA 2RCBA 4U21A 3ILUB 4PFUA 3C31A 4P11A 1M5DA 4OZ9A 3KZGA 1ZLQA 4TQUQ 3OELA 5B70A 4P0GA 1YPNA 1B0HA 3U1OA 3H3GA 3W9VA 1HSLA 4GL8A 3Q28A 4YU0A 3C36A 2HQ0A 4ELRA 3S2VA 2CZLA 1OQHA 4F3PA 4O3BA 3LC8A 3TQWA 1PB9A 2DVCA 2F7BA 2YJPA 4ZS9A 2XX8A 3KOSA 4GF8A 1MXWA 3CFXA 2ONKE 3G3IA 4GD5A 4ZE8A 3RT6B 1QVSA 3G3FA 3N6TA 2H25A 1UQWA 2B3FA 4PP0A 2Q89A 2Q2AA 3R26A 2O7UA 1XC1A 1UTBB 3HN0A 2Y84A 1M5CA 2Z8FA 3PPOA 4E0WA 4RK2A 1MY4A 3PD8A 1Y3QA 5K2XA 4ZECA 2HAVA 2RF1A 5H8QA 3H4ZA 5H8NB 4H8JA 3H03A 2NUVA 1A99A 3M3FA 3D4GA 4ELPA 4DXCA 2ONRA 3MZBA 2NWJA 4I8CA 4YMAA 4QF9A 2X7QA 2QS1A 3DM0A 3MJNA 3OSQA 4MFIA 3N5LA 2V25A 1B05A 3I3VA 3VVFA 3TQLA 2ZXTA 2PBWA 3F11A 5JTYA 3MP1A 4IO4A 3QYTA 2F97A 3SESA 1B0LA 4X1BA 4RY1A 2GHAA 1IITA 2QS4A 5I57A 5AA3A 1SVXB 2RC8A 4IGRA 3QK6A 1POY1 4U2RA 2H98A 1ZJLA 3VDFA 4EDPA 4IO7A 3I6VA 1P99A 5H8FA 3FXUA 4G68A 4F1VA 3MVYA 1MXZA 3IR1A 1P1OA 3RTWB 3UIFA 5HPQA 3FJGA 4XKQA 2IA4A 3IO6A 3LUYA 2Y7RA 3SETA 1CB6A 5EHMA 3E9XA 1Q1KA 1LAXA 2F34A 2G29A 1I69A 1SQYA 2GRVA 2R71A 5AA2A 1FTOA 1XOCA 5L9SA 1R6ZA 3FASA 4Q8RA 1MXVA 1EU8A 4MLQA 4EQ7A 4GXSB 3LSWA 3G3GA 3IB2A 3K2DA 4EXKA 2R9JA 3MZ1A 3FVNA 3SEVA 1QJMA 2D5WA 3Q25A 3IOWA 1A7LA 3IK6B 1J1NA 3MP8A 4XKNA 2GHBA 1B4ZA 1N84A 1PB8A 3PPRA 1ZTYA 2QRYA 1B52A 3RT8A 1PBQA 3PMWA 2A5TB 2HXWA 4FATA 1WODA 3M3LA 4KCCA 1FCKA 1T0KA 1R1NA 3TMGA 3CIJA 4LP2B 2Q9TA 2VD2A 2VOZA 1NKXA 1SW5A 4BDOA 3DELB 3MUQA 5FHMA 4QFNA 5FHNA 2ZMBA 2Z22A 1XS5A 3W9WA 2DWAA 1B9JA 1P1WA 4ESXA 2I58A 5I2NA 3TFLA 3K02A 4R2BA 4ND9A 4XKRA 3I5OA 3TDJA 4GXAA 1IXGA 1II5A 1GVCA 1H43A 2XD2A 3B6QA 2ZYKA 4NMYA 3RQTA 5CBSA 3O66A 1GV8A 5I59B 3S9LC 1MDQA 4F2OA 1POTA 5AA1A 3ZSFA 3T9VA 2DWIA 4O3AA 2Z23A 4F29A 3SKPA 4M4GA 3DP6A 1DPPA 4FIMA 4QFKA 1UTBA 2REJA 3ONMA 4IB2A 4R74A 1MY2A 1LBBA 3TTNA 5H8QB 3HPIA 4MBPA 1NL5A 5H8NA 2F7AA 3FIRA 4X48A 1Z7NE 4NF6A 4TLMB 1D3KA 4RXLA 3T93B 3MAMA 4HS7A 3G7WA 1QUIA 5DEXA 3K00A 3TPAA 4H5GA 3ZS6A 3G3HA 4NWCA 4XKPA 2QMWA 5CBRA 2Q2CA 4HTGA 4NF4B 4POXA 4I1DA 1BKAA 1D4NA 3UP9A 3MVZA 5DTBA 3C34A 4BDRA 4KCDA 1MQGA 2F8DA 4GQOA 3THIA 5EHSA 2Y7IA 1QUJA 4G77A 2HAUA 2DE4A 3K6WA 1B58A 1HSJA 2OWSA 1UTHA 4H0WA 4I9DA 5CMCA 3MVXA 2Z8EA 2O69A 1N04A 3H6TA 3VVEA 1H76A 5H8FB 3HCQA 3FZVA 1IXCA 2V3QA 5L9OA 1AL3A 2AL4A 3UN6A 5TU0A 2F78A 2PT2A 4DZ1A 2DVZA 3T22A 3G3JA 4NEDA 3KN8A 1Y1MA 3TTKA 4LZ8A 4TOZA 1MQJA 1SBPA 4U4XA 5AA2B 3T9UA 2P2AA 1TFDA 1LB8A 1FQEA 1NNTA 4ELQA 1B4HA 3TCGA 3QAXA 4X1DA 2HCAA 4JWYA 2H4IA 3GBBA 4H67A 2NXOA 1US4A
chains in the Genus database with same CATH superfamily
4QSEA 2O84X 3U92A 5I84A 2RC9A 3ROJA 3TEPA 1QGXA 3FUZA 4M1VA 3IB0A 2OX3A 1PEBA 4QSDA 3OSRA 1Y1ZA 2PCRA 3K1PA 1MXYA 4N15A 3EPEA 3BBRA 4ESWA 3IOVA 3MYUA 5L9MA 4PAIA 4F3GA 4L17A 1IXIA 1B40A 2A5TA 3S9MC 1JVXA 3MBPA 1MY3A 3K6XA 1DSNA 2DOJA 3GBAA 3HHFA 3KG2A 4OYVA 1OLCA 2XXHA 4N13A 5I58B 1K9ZA 1MQHA 2XA5A 1ZU0A 1EYKA 4UA8A 3S4UA 3OOAA 1YAEA 3HSTA 1S7YA 1LFHA 1B7HA 2GH9A 1B6HA 4WEPA 4OENA 4FJPA 4OANA 2F3BA 5I2NB 1LSTA 1ZBMA 2QVVA 1MS7A 3G3KA 1BP5A 2V3TA 1N3WA 4HXVA 4NF0A 2AIXA 3ZKLA 2M8CA 4U4SA 3OMBA 2B3BA 3OD7A 4DXBA 4MNPA 1OVTA 1FTLA 3E79A 3JV9A 4K3FA 2R8TA 3CRBA 5M2VA 1PC3A 2UVJA 4JVIA 5I59A 4ISUA 2R6GE 2UYEA 3FVGA 3MC2A 3N26A 4PFBA 4RA1A 5TPAB 3KC1A 4OERA 1JQFA 2F35A 4F3BA 1MPCA 2DSFA 4EQ9A 4RPNA 4OMBA 2THIA 4AQ4A 1MDP1 4FEBA 1D9YA 1VE4A 3L6HA 1EYIA 4JDFA 4R6HA 1N3XA 1FQAA 2P3NA 4C1TA 1PDAA 4NF6B 3RNNA 3C32A 4YB7A 3KC0A 5DEXB 3VLVA 5CC2A 2H9BA 5T3JA 1FPGA 3Q26A 1FQBA 2B65A 4P1EA 1H3DA 3VVDA 3EHUA 4BDMA 3OEKA 5EYGA 4R6YA 2PVUA 2O1LA 4O8MA 3ODBA 3M8UA 3EHTA 4WEDA 4R73A 3EQ1A 3SDFA 3KN3A 1MM6A 1URGA 4NF4A 5B7DA 4YZZA 2WBBA 3VE1B 5CMMA 4MJOA 5CMBA 4FE8A 3LSFB 2QSXA 3A29A 1XVXA 4XTCQ 4PFIA 5IAIA 1A55A 1JEVA 2DWJA 3D1RA 2CZKA 3H6UA 2DXYA 2UVHA 1SD3A 2XXIA 3PPQA 4H46A 1LB9A 1QKAA 3MP6A 4MEVA 4YAHX 5IZ3A 4E0XA 3O6IA 1UTHB 4FORA 3MSTA 1B7UA 2UYFA 5EQ7A 1NV4A 1VSOA 1JNFA 1LLSA 4KI0E 4OVTA 4LQ2A 1MH4A 5ET8A 2Q88A 2QS2A 4FEDA 1RYOA 1JW5A 3DLNA 1F9BA 3KJ7A 3FJ7A 3K1MA 3LSXA 3FV1A 5DVJA 4LZ5A 4RYAA 2ZZVA 3UORA 3JYRA 3B50A 4G8MA 4GX6A 1MY0A 4ONYA 3KBZA 1MM7A 4DI3D 1BTJA 4WXJA 5KCJA 1IMAA 3IAZA 3IOTA 3K0VA 2ZNSA 4BDLA 1B3LA 2V93A 2A5SA 2I48A 4IO3A 4KYSA 4MH5A 2NOOA 5EQ8A 4GL0A 3EF7A 2XXYA 3N6UA 4ZEIA 1YTVA 4OA4A 1Q35A 1I6AA 4JSOA 3BFTA 4DIGA 1OIBA 3ECRA 1LCTA 1URDA 4OFLA 4MMPA 1QUKA 4OVJA 1KA0A 3MZ9A 3UA8A 4QXDA 2ABHA 4OXVA 4MNCA 4ZEBA 1B46A 4G2ZA 4NF8B 5FTHA 4DCXA 1I6BA 3LBSA 3K6VA 3CFZA 3CSBA 3CSGA 2CMOA 4RPOA 1MXXA 5AE4A 4F1UA 4XXUA 3GLBA 2XHDA 3U72A 4GFRA 1EYJA 3KJTA 2HEUA 1FW0A 5I58A 2PX1A 4QHQA 2I4BA 3A09A 1NNFA 1ZKBA 2RINA 3IJOB 4R9GA 4IY6A 3TTMA 2BJJX 1UIVA 3TYHA 4JXIA 3Q29A 2Y7PA 4TLLB 2ZYNA 4ZZAA 4QFLA 1FSAA 1JW4A 1R9QA 3RTFB 3RY3A 2OCUA 4Q30B 1ZIUA 4WKMA 1IMFA 3H6VA 4QFOA 1OLAA 1CE2A 4NTLA 2W7YA 2PYYA 5BWJA 3TODA 3E78A 5IZ1A 4X04A 1UIUA 1MY1A 1XVYA 3UK4A 5DVIA 2F6GA 1SYIA 2VHAA 1A8FA 3CG3A 2ZNUA 4LQ5A 4OESA 4GBWA 5TPAA 2O1MA 2ANJA 4P9KA 1I6QA 2I0BA 1P1NA 5ITOA 4MLVA 4ZDMA 3VXBA 1INPA 3KOTA 4N07A 3USDA 3FV2A 1OMPA 4JB7A 4GRKA 2F7CA 2OK2A 4EQBA 3JZJA 1EH3A 3HO7A 1IQ7A 1FRPA 2E0SA 4F3SA 3OO7A 4OFOA 2X26A 1PB7A 1QKBA 4EF1A 1AOVA 2WKYA 3FVKA 2DXRA 2KR0A 1DTGA 3ILTB 4Z0IA 1G0IA 4GWWA 2QFLA 2XWVA 3TELA 3CI8A 4LN5A 1DOTA 4HW8A 2DP8A 3MPLA 3M3KA 5H8HA 5FTIA 4PAFA 3Q27A 5JEIA 4Z7EA 3PUYE 2XX9A 4N6PA 4HE0A 1SW1A 5F7VA 5IGAA 3MQ9A 2HXRA 4RJZA 4RNSA 4BDQA 3PPPA 3OO8A 3TTRA 4BLAA 1EZPA 2XXUA 2V84A 4YKIA 2I49A 1ELJA 1N7WA 3PMVA 4R2FA 1FBCA 2QMXA 5CRYA 2YLNA 1IZ1A 3C35A 1XT8A 3C4MA 4H8IA 1URSA 3KGCA 1B3GA 1P1UA 1LGBC 3CVGA 3RPLB 2ZYOA 1M5EA 4AB5A 2QJEA 2WX9A 1GR2A 1FPKA 4JWXA 2XD3A 4R9FA 1TXFA 3U94A 4NWDA 5I2KB 4PCDA 5HM4B 5KCJB 3IORA 5HBCA 2RKMA 4H5FA 2GQ1A 3UGWA 4LONB 2Y7KA 3RYDA 4X9TA 4GX3A 5J1DA 3BKIB 1Y4TA 2VD3A 4AS5A 4QRZA 3B7DA 1NMUA 3A3CA 2PT1A 3QSLA 1B2HA 4OEUA 4QSCA 4XIGQ 1FBFA 4ZE9A 4N6KA 3KSJA 2VP1A 4IO2A 3MW0A 1YYZA 3K1NA 2XXQA 1A40A 4U1OA 5ISUA 3CHGA 4NF8A 1NFTA 2DE2A 1B5IA 4MIJA 4YKKA 1FPIA 4OTEA 4P3LA 3U8QA 1NV6A 4ECFA 2HZKA 4P1LA 5DYHA 1FPDA 1L5TA 4FAJA 2V4CA 2LAOA 2Q8MA 4F22A 4LATA 4GLIA 2FYIA 3FATA 1NV1A 4JWOA 1SDXA 4LVQA 5AA4A 1FJ9A 3KEIA 4IGTA 2NVUB 4OQOA 5ITPA 4HE2A 4POWA 4C0RA 2E1SA 4GVOA 1B5JA 3TKDA 3QMFA 3IB1A 3S9NC 3MVWA 4I3YA 4F1YA 1B3EA 1USYE 2UXAA 3RUMA 3IO4A 4KYEA 1M5BA 3L6GA 3KFMA 3BFUA 2O68A 4G4PA 1EZ9A 3O6GA 1OQGA 2F36A 2QPQA 4EXLA 2OBGA 2XX7A 2I3WA 4OVRA 1MQIA 3T96B 4KHZE 4AB6A 4N6DA 4OETA 5DT6A 4RK9A 3H7MA 4UACA 4KQPA 1R9LA 1DMBA 3T1BA 4F19A 4EF2A 1LBZA 4N8YA 1NNPA 2HZLA 4OFJA 5CMKA 4ZEKA 3IX1A 2CEXA 4PGPA 4NX1A 5KDTB 4DI4B 3IFCA 3VV5A 3OENA 1ATGA 3A3UA 1FPEA 3E3KA 3TUSA 4MAGA 3PUVE 4H1XA 3RPWA 3OO6A 3FJMA 2OZZA 1B1HA 1B3HA 1NV2A 4EUOA 4NAPA 2FIXA 2FA7A 4PBHA 1FBDA 3WAFA 4IY5A 5AA2D 2I0CA 3RLFE 1TWYA 4P0IA 1FQFA 3K6UA 2YPNA 2ZYMA 2UVGA 4KFQA 2VT5A 3PUXE 2REGA 3B6TA 1Y20A 1O7TA 5ELVA 5K2YA 1B3FA 4HCYA 1SW4A 5H8HB 1FPFA 5IKBA 1LAGE 4PQJA 1N76A 4R72A 1LFIA 5KZTA 1SPIA 3FXQA 3T9HB 2RCAA 5IM2A 4UABA 1JW1A 1LCFA 1S50A 2DYXA 1P1QA 1AIVA 1IMEA 3MWBA 3U93A 1MPBA 3T9XB 5I5PA 2PMSA 1MH3A 2PFYA 3V83A 2DWHA 1H44A 4FECA 2BJIA 4OVQA 3TCHA 1IXHA 1OVBA 4IO6A 4IR8A 4NHBA 1HSEA 1MG1A 3RPLA 3IL1B 3IJXB 1EZOA 1VFEA 3LSLA 3LUZA 4YICA 3H06B 5F1QA 4BDNA 4P8BA 4NF5B 3V89B 3O29A 2QVRA 3HV1A 2Y7WA 1LBXA 4LA9A 5I2KA 1VR5A 5I56B 4PFYA 4O7IA 4QBAA 4F31B 4GOTA 1Y9UA 3O2AA 4MNIA 5H8SA 1LBYA 1Y4CA 3AXFA 1Q9DA 4NE4A 3BIHA 4Q5TA 3R6UA 2O6AA 3FVOA 3SZPA 2H5YA 5ET7A 5LDZA 5LOMA 1Z7ME 3FD3A 3PGFA 3QIMA 2DS9A 4OEVA 1H45A 1FQCA 3K01A 1WVJA 4THIA 3E13X 4DLDA 5F24A 4ZZEA 1LEVA 1BLFA 2ZZWA 3QXMA 5TP9B 1LAFE 2I3VA 3SEWA 1JVYA 1NH8A 1ZMGA 4NQ8A 3VLUA 2Q8JA 4OHNA 2QL3A 3QUJA 4I3EA 2G93A 2UVIA 4KPTA 4AS4A 1LFGA 1RDYA 2OLBA 2ESNA 5FHOA 1TT1A 1A54A 5A5XB 2O7IA 3KSXA 1YXIA 2DE3A 5AA4B 2F5XA 2X7PA 3SEXA 1BIYA 1AMFA 4U22A 1JP4A 1Y3PA 1VDWA 1NUZA 1FBHA 3ISPA 1LBCA 1B51A 1G0HA 2I4CA 3DP4A 3KBRA 4R75A 5CM6A 3B8BA 2Z8DA 2OWTA 1IUDA 3PU5A 3FXRA 1LBWA 1NV7A 3LR1A 3U65A 1RKMA 2XXPA 2CEYA 3N94A 2V3UA 2AYSA 1TFAA 3TAJA 4PC9A 3WAEA 3D4CA 3CG1A 2ONSA 1NH7A 5JK4A 4DCYA 4F2QA 3C9HA 3PV0E 3PD9A 3EN3A 1JEUA 1DTZA 3TTLA 4JSDA 2P1SA 1DCUA 1B7ZA 2GFEA 2H99A 3H6WA 1FTJA 4PETA 5KDTA 1N7XA 5FBPA 2PFZA 2XXKA 3EKIA 3IFAA 2RC7A 3S9EA 2WYPA 1SYHA 4GWOA 1GTKA 2VGQA 4PBQA 3EHSA 1XI6A 2DDKA 3P7IA 1BK4A 2CZIA 4HCWA 3PUWE 4YB6A 5EYHA 4O3CA 4QFPA 1FTKA 1NI9A 1NNKA 4DXUA 1FTMA 4G68C 3CFLA 1QULA 2KQZA 5ET5A 3GXAA 4IO5A 3BIGA 4GWXA 3W15C 3IOUA 1IIWA 2FVZA 3TCFA 4FBPA 3O97A 4ZEDA 4MCOA 2DQVA 1MQDA 1SI0A 4JVCA 3O6HA 4GIZA 1SW2A 4PE5B 1ANFA 2ZNTA 4PFTA 5ICTA 1JETA 1MPDA 1YCJA 2MKZA 4R6KA 1S9TA 4H65A 3RN8A 2F6PA 2IEEA 2OJTA 2QVUA 3MPKA 3SEUA 3O28A 2Y5KA 5DVFA 2HFBA 5EYFA 4YMBA 1B1XA 4PE3A 2D3IA 1VFDA 2O51A 5CI5A 4YKJA 1GGGA 1M5FA 5JTYB 1KWHA 2FHYA 1FQDA 3T66A 2B4LA 1AWBA 3V5AA 3K4UA 1NUWA 5I57B 1K9YA 4KR5A 2L5VA 4H6DA 5L8DA 1XHYA 4G8NA 3C33A 4LZ7A 1MRPA 1QW0A 5DW8A 4DDDA 2P0SA 1WDNA 3LV0A 4OWDA 1B5HA 4NF5A 3V8XB 3DP8A 3FGSA 2ALUA 4ZEFA 4G68B 3RGYA 2XXXA 2I6EA 3B6WA 4F18A 5I56A 1Y3NA 3OO9A 1LAHE 1O63A 1FBEA 4YKPA 4MF3A 4JBZA 3QUFA 4O7MA 5BUUA 3ZKKA 4U1ZA 1USYH 2B4MA 4KD5A 1SI1A 3VXCA 4LUBA 2XXVA 1PBPA 1DPEA 4I62A 1RYXA 2Q74A 4PFRA 5ICQA 3VLWA 1MXUA 1US5A 1IEJA 3R7XA 3E4RA 4C1UA 1AH5A 3GZGA 4PDHA 1N0TA 4GBVA 4DE8A 3VFJA 1B32A 3OEMA 2XXRA 4F39A 3SERA 4YB5A 1IMDA 4N81A 2AL5A 4N8GA 5TP9A 4N91A 4KXPA 3PPNA 4Q0CA 3CR9A 1A8EA 3PMXA 2KLFA 1D9QA 3OXNA 4JVDA 4PFWA 2WYKA 3PUZE 3O9PA 2XXTA 3KN7A 1FJ6A 1O64A 2XXWA 1NUYA 4U23A 3SEYA 2QS3A 4MHFA 5LTCA 1D9VA 3TZAA 5A5XA 3HHGA 4G8HA 4ELOA 2D21A 4KYDA 2FNCA 2RCBA 2WBDA 2VPOA 4U21A 3ILUB 4PFUA 3C31A 5J16A 4P11A 1M5DA 4XF5A 4OZ9A 3KZGA 1ZLQA 4TQUQ 3OELA 5B70A 1CNQA 4P0GA 1YPNA 1B0HA 3U1OA 3H3GA 3W9VA 1HSLA 4GL8A 3Q28A 4YU0A 3C36A 4GWYA 2HQ0A 4ELRA 3S2VA 2CZLA 1OQHA 1FBGA 4F3PA 4O3BA 3LC8A 3TQWA 1PB9A 2DVCA 4GWZA 2F7BA 2YJPA 1LBVA 1DBZA 4ZS9A 3FXBA 2XX8A 4XEQA 4OVSA 3KOSA 4GF8A 1MXWA 3CFXA 2ONKE 4P47A 3G3IA 4GD5A 4NG7A 4ZE8A 1KA1A 1IMBA 3RT6B 1QVSA 3G3FA 3N6TA 2H25A 1UQWA 2B3FA 4PP0A 2Q89A 2Q2AA 4PF8A 5EQ9A 3R26A 2O7UA 1XC1A 1UTBB 3FBPA 3HN0A 2Y84A 2HPGA 1M5CA 2Z8FA 3PPOA 4E0WA 4RK2A 1MY4A 5A5LA 3PD8A 1Y3QA 5K2XA 4ZECA 4GWSA 2HAVA 2RF1A 5H8QA 3H4ZA 5H8NB 4H8JA 3H03A 3GYYA 2NUVA 4PDDA 1A99A 3M3FA 3D4GA 4ELPA 4DXCA 2ONRA 4PF6A 3MZBA 2NWJA 4I8CA 4YMAA 4HE1A 2Y5LA 5I3SA 4QF9A 2X7QA 1FTAA 2QS1A 1NV3A 3DM0A 3MJNA 2FBPA 3OSQA 4MFIA 4O94A 3N5LA 2V25A 1B05A 3I3VA 3VVFA 3TQLA 2ZXTA 1NV5A 2PBWA 3F11A 1FPBA 5JTYA 3MP1A 4IO4A 3QYTA 2F97A 3SESA 1B0LA 4X1BA 4RY1A 5EQAA 2GHAA 1IITA 2QS4A 5I57A 5AA3A 1SVXB 2RC8A 4IGRA 4GWUA 3QK6A 2VPNA 1POY1 4U2RA 2H98A 4OVPA 1ZJLA 3VDFA 4EDPA 2XWIA 4IO7A 2F3DA 3I6VA 1P99A 5H8FA 3FXUA 4G68A 4F1VA 3MVYA 4H45A 1MXZA 3IR1A 1P1OA 3RTWB 3UIFA 5HPQA 3FJGA 4XKQA 2IA4A 3IO6A 3LUYA 2Y7RA 3SETA 1CB6A 5EHMA 3E9XA 1Q1KA 1LAXA 2F34A 2G29A 1I69A 4N17A 1SQYA 2GRVA 2R71A 3NOHA 5AA2A 1FTOA 1XOCA 5L9SA 1R6ZA 1IMCA 3FASA 4Q8RA 1MXVA 1EU8A 4MLQA 4EQ7A 4GXSB 3LSWA 3G3GA 3IB2A 3K2DA 5IZZA 4EXKA 2R9JA 3MZ1A 1RDXA 3FVNA 3SEVA 1QJMA 2D5WA 3Q25A 3HFUA 3IOWA 1A7LA 3IK6B 1KZ8A 1J1NA 3MP8A 2WEFA 4XKNA 2GHBA 1B4ZA 1N84A 1PB8A 3PPRA 1ZTYA 2QRYA 5ESYA 1B52A 1YZ0A 3RT8A 1PBQA 2HHMA 4NN3A 3PMWA 4G61A 2A5TB 2HXWA 4FATA 1WODA 3M3LA 4KCCA 1FCKA 1T0KA 1R1NA 3TMGA 3CIJA 4LP2B 1NUXA 2Q9TA 2VD2A 2VOZA 1NKXA 1SW5A 2XWOA 4BDOA 3DELB 4PAKA 3MUQA 4X8RA 2P3VA 5FHMA 4QFNA 5FHNA 2ZMBA 2Z22A 1XS5A 4MX6A 3W9WA 2DWAA 1FPJA 1B9JA 1FPLA 1P1WA 4N4UA 4ESXA 2I58A 5I2NA 3TFLA 3K02A 1FBPA 4R2BA 4ND9A 4XKRA 3I5OA 5I7IA 3TDJA 4GXAA 1IXGA 1II5A 1GVCA 2FIEA 1H43A 2CZHA 2XD2A 3B6QA 2ZYKA 4NMYA 3RQTA 5CBSA 3O66A 1GV8A 5I59B 3S9LC 1MDQA 4F2OA 3PTYA 2ZZXA 1NV0A 1POTA 5AA1A 3ZSFA 3T9VA 2DWIA 4O3AA 2Z23A 4F29A 3SKPA 4M4GA 3DP6A 1DPPA 4FIMA 4GX4A 1DK4A 4QFKA 1UTBA 2REJA 3T0JA 3ONMA 4IB2A 4R74A 1MY2A 1LBBA 3TTNA 5H8QB 3HPIA 4MBPA 1NL5A 5H8NA 2F7AA 3FIRA 4X48A 1Z7NE 4NF6A 4TLMB 1D3KA 4RXLA 3T93B 3MAMA 4HS7A 3G7WA 1QUIA 5DEXA 3K00A 3TPAA 4H5GA 3ZS6A 3G3HA 4NWCA 4XKPA 2QMWA 4I40A 5CBRA 2Q2CA 5ET6A 4HTGA 4NF4B 4POXA 4I1DA 1BKAA 1D4NA 3UP9A 3MVZA 5DTBA 3C34A 4BDRA 4KCDA 1MQGA 2F8DA 4XFEA 4GQOA 3THIA 5EHSA 2Y7IA 1QUJA 4G77A 2HAUA 2DE4A 1RDZA 3K6WA 1B58A 1HSJA 5IZ3B 2OWSA 1UTHA 4H0WA 4I9DA 5CMCA 3MVXA 4P56A 2Z8EA 2O69A 1N04A 3H6TA 3VVEA 1H76A 5H8FB 3HCQA 3FZVA 1IXCA 2V3QA 5L9OA 1AL3A 2AL4A 2XWKA 3UN6A 5TU0A 2F78A 2PT2A 4DZ1A 2DVZA 3T22A 3G3JA 4NEDA 3KN8A 1Y1MA 3TTKA 4LZ8A 4TOZA 1MQJA 1SBPA 4U4XA 5AA2B 4NGUA 2OWZA 3T9UA 2P2AA 1TFDA 4PTKA 1LB8A 1FQEA 1NNTA 2JJKA 4ELQA 1B4HA 4PGNA 3TCGA 3QAXA 4X1DA 2HCAA 4JWYA 2H4IA 3GBBA 4H67A 2NXOA 1US4A
chains in the Genus database with same CATH topology
4QSEA 2O84X 3U92A 5I84A 2RC9A 3TEPA 3FUZA 4M1VA 3IB0A 1PEBA 4QSDA 3OSRA 1Y1ZA 3K1PA 1MXYA 3EPEA 3BBRA 4ESWA 3IOVA 5L9MA 4F3GA 4L17A 1IXIA 1B40A 2A5TA 3S9MC 1JVXA 3MBPA 1MY3A 3K6XA 1DSNA 2DOJA 3GBAA 3HHFA 3KG2A 4OYVA 1OLCA 2XXHA 4N13A 5I58B 4UA8A 1MQHA 1ZU0A 3S4UA 3OOAA 1YAEA 3HSTA 1S7YA 1LFHA 1B7HA 2GH9A 1B6HA 4WEPA 4OENA 4FJPA 5I2NB 1LSTA 1ZBMA 1MS7A 3G3KA 1BP5A 2V3TA 1N3WA 2AIXA 3ZKLA 2M8CA 4U4SA 3OMBA 2B3BA 3OD7A 4DXBA 1OVTA 1FTLA 3JV9A 4K3FA 3CRBA 5M2VA 1PC3A 2UVJA 5I59A 4ISUA 2R6GE 2UYEA 3FVGA 3MC2A 3N26A 4RA1A 5TPAB 4OERA 1JQFA 2F35A 4F3BA 1MPCA 2DSFA 4EQ9A 4RPNA 4OMBA 2THIA 4AQ4A 1MDP1 4FEBA 1D9YA 1VE4A 3L6HA 4JDFA 4R6HA 1N3XA 1FQAA 4C1TA 1PDAA 4NF6B 3RNNA 3C32A 4YB7A 5DEXB 3VLVA 5CC2A 2H9BA 3Q26A 1FQBA 2B65A 1H3DA 3VVDA 3EHUA 4BDMA 3OEKA 4R6YA 2PVUA 2O1LA 3ODBA 3M8UA 3EHTA 4WEDA 4R73A 3EQ1A 3SDFA 3KN3A 1MM6A 1URGA 4NF4A 5B7DA 4YZZA 3VE1B 5CMMA 5CMBA 4FE8A 3LSFB 2QSXA 1XVXA 4XTCQ 5IAIA 1A55A 1JEVA 2DWJA 3H6UA 2DXYA 2UVHA 1SD3A 2XXIA 3PPQA 1LB9A 1QKAA 3MP6A 4YAHX 4E0XA 3O6IA 1UTHB 4FORA 1B7UA 2UYFA 1VSOA 1JNFA 1LLSA 4KI0E 4LQ2A 1MH4A 2Q88A 2QS2A 4FEDA 1RYOA 1JW5A 3DLNA 1F9BA 3KJ7A 3FJ7A 3K1MA 3LSXA 3FV1A 5DVJA 4LZ5A 4RYAA 3UORA 3JYRA 4G8MA 1MY0A 4ONYA 1MM7A 1BTJA 4WXJA 5KCJA 3IAZA 3IOTA 3K0VA 2ZNSA 4BDLA 1B3LA 2V93A 2A5SA 2I48A 4IO3A 4KYSA 4MH5A 2NOOA 4GL0A 3EF7A 2XXYA 3N6UA 4ZEIA 1YTVA 1Q35A 1I6AA 4JSOA 3BFTA 4DIGA 1OIBA 3ECRA 1LCTA 1URDA 4OFLA 1QUKA 4OVJA 3MZ9A 3UA8A 2ABHA 4OXVA 4ZEBA 1B46A 4G2ZA 4NF8B 5FTHA 4DCXA 1I6BA 3LBSA 3K6VA 3CFZA 3CSBA 3CSGA 2CMOA 4RPOA 1MXXA 5AE4A 4F1UA 4XXUA 3GLBA 2XHDA 3U72A 4GFRA 5I58A 3KJTA 2HEUA 1FW0A 2PX1A 4QHQA 2I4BA 3A09A 1NNFA 1ZKBA 2RINA 3IJOB 4R9GA 4IY6A 3TTMA 2BJJX 1UIVA 3TYHA 4JXIA 3Q29A 2Y7PA 4TLLB 2ZYNA 4ZZAA 4QFLA 1JW4A 1R9QA 3RTFB 3RY3A 2OCUA 4Q30B 1ZIUA 4WKMA 3H6VA 4QFOA 1OLAA 1CE2A 4NTLA 2W7YA 2PYYA 5BWJA 3TODA 1UIUA 1MY1A 1XVYA 3UK4A 5DVIA 2F6GA 1SYIA 2VHAA 1A8FA 3CG3A 2ZNUA 4LQ5A 4OESA 5TPAA 2O1MA 2ANJA 1I6QA 2I0BA 1P1NA 5ITOA 4MLVA 4ZDMA 3VXBA 3KOTA 4N07A 3USDA 3FV2A 1OMPA 4JB7A 4GRKA 2F7CA 2OK2A 4EQBA 3JZJA 1EH3A 3HO7A 1IQ7A 2E0SA 4F3SA 3OO7A 4OFOA 2X26A 1PB7A 1QKBA 4EF1A 1AOVA 2WKYA 3FVKA 2DXRA 1DTGA 3ILTB 4Z0IA 3TELA 3CI8A 1DOTA 4HW8A 2DP8A 3MPLA 3M3KA 5H8HA 5FTIA 3Q27A 5JEIA 4Z7EA 3PUYE 2XX9A 4N6PA 1SW1A 5F7VA 3MQ9A 4RJZA 4RNSA 4BDQA 3PPPA 3OO8A 3TTRA 4BLAA 1EZPA 2XXUA 2V84A 4YKIA 2I49A 1ELJA 1N7WA 3PMVA 4R2FA 5CRYA 2QMXA 2YLNA 1IZ1A 3C35A 1XT8A 3C4MA 4H8IA 1URSA 3KGCA 1B3GA 1P1UA 1LGBC 3CVGA 2ZYOA 1M5EA 4AB5A 2QJEA 1GR2A 4JWXA 2XD3A 4R9FA 1TXFA 3U94A 4NWDA 5I2KB 5HM4B 5KCJB 3IORA 5HBCA 2RKMA 4H5FA 3UGWA 4LONB 2Y7KA 4X9TA 5J1DA 3BKIB 1Y4TA 2VD3A 4QRZA 3B7DA 1NMUA 3A3CA 2PT1A 3QSLA 1B2HA 4OEUA 4QSCA 4XIGQ 4ZE9A 3KSJA 2VP1A 4IO2A 3MW0A 3K1NA 2XXQA 1A40A 4U1OA 5ISUA 4NF8A 1NFTA 2DE2A 1B5IA 4YKKA 4OTEA 3U8QA 4ECFA 2HZKA 5DYHA 1L5TA 4FAJA 2LAOA 4F22A 4LATA 4GLIA 2FYIA 3FATA 4JWOA 1SDXA 4LVQA 5AA4A 3KEIA 4IGTA 2NVUB 4OQOA 5ITPA 4POWA 4C0RA 2E1SA 4GVOA 1B5JA 3TKDA 3IB1A 3S9NC 3MVWA 4F1YA 1B3EA 1USYE 2UXAA 3RUMA 3IO4A 4KYEA 1M5BA 3L6GA 3KFMA 3BFUA 2O68A 4G4PA 1EZ9A 3O6GA 1OQGA 2F36A 2QPQA 4EXLA 2OBGA 2XX7A 2I3WA 1MQIA 3T96B 4KHZE 4AB6A 4OETA 5DT6A 4RK9A 3H7MA 4UACA 4KQPA 1R9LA 1DMBA 4F19A 4EF2A 1NNPA 2HZLA 4OFJA 5CMKA 4ZEKA 3IX1A 5KDTB 3VV5A 3OENA 1ATGA 3A3UA 3E3KA 3TUSA 3PUVE 4H1XA 3RPWA 3OO6A 3FJMA 2OZZA 1B1HA 1B3HA 4EUOA 2FA7A 3WAFA 4IY5A 5AA2D 2I0CA 3RLFE 1TWYA 4P0IA 1FQFA 3K6UA 2YPNA 2ZYMA 2UVGA 4KFQA 3PUXE 2REGA 3B6TA 1Y20A 1O7TA 5ELVA 5K2YA 1B3FA 4HCYA 1SW4A 5H8HB 5IKBA 1LAGE 4PQJA 1N76A 4R72A 1LFIA 5KZTA 3FXQA 3T9HB 2RCAA 1JW1A 1LCFA 1S50A 2DYXA 1P1QA 1AIVA 3MWBA 3U93A 1MPBA 3T9XB 2PMSA 1MH3A 3V83A 2DWHA 1H44A 4FECA 3TCHA 1IXHA 1OVBA 4IO6A 1HSEA 1MG1A 3IL1B 3IJXB 1EZOA 1VFEA 3LSLA 4YICA 3H06B 5F1QA 4BDNA 4NF5B 3V89B 3O29A 3HV1A 2Y7WA 4LA9A 5I2KA 1VR5A 5I56B 4PFYA 4F31B 4GOTA 1Y9UA 3O2AA 5H8SA 1Y4CA 3AXFA 4NE4A 4Q5TA 3R6UA 2O6AA 3FVOA 2H5YA 5LOMA 1Z7ME 3FD3A 3PGFA 3QIMA 2DS9A 4OEVA 1H45A 1FQCA 3K01A 1WVJA 4THIA 3E13X 4DLDA 4ZZEA 1BLFA 3QXMA 5TP9B 1LAFE 2I3VA 3SEWA 1JVYA 1NH8A 1ZMGA 3VLUA 2Q8JA 4OHNA 2QL3A 3QUJA 2G93A 2UVIA 4KPTA 1LFGA 2OLBA 2ESNA 5FHOA 1TT1A 1A54A 5A5XB 2O7IA 3KSXA 2DE3A 5AA4B 2F5XA 3SEXA 2X7PA 1BIYA 1AMFA 4U22A 1Y3PA 1LBCA 1B51A 2I4CA 3DP4A 3KBRA 4R75A 5CM6A 2Z8DA 2OWTA 1IUDA 3PU5A 3FXRA 3LR1A 1RKMA 2XXPA 3N94A 2V3UA 2AYSA 1TFAA 3TAJA 3WAEA 3D4CA 3CG1A 2ONSA 1NH7A 5JK4A 4DCYA 4F2QA 3C9HA 3PV0E 3PD9A 3EN3A 1JEUA 1DTZA 3TTLA 4JSDA 2P1SA 1B7ZA 2GFEA 2H99A 3H6WA 1FTJA 4PETA 5KDTA 1N7XA 2RC7A 3S9EA 1SYHA 4GWOA 1GTKA 2VGQA 3EHSA 3P7IA 4HCWA 3PUWE 4YB6A 4O3CA 4QFPA 1FTKA 1NNKA 4DXUA 1FTMA 4G68C 3CFLA 1QULA 3GXAA 4IO5A 3W15C 3IOUA 1IIWA 3TCFA 3O97A 4ZEDA 2DQVA 1MQDA 1SI0A 3O6HA 4GIZA 1SW2A 4PE5B 1ANFA 2ZNTA 4PFTA 5ICTA 1JETA 1MPDA 1YCJA 4R6KA 1S9TA 4H65A 3RN8A 2F6PA 2IEEA 2OJTA 3MPKA 3SEUA 3O28A 4YMBA 5DVFA 2HFBA 5EYFA 1B1XA 2D3IA 1VFDA 2O51A 5CI5A 4YKJA 1GGGA 1M5FA 5JTYB 1KWHA 1FQDA 3T66A 3V5AA 3K4UA 5I57B 4KR5A 4H6DA 5L8DA 1XHYA 4G8NA 3C33A 4LZ7A 1MRPA 1QW0A 4DDDA 2P0SA 1WDNA 4OWDA 1B5HA 4NF5A 3V8XB 3DP8A 3FGSA 2ALUA 4ZEFA 4G68B 3RGYA 2XXXA 2I6EA 3B6WA 4F18A 5I56A 1Y3NA 3OO9A 1LAHE 1O63A 4YKPA 4MF3A 4JBZA 3QUFA 5BUUA 3ZKKA 4U1ZA 1USYH 4KD5A 1SI1A 3VXCA 4LUBA 2XXVA 1PBPA 1DPEA 4I62A 1RYXA 5ICQA 3VLWA 1MXUA 1US5A 1IEJA 3R7XA 3E4RA 4C1UA 1AH5A 3GZGA 1N0TA 4DE8A 3VFJA 1B32A 3OEMA 2XXRA 4F39A 3SERA 4YB5A 2AL5A 5TP9A 3PPNA 4Q0CA 3CR9A 1A8EA 3PMXA 2KLFA 3OXNA 4PFWA 3PUZE 3O9PA 2XXTA 3KN7A 1O64A 2XXWA 4U23A 3SEYA 2QS3A 1D9VA 3TZAA 5A5XA 3HHGA 4G8HA 4ELOA 2D21A 4KYDA 2FNCA 2RCBA 4U21A 3ILUB 4PFUA 3C31A 4P11A 1M5DA 4OZ9A 3KZGA 1ZLQA 4TQUQ 3OELA 5B70A 4P0GA 1YPNA 1B0HA 3U1OA 3H3GA 3W9VA 1HSLA 4GL8A 3Q28A 4YU0A 3C36A 2HQ0A 4ELRA 3S2VA 2CZLA 1OQHA 4F3PA 4O3BA 3LC8A 3TQWA 1PB9A 2DVCA 2F7BA 2YJPA 4ZS9A 2XX8A 3KOSA 4GF8A 1MXWA 3CFXA 2ONKE 3G3IA 4GD5A 4ZE8A 3RT6B 1QVSA 3G3FA 3N6TA 2H25A 1UQWA 2B3FA 4PP0A 2Q89A 2Q2AA 3R26A 2O7UA 1XC1A 1UTBB 3HN0A 2Y84A 1M5CA 2Z8FA 3PPOA 4E0WA 4RK2A 1MY4A 3PD8A 1Y3QA 5K2XA 4ZECA 2HAVA 2RF1A 5H8QA 3H4ZA 5H8NB 4H8JA 3H03A 2NUVA 1A99A 3M3FA 3D4GA 4ELPA 4DXCA 2ONRA 3MZBA 2NWJA 4I8CA 4YMAA 4QF9A 2X7QA 2QS1A 3DM0A 3MJNA 3OSQA 4MFIA 3N5LA 2V25A 1B05A 3I3VA 3VVFA 3TQLA 2ZXTA 2PBWA 3F11A 5JTYA 3MP1A 4IO4A 3QYTA 2F97A 3SESA 1B0LA 4X1BA 4RY1A 2GHAA 1IITA 2QS4A 5I57A 5AA3A 1SVXB 2RC8A 4IGRA 3QK6A 1POY1 4U2RA 2H98A 1ZJLA 3VDFA 4EDPA 4IO7A 3I6VA 1P99A 5H8FA 3FXUA 4G68A 4F1VA 3MVYA 1MXZA 3IR1A 1P1OA 3RTWB 3UIFA 5HPQA 3FJGA 4XKQA 2IA4A 3IO6A 3LUYA 2Y7RA 3SETA 1CB6A 5EHMA 3E9XA 1Q1KA 1LAXA 2F34A 2G29A 1I69A 1SQYA 2GRVA 2R71A 5AA2A 1FTOA 1XOCA 5L9SA 1R6ZA 3FASA 4Q8RA 1MXVA 1EU8A 4MLQA 4EQ7A 4GXSB 3LSWA 3G3GA 3IB2A 3K2DA 4EXKA 2R9JA 3MZ1A 3FVNA 3SEVA 1QJMA 2D5WA 3Q25A 3IOWA 1A7LA 3IK6B 1J1NA 3MP8A 4XKNA 2GHBA 1B4ZA 1N84A 1PB8A 3PPRA 1ZTYA 2QRYA 1B52A 3RT8A 1PBQA 3PMWA 2A5TB 2HXWA 4FATA 1WODA 3M3LA 4KCCA 1FCKA 1T0KA 1R1NA 3TMGA 3CIJA 4LP2B 2Q9TA 2VD2A 2VOZA 1NKXA 1SW5A 4BDOA 3DELB 3MUQA 5FHMA 4QFNA 5FHNA 2ZMBA 2Z22A 1XS5A 3W9WA 2DWAA 1B9JA 1P1WA 4ESXA 2I58A 5I2NA 3TFLA 3K02A 4R2BA 4ND9A 4XKRA 3I5OA 3TDJA 4GXAA 1IXGA 1II5A 1GVCA 1H43A 2XD2A 3B6QA 2ZYKA 4NMYA 3RQTA 5CBSA 3O66A 1GV8A 5I59B 3S9LC 1MDQA 4F2OA 1POTA 5AA1A 3ZSFA 3T9VA 2DWIA 4O3AA 2Z23A 4F29A 3SKPA 4M4GA 3DP6A 1DPPA 4FIMA 4QFKA 1UTBA 2REJA 3ONMA 4IB2A 4R74A 1MY2A 1LBBA 3TTNA 5H8QB 3HPIA 4MBPA 1NL5A 5H8NA 2F7AA 3FIRA 4X48A 1Z7NE 4NF6A 4TLMB 1D3KA 4RXLA 3T93B 3MAMA 4HS7A 3G7WA 1QUIA 5DEXA 3K00A 3TPAA 4H5GA 3ZS6A 3G3HA 4NWCA 4XKPA 2QMWA 5CBRA 2Q2CA 4HTGA 4NF4B 4POXA 4I1DA 1BKAA 1D4NA 3UP9A 3MVZA 5DTBA 3C34A 4BDRA 4KCDA 1MQGA 2F8DA 4GQOA 3THIA 5EHSA 2Y7IA 1QUJA 4G77A 2HAUA 2DE4A 3K6WA 1B58A 1HSJA 2OWSA 1UTHA 4H0WA 4I9DA 5CMCA 3MVXA 2Z8EA 2O69A 1N04A 3H6TA 3VVEA 1H76A 5H8FB 3HCQA 3FZVA 1IXCA 2V3QA 5L9OA 1AL3A 2AL4A 3UN6A 5TU0A 2F78A 2PT2A 4DZ1A 2DVZA 3T22A 3G3JA 4NEDA 3KN8A 1Y1MA 3TTKA 4LZ8A 4TOZA 1MQJA 1SBPA 4U4XA 5AA2B 3T9UA 2P2AA 1TFDA 1LB8A 1FQEA 1NNTA 4ELQA 1B4HA 3TCGA 3QAXA 4X1DA 2HCAA 4JWYA 2H4IA 3GBBA 4H67A 2NXOA 1US4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QSE A;  2O84 X;  3U92 A;  5I84 A;  2RC9 A;  3TEP A;  3FUZ A;  4M1V A;  3IB0 A;  1PEB A;  4QSD A;  3OSR A;  1Y1Z A;  3K1P A;  1MXY A;  3EPE A;  3BBR A;  4ESW A;  3IOV A;  5L9M A;  4F3G A;  4L17 A;  1IXI A;  1B40 A;  2A5T A;  3S9M C;  1JVX A;  3MBP A;  1MY3 A;  3K6X A;  1DSN A;  2DOJ A;  3GBA A;  3HHF A;  3KG2 A;  4OYV A;  1OLC A;  2XXH A;  4N13 A;  5I58 B;  4UA8 A;  1MQH A;  1ZU0 A;  3S4U A;  3OOA A;  1YAE A;  3HST A;  1S7Y A;  1LFH A;  1B7H A;  2GH9 A;  1B6H A;  4WEP A;  4OEN A;  4FJP A;  5I2N B;  1LST A;  1ZBM A;  1MS7 A;  3G3K A;  1BP5 A;  2V3T A;  1N3W A;  2AIX A;  3ZKL A;  2M8C A;  4U4S A;  3OMB A;  2B3B A;  3OD7 A;  4DXB A;  1OVT A;  1FTL A;  3JV9 A;  4K3F A;  3CRB A;  5M2V A;  1PC3 A;  2UVJ A;  5I59 A;  4ISU A;  2R6G E;  2UYE A;  3FVG A;  3MC2 A;  3N26 A;  4RA1 A;  5TPA B;  4OER A;  1JQF A;  2F35 A;  4F3B A;  1MPC A;  2DSF A;  4EQ9 A;  4RPN A;  4OMB A;  2THI A;  4AQ4 A;  1MDP 1;  4FEB A;  1D9Y A;  1VE4 A;  3L6H A;  4JDF A;  4R6H A;  1N3X A;  1FQA A;  4C1T A;  1PDA A;  4NF6 B;  3RNN A;  3C32 A;  4YB7 A;  5DEX B;  3VLV A;  5CC2 A;  2H9B A;  3Q26 A;  1FQB A;  2B65 A;  1H3D A;  3VVD A;  3EHU A;  4BDM A;  3OEK A;  4R6Y A;  2PVU A;  2O1L A;  3ODB A;  3M8U A;  3EHT A;  4WED A;  4R73 A;  3EQ1 A;  3SDF A;  3KN3 A;  1MM6 A;  1URG A;  4NF4 A;  5B7D A;  4YZZ A;  3VE1 B;  5CMM A;  5CMB A;  4FE8 A;  3LSF B;  2QSX A;  1XVX A;  4XTC Q;  5IAI A;  1A55 A;  1JEV A;  2DWJ A;  3H6U A;  2DXY A;  2UVH A;  1SD3 A;  2XXI A;  3PPQ A;  1LB9 A;  1QKA A;  3MP6 A;  4YAH X;  4E0X A;  3O6I A;  1UTH B;  4FOR A;  1B7U A;  2UYF A;  1VSO A;  1JNF A;  1LLS A;  4KI0 E;  4LQ2 A;  1MH4 A;  2Q88 A;  2QS2 A;  4FED A;  1RYO A;  1JW5 A;  3DLN A;  1F9B A;  3KJ7 A;  3FJ7 A;  3K1M A;  3LSX A;  3FV1 A;  5DVJ A;  4LZ5 A;  4RYA A;  3UOR A;  3JYR A;  4G8M A;  1MY0 A;  4ONY A;  1MM7 A;  1BTJ A;  4WXJ A;  5KCJ A;  3IAZ A;  3IOT A;  3K0V A;  2ZNS A;  4BDL A;  1B3L A;  2V93 A;  2A5S A;  2I48 A;  4IO3 A;  4KYS A;  4MH5 A;  2NOO A;  4GL0 A;  3EF7 A;  2XXY A;  3N6U A;  4ZEI A;  1YTV A;  1Q35 A;  1I6A A;  4JSO A;  3BFT A;  4DIG A;  1OIB A;  3ECR A;  1LCT A;  1URD A;  4OFL A;  1QUK A;  4OVJ A;  3MZ9 A;  3UA8 A;  2ABH A;  4OXV A;  4ZEB A;  1B46 A;  4G2Z A;  4NF8 B;  5FTH A;  4DCX A;  1I6B A;  3LBS A;  3K6V A;  3CFZ A;  3CSB A;  3CSG A;  2CMO A;  4RPO A;  1MXX A;  5AE4 A;  4F1U A;  4XXU A;  3GLB A;  2XHD A;  3U72 A;  4GFR A;  5I58 A;  3KJT A;  2HEU A;  1FW0 A;  2PX1 A;  4QHQ A;  2I4B A;  3A09 A;  1NNF A;  1ZKB A;  2RIN A;  3IJO B;  4R9G A;  4IY6 A;  3TTM A;  2BJJ X;  1UIV A;  3TYH A;  4JXI A;  3Q29 A;  2Y7P A;  4TLL B;  2ZYN A;  4ZZA A;  4QFL A;  1JW4 A;  1R9Q A;  3RTF B;  3RY3 A;  2OCU A;  4Q30 B;  1ZIU A;  4WKM A;  3H6V A;  4QFO A;  1OLA A;  1CE2 A;  4NTL A;  2W7Y A;  2PYY A;  5BWJ A;  3TOD A;  1UIU A;  1MY1 A;  1XVY A;  3UK4 A;  5DVI A;  2F6G A;  1SYI A;  2VHA A;  1A8F A;  3CG3 A;  2ZNU A;  4LQ5 A;  4OES A;  5TPA A;  2O1M A;  2ANJ A;  1I6Q A;  2I0B A;  1P1N A;  5ITO A;  4MLV A;  4ZDM A;  3VXB A;  3KOT A;  4N07 A;  3USD A;  3FV2 A;  1OMP A;  4JB7 A;  4GRK A;  2F7C A;  2OK2 A;  4EQB A;  3JZJ A;  1EH3 A;  3HO7 A;  1IQ7 A;  2E0S A;  4F3S A;  3OO7 A;  4OFO A;  2X26 A;  1PB7 A;  1QKB A;  4EF1 A;  1AOV A;  2WKY A;  3FVK A;  2DXR A;  1DTG A;  3ILT B;  4Z0I A;  3TEL A;  3CI8 A;  1DOT A;  4HW8 A;  2DP8 A;  3MPL A;  3M3K A;  5H8H A;  5FTI A;  3Q27 A;  5JEI A;  4Z7E A;  3PUY E;  2XX9 A;  4N6P A;  1SW1 A;  5F7V A;  3MQ9 A;  4RJZ A;  4RNS A;  4BDQ A;  3PPP A;  3OO8 A;  3TTR A;  4BLA A;  1EZP A;  2XXU A;  2V84 A;  4YKI A;  2I49 A;  1ELJ A;  1N7W A;  3PMV A;  4R2F A;  5CRY A;  2QMX A;  2YLN A;  1IZ1 A;  3C35 A;  1XT8 A;  3C4M A;  4H8I A;  1URS A;  3KGC A;  1B3G A;  1P1U A;  1LGB C;  3CVG A;  2ZYO A;  1M5E A;  4AB5 A;  2QJE A;  1GR2 A;  4JWX A;  2XD3 A;  4R9F A;  1TXF A;  3U94 A;  4NWD A;  5I2K B;  5HM4 B;  5KCJ B;  3IOR A;  5HBC A;  2RKM A;  4H5F A;  3UGW A;  4LON B;  2Y7K A;  4X9T A;  5J1D A;  3BKI B;  1Y4T A;  2VD3 A;  4QRZ A;  3B7D A;  1NMU A;  3A3C A;  2PT1 A;  3QSL A;  1B2H A;  4OEU A;  4QSC A;  4XIG Q;  4ZE9 A;  3KSJ A;  2VP1 A;  4IO2 A;  3MW0 A;  3K1N A;  2XXQ A;  1A40 A;  4U1O A;  5ISU A;  4NF8 A;  1NFT A;  2DE2 A;  1B5I A;  4YKK A;  4OTE A;  3U8Q A;  4ECF A;  2HZK A;  5DYH A;  1L5T A;  4FAJ A;  2LAO A;  4F22 A;  4LAT A;  4GLI A;  2FYI A;  3FAT A;  4JWO A;  1SDX A;  4LVQ A;  5AA4 A;  3KEI A;  4IGT A;  2NVU B;  4OQO A;  5ITP A;  4POW A;  4C0R A;  2E1S A;  4GVO A;  1B5J A;  3TKD A;  3IB1 A;  3S9N C;  3MVW A;  4F1Y A;  1B3E A;  1USY E;  2UXA A;  3RUM A;  3IO4 A;  4KYE A;  1M5B A;  3L6G A;  3KFM A;  3BFU A;  2O68 A;  4G4P A;  1EZ9 A;  3O6G A;  1OQG A;  2F36 A;  2QPQ A;  4EXL A;  2OBG A;  2XX7 A;  2I3W A;  1MQI A;  3T96 B;  4KHZ E;  4AB6 A;  4OET A;  5DT6 A;  4RK9 A;  3H7M A;  4UAC A;  4KQP A;  1R9L A;  1DMB A;  4F19 A;  4EF2 A;  1NNP A;  2HZL A;  4OFJ A;  5CMK A;  4ZEK A;  3IX1 A;  5KDT B;  3VV5 A;  3OEN A;  1ATG A;  3A3U A;  3E3K A;  3TUS A;  3PUV E;  4H1X A;  3RPW A;  3OO6 A;  3FJM A;  2OZZ A;  1B1H A;  1B3H A;  4EUO A;  2FA7 A;  3WAF A;  4IY5 A;  5AA2 D;  2I0C A;  3RLF E;  1TWY A;  4P0I A;  1FQF A;  3K6U A;  2YPN A;  2ZYM A;  2UVG A;  4KFQ A;  3PUX E;  2REG A;  3B6T A;  1Y20 A;  1O7T A;  5ELV A;  5K2Y A;  1B3F A;  4HCY A;  1SW4 A;  5H8H B;  5IKB A;  1LAG E;  4PQJ A;  1N76 A;  4R72 A;  1LFI A;  5KZT A;  3FXQ A;  3T9H B;  2RCA A;  1JW1 A;  1LCF A;  1S50 A;  2DYX A;  1P1Q A;  1AIV A;  3MWB A;  3U93 A;  1MPB A;  3T9X B;  2PMS A;  1MH3 A;  3V83 A;  2DWH A;  1H44 A;  4FEC A;  3TCH A;  1IXH A;  1OVB A;  4IO6 A;  1HSE A;  1MG1 A;  3IL1 B;  3IJX B;  1EZO A;  1VFE A;  3LSL A;  4YIC A;  3H06 B;  5F1Q A;  4BDN A;  4NF5 B;  3V89 B;  3O29 A;  3HV1 A;  2Y7W A;  4LA9 A;  5I2K A;  1VR5 A;  5I56 B;  4PFY A;  4F31 B;  4GOT A;  1Y9U A;  3O2A A;  5H8S A;  1Y4C A;  3AXF A;  4NE4 A;  4Q5T A;  3R6U A;  2O6A A;  3FVO A;  2H5Y A;  5LOM A;  1Z7M E;  3FD3 A;  3PGF A;  3QIM A;  2DS9 A;  4OEV A;  1H45 A;  1FQC A;  3K01 A;  1WVJ A;  4THI A;  3E13 X;  4DLD A;  4ZZE A;  1BLF A;  3QXM A;  5TP9 B;  1LAF E;  2I3V A;  3SEW A;  1JVY A;  1NH8 A;  1ZMG A;  3VLU A;  2Q8J A;  4OHN A;  2QL3 A;  3QUJ A;  2G93 A;  2UVI A;  4KPT A;  1LFG A;  2OLB A;  2ESN A;  5FHO A;  1TT1 A;  1A54 A;  5A5X B;  2O7I A;  3KSX A;  2DE3 A;  5AA4 B;  2F5X A;  3SEX A;  2X7P A;  1BIY A;  1AMF A;  4U22 A;  1Y3P A;  1LBC A;  1B51 A;  2I4C A;  3DP4 A;  3KBR A;  4R75 A;  5CM6 A;  2Z8D A;  2OWT A;  1IUD A;  3PU5 A;  3FXR A;  3LR1 A;  1RKM A;  2XXP A;  3N94 A;  2V3U A;  2AYS A;  1TFA A;  3TAJ A;  3WAE A;  3D4C A;  3CG1 A;  2ONS A;  1NH7 A;  5JK4 A;  4DCY A;  4F2Q A;  3C9H A;  3PV0 E;  3PD9 A;  3EN3 A;  1JEU A;  1DTZ A;  3TTL A;  4JSD A;  2P1S A;  1B7Z A;  2GFE A;  2H99 A;  3H6W A;  1FTJ A;  4PET A;  5KDT A;  1N7X A;  2RC7 A;  3S9E A;  1SYH A;  4GWO A;  1GTK A;  2VGQ A;  3EHS A;  3P7I A;  4HCW A;  3PUW E;  4YB6 A;  4O3C A;  4QFP A;  1FTK A;  1NNK A;  4DXU A;  1FTM A;  4G68 C;  3CFL A;  1QUL A;  3GXA A;  4IO5 A;  3W15 C;  3IOU A;  1IIW A;  3TCF A;  3O97 A;  4ZED A;  2DQV A;  1MQD A;  1SI0 A;  3O6H A;  4GIZ A;  1SW2 A;  4PE5 B;  1ANF A;  2ZNT A;  4PFT A;  5ICT A;  1JET A;  1MPD A;  1YCJ A;  4R6K A;  1S9T A;  4H65 A;  3RN8 A;  2F6P A;  2IEE A;  2OJT A;  3MPK A;  3SEU A;  3O28 A;  4YMB A;  5DVF A;  2HFB A;  5EYF A;  1B1X A;  2D3I A;  1VFD A;  2O51 A;  5CI5 A;  4YKJ A;  1GGG A;  1M5F A;  5JTY B;  1KWH A;  1FQD A;  3T66 A;  3V5A A;  3K4U A;  5I57 B;  4KR5 A;  4H6D A;  5L8D A;  1XHY A;  4G8N A;  3C33 A;  4LZ7 A;  1MRP A;  1QW0 A;  4DDD A;  2P0S A;  1WDN A;  4OWD A;  1B5H A;  4NF5 A;  3V8X B;  3DP8 A;  3FGS A;  2ALU A;  4ZEF A;  4G68 B;  3RGY A;  2XXX A;  2I6E A;  3B6W A;  4F18 A;  5I56 A;  1Y3N A;  3OO9 A;  1LAH E;  1O63 A;  4YKP A;  4MF3 A;  4JBZ A;  3QUF A;  5BUU A;  3ZKK A;  4U1Z A;  1USY H;  4KD5 A;  1SI1 A;  3VXC A;  4LUB A;  2XXV A;  1PBP A;  1DPE A;  4I62 A;  1RYX A;  5ICQ A;  3VLW A;  1MXU A;  1US5 A;  1IEJ A;  3R7X A;  3E4R A;  4C1U A;  1AH5 A;  3GZG A;  1N0T A;  4DE8 A;  3VFJ A;  1B32 A;  3OEM A;  2XXR A;  4F39 A;  3SER A;  4YB5 A;  2AL5 A;  5TP9 A;  3PPN A;  4Q0C A;  3CR9 A;  1A8E A;  3PMX A;  2KLF A;  3OXN A;  4PFW A;  3PUZ E;  3O9P A;  2XXT A;  3KN7 A;  1O64 A;  2XXW A;  4U23 A;  3SEY A;  2QS3 A;  1D9V A;  3TZA A;  5A5X A;  3HHG A;  4G8H A;  4ELO A;  2D21 A;  4KYD A;  2FNC A;  2RCB A;  4U21 A;  3ILU B;  4PFU A;  3C31 A;  4P11 A;  1M5D A;  4OZ9 A;  3KZG A;  1ZLQ A;  4TQU Q;  3OEL A;  5B70 A;  4P0G A;  1YPN A;  1B0H A;  3U1O A;  3H3G A;  3W9V A;  1HSL A;  4GL8 A;  3Q28 A;  4YU0 A;  3C36 A;  2HQ0 A;  4ELR A;  3S2V A;  2CZL A;  1OQH A;  4F3P A;  4O3B A;  3LC8 A;  3TQW A;  1PB9 A;  2DVC A;  2F7B A;  2YJP A;  4ZS9 A;  2XX8 A;  3KOS A;  4GF8 A;  1MXW A;  3CFX A;  2ONK E;  3G3I A;  4GD5 A;  4ZE8 A;  3RT6 B;  1QVS A;  3G3F A;  3N6T A;  2H25 A;  1UQW A;  2B3F A;  4PP0 A;  2Q89 A;  2Q2A A;  3R26 A;  2O7U A;  1XC1 A;  1UTB B;  3HN0 A;  2Y84 A;  1M5C A;  2Z8F A;  3PPO A;  4E0W A;  4RK2 A;  1MY4 A;  3PD8 A;  1Y3Q A;  5K2X A;  4ZEC A;  2HAV A;  2RF1 A;  5H8Q A;  3H4Z A;  5H8N B;  4H8J A;  3H03 A;  2NUV A;  1A99 A;  3M3F A;  3D4G A;  4ELP A;  4DXC A;  2ONR A;  3MZB A;  2NWJ A;  4I8C A;  4YMA A;  4QF9 A;  2X7Q A;  2QS1 A;  3DM0 A;  3MJN A;  3OSQ A;  4MFI A;  3N5L A;  2V25 A;  1B05 A;  3I3V A;  3VVF A;  3TQL A;  2ZXT A;  2PBW A;  3F11 A;  5JTY A;  3MP1 A;  4IO4 A;  3QYT A;  2F97 A;  3SES A;  1B0L A;  4X1B A;  4RY1 A;  2GHA A;  1IIT A;  2QS4 A;  5I57 A;  5AA3 A;  1SVX B;  2RC8 A;  4IGR A;  3QK6 A;  1POY 1;  4U2R A;  2H98 A;  1ZJL A;  3VDF A;  4EDP A;  4IO7 A;  3I6V A;  1P99 A;  5H8F A;  3FXU A;  4G68 A;  4F1V A;  3MVY A;  1MXZ A;  3IR1 A;  1P1O A;  3RTW B;  3UIF A;  5HPQ A;  3FJG A;  4XKQ A;  2IA4 A;  3IO6 A;  3LUY A;  2Y7R A;  3SET A;  1CB6 A;  5EHM A;  3E9X A;  1Q1K A;  1LAX A;  2F34 A;  2G29 A;  1I69 A;  1SQY A;  2GRV A;  2R71 A;  5AA2 A;  1FTO A;  1XOC A;  5L9S A;  1R6Z A;  3FAS A;  4Q8R A;  1MXV A;  1EU8 A;  4MLQ A;  4EQ7 A;  4GXS B;  3LSW A;  3G3G A;  3IB2 A;  3K2D A;  4EXK A;  2R9J A;  3MZ1 A;  3FVN A;  3SEV A;  1QJM A;  2D5W A;  3Q25 A;  3IOW A;  1A7L A;  3IK6 B;  1J1N A;  3MP8 A;  4XKN A;  2GHB A;  1B4Z A;  1N84 A;  1PB8 A;  3PPR A;  1ZTY A;  2QRY A;  1B52 A;  3RT8 A;  1PBQ A;  3PMW A;  2A5T B;  2HXW A;  4FAT A;  1WOD A;  3M3L A;  4KCC A;  1FCK A;  1T0K A;  1R1N A;  3TMG A;  3CIJ A;  4LP2 B;  2Q9T A;  2VD2 A;  2VOZ A;  1NKX A;  1SW5 A;  4BDO A;  3DEL B;  3MUQ A;  5FHM A;  4QFN A;  5FHN A;  2ZMB A;  2Z22 A;  1XS5 A;  3W9W A;  2DWA A;  1B9J A;  1P1W A;  4ESX A;  2I58 A;  5I2N A;  3TFL A;  3K02 A;  4R2B A;  4ND9 A;  4XKR A;  3I5O A;  3TDJ A;  4GXA A;  1IXG A;  1II5 A;  1GVC A;  1H43 A;  2XD2 A;  3B6Q A;  2ZYK A;  4NMY A;  3RQT A;  5CBS A;  3O66 A;  1GV8 A;  5I59 B;  3S9L C;  1MDQ A;  4F2O A;  1POT A;  5AA1 A;  3ZSF A;  3T9V A;  2DWI A;  4O3A A;  2Z23 A;  4F29 A;  3SKP A;  4M4G A;  3DP6 A;  1DPP A;  4FIM A;  4QFK A;  1UTB A;  2REJ A;  3ONM A;  4IB2 A;  4R74 A;  1MY2 A;  1LBB A;  3TTN A;  5H8Q B;  3HPI A;  4MBP A;  1NL5 A;  5H8N A;  2F7A A;  3FIR A;  4X48 A;  1Z7N E;  4NF6 A;  4TLM B;  1D3K A;  4RXL A;  3T93 B;  3MAM A;  4HS7 A;  3G7W A;  1QUI A;  5DEX A;  3K00 A;  3TPA A;  4H5G A;  3ZS6 A;  3G3H A;  4NWC A;  4XKP A;  2QMW A;  5CBR A;  2Q2C A;  4HTG A;  4NF4 B;  4POX A;  4I1D A;  1BKA A;  1D4N A;  3UP9 A;  3MVZ A;  5DTB A;  3C34 A;  4BDR A;  4KCD A;  1MQG A;  2F8D A;  4GQO A;  3THI A;  5EHS A;  2Y7I A;  1QUJ A;  4G77 A;  2HAU A;  2DE4 A;  3K6W A;  1B58 A;  1HSJ A;  2OWS A;  1UTH A;  4H0W A;  4I9D A;  5CMC A;  3MVX A;  2Z8E A;  2O69 A;  1N04 A;  3H6T A;  3VVE A;  1H76 A;  5H8F B;  3HCQ A;  3FZV A;  1IXC A;  2V3Q A;  5L9O A;  1AL3 A;  2AL4 A;  3UN6 A;  5TU0 A;  2F78 A;  2PT2 A;  4DZ1 A;  2DVZ A;  3T22 A;  3G3J A;  4NED A;  3KN8 A;  1Y1M A;  3TTK A;  4LZ8 A;  4TOZ A;  1MQJ A;  1SBP A;  4U4X A;  5AA2 B;  3T9U A;  2P2A A;  1TFD A;  1LB8 A;  1FQE A;  1NNT A;  4ELQ A;  1B4H A;  3TCG A;  3QAX A;  4X1D A;  2HCA A;  4JWY A;  2H4I A;  3GBB A;  4H67 A;  2NXO A;  1US4 A; 
#chains in the Genus database with same CATH topology
 4QSE A;  2O84 X;  3U92 A;  5I84 A;  2RC9 A;  3ROJ A;  3TEP A;  1QGX A;  3FUZ A;  4M1V A;  3IB0 A;  2OX3 A;  1PEB A;  4QSD A;  3OSR A;  1Y1Z A;  2PCR A;  3K1P A;  1MXY A;  4N15 A;  3EPE A;  3BBR A;  4ESW A;  3IOV A;  3MYU A;  5L9M A;  4PAI A;  4F3G A;  4L17 A;  1IXI A;  1B40 A;  2A5T A;  3S9M C;  1JVX A;  3MBP A;  1MY3 A;  3K6X A;  1DSN A;  2DOJ A;  3GBA A;  3HHF A;  3KG2 A;  4OYV A;  1OLC A;  2XXH A;  4N13 A;  5I58 B;  1K9Z A;  1MQH A;  2XA5 A;  1ZU0 A;  1EYK A;  4UA8 A;  3S4U A;  3OOA A;  1YAE A;  3HST A;  1S7Y A;  1LFH A;  1B7H A;  2GH9 A;  1B6H A;  4WEP A;  4OEN A;  4FJP A;  4OAN A;  2F3B A;  5I2N B;  1LST A;  1ZBM A;  2QVV A;  1MS7 A;  3G3K A;  1BP5 A;  2V3T A;  1N3W A;  4HXV A;  4NF0 A;  2AIX A;  3ZKL A;  2M8C A;  4U4S A;  3OMB A;  2B3B A;  3OD7 A;  4DXB A;  4MNP A;  1OVT A;  1FTL A;  3E79 A;  3JV9 A;  4K3F A;  2R8T A;  3CRB A;  5M2V A;  1PC3 A;  2UVJ A;  4JVI A;  5I59 A;  4ISU A;  2R6G E;  2UYE A;  3FVG A;  3MC2 A;  3N26 A;  4PFB A;  4RA1 A;  5TPA B;  3KC1 A;  4OER A;  1JQF A;  2F35 A;  4F3B A;  1MPC A;  2DSF A;  4EQ9 A;  4RPN A;  4OMB A;  2THI A;  4AQ4 A;  1MDP 1;  4FEB A;  1D9Y A;  1VE4 A;  3L6H A;  1EYI A;  4JDF A;  4R6H A;  1N3X A;  1FQA A;  2P3N A;  4C1T A;  1PDA A;  4NF6 B;  3RNN A;  3C32 A;  4YB7 A;  3KC0 A;  5DEX B;  3VLV A;  5CC2 A;  2H9B A;  5T3J A;  1FPG A;  3Q26 A;  1FQB A;  2B65 A;  4P1E A;  1H3D A;  3VVD A;  3EHU A;  4BDM A;  3OEK A;  5EYG A;  4R6Y A;  2PVU A;  2O1L A;  4O8M A;  3ODB A;  3M8U A;  3EHT A;  4WED A;  4R73 A;  3EQ1 A;  3SDF A;  3KN3 A;  1MM6 A;  1URG A;  4NF4 A;  5B7D A;  4YZZ A;  2WBB A;  3VE1 B;  5CMM A;  4MJO A;  5CMB A;  4FE8 A;  3LSF B;  2QSX A;  3A29 A;  1XVX A;  4XTC Q;  4PFI A;  5IAI A;  1A55 A;  1JEV A;  2DWJ A;  3D1R A;  2CZK A;  3H6U A;  2DXY A;  2UVH A;  1SD3 A;  2XXI A;  3PPQ A;  4H46 A;  1LB9 A;  1QKA A;  3MP6 A;  4MEV A;  4YAH X;  5IZ3 A;  4E0X A;  3O6I A;  1UTH B;  4FOR A;  3MST A;  1B7U A;  2UYF A;  5EQ7 A;  1NV4 A;  1VSO A;  1JNF A;  1LLS A;  4KI0 E;  4OVT A;  4LQ2 A;  1MH4 A;  5ET8 A;  2Q88 A;  2QS2 A;  4FED A;  1RYO A;  1JW5 A;  3DLN A;  1F9B A;  3KJ7 A;  3FJ7 A;  3K1M A;  3LSX A;  3FV1 A;  5DVJ A;  4LZ5 A;  4RYA A;  2ZZV A;  3UOR A;  3JYR A;  3B50 A;  4G8M A;  4GX6 A;  1MY0 A;  4ONY A;  3KBZ A;  1MM7 A;  4DI3 D;  1BTJ A;  4WXJ A;  5KCJ A;  1IMA A;  3IAZ A;  3IOT A;  3K0V A;  2ZNS A;  4BDL A;  1B3L A;  2V93 A;  2A5S A;  2I48 A;  4IO3 A;  4KYS A;  4MH5 A;  2NOO A;  5EQ8 A;  4GL0 A;  3EF7 A;  2XXY A;  3N6U A;  4ZEI A;  1YTV A;  4OA4 A;  1Q35 A;  1I6A A;  4JSO A;  3BFT A;  4DIG A;  1OIB A;  3ECR A;  1LCT A;  1URD A;  4OFL A;  4MMP A;  1QUK A;  4OVJ A;  1KA0 A;  3MZ9 A;  3UA8 A;  4QXD A;  2ABH A;  4OXV A;  4MNC A;  4ZEB A;  1B46 A;  4G2Z A;  4NF8 B;  5FTH A;  4DCX A;  1I6B A;  3LBS A;  3K6V A;  3CFZ A;  3CSB A;  3CSG A;  2CMO A;  4RPO A;  1MXX A;  5AE4 A;  4F1U A;  4XXU A;  3GLB A;  2XHD A;  3U72 A;  4GFR A;  1EYJ A;  3KJT A;  2HEU A;  1FW0 A;  5I58 A;  2PX1 A;  4QHQ A;  2I4B A;  3A09 A;  1NNF A;  1ZKB A;  2RIN A;  3IJO B;  4R9G A;  4IY6 A;  3TTM A;  2BJJ X;  1UIV A;  3TYH A;  4JXI A;  3Q29 A;  2Y7P A;  4TLL B;  2ZYN A;  4ZZA A;  4QFL A;  1FSA A;  1JW4 A;  1R9Q A;  3RTF B;  3RY3 A;  2OCU A;  4Q30 B;  1ZIU A;  4WKM A;  1IMF A;  3H6V A;  4QFO A;  1OLA A;  1CE2 A;  4NTL A;  2W7Y A;  2PYY A;  5BWJ A;  3TOD A;  3E78 A;  5IZ1 A;  4X04 A;  1UIU A;  1MY1 A;  1XVY A;  3UK4 A;  5DVI A;  2F6G A;  1SYI A;  2VHA A;  1A8F A;  3CG3 A;  2ZNU A;  4LQ5 A;  4OES A;  4GBW A;  5TPA A;  2O1M A;  2ANJ A;  4P9K A;  1I6Q A;  2I0B A;  1P1N A;  5ITO A;  4MLV A;  4ZDM A;  3VXB A;  1INP A;  3KOT A;  4N07 A;  3USD A;  3FV2 A;  1OMP A;  4JB7 A;  4GRK A;  2F7C A;  2OK2 A;  4EQB A;  3JZJ A;  1EH3 A;  3HO7 A;  1IQ7 A;  1FRP A;  2E0S A;  4F3S A;  3OO7 A;  4OFO A;  2X26 A;  1PB7 A;  1QKB A;  4EF1 A;  1AOV A;  2WKY A;  3FVK A;  2DXR A;  2KR0 A;  1DTG A;  3ILT B;  4Z0I A;  1G0I A;  4GWW A;  2QFL A;  2XWV A;  3TEL A;  3CI8 A;  4LN5 A;  1DOT A;  4HW8 A;  2DP8 A;  3MPL A;  3M3K A;  5H8H A;  5FTI A;  4PAF A;  3Q27 A;  5JEI A;  4Z7E A;  3PUY E;  2XX9 A;  4N6P A;  4HE0 A;  1SW1 A;  5F7V A;  5IGA A;  3MQ9 A;  2HXR A;  4RJZ A;  4RNS A;  4BDQ A;  3PPP A;  3OO8 A;  3TTR A;  4BLA A;  1EZP A;  2XXU A;  2V84 A;  4YKI A;  2I49 A;  1ELJ A;  1N7W A;  3PMV A;  4R2F A;  1FBC A;  2QMX A;  5CRY A;  2YLN A;  1IZ1 A;  3C35 A;  1XT8 A;  3C4M A;  4H8I A;  1URS A;  3KGC A;  1B3G A;  1P1U A;  1LGB C;  3CVG A;  3RPL B;  2ZYO A;  1M5E A;  4AB5 A;  2QJE A;  2WX9 A;  1GR2 A;  1FPK A;  4JWX A;  2XD3 A;  4R9F A;  1TXF A;  3U94 A;  4NWD A;  5I2K B;  4PCD A;  5HM4 B;  5KCJ B;  3IOR A;  5HBC A;  2RKM A;  4H5F A;  2GQ1 A;  3UGW A;  4LON B;  2Y7K A;  3RYD A;  4X9T A;  4GX3 A;  5J1D A;  3BKI B;  1Y4T A;  2VD3 A;  4AS5 A;  4QRZ A;  3B7D A;  1NMU A;  3A3C A;  2PT1 A;  3QSL A;  1B2H A;  4OEU A;  4QSC A;  4XIG Q;  1FBF A;  4ZE9 A;  4N6K A;  3KSJ A;  2VP1 A;  4IO2 A;  3MW0 A;  1YYZ A;  3K1N A;  2XXQ A;  1A40 A;  4U1O A;  5ISU A;  3CHG A;  4NF8 A;  1NFT A;  2DE2 A;  1B5I A;  4MIJ A;  4YKK A;  1FPI A;  4OTE A;  4P3L A;  3U8Q A;  1NV6 A;  4ECF A;  2HZK A;  4P1L A;  5DYH A;  1FPD A;  1L5T A;  4FAJ A;  2V4C A;  2LAO A;  2Q8M A;  4F22 A;  4LAT A;  4GLI A;  2FYI A;  3FAT A;  1NV1 A;  4JWO A;  1SDX A;  4LVQ A;  5AA4 A;  1FJ9 A;  3KEI A;  4IGT A;  2NVU B;  4OQO A;  5ITP A;  4HE2 A;  4POW A;  4C0R A;  2E1S A;  4GVO A;  1B5J A;  3TKD A;  3QMF A;  3IB1 A;  3S9N C;  3MVW A;  4I3Y A;  4F1Y A;  1B3E A;  1USY E;  2UXA A;  3RUM A;  3IO4 A;  4KYE A;  1M5B A;  3L6G A;  3KFM A;  3BFU A;  2O68 A;  4G4P A;  1EZ9 A;  3O6G A;  1OQG A;  2F36 A;  2QPQ A;  4EXL A;  2OBG A;  2XX7 A;  2I3W A;  4OVR A;  1MQI A;  3T96 B;  4KHZ E;  4AB6 A;  4N6D A;  4OET A;  5DT6 A;  4RK9 A;  3H7M A;  4UAC A;  4KQP A;  1R9L A;  1DMB A;  3T1B A;  4F19 A;  4EF2 A;  1LBZ A;  4N8Y A;  1NNP A;  2HZL A;  4OFJ A;  5CMK A;  4ZEK A;  3IX1 A;  2CEX A;  4PGP A;  4NX1 A;  5KDT B;  4DI4 B;  3IFC A;  3VV5 A;  3OEN A;  1ATG A;  3A3U A;  1FPE A;  3E3K A;  3TUS A;  4MAG A;  3PUV E;  4H1X A;  3RPW A;  3OO6 A;  3FJM A;  2OZZ A;  1B1H A;  1B3H A;  1NV2 A;  4EUO A;  4NAP A;  2FIX A;  2FA7 A;  4PBH A;  1FBD A;  3WAF A;  4IY5 A;  5AA2 D;  2I0C A;  3RLF E;  1TWY A;  4P0I A;  1FQF A;  3K6U A;  2YPN A;  2ZYM A;  2UVG A;  4KFQ A;  2VT5 A;  3PUX E;  2REG A;  3B6T A;  1Y20 A;  1O7T A;  5ELV A;  5K2Y A;  1B3F A;  4HCY A;  1SW4 A;  5H8H B;  1FPF A;  5IKB A;  1LAG E;  4PQJ A;  1N76 A;  4R72 A;  1LFI A;  5KZT A;  1SPI A;  3FXQ A;  3T9H B;  2RCA A;  5IM2 A;  4UAB A;  1JW1 A;  1LCF A;  1S50 A;  2DYX A;  1P1Q A;  1AIV A;  1IME A;  3MWB A;  3U93 A;  1MPB A;  3T9X B;  5I5P A;  2PMS A;  1MH3 A;  2PFY A;  3V83 A;  2DWH A;  1H44 A;  4FEC A;  2BJI A;  4OVQ A;  3TCH A;  1IXH A;  1OVB A;  4IO6 A;  4IR8 A;  4NHB A;  1HSE A;  1MG1 A;  3RPL A;  3IL1 B;  3IJX B;  1EZO A;  1VFE A;  3LSL A;  3LUZ A;  4YIC A;  3H06 B;  5F1Q A;  4BDN A;  4P8B A;  4NF5 B;  3V89 B;  3O29 A;  2QVR A;  3HV1 A;  2Y7W A;  1LBX A;  4LA9 A;  5I2K A;  1VR5 A;  5I56 B;  4PFY A;  4O7I A;  4QBA A;  4F31 B;  4GOT A;  1Y9U A;  3O2A A;  4MNI A;  5H8S A;  1LBY A;  1Y4C A;  3AXF A;  1Q9D A;  4NE4 A;  3BIH A;  4Q5T A;  3R6U A;  2O6A A;  3FVO A;  3SZP A;  2H5Y A;  5ET7 A;  5LDZ A;  5LOM A;  1Z7M E;  3FD3 A;  3PGF A;  3QIM A;  2DS9 A;  4OEV A;  1H45 A;  1FQC A;  3K01 A;  1WVJ A;  4THI A;  3E13 X;  4DLD A;  5F24 A;  4ZZE A;  1LEV A;  1BLF A;  2ZZW A;  3QXM A;  5TP9 B;  1LAF E;  2I3V A;  3SEW A;  1JVY A;  1NH8 A;  1ZMG A;  4NQ8 A;  3VLU A;  2Q8J A;  4OHN A;  2QL3 A;  3QUJ A;  4I3E A;  2G93 A;  2UVI A;  4KPT A;  4AS4 A;  1LFG A;  1RDY A;  2OLB A;  2ESN A;  5FHO A;  1TT1 A;  1A54 A;  5A5X B;  2O7I A;  3KSX A;  1YXI A;  2DE3 A;  5AA4 B;  2F5X A;  2X7P A;  3SEX A;  1BIY A;  1AMF A;  4U22 A;  1JP4 A;  1Y3P A;  1VDW A;  1NUZ A;  1FBH A;  3ISP A;  1LBC A;  1B51 A;  1G0H A;  2I4C A;  3DP4 A;  3KBR A;  4R75 A;  5CM6 A;  3B8B A;  2Z8D A;  2OWT A;  1IUD A;  3PU5 A;  3FXR A;  1LBW A;  1NV7 A;  3LR1 A;  3U65 A;  1RKM A;  2XXP A;  2CEY A;  3N94 A;  2V3U A;  2AYS A;  1TFA A;  3TAJ A;  4PC9 A;  3WAE A;  3D4C A;  3CG1 A;  2ONS A;  1NH7 A;  5JK4 A;  4DCY A;  4F2Q A;  3C9H A;  3PV0 E;  3PD9 A;  3EN3 A;  1JEU A;  1DTZ A;  3TTL A;  4JSD A;  2P1S A;  1DCU A;  1B7Z A;  2GFE A;  2H99 A;  3H6W A;  1FTJ A;  4PET A;  5KDT A;  1N7X A;  5FBP A;  2PFZ A;  2XXK A;  3EKI A;  3IFA A;  2RC7 A;  3S9E A;  2WYP A;  1SYH A;  4GWO A;  1GTK A;  2VGQ A;  4PBQ A;  3EHS A;  1XI6 A;  2DDK A;  3P7I A;  1BK4 A;  2CZI A;  4HCW A;  3PUW E;  4YB6 A;  5EYH A;  4O3C A;  4QFP A;  1FTK A;  1NI9 A;  1NNK A;  4DXU A;  1FTM A;  4G68 C;  3CFL A;  1QUL A;  2KQZ A;  5ET5 A;  3GXA A;  4IO5 A;  3BIG A;  4GWX A;  3W15 C;  3IOU A;  1IIW A;  2FVZ A;  3TCF A;  4FBP A;  3O97 A;  4ZED A;  4MCO A;  2DQV A;  1MQD A;  1SI0 A;  4JVC A;  3O6H A;  4GIZ A;  1SW2 A;  4PE5 B;  1ANF A;  2ZNT A;  4PFT A;  5ICT A;  1JET A;  1MPD A;  1YCJ A;  2MKZ A;  4R6K A;  1S9T A;  4H65 A;  3RN8 A;  2F6P A;  2IEE A;  2OJT A;  2QVU A;  3MPK A;  3SEU A;  3O28 A;  2Y5K A;  5DVF A;  2HFB A;  5EYF A;  4YMB A;  1B1X A;  4PE3 A;  2D3I A;  1VFD A;  2O51 A;  5CI5 A;  4YKJ A;  1GGG A;  1M5F A;  5JTY B;  1KWH A;  2FHY A;  1FQD A;  3T66 A;  2B4L A;  1AWB A;  3V5A A;  3K4U A;  1NUW A;  5I57 B;  1K9Y A;  4KR5 A;  2L5V A;  4H6D A;  5L8D A;  1XHY A;  4G8N A;  3C33 A;  4LZ7 A;  1MRP A;  1QW0 A;  5DW8 A;  4DDD A;  2P0S A;  1WDN A;  3LV0 A;  4OWD A;  1B5H A;  4NF5 A;  3V8X B;  3DP8 A;  3FGS A;  2ALU A;  4ZEF A;  4G68 B;  3RGY A;  2XXX A;  2I6E A;  3B6W A;  4F18 A;  5I56 A;  1Y3N A;  3OO9 A;  1LAH E;  1O63 A;  1FBE A;  4YKP A;  4MF3 A;  4JBZ A;  3QUF A;  4O7M A;  5BUU A;  3ZKK A;  4U1Z A;  1USY H;  2B4M A;  4KD5 A;  1SI1 A;  3VXC A;  4LUB A;  2XXV A;  1PBP A;  1DPE A;  4I62 A;  1RYX A;  2Q74 A;  4PFR A;  5ICQ A;  3VLW A;  1MXU A;  1US5 A;  1IEJ A;  3R7X A;  3E4R A;  4C1U A;  1AH5 A;  3GZG A;  4PDH A;  1N0T A;  4GBV A;  4DE8 A;  3VFJ A;  1B32 A;  3OEM A;  2XXR A;  4F39 A;  3SER A;  4YB5 A;  1IMD A;  4N81 A;  2AL5 A;  4N8G A;  5TP9 A;  4N91 A;  4KXP A;  3PPN A;  4Q0C A;  3CR9 A;  1A8E A;  3PMX A;  2KLF A;  1D9Q A;  3OXN A;  4JVD A;  4PFW A;  2WYK A;  3PUZ E;  3O9P A;  2XXT A;  3KN7 A;  1FJ6 A;  1O64 A;  2XXW A;  1NUY A;  4U23 A;  3SEY A;  2QS3 A;  4MHF A;  5LTC A;  1D9V A;  3TZA A;  5A5X A;  3HHG A;  4G8H A;  4ELO A;  2D21 A;  4KYD A;  2FNC A;  2RCB A;  2WBD A;  2VPO A;  4U21 A;  3ILU B;  4PFU A;  3C31 A;  5J16 A;  4P11 A;  1M5D A;  4XF5 A;  4OZ9 A;  3KZG A;  1ZLQ A;  4TQU Q;  3OEL A;  5B70 A;  1CNQ A;  4P0G A;  1YPN A;  1B0H A;  3U1O A;  3H3G A;  3W9V A;  1HSL A;  4GL8 A;  3Q28 A;  4YU0 A;  3C36 A;  4GWY A;  2HQ0 A;  4ELR A;  3S2V A;  2CZL A;  1OQH A;  1FBG A;  4F3P A;  4O3B A;  3LC8 A;  3TQW A;  1PB9 A;  2DVC A;  4GWZ A;  2F7B A;  2YJP A;  1LBV A;  1DBZ A;  4ZS9 A;  3FXB A;  2XX8 A;  4XEQ A;  4OVS A;  3KOS A;  4GF8 A;  1MXW A;  3CFX A;  2ONK E;  4P47 A;  3G3I A;  4GD5 A;  4NG7 A;  4ZE8 A;  1KA1 A;  1IMB A;  3RT6 B;  1QVS A;  3G3F A;  3N6T A;  2H25 A;  1UQW A;  2B3F A;  4PP0 A;  2Q89 A;  2Q2A A;  4PF8 A;  5EQ9 A;  3R26 A;  2O7U A;  1XC1 A;  1UTB B;  3FBP A;  3HN0 A;  2Y84 A;  2HPG A;  1M5C A;  2Z8F A;  3PPO A;  4E0W A;  4RK2 A;  1MY4 A;  5A5L A;  3PD8 A;  1Y3Q A;  5K2X A;  4ZEC A;  4GWS A;  2HAV A;  2RF1 A;  5H8Q A;  3H4Z A;  5H8N B;  4H8J A;  3H03 A;  3GYY A;  2NUV A;  4PDD A;  1A99 A;  3M3F A;  3D4G A;  4ELP A;  4DXC A;  2ONR A;  4PF6 A;  3MZB A;  2NWJ A;  4I8C A;  4YMA A;  4HE1 A;  2Y5L A;  5I3S A;  4QF9 A;  2X7Q A;  1FTA A;  2QS1 A;  1NV3 A;  3DM0 A;  3MJN A;  2FBP A;  3OSQ A;  4MFI A;  4O94 A;  3N5L A;  2V25 A;  1B05 A;  3I3V A;  3VVF A;  3TQL A;  2ZXT A;  1NV5 A;  2PBW A;  3F11 A;  1FPB A;  5JTY A;  3MP1 A;  4IO4 A;  3QYT A;  2F97 A;  3SES A;  1B0L A;  4X1B A;  4RY1 A;  5EQA A;  2GHA A;  1IIT A;  2QS4 A;  5I57 A;  5AA3 A;  1SVX B;  2RC8 A;  4IGR A;  4GWU A;  3QK6 A;  2VPN A;  1POY 1;  4U2R A;  2H98 A;  4OVP A;  1ZJL A;  3VDF A;  4EDP A;  2XWI A;  4IO7 A;  2F3D A;  3I6V A;  1P99 A;  5H8F A;  3FXU A;  4G68 A;  4F1V A;  3MVY A;  4H45 A;  1MXZ A;  3IR1 A;  1P1O A;  3RTW B;  3UIF A;  5HPQ A;  3FJG A;  4XKQ A;  2IA4 A;  3IO6 A;  3LUY A;  2Y7R A;  3SET A;  1CB6 A;  5EHM A;  3E9X A;  1Q1K A;  1LAX A;  2F34 A;  2G29 A;  1I69 A;  4N17 A;  1SQY A;  2GRV A;  2R71 A;  3NOH A;  5AA2 A;  1FTO A;  1XOC A;  5L9S A;  1R6Z A;  1IMC A;  3FAS A;  4Q8R A;  1MXV A;  1EU8 A;  4MLQ A;  4EQ7 A;  4GXS B;  3LSW A;  3G3G A;  3IB2 A;  3K2D A;  5IZZ A;  4EXK A;  2R9J A;  3MZ1 A;  1RDX A;  3FVN A;  3SEV A;  1QJM A;  2D5W A;  3Q25 A;  3HFU A;  3IOW A;  1A7L A;  3IK6 B;  1KZ8 A;  1J1N A;  3MP8 A;  2WEF A;  4XKN A;  2GHB A;  1B4Z A;  1N84 A;  1PB8 A;  3PPR A;  1ZTY A;  2QRY A;  5ESY A;  1B52 A;  1YZ0 A;  3RT8 A;  1PBQ A;  2HHM A;  4NN3 A;  3PMW A;  4G61 A;  2A5T B;  2HXW A;  4FAT A;  1WOD A;  3M3L A;  4KCC A;  1FCK A;  1T0K A;  1R1N A;  3TMG A;  3CIJ A;  4LP2 B;  1NUX A;  2Q9T A;  2VD2 A;  2VOZ A;  1NKX A;  1SW5 A;  2XWO A;  4BDO A;  3DEL B;  4PAK A;  3MUQ A;  4X8R A;  2P3V A;  5FHM A;  4QFN A;  5FHN A;  2ZMB A;  2Z22 A;  1XS5 A;  4MX6 A;  3W9W A;  2DWA A;  1FPJ A;  1B9J A;  1FPL A;  1P1W A;  4N4U A;  4ESX A;  2I58 A;  5I2N A;  3TFL A;  3K02 A;  1FBP A;  4R2B A;  4ND9 A;  4XKR A;  3I5O A;  5I7I A;  3TDJ A;  4GXA A;  1IXG A;  1II5 A;  1GVC A;  2FIE A;  1H43 A;  2CZH A;  2XD2 A;  3B6Q A;  2ZYK A;  4NMY A;  3RQT A;  5CBS A;  3O66 A;  1GV8 A;  5I59 B;  3S9L C;  1MDQ A;  4F2O A;  3PTY A;  2ZZX A;  1NV0 A;  1POT A;  5AA1 A;  3ZSF A;  3T9V A;  2DWI A;  4O3A A;  2Z23 A;  4F29 A;  3SKP A;  4M4G A;  3DP6 A;  1DPP A;  4FIM A;  4GX4 A;  1DK4 A;  4QFK A;  1UTB A;  2REJ A;  3T0J A;  3ONM A;  4IB2 A;  4R74 A;  1MY2 A;  1LBB A;  3TTN A;  5H8Q B;  3HPI A;  4MBP A;  1NL5 A;  5H8N A;  2F7A A;  3FIR A;  4X48 A;  1Z7N E;  4NF6 A;  4TLM B;  1D3K A;  4RXL A;  3T93 B;  3MAM A;  4HS7 A;  3G7W A;  1QUI A;  5DEX A;  3K00 A;  3TPA A;  4H5G A;  3ZS6 A;  3G3H A;  4NWC A;  4XKP A;  2QMW A;  4I40 A;  5CBR A;  2Q2C A;  5ET6 A;  4HTG A;  4NF4 B;  4POX A;  4I1D A;  1BKA A;  1D4N A;  3UP9 A;  3MVZ A;  5DTB A;  3C34 A;  4BDR A;  4KCD A;  1MQG A;  2F8D A;  4XFE A;  4GQO A;  3THI A;  5EHS A;  2Y7I A;  1QUJ A;  4G77 A;  2HAU A;  2DE4 A;  1RDZ A;  3K6W A;  1B58 A;  1HSJ A;  5IZ3 B;  2OWS A;  1UTH A;  4H0W A;  4I9D A;  5CMC A;  3MVX A;  4P56 A;  2Z8E A;  2O69 A;  1N04 A;  3H6T A;  3VVE A;  1H76 A;  5H8F B;  3HCQ A;  3FZV A;  1IXC A;  2V3Q A;  5L9O A;  1AL3 A;  2AL4 A;  2XWK A;  3UN6 A;  5TU0 A;  2F78 A;  2PT2 A;  4DZ1 A;  2DVZ A;  3T22 A;  3G3J A;  4NED A;  3KN8 A;  1Y1M A;  3TTK A;  4LZ8 A;  4TOZ A;  1MQJ A;  1SBP A;  4U4X A;  5AA2 B;  4NGU A;  2OWZ A;  3T9U A;  2P2A A;  1TFD A;  4PTK A;  1LB8 A;  1FQE A;  1NNT A;  2JJK A;  4ELQ A;  1B4H A;  4PGN A;  3TCG A;  3QAX A;  4X1D A;  2HCA A;  4JWY A;  2H4I A;  3GBB A;  4H67 A;  2NXO A;  1US4 A; 
#chains in the Genus database with same CATH homology
 4QSE A;  2O84 X;  3U92 A;  5I84 A;  2RC9 A;  3TEP A;  3FUZ A;  4M1V A;  3IB0 A;  1PEB A;  4QSD A;  3OSR A;  1Y1Z A;  3K1P A;  1MXY A;  3EPE A;  3BBR A;  4ESW A;  3IOV A;  5L9M A;  4F3G A;  4L17 A;  1IXI A;  1B40 A;  2A5T A;  3S9M C;  1JVX A;  3MBP A;  1MY3 A;  3K6X A;  1DSN A;  2DOJ A;  3GBA A;  3HHF A;  3KG2 A;  4OYV A;  1OLC A;  2XXH A;  4N13 A;  5I58 B;  4UA8 A;  1MQH A;  1ZU0 A;  3S4U A;  3OOA A;  1YAE A;  3HST A;  1S7Y A;  1LFH A;  1B7H A;  2GH9 A;  1B6H A;  4WEP A;  4OEN A;  4FJP A;  5I2N B;  1LST A;  1ZBM A;  1MS7 A;  3G3K A;  1BP5 A;  2V3T A;  1N3W A;  2AIX A;  3ZKL A;  2M8C A;  4U4S A;  3OMB A;  2B3B A;  3OD7 A;  4DXB A;  1OVT A;  1FTL A;  3JV9 A;  4K3F A;  3CRB A;  5M2V A;  1PC3 A;  2UVJ A;  5I59 A;  4ISU A;  2R6G E;  2UYE A;  3FVG A;  3MC2 A;  3N26 A;  4RA1 A;  5TPA B;  4OER A;  1JQF A;  2F35 A;  4F3B A;  1MPC A;  2DSF A;  4EQ9 A;  4RPN A;  4OMB A;  2THI A;  4AQ4 A;  1MDP 1;  4FEB A;  1D9Y A;  1VE4 A;  3L6H A;  4JDF A;  4R6H A;  1N3X A;  1FQA A;  4C1T A;  1PDA A;  4NF6 B;  3RNN A;  3C32 A;  4YB7 A;  5DEX B;  3VLV A;  5CC2 A;  2H9B A;  3Q26 A;  1FQB A;  2B65 A;  1H3D A;  3VVD A;  3EHU A;  4BDM A;  3OEK A;  4R6Y A;  2PVU A;  2O1L A;  3ODB A;  3M8U A;  3EHT A;  4WED A;  4R73 A;  3EQ1 A;  3SDF A;  3KN3 A;  1MM6 A;  1URG A;  4NF4 A;  5B7D A;  4YZZ A;  3VE1 B;  5CMM A;  5CMB A;  4FE8 A;  3LSF B;  2QSX A;  1XVX A;  4XTC Q;  5IAI A;  1A55 A;  1JEV A;  2DWJ A;  3H6U A;  2DXY A;  2UVH A;  1SD3 A;  2XXI A;  3PPQ A;  1LB9 A;  1QKA A;  3MP6 A;  4YAH X;  4E0X A;  3O6I A;  1UTH B;  4FOR A;  1B7U A;  2UYF A;  1VSO A;  1JNF A;  1LLS A;  4KI0 E;  4LQ2 A;  1MH4 A;  2Q88 A;  2QS2 A;  4FED A;  1RYO A;  1JW5 A;  3DLN A;  1F9B A;  3KJ7 A;  3FJ7 A;  3K1M A;  3LSX A;  3FV1 A;  5DVJ A;  4LZ5 A;  4RYA A;  3UOR A;  3JYR A;  4G8M A;  1MY0 A;  4ONY A;  1MM7 A;  1BTJ A;  4WXJ A;  5KCJ A;  3IAZ A;  3IOT A;  3K0V A;  2ZNS A;  4BDL A;  1B3L A;  2V93 A;  2A5S A;  2I48 A;  4IO3 A;  4KYS A;  4MH5 A;  2NOO A;  4GL0 A;  3EF7 A;  2XXY A;  3N6U A;  4ZEI A;  1YTV A;  1Q35 A;  1I6A A;  4JSO A;  3BFT A;  4DIG A;  1OIB A;  3ECR A;  1LCT A;  1URD A;  4OFL A;  1QUK A;  4OVJ A;  3MZ9 A;  3UA8 A;  2ABH A;  4OXV A;  4ZEB A;  1B46 A;  4G2Z A;  4NF8 B;  5FTH A;  4DCX A;  1I6B A;  3LBS A;  3K6V A;  3CFZ A;  3CSB A;  3CSG A;  2CMO A;  4RPO A;  1MXX A;  5AE4 A;  4F1U A;  4XXU A;  3GLB A;  2XHD A;  3U72 A;  4GFR A;  5I58 A;  3KJT A;  2HEU A;  1FW0 A;  2PX1 A;  4QHQ A;  2I4B A;  3A09 A;  1NNF A;  1ZKB A;  2RIN A;  3IJO B;  4R9G A;  4IY6 A;  3TTM A;  2BJJ X;  1UIV A;  3TYH A;  4JXI A;  3Q29 A;  2Y7P A;  4TLL B;  2ZYN A;  4ZZA A;  4QFL A;  1JW4 A;  1R9Q A;  3RTF B;  3RY3 A;  2OCU A;  4Q30 B;  1ZIU A;  4WKM A;  3H6V A;  4QFO A;  1OLA A;  1CE2 A;  4NTL A;  2W7Y A;  2PYY A;  5BWJ A;  3TOD A;  1UIU A;  1MY1 A;  1XVY A;  3UK4 A;  5DVI A;  2F6G A;  1SYI A;  2VHA A;  1A8F A;  3CG3 A;  2ZNU A;  4LQ5 A;  4OES A;  5TPA A;  2O1M A;  2ANJ A;  1I6Q A;  2I0B A;  1P1N A;  5ITO A;  4MLV A;  4ZDM A;  3VXB A;  3KOT A;  4N07 A;  3USD A;  3FV2 A;  1OMP A;  4JB7 A;  4GRK A;  2F7C A;  2OK2 A;  4EQB A;  3JZJ A;  1EH3 A;  3HO7 A;  1IQ7 A;  2E0S A;  4F3S A;  3OO7 A;  4OFO A;  2X26 A;  1PB7 A;  1QKB A;  4EF1 A;  1AOV A;  2WKY A;  3FVK A;  2DXR A;  1DTG A;  3ILT B;  4Z0I A;  3TEL A;  3CI8 A;  1DOT A;  4HW8 A;  2DP8 A;  3MPL A;  3M3K A;  5H8H A;  5FTI A;  3Q27 A;  5JEI A;  4Z7E A;  3PUY E;  2XX9 A;  4N6P A;  1SW1 A;  5F7V A;  3MQ9 A;  4RJZ A;  4RNS A;  4BDQ A;  3PPP A;  3OO8 A;  3TTR A;  4BLA A;  1EZP A;  2XXU A;  2V84 A;  4YKI A;  2I49 A;  1ELJ A;  1N7W A;  3PMV A;  4R2F A;  5CRY A;  2QMX A;  2YLN A;  1IZ1 A;  3C35 A;  1XT8 A;  3C4M A;  4H8I A;  1URS A;  3KGC A;  1B3G A;  1P1U A;  1LGB C;  3CVG A;  2ZYO A;  1M5E A;  4AB5 A;  2QJE A;  1GR2 A;  4JWX A;  2XD3 A;  4R9F A;  1TXF A;  3U94 A;  4NWD A;  5I2K B;  5HM4 B;  5KCJ B;  3IOR A;  5HBC A;  2RKM A;  4H5F A;  3UGW A;  4LON B;  2Y7K A;  4X9T A;  5J1D A;  3BKI B;  1Y4T A;  2VD3 A;  4QRZ A;  3B7D A;  1NMU A;  3A3C A;  2PT1 A;  3QSL A;  1B2H A;  4OEU A;  4QSC A;  4XIG Q;  4ZE9 A;  3KSJ A;  2VP1 A;  4IO2 A;  3MW0 A;  3K1N A;  2XXQ A;  1A40 A;  4U1O A;  5ISU A;  4NF8 A;  1NFT A;  2DE2 A;  1B5I A;  4YKK A;  4OTE A;  3U8Q A;  4ECF A;  2HZK A;  5DYH A;  1L5T A;  4FAJ A;  2LAO A;  4F22 A;  4LAT A;  4GLI A;  2FYI A;  3FAT A;  4JWO A;  1SDX A;  4LVQ A;  5AA4 A;  3KEI A;  4IGT A;  2NVU B;  4OQO A;  5ITP A;  4POW A;  4C0R A;  2E1S A;  4GVO A;  1B5J A;  3TKD A;  3IB1 A;  3S9N C;  3MVW A;  4F1Y A;  1B3E A;  1USY E;  2UXA A;  3RUM A;  3IO4 A;  4KYE A;  1M5B A;  3L6G A;  3KFM A;  3BFU A;  2O68 A;  4G4P A;  1EZ9 A;  3O6G A;  1OQG A;  2F36 A;  2QPQ A;  4EXL A;  2OBG A;  2XX7 A;  2I3W A;  1MQI A;  3T96 B;  4KHZ E;  4AB6 A;  4OET A;  5DT6 A;  4RK9 A;  3H7M A;  4UAC A;  4KQP A;  1R9L A;  1DMB A;  4F19 A;  4EF2 A;  1NNP A;  2HZL A;  4OFJ A;  5CMK A;  4ZEK A;  3IX1 A;  5KDT B;  3VV5 A;  3OEN A;  1ATG A;  3A3U A;  3E3K A;  3TUS A;  3PUV E;  4H1X A;  3RPW A;  3OO6 A;  3FJM A;  2OZZ A;  1B1H A;  1B3H A;  4EUO A;  2FA7 A;  3WAF A;  4IY5 A;  5AA2 D;  2I0C A;  3RLF E;  1TWY A;  4P0I A;  1FQF A;  3K6U A;  2YPN A;  2ZYM A;  2UVG A;  4KFQ A;  3PUX E;  2REG A;  3B6T A;  1Y20 A;  1O7T A;  5ELV A;  5K2Y A;  1B3F A;  4HCY A;  1SW4 A;  5H8H B;  5IKB A;  1LAG E;  4PQJ A;  1N76 A;  4R72 A;  1LFI A;  5KZT A;  3FXQ A;  3T9H B;  2RCA A;  1JW1 A;  1LCF A;  1S50 A;  2DYX A;  1P1Q A;  1AIV A;  3MWB A;  3U93 A;  1MPB A;  3T9X B;  2PMS A;  1MH3 A;  3V83 A;  2DWH A;  1H44 A;  4FEC A;  3TCH A;  1IXH A;  1OVB A;  4IO6 A;  1HSE A;  1MG1 A;  3IL1 B;  3IJX B;  1EZO A;  1VFE A;  3LSL A;  4YIC A;  3H06 B;  5F1Q A;  4BDN A;  4NF5 B;  3V89 B;  3O29 A;  3HV1 A;  2Y7W A;  4LA9 A;  5I2K A;  1VR5 A;  5I56 B;  4PFY A;  4F31 B;  4GOT A;  1Y9U A;  3O2A A;  5H8S A;  1Y4C A;  3AXF A;  4NE4 A;  4Q5T A;  3R6U A;  2O6A A;  3FVO A;  2H5Y A;  5LOM A;  1Z7M E;  3FD3 A;  3PGF A;  3QIM A;  2DS9 A;  4OEV A;  1H45 A;  1FQC A;  3K01 A;  1WVJ A;  4THI A;  3E13 X;  4DLD A;  4ZZE A;  1BLF A;  3QXM A;  5TP9 B;  1LAF E;  2I3V A;  3SEW A;  1JVY A;  1NH8 A;  1ZMG A;  3VLU A;  2Q8J A;  4OHN A;  2QL3 A;  3QUJ A;  2G93 A;  2UVI A;  4KPT A;  1LFG A;  2OLB A;  2ESN A;  5FHO A;  1TT1 A;  1A54 A;  5A5X B;  2O7I A;  3KSX A;  2DE3 A;  5AA4 B;  2F5X A;  3SEX A;  2X7P A;  1BIY A;  1AMF A;  4U22 A;  1Y3P A;  1LBC A;  1B51 A;  2I4C A;  3DP4 A;  3KBR A;  4R75 A;  5CM6 A;  2Z8D A;  2OWT A;  1IUD A;  3PU5 A;  3FXR A;  3LR1 A;  1RKM A;  2XXP A;  3N94 A;  2V3U A;  2AYS A;  1TFA A;  3TAJ A;  3WAE A;  3D4C A;  3CG1 A;  2ONS A;  1NH7 A;  5JK4 A;  4DCY A;  4F2Q A;  3C9H A;  3PV0 E;  3PD9 A;  3EN3 A;  1JEU A;  1DTZ A;  3TTL A;  4JSD A;  2P1S A;  1B7Z A;  2GFE A;  2H99 A;  3H6W A;  1FTJ A;  4PET A;  5KDT A;  1N7X A;  2RC7 A;  3S9E A;  1SYH A;  4GWO A;  1GTK A;  2VGQ A;  3EHS A;  3P7I A;  4HCW A;  3PUW E;  4YB6 A;  4O3C A;  4QFP A;  1FTK A;  1NNK A;  4DXU A;  1FTM A;  4G68 C;  3CFL A;  1QUL A;  3GXA A;  4IO5 A;  3W15 C;  3IOU A;  1IIW A;  3TCF A;  3O97 A;  4ZED A;  2DQV A;  1MQD A;  1SI0 A;  3O6H A;  4GIZ A;  1SW2 A;  4PE5 B;  1ANF A;  2ZNT A;  4PFT A;  5ICT A;  1JET A;  1MPD A;  1YCJ A;  4R6K A;  1S9T A;  4H65 A;  3RN8 A;  2F6P A;  2IEE A;  2OJT A;  3MPK A;  3SEU A;  3O28 A;  4YMB A;  5DVF A;  2HFB A;  5EYF A;  1B1X A;  2D3I A;  1VFD A;  2O51 A;  5CI5 A;  4YKJ A;  1GGG A;  1M5F A;  5JTY B;  1KWH A;  1FQD A;  3T66 A;  3V5A A;  3K4U A;  5I57 B;  4KR5 A;  4H6D A;  5L8D A;  1XHY A;  4G8N A;  3C33 A;  4LZ7 A;  1MRP A;  1QW0 A;  4DDD A;  2P0S A;  1WDN A;  4OWD A;  1B5H A;  4NF5 A;  3V8X B;  3DP8 A;  3FGS A;  2ALU A;  4ZEF A;  4G68 B;  3RGY A;  2XXX A;  2I6E A;  3B6W A;  4F18 A;  5I56 A;  1Y3N A;  3OO9 A;  1LAH E;  1O63 A;  4YKP A;  4MF3 A;  4JBZ A;  3QUF A;  5BUU A;  3ZKK A;  4U1Z A;  1USY H;  4KD5 A;  1SI1 A;  3VXC A;  4LUB A;  2XXV A;  1PBP A;  1DPE A;  4I62 A;  1RYX A;  5ICQ A;  3VLW A;  1MXU A;  1US5 A;  1IEJ A;  3R7X A;  3E4R A;  4C1U A;  1AH5 A;  3GZG A;  1N0T A;  4DE8 A;  3VFJ A;  1B32 A;  3OEM A;  2XXR A;  4F39 A;  3SER A;  4YB5 A;  2AL5 A;  5TP9 A;  3PPN A;  4Q0C A;  3CR9 A;  1A8E A;  3PMX A;  2KLF A;  3OXN A;  4PFW A;  3PUZ E;  3O9P A;  2XXT A;  3KN7 A;  1O64 A;  2XXW A;  4U23 A;  3SEY A;  2QS3 A;  1D9V A;  3TZA A;  5A5X A;  3HHG A;  4G8H A;  4ELO A;  2D21 A;  4KYD A;  2FNC A;  2RCB A;  4U21 A;  3ILU B;  4PFU A;  3C31 A;  4P11 A;  1M5D A;  4OZ9 A;  3KZG A;  1ZLQ A;  4TQU Q;  3OEL A;  5B70 A;  4P0G A;  1YPN A;  1B0H A;  3U1O A;  3H3G A;  3W9V A;  1HSL A;  4GL8 A;  3Q28 A;  4YU0 A;  3C36 A;  2HQ0 A;  4ELR A;  3S2V A;  2CZL A;  1OQH A;  4F3P A;  4O3B A;  3LC8 A;  3TQW A;  1PB9 A;  2DVC A;  2F7B A;  2YJP A;  4ZS9 A;  2XX8 A;  3KOS A;  4GF8 A;  1MXW A;  3CFX A;  2ONK E;  3G3I A;  4GD5 A;  4ZE8 A;  3RT6 B;  1QVS A;  3G3F A;  3N6T A;  2H25 A;  1UQW A;  2B3F A;  4PP0 A;  2Q89 A;  2Q2A A;  3R26 A;  2O7U A;  1XC1 A;  1UTB B;  3HN0 A;  2Y84 A;  1M5C A;  2Z8F A;  3PPO A;  4E0W A;  4RK2 A;  1MY4 A;  3PD8 A;  1Y3Q A;  5K2X A;  4ZEC A;  2HAV A;  2RF1 A;  5H8Q A;  3H4Z A;  5H8N B;  4H8J A;  3H03 A;  2NUV A;  1A99 A;  3M3F A;  3D4G A;  4ELP A;  4DXC A;  2ONR A;  3MZB A;  2NWJ A;  4I8C A;  4YMA A;  4QF9 A;  2X7Q A;  2QS1 A;  3DM0 A;  3MJN A;  3OSQ A;  4MFI A;  3N5L A;  2V25 A;  1B05 A;  3I3V A;  3VVF A;  3TQL A;  2ZXT A;  2PBW A;  3F11 A;  5JTY A;  3MP1 A;  4IO4 A;  3QYT A;  2F97 A;  3SES A;  1B0L A;  4X1B A;  4RY1 A;  2GHA A;  1IIT A;  2QS4 A;  5I57 A;  5AA3 A;  1SVX B;  2RC8 A;  4IGR A;  3QK6 A;  1POY 1;  4U2R A;  2H98 A;  1ZJL A;  3VDF A;  4EDP A;  4IO7 A;  3I6V A;  1P99 A;  5H8F A;  3FXU A;  4G68 A;  4F1V A;  3MVY A;  1MXZ A;  3IR1 A;  1P1O A;  3RTW B;  3UIF A;  5HPQ A;  3FJG A;  4XKQ A;  2IA4 A;  3IO6 A;  3LUY A;  2Y7R A;  3SET A;  1CB6 A;  5EHM A;  3E9X A;  1Q1K A;  1LAX A;  2F34 A;  2G29 A;  1I69 A;  1SQY A;  2GRV A;  2R71 A;  5AA2 A;  1FTO A;  1XOC A;  5L9S A;  1R6Z A;  3FAS A;  4Q8R A;  1MXV A;  1EU8 A;  4MLQ A;  4EQ7 A;  4GXS B;  3LSW A;  3G3G A;  3IB2 A;  3K2D A;  4EXK A;  2R9J A;  3MZ1 A;  3FVN A;  3SEV A;  1QJM A;  2D5W A;  3Q25 A;  3IOW A;  1A7L A;  3IK6 B;  1J1N A;  3MP8 A;  4XKN A;  2GHB A;  1B4Z A;  1N84 A;  1PB8 A;  3PPR A;  1ZTY A;  2QRY A;  1B52 A;  3RT8 A;  1PBQ A;  3PMW A;  2A5T B;  2HXW A;  4FAT A;  1WOD A;  3M3L A;  4KCC A;  1FCK A;  1T0K A;  1R1N A;  3TMG A;  3CIJ A;  4LP2 B;  2Q9T A;  2VD2 A;  2VOZ A;  1NKX A;  1SW5 A;  4BDO A;  3DEL B;  3MUQ A;  5FHM A;  4QFN A;  5FHN A;  2ZMB A;  2Z22 A;  1XS5 A;  3W9W A;  2DWA A;  1B9J A;  1P1W A;  4ESX A;  2I58 A;  5I2N A;  3TFL A;  3K02 A;  4R2B A;  4ND9 A;  4XKR A;  3I5O A;  3TDJ A;  4GXA A;  1IXG A;  1II5 A;  1GVC A;  1H43 A;  2XD2 A;  3B6Q A;  2ZYK A;  4NMY A;  3RQT A;  5CBS A;  3O66 A;  1GV8 A;  5I59 B;  3S9L C;  1MDQ A;  4F2O A;  1POT A;  5AA1 A;  3ZSF A;  3T9V A;  2DWI A;  4O3A A;  2Z23 A;  4F29 A;  3SKP A;  4M4G A;  3DP6 A;  1DPP A;  4FIM A;  4QFK A;  1UTB A;  2REJ A;  3ONM A;  4IB2 A;  4R74 A;  1MY2 A;  1LBB A;  3TTN A;  5H8Q B;  3HPI A;  4MBP A;  1NL5 A;  5H8N A;  2F7A A;  3FIR A;  4X48 A;  1Z7N E;  4NF6 A;  4TLM B;  1D3K A;  4RXL A;  3T93 B;  3MAM A;  4HS7 A;  3G7W A;  1QUI A;  5DEX A;  3K00 A;  3TPA A;  4H5G A;  3ZS6 A;  3G3H A;  4NWC A;  4XKP A;  2QMW A;  5CBR A;  2Q2C A;  4HTG A;  4NF4 B;  4POX A;  4I1D A;  1BKA A;  1D4N A;  3UP9 A;  3MVZ A;  5DTB A;  3C34 A;  4BDR A;  4KCD A;  1MQG A;  2F8D A;  4GQO A;  3THI A;  5EHS A;  2Y7I A;  1QUJ A;  4G77 A;  2HAU A;  2DE4 A;  3K6W A;  1B58 A;  1HSJ A;  2OWS A;  1UTH A;  4H0W A;  4I9D A;  5CMC A;  3MVX A;  2Z8E A;  2O69 A;  1N04 A;  3H6T A;  3VVE A;  1H76 A;  5H8F B;  3HCQ A;  3FZV A;  1IXC A;  2V3Q A;  5L9O A;  1AL3 A;  2AL4 A;  3UN6 A;  5TU0 A;  2F78 A;  2PT2 A;  4DZ1 A;  2DVZ A;  3T22 A;  3G3J A;  4NED A;  3KN8 A;  1Y1M A;  3TTK A;  4LZ8 A;  4TOZ A;  1MQJ A;  1SBP A;  4U4X A;  5AA2 B;  3T9U A;  2P2A A;  1TFD A;  1LB8 A;  1FQE A;  1NNT A;  4ELQ A;  1B4H A;  3TCG A;  3QAX A;  4X1D A;  2HCA A;  4JWY A;  2H4I A;  3GBB A;  4H67 A;  2NXO A;  1US4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...