5IM2A

Crystal structure of a trap solute binding protein from rhodoferax ferrireducens t118 (rfer_2570, target efi-510210) in complex with copurified benzoate
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
322
structure length
322
Chain Sequence
TVTLKFHTFMAPQSNVWQNMHKVWMDKVSKESGGRIQFEAYPAMQLGGSPAQLYDQAKDGVVDIIWTIPGYTAGRFPRIEVFELPFMMTNAEATSRACWEYMQTMALDEFKDTQVLALQVHGPGVFHTKDKQIKTAADLKGLKMRGPTRQVTKMLGYLGAIPVGMPLPAIPDALSKGTIDGAALPWEVVPSVKVHELTRFHSEFDPAGGALYTATFVLAMNKASYQALPPDLRKIIDNNSGLQTSGWLGRVQQAGDAAGRQAALAHKNTIYAIPALEAQEFKRKAAVVEVAWVEDMNQRGFDGRQLLTTARALIAKHSKVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Twin-arginine translocation pathway signal
publication title Crystal structure of a TRAP solute binding protein from Rhodoferax ferrireducens T118 (Rfer_2570, TARGET EFI-510210) in complex with copurified benzoate
rcsb
source organism Rhodoferax ferrireducens
total genus 125
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2016-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5im2A00
4MX6A 4OVQA 4OVSA 4P3LA 2PFYA 4PCDA 2HZLA 4P47A 4NX1A 4YICA 5I5PA 2XA5A 4PAKA 4OVTA 4X8RA 4N91A 2HPGA 4PF6A 2XXKA 3FXBA 4N6KA 4NAPA 4PBHA 4XF5A 4P8BA 4OA4A 2VPOA 4X04A 4OVRA 4P1EA 2XWOA 4PFRA 4XFEA 4N15A 2XWIA 4PAFA 4P9KA 4PFIA 3U65A 4PBQA 4N6DA 4PAIA 4MCOA 4DI4B 4PDDA 5IZZA 4MNPA 2WX9A 4N17A 4NQ8A 3B50A 4MNIA 5IGAA 2XWVA 5CM6A 2WYPA 4MAGA 3GYYA 2PFZA 4NG7A 4PGNA 4YZZA 4O7MA 4O8MA 4MIJA 4NN3A 4N4UA 2WYKA 2XWKA 4OVPA 4PE3A 4N8GA 5IM2A 2CEYA 4XEQA 5LTCA 4N8YA 4NGUA 4NHBA 5I7IA 2HZKA 4UABA 2ZZVA 2CEXA 4LN5A 4P56A 4PDHA 2ZZWA 4PETA 4MNCA 4NF0A 4MHFA 4P1LA 4DI3D 4PC9A 4MMPA 2V4CA 4MEVA 2VPNA 4OANA 4PFBA 4O94A 4PGPA 2ZZXA 4PF8A
chains in the Genus database with same CATH superfamily
1L5TA 2XD2A 4OFJA 2OJTA 1SW4A 4WEDA 1IMDA 2OWSA 4I3YA 3NOHA 3IL1B 4IO6A 1PBQA 1IMEA 1JW5A 1B05A 1XI6A 2XXTA 3V83A 3V89B 1M5EA 2P3VA 2I3VA 2MKZA 3RLFE 1BIYA 1NMUA 1HSJA 4IGTA 1PDAA 3E4RA 3CG3A 4P0GA 3BIGA 4FAJA 2FHYA 1AMFA 1OVTA 1MQDA 5I57B 2Z22A 4PFYA 4N07A 1MM6A 1NFTA 4MNPA 4FJPA 3FVOA 1FQBA 4I3EA 3P7IA 4U23A 1EZOA 4OFOA 3S4UA 3MWBA 1FPDA 1CB6A 1FTAA 3C34A 3OSQA 1BKAA 3IAZA 4H46A 3MQ9A 4JDFA 4RPOA 3PMVA 2ZXTA 1P99A 2XXWA 2F97A 4LQ2A 4F19A 2D5WA 1ATGA 3RYDA 4LN5A 4GBVA 4OESA 4FATA 3USDA 2RC7A 4ZEDA 4HE2A 4KYEA 1IXCA 3U1OA 3BFUA 2PT2A 2AL4A 3FATA 2REJA 3B6WA 3IJOB 3FGSA 4OYVA 2LAOA 4P3LA 3U92A 3IX1A 1INPA 4X1BA 4PCDA 2HZLA 3RT8A 1MQGA 4MJOA 4JWYA 4R75A 3JV9A 1DBZA 3ISPA 4NF5B 1QKAA 1JETA 2E0SA 3GBBA 1ZJLA 2DXRA 5IZ3B 4R73A 4DDDA 4OA4A 1MY3A 4KR5A 3LV0A 5BWJA 1D9QA 5H8FB 1AL3A 5T3JA 1II5A 1NV5A 1B1HA 3SEXA 3ZKKA 1FBFA 2O1MA 3GLBA 3T0JA 4RNSA 3QSLA 4N6DA 1OIBA 4H6DA 2V3QA 3RNNA 3H7MA 4BDLA 3B50A 1TT1A 3C9HA 2VT5A 4GX6A 3FBPA 1FCKA 3TODA 3PMXA 4OERA 1B32A 3K2DA 1DK4A 3T96B 3DELB 4QSEA 4DIGA 2VD3A 1MXWA 1VSOA 3O97A 4GWUA 4BDOA 4PTKA 3Q26A 3U8QA 5CMMA 2ONSA 5FHMA 2ZNTA 5I2KA 4ESWA 1LAHE 1MPCA 1NUYA 2I3WA 3MPLA 4LUBA 3MZ9A 3VE1B 2FYIA 3U94A 2A5TB 3VXCA 3FJ7A 1SW5A 1Y3PA 3C31A 3B6QA 1FBPA 4MX6A 1O64A 4R74A 4FBPA 4G8HA 3UP9A 4EQBA 1LEVA 4Z0IA 2WKYA 4LZ5A 1LGBC 3OELA 1FQCA 3FXUA 1B7HA 1MS7A 3OSRA 5AA3A 1N04A 4GOTA 1I6AA 2GFEA 3CFLA 1Y3QA 4FEDA 4QRZA 3THIA 5AA4A 4ELPA 4QHQA 5I58A 4G68B 1JW4A 4YKKA 2XXVA 2PCRA 4OMBA 4R6YA 3QUJA 4LVQA 1IMBA 1SPIA 4OEUA 4F2QA 2P1SA 4MF3A 1B4HA 5AA2B 4P11A 3SZPA 5LOMA 2Y7IA 5IGAA 3RTFB 3TTLA 3HV1A 4POXA 4E0XA 3KN3A 3IJXB 3GXAA 4IGRA 4THIA 4RYAA 1MY1A 2HXWA 3LSFB 4XIGQ 1URGA 4OVPA 2H98A 4PE3A 4HE0A 5H8HA 5DVIA 3RPLB 4QFPA 5DVFA 1LAFE 2ZYKA 4RK2A 4UABA 2ZMBA 3FUZA 4H5GA 1MH3A 3S9NC 3CSGA 4LONB 4N81A 1AOVA 2QSXA 4GWWA 1A7LA 1NH7A 1LFIA 5H8QA 2H25A 5AA2D 1QUKA 2F78A 2DOJA 5K2XA 2NOOA 4U2RA 5I59A 4ZZEA 2OK2A 4C0RA 3A29A 4OWDA 4TQUQ 1MPBA 4O3BA 4ZEKA 1MY2A 4F22A 1GTKA 3MVXA 1IXGA 3LR1A 4IR8A 3KC1A 2DE3A 5JEIA 3O9PA 2HPGA 3MUQA 3WAFA 5L9SA 4NF6A 4GL0A 1FQEA 4XKNA 4QXDA 2G93A 2YLNA 4PFRA 3N94A 1SI0A 3FJGA 3IO4A 2O6AA 3KOTA 1N84A 2VD2A 2O84X 3CFZA 4PAIA 3S9LC 5IZ1A 3MC2A 3OO8A 2E1SA 1H43A 1M5BA 1LCTA 1LFGA 2CZHA 3IB2A 2F7AA 2XXIA 3B6TA 2XX7A 3TCGA 1UQWA 3V8XB 1A8EA 1G0HA 1ELJA 1LBXA 4YZZA 3FXQA 5EHSA 3TKDA 3PGFA 4PE5B 4F2OA 3IOTA 3W9WA 1NH8A 4NHBA 2B4MA 3TTKA 1MY0A 4YKPA 1WODA 1LBCA 4PDHA 1TFDA 3M3KA 1USYH 1YPNA 1NV2A 1YYZA 4H8IA 3FVKA 3TTMA 4QFOA 4JWXA 3HHFA 4JBZA 4M1VA 1QUIA 3TTNA 5KDTA 2QFLA 4RXLA 5ICTA 3MZBA 1FTKA 3K01A 2BJIA 5I5PA 5ELVA 3E3KA 2F3BA 4H45A 2NUVA 2HQ0A 1WVJA 2O7IA 3KJTA 3K00A 3H03A 4OFLA 4GX4A 4QBAA 2F7CA 1IIWA 1B3GA 4IO2A 1JEUA 3OEKA 1LBYA 3FD3A 2P2AA 4X04A 2Q74A 1H3DA 2B4LA 3SESA 5EYFA 5I3SA 4PFUA 1OMPA 3S2VA 1MDQA 1IITA 4PBQA 4PP0A 1TFAA 1H76A 4EDPA 1TWYA 4XKPA 5HBCA 3HPIA 3KBZA 3RTWB 4ZEBA 1EZPA 3MPKA 3VV5A 4U22A 1FPFA 4KYSA 3HFUA 4U1ZA 4MAGA 5TPAB 2B3FA 4NG7A 4O8MA 3M3LA 2V3UA 1POTA 3TQWA 5I56A 1XHYA 1MRPA 3UN6A 2OLBA 4FORA 3D1RA 5IM2A 3PPQA 2CZLA 1OQHA 1FRPA 3C36A 3ROJA 5K2YA 1GVCA 2DDKA 5I2NB 2B3BA 2NWJA 3H4ZA 4IY5A 2QS4A 3Q29A 5KZTA 3HCQA 3CR9A 2XX9A 3CSBA 5KCJA 2I58A 2QVVA 4WEPA 4PFBA 4YICA 5DT6A 1LLSA 1Y3NA 1SYHA 1PB8A 1VE4A 4F3PA 3QAXA 4ZECA 1B51A 2D21A 2NXOA 1PB9A 1AIVA 3S9EA 2UVIA 3MVYA 4PFWA 3T1BA 5AA1A 2DE2A 2Z23A 1PB7A 2VP1A 3VLUA 1IZ1A 5EQ9A 2UVHA 3O6IA 3Q27A 5EQAA 5FBPA 1D9VA 2XXXA 4F1YA 3WAEA 4PFIA 5JTYB 1UIUA 4O3CA 3H06B 1VFEA 3TDJA 4I8CA 4PDDA 4E0WA 3G3JA 5CC2A 1URSA 4OZ9A 4KFQA 1LBVA 2OWTA 2FA7A 1SI1A 3TCFA 5IAIA 2FBPA 3KN8A 3UK4A 2R9JA 4OQOA 5ISUA 3G3IA 1R6ZA 2DWAA 1P1OA 4GFRA 2OX3A 4XEQA 3CI8A 5CBRA 1B3EA 3G3FA 1S7YA 3QIMA 3KSXA 1XC1A 1B9JA 3SEWA 3CIJA 4KCDA 1BP5A 2CZKA 1B5JA 2BJJX 4KI0E 4ZE9A 3KN7A 5IKBA 4FE8A 2Z8EA 4G68C 4LA9A 3W15C 3R26A 2Q9TA 4GF8A 3H6UA 3FVNA 5AE4A 5TP9A 1US5A 1HSLA 3LC8A 2XA5A 3PMWA 3V5AA 2Q2CA 1MG1A 4EUOA 4PFTA 1QGXA 3IORA 2F6GA 2F3DA 4KHZE 4OTEA 5HM4B 2X26A 3K1NA 5CBSA 4U4SA 1B0HA 3I6VA 1MXUA 1FPIA 2WBDA 4G2ZA 4DCYA 5IZZA 4WKMA 4EQ7A 4JSOA 3OO9A 1LBZA 2D3IA 2ZYMA 3R7XA 4ESXA 3PPNA 4KQPA 2RC8A 5F7VA 3KG2A 4OXVA 5CRYA 2DS9A 3U72A 3F11A 2HHMA 1H44A 2XWKA 3DLNA 4MH5A 3AXFA 3T9VA 1FPLA 1DSNA 2AIXA 2DQVA 2ZZVA 3GZGA 1ZKBA 2PBWA 3SKPA 4IO5A 3A3CA 3IB1A 4DI3D 1LAGE 1B7UA 2H9BA 2RC9A 2QPQA 2QS2A 3EQ1A 5H8FA 4XXUA 2V3TA 2Q2AA 4AB6A 2PYYA 4PGPA 2VGQA 2ZZXA 4Q0CA 3RT6B 1VFDA 4LP2B 2GH9A 1UTBA 2HCAA 2IA4A 3LUYA 1NUWA 3MP1A 1Y9UA 2QS1A 1R1NA 1FBDA 4F29A 4GIZA 3PTYA 2ABHA 5L9OA 1B1XA 4RK9A 1KA0A 2O7UA 4F1VA 4F31B 3DP8A 2VPOA 4BDRA 3QK6A 3RY3A 4DXUA 1Y20A 4XKQA 4N15A 1LFHA 2Y7PA 1NV6A 3FV2A 3PUZE 5A5XA 1OQGA 1ZU0A 4KD5A 2Q89A 5I58B 2XXYA 5J16A 1ZIUA 4MCOA 3HO7A 5ET5A 4NF8A 3H6VA 4BLAA 2HAVA 1RYXA 3ODBA 3N6UA 1POY1 3O66A 4NTLA 2REGA 1YAEA 3C4MA 4BDMA 3SEVA 3OEMA 4R9GA 3IFCA 3E9XA 1JP4A 4GD5A 4GWOA 2P3NA 4G8MA 5H8HB 1YZ0A 4P56A 3VVDA 1SYIA 4DXBA 3O29A 3OMBA 1ZLQA 3TAJA 2ZNUA 2M8CA 2F35A 1MXYA 1MXXA 5H8QB 4LQ5A 4GL8A 2XD3A 1N0TA 1IXIA 5DYHA 3E78A 1WDNA 4H5FA 3K1PA 4QF9A 2O51A 3FXRA 3UIFA 1Y4TA 1CE2A 5H8NB 1JNFA 4M4GA 4YKJA 3U93A 2ONKE 5ET6A 2DWIA 4P1EA 2O69A 1FJ6A 3PUWE 3IOVA 2I0BA 4EXKA 4F3SA 3K6WA 3VVEA 1LBBA 3Q25A 1NI9A 1OLCA 3VXBA 5FHNA 3RUMA 1I6BA 4YKIA 2QMXA 4YU0A 3ONMA 3T22A 1DOTA 1Y1ZA 2F34A 4GLIA 2WYPA 3VFJA 3OO7A 4UACA 3RGYA 1QJMA 3PUVE 4I62A 2QL3A 4G61A 2V84A 2JJKA 1A54A 1FTOA 4NN3A 3O6GA 4POWA 4HTGA 4DXCA 3T9XB 1RYOA 2AL5A 4DE8A 1FJ9A 3TPAA 2Y7RA 4RA1A 5FHOA 4NF4A 4HW8A 4AB5A 1KWHA 4GBWA 4TOZA 3IOUA 3ECRA 4G8NA 1GGGA 4GQOA 4NEDA 4R2BA 2OZZA 2F6PA 1RDXA 4LATA 1US4A 2YJPA 3K0VA 5H8SA 4U4XA 3D4GA 1B46A 5KDTB 4F3GA 4G4PA 4KYDA 4X8RA 2AYSA 1FBEA 1B6HA 2Q8JA 4NAPA 3MJNA 4AS4A 2X7QA 2R8TA 3KEIA 2I6EA 1Q35A 3PD9A 2HEUA 1QUJA 3HSTA 3L6GA 3QUFA 1DMBA 3VLWA 3DP4A 3O6HA 5ITPA 2Z8FA 1DTGA 5CI5A 3TFLA 3T9HB 4NQ8A 2XWVA 4ELOA 1SW2A 4TLLB 4MLQA 1B2HA 4HXVA 3OD7A 4XTCQ 1P1UA 1IEJA 4H0WA 3E79A 2QRYA 4GWXA 1FTMA 4C1TA 3QXMA 1I6QA 1LCFA 5I56B 3Q28A 1YXIA 2I4BA 4NMYA 3MW0A 3MP6A 3KJ7A 5I84A 4MNCA 1LAXA 3HN0A 5DEXA 1FPGA 3UGWA 1AH5A 1NV3A 4MMPA 2H5YA 2UVJA 2R6GE 2XXUA 2F7BA 1UTHB 3ZSFA 2H4IA 3LSWA 1NL5A 4YMBA 1O63A 3UORA 1S50A 2DP8A 4Q30B 1NNPA 3O28A 1IMAA 2IEEA 3C33A 4H1XA 1EYIA 4OVTA 5EHMA 4ZDMA 4LZ7A 1B0LA 3FXBA 4N6KA 5TPAA 2Q8MA 1FBHA 1MDP1 2FVZA 3OENA 1SBPA 2FIXA 3M8UA 4AS5A 3L6HA 4O7IA 4QSCA 4K3FA 1MPDA 1A40A 4I1DA 3G3HA 2ANJA 2RCAA 3IO6A 5B7DA 3H6WA 4IY6A 5CM6A 5ET8A 1B5IA 3B7DA 3LSLA 1A55A 1RDYA 2X7PA 1M5CA 1B3FA 3K6XA 4WXJA 4UA8A 1NNTA 1CNQA 4IB2A 3LBSA 1PC3A 3TQLA 2I48A 1D3KA 1BTJA 2CEYA 3PU5A 3SETA 3TMGA 5CMBA 1EYJA 4F18A 4MLVA 4PQJA 3KGCA 3ILUB 4QFNA 4NF0A 4P1LA 3JZJA 4PC9A 2F5XA 1LB9A 4AQ4A 2UYFA 4U1OA 1S9TA 4PF8A 2PVUA 2O68A 2GHBA 5JTYA 2WBBA 2DWJA 2PMSA 4P47A 5ITOA 5EQ7A 1FPBA 1G0IA 1A99A 1XT8A 3KC0A 4RY1A 2HFBA 5TP9B 4ND9A 1H45A 5FTIA 1O7TA 2Y7KA 1NKXA 4QSDA 1NUXA 1IUDA 2DWHA 3PD8A 3C35A 1NV4A 2XXRA 5I57A 4H65A 3EN3A 4ZS9A 1FTJA 2HAUA 2OWZA 2DE4A 5BUUA 1K9ZA 2H99A 1SQYA 3H3GA 5JK4A 4ECFA 1FQAA 2XXPA 3IR1A 1PBPA 1XOCA 3S9MC 1B5HA 2RKMA 2I0CA 4OEVA 2GRVA 1URDA 4RPNA 4TLMB 3MVZA 3QYTA 2QJEA 3PPPA 3RQTA 1VR5A 5A5LA 1RKMA 4X1DA 1B4ZA 4JXIA 4GXSB 4MIJA 2QVUA 2DVZA 2WYKA 1BLFA 1NV0A 1Y4CA 3EF7A 3T66A 3MVWA 1T0KA 1ZMGA 3FJMA 4ELQA 3MBPA 3GBAA 1M5FA 5L8DA 3M3FA 4R9FA 1EH3A 1FQFA 1XVYA 2ZZWA 4QFLA 4ZE8A 1A8FA 3CRBA 2YPNA 1JVYA 1KA1A 4I40A 4N6PA 2VPNA 4O94A 2PX1A 4YB7A 4OVQA 4NF5A 1RDZA 5EYHA 1MQIA 3TTRA 5IZ3A 2QVRA 1IXHA 3H6TA 4PAKA 5I2KB 1JVXA 2A5SA 2I49A 1UTBB 1EU8A 4PBHA 1FPEA 1F9BA 3TZAA 5ESYA 1UIVA 2XWOA 4GWSA 5EYGA 4I9DA 4DLDA 2QS3A 3T9UA 2Y5KA 3OXNA 2RCBA 5F1QA 4ISUA 1OVBA 4KPTA 4G77A 4DI4B 1Z7NE 2B65A 5A5XB 1ZBMA 4EF2A 1FPJA 1B3LA 1SVXB 4NF8B 3JYRA 4MFIA 4O7MA 4IO7A 4N4UA 4H8JA 4HCYA 1FSAA 5AA4B 1DPEA 4EF1A 1Q1KA 2VOZA 4ZEIA 3T93B 4LZ8A 4O3AA 1QULA 1R9QA 4NGUA 3SERA 3ILTB 3MSTA 2ESNA 2DSFA 5DVJA 1B40A 1LB8A 1TXFA 2A5TA 2DVCA 3FIRA 4RJZA 3CFXA 3CHGA 4BDQA 4R72A 4PETA 3OOAA 4MHFA 4EQ9A 2I4CA 3K6UA 2XXHA 4JVDA 2O1LA 1MQJA 3O2AA 3EKIA 2OBGA 3KZGA 2CMOA 4OANA 1MQHA 4GX3A 3G3KA 4OVSA 1DCUA 2FIEA 3TELA 5M2VA 4YB6A 1YCJA 4U21A 3FZVA 3ZS6A 4NX1A 4R2FA 3FV1A 5FTHA 3PPOA 4Z7EA 1JEVA 4GWZA 5CMKA 2Y7WA 3IB0A 2GHAA 3VDFA 4YMAA 2XXKA 4F1UA 4OVJA 4NWCA 1Y1MA 3K6VA 4G68A 3E13X 3KSJA 1JW1A 1K9YA 3IK6B 3OO6A 3MP8A 1MM7A 5I59B 4R6KA 5AA2A 5DTBA 3N26A 1LSTA 3SDFA 4C1UA 1IMCA 3DP6A 4P0IA 4HCWA 4DZ1A 2WX9A 2OCUA 3N5LA 4MNIA 3QMFA 2ZYOA 2HXRA 4X9TA 4YAHX 2F36A 1P1QA 2NVUB 1I69A 3VVFA 4NF6B 4HE1A 4JSDA 1GV8A 2KR0A 3RPLA 1PEBA 4FECA 1SDXA 4FIMA 2ZNSA 2RF1A 4OHNA 5LTCA 1XVXA 4N8YA 1FBCA 3EHUA 1HSEA 3KBRA 1OLAA 2R71A 4ZZAA 3IFAA 5H8NA 1EZ9A 1NUZA 3PPRA 2CEXA 1USYE 3K4UA 4BDNA 3ZKLA 3PV0E 3DM0A 1NV1A 3B8BA 4NF4B 4HS7A 3C32A 1NNFA 2L5VA 1NNKA 1ANFA 3TEPA 5ICQA 2PFYA 1MXZA 1IMFA 1P1WA 4OETA 3IOWA 1B58A 1YTVA 1DPPA 1FQDA 1N3WA 1VDWA 4GXAA 5ET7A 1EYKA 4OVRA 1MXVA 2FNCA 3EHTA 5EQ8A 3HHGA 1BK4A 4NWDA 2KQZA 2Y5LA 4IO3A 3W9VA 2XXQA 4DCXA 1M5DA 3G7WA 3RPWA 2PT1A 1N7XA 4N17A 2KLFA 4GRKA 1DTZA 3TCHA 4R6HA 5DW8A 3RN8A 3GYYA 5HPQA 3SEYA 1D9YA 2VHAA 1D4NA 1Z7ME 3BBRA 3BKIB 1KZ8A 5L9MA 1AWBA 1P1NA 3LUZA 2UYEA 1N3XA 1FW0A 4ONYA 4JVIA 4F39A 4OENA 4N8GA 5CMCA 4NE4A 5I7IA 4Q5TA 2HZKA 4JWOA 5F24A 1ZTYA 2ALUA 3VLVA 4ZEFA 2CZIA 3BIHA 1MH4A 2THIA 2DXYA 1IQ7A 4KCCA 3G3GA 1N7WA 3I3VA 4H67A 4MEVA 4QFKA 4XKRA 3SEUA 5DEXB 3U65A 2P0SA 2QMWA 4MBPA 3TYHA 1MY4A 1FTLA 2UVGA 2ONRA 3MYUA 3PUYE 2Q88A 3MAMA 2UXAA 3KFMA 1N76A 2RINA 4N91A 4PF6A 1QW0A 2V25A 4XF5A 4P8BA 3K1MA 5J1DA 3PUXE 1SD3A 3CVGA 3MZ1A 1GR2A 5KCJB 4XFEA 4ELRA 4GWYA 2XWIA 4PAFA 4P9KA 3FVGA 4FEBA 5LDZA 1B52A 3A3UA 1B7ZA 3TUSA 4N13A 3CG1A 3EPEA 4EXLA 3FASA 4JB7A 3R6UA 4IO4A 5B70A 1QVSA 1B3HA 2F8DA 4L17A 3UA8A 4PGNA 2PFZA 1QKBA 1JQFA 1NV7A 1UTHA 1LBWA 1FPKA 4YB5A 1SW1A 4X48A 4Q8RA 5I2NA 2WEFA 1Q9DA 3EHSA 2Z8DA 3BFTA 1FBGA 2ZYNA 3N6TA 2G29A 4JVCA 2V93A 3A09A 2GQ1A 2Y84A 3D4CA 3K02A 4KXPA 1J1NA 3KOSA 2W7YA 1R9LA 5TU0A 3LSXA 2XHDA 2XX8A 4GVOA 4F3BA 1XS5A 2V4CA 2DYXA 3I5OA
chains in the Genus database with same CATH topology
4OVQA 2QFLA 1RDZA 3E78A 5EYHA 1IMDA 2BJIA 4I3YA 5IZ3A 5I5PA 2QVRA 3NOHA 2F3BA 4H45A 4PAKA 1IMEA 1XI6A 4GX4A 2P3VA 4QBAA 4PBHA 1FPEA 1LBYA 2MKZA 5ET6A 4X04A 5ESYA 2Q74A 4P1EA 2XWOA 4GWSA 5EYGA 1FJ6A 2B4LA 5I3SA 2Y5KA 3BIGA 2FHYA 1NI9A 4PBQA 4DI4B 4MNPA 3KBZA 4I3EA 1FPFA 2WYPA 3HFUA 4MAGA 1FPDA 1FPJA 4G61A 4NG7A 2JJKA 4O7MA 1FTAA 4O8MA 4NN3A 4N4UA 4HCYA 1FSAA 3D1RA 5IM2A 4H46A 1FRPA 4NGUA 3ROJA 3MSTA 1FJ9A 2DDKA 4F19A 3RYDA 4LN5A 4GBVA 3CHGA 4GBWA 4PETA 4HE2A 4MHFA 4JVDA 3EKIA 2QVVA 4OANA 4PFBA 1RDXA 4YICA 4GX3A 4OVSA 4P3LA 1DCUA 2FIEA 1INPA 4PCDA 2HZLA 4NX1A 4MJOA 1DBZA 3ISPA 4GWZA 4X8RA 3T1BA 1FBEA 2XXKA 4F1UA 5IZ3B 4NAPA 2DE2A 4AS4A 4OA4A 2R8TA 3LV0A 5EQ9A 1D9QA 1K9YA 5EQAA 5T3JA 5FBPA 1NV5A 4PFIA 1FBFA 3T0JA 4N6DA 1IMCA 4PDDA 4HCWA 2WX9A 2V3QA 4NQ8A 3B50A 4MNIA 3QMFA 2VT5A 4GX6A 2XWVA 3FBPA 2HXRA 4X9TA 4HXVA 1LBVA 4HE1A 1DK4A 3RPLA 2KR0A 2FBPA 3E79A 4GWXA 4GWUA 4PTKA 2OX3A 4XEQA 5LTCA 4N8YA 1FBCA 3IFAA 1YXIA 1NUZA 2CEXA 1NUYA 4MNCA 2CZKA 1FPGA 1NV1A 1NV3A 3B8BA 4MMPA 2L5VA 1FBPA 4MX6A 2PFYA 2Q9TA 1IMFA 4FBPA 1LEVA 2XA5A 1IMAA 1EYIA 4OVTA 3FXBA 4N6KA 2Q8MA 1FBHA 2FVZA 1QGXA 1VDWA 5ET7A 1EYKA 2F3DA 2FIXA 4OVRA 4AS5A 4O7IA 5EQ8A 1BK4A 2KQZA 2PCRA 2Y5LA 1FPIA 2WBDA 3W9VA 1IMBA 1SPIA 5IZZA 4N17A 3SZPA 5IGAA 1LBZA 5CM6A 5ET8A 5DW8A 3GYYA 1RDYA 1KZ8A 1AWBA 3LUZA 1CNQA 2HHMA 2XWKA 4JVIA 4OVPA 4PE3A 4N8GA 4HE0A 2CEYA 3RPLB 5I7IA 1FPLA 2HZKA 1EYJA 5F24A 4UABA 2ZZVA 4F18A 4N81A 2CZIA 3BIHA 4GWWA 4NF0A 4P1LA 4DI3D 4PC9A 2F5XA 2QPQA 4MEVA 3U65A 4PGPA 2ZZXA 4PF8A 3MYUA 3A29A 2WBBA 4P47A 5EQ7A 1FPBA 1G0IA 1NUWA 3KC0A 4IR8A 3KC1A 2DE3A 1FBDA 4N91A 2HPGA 4PF6A 3PTYA 4XF5A 4P8BA 1KA0A 5J1DA 1NUXA 4F1VA 2VPOA 4QXDA 1NV4A 4PFRA 4XFEA 4N15A 4GWYA 2XWIA 4PAFA 4P9KA 1NV6A 2OWZA 2DE4A 1K9ZA 5LDZA 5JK4A 5J16A 4PAIA 4MCOA 5IZ1A 5ET5A 2CZHA 5A5LA 1G0HA 2PFZA 4PGNA 1NV7A 4YZZA 1LBXA 4MIJA 2QVUA 1LBWA 1FPKA 2DVZA 2WYKA 1NV0A 2WEFA 3W9WA 3IFCA 1Q9DA 1FBGA 4NHBA 2B4MA 1JP4A 4JVCA 2GQ1A 2P3NA 4KXPA 1YZ0A 4P56A 4PDHA 1NV2A 2ZZWA 1YYZA 1KA1A 4I40A 2V4CA 2VPNA 4M1VA 4O94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MX6 A;  4OVQ A;  4OVS A;  4P3L A;  2PFY A;  4PCD A;  2HZL A;  4P47 A;  4NX1 A;  4YIC A;  5I5P A;  2XA5 A;  4PAK A;  4OVT A;  4X8R A;  4N91 A;  2HPG A;  4PF6 A;  2XXK A;  3FXB A;  4N6K A;  4NAP A;  4PBH A;  4XF5 A;  4P8B A;  4OA4 A;  2VPO A;  4X04 A;  4OVR A;  4P1E A;  2XWO A;  4PFR A;  4XFE A;  4N15 A;  2XWI A;  4PAF A;  4P9K A;  4PFI A;  3U65 A;  4PBQ A;  4N6D A;  4PAI A;  4MCO A;  4DI4 B;  4PDD A;  5IZZ A;  4MNP A;  2WX9 A;  4N17 A;  4NQ8 A;  3B50 A;  4MNI A;  5IGA A;  2XWV A;  5CM6 A;  2WYP A;  4MAG A;  3GYY A;  2PFZ A;  4NG7 A;  4PGN A;  4YZZ A;  4O7M A;  4O8M A;  4MIJ A;  4NN3 A;  4N4U A;  2WYK A;  2XWK A;  4OVP A;  4PE3 A;  4N8G A;  5IM2 A;  2CEY A;  4XEQ A;  5LTC A;  4N8Y A;  4NGU A;  4NHB A;  5I7I A;  2HZK A;  4UAB A;  2ZZV A;  2CEX A;  4LN5 A;  4P56 A;  4PDH A;  2ZZW A;  4PET A;  4MNC A;  4NF0 A;  4MHF A;  4P1L A;  4DI3 D;  4PC9 A;  4MMP A;  2V4C A;  4MEV A;  2VPN A;  4OAN A;  4PFB A;  4O94 A;  4PGP A;  2ZZX A;  4PF8 A; 
#chains in the Genus database with same CATH topology
 1L5T A;  2XD2 A;  4OFJ A;  2OJT A;  1SW4 A;  4WED A;  1IMD A;  2OWS A;  4I3Y A;  3NOH A;  3IL1 B;  4IO6 A;  1PBQ A;  1IME A;  1JW5 A;  1B05 A;  1XI6 A;  2XXT A;  3V83 A;  3V89 B;  1M5E A;  2P3V A;  2I3V A;  2MKZ A;  3RLF E;  1BIY A;  1NMU A;  1HSJ A;  4IGT A;  1PDA A;  3E4R A;  3CG3 A;  4P0G A;  3BIG A;  4FAJ A;  2FHY A;  1AMF A;  1OVT A;  1MQD A;  5I57 B;  2Z22 A;  4PFY A;  4N07 A;  1MM6 A;  1NFT A;  4MNP A;  4FJP A;  3FVO A;  1FQB A;  4I3E A;  3P7I A;  4U23 A;  1EZO A;  4OFO A;  3S4U A;  3MWB A;  1FPD A;  1CB6 A;  1FTA A;  3C34 A;  3OSQ A;  1BKA A;  3IAZ A;  4H46 A;  3MQ9 A;  4JDF A;  4RPO A;  3PMV A;  2ZXT A;  1P99 A;  2XXW A;  2F97 A;  4LQ2 A;  4F19 A;  2D5W A;  1ATG A;  3RYD A;  4LN5 A;  4GBV A;  4OES A;  4FAT A;  3USD A;  2RC7 A;  4ZED A;  4HE2 A;  4KYE A;  1IXC A;  3U1O A;  3BFU A;  2PT2 A;  2AL4 A;  3FAT A;  2REJ A;  3B6W A;  3IJO B;  3FGS A;  4OYV A;  2LAO A;  4P3L A;  3U92 A;  3IX1 A;  1INP A;  4X1B A;  4PCD A;  2HZL A;  3RT8 A;  1MQG A;  4MJO A;  4JWY A;  4R75 A;  3JV9 A;  1DBZ A;  3ISP A;  4NF5 B;  1QKA A;  1JET A;  2E0S A;  3GBB A;  1ZJL A;  2DXR A;  5IZ3 B;  4R73 A;  4DDD A;  4OA4 A;  1MY3 A;  4KR5 A;  3LV0 A;  5BWJ A;  1D9Q A;  5H8F B;  1AL3 A;  5T3J A;  1II5 A;  1NV5 A;  1B1H A;  3SEX A;  3ZKK A;  1FBF A;  2O1M A;  3GLB A;  3T0J A;  4RNS A;  3QSL A;  4N6D A;  1OIB A;  4H6D A;  2V3Q A;  3RNN A;  3H7M A;  4BDL A;  3B50 A;  1TT1 A;  3C9H A;  2VT5 A;  4GX6 A;  3FBP A;  1FCK A;  3TOD A;  3PMX A;  4OER A;  1B32 A;  3K2D A;  1DK4 A;  3T96 B;  3DEL B;  4QSE A;  4DIG A;  2VD3 A;  1MXW A;  1VSO A;  3O97 A;  4GWU A;  4BDO A;  4PTK A;  3Q26 A;  3U8Q A;  5CMM A;  2ONS A;  5FHM A;  2ZNT A;  5I2K A;  4ESW A;  1LAH E;  1MPC A;  1NUY A;  2I3W A;  3MPL A;  4LUB A;  3MZ9 A;  3VE1 B;  2FYI A;  3U94 A;  2A5T B;  3VXC A;  3FJ7 A;  1SW5 A;  1Y3P A;  3C31 A;  3B6Q A;  1FBP A;  4MX6 A;  1O64 A;  4R74 A;  4FBP A;  4G8H A;  3UP9 A;  4EQB A;  1LEV A;  4Z0I A;  2WKY A;  4LZ5 A;  1LGB C;  3OEL A;  1FQC A;  3FXU A;  1B7H A;  1MS7 A;  3OSR A;  5AA3 A;  1N04 A;  4GOT A;  1I6A A;  2GFE A;  3CFL A;  1Y3Q A;  4FED A;  4QRZ A;  3THI A;  5AA4 A;  4ELP A;  4QHQ A;  5I58 A;  4G68 B;  1JW4 A;  4YKK A;  2XXV A;  2PCR A;  4OMB A;  4R6Y A;  3QUJ A;  4LVQ A;  1IMB A;  1SPI A;  4OEU A;  4F2Q A;  2P1S A;  4MF3 A;  1B4H A;  5AA2 B;  4P11 A;  3SZP A;  5LOM A;  2Y7I A;  5IGA A;  3RTF B;  3TTL A;  3HV1 A;  4POX A;  4E0X A;  3KN3 A;  3IJX B;  3GXA A;  4IGR A;  4THI A;  4RYA A;  1MY1 A;  2HXW A;  3LSF B;  4XIG Q;  1URG A;  4OVP A;  2H98 A;  4PE3 A;  4HE0 A;  5H8H A;  5DVI A;  3RPL B;  4QFP A;  5DVF A;  1LAF E;  2ZYK A;  4RK2 A;  4UAB A;  2ZMB A;  3FUZ A;  4H5G A;  1MH3 A;  3S9N C;  3CSG A;  4LON B;  4N81 A;  1AOV A;  2QSX A;  4GWW A;  1A7L A;  1NH7 A;  1LFI A;  5H8Q A;  2H25 A;  5AA2 D;  1QUK A;  2F78 A;  2DOJ A;  5K2X A;  2NOO A;  4U2R A;  5I59 A;  4ZZE A;  2OK2 A;  4C0R A;  3A29 A;  4OWD A;  4TQU Q;  1MPB A;  4O3B A;  4ZEK A;  1MY2 A;  4F22 A;  1GTK A;  3MVX A;  1IXG A;  3LR1 A;  4IR8 A;  3KC1 A;  2DE3 A;  5JEI A;  3O9P A;  2HPG A;  3MUQ A;  3WAF A;  5L9S A;  4NF6 A;  4GL0 A;  1FQE A;  4XKN A;  4QXD A;  2G93 A;  2YLN A;  4PFR A;  3N94 A;  1SI0 A;  3FJG A;  3IO4 A;  2O6A A;  3KOT A;  1N84 A;  2VD2 A;  2O84 X;  3CFZ A;  4PAI A;  3S9L C;  5IZ1 A;  3MC2 A;  3OO8 A;  2E1S A;  1H43 A;  1M5B A;  1LCT A;  1LFG A;  2CZH A;  3IB2 A;  2F7A A;  2XXI A;  3B6T A;  2XX7 A;  3TCG A;  1UQW A;  3V8X B;  1A8E A;  1G0H A;  1ELJ A;  1LBX A;  4YZZ A;  3FXQ A;  5EHS A;  3TKD A;  3PGF A;  4PE5 B;  4F2O A;  3IOT A;  3W9W A;  1NH8 A;  4NHB A;  2B4M A;  3TTK A;  1MY0 A;  4YKP A;  1WOD A;  1LBC A;  4PDH A;  1TFD A;  3M3K A;  1USY H;  1YPN A;  1NV2 A;  1YYZ A;  4H8I A;  3FVK A;  3TTM A;  4QFO A;  4JWX A;  3HHF A;  4JBZ A;  4M1V A;  1QUI A;  3TTN A;  5KDT A;  2QFL A;  4RXL A;  5ICT A;  3MZB A;  1FTK A;  3K01 A;  2BJI A;  5I5P A;  5ELV A;  3E3K A;  2F3B A;  4H45 A;  2NUV A;  2HQ0 A;  1WVJ A;  2O7I A;  3KJT A;  3K00 A;  3H03 A;  4OFL A;  4GX4 A;  4QBA A;  2F7C A;  1IIW A;  1B3G A;  4IO2 A;  1JEU A;  3OEK A;  1LBY A;  3FD3 A;  2P2A A;  4X04 A;  2Q74 A;  1H3D A;  2B4L A;  3SES A;  5EYF A;  5I3S A;  4PFU A;  1OMP A;  3S2V A;  1MDQ A;  1IIT A;  4PBQ A;  4PP0 A;  1TFA A;  1H76 A;  4EDP A;  1TWY A;  4XKP A;  5HBC A;  3HPI A;  3KBZ A;  3RTW B;  4ZEB A;  1EZP A;  3MPK A;  3VV5 A;  4U22 A;  1FPF A;  4KYS A;  3HFU A;  4U1Z A;  4MAG A;  5TPA B;  2B3F A;  4NG7 A;  4O8M A;  3M3L A;  2V3U A;  1POT A;  3TQW A;  5I56 A;  1XHY A;  1MRP A;  3UN6 A;  2OLB A;  4FOR A;  3D1R A;  5IM2 A;  3PPQ A;  2CZL A;  1OQH A;  1FRP A;  3C36 A;  3ROJ A;  5K2Y A;  1GVC A;  2DDK A;  5I2N B;  2B3B A;  2NWJ A;  3H4Z A;  4IY5 A;  2QS4 A;  3Q29 A;  5KZT A;  3HCQ A;  3CR9 A;  2XX9 A;  3CSB A;  5KCJ A;  2I58 A;  2QVV A;  4WEP A;  4PFB A;  4YIC A;  5DT6 A;  1LLS A;  1Y3N A;  1SYH A;  1PB8 A;  1VE4 A;  4F3P A;  3QAX A;  4ZEC A;  1B51 A;  2D21 A;  2NXO A;  1PB9 A;  1AIV A;  3S9E A;  2UVI A;  3MVY A;  4PFW A;  3T1B A;  5AA1 A;  2DE2 A;  2Z23 A;  1PB7 A;  2VP1 A;  3VLU A;  1IZ1 A;  5EQ9 A;  2UVH A;  3O6I A;  3Q27 A;  5EQA A;  5FBP A;  1D9V A;  2XXX A;  4F1Y A;  3WAE A;  4PFI A;  5JTY B;  1UIU A;  4O3C A;  3H06 B;  1VFE A;  3TDJ A;  4I8C A;  4PDD A;  4E0W A;  3G3J A;  5CC2 A;  1URS A;  4OZ9 A;  4KFQ A;  1LBV A;  2OWT A;  2FA7 A;  1SI1 A;  3TCF A;  5IAI A;  2FBP A;  3KN8 A;  3UK4 A;  2R9J A;  4OQO A;  5ISU A;  3G3I A;  1R6Z A;  2DWA A;  1P1O A;  4GFR A;  2OX3 A;  4XEQ A;  3CI8 A;  5CBR A;  1B3E A;  3G3F A;  1S7Y A;  3QIM A;  3KSX A;  1XC1 A;  1B9J A;  3SEW A;  3CIJ A;  4KCD A;  1BP5 A;  2CZK A;  1B5J A;  2BJJ X;  4KI0 E;  4ZE9 A;  3KN7 A;  5IKB A;  4FE8 A;  2Z8E A;  4G68 C;  4LA9 A;  3W15 C;  3R26 A;  2Q9T A;  4GF8 A;  3H6U A;  3FVN A;  5AE4 A;  5TP9 A;  1US5 A;  1HSL A;  3LC8 A;  2XA5 A;  3PMW A;  3V5A A;  2Q2C A;  1MG1 A;  4EUO A;  4PFT A;  1QGX A;  3IOR A;  2F6G A;  2F3D A;  4KHZ E;  4OTE A;  5HM4 B;  2X26 A;  3K1N A;  5CBS A;  4U4S A;  1B0H A;  3I6V A;  1MXU A;  1FPI A;  2WBD A;  4G2Z A;  4DCY A;  5IZZ A;  4WKM A;  4EQ7 A;  4JSO A;  3OO9 A;  1LBZ A;  2D3I A;  2ZYM A;  3R7X A;  4ESX A;  3PPN A;  4KQP A;  2RC8 A;  5F7V A;  3KG2 A;  4OXV A;  5CRY A;  2DS9 A;  3U72 A;  3F11 A;  2HHM A;  1H44 A;  2XWK A;  3DLN A;  4MH5 A;  3AXF A;  3T9V A;  1FPL A;  1DSN A;  2AIX A;  2DQV A;  2ZZV A;  3GZG A;  1ZKB A;  2PBW A;  3SKP A;  4IO5 A;  3A3C A;  3IB1 A;  4DI3 D;  1LAG E;  1B7U A;  2H9B A;  2RC9 A;  2QPQ A;  2QS2 A;  3EQ1 A;  5H8F A;  4XXU A;  2V3T A;  2Q2A A;  4AB6 A;  2PYY A;  4PGP A;  2VGQ A;  2ZZX A;  4Q0C A;  3RT6 B;  1VFD A;  4LP2 B;  2GH9 A;  1UTB A;  2HCA A;  2IA4 A;  3LUY A;  1NUW A;  3MP1 A;  1Y9U A;  2QS1 A;  1R1N A;  1FBD A;  4F29 A;  4GIZ A;  3PTY A;  2ABH A;  5L9O A;  1B1X A;  4RK9 A;  1KA0 A;  2O7U A;  4F1V A;  4F31 B;  3DP8 A;  2VPO A;  4BDR A;  3QK6 A;  3RY3 A;  4DXU A;  1Y20 A;  4XKQ A;  4N15 A;  1LFH A;  2Y7P A;  1NV6 A;  3FV2 A;  3PUZ E;  5A5X A;  1OQG A;  1ZU0 A;  4KD5 A;  2Q89 A;  5I58 B;  2XXY A;  5J16 A;  1ZIU A;  4MCO A;  3HO7 A;  5ET5 A;  4NF8 A;  3H6V A;  4BLA A;  2HAV A;  1RYX A;  3ODB A;  3N6U A;  1POY 1;  3O66 A;  4NTL A;  2REG A;  1YAE A;  3C4M A;  4BDM A;  3SEV A;  3OEM A;  4R9G A;  3IFC A;  3E9X A;  1JP4 A;  4GD5 A;  4GWO A;  2P3N A;  4G8M A;  5H8H B;  1YZ0 A;  4P56 A;  3VVD A;  1SYI A;  4DXB A;  3O29 A;  3OMB A;  1ZLQ A;  3TAJ A;  2ZNU A;  2M8C A;  2F35 A;  1MXY A;  1MXX A;  5H8Q B;  4LQ5 A;  4GL8 A;  2XD3 A;  1N0T A;  1IXI A;  5DYH A;  3E78 A;  1WDN A;  4H5F A;  3K1P A;  4QF9 A;  2O51 A;  3FXR A;  3UIF A;  1Y4T A;  1CE2 A;  5H8N B;  1JNF A;  4M4G A;  4YKJ A;  3U93 A;  2ONK E;  5ET6 A;  2DWI A;  4P1E A;  2O69 A;  1FJ6 A;  3PUW E;  3IOV A;  2I0B A;  4EXK A;  4F3S A;  3K6W A;  3VVE A;  1LBB A;  3Q25 A;  1NI9 A;  1OLC A;  3VXB A;  5FHN A;  3RUM A;  1I6B A;  4YKI A;  2QMX A;  4YU0 A;  3ONM A;  3T22 A;  1DOT A;  1Y1Z A;  2F34 A;  4GLI A;  2WYP A;  3VFJ A;  3OO7 A;  4UAC A;  3RGY A;  1QJM A;  3PUV E;  4I62 A;  2QL3 A;  4G61 A;  2V84 A;  2JJK A;  1A54 A;  1FTO A;  4NN3 A;  3O6G A;  4POW A;  4HTG A;  4DXC A;  3T9X B;  1RYO A;  2AL5 A;  4DE8 A;  1FJ9 A;  3TPA A;  2Y7R A;  4RA1 A;  5FHO A;  4NF4 A;  4HW8 A;  4AB5 A;  1KWH A;  4GBW A;  4TOZ A;  3IOU A;  3ECR A;  4G8N A;  1GGG A;  4GQO A;  4NED A;  4R2B A;  2OZZ A;  2F6P A;  1RDX A;  4LAT A;  1US4 A;  2YJP A;  3K0V A;  5H8S A;  4U4X A;  3D4G A;  1B46 A;  5KDT B;  4F3G A;  4G4P A;  4KYD A;  4X8R A;  2AYS A;  1FBE A;  1B6H A;  2Q8J A;  4NAP A;  3MJN A;  4AS4 A;  2X7Q A;  2R8T A;  3KEI A;  2I6E A;  1Q35 A;  3PD9 A;  2HEU A;  1QUJ A;  3HST A;  3L6G A;  3QUF A;  1DMB A;  3VLW A;  3DP4 A;  3O6H A;  5ITP A;  2Z8F A;  1DTG A;  5CI5 A;  3TFL A;  3T9H B;  4NQ8 A;  2XWV A;  4ELO A;  1SW2 A;  4TLL B;  4MLQ A;  1B2H A;  4HXV A;  3OD7 A;  4XTC Q;  1P1U A;  1IEJ A;  4H0W A;  3E79 A;  2QRY A;  4GWX A;  1FTM A;  4C1T A;  3QXM A;  1I6Q A;  1LCF A;  5I56 B;  3Q28 A;  1YXI A;  2I4B A;  4NMY A;  3MW0 A;  3MP6 A;  3KJ7 A;  5I84 A;  4MNC A;  1LAX A;  3HN0 A;  5DEX A;  1FPG A;  3UGW A;  1AH5 A;  1NV3 A;  4MMP A;  2H5Y A;  2UVJ A;  2R6G E;  2XXU A;  2F7B A;  1UTH B;  3ZSF A;  2H4I A;  3LSW A;  1NL5 A;  4YMB A;  1O63 A;  3UOR A;  1S50 A;  2DP8 A;  4Q30 B;  1NNP A;  3O28 A;  1IMA A;  2IEE A;  3C33 A;  4H1X A;  1EYI A;  4OVT A;  5EHM A;  4ZDM A;  4LZ7 A;  1B0L A;  3FXB A;  4N6K A;  5TPA A;  2Q8M A;  1FBH A;  1MDP 1;  2FVZ A;  3OEN A;  1SBP A;  2FIX A;  3M8U A;  4AS5 A;  3L6H A;  4O7I A;  4QSC A;  4K3F A;  1MPD A;  1A40 A;  4I1D A;  3G3H A;  2ANJ A;  2RCA A;  3IO6 A;  5B7D A;  3H6W A;  4IY6 A;  5CM6 A;  5ET8 A;  1B5I A;  3B7D A;  3LSL A;  1A55 A;  1RDY A;  2X7P A;  1M5C A;  1B3F A;  3K6X A;  4WXJ A;  4UA8 A;  1NNT A;  1CNQ A;  4IB2 A;  3LBS A;  1PC3 A;  3TQL A;  2I48 A;  1D3K A;  1BTJ A;  2CEY A;  3PU5 A;  3SET A;  3TMG A;  5CMB A;  1EYJ A;  4F18 A;  4MLV A;  4PQJ A;  3KGC A;  3ILU B;  4QFN A;  4NF0 A;  4P1L A;  3JZJ A;  4PC9 A;  2F5X A;  1LB9 A;  4AQ4 A;  2UYF A;  4U1O A;  1S9T A;  4PF8 A;  2PVU A;  2O68 A;  2GHB A;  5JTY A;  2WBB A;  2DWJ A;  2PMS A;  4P47 A;  5ITO A;  5EQ7 A;  1FPB A;  1G0I A;  1A99 A;  1XT8 A;  3KC0 A;  4RY1 A;  2HFB A;  5TP9 B;  4ND9 A;  1H45 A;  5FTI A;  1O7T A;  2Y7K A;  1NKX A;  4QSD A;  1NUX A;  1IUD A;  2DWH A;  3PD8 A;  3C35 A;  1NV4 A;  2XXR A;  5I57 A;  4H65 A;  3EN3 A;  4ZS9 A;  1FTJ A;  2HAU A;  2OWZ A;  2DE4 A;  5BUU A;  1K9Z A;  2H99 A;  1SQY A;  3H3G A;  5JK4 A;  4ECF A;  1FQA A;  2XXP A;  3IR1 A;  1PBP A;  1XOC A;  3S9M C;  1B5H A;  2RKM A;  2I0C A;  4OEV A;  2GRV A;  1URD A;  4RPN A;  4TLM B;  3MVZ A;  3QYT A;  2QJE A;  3PPP A;  3RQT A;  1VR5 A;  5A5L A;  1RKM A;  4X1D A;  1B4Z A;  4JXI A;  4GXS B;  4MIJ A;  2QVU A;  2DVZ A;  2WYK A;  1BLF A;  1NV0 A;  1Y4C A;  3EF7 A;  3T66 A;  3MVW A;  1T0K A;  1ZMG A;  3FJM A;  4ELQ A;  3MBP A;  3GBA A;  1M5F A;  5L8D A;  3M3F A;  4R9F A;  1EH3 A;  1FQF A;  1XVY A;  2ZZW A;  4QFL A;  4ZE8 A;  1A8F A;  3CRB A;  2YPN A;  1JVY A;  1KA1 A;  4I40 A;  4N6P A;  2VPN A;  4O94 A;  2PX1 A;  4YB7 A;  4OVQ A;  4NF5 A;  1RDZ A;  5EYH A;  1MQI A;  3TTR A;  5IZ3 A;  2QVR A;  1IXH A;  3H6T A;  4PAK A;  5I2K B;  1JVX A;  2A5S A;  2I49 A;  1UTB B;  1EU8 A;  4PBH A;  1FPE A;  1F9B A;  3TZA A;  5ESY A;  1UIV A;  2XWO A;  4GWS A;  5EYG A;  4I9D A;  4DLD A;  2QS3 A;  3T9U A;  2Y5K A;  3OXN A;  2RCB A;  5F1Q A;  4ISU A;  1OVB A;  4KPT A;  4G77 A;  4DI4 B;  1Z7N E;  2B65 A;  5A5X B;  1ZBM A;  4EF2 A;  1FPJ A;  1B3L A;  1SVX B;  4NF8 B;  3JYR A;  4MFI A;  4O7M A;  4IO7 A;  4N4U A;  4H8J A;  4HCY A;  1FSA A;  5AA4 B;  1DPE A;  4EF1 A;  1Q1K A;  2VOZ A;  4ZEI A;  3T93 B;  4LZ8 A;  4O3A A;  1QUL A;  1R9Q A;  4NGU A;  3SER A;  3ILT B;  3MST A;  2ESN A;  2DSF A;  5DVJ A;  1B40 A;  1LB8 A;  1TXF A;  2A5T A;  2DVC A;  3FIR A;  4RJZ A;  3CFX A;  3CHG A;  4BDQ A;  4R72 A;  4PET A;  3OOA A;  4MHF A;  4EQ9 A;  2I4C A;  3K6U A;  2XXH A;  4JVD A;  2O1L A;  1MQJ A;  3O2A A;  3EKI A;  2OBG A;  3KZG A;  2CMO A;  4OAN A;  1MQH A;  4GX3 A;  3G3K A;  4OVS A;  1DCU A;  2FIE A;  3TEL A;  5M2V A;  4YB6 A;  1YCJ A;  4U21 A;  3FZV A;  3ZS6 A;  4NX1 A;  4R2F A;  3FV1 A;  5FTH A;  3PPO A;  4Z7E A;  1JEV A;  4GWZ A;  5CMK A;  2Y7W A;  3IB0 A;  2GHA A;  3VDF A;  4YMA A;  2XXK A;  4F1U A;  4OVJ A;  4NWC A;  1Y1M A;  3K6V A;  4G68 A;  3E13 X;  3KSJ A;  1JW1 A;  1K9Y A;  3IK6 B;  3OO6 A;  3MP8 A;  1MM7 A;  5I59 B;  4R6K A;  5AA2 A;  5DTB A;  3N26 A;  1LST A;  3SDF A;  4C1U A;  1IMC A;  3DP6 A;  4P0I A;  4HCW A;  4DZ1 A;  2WX9 A;  2OCU A;  3N5L A;  4MNI A;  3QMF A;  2ZYO A;  2HXR A;  4X9T A;  4YAH X;  2F36 A;  1P1Q A;  2NVU B;  1I69 A;  3VVF A;  4NF6 B;  4HE1 A;  4JSD A;  1GV8 A;  2KR0 A;  3RPL A;  1PEB A;  4FEC A;  1SDX A;  4FIM A;  2ZNS A;  2RF1 A;  4OHN A;  5LTC A;  1XVX A;  4N8Y A;  1FBC A;  3EHU A;  1HSE A;  3KBR A;  1OLA A;  2R71 A;  4ZZA A;  3IFA A;  5H8N A;  1EZ9 A;  1NUZ A;  3PPR A;  2CEX A;  1USY E;  3K4U A;  4BDN A;  3ZKL A;  3PV0 E;  3DM0 A;  1NV1 A;  3B8B A;  4NF4 B;  4HS7 A;  3C32 A;  1NNF A;  2L5V A;  1NNK A;  1ANF A;  3TEP A;  5ICQ A;  2PFY A;  1MXZ A;  1IMF A;  1P1W A;  4OET A;  3IOW A;  1B58 A;  1YTV A;  1DPP A;  1FQD A;  1N3W A;  1VDW A;  4GXA A;  5ET7 A;  1EYK A;  4OVR A;  1MXV A;  2FNC A;  3EHT A;  5EQ8 A;  3HHG A;  1BK4 A;  4NWD A;  2KQZ A;  2Y5L A;  4IO3 A;  3W9V A;  2XXQ A;  4DCX A;  1M5D A;  3G7W A;  3RPW A;  2PT1 A;  1N7X A;  4N17 A;  2KLF A;  4GRK A;  1DTZ A;  3TCH A;  4R6H A;  5DW8 A;  3RN8 A;  3GYY A;  5HPQ A;  3SEY A;  1D9Y A;  2VHA A;  1D4N A;  1Z7M E;  3BBR A;  3BKI B;  1KZ8 A;  5L9M A;  1AWB A;  1P1N A;  3LUZ A;  2UYE A;  1N3X A;  1FW0 A;  4ONY A;  4JVI A;  4F39 A;  4OEN A;  4N8G A;  5CMC A;  4NE4 A;  5I7I A;  4Q5T A;  2HZK A;  4JWO A;  5F24 A;  1ZTY A;  2ALU A;  3VLV A;  4ZEF A;  2CZI A;  3BIH A;  1MH4 A;  2THI A;  2DXY A;  1IQ7 A;  4KCC A;  3G3G A;  1N7W A;  3I3V A;  4H67 A;  4MEV A;  4QFK A;  4XKR A;  3SEU A;  5DEX B;  3U65 A;  2P0S A;  2QMW A;  4MBP A;  3TYH A;  1MY4 A;  1FTL A;  2UVG A;  2ONR A;  3MYU A;  3PUY E;  2Q88 A;  3MAM A;  2UXA A;  3KFM A;  1N76 A;  2RIN A;  4N91 A;  4PF6 A;  1QW0 A;  2V25 A;  4XF5 A;  4P8B A;  3K1M A;  5J1D A;  3PUX E;  1SD3 A;  3CVG A;  3MZ1 A;  1GR2 A;  5KCJ B;  4XFE A;  4ELR A;  4GWY A;  2XWI A;  4PAF A;  4P9K A;  3FVG A;  4FEB A;  5LDZ A;  1B52 A;  3A3U A;  1B7Z A;  3TUS A;  4N13 A;  3CG1 A;  3EPE A;  4EXL A;  3FAS A;  4JB7 A;  3R6U A;  4IO4 A;  5B70 A;  1QVS A;  1B3H A;  2F8D A;  4L17 A;  3UA8 A;  4PGN A;  2PFZ A;  1QKB A;  1JQF A;  1NV7 A;  1UTH A;  1LBW A;  1FPK A;  4YB5 A;  1SW1 A;  4X48 A;  4Q8R A;  5I2N A;  2WEF A;  1Q9D A;  3EHS A;  2Z8D A;  3BFT A;  1FBG A;  2ZYN A;  3N6T A;  2G29 A;  4JVC A;  2V93 A;  3A09 A;  2GQ1 A;  2Y84 A;  3D4C A;  3K02 A;  4KXP A;  1J1N A;  3KOS A;  2W7Y A;  1R9L A;  5TU0 A;  3LSX A;  2XHD A;  2XX8 A;  4GVO A;  4F3B A;  1XS5 A;  2V4C A;  2DYX A;  3I5O A; 
#chains in the Genus database with same CATH homology
 4OVQ A;  2QFL A;  1RDZ A;  3E78 A;  5EYH A;  1IMD A;  2BJI A;  4I3Y A;  5IZ3 A;  5I5P A;  2QVR A;  3NOH A;  2F3B A;  4H45 A;  4PAK A;  1IME A;  1XI6 A;  4GX4 A;  2P3V A;  4QBA A;  4PBH A;  1FPE A;  1LBY A;  2MKZ A;  5ET6 A;  4X04 A;  5ESY A;  2Q74 A;  4P1E A;  2XWO A;  4GWS A;  5EYG A;  1FJ6 A;  2B4L A;  5I3S A;  2Y5K A;  3BIG A;  2FHY A;  1NI9 A;  4PBQ A;  4DI4 B;  4MNP A;  3KBZ A;  4I3E A;  1FPF A;  2WYP A;  3HFU A;  4MAG A;  1FPD A;  1FPJ A;  4G61 A;  4NG7 A;  2JJK A;  4O7M A;  1FTA A;  4O8M A;  4NN3 A;  4N4U A;  4HCY A;  1FSA A;  3D1R A;  5IM2 A;  4H46 A;  1FRP A;  4NGU A;  3ROJ A;  3MST A;  1FJ9 A;  2DDK A;  4F19 A;  3RYD A;  4LN5 A;  4GBV A;  3CHG A;  4GBW A;  4PET A;  4HE2 A;  4MHF A;  4JVD A;  3EKI A;  2QVV A;  4OAN A;  4PFB A;  1RDX A;  4YIC A;  4GX3 A;  4OVS A;  4P3L A;  1DCU A;  2FIE A;  1INP A;  4PCD A;  2HZL A;  4NX1 A;  4MJO A;  1DBZ A;  3ISP A;  4GWZ A;  4X8R A;  3T1B A;  1FBE A;  2XXK A;  4F1U A;  5IZ3 B;  4NAP A;  2DE2 A;  4AS4 A;  4OA4 A;  2R8T A;  3LV0 A;  5EQ9 A;  1D9Q A;  1K9Y A;  5EQA A;  5T3J A;  5FBP A;  1NV5 A;  4PFI A;  1FBF A;  3T0J A;  4N6D A;  1IMC A;  4PDD A;  4HCW A;  2WX9 A;  2V3Q A;  4NQ8 A;  3B50 A;  4MNI A;  3QMF A;  2VT5 A;  4GX6 A;  2XWV A;  3FBP A;  2HXR A;  4X9T A;  4HXV A;  1LBV A;  4HE1 A;  1DK4 A;  3RPL A;  2KR0 A;  2FBP A;  3E79 A;  4GWX A;  4GWU A;  4PTK A;  2OX3 A;  4XEQ A;  5LTC A;  4N8Y A;  1FBC A;  3IFA A;  1YXI A;  1NUZ A;  2CEX A;  1NUY A;  4MNC A;  2CZK A;  1FPG A;  1NV1 A;  1NV3 A;  3B8B A;  4MMP A;  2L5V A;  1FBP A;  4MX6 A;  2PFY A;  2Q9T A;  1IMF A;  4FBP A;  1LEV A;  2XA5 A;  1IMA A;  1EYI A;  4OVT A;  3FXB A;  4N6K A;  2Q8M A;  1FBH A;  2FVZ A;  1QGX A;  1VDW A;  5ET7 A;  1EYK A;  2F3D A;  2FIX A;  4OVR A;  4AS5 A;  4O7I A;  5EQ8 A;  1BK4 A;  2KQZ A;  2PCR A;  2Y5L A;  1FPI A;  2WBD A;  3W9V A;  1IMB A;  1SPI A;  5IZZ A;  4N17 A;  3SZP A;  5IGA A;  1LBZ A;  5CM6 A;  5ET8 A;  5DW8 A;  3GYY A;  1RDY A;  1KZ8 A;  1AWB A;  3LUZ A;  1CNQ A;  2HHM A;  2XWK A;  4JVI A;  4OVP A;  4PE3 A;  4N8G A;  4HE0 A;  2CEY A;  3RPL B;  5I7I A;  1FPL A;  2HZK A;  1EYJ A;  5F24 A;  4UAB A;  2ZZV A;  4F18 A;  4N81 A;  2CZI A;  3BIH A;  4GWW A;  4NF0 A;  4P1L A;  4DI3 D;  4PC9 A;  2F5X A;  2QPQ A;  4MEV A;  3U65 A;  4PGP A;  2ZZX A;  4PF8 A;  3MYU A;  3A29 A;  2WBB A;  4P47 A;  5EQ7 A;  1FPB A;  1G0I A;  1NUW A;  3KC0 A;  4IR8 A;  3KC1 A;  2DE3 A;  1FBD A;  4N91 A;  2HPG A;  4PF6 A;  3PTY A;  4XF5 A;  4P8B A;  1KA0 A;  5J1D A;  1NUX A;  4F1V A;  2VPO A;  4QXD A;  1NV4 A;  4PFR A;  4XFE A;  4N15 A;  4GWY A;  2XWI A;  4PAF A;  4P9K A;  1NV6 A;  2OWZ A;  2DE4 A;  1K9Z A;  5LDZ A;  5JK4 A;  5J16 A;  4PAI A;  4MCO A;  5IZ1 A;  5ET5 A;  2CZH A;  5A5L A;  1G0H A;  2PFZ A;  4PGN A;  1NV7 A;  4YZZ A;  1LBX A;  4MIJ A;  2QVU A;  1LBW A;  1FPK A;  2DVZ A;  2WYK A;  1NV0 A;  2WEF A;  3W9W A;  3IFC A;  1Q9D A;  1FBG A;  4NHB A;  2B4M A;  1JP4 A;  4JVC A;  2GQ1 A;  2P3N A;  4KXP A;  1YZ0 A;  4P56 A;  4PDH A;  1NV2 A;  2ZZW A;  1YYZ A;  1KA1 A;  4I40 A;  2V4C A;  2VPN A;  4M1V A;  4O94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...