3MAMA

A molecular switch changes the low to the high affinity state in the substrate binding protein afprox
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
270
structure length
270
Chain Sequence
ERVVIGSKPFNEQYILANMIAILLEENGYKAEVKEGLGGTLVNYEALKRNDIQLYVEYTGTAYNVILRKQPPELWDQQYIFDEVKKGLLEADGVVVAAKLGFRDDAALAVRADWAEENGVEKISDLAEFADQLVFGSDPEFASRPDGLPQIKKVYGFEFKEVKQMEPTLMYEAIKNKQVDVIPAYTTDSRVDLFNLKILEDDKGALPPYDAIIIVNGNTAKDEKLISVLKLLEDRIDTDTMRALNYQYDVEKKDAREIAMSFLKEQGLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Osmoprotection protein (ProX)
publication title Arg149 Is Involved in Switching the Low Affinity, Open State of the Binding Protein AfProX into Its High Affinity, Closed State.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 97
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mamA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3mamA02
1N04A 3O6GA 2YJPA 1MH3A 4F1YA 4ZDMA 1B5HA 2H25A 5TU0A 1JNFA 2P0SA 3PPNA 3PUWE 3V89B 3KSXA 3BFTA 2O69A 3KFMA 3OO6A 3G7WA 2HAVA 1NNPA 2PYYA 2Y7WA 4RY1A 2DXRA 3PU5A 3K6WA 4OFLA 1FQDA 3FXRA 4I1DA 3I5OA 4F29A 5DEXB 2QPQA 2O6AA 1PB7A 3KOTA 4N6PA 4LQ5A 1QKBA 1LBCA 4ZEFA 2DP8A 2QS2A 5TP9A 1NNTA 4FIMA 1H76A 2P2AA 3SEYA 4OEVA 5AA2D 3M3FA 3H06B 2XXVA 4BDOA 4NF6A 1H43A 2XXYA 2HCAA 1PEBA 1MY3A 4GOTA 1ANFA 4IO5A 1AH5A 2Q8JA 3D4GA 3A3CA 3FJMA 2GFEA 4G68A 4Q0CA 2OCUA 2QS3A 4EXLA 5I84A 3FXQA 1OMPA 4F2OA 1N3WA 2PMSA 4NF8B 3PMXA 3T9VA 2UVHA 3P7IA 4OEUA 1J1NA 1MPCA 2DWJA 1B2HA 3MZ1A 2F78A 1AMFA 3K02A 4C1TA 3H7MA 3IJXB 1B1HA 3TTNA 2R6GE 4EF2A 3S9MC 1P1OA 3SEUA 3BKIB 3HHGA 3H6UA 3ILTB 4IGRA 5H8SA 4KCDA 1XVYA 1B32A 2OBGA 3QYTA 3RT8A 2I3VA 3GLBA 4FEBA 4R6KA 3UK4A 4LQ2A 3MWBA 3K4UA 1OVTA 3MP8A 5TPAB 3KBRA 1URSA 2Z23A 1Z7NE 3SEVA 2XHDA 1B58A 3LUYA 2F35A 1OLCA 3I6VA 1PDAA 1NFTA 2PVUA 1M5FA 1Q1KA 1NNKA 4H6DA 4GQOA 3QUFA 3RQTA 3FGSA 4DCYA 3ZKKA 3IAZA 3OELA 2V93A 1B0LA 3VDFA 4H8IA 1Y3NA 2DWAA 4FE8A 2QS4A 1T0KA 4C0RA 4P0IA 3IB0A 4JXIA 2AL5A 1CE2A 1MQHA 3KN8A 4EUOA 1JW5A 1N3XA 3MP6A 3N26A 3C4MA 3C35A 2F7CA 3DP4A 2ALUA 1XC1A 3IOWA 5DT6A 5IKBA 4BDMA 5H8QB 4PFTA 4L17A 4POWA 2B3BA 2XX8A 3T9UA 3SKPA 5KCJA 2E0SA 1Y20A 3KJ7A 5AA1A 3CIJA 3L6GA 3EN3A 3K1MA 4KHZE 1XOCA 1TFDA 1GR2A 2ONKE 3TQLA 5H8FA 4XKNA 3TTRA 4RJZA 4F2QA 4ONYA 3VE1B 2DQVA 1AOVA 2ZNTA 1FQCA 1JEVA 4LZ7A 4U4SA 1D9YA 4PP0A 1MPBA 3S9EA 4XKQA 3H6VA 2XX9A 4U4XA 2ZYOA 4H8JA 1POTA 1NL5A 3N6UA 4YKIA 1DTGA 4RNSA 4JWOA 2ZMBA 4QHQA 1A7LA 1N7WA 4I9DA 4DDDA 2Y7KA 1B52A 5TP9B 3PUXE 3U93A 4F3GA 4R6HA 1BTJA 4ISUA 4ZEDA 2HFBA 4XKPA 5CC2A 4NF6B 3TQWA 4DE8A 1SI0A 4U23A 4KR5A 3HO7A 3TAJA 1P1QA 2DWHA 4X1DA 4G68B 4R72A 4FORA 4ZE8A 4XXUA 1FTMA 4C1UA 3PGFA 2ZYKA 1IQ7A 1Y3PA 2P1SA 1LCFA 3WAFA 4Z7EA 2H4IA 3O6IA 4I8CA 1B3FA 3MVYA 1MQJA 5ITOA 5JTYA 2CZLA 1SD3A 2Q88A 3MVWA 4MLVA 3U1OA 5I57A 2OJTA 4U21A 1Z7ME 2PX1A 1SW5A 2M8CA 1MXYA 3I3VA 2Q2AA 4NTLA 3UP9A 2KLFA 3DM0A 1WDNA 3PUYE 1RKMA 3LSFB 4WXJA 3K6VA 5ICTA 1QW0A 2V84A 1KWHA 3MUQA 1FW0A 1IITA 2AYSA 2WKYA 5AA2A 3LC8A 1M5CA 4U22A 4WKMA 3VVFA 5F1QA 2F6GA 4G8HA 1IXCA 3HSTA 4LZ5A 1Q35A 3IORA 2O51A 2XXUA 4BDRA 3PUZE 3RPWA 1LAHE 5CI5A 1I6BA 4RPOA 5LOMA 2ANJA 3CFXA 3TTMA 4GL8A 4YAHX 2DYXA 4F31B 3K00A 2F36A 1LCTA 1NH8A 2OWSA 1MDQA 3G3IA 1MS7A 2XXQA 1A99A 1O63A 4F39A 3TMGA 2THIA 1Y3QA 1SI1A 3G3KA 1Y1MA 5L9MA 4GIZA 1IUDA 1LAXA 3MPKA 4TLMB 3C9HA 2RINA 4HTGA 3CRBA 3MZBA 1EU8A 1B40A 5KCJB 4PQJA 5JEIA 2PT2A 1URDA 1PBQA 4KYDA 3OOAA 4LVQA 4GWOA 5DVJA 3KOSA 1NMUA 4Q30B 3C36A 3PV0E 2GHAA 2D3IA 3FVNA 5H8FB 1FQAA 3KN7A 2UYFA 3QK6A 3TUSA 4G2ZA 1MY2A 1GVCA 4I62A 1N0TA 3IJOB 3FJ7A 2F97A 5CRYA 2GRVA 2Q2CA 5HM4B 3TZAA 2R71A 3MJNA 4KI0E 1LSTA 3DLNA 3FD3A 2D5WA 3W9WA 5DVIA 1FTOA 3B6WA 2BJJX 2VHAA 4H1XA 3IO6A 1HSEA 3IB2A 1H45A 3K1NA 2V3TA 1SQYA 4YKKA 3OEMA 3S9NC 1RYXA 3EHUA 5H8NA 3KGCA 1R6ZA 3BFUA 4DIGA 3O2AA 2Y7PA 4JBZA 3ODBA 1JW1A 4FECA 5HBCA 4POXA 4R6YA 3MVZA 2QRYA 3RNNA 5FHNA 4RYAA 5JTYB 4BDNA 1WVJA 3RUMA 3VXBA 4G8NA 3PMVA 2DE4A 3RTFB 5I57B 3TCHA 4YMAA 3Q25A 4G8MA 2DOJA 1NKXA 4ZE9A 1OVBA 3WAEA 4PFWA 2AL4A 3USDA 4AB5A 1SBPA 1I6QA 5AA4A 4R74A 4RXLA 4BLAA 4F1UA 1R9QA 2YPNA 2RCAA 2RKMA 5CM6A 5L9SA 1IIWA 1MXWA 4OQOA 5CMKA 3FVGA 5AA2B 3R26A 1XT8A 2ESNA 3RLFE 3K01A 3MW0A 4ELQA 5F7VA 2ZNUA 2Y84A 1OLAA 1AL3A 4KQPA 3TFLA 3IOTA 4NMYA 4G77A 3S4UA 4IO7A 2FYIA 1FQBA 3KJTA 5FTHA 3GXAA 1VFDA 1EZOA 2QS1A 3HV1A 4QFLA 5L8DA 4KCCA 4YICA 4O3AA 3IB1A 3DELB 4QFKA 4DLDA 4IY5A 4QF9A 3T93B 3OO8A 2W7YA 3JV9A 1B6HA 3LSWA 5KDTA 2NVUB 4N13A 2PBWA 3KSJA 2OLBA 4NF5A 2Y7IA 1DMBA 3CR9A 3E13X 1M5BA 2ZNSA 4U2RA 3H6TA 1B7ZA 5I58A 1OIBA 4X9TA 3RY3A 3PD8A 4QFOA 4OYVA 4OWDA 2PT1A 1A8EA 3EQ1A 2RF1A 3VV5A 4NWDA 4O3BA 5EHSA 4EQ7A 1VE4A 3GBBA 5I59A 1R1NA 4AQ4A 4F3SA 1FQEA 2CMOA 3T9HB 5I2KA 1A55A 4OTEA 2Z8DA 5CMMA 4NEDA 1S9TA 4YB6A 3QXMA 5A5XA 1WODA 1JVXA 3M3KA 4N07A 4E0WA 2O7IA 4OZ9A 3OD7A 4WEDA 3C34A 3O28A 3H03A 1YTVA 2I0BA 1URGA 1JW4A 4G4PA 3U8QA 1QKAA 3KEIA 3HHFA 4GLIA 2O1MA 3TEPA 3AXFA 2RC9A 4PFUA 3UA8A 4IO2A 4YB5A 2HZKA 2OZZA 4IY6A 1Y4CA 1F9BA 5BWJA 5L9OA 3MP1A 1LFGA 2Z22A 3G3GA 3N94A 4ZEBA 3GBAA 1DPPA 2QL3A 4H65A 5CBSA 3PMWA 3RGYA 3RN8A 5H8NB 4OENA 1MM6A 1YCJA 1FTLA 3SETA 1D4NA 4MLQA 1USYE 3S2VA 4UA8A 1ELJA 4IO3A 2ZXTA 3OO9A 2O1LA 2UXAA 1JETA 3EPEA 3CG1A 4OERA 2VGQA 2QSXA 2VP1A 4ELOA 2GHBA 4M4GA 5H8HA 1ZJLA 1IXGA 1MDP1 1B4ZA 4H5FA 4F1VA 2H98A 5DYHA 4QSDA 5AA4B 4EF1A 3U92A 1VSOA 2I0CA 4DXBA 3Q29A 1DSNA 2O68A 3VXCA 3VVEA 1B51A 1ZIUA 4E0XA 5I2NB 2XXHA 4H0WA 1YAEA 4RA1A 1RYOA 2F7BA 1A54A 4JWYA 2UVIA 2Z8EA 1TXFA 1N84A 1QUKA 5FHOA 1B4HA 2I4BA 3UORA 2HEUA 4JDFA 2XXTA 4O3CA 1A40A 4MH5A 5J1DA 3EF7A 2IEEA 2D21A 3K6UA 4EQ9A 3VVDA 3BBRA 1LFIA 4QFNA 4JSDA 5KDTB 1NH7A 1USYH 4MF3A 4GFRA 4TQUQ 3K0VA 4XTCQ 3LSLA 3MQ9A 2V25A 4ZZAA 4ZEIA 4NF5B 3W15C 4HW8A 4FAJA 2Y7RA 2QJEA 5I58B 3FV1A 1BLFA 3T96B 3PPQA 2UVJA 4GVOA 3V8XB 2VD3A 3R7XA 4ZZEA 1ATGA 4QSCA 3LR1A 2X7QA 2XXRA 1S50A 5I59B 3O9PA 5I2KB 3TCGA 3CFZA 2LAOA 4RK9A 1TWYA 1PBPA 3RTWB 3N5LA 2ONSA 1ZKBA 5A5XB 3Q27A 2DWIA 1MXVA 3B6QA 1B7UA 3CFLA 2F7AA 1Y1ZA 4DXCA 2REJA 4LUBA 4GD5A 3TTLA 3G3HA 3MPLA 3T22A 1FTKA 1US5A 3TODA 1QJMA 2R9JA 5I56A 3W9VA 1SW2A 3C33A 2NUVA 2A5TA 1UIUA 4LONB 4ESWA 1S7YA 1QVSA 4DCXA 4YU0A 1BP5A 2QMWA 2XX7A 2I48A 4GXSB 4NWCA 4YMBA 1O64A 3IL1B 4R2BA 1SVXB 4U1ZA 1FTJA 5EYFA 3T66A 3R6UA 5FHMA 2IA4A 4LA9A 3DP8A 1R9LA 2AIXA 5K2XA 3PD9A 4NE4A 4XIGQ 2HXWA 3IOVA 4PFYA 2UYEA 1MXUA 3IOUA 4ELRA 2DVZA 4RK2A 1MQDA 3A3UA 3M8UA 3B6TA 1GV8A 2NWJA 3ONMA 1UTHA 3LBSA 5H8HB 1N7XA 2G29A 3CSGA 2OK2A 4AB6A 1P99A 4JSOA 2DE2A 1LBBA 4EXKA 4FEDA 3UGWA 3F11A 1EZPA 2ZYNA 2H99A 1AIVA 2QMXA 4LZ8A 4Z0IA 4R2FA 1ZTYA 3OMBA 3TPAA 1MXZA 1B3HA 1NNFA 4LATA 3IO4A 3KN3A 5DTBA 4GL0A 2GH9A 3IX1A 3QAXA 3O29A 1I69A 2G93A 3CG3A 1MY1A 1UIVA 3N6TA 2VD2A 1LGBC 5B70A 2XXWA 1II5A 5I2NA 5AE4A 2H9BA 3CVGA 4X1BA 4OFOA 5KZTA 4IB2A 1IXHA 1CB6A 1LB9A 2I3WA 1XVXA 4YZZA 4HCYA 3FVOA 4R9GA 4LP2B 4X48A 1B3LA 2O84X 3VLVA 4JB7A 4K3FA 4WEPA 1UTBA 4Q5TA 2NXOA 3FVKA 1MM7A 2XXXA 2F6PA 3O66A 4OMBA 1MQIA 1ZBMA 1SW4A 1JVYA 1SYHA 3H6WA 1B9JA 1B0HA 2DE3A 3HPIA 3TELA 4XKRA 1P1UA 4R73A 1VR5A 4QFPA 4YKJA 1EH3A 4MBPA 3MZ9A 3SDFA 1N76A 1O7TA 1LFHA 1B1XA 5CMBA 3MBPA 1B46A 1MG1A 4EQBA 1TFAA 1LAGE 3G3JA 4PETA 4Q8RA 2VOZA 2O7UA 3OXNA 1B5JA 3H3GA 1SW1A 3VLWA 3FXUA 1DOTA 4TOZA 1DTZA 3TKDA 1JQFA 3C32A 3TYHA 2RC8A 4GF8A 2REGA 3QSLA 1B3GA 2Z8FA 3CI8A 1XS5A 1PC3A 1JEUA 3LSXA 4KFQA 2X7PA 3RT6B 5I56B 1MRPA 4G68C 5EHMA 4IO6A 2A5TB 1GTKA 4R9FA 1I6AA 1ZU0A 2HZLA 2E1SA 2F8DA 1BKAA 3FV2A 2H5YA 3ZS6A 1GGGA 3K6XA 5CMCA 4IGTA 4M1VA 4IO4A 1PB8A 4BDLA 3B7DA 3OSRA 4RPNA 5ITPA 2NOOA 2DS9A 1IZ1A 3MC2A 2A5SA 3HCQA 3K2DA 4KYSA 3PPRA 4BDQA 3O6HA 2I4CA 4DZ1A 3FZVA 4NF4A 1MXXA 5HPQA 4OVJA 2Q9TA 5ICQA 3SEWA 4OETA 1P1NA 4ZECA 1B5IA 2FNCA 4P0GA 3U72A 3M3LA 3SEXA 5JK4A 3K1PA 3TDJA 5IAIA 4YKPA 1QUJA 2RCBA 5BUUA 1UTHB 1FQFA 1Y4TA 4KYEA 1TT1A 5M2VA 3FJGA 2ABHA 4OHNA 3Q28A 4MFIA 3ECRA 3MAMA 3FASA 1D3KA 2B65A 3KZGA 3KG2A 3OEKA 4THIA 1YPNA 3E9XA 2OWTA 5ISUA 4F3PA 4HCWA 4ELPA 4U1OA 3PPPA 4QRZA 1LAFE 1MQGA 1OQGA 1SDXA 1P1WA 1FCKA 1H44A 3CSBA 4OESA 3VFJA 3PUVE 1QUIA 5DEXA 1MY0A 1DPEA 4F22A 1M5EA 3ZKLA 5CBRA 1LLSA 1MPDA 4YB7A 1A8FA 1BIYA 4HS7A 1MY4A 4ND9A 2XD3A 1IXIA 2UVGA 3UN6A 3OO7A 3TCFA 1H3DA 3DP6A 1SYIA 4ZEKA 3VLUA 4OXVA 3E3KA 3SERA 4F3BA 4JWXA 4NF8A 3ILUB 5AA3A 2ZYMA 4KPTA 1UTBB 1B7HA 2DXYA 4H67A 4KD5A 2XXIA 4FATA 1B3EA 3E4RA 3T9XB 3QUJA 1B05A 1L5TA 5ELVA 3FATA 5K2YA 3MVXA 2I49A 1POY1 3QIMA 5FTIA 4R75A 4P11A 3L6HA 4UACA 3FIRA 4OFJA 3GZGA 3PPOA 2YLNA 3EHSA 3V83A 4QSEA 3A09A 1ZMGA 2B3FA 2XD2A 5DVFA 1OQHA 2V3QA 3U94A 1HSJA 5TPAA 3Q26A 1M5DA 3S9LC 3G3FA 1IEJA 3FUZA 4ZS9A 2ONRA 3C31A 4ECFA 4F18A 1Y9UA 2I6EA 3JYRA 4GXAA 1VFEA 3SESA 4H5GA 3TTKA 2RC7A 3HN0A 4EDPA 4GRKA 3V5AA 4FJPA 1QULA 2F34A 3IK6B 3OENA 3OSQA 2HQ0A 3UIFA 2X26A 3O97A 4DXUA 3D4CA 1UQWA 5B7DA 1MH4A 4F19A 2DSFA 1PB9A 4NF4B 1LB8A 4PE5B 5H8QA 2V3UA 2DVCA 2F5XA 1HSLA 3ZSFA 4ESXA 2XXPA 4TLLB 3IR1A 1ZLQA 2FA7A 3H4ZA 2Q89A 3JZJA 3THIA 1XHYA 2I58A 2HAUA 3EHTA 1D9VA 1EZ9A 1US4A
chains in the Genus database with same CATH superfamily
1N04A 3O6GA 2YJPA 1MH3A 2OX3A 4ZDMA 4F1YA 1B5HA 2H25A 5TU0A 1JNFA 2P0SA 3PPNA 3PUWE 3V89B 1FJ6A 3KSXA 3BFTA 2O69A 3KFMA 3OO6A 3G7WA 2HAVA 1NNPA 2PYYA 2Y7WA 4RY1A 2DXRA 3PU5A 3K6WA 4OFLA 1FQDA 3FXRA 4I1DA 3I5OA 4F29A 4X04A 5DEXB 2QPQA 2O6AA 1PB7A 3KOTA 4N6PA 4LQ5A 1G0HA 1QKBA 1LBCA 4ZEFA 2DP8A 2QS2A 5TP9A 2XWIA 4HXVA 1NNTA 4FIMA 1H76A 2P2AA 3SEYA 4OEVA 5AA2D 3M3FA 3H06B 2XXVA 4BDOA 4NF6A 3LV0A 1H43A 2XXYA 2HCAA 1PEBA 1MY3A 2VT5A 4GOTA 1ANFA 1LEVA 4IO5A 1AH5A 2Q8JA 3D4GA 3A3CA 3FJMA 2GFEA 4G68A 4Q0CA 2HXRA 2OCUA 2QS3A 4EXLA 4PDHA 1KA1A 3BIHA 5I84A 3FXQA 1OMPA 4F2OA 1N3WA 1IMFA 2B4MA 2PMSA 4NF8B 3PMXA 3T9VA 2UVHA 3P7IA 4OEUA 1J1NA 1MPCA 1DK4A 2DWJA 1B2HA 3MZ1A 2F78A 1AMFA 1FBPA 3K02A 4C1TA 3H7MA 3IJXB 1B1HA 3TTNA 2QVUA 2R6GE 4EF2A 3S9MC 1P1OA 3SEUA 3BKIB 3HHGA 3H6UA 3ILTB 4IGRA 1FTAA 5H8SA 4KCDA 1XVYA 1B32A 2OBGA 1JP4A 2WYPA 3QYTA 3RT8A 1QGXA 2I3VA 3GLBA 3RYDA 1NV0A 4FEBA 3FXBA 4R6KA 3UK4A 2CEYA 4LQ2A 3MWBA 3K4UA 1OVTA 3MP8A 5TPAB 1FBDA 3KBRA 1URSA 2Z23A 1Z7NE 3B8BA 3SEVA 2XHDA 1B58A 3LUYA 2F35A 4HE1A 2R8TA 1OLCA 3I6VA 1PDAA 1NFTA 1SPIA 2PVUA 1M5FA 1Q1KA 1NNKA 4H6DA 4GQOA 3QUFA 3RQTA 2B4LA 3FGSA 4DCYA 3ZKKA 3IAZA 3OELA 2V93A 1B0LA 2Q74A 3VDFA 4H8IA 1Y3NA 2DWAA 4FE8A 2QS4A 1LBZA 3HFUA 1T0KA 4C0RA 4O7IA 4P0IA 3IB0A 4JXIA 2AL5A 4KXPA 1CE2A 1MQHA 3CHGA 3KN8A 4EUOA 1JW5A 2KR0A 1N3XA 3MP6A 3N26A 3C4MA 3C35A 4NQ8A 5ET5A 2F7CA 3PTYA 3DP4A 2ALUA 1XC1A 3IOWA 5DT6A 5IKBA 4BDMA 5H8QB 4PFTA 4L17A 4POWA 2B3BA 2XX8A 3T9UA 3SKPA 5KCJA 2E0SA 1NV2A 4MIJA 1Y20A 3KJ7A 5AA1A 3CIJA 3L6GA 3EN3A 3K1MA 4KHZE 1XOCA 1TFDA 1GR2A 2ONKE 3TQLA 5H8FA 4I3EA 1FSAA 4AS5A 4XKNA 3TTRA 4RJZA 4F2QA 4ONYA 3VE1B 2DQVA 1AOVA 2ZNTA 1FQCA 1JEVA 4LZ7A 4U4SA 1DBZA 1D9YA 4PP0A 1MPBA 3S9EA 4XKQA 3H6VA 2XX9A 2OWZA 4U4XA 2ZYOA 4H8JA 1POTA 3ISPA 1NL5A 3N6UA 4YKIA 1DTGA 1FBHA 4RNSA 4NHBA 4JWOA 2ZMBA 4QHQA 4MX6A 1A7LA 1N7WA 4I9DA 4OVRA 4DDDA 2Y7KA 4PCDA 1B52A 5TP9B 3PUXE 3U93A 4F3GA 4R6HA 1BTJA 4ISUA 4ZEDA 2HFBA 4XKPA 5CC2A 4NF6B 3TQWA 4DE8A 1IMAA 1SI0A 4U23A 4KR5A 3HO7A 3TAJA 1P1QA 2DWHA 4X1DA 4G68B 4R72A 4FORA 4ZE8A 4XXUA 1FTMA 4C1UA 4NN3A 3PGFA 2ZYKA 1IQ7A 1Y3PA 4PFIA 2P1SA 1FPLA 1LCFA 3WAFA 4Z7EA 2H4IA 4MMPA 3O6IA 4I8CA 1B3FA 3MVYA 1MQJA 5ITOA 5JTYA 2CZLA 1SD3A 2Q88A 3MVWA 1FPJA 4MLVA 3U1OA 5I57A 2OJTA 4U21A 4X8RA 1Z7ME 2PX1A 1SW5A 1K9YA 2M8CA 1MXYA 3I3VA 2Q2AA 4NTLA 3UP9A 2KLFA 3DM0A 1WDNA 3PUYE 1RKMA 3LSFB 4WXJA 3K6VA 5ICTA 2Y5LA 1QW0A 2V84A 4GBWA 1KWHA 3MUQA 1NUYA 1FW0A 1IITA 2AYSA 2CEXA 2WKYA 5AA2A 3LC8A 1M5CA 1IMDA 4U22A 4WKMA 3VVFA 4IR8A 5F1QA 2F6GA 4G8HA 4OVQA 1IXCA 3HSTA 1DCUA 4LZ5A 1Q35A 3IORA 2O51A 2XXUA 4BDRA 3PUZE 3RPWA 1LAHE 5CI5A 1I6BA 4I40A 4RPOA 5LOMA 2ANJA 4GX6A 3CFXA 3TTMA 4GL8A 4YAHX 2DYXA 4F31B 3K00A 2F36A 1LCTA 1NH8A 2OWSA 1MDQA 3G3IA 1MS7A 2XXQA 1A99A 1O63A 4F39A 3TMGA 2THIA 1Y3QA 1SI1A 3G3KA 1Y1MA 5ET6A 5L9MA 4GIZA 1IUDA 1LAXA 3MPKA 4TLMB 3C9HA 2RINA 4DI4B 4HTGA 3CRBA 3MZBA 1EU8A 1B40A 3FBPA 5KCJB 3T0JA 4PQJA 1FBFA 5JEIA 2PT2A 1URDA 1PBQA 4KYDA 2JJKA 3OOAA 4LVQA 3KC1A 4GWOA 5DVJA 3KOSA 1NMUA 4Q30B 3C36A 3PV0E 1RDZA 2GHAA 2DDKA 2D3IA 3FVNA 4PC9A 5H8FB 2HPGA 1FQAA 4XEQA 3KN7A 1LBYA 1FPKA 2UYFA 2CZHA 3QK6A 4P9KA 3TUSA 3A29A 4G2ZA 1MY2A 2ZZVA 1GVCA 4I62A 1N0TA 3IJOB 3FJ7A 2F97A 5CRYA 1EYKA 2GRVA 2Q2CA 5HM4B 3TZAA 1NV3A 2R71A 3MJNA 4KI0E 1LSTA 3DLNA 3FD3A 2D5WA 3W9WA 5DVIA 1FTOA 3B6WA 4P1EA 1LBWA 2BJJX 2VHAA 4H1XA 4P3LA 3GYYA 3IO6A 4PE3A 1HSEA 3IB2A 1H45A 3K1NA 2V3TA 1SQYA 4YKKA 3OEMA 3S9NC 1RYXA 3EHUA 5H8NA 3KGCA 1R6ZA 3BFUA 4DIGA 3O2AA 2Y7PA 4JBZA 3ODBA 1JW1A 2V4CA 4FECA 3RPLA 5HBCA 4POXA 4R6YA 4PGNA 3MVZA 2P3NA 2QRYA 3RNNA 1NV6A 5FHNA 2CZKA 5IZ3A 4RYAA 5JTYB 4PBHA 4BDNA 1WVJA 3RUMA 3VXBA 1VDWA 3B50A 3PMVA 4G8NA 2DE4A 3RTFB 5I57B 3TCHA 4YMAA 3Q25A 4G8MA 1YXIA 2WBDA 5T3JA 2DOJA 4NF0A 1NKXA 4ZE9A 1OVBA 3WAEA 1FPDA 4PFWA 2AL4A 3USDA 5DW8A 4AB5A 1SBPA 1I6QA 4R74A 4RXLA 4BLAA 4F1UA 5AA4A 1R9QA 2YPNA 2RCAA 2RKMA 5CM6A 5L9SA 1IIWA 1MXWA 4OQOA 5CMKA 4N81A 3FVGA 5AA2B 1K9ZA 3R26A 1XT8A 2ESNA 3RLFE 3K01A 3MW0A 4ELQA 5F7VA 2ZNUA 2Y84A 1OLAA 1AL3A 4KQPA 4O7MA 3TFLA 3IOTA 4NMYA 3IFAA 4G77A 3S4UA 4XFEA 4IO7A 2FYIA 1FQBA 3KJTA 4OA4A 5FTHA 3GXAA 1VFDA 1EZOA 4QFLA 2QS1A 3HV1A 5L8DA 2WYKA 3BIGA 4KCCA 4YICA 4O3AA 3IB1A 2XWOA 5J16A 3DELB 4NGUA 4QFKA 4DLDA 4IY5A 1EYJA 4QF9A 3T93B 3OO8A 2W7YA 3JV9A 1B6HA 3LSWA 4HE0A 5KDTA 4UABA 4OVPA 2NVUB 4N13A 2PBWA 3KSJA 1FPBA 2OLBA 4NF5A 2Y7IA 1DMBA 3CR9A 3E13X 3U65A 1M5BA 2ZNSA 4U2RA 3H6TA 1B7ZA 5I58A 1OIBA 4X9TA 3RY3A 3PD8A 4QFOA 4OYVA 4OWDA 2PT1A 1A8EA 3EQ1A 2RF1A 3VV5A 4NWDA 4O3BA 1NV4A 5EHSA 4EQ7A 1VE4A 1NV5A 3GBBA 5I59A 1R1NA 4AQ4A 4F3SA 1FQEA 2CMOA 3T9HB 5I2KA 1A55A 4OTEA 2Z8DA 5CMMA 4NEDA 1S9TA 3E79A 4YB6A 3QXMA 5A5XA 1WODA 1JVXA 3M3KA 4N07A 4E0WA 2O7IA 4OZ9A 3OD7A 4WEDA 3C34A 2VPNA 1FPFA 3O28A 3H03A 1YTVA 5IZZA 2L5VA 4P56A 2I0BA 1URGA 1JW4A 4G4PA 1QKAA 3U8QA 3KEIA 3HHFA 4GLIA 2O1MA 3TEPA 3AXFA 2RC9A 4PFUA 4MJOA 3UA8A 4IO2A 5IGAA 4YB5A 2HZKA 2OZZA 4IY6A 1Y4CA 1F9BA 5BWJA 5L9OA 3MP1A 1LFGA 2Z22A 3G3GA 2WX9A 3N94A 4ZEBA 3GBAA 1IMBA 1DPPA 2QL3A 4H65A 5CBSA 3PMWA 3RGYA 3RN8A 5H8NB 4OENA 1MM6A 1YCJA 2F3DA 1FTLA 5IZ1A 3SETA 1D4NA 3RPLB 4MLQA 1LBXA 1USYE 1EYIA 3S2VA 4UA8A 4PTKA 1ELJA 5IZ3B 4IO3A 2ZXTA 3OO9A 2FVZA 2O1LA 2UXAA 1JETA 3EPEA 3CG1A 4OERA 2VGQA 1FPEA 4GX4A 2QSXA 2CZIA 2VP1A 4I3YA 4ELOA 2GHBA 4M4GA 5H8HA 1ZJLA 1IXGA 1MDP1 1B4ZA 4H5FA 4F1VA 2H98A 5DYHA 2FIEA 5EQ7A 4QSDA 5AA4B 4EF1A 3U92A 1YYZA 1VSOA 2I0CA 4DXBA 3Q29A 1DSNA 2O68A 3VXCA 1FBGA 4XF5A 3VVEA 1B51A 1ZIUA 4E0XA 5I2NB 2XXHA 1FBEA 4H0WA 1YAEA 4RA1A 1RYOA 2F7BA 1A54A 4JWYA 2UVIA 2Z8EA 4GX3A 1TXFA 1N84A 1LBVA 1QUKA 5FHOA 1B4HA 2I4BA 3UORA 2HEUA 4JDFA 2XXTA 4O3CA 3LUZA 1A40A 4MH5A 5J1DA 4FBPA 3EF7A 2WEFA 4PAIA 4JVDA 2IEEA 2D21A 3K6UA 4EQ9A 3VVDA 2Y5KA 3BBRA 1LFIA 4QFNA 4JSDA 5KDTB 1NH7A 1USYH 4MF3A 2P3VA 4QBAA 4GFRA 4TQUQ 3K0VA 4XTCQ 3KC0A 3LSLA 3MQ9A 2V25A 4ZZAA 4ZEIA 4NF5B 3W15C 4HW8A 4FAJA 2Y7RA 2QJEA 5I58B 3FV1A 1BLFA 3T96B 1NV7A 3PPQA 2UVJA 4GVOA 3V8XB 4P8BA 2VD3A 3R7XA 1NUXA 4MCOA 4ZZEA 1ATGA 1NUZA 4QSCA 3LR1A 2X7QA 4PGPA 2XXRA 5EQ9A 1CNQA 1S50A 5I59B 3O9PA 2VPOA 5I2KB 3TCGA 3CFZA 2LAOA 4RK9A 1TWYA 1PBPA 3RTWB 3N5LA 2ONSA 1ZKBA 5A5XB 3Q27A 1XI6A 2DWIA 5I7IA 1MXVA 3B6QA 4PAKA 1B7UA 3CFLA 2F7AA 4NG7A 1Y1ZA 4DXCA 2REJA 4LUBA 3EKIA 4GD5A 4P47A 4G61A 1G0IA 3TTLA 3G3HA 3MPLA 3T22A 1FTKA 1US5A 3TODA 1QJMA 4GWUA 1FPGA 2R9JA 5I56A 3W9VA 1SW2A 3C33A 2NUVA 2A5TA 4O8MA 4N8GA 1UIUA 4LONB 4ESWA 1S7YA 1QVSA 4DCXA 4YU0A 1BP5A 1RDXA 4GWZA 2PFZA 2QMWA 2XX7A 2I48A 4GXSB 4NWCA 4YMBA 1O64A 3IL1B 4GWYA 4R2BA 1SVXB 4U1ZA 3QMFA 1FTJA 5EYFA 3T66A 3R6UA 5FHMA 2IA4A 4LA9A 3DP8A 1R9LA 2AIXA 5K2XA 3PD9A 4NE4A 4XIGQ 2HXWA 3IOVA 4PFYA 2UYEA 4N6KA 1MXUA 3IOUA 4ELRA 2DVZA 4RK2A 1MQDA 3A3UA 3M8UA 3B6TA 4PF6A 1GV8A 2NWJA 3ONMA 1UTHA 3LBSA 5H8HB 1N7XA 4DI3D 2G29A 3CSGA 2OK2A 4AB6A 1P99A 4GWWA 4JSOA 2DE2A 1LBBA 4EXKA 5ET7A 4FEDA 3UGWA 2F3BA 3F11A 1EZPA 2ZYNA 5EQAA 2H99A 2FBPA 1AIVA 2QMXA 4LZ8A 4Z0IA 4R2FA 1KZ8A 1ZTYA 4PAFA 3OMBA 3TPAA 1MXZA 1B3HA 1FJ9A 1NNFA 4LATA 3IO4A 3KN3A 2MKZA 5DTBA 4GL0A 2GH9A 3IX1A 1IMEA 3QAXA 1BK4A 2XWKA 3O29A 1I69A 4N8YA 2G93A 3CG3A 1MY1A 1UIVA 3N6TA 2VD2A 5FBPA 1LGBC 5B70A 2XXWA 3IFCA 1II5A 4PF8A 5I2NA 5AE4A 2H9BA 3CVGA 4X1BA 4OFOA 5KZTA 4IB2A 1IXHA 1CB6A 4NAPA 1LB9A 4MNCA 2I3WA 1XVXA 4YZZA 4HCYA 4AS4A 3FVOA 4R9GA 4LP2B 3MSTA 4X48A 5ESYA 1B3LA 2O84X 3VLVA 4JB7A 4K3FA 4WEPA 1UTBA 4Q5TA 2ZZWA 2NXOA 3FVKA 1MM7A 2XXXA 2F6PA 3O66A 4OMBA 1MQIA 1ZBMA 1SW4A 1JVYA 1SYHA 3H6WA 1B9JA 1B0HA 2DE3A 3HPIA 4N17A 5I3SA 3TELA 4XKRA 1P1UA 5LTCA 4R73A 1VR5A 4QFPA 4YKJA 1EH3A 4MBPA 3MZ9A 3SDFA 1D9QA 4JVCA 4QXDA 1N76A 1KA0A 1O7TA 1LFHA 1B1XA 5CMBA 3E78A 3MBPA 1B46A 2XA5A 4MNPA 1MG1A 4EQBA 1TFAA 2QVRA 1LAGE 3G3JA 4PETA 4Q8RA 2VOZA 2O7UA 3OXNA 1B5JA 3H3GA 1SW1A 3VLWA 3FXUA 1DOTA 4TOZA 1DTZA 3TKDA 1JQFA 3C32A 3TYHA 1AWBA 2RC8A 4GF8A 2REGA 3QSLA 1B3GA 2Z8FA 3CI8A 1XS5A 1PC3A 1NUWA 1JEUA 3LSXA 4N15A 4KFQA 2X7PA 3RT6B 5I56B 2HHMA 1MRPA 4G68C 2Q8MA 5EHMA 4IO6A 2A5TB 1GTKA 4R9FA 1I6AA 1ZU0A 2HZLA 2E1SA 2F8DA 2PCRA 1BKAA 3FV2A 2H5YA 3ZS6A 1GGGA 3K6XA 5CMCA 3MYUA 4IGTA 4M1VA 4IO4A 1PB8A 4MHFA 3B7DA 4BDLA 3OSRA 4RPNA 5ITPA 2NOOA 2DS9A 1IZ1A 3MC2A 2A5SA 3HCQA 3K2DA 4KYSA 3PPRA 4BDQA 3O6HA 2I4CA 4DZ1A 2PFYA 3FZVA 4NF4A 1MXXA 5HPQA 4OVJA 2Q9TA 2QFLA 5ICQA 3SEWA 4OETA 1P1NA 4ZECA 1B5IA 2FNCA 4P0GA 4JVIA 3U72A 3M3LA 3SEXA 5JK4A 3K1PA 2GQ1A 3TDJA 5IAIA 4O94A 4YKPA 1QUJA 2RCBA 5BUUA 1UTHB 4LN5A 1FQFA 1Y4TA 4KYEA 2QVVA 1TT1A 5M2VA 3FJGA 2ABHA 4OHNA 4GWXA 3Q28A 4MFIA 5I5PA 3ECRA 3MAMA 3FASA 1D3KA 2B65A 3KZGA 3KG2A 3OEKA 4N6DA 4THIA 4MEVA 1YPNA 3E9XA 2OWTA 5ISUA 4F3PA 2WBBA 4HCWA 4ELPA 4U1OA 3PPPA 4QRZA 5A5LA 1LAFE 1MQGA 1OQGA 1SDXA 1P1WA 4OVTA 1FCKA 3SZPA 1H44A 3CSBA 4OESA 3VFJA 3PUVE 1NV1A 1QUIA 5EYHA 5DEXA 1MY0A 1DPEA 2ZZXA 4F22A 1M5EA 4MNIA 4NX1A 3ZKLA 5CBRA 4HE2A 1LLSA 1MPDA 1IMCA 4YB7A 1A8FA 1BIYA 4HS7A 1MY4A 4PBQA 4ND9A 2XD3A 1IXIA 4H45A 5F24A 2UVGA 3UN6A 3T1BA 3OO7A 3TCFA 1H3DA 3DP6A 1SYIA 4ZEKA 3VLUA 4OXVA 3E3KA 3SERA 4N91A 4F3BA 4JWXA 2FHYA 4PFBA 4NF8A 3ILUB 5AA3A 2ZYMA 4KPTA 1UTBB 1B7HA 2DXYA 1Q9DA 4H67A 4KD5A 2XXIA 4FATA 1B3EA 4N4UA 3E4RA 3T9XB 3QUJA 1B05A 3ROJA 1L5TA 5ET8A 5ELVA 3FATA 5K2YA 5LDZA 2FIXA 3MVXA 2I49A 1POY1 3QIMA 5FTIA 4PFRA 4PDDA 1FRPA 5IM2A 4R75A 4GBVA 4P11A 4H46A 3NOHA 3L6HA 4UACA 3FIRA 4OFJA 3GZGA 3PPOA 2YLNA 3EHSA 3V83A 4QSEA 3A09A 1ZMGA 2B3FA 2XD2A 5EQ8A 5DVFA 2KQZA 1OQHA 1INPA 2V3QA 3U94A 1HSJA 5TPAA 3Q26A 1M5DA 3S9LC 3KBZA 3G3FA 1IEJA 3FUZA 4ZS9A 2ONRA 3C31A 4ECFA 4F18A 1Y9UA 4OVSA 2I6EA 3JYRA 4GXAA 1RDYA 2BJIA 4P1LA 1VFEA 3SESA 4H5GA 3TTKA 2RC7A 3HN0A 4EDPA 4GRKA 3V5AA 4FJPA 1QULA 4OANA 2F34A 3IK6B 3OENA 3OSQA 2HQ0A 3UIFA 2XXKA 2X26A 1FPIA 3O97A 4GWSA 4DXUA 4MAGA 1NI9A 3D4CA 1UQWA 5EYGA 5B7DA 1MH4A 4F19A 1FBCA 2DSFA 1PB9A 4NF4B 1LB8A 4PE5B 5H8QA 2V3UA 2DVCA 2F5XA 1YZ0A 1HSLA 3ZSFA 4ESXA 2XWVA 2XXPA 4TLLB 3IR1A 1ZLQA 2FA7A 3H4ZA 2Q89A 3JZJA 3THIA 1XHYA 2I58A 2HAUA 3D1RA 3EHTA 1D9VA 1EZ9A 1US4A
chains in the Genus database with same CATH topology
1N04A 3O6GA 2YJPA 1MH3A 4F1YA 4ZDMA 1B5HA 2H25A 5TU0A 1JNFA 2P0SA 3PPNA 3PUWE 3V89B 3KSXA 3BFTA 2O69A 3KFMA 3OO6A 3G7WA 2HAVA 1NNPA 2PYYA 2Y7WA 4RY1A 2DXRA 3PU5A 3K6WA 4OFLA 1FQDA 3FXRA 4I1DA 3I5OA 4F29A 5DEXB 2QPQA 2O6AA 1PB7A 3KOTA 4N6PA 4LQ5A 1QKBA 1LBCA 4ZEFA 2DP8A 2QS2A 5TP9A 1NNTA 4FIMA 1H76A 2P2AA 3SEYA 4OEVA 5AA2D 3M3FA 3H06B 2XXVA 4BDOA 4NF6A 1H43A 2XXYA 2HCAA 1PEBA 1MY3A 4GOTA 1ANFA 4IO5A 1AH5A 2Q8JA 3D4GA 3A3CA 3FJMA 2GFEA 4G68A 4Q0CA 2OCUA 2QS3A 4EXLA 5I84A 3FXQA 1OMPA 4F2OA 1N3WA 2PMSA 4NF8B 3PMXA 3T9VA 2UVHA 3P7IA 4OEUA 1J1NA 1MPCA 2DWJA 1B2HA 3MZ1A 2F78A 1AMFA 3K02A 4C1TA 3H7MA 3IJXB 1B1HA 3TTNA 2R6GE 4EF2A 3S9MC 1P1OA 3SEUA 3BKIB 3HHGA 3H6UA 3ILTB 4IGRA 5H8SA 4KCDA 1XVYA 1B32A 2OBGA 3QYTA 3RT8A 2I3VA 3GLBA 4FEBA 4R6KA 3UK4A 4LQ2A 3MWBA 3K4UA 1OVTA 3MP8A 5TPAB 3KBRA 1URSA 2Z23A 1Z7NE 3SEVA 2XHDA 1B58A 3LUYA 2F35A 1OLCA 3I6VA 1PDAA 1NFTA 2PVUA 1M5FA 1Q1KA 1NNKA 4H6DA 4GQOA 3QUFA 3RQTA 3FGSA 4DCYA 3ZKKA 3IAZA 3OELA 2V93A 1B0LA 3VDFA 4H8IA 1Y3NA 2DWAA 4FE8A 2QS4A 1T0KA 4C0RA 4P0IA 3IB0A 4JXIA 2AL5A 1CE2A 1MQHA 3KN8A 4EUOA 1JW5A 1N3XA 3MP6A 3N26A 3C4MA 3C35A 2F7CA 3DP4A 2ALUA 1XC1A 3IOWA 5DT6A 5IKBA 4BDMA 5H8QB 4PFTA 4L17A 4POWA 2B3BA 2XX8A 3T9UA 3SKPA 5KCJA 2E0SA 1Y20A 3KJ7A 5AA1A 3CIJA 3L6GA 3EN3A 3K1MA 4KHZE 1XOCA 1TFDA 1GR2A 2ONKE 3TQLA 5H8FA 4XKNA 3TTRA 4RJZA 4F2QA 4ONYA 3VE1B 2DQVA 1AOVA 2ZNTA 1FQCA 1JEVA 4LZ7A 4U4SA 1D9YA 4PP0A 1MPBA 3S9EA 4XKQA 3H6VA 2XX9A 4U4XA 2ZYOA 4H8JA 1POTA 1NL5A 3N6UA 4YKIA 1DTGA 4RNSA 4JWOA 2ZMBA 4QHQA 1A7LA 1N7WA 4I9DA 4DDDA 2Y7KA 1B52A 5TP9B 3PUXE 3U93A 4F3GA 4R6HA 1BTJA 4ISUA 4ZEDA 2HFBA 4XKPA 5CC2A 4NF6B 3TQWA 4DE8A 1SI0A 4U23A 4KR5A 3HO7A 3TAJA 1P1QA 2DWHA 4X1DA 4G68B 4R72A 4FORA 4ZE8A 4XXUA 1FTMA 4C1UA 3PGFA 2ZYKA 1IQ7A 1Y3PA 2P1SA 1LCFA 3WAFA 4Z7EA 2H4IA 3O6IA 4I8CA 1B3FA 3MVYA 1MQJA 5ITOA 5JTYA 2CZLA 1SD3A 2Q88A 3MVWA 4MLVA 3U1OA 5I57A 2OJTA 4U21A 1Z7ME 2PX1A 1SW5A 2M8CA 1MXYA 3I3VA 2Q2AA 4NTLA 3UP9A 2KLFA 3DM0A 1WDNA 3PUYE 1RKMA 3LSFB 4WXJA 3K6VA 5ICTA 1QW0A 2V84A 1KWHA 3MUQA 1FW0A 1IITA 2AYSA 2WKYA 5AA2A 3LC8A 1M5CA 4U22A 4WKMA 3VVFA 5F1QA 2F6GA 4G8HA 1IXCA 3HSTA 4LZ5A 1Q35A 3IORA 2O51A 2XXUA 4BDRA 3PUZE 3RPWA 1LAHE 5CI5A 1I6BA 4RPOA 5LOMA 2ANJA 3CFXA 3TTMA 4GL8A 4YAHX 2DYXA 4F31B 3K00A 2F36A 1LCTA 1NH8A 2OWSA 1MDQA 3G3IA 1MS7A 2XXQA 1A99A 1O63A 4F39A 3TMGA 2THIA 1Y3QA 1SI1A 3G3KA 1Y1MA 5L9MA 4GIZA 1IUDA 1LAXA 3MPKA 4TLMB 3C9HA 2RINA 4HTGA 3CRBA 3MZBA 1EU8A 1B40A 5KCJB 4PQJA 5JEIA 2PT2A 1URDA 1PBQA 4KYDA 3OOAA 4LVQA 4GWOA 5DVJA 3KOSA 1NMUA 4Q30B 3C36A 3PV0E 2GHAA 2D3IA 3FVNA 5H8FB 1FQAA 3KN7A 2UYFA 3QK6A 3TUSA 4G2ZA 1MY2A 1GVCA 4I62A 1N0TA 3IJOB 3FJ7A 2F97A 5CRYA 2GRVA 2Q2CA 5HM4B 3TZAA 2R71A 3MJNA 4KI0E 1LSTA 3DLNA 3FD3A 2D5WA 3W9WA 5DVIA 1FTOA 3B6WA 2BJJX 2VHAA 4H1XA 3IO6A 1HSEA 3IB2A 1H45A 3K1NA 2V3TA 1SQYA 4YKKA 3OEMA 3S9NC 1RYXA 3EHUA 5H8NA 3KGCA 1R6ZA 3BFUA 4DIGA 3O2AA 2Y7PA 4JBZA 3ODBA 1JW1A 4FECA 5HBCA 4POXA 4R6YA 3MVZA 2QRYA 3RNNA 5FHNA 4RYAA 5JTYB 4BDNA 1WVJA 3RUMA 3VXBA 4G8NA 3PMVA 2DE4A 3RTFB 5I57B 3TCHA 4YMAA 3Q25A 4G8MA 2DOJA 1NKXA 4ZE9A 1OVBA 3WAEA 4PFWA 2AL4A 3USDA 4AB5A 1SBPA 1I6QA 5AA4A 4R74A 4RXLA 4BLAA 4F1UA 1R9QA 2YPNA 2RCAA 2RKMA 5CM6A 5L9SA 1IIWA 1MXWA 4OQOA 5CMKA 3FVGA 5AA2B 3R26A 1XT8A 2ESNA 3RLFE 3K01A 3MW0A 4ELQA 5F7VA 2ZNUA 2Y84A 1OLAA 1AL3A 4KQPA 3TFLA 3IOTA 4NMYA 4G77A 3S4UA 4IO7A 2FYIA 1FQBA 3KJTA 5FTHA 3GXAA 1VFDA 1EZOA 2QS1A 3HV1A 4QFLA 5L8DA 4KCCA 4YICA 4O3AA 3IB1A 3DELB 4QFKA 4DLDA 4IY5A 4QF9A 3T93B 3OO8A 2W7YA 3JV9A 1B6HA 3LSWA 5KDTA 2NVUB 4N13A 2PBWA 3KSJA 2OLBA 4NF5A 2Y7IA 1DMBA 3CR9A 3E13X 1M5BA 2ZNSA 4U2RA 3H6TA 1B7ZA 5I58A 1OIBA 4X9TA 3RY3A 3PD8A 4QFOA 4OYVA 4OWDA 2PT1A 1A8EA 3EQ1A 2RF1A 3VV5A 4NWDA 4O3BA 5EHSA 4EQ7A 1VE4A 3GBBA 5I59A 1R1NA 4AQ4A 4F3SA 1FQEA 2CMOA 3T9HB 5I2KA 1A55A 4OTEA 2Z8DA 5CMMA 4NEDA 1S9TA 4YB6A 3QXMA 5A5XA 1WODA 1JVXA 3M3KA 4N07A 4E0WA 2O7IA 4OZ9A 3OD7A 4WEDA 3C34A 3O28A 3H03A 1YTVA 2I0BA 1URGA 1JW4A 4G4PA 3U8QA 1QKAA 3KEIA 3HHFA 4GLIA 2O1MA 3TEPA 3AXFA 2RC9A 4PFUA 3UA8A 4IO2A 4YB5A 2HZKA 2OZZA 4IY6A 1Y4CA 1F9BA 5BWJA 5L9OA 3MP1A 1LFGA 2Z22A 3G3GA 3N94A 4ZEBA 3GBAA 1DPPA 2QL3A 4H65A 5CBSA 3PMWA 3RGYA 3RN8A 5H8NB 4OENA 1MM6A 1YCJA 1FTLA 3SETA 1D4NA 4MLQA 1USYE 3S2VA 4UA8A 1ELJA 4IO3A 2ZXTA 3OO9A 2O1LA 2UXAA 1JETA 3EPEA 3CG1A 4OERA 2VGQA 2QSXA 2VP1A 4ELOA 2GHBA 4M4GA 5H8HA 1ZJLA 1IXGA 1MDP1 1B4ZA 4H5FA 4F1VA 2H98A 5DYHA 4QSDA 5AA4B 4EF1A 3U92A 1VSOA 2I0CA 4DXBA 3Q29A 1DSNA 2O68A 3VXCA 3VVEA 1B51A 1ZIUA 4E0XA 5I2NB 2XXHA 4H0WA 1YAEA 4RA1A 1RYOA 2F7BA 1A54A 4JWYA 2UVIA 2Z8EA 1TXFA 1N84A 1QUKA 5FHOA 1B4HA 2I4BA 3UORA 2HEUA 4JDFA 2XXTA 4O3CA 1A40A 4MH5A 5J1DA 3EF7A 2IEEA 2D21A 3K6UA 4EQ9A 3VVDA 3BBRA 1LFIA 4QFNA 4JSDA 5KDTB 1NH7A 1USYH 4MF3A 4GFRA 4TQUQ 3K0VA 4XTCQ 3LSLA 3MQ9A 2V25A 4ZZAA 4ZEIA 4NF5B 3W15C 4HW8A 4FAJA 2Y7RA 2QJEA 5I58B 3FV1A 1BLFA 3T96B 3PPQA 2UVJA 4GVOA 3V8XB 2VD3A 3R7XA 4ZZEA 1ATGA 4QSCA 3LR1A 2X7QA 2XXRA 1S50A 5I59B 3O9PA 5I2KB 3TCGA 3CFZA 2LAOA 4RK9A 1TWYA 1PBPA 3RTWB 3N5LA 2ONSA 1ZKBA 5A5XB 3Q27A 2DWIA 1MXVA 3B6QA 1B7UA 3CFLA 2F7AA 1Y1ZA 4DXCA 2REJA 4LUBA 4GD5A 3TTLA 3G3HA 3MPLA 3T22A 1FTKA 1US5A 3TODA 1QJMA 2R9JA 5I56A 3W9VA 1SW2A 3C33A 2NUVA 2A5TA 1UIUA 4LONB 4ESWA 1S7YA 1QVSA 4DCXA 4YU0A 1BP5A 2QMWA 2XX7A 2I48A 4GXSB 4NWCA 4YMBA 1O64A 3IL1B 4R2BA 1SVXB 4U1ZA 1FTJA 5EYFA 3T66A 3R6UA 5FHMA 2IA4A 4LA9A 3DP8A 1R9LA 2AIXA 5K2XA 3PD9A 4NE4A 4XIGQ 2HXWA 3IOVA 4PFYA 2UYEA 1MXUA 3IOUA 4ELRA 2DVZA 4RK2A 1MQDA 3A3UA 3M8UA 3B6TA 1GV8A 2NWJA 3ONMA 1UTHA 3LBSA 5H8HB 1N7XA 2G29A 3CSGA 2OK2A 4AB6A 1P99A 4JSOA 2DE2A 1LBBA 4EXKA 4FEDA 3UGWA 3F11A 1EZPA 2ZYNA 2H99A 1AIVA 2QMXA 4LZ8A 4Z0IA 4R2FA 1ZTYA 3OMBA 3TPAA 1MXZA 1B3HA 1NNFA 4LATA 3IO4A 3KN3A 5DTBA 4GL0A 2GH9A 3IX1A 3QAXA 3O29A 1I69A 2G93A 3CG3A 1MY1A 1UIVA 3N6TA 2VD2A 1LGBC 5B70A 2XXWA 1II5A 5I2NA 5AE4A 2H9BA 3CVGA 4X1BA 4OFOA 5KZTA 4IB2A 1IXHA 1CB6A 1LB9A 2I3WA 1XVXA 4YZZA 4HCYA 3FVOA 4R9GA 4LP2B 4X48A 1B3LA 2O84X 3VLVA 4JB7A 4K3FA 4WEPA 1UTBA 4Q5TA 2NXOA 3FVKA 1MM7A 2XXXA 2F6PA 3O66A 4OMBA 1MQIA 1ZBMA 1SW4A 1JVYA 1SYHA 3H6WA 1B9JA 1B0HA 2DE3A 3HPIA 3TELA 4XKRA 1P1UA 4R73A 1VR5A 4QFPA 4YKJA 1EH3A 4MBPA 3MZ9A 3SDFA 1N76A 1O7TA 1LFHA 1B1XA 5CMBA 3MBPA 1B46A 1MG1A 4EQBA 1TFAA 1LAGE 3G3JA 4PETA 4Q8RA 2VOZA 2O7UA 3OXNA 1B5JA 3H3GA 1SW1A 3VLWA 3FXUA 1DOTA 4TOZA 1DTZA 3TKDA 1JQFA 3C32A 3TYHA 2RC8A 4GF8A 2REGA 3QSLA 1B3GA 2Z8FA 3CI8A 1XS5A 1PC3A 1JEUA 3LSXA 4KFQA 2X7PA 3RT6B 5I56B 1MRPA 4G68C 5EHMA 4IO6A 2A5TB 1GTKA 4R9FA 1I6AA 1ZU0A 2HZLA 2E1SA 2F8DA 1BKAA 3FV2A 2H5YA 3ZS6A 1GGGA 3K6XA 5CMCA 4IGTA 4M1VA 4IO4A 1PB8A 4BDLA 3B7DA 3OSRA 4RPNA 5ITPA 2NOOA 2DS9A 1IZ1A 3MC2A 2A5SA 3HCQA 3K2DA 4KYSA 3PPRA 4BDQA 3O6HA 2I4CA 4DZ1A 3FZVA 4NF4A 1MXXA 5HPQA 4OVJA 2Q9TA 5ICQA 3SEWA 4OETA 1P1NA 4ZECA 1B5IA 2FNCA 4P0GA 3U72A 3M3LA 3SEXA 5JK4A 3K1PA 3TDJA 5IAIA 4YKPA 1QUJA 2RCBA 5BUUA 1UTHB 1FQFA 1Y4TA 4KYEA 1TT1A 5M2VA 3FJGA 2ABHA 4OHNA 3Q28A 4MFIA 3ECRA 3MAMA 3FASA 1D3KA 2B65A 3KZGA 3KG2A 3OEKA 4THIA 1YPNA 3E9XA 2OWTA 5ISUA 4F3PA 4HCWA 4ELPA 4U1OA 3PPPA 4QRZA 1LAFE 1MQGA 1OQGA 1SDXA 1P1WA 1FCKA 1H44A 3CSBA 4OESA 3VFJA 3PUVE 1QUIA 5DEXA 1MY0A 1DPEA 4F22A 1M5EA 3ZKLA 5CBRA 1LLSA 1MPDA 4YB7A 1A8FA 1BIYA 4HS7A 1MY4A 4ND9A 2XD3A 1IXIA 2UVGA 3UN6A 3OO7A 3TCFA 1H3DA 3DP6A 1SYIA 4ZEKA 3VLUA 4OXVA 3E3KA 3SERA 4F3BA 4JWXA 4NF8A 3ILUB 5AA3A 2ZYMA 4KPTA 1UTBB 1B7HA 2DXYA 4H67A 4KD5A 2XXIA 4FATA 1B3EA 3E4RA 3T9XB 3QUJA 1B05A 1L5TA 5ELVA 3FATA 5K2YA 3MVXA 2I49A 1POY1 3QIMA 5FTIA 4R75A 4P11A 3L6HA 4UACA 3FIRA 4OFJA 3GZGA 3PPOA 2YLNA 3EHSA 3V83A 4QSEA 3A09A 1ZMGA 2B3FA 2XD2A 5DVFA 1OQHA 2V3QA 3U94A 1HSJA 5TPAA 3Q26A 1M5DA 3S9LC 3G3FA 1IEJA 3FUZA 4ZS9A 2ONRA 3C31A 4ECFA 4F18A 1Y9UA 2I6EA 3JYRA 4GXAA 1VFEA 3SESA 4H5GA 3TTKA 2RC7A 3HN0A 4EDPA 4GRKA 3V5AA 4FJPA 1QULA 2F34A 3IK6B 3OENA 3OSQA 2HQ0A 3UIFA 2X26A 3O97A 4DXUA 3D4CA 1UQWA 5B7DA 1MH4A 4F19A 2DSFA 1PB9A 4NF4B 1LB8A 4PE5B 5H8QA 2V3UA 2DVCA 2F5XA 1HSLA 3ZSFA 4ESXA 2XXPA 4TLLB 3IR1A 1ZLQA 2FA7A 3H4ZA 2Q89A 3JZJA 3THIA 1XHYA 2I58A 2HAUA 3EHTA 1D9VA 1EZ9A 1US4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N04 A;  3O6G A;  2YJP A;  1MH3 A;  4F1Y A;  4ZDM A;  1B5H A;  2H25 A;  5TU0 A;  1JNF A;  2P0S A;  3PPN A;  3PUW E;  3V89 B;  3KSX A;  3BFT A;  2O69 A;  3KFM A;  3OO6 A;  3G7W A;  2HAV A;  1NNP A;  2PYY A;  2Y7W A;  4RY1 A;  2DXR A;  3PU5 A;  3K6W A;  4OFL A;  1FQD A;  3FXR A;  4I1D A;  3I5O A;  4F29 A;  5DEX B;  2QPQ A;  2O6A A;  1PB7 A;  3KOT A;  4N6P A;  4LQ5 A;  1QKB A;  1LBC A;  4ZEF A;  2DP8 A;  2QS2 A;  5TP9 A;  1NNT A;  4FIM A;  1H76 A;  2P2A A;  3SEY A;  4OEV A;  5AA2 D;  3M3F A;  3H06 B;  2XXV A;  4BDO A;  4NF6 A;  1H43 A;  2XXY A;  2HCA A;  1PEB A;  1MY3 A;  4GOT A;  1ANF A;  4IO5 A;  1AH5 A;  2Q8J A;  3D4G A;  3A3C A;  3FJM A;  2GFE A;  4G68 A;  4Q0C A;  2OCU A;  2QS3 A;  4EXL A;  5I84 A;  3FXQ A;  1OMP A;  4F2O A;  1N3W A;  2PMS A;  4NF8 B;  3PMX A;  3T9V A;  2UVH A;  3P7I A;  4OEU A;  1J1N A;  1MPC A;  2DWJ A;  1B2H A;  3MZ1 A;  2F78 A;  1AMF A;  3K02 A;  4C1T A;  3H7M A;  3IJX B;  1B1H A;  3TTN A;  2R6G E;  4EF2 A;  3S9M C;  1P1O A;  3SEU A;  3BKI B;  3HHG A;  3H6U A;  3ILT B;  4IGR A;  5H8S A;  4KCD A;  1XVY A;  1B32 A;  2OBG A;  3QYT A;  3RT8 A;  2I3V A;  3GLB A;  4FEB A;  4R6K A;  3UK4 A;  4LQ2 A;  3MWB A;  3K4U A;  1OVT A;  3MP8 A;  5TPA B;  3KBR A;  1URS A;  2Z23 A;  1Z7N E;  3SEV A;  2XHD A;  1B58 A;  3LUY A;  2F35 A;  1OLC A;  3I6V A;  1PDA A;  1NFT A;  2PVU A;  1M5F A;  1Q1K A;  1NNK A;  4H6D A;  4GQO A;  3QUF A;  3RQT A;  3FGS A;  4DCY A;  3ZKK A;  3IAZ A;  3OEL A;  2V93 A;  1B0L A;  3VDF A;  4H8I A;  1Y3N A;  2DWA A;  4FE8 A;  2QS4 A;  1T0K A;  4C0R A;  4P0I A;  3IB0 A;  4JXI A;  2AL5 A;  1CE2 A;  1MQH A;  3KN8 A;  4EUO A;  1JW5 A;  1N3X A;  3MP6 A;  3N26 A;  3C4M A;  3C35 A;  2F7C A;  3DP4 A;  2ALU A;  1XC1 A;  3IOW A;  5DT6 A;  5IKB A;  4BDM A;  5H8Q B;  4PFT A;  4L17 A;  4POW A;  2B3B A;  2XX8 A;  3T9U A;  3SKP A;  5KCJ A;  2E0S A;  1Y20 A;  3KJ7 A;  5AA1 A;  3CIJ A;  3L6G A;  3EN3 A;  3K1M A;  4KHZ E;  1XOC A;  1TFD A;  1GR2 A;  2ONK E;  3TQL A;  5H8F A;  4XKN A;  3TTR A;  4RJZ A;  4F2Q A;  4ONY A;  3VE1 B;  2DQV A;  1AOV A;  2ZNT A;  1FQC A;  1JEV A;  4LZ7 A;  4U4S A;  1D9Y A;  4PP0 A;  1MPB A;  3S9E A;  4XKQ A;  3H6V A;  2XX9 A;  4U4X A;  2ZYO A;  4H8J A;  1POT A;  1NL5 A;  3N6U A;  4YKI A;  1DTG A;  4RNS A;  4JWO A;  2ZMB A;  4QHQ A;  1A7L A;  1N7W A;  4I9D A;  4DDD A;  2Y7K A;  1B52 A;  5TP9 B;  3PUX E;  3U93 A;  4F3G A;  4R6H A;  1BTJ A;  4ISU A;  4ZED A;  2HFB A;  4XKP A;  5CC2 A;  4NF6 B;  3TQW A;  4DE8 A;  1SI0 A;  4U23 A;  4KR5 A;  3HO7 A;  3TAJ A;  1P1Q A;  2DWH A;  4X1D A;  4G68 B;  4R72 A;  4FOR A;  4ZE8 A;  4XXU A;  1FTM A;  4C1U A;  3PGF A;  2ZYK A;  1IQ7 A;  1Y3P A;  2P1S A;  1LCF A;  3WAF A;  4Z7E A;  2H4I A;  3O6I A;  4I8C A;  1B3F A;  3MVY A;  1MQJ A;  5ITO A;  5JTY A;  2CZL A;  1SD3 A;  2Q88 A;  3MVW A;  4MLV A;  3U1O A;  5I57 A;  2OJT A;  4U21 A;  1Z7M E;  2PX1 A;  1SW5 A;  2M8C A;  1MXY A;  3I3V A;  2Q2A A;  4NTL A;  3UP9 A;  2KLF A;  3DM0 A;  1WDN A;  3PUY E;  1RKM A;  3LSF B;  4WXJ A;  3K6V A;  5ICT A;  1QW0 A;  2V84 A;  1KWH A;  3MUQ A;  1FW0 A;  1IIT A;  2AYS A;  2WKY A;  5AA2 A;  3LC8 A;  1M5C A;  4U22 A;  4WKM A;  3VVF A;  5F1Q A;  2F6G A;  4G8H A;  1IXC A;  3HST A;  4LZ5 A;  1Q35 A;  3IOR A;  2O51 A;  2XXU A;  4BDR A;  3PUZ E;  3RPW A;  1LAH E;  5CI5 A;  1I6B A;  4RPO A;  5LOM A;  2ANJ A;  3CFX A;  3TTM A;  4GL8 A;  4YAH X;  2DYX A;  4F31 B;  3K00 A;  2F36 A;  1LCT A;  1NH8 A;  2OWS A;  1MDQ A;  3G3I A;  1MS7 A;  2XXQ A;  1A99 A;  1O63 A;  4F39 A;  3TMG A;  2THI A;  1Y3Q A;  1SI1 A;  3G3K A;  1Y1M A;  5L9M A;  4GIZ A;  1IUD A;  1LAX A;  3MPK A;  4TLM B;  3C9H A;  2RIN A;  4HTG A;  3CRB A;  3MZB A;  1EU8 A;  1B40 A;  5KCJ B;  4PQJ A;  5JEI A;  2PT2 A;  1URD A;  1PBQ A;  4KYD A;  3OOA A;  4LVQ A;  4GWO A;  5DVJ A;  3KOS A;  1NMU A;  4Q30 B;  3C36 A;  3PV0 E;  2GHA A;  2D3I A;  3FVN A;  5H8F B;  1FQA A;  3KN7 A;  2UYF A;  3QK6 A;  3TUS A;  4G2Z A;  1MY2 A;  1GVC A;  4I62 A;  1N0T A;  3IJO B;  3FJ7 A;  2F97 A;  5CRY A;  2GRV A;  2Q2C A;  5HM4 B;  3TZA A;  2R71 A;  3MJN A;  4KI0 E;  1LST A;  3DLN A;  3FD3 A;  2D5W A;  3W9W A;  5DVI A;  1FTO A;  3B6W A;  2BJJ X;  2VHA A;  4H1X A;  3IO6 A;  1HSE A;  3IB2 A;  1H45 A;  3K1N A;  2V3T A;  1SQY A;  4YKK A;  3OEM A;  3S9N C;  1RYX A;  3EHU A;  5H8N A;  3KGC A;  1R6Z A;  3BFU A;  4DIG A;  3O2A A;  2Y7P A;  4JBZ A;  3ODB A;  1JW1 A;  4FEC A;  5HBC A;  4POX A;  4R6Y A;  3MVZ A;  2QRY A;  3RNN A;  5FHN A;  4RYA A;  5JTY B;  4BDN A;  1WVJ A;  3RUM A;  3VXB A;  4G8N A;  3PMV A;  2DE4 A;  3RTF B;  5I57 B;  3TCH A;  4YMA A;  3Q25 A;  4G8M A;  2DOJ A;  1NKX A;  4ZE9 A;  1OVB A;  3WAE A;  4PFW A;  2AL4 A;  3USD A;  4AB5 A;  1SBP A;  1I6Q A;  5AA4 A;  4R74 A;  4RXL A;  4BLA A;  4F1U A;  1R9Q A;  2YPN A;  2RCA A;  2RKM A;  5CM6 A;  5L9S A;  1IIW A;  1MXW A;  4OQO A;  5CMK A;  3FVG A;  5AA2 B;  3R26 A;  1XT8 A;  2ESN A;  3RLF E;  3K01 A;  3MW0 A;  4ELQ A;  5F7V A;  2ZNU A;  2Y84 A;  1OLA A;  1AL3 A;  4KQP A;  3TFL A;  3IOT A;  4NMY A;  4G77 A;  3S4U A;  4IO7 A;  2FYI A;  1FQB A;  3KJT A;  5FTH A;  3GXA A;  1VFD A;  1EZO A;  2QS1 A;  3HV1 A;  4QFL A;  5L8D A;  4KCC A;  4YIC A;  4O3A A;  3IB1 A;  3DEL B;  4QFK A;  4DLD A;  4IY5 A;  4QF9 A;  3T93 B;  3OO8 A;  2W7Y A;  3JV9 A;  1B6H A;  3LSW A;  5KDT A;  2NVU B;  4N13 A;  2PBW A;  3KSJ A;  2OLB A;  4NF5 A;  2Y7I A;  1DMB A;  3CR9 A;  3E13 X;  1M5B A;  2ZNS A;  4U2R A;  3H6T A;  1B7Z A;  5I58 A;  1OIB A;  4X9T A;  3RY3 A;  3PD8 A;  4QFO A;  4OYV A;  4OWD A;  2PT1 A;  1A8E A;  3EQ1 A;  2RF1 A;  3VV5 A;  4NWD A;  4O3B A;  5EHS A;  4EQ7 A;  1VE4 A;  3GBB A;  5I59 A;  1R1N A;  4AQ4 A;  4F3S A;  1FQE A;  2CMO A;  3T9H B;  5I2K A;  1A55 A;  4OTE A;  2Z8D A;  5CMM A;  4NED A;  1S9T A;  4YB6 A;  3QXM A;  5A5X A;  1WOD A;  1JVX A;  3M3K A;  4N07 A;  4E0W A;  2O7I A;  4OZ9 A;  3OD7 A;  4WED A;  3C34 A;  3O28 A;  3H03 A;  1YTV A;  2I0B A;  1URG A;  1JW4 A;  4G4P A;  3U8Q A;  1QKA A;  3KEI A;  3HHF A;  4GLI A;  2O1M A;  3TEP A;  3AXF A;  2RC9 A;  4PFU A;  3UA8 A;  4IO2 A;  4YB5 A;  2HZK A;  2OZZ A;  4IY6 A;  1Y4C A;  1F9B A;  5BWJ A;  5L9O A;  3MP1 A;  1LFG A;  2Z22 A;  3G3G A;  3N94 A;  4ZEB A;  3GBA A;  1DPP A;  2QL3 A;  4H65 A;  5CBS A;  3PMW A;  3RGY A;  3RN8 A;  5H8N B;  4OEN A;  1MM6 A;  1YCJ A;  1FTL A;  3SET A;  1D4N A;  4MLQ A;  1USY E;  3S2V A;  4UA8 A;  1ELJ A;  4IO3 A;  2ZXT A;  3OO9 A;  2O1L A;  2UXA A;  1JET A;  3EPE A;  3CG1 A;  4OER A;  2VGQ A;  2QSX A;  2VP1 A;  4ELO A;  2GHB A;  4M4G A;  5H8H A;  1ZJL A;  1IXG A;  1MDP 1;  1B4Z A;  4H5F A;  4F1V A;  2H98 A;  5DYH A;  4QSD A;  5AA4 B;  4EF1 A;  3U92 A;  1VSO A;  2I0C A;  4DXB A;  3Q29 A;  1DSN A;  2O68 A;  3VXC A;  3VVE A;  1B51 A;  1ZIU A;  4E0X A;  5I2N B;  2XXH A;  4H0W A;  1YAE A;  4RA1 A;  1RYO A;  2F7B A;  1A54 A;  4JWY A;  2UVI A;  2Z8E A;  1TXF A;  1N84 A;  1QUK A;  5FHO A;  1B4H A;  2I4B A;  3UOR A;  2HEU A;  4JDF A;  2XXT A;  4O3C A;  1A40 A;  4MH5 A;  5J1D A;  3EF7 A;  2IEE A;  2D21 A;  3K6U A;  4EQ9 A;  3VVD A;  3BBR A;  1LFI A;  4QFN A;  4JSD A;  5KDT B;  1NH7 A;  1USY H;  4MF3 A;  4GFR A;  4TQU Q;  3K0V A;  4XTC Q;  3LSL A;  3MQ9 A;  2V25 A;  4ZZA A;  4ZEI A;  4NF5 B;  3W15 C;  4HW8 A;  4FAJ A;  2Y7R A;  2QJE A;  5I58 B;  3FV1 A;  1BLF A;  3T96 B;  3PPQ A;  2UVJ A;  4GVO A;  3V8X B;  2VD3 A;  3R7X A;  4ZZE A;  1ATG A;  4QSC A;  3LR1 A;  2X7Q A;  2XXR A;  1S50 A;  5I59 B;  3O9P A;  5I2K B;  3TCG A;  3CFZ A;  2LAO A;  4RK9 A;  1TWY A;  1PBP A;  3RTW B;  3N5L A;  2ONS A;  1ZKB A;  5A5X B;  3Q27 A;  2DWI A;  1MXV A;  3B6Q A;  1B7U A;  3CFL A;  2F7A A;  1Y1Z A;  4DXC A;  2REJ A;  4LUB A;  4GD5 A;  3TTL A;  3G3H A;  3MPL A;  3T22 A;  1FTK A;  1US5 A;  3TOD A;  1QJM A;  2R9J A;  5I56 A;  3W9V A;  1SW2 A;  3C33 A;  2NUV A;  2A5T A;  1UIU A;  4LON B;  4ESW A;  1S7Y A;  1QVS A;  4DCX A;  4YU0 A;  1BP5 A;  2QMW A;  2XX7 A;  2I48 A;  4GXS B;  4NWC A;  4YMB A;  1O64 A;  3IL1 B;  4R2B A;  1SVX B;  4U1Z A;  1FTJ A;  5EYF A;  3T66 A;  3R6U A;  5FHM A;  2IA4 A;  4LA9 A;  3DP8 A;  1R9L A;  2AIX A;  5K2X A;  3PD9 A;  4NE4 A;  4XIG Q;  2HXW A;  3IOV A;  4PFY A;  2UYE A;  1MXU A;  3IOU A;  4ELR A;  2DVZ A;  4RK2 A;  1MQD A;  3A3U A;  3M8U A;  3B6T A;  1GV8 A;  2NWJ A;  3ONM A;  1UTH A;  3LBS A;  5H8H B;  1N7X A;  2G29 A;  3CSG A;  2OK2 A;  4AB6 A;  1P99 A;  4JSO A;  2DE2 A;  1LBB A;  4EXK A;  4FED A;  3UGW A;  3F11 A;  1EZP A;  2ZYN A;  2H99 A;  1AIV A;  2QMX A;  4LZ8 A;  4Z0I A;  4R2F A;  1ZTY A;  3OMB A;  3TPA A;  1MXZ A;  1B3H A;  1NNF A;  4LAT A;  3IO4 A;  3KN3 A;  5DTB A;  4GL0 A;  2GH9 A;  3IX1 A;  3QAX A;  3O29 A;  1I69 A;  2G93 A;  3CG3 A;  1MY1 A;  1UIV A;  3N6T A;  2VD2 A;  1LGB C;  5B70 A;  2XXW A;  1II5 A;  5I2N A;  5AE4 A;  2H9B A;  3CVG A;  4X1B A;  4OFO A;  5KZT A;  4IB2 A;  1IXH A;  1CB6 A;  1LB9 A;  2I3W A;  1XVX A;  4YZZ A;  4HCY A;  3FVO A;  4R9G A;  4LP2 B;  4X48 A;  1B3L A;  2O84 X;  3VLV A;  4JB7 A;  4K3F A;  4WEP A;  1UTB A;  4Q5T A;  2NXO A;  3FVK A;  1MM7 A;  2XXX A;  2F6P A;  3O66 A;  4OMB A;  1MQI A;  1ZBM A;  1SW4 A;  1JVY A;  1SYH A;  3H6W A;  1B9J A;  1B0H A;  2DE3 A;  3HPI A;  3TEL A;  4XKR A;  1P1U A;  4R73 A;  1VR5 A;  4QFP A;  4YKJ A;  1EH3 A;  4MBP A;  3MZ9 A;  3SDF A;  1N76 A;  1O7T A;  1LFH A;  1B1X A;  5CMB A;  3MBP A;  1B46 A;  1MG1 A;  4EQB A;  1TFA A;  1LAG E;  3G3J A;  4PET A;  4Q8R A;  2VOZ A;  2O7U A;  3OXN A;  1B5J A;  3H3G A;  1SW1 A;  3VLW A;  3FXU A;  1DOT A;  4TOZ A;  1DTZ A;  3TKD A;  1JQF A;  3C32 A;  3TYH A;  2RC8 A;  4GF8 A;  2REG A;  3QSL A;  1B3G A;  2Z8F A;  3CI8 A;  1XS5 A;  1PC3 A;  1JEU A;  3LSX A;  4KFQ A;  2X7P A;  3RT6 B;  5I56 B;  1MRP A;  4G68 C;  5EHM A;  4IO6 A;  2A5T B;  1GTK A;  4R9F A;  1I6A A;  1ZU0 A;  2HZL A;  2E1S A;  2F8D A;  1BKA A;  3FV2 A;  2H5Y A;  3ZS6 A;  1GGG A;  3K6X A;  5CMC A;  4IGT A;  4M1V A;  4IO4 A;  1PB8 A;  4BDL A;  3B7D A;  3OSR A;  4RPN A;  5ITP A;  2NOO A;  2DS9 A;  1IZ1 A;  3MC2 A;  2A5S A;  3HCQ A;  3K2D A;  4KYS A;  3PPR A;  4BDQ A;  3O6H A;  2I4C A;  4DZ1 A;  3FZV A;  4NF4 A;  1MXX A;  5HPQ A;  4OVJ A;  2Q9T A;  5ICQ A;  3SEW A;  4OET A;  1P1N A;  4ZEC A;  1B5I A;  2FNC A;  4P0G A;  3U72 A;  3M3L A;  3SEX A;  5JK4 A;  3K1P A;  3TDJ A;  5IAI A;  4YKP A;  1QUJ A;  2RCB A;  5BUU A;  1UTH B;  1FQF A;  1Y4T A;  4KYE A;  1TT1 A;  5M2V A;  3FJG A;  2ABH A;  4OHN A;  3Q28 A;  4MFI A;  3ECR A;  3MAM A;  3FAS A;  1D3K A;  2B65 A;  3KZG A;  3KG2 A;  3OEK A;  4THI A;  1YPN A;  3E9X A;  2OWT A;  5ISU A;  4F3P A;  4HCW A;  4ELP A;  4U1O A;  3PPP A;  4QRZ A;  1LAF E;  1MQG A;  1OQG A;  1SDX A;  1P1W A;  1FCK A;  1H44 A;  3CSB A;  4OES A;  3VFJ A;  3PUV E;  1QUI A;  5DEX A;  1MY0 A;  1DPE A;  4F22 A;  1M5E A;  3ZKL A;  5CBR A;  1LLS A;  1MPD A;  4YB7 A;  1A8F A;  1BIY A;  4HS7 A;  1MY4 A;  4ND9 A;  2XD3 A;  1IXI A;  2UVG A;  3UN6 A;  3OO7 A;  3TCF A;  1H3D A;  3DP6 A;  1SYI A;  4ZEK A;  3VLU A;  4OXV A;  3E3K A;  3SER A;  4F3B A;  4JWX A;  4NF8 A;  3ILU B;  5AA3 A;  2ZYM A;  4KPT A;  1UTB B;  1B7H A;  2DXY A;  4H67 A;  4KD5 A;  2XXI A;  4FAT A;  1B3E A;  3E4R A;  3T9X B;  3QUJ A;  1B05 A;  1L5T A;  5ELV A;  3FAT A;  5K2Y A;  3MVX A;  2I49 A;  1POY 1;  3QIM A;  5FTI A;  4R75 A;  4P11 A;  3L6H A;  4UAC A;  3FIR A;  4OFJ A;  3GZG A;  3PPO A;  2YLN A;  3EHS A;  3V83 A;  4QSE A;  3A09 A;  1ZMG A;  2B3F A;  2XD2 A;  5DVF A;  1OQH A;  2V3Q A;  3U94 A;  1HSJ A;  5TPA A;  3Q26 A;  1M5D A;  3S9L C;  3G3F A;  1IEJ A;  3FUZ A;  4ZS9 A;  2ONR A;  3C31 A;  4ECF A;  4F18 A;  1Y9U A;  2I6E A;  3JYR A;  4GXA A;  1VFE A;  3SES A;  4H5G A;  3TTK A;  2RC7 A;  3HN0 A;  4EDP A;  4GRK A;  3V5A A;  4FJP A;  1QUL A;  2F34 A;  3IK6 B;  3OEN A;  3OSQ A;  2HQ0 A;  3UIF A;  2X26 A;  3O97 A;  4DXU A;  3D4C A;  1UQW A;  5B7D A;  1MH4 A;  4F19 A;  2DSF A;  1PB9 A;  4NF4 B;  1LB8 A;  4PE5 B;  5H8Q A;  2V3U A;  2DVC A;  2F5X A;  1HSL A;  3ZSF A;  4ESX A;  2XXP A;  4TLL B;  3IR1 A;  1ZLQ A;  2FA7 A;  3H4Z A;  2Q89 A;  3JZJ A;  3THI A;  1XHY A;  2I58 A;  2HAU A;  3EHT A;  1D9V A;  1EZ9 A;  1US4 A; 
#chains in the Genus database with same CATH topology
 1N04 A;  3O6G A;  2YJP A;  1MH3 A;  2OX3 A;  4ZDM A;  4F1Y A;  1B5H A;  2H25 A;  5TU0 A;  1JNF A;  2P0S A;  3PPN A;  3PUW E;  3V89 B;  1FJ6 A;  3KSX A;  3BFT A;  2O69 A;  3KFM A;  3OO6 A;  3G7W A;  2HAV A;  1NNP A;  2PYY A;  2Y7W A;  4RY1 A;  2DXR A;  3PU5 A;  3K6W A;  4OFL A;  1FQD A;  3FXR A;  4I1D A;  3I5O A;  4F29 A;  4X04 A;  5DEX B;  2QPQ A;  2O6A A;  1PB7 A;  3KOT A;  4N6P A;  4LQ5 A;  1G0H A;  1QKB A;  1LBC A;  4ZEF A;  2DP8 A;  2QS2 A;  5TP9 A;  2XWI A;  4HXV A;  1NNT A;  4FIM A;  1H76 A;  2P2A A;  3SEY A;  4OEV A;  5AA2 D;  3M3F A;  3H06 B;  2XXV A;  4BDO A;  4NF6 A;  3LV0 A;  1H43 A;  2XXY A;  2HCA A;  1PEB A;  1MY3 A;  2VT5 A;  4GOT A;  1ANF A;  1LEV A;  4IO5 A;  1AH5 A;  2Q8J A;  3D4G A;  3A3C A;  3FJM A;  2GFE A;  4G68 A;  4Q0C A;  2HXR A;  2OCU A;  2QS3 A;  4EXL A;  4PDH A;  1KA1 A;  3BIH A;  5I84 A;  3FXQ A;  1OMP A;  4F2O A;  1N3W A;  1IMF A;  2B4M A;  2PMS A;  4NF8 B;  3PMX A;  3T9V A;  2UVH A;  3P7I A;  4OEU A;  1J1N A;  1MPC A;  1DK4 A;  2DWJ A;  1B2H A;  3MZ1 A;  2F78 A;  1AMF A;  1FBP A;  3K02 A;  4C1T A;  3H7M A;  3IJX B;  1B1H A;  3TTN A;  2QVU A;  2R6G E;  4EF2 A;  3S9M C;  1P1O A;  3SEU A;  3BKI B;  3HHG A;  3H6U A;  3ILT B;  4IGR A;  1FTA A;  5H8S A;  4KCD A;  1XVY A;  1B32 A;  2OBG A;  1JP4 A;  2WYP A;  3QYT A;  3RT8 A;  1QGX A;  2I3V A;  3GLB A;  3RYD A;  1NV0 A;  4FEB A;  3FXB A;  4R6K A;  3UK4 A;  2CEY A;  4LQ2 A;  3MWB A;  3K4U A;  1OVT A;  3MP8 A;  5TPA B;  1FBD A;  3KBR A;  1URS A;  2Z23 A;  1Z7N E;  3B8B A;  3SEV A;  2XHD A;  1B58 A;  3LUY A;  2F35 A;  4HE1 A;  2R8T A;  1OLC A;  3I6V A;  1PDA A;  1NFT A;  1SPI A;  2PVU A;  1M5F A;  1Q1K A;  1NNK A;  4H6D A;  4GQO A;  3QUF A;  3RQT A;  2B4L A;  3FGS A;  4DCY A;  3ZKK A;  3IAZ A;  3OEL A;  2V93 A;  1B0L A;  2Q74 A;  3VDF A;  4H8I A;  1Y3N A;  2DWA A;  4FE8 A;  2QS4 A;  1LBZ A;  3HFU A;  1T0K A;  4C0R A;  4O7I A;  4P0I A;  3IB0 A;  4JXI A;  2AL5 A;  4KXP A;  1CE2 A;  1MQH A;  3CHG A;  3KN8 A;  4EUO A;  1JW5 A;  2KR0 A;  1N3X A;  3MP6 A;  3N26 A;  3C4M A;  3C35 A;  4NQ8 A;  5ET5 A;  2F7C A;  3PTY A;  3DP4 A;  2ALU A;  1XC1 A;  3IOW A;  5DT6 A;  5IKB A;  4BDM A;  5H8Q B;  4PFT A;  4L17 A;  4POW A;  2B3B A;  2XX8 A;  3T9U A;  3SKP A;  5KCJ A;  2E0S A;  1NV2 A;  4MIJ A;  1Y20 A;  3KJ7 A;  5AA1 A;  3CIJ A;  3L6G A;  3EN3 A;  3K1M A;  4KHZ E;  1XOC A;  1TFD A;  1GR2 A;  2ONK E;  3TQL A;  5H8F A;  4I3E A;  1FSA A;  4AS5 A;  4XKN A;  3TTR A;  4RJZ A;  4F2Q A;  4ONY A;  3VE1 B;  2DQV A;  1AOV A;  2ZNT A;  1FQC A;  1JEV A;  4LZ7 A;  4U4S A;  1DBZ A;  1D9Y A;  4PP0 A;  1MPB A;  3S9E A;  4XKQ A;  3H6V A;  2XX9 A;  2OWZ A;  4U4X A;  2ZYO A;  4H8J A;  1POT A;  3ISP A;  1NL5 A;  3N6U A;  4YKI A;  1DTG A;  1FBH A;  4RNS A;  4NHB A;  4JWO A;  2ZMB A;  4QHQ A;  4MX6 A;  1A7L A;  1N7W A;  4I9D A;  4OVR A;  4DDD A;  2Y7K A;  4PCD A;  1B52 A;  5TP9 B;  3PUX E;  3U93 A;  4F3G A;  4R6H A;  1BTJ A;  4ISU A;  4ZED A;  2HFB A;  4XKP A;  5CC2 A;  4NF6 B;  3TQW A;  4DE8 A;  1IMA A;  1SI0 A;  4U23 A;  4KR5 A;  3HO7 A;  3TAJ A;  1P1Q A;  2DWH A;  4X1D A;  4G68 B;  4R72 A;  4FOR A;  4ZE8 A;  4XXU A;  1FTM A;  4C1U A;  4NN3 A;  3PGF A;  2ZYK A;  1IQ7 A;  1Y3P A;  4PFI A;  2P1S A;  1FPL A;  1LCF A;  3WAF A;  4Z7E A;  2H4I A;  4MMP A;  3O6I A;  4I8C A;  1B3F A;  3MVY A;  1MQJ A;  5ITO A;  5JTY A;  2CZL A;  1SD3 A;  2Q88 A;  3MVW A;  1FPJ A;  4MLV A;  3U1O A;  5I57 A;  2OJT A;  4U21 A;  4X8R A;  1Z7M E;  2PX1 A;  1SW5 A;  1K9Y A;  2M8C A;  1MXY A;  3I3V A;  2Q2A A;  4NTL A;  3UP9 A;  2KLF A;  3DM0 A;  1WDN A;  3PUY E;  1RKM A;  3LSF B;  4WXJ A;  3K6V A;  5ICT A;  2Y5L A;  1QW0 A;  2V84 A;  4GBW A;  1KWH A;  3MUQ A;  1NUY A;  1FW0 A;  1IIT A;  2AYS A;  2CEX A;  2WKY A;  5AA2 A;  3LC8 A;  1M5C A;  1IMD A;  4U22 A;  4WKM A;  3VVF A;  4IR8 A;  5F1Q A;  2F6G A;  4G8H A;  4OVQ A;  1IXC A;  3HST A;  1DCU A;  4LZ5 A;  1Q35 A;  3IOR A;  2O51 A;  2XXU A;  4BDR A;  3PUZ E;  3RPW A;  1LAH E;  5CI5 A;  1I6B A;  4I40 A;  4RPO A;  5LOM A;  2ANJ A;  4GX6 A;  3CFX A;  3TTM A;  4GL8 A;  4YAH X;  2DYX A;  4F31 B;  3K00 A;  2F36 A;  1LCT A;  1NH8 A;  2OWS A;  1MDQ A;  3G3I A;  1MS7 A;  2XXQ A;  1A99 A;  1O63 A;  4F39 A;  3TMG A;  2THI A;  1Y3Q A;  1SI1 A;  3G3K A;  1Y1M A;  5ET6 A;  5L9M A;  4GIZ A;  1IUD A;  1LAX A;  3MPK A;  4TLM B;  3C9H A;  2RIN A;  4DI4 B;  4HTG A;  3CRB A;  3MZB A;  1EU8 A;  1B40 A;  3FBP A;  5KCJ B;  3T0J A;  4PQJ A;  1FBF A;  5JEI A;  2PT2 A;  1URD A;  1PBQ A;  4KYD A;  2JJK A;  3OOA A;  4LVQ A;  3KC1 A;  4GWO A;  5DVJ A;  3KOS A;  1NMU A;  4Q30 B;  3C36 A;  3PV0 E;  1RDZ A;  2GHA A;  2DDK A;  2D3I A;  3FVN A;  4PC9 A;  5H8F B;  2HPG A;  1FQA A;  4XEQ A;  3KN7 A;  1LBY A;  1FPK A;  2UYF A;  2CZH A;  3QK6 A;  4P9K A;  3TUS A;  3A29 A;  4G2Z A;  1MY2 A;  2ZZV A;  1GVC A;  4I62 A;  1N0T A;  3IJO B;  3FJ7 A;  2F97 A;  5CRY A;  1EYK A;  2GRV A;  2Q2C A;  5HM4 B;  3TZA A;  1NV3 A;  2R71 A;  3MJN A;  4KI0 E;  1LST A;  3DLN A;  3FD3 A;  2D5W A;  3W9W A;  5DVI A;  1FTO A;  3B6W A;  4P1E A;  1LBW A;  2BJJ X;  2VHA A;  4H1X A;  4P3L A;  3GYY A;  3IO6 A;  4PE3 A;  1HSE A;  3IB2 A;  1H45 A;  3K1N A;  2V3T A;  1SQY A;  4YKK A;  3OEM A;  3S9N C;  1RYX A;  3EHU A;  5H8N A;  3KGC A;  1R6Z A;  3BFU A;  4DIG A;  3O2A A;  2Y7P A;  4JBZ A;  3ODB A;  1JW1 A;  2V4C A;  4FEC A;  3RPL A;  5HBC A;  4POX A;  4R6Y A;  4PGN A;  3MVZ A;  2P3N A;  2QRY A;  3RNN A;  1NV6 A;  5FHN A;  2CZK A;  5IZ3 A;  4RYA A;  5JTY B;  4PBH A;  4BDN A;  1WVJ A;  3RUM A;  3VXB A;  1VDW A;  3B50 A;  3PMV A;  4G8N A;  2DE4 A;  3RTF B;  5I57 B;  3TCH A;  4YMA A;  3Q25 A;  4G8M A;  1YXI A;  2WBD A;  5T3J A;  2DOJ A;  4NF0 A;  1NKX A;  4ZE9 A;  1OVB A;  3WAE A;  1FPD A;  4PFW A;  2AL4 A;  3USD A;  5DW8 A;  4AB5 A;  1SBP A;  1I6Q A;  4R74 A;  4RXL A;  4BLA A;  4F1U A;  5AA4 A;  1R9Q A;  2YPN A;  2RCA A;  2RKM A;  5CM6 A;  5L9S A;  1IIW A;  1MXW A;  4OQO A;  5CMK A;  4N81 A;  3FVG A;  5AA2 B;  1K9Z A;  3R26 A;  1XT8 A;  2ESN A;  3RLF E;  3K01 A;  3MW0 A;  4ELQ A;  5F7V A;  2ZNU A;  2Y84 A;  1OLA A;  1AL3 A;  4KQP A;  4O7M A;  3TFL A;  3IOT A;  4NMY A;  3IFA A;  4G77 A;  3S4U A;  4XFE A;  4IO7 A;  2FYI A;  1FQB A;  3KJT A;  4OA4 A;  5FTH A;  3GXA A;  1VFD A;  1EZO A;  4QFL A;  2QS1 A;  3HV1 A;  5L8D A;  2WYK A;  3BIG A;  4KCC A;  4YIC A;  4O3A A;  3IB1 A;  2XWO A;  5J16 A;  3DEL B;  4NGU A;  4QFK A;  4DLD A;  4IY5 A;  1EYJ A;  4QF9 A;  3T93 B;  3OO8 A;  2W7Y A;  3JV9 A;  1B6H A;  3LSW A;  4HE0 A;  5KDT A;  4UAB A;  4OVP A;  2NVU B;  4N13 A;  2PBW A;  3KSJ A;  1FPB A;  2OLB A;  4NF5 A;  2Y7I A;  1DMB A;  3CR9 A;  3E13 X;  3U65 A;  1M5B A;  2ZNS A;  4U2R A;  3H6T A;  1B7Z A;  5I58 A;  1OIB A;  4X9T A;  3RY3 A;  3PD8 A;  4QFO A;  4OYV A;  4OWD A;  2PT1 A;  1A8E A;  3EQ1 A;  2RF1 A;  3VV5 A;  4NWD A;  4O3B A;  1NV4 A;  5EHS A;  4EQ7 A;  1VE4 A;  1NV5 A;  3GBB A;  5I59 A;  1R1N A;  4AQ4 A;  4F3S A;  1FQE A;  2CMO A;  3T9H B;  5I2K A;  1A55 A;  4OTE A;  2Z8D A;  5CMM A;  4NED A;  1S9T A;  3E79 A;  4YB6 A;  3QXM A;  5A5X A;  1WOD A;  1JVX A;  3M3K A;  4N07 A;  4E0W A;  2O7I A;  4OZ9 A;  3OD7 A;  4WED A;  3C34 A;  2VPN A;  1FPF A;  3O28 A;  3H03 A;  1YTV A;  5IZZ A;  2L5V A;  4P56 A;  2I0B A;  1URG A;  1JW4 A;  4G4P A;  1QKA A;  3U8Q A;  3KEI A;  3HHF A;  4GLI A;  2O1M A;  3TEP A;  3AXF A;  2RC9 A;  4PFU A;  4MJO A;  3UA8 A;  4IO2 A;  5IGA A;  4YB5 A;  2HZK A;  2OZZ A;  4IY6 A;  1Y4C A;  1F9B A;  5BWJ A;  5L9O A;  3MP1 A;  1LFG A;  2Z22 A;  3G3G A;  2WX9 A;  3N94 A;  4ZEB A;  3GBA A;  1IMB A;  1DPP A;  2QL3 A;  4H65 A;  5CBS A;  3PMW A;  3RGY A;  3RN8 A;  5H8N B;  4OEN A;  1MM6 A;  1YCJ A;  2F3D A;  1FTL A;  5IZ1 A;  3SET A;  1D4N A;  3RPL B;  4MLQ A;  1LBX A;  1USY E;  1EYI A;  3S2V A;  4UA8 A;  4PTK A;  1ELJ A;  5IZ3 B;  4IO3 A;  2ZXT A;  3OO9 A;  2FVZ A;  2O1L A;  2UXA A;  1JET A;  3EPE A;  3CG1 A;  4OER A;  2VGQ A;  1FPE A;  4GX4 A;  2QSX A;  2CZI A;  2VP1 A;  4I3Y A;  4ELO A;  2GHB A;  4M4G A;  5H8H A;  1ZJL A;  1IXG A;  1MDP 1;  1B4Z A;  4H5F A;  4F1V A;  2H98 A;  5DYH A;  2FIE A;  5EQ7 A;  4QSD A;  5AA4 B;  4EF1 A;  3U92 A;  1YYZ A;  1VSO A;  2I0C A;  4DXB A;  3Q29 A;  1DSN A;  2O68 A;  3VXC A;  1FBG A;  4XF5 A;  3VVE A;  1B51 A;  1ZIU A;  4E0X A;  5I2N B;  2XXH A;  1FBE A;  4H0W A;  1YAE A;  4RA1 A;  1RYO A;  2F7B A;  1A54 A;  4JWY A;  2UVI A;  2Z8E A;  4GX3 A;  1TXF A;  1N84 A;  1LBV A;  1QUK A;  5FHO A;  1B4H A;  2I4B A;  3UOR A;  2HEU A;  4JDF A;  2XXT A;  4O3C A;  3LUZ A;  1A40 A;  4MH5 A;  5J1D A;  4FBP A;  3EF7 A;  2WEF A;  4PAI A;  4JVD A;  2IEE A;  2D21 A;  3K6U A;  4EQ9 A;  3VVD A;  2Y5K A;  3BBR A;  1LFI A;  4QFN A;  4JSD A;  5KDT B;  1NH7 A;  1USY H;  4MF3 A;  2P3V A;  4QBA A;  4GFR A;  4TQU Q;  3K0V A;  4XTC Q;  3KC0 A;  3LSL A;  3MQ9 A;  2V25 A;  4ZZA A;  4ZEI A;  4NF5 B;  3W15 C;  4HW8 A;  4FAJ A;  2Y7R A;  2QJE A;  5I58 B;  3FV1 A;  1BLF A;  3T96 B;  1NV7 A;  3PPQ A;  2UVJ A;  4GVO A;  3V8X B;  4P8B A;  2VD3 A;  3R7X A;  1NUX A;  4MCO A;  4ZZE A;  1ATG A;  1NUZ A;  4QSC A;  3LR1 A;  2X7Q A;  4PGP A;  2XXR A;  5EQ9 A;  1CNQ A;  1S50 A;  5I59 B;  3O9P A;  2VPO A;  5I2K B;  3TCG A;  3CFZ A;  2LAO A;  4RK9 A;  1TWY A;  1PBP A;  3RTW B;  3N5L A;  2ONS A;  1ZKB A;  5A5X B;  3Q27 A;  1XI6 A;  2DWI A;  5I7I A;  1MXV A;  3B6Q A;  4PAK A;  1B7U A;  3CFL A;  2F7A A;  4NG7 A;  1Y1Z A;  4DXC A;  2REJ A;  4LUB A;  3EKI A;  4GD5 A;  4P47 A;  4G61 A;  1G0I A;  3TTL A;  3G3H A;  3MPL A;  3T22 A;  1FTK A;  1US5 A;  3TOD A;  1QJM A;  4GWU A;  1FPG A;  2R9J A;  5I56 A;  3W9V A;  1SW2 A;  3C33 A;  2NUV A;  2A5T A;  4O8M A;  4N8G A;  1UIU A;  4LON B;  4ESW A;  1S7Y A;  1QVS A;  4DCX A;  4YU0 A;  1BP5 A;  1RDX A;  4GWZ A;  2PFZ A;  2QMW A;  2XX7 A;  2I48 A;  4GXS B;  4NWC A;  4YMB A;  1O64 A;  3IL1 B;  4GWY A;  4R2B A;  1SVX B;  4U1Z A;  3QMF A;  1FTJ A;  5EYF A;  3T66 A;  3R6U A;  5FHM A;  2IA4 A;  4LA9 A;  3DP8 A;  1R9L A;  2AIX A;  5K2X A;  3PD9 A;  4NE4 A;  4XIG Q;  2HXW A;  3IOV A;  4PFY A;  2UYE A;  4N6K A;  1MXU A;  3IOU A;  4ELR A;  2DVZ A;  4RK2 A;  1MQD A;  3A3U A;  3M8U A;  3B6T A;  4PF6 A;  1GV8 A;  2NWJ A;  3ONM A;  1UTH A;  3LBS A;  5H8H B;  1N7X A;  4DI3 D;  2G29 A;  3CSG A;  2OK2 A;  4AB6 A;  1P99 A;  4GWW A;  4JSO A;  2DE2 A;  1LBB A;  4EXK A;  5ET7 A;  4FED A;  3UGW A;  2F3B A;  3F11 A;  1EZP A;  2ZYN A;  5EQA A;  2H99 A;  2FBP A;  1AIV A;  2QMX A;  4LZ8 A;  4Z0I A;  4R2F A;  1KZ8 A;  1ZTY A;  4PAF A;  3OMB A;  3TPA A;  1MXZ A;  1B3H A;  1FJ9 A;  1NNF A;  4LAT A;  3IO4 A;  3KN3 A;  2MKZ A;  5DTB A;  4GL0 A;  2GH9 A;  3IX1 A;  1IME A;  3QAX A;  1BK4 A;  2XWK A;  3O29 A;  1I69 A;  4N8Y A;  2G93 A;  3CG3 A;  1MY1 A;  1UIV A;  3N6T A;  2VD2 A;  5FBP A;  1LGB C;  5B70 A;  2XXW A;  3IFC A;  1II5 A;  4PF8 A;  5I2N A;  5AE4 A;  2H9B A;  3CVG A;  4X1B A;  4OFO A;  5KZT A;  4IB2 A;  1IXH A;  1CB6 A;  4NAP A;  1LB9 A;  4MNC A;  2I3W A;  1XVX A;  4YZZ A;  4HCY A;  4AS4 A;  3FVO A;  4R9G A;  4LP2 B;  3MST A;  4X48 A;  5ESY A;  1B3L A;  2O84 X;  3VLV A;  4JB7 A;  4K3F A;  4WEP A;  1UTB A;  4Q5T A;  2ZZW A;  2NXO A;  3FVK A;  1MM7 A;  2XXX A;  2F6P A;  3O66 A;  4OMB A;  1MQI A;  1ZBM A;  1SW4 A;  1JVY A;  1SYH A;  3H6W A;  1B9J A;  1B0H A;  2DE3 A;  3HPI A;  4N17 A;  5I3S A;  3TEL A;  4XKR A;  1P1U A;  5LTC A;  4R73 A;  1VR5 A;  4QFP A;  4YKJ A;  1EH3 A;  4MBP A;  3MZ9 A;  3SDF A;  1D9Q A;  4JVC A;  4QXD A;  1N76 A;  1KA0 A;  1O7T A;  1LFH A;  1B1X A;  5CMB A;  3E78 A;  3MBP A;  1B46 A;  2XA5 A;  4MNP A;  1MG1 A;  4EQB A;  1TFA A;  2QVR A;  1LAG E;  3G3J A;  4PET A;  4Q8R A;  2VOZ A;  2O7U A;  3OXN A;  1B5J A;  3H3G A;  1SW1 A;  3VLW A;  3FXU A;  1DOT A;  4TOZ A;  1DTZ A;  3TKD A;  1JQF A;  3C32 A;  3TYH A;  1AWB A;  2RC8 A;  4GF8 A;  2REG A;  3QSL A;  1B3G A;  2Z8F A;  3CI8 A;  1XS5 A;  1PC3 A;  1NUW A;  1JEU A;  3LSX A;  4N15 A;  4KFQ A;  2X7P A;  3RT6 B;  5I56 B;  2HHM A;  1MRP A;  4G68 C;  2Q8M A;  5EHM A;  4IO6 A;  2A5T B;  1GTK A;  4R9F A;  1I6A A;  1ZU0 A;  2HZL A;  2E1S A;  2F8D A;  2PCR A;  1BKA A;  3FV2 A;  2H5Y A;  3ZS6 A;  1GGG A;  3K6X A;  5CMC A;  3MYU A;  4IGT A;  4M1V A;  4IO4 A;  1PB8 A;  4MHF A;  3B7D A;  4BDL A;  3OSR A;  4RPN A;  5ITP A;  2NOO A;  2DS9 A;  1IZ1 A;  3MC2 A;  2A5S A;  3HCQ A;  3K2D A;  4KYS A;  3PPR A;  4BDQ A;  3O6H A;  2I4C A;  4DZ1 A;  2PFY A;  3FZV A;  4NF4 A;  1MXX A;  5HPQ A;  4OVJ A;  2Q9T A;  2QFL A;  5ICQ A;  3SEW A;  4OET A;  1P1N A;  4ZEC A;  1B5I A;  2FNC A;  4P0G A;  4JVI A;  3U72 A;  3M3L A;  3SEX A;  5JK4 A;  3K1P A;  2GQ1 A;  3TDJ A;  5IAI A;  4O94 A;  4YKP A;  1QUJ A;  2RCB A;  5BUU A;  1UTH B;  4LN5 A;  1FQF A;  1Y4T A;  4KYE A;  2QVV A;  1TT1 A;  5M2V A;  3FJG A;  2ABH A;  4OHN A;  4GWX A;  3Q28 A;  4MFI A;  5I5P A;  3ECR A;  3MAM A;  3FAS A;  1D3K A;  2B65 A;  3KZG A;  3KG2 A;  3OEK A;  4N6D A;  4THI A;  4MEV A;  1YPN A;  3E9X A;  2OWT A;  5ISU A;  4F3P A;  2WBB A;  4HCW A;  4ELP A;  4U1O A;  3PPP A;  4QRZ A;  5A5L A;  1LAF E;  1MQG A;  1OQG A;  1SDX A;  1P1W A;  4OVT A;  1FCK A;  3SZP A;  1H44 A;  3CSB A;  4OES A;  3VFJ A;  3PUV E;  1NV1 A;  1QUI A;  5EYH A;  5DEX A;  1MY0 A;  1DPE A;  2ZZX A;  4F22 A;  1M5E A;  4MNI A;  4NX1 A;  3ZKL A;  5CBR A;  4HE2 A;  1LLS A;  1MPD A;  1IMC A;  4YB7 A;  1A8F A;  1BIY A;  4HS7 A;  1MY4 A;  4PBQ A;  4ND9 A;  2XD3 A;  1IXI A;  4H45 A;  5F24 A;  2UVG A;  3UN6 A;  3T1B A;  3OO7 A;  3TCF A;  1H3D A;  3DP6 A;  1SYI A;  4ZEK A;  3VLU A;  4OXV A;  3E3K A;  3SER A;  4N91 A;  4F3B A;  4JWX A;  2FHY A;  4PFB A;  4NF8 A;  3ILU B;  5AA3 A;  2ZYM A;  4KPT A;  1UTB B;  1B7H A;  2DXY A;  1Q9D A;  4H67 A;  4KD5 A;  2XXI A;  4FAT A;  1B3E A;  4N4U A;  3E4R A;  3T9X B;  3QUJ A;  1B05 A;  3ROJ A;  1L5T A;  5ET8 A;  5ELV A;  3FAT A;  5K2Y A;  5LDZ A;  2FIX A;  3MVX A;  2I49 A;  1POY 1;  3QIM A;  5FTI A;  4PFR A;  4PDD A;  1FRP A;  5IM2 A;  4R75 A;  4GBV A;  4P11 A;  4H46 A;  3NOH A;  3L6H A;  4UAC A;  3FIR A;  4OFJ A;  3GZG A;  3PPO A;  2YLN A;  3EHS A;  3V83 A;  4QSE A;  3A09 A;  1ZMG A;  2B3F A;  2XD2 A;  5EQ8 A;  5DVF A;  2KQZ A;  1OQH A;  1INP A;  2V3Q A;  3U94 A;  1HSJ A;  5TPA A;  3Q26 A;  1M5D A;  3S9L C;  3KBZ A;  3G3F A;  1IEJ A;  3FUZ A;  4ZS9 A;  2ONR A;  3C31 A;  4ECF A;  4F18 A;  1Y9U A;  4OVS A;  2I6E A;  3JYR A;  4GXA A;  1RDY A;  2BJI A;  4P1L A;  1VFE A;  3SES A;  4H5G A;  3TTK A;  2RC7 A;  3HN0 A;  4EDP A;  4GRK A;  3V5A A;  4FJP A;  1QUL A;  4OAN A;  2F34 A;  3IK6 B;  3OEN A;  3OSQ A;  2HQ0 A;  3UIF A;  2XXK A;  2X26 A;  1FPI A;  3O97 A;  4GWS A;  4DXU A;  4MAG A;  1NI9 A;  3D4C A;  1UQW A;  5EYG A;  5B7D A;  1MH4 A;  4F19 A;  1FBC A;  2DSF A;  1PB9 A;  4NF4 B;  1LB8 A;  4PE5 B;  5H8Q A;  2V3U A;  2DVC A;  2F5X A;  1YZ0 A;  1HSL A;  3ZSF A;  4ESX A;  2XWV A;  2XXP A;  4TLL B;  3IR1 A;  1ZLQ A;  2FA7 A;  3H4Z A;  2Q89 A;  3JZJ A;  3THI A;  1XHY A;  2I58 A;  2HAU A;  3D1R A;  3EHT A;  1D9V A;  1EZ9 A;  1US4 A; 
#chains in the Genus database with same CATH homology
 1N04 A;  3O6G A;  2YJP A;  1MH3 A;  4F1Y A;  4ZDM A;  1B5H A;  2H25 A;  5TU0 A;  1JNF A;  2P0S A;  3PPN A;  3PUW E;  3V89 B;  3KSX A;  3BFT A;  2O69 A;  3KFM A;  3OO6 A;  3G7W A;  2HAV A;  1NNP A;  2PYY A;  2Y7W A;  4RY1 A;  2DXR A;  3PU5 A;  3K6W A;  4OFL A;  1FQD A;  3FXR A;  4I1D A;  3I5O A;  4F29 A;  5DEX B;  2QPQ A;  2O6A A;  1PB7 A;  3KOT A;  4N6P A;  4LQ5 A;  1QKB A;  1LBC A;  4ZEF A;  2DP8 A;  2QS2 A;  5TP9 A;  1NNT A;  4FIM A;  1H76 A;  2P2A A;  3SEY A;  4OEV A;  5AA2 D;  3M3F A;  3H06 B;  2XXV A;  4BDO A;  4NF6 A;  1H43 A;  2XXY A;  2HCA A;  1PEB A;  1MY3 A;  4GOT A;  1ANF A;  4IO5 A;  1AH5 A;  2Q8J A;  3D4G A;  3A3C A;  3FJM A;  2GFE A;  4G68 A;  4Q0C A;  2OCU A;  2QS3 A;  4EXL A;  5I84 A;  3FXQ A;  1OMP A;  4F2O A;  1N3W A;  2PMS A;  4NF8 B;  3PMX A;  3T9V A;  2UVH A;  3P7I A;  4OEU A;  1J1N A;  1MPC A;  2DWJ A;  1B2H A;  3MZ1 A;  2F78 A;  1AMF A;  3K02 A;  4C1T A;  3H7M A;  3IJX B;  1B1H A;  3TTN A;  2R6G E;  4EF2 A;  3S9M C;  1P1O A;  3SEU A;  3BKI B;  3HHG A;  3H6U A;  3ILT B;  4IGR A;  5H8S A;  4KCD A;  1XVY A;  1B32 A;  2OBG A;  3QYT A;  3RT8 A;  2I3V A;  3GLB A;  4FEB A;  4R6K A;  3UK4 A;  4LQ2 A;  3MWB A;  3K4U A;  1OVT A;  3MP8 A;  5TPA B;  3KBR A;  1URS A;  2Z23 A;  1Z7N E;  3SEV A;  2XHD A;  1B58 A;  3LUY A;  2F35 A;  1OLC A;  3I6V A;  1PDA A;  1NFT A;  2PVU A;  1M5F A;  1Q1K A;  1NNK A;  4H6D A;  4GQO A;  3QUF A;  3RQT A;  3FGS A;  4DCY A;  3ZKK A;  3IAZ A;  3OEL A;  2V93 A;  1B0L A;  3VDF A;  4H8I A;  1Y3N A;  2DWA A;  4FE8 A;  2QS4 A;  1T0K A;  4C0R A;  4P0I A;  3IB0 A;  4JXI A;  2AL5 A;  1CE2 A;  1MQH A;  3KN8 A;  4EUO A;  1JW5 A;  1N3X A;  3MP6 A;  3N26 A;  3C4M A;  3C35 A;  2F7C A;  3DP4 A;  2ALU A;  1XC1 A;  3IOW A;  5DT6 A;  5IKB A;  4BDM A;  5H8Q B;  4PFT A;  4L17 A;  4POW A;  2B3B A;  2XX8 A;  3T9U A;  3SKP A;  5KCJ A;  2E0S A;  1Y20 A;  3KJ7 A;  5AA1 A;  3CIJ A;  3L6G A;  3EN3 A;  3K1M A;  4KHZ E;  1XOC A;  1TFD A;  1GR2 A;  2ONK E;  3TQL A;  5H8F A;  4XKN A;  3TTR A;  4RJZ A;  4F2Q A;  4ONY A;  3VE1 B;  2DQV A;  1AOV A;  2ZNT A;  1FQC A;  1JEV A;  4LZ7 A;  4U4S A;  1D9Y A;  4PP0 A;  1MPB A;  3S9E A;  4XKQ A;  3H6V A;  2XX9 A;  4U4X A;  2ZYO A;  4H8J A;  1POT A;  1NL5 A;  3N6U A;  4YKI A;  1DTG A;  4RNS A;  4JWO A;  2ZMB A;  4QHQ A;  1A7L A;  1N7W A;  4I9D A;  4DDD A;  2Y7K A;  1B52 A;  5TP9 B;  3PUX E;  3U93 A;  4F3G A;  4R6H A;  1BTJ A;  4ISU A;  4ZED A;  2HFB A;  4XKP A;  5CC2 A;  4NF6 B;  3TQW A;  4DE8 A;  1SI0 A;  4U23 A;  4KR5 A;  3HO7 A;  3TAJ A;  1P1Q A;  2DWH A;  4X1D A;  4G68 B;  4R72 A;  4FOR A;  4ZE8 A;  4XXU A;  1FTM A;  4C1U A;  3PGF A;  2ZYK A;  1IQ7 A;  1Y3P A;  2P1S A;  1LCF A;  3WAF A;  4Z7E A;  2H4I A;  3O6I A;  4I8C A;  1B3F A;  3MVY A;  1MQJ A;  5ITO A;  5JTY A;  2CZL A;  1SD3 A;  2Q88 A;  3MVW A;  4MLV A;  3U1O A;  5I57 A;  2OJT A;  4U21 A;  1Z7M E;  2PX1 A;  1SW5 A;  2M8C A;  1MXY A;  3I3V A;  2Q2A A;  4NTL A;  3UP9 A;  2KLF A;  3DM0 A;  1WDN A;  3PUY E;  1RKM A;  3LSF B;  4WXJ A;  3K6V A;  5ICT A;  1QW0 A;  2V84 A;  1KWH A;  3MUQ A;  1FW0 A;  1IIT A;  2AYS A;  2WKY A;  5AA2 A;  3LC8 A;  1M5C A;  4U22 A;  4WKM A;  3VVF A;  5F1Q A;  2F6G A;  4G8H A;  1IXC A;  3HST A;  4LZ5 A;  1Q35 A;  3IOR A;  2O51 A;  2XXU A;  4BDR A;  3PUZ E;  3RPW A;  1LAH E;  5CI5 A;  1I6B A;  4RPO A;  5LOM A;  2ANJ A;  3CFX A;  3TTM A;  4GL8 A;  4YAH X;  2DYX A;  4F31 B;  3K00 A;  2F36 A;  1LCT A;  1NH8 A;  2OWS A;  1MDQ A;  3G3I A;  1MS7 A;  2XXQ A;  1A99 A;  1O63 A;  4F39 A;  3TMG A;  2THI A;  1Y3Q A;  1SI1 A;  3G3K A;  1Y1M A;  5L9M A;  4GIZ A;  1IUD A;  1LAX A;  3MPK A;  4TLM B;  3C9H A;  2RIN A;  4HTG A;  3CRB A;  3MZB A;  1EU8 A;  1B40 A;  5KCJ B;  4PQJ A;  5JEI A;  2PT2 A;  1URD A;  1PBQ A;  4KYD A;  3OOA A;  4LVQ A;  4GWO A;  5DVJ A;  3KOS A;  1NMU A;  4Q30 B;  3C36 A;  3PV0 E;  2GHA A;  2D3I A;  3FVN A;  5H8F B;  1FQA A;  3KN7 A;  2UYF A;  3QK6 A;  3TUS A;  4G2Z A;  1MY2 A;  1GVC A;  4I62 A;  1N0T A;  3IJO B;  3FJ7 A;  2F97 A;  5CRY A;  2GRV A;  2Q2C A;  5HM4 B;  3TZA A;  2R71 A;  3MJN A;  4KI0 E;  1LST A;  3DLN A;  3FD3 A;  2D5W A;  3W9W A;  5DVI A;  1FTO A;  3B6W A;  2BJJ X;  2VHA A;  4H1X A;  3IO6 A;  1HSE A;  3IB2 A;  1H45 A;  3K1N A;  2V3T A;  1SQY A;  4YKK A;  3OEM A;  3S9N C;  1RYX A;  3EHU A;  5H8N A;  3KGC A;  1R6Z A;  3BFU A;  4DIG A;  3O2A A;  2Y7P A;  4JBZ A;  3ODB A;  1JW1 A;  4FEC A;  5HBC A;  4POX A;  4R6Y A;  3MVZ A;  2QRY A;  3RNN A;  5FHN A;  4RYA A;  5JTY B;  4BDN A;  1WVJ A;  3RUM A;  3VXB A;  4G8N A;  3PMV A;  2DE4 A;  3RTF B;  5I57 B;  3TCH A;  4YMA A;  3Q25 A;  4G8M A;  2DOJ A;  1NKX A;  4ZE9 A;  1OVB A;  3WAE A;  4PFW A;  2AL4 A;  3USD A;  4AB5 A;  1SBP A;  1I6Q A;  5AA4 A;  4R74 A;  4RXL A;  4BLA A;  4F1U A;  1R9Q A;  2YPN A;  2RCA A;  2RKM A;  5CM6 A;  5L9S A;  1IIW A;  1MXW A;  4OQO A;  5CMK A;  3FVG A;  5AA2 B;  3R26 A;  1XT8 A;  2ESN A;  3RLF E;  3K01 A;  3MW0 A;  4ELQ A;  5F7V A;  2ZNU A;  2Y84 A;  1OLA A;  1AL3 A;  4KQP A;  3TFL A;  3IOT A;  4NMY A;  4G77 A;  3S4U A;  4IO7 A;  2FYI A;  1FQB A;  3KJT A;  5FTH A;  3GXA A;  1VFD A;  1EZO A;  2QS1 A;  3HV1 A;  4QFL A;  5L8D A;  4KCC A;  4YIC A;  4O3A A;  3IB1 A;  3DEL B;  4QFK A;  4DLD A;  4IY5 A;  4QF9 A;  3T93 B;  3OO8 A;  2W7Y A;  3JV9 A;  1B6H A;  3LSW A;  5KDT A;  2NVU B;  4N13 A;  2PBW A;  3KSJ A;  2OLB A;  4NF5 A;  2Y7I A;  1DMB A;  3CR9 A;  3E13 X;  1M5B A;  2ZNS A;  4U2R A;  3H6T A;  1B7Z A;  5I58 A;  1OIB A;  4X9T A;  3RY3 A;  3PD8 A;  4QFO A;  4OYV A;  4OWD A;  2PT1 A;  1A8E A;  3EQ1 A;  2RF1 A;  3VV5 A;  4NWD A;  4O3B A;  5EHS A;  4EQ7 A;  1VE4 A;  3GBB A;  5I59 A;  1R1N A;  4AQ4 A;  4F3S A;  1FQE A;  2CMO A;  3T9H B;  5I2K A;  1A55 A;  4OTE A;  2Z8D A;  5CMM A;  4NED A;  1S9T A;  4YB6 A;  3QXM A;  5A5X A;  1WOD A;  1JVX A;  3M3K A;  4N07 A;  4E0W A;  2O7I A;  4OZ9 A;  3OD7 A;  4WED A;  3C34 A;  3O28 A;  3H03 A;  1YTV A;  2I0B A;  1URG A;  1JW4 A;  4G4P A;  3U8Q A;  1QKA A;  3KEI A;  3HHF A;  4GLI A;  2O1M A;  3TEP A;  3AXF A;  2RC9 A;  4PFU A;  3UA8 A;  4IO2 A;  4YB5 A;  2HZK A;  2OZZ A;  4IY6 A;  1Y4C A;  1F9B A;  5BWJ A;  5L9O A;  3MP1 A;  1LFG A;  2Z22 A;  3G3G A;  3N94 A;  4ZEB A;  3GBA A;  1DPP A;  2QL3 A;  4H65 A;  5CBS A;  3PMW A;  3RGY A;  3RN8 A;  5H8N B;  4OEN A;  1MM6 A;  1YCJ A;  1FTL A;  3SET A;  1D4N A;  4MLQ A;  1USY E;  3S2V A;  4UA8 A;  1ELJ A;  4IO3 A;  2ZXT A;  3OO9 A;  2O1L A;  2UXA A;  1JET A;  3EPE A;  3CG1 A;  4OER A;  2VGQ A;  2QSX A;  2VP1 A;  4ELO A;  2GHB A;  4M4G A;  5H8H A;  1ZJL A;  1IXG A;  1MDP 1;  1B4Z A;  4H5F A;  4F1V A;  2H98 A;  5DYH A;  4QSD A;  5AA4 B;  4EF1 A;  3U92 A;  1VSO A;  2I0C A;  4DXB A;  3Q29 A;  1DSN A;  2O68 A;  3VXC A;  3VVE A;  1B51 A;  1ZIU A;  4E0X A;  5I2N B;  2XXH A;  4H0W A;  1YAE A;  4RA1 A;  1RYO A;  2F7B A;  1A54 A;  4JWY A;  2UVI A;  2Z8E A;  1TXF A;  1N84 A;  1QUK A;  5FHO A;  1B4H A;  2I4B A;  3UOR A;  2HEU A;  4JDF A;  2XXT A;  4O3C A;  1A40 A;  4MH5 A;  5J1D A;  3EF7 A;  2IEE A;  2D21 A;  3K6U A;  4EQ9 A;  3VVD A;  3BBR A;  1LFI A;  4QFN A;  4JSD A;  5KDT B;  1NH7 A;  1USY H;  4MF3 A;  4GFR A;  4TQU Q;  3K0V A;  4XTC Q;  3LSL A;  3MQ9 A;  2V25 A;  4ZZA A;  4ZEI A;  4NF5 B;  3W15 C;  4HW8 A;  4FAJ A;  2Y7R A;  2QJE A;  5I58 B;  3FV1 A;  1BLF A;  3T96 B;  3PPQ A;  2UVJ A;  4GVO A;  3V8X B;  2VD3 A;  3R7X A;  4ZZE A;  1ATG A;  4QSC A;  3LR1 A;  2X7Q A;  2XXR A;  1S50 A;  5I59 B;  3O9P A;  5I2K B;  3TCG A;  3CFZ A;  2LAO A;  4RK9 A;  1TWY A;  1PBP A;  3RTW B;  3N5L A;  2ONS A;  1ZKB A;  5A5X B;  3Q27 A;  2DWI A;  1MXV A;  3B6Q A;  1B7U A;  3CFL A;  2F7A A;  1Y1Z A;  4DXC A;  2REJ A;  4LUB A;  4GD5 A;  3TTL A;  3G3H A;  3MPL A;  3T22 A;  1FTK A;  1US5 A;  3TOD A;  1QJM A;  2R9J A;  5I56 A;  3W9V A;  1SW2 A;  3C33 A;  2NUV A;  2A5T A;  1UIU A;  4LON B;  4ESW A;  1S7Y A;  1QVS A;  4DCX A;  4YU0 A;  1BP5 A;  2QMW A;  2XX7 A;  2I48 A;  4GXS B;  4NWC A;  4YMB A;  1O64 A;  3IL1 B;  4R2B A;  1SVX B;  4U1Z A;  1FTJ A;  5EYF A;  3T66 A;  3R6U A;  5FHM A;  2IA4 A;  4LA9 A;  3DP8 A;  1R9L A;  2AIX A;  5K2X A;  3PD9 A;  4NE4 A;  4XIG Q;  2HXW A;  3IOV A;  4PFY A;  2UYE A;  1MXU A;  3IOU A;  4ELR A;  2DVZ A;  4RK2 A;  1MQD A;  3A3U A;  3M8U A;  3B6T A;  1GV8 A;  2NWJ A;  3ONM A;  1UTH A;  3LBS A;  5H8H B;  1N7X A;  2G29 A;  3CSG A;  2OK2 A;  4AB6 A;  1P99 A;  4JSO A;  2DE2 A;  1LBB A;  4EXK A;  4FED A;  3UGW A;  3F11 A;  1EZP A;  2ZYN A;  2H99 A;  1AIV A;  2QMX A;  4LZ8 A;  4Z0I A;  4R2F A;  1ZTY A;  3OMB A;  3TPA A;  1MXZ A;  1B3H A;  1NNF A;  4LAT A;  3IO4 A;  3KN3 A;  5DTB A;  4GL0 A;  2GH9 A;  3IX1 A;  3QAX A;  3O29 A;  1I69 A;  2G93 A;  3CG3 A;  1MY1 A;  1UIV A;  3N6T A;  2VD2 A;  1LGB C;  5B70 A;  2XXW A;  1II5 A;  5I2N A;  5AE4 A;  2H9B A;  3CVG A;  4X1B A;  4OFO A;  5KZT A;  4IB2 A;  1IXH A;  1CB6 A;  1LB9 A;  2I3W A;  1XVX A;  4YZZ A;  4HCY A;  3FVO A;  4R9G A;  4LP2 B;  4X48 A;  1B3L A;  2O84 X;  3VLV A;  4JB7 A;  4K3F A;  4WEP A;  1UTB A;  4Q5T A;  2NXO A;  3FVK A;  1MM7 A;  2XXX A;  2F6P A;  3O66 A;  4OMB A;  1MQI A;  1ZBM A;  1SW4 A;  1JVY A;  1SYH A;  3H6W A;  1B9J A;  1B0H A;  2DE3 A;  3HPI A;  3TEL A;  4XKR A;  1P1U A;  4R73 A;  1VR5 A;  4QFP A;  4YKJ A;  1EH3 A;  4MBP A;  3MZ9 A;  3SDF A;  1N76 A;  1O7T A;  1LFH A;  1B1X A;  5CMB A;  3MBP A;  1B46 A;  1MG1 A;  4EQB A;  1TFA A;  1LAG E;  3G3J A;  4PET A;  4Q8R A;  2VOZ A;  2O7U A;  3OXN A;  1B5J A;  3H3G A;  1SW1 A;  3VLW A;  3FXU A;  1DOT A;  4TOZ A;  1DTZ A;  3TKD A;  1JQF A;  3C32 A;  3TYH A;  2RC8 A;  4GF8 A;  2REG A;  3QSL A;  1B3G A;  2Z8F A;  3CI8 A;  1XS5 A;  1PC3 A;  1JEU A;  3LSX A;  4KFQ A;  2X7P A;  3RT6 B;  5I56 B;  1MRP A;  4G68 C;  5EHM A;  4IO6 A;  2A5T B;  1GTK A;  4R9F A;  1I6A A;  1ZU0 A;  2HZL A;  2E1S A;  2F8D A;  1BKA A;  3FV2 A;  2H5Y A;  3ZS6 A;  1GGG A;  3K6X A;  5CMC A;  4IGT A;  4M1V A;  4IO4 A;  1PB8 A;  4BDL A;  3B7D A;  3OSR A;  4RPN A;  5ITP A;  2NOO A;  2DS9 A;  1IZ1 A;  3MC2 A;  2A5S A;  3HCQ A;  3K2D A;  4KYS A;  3PPR A;  4BDQ A;  3O6H A;  2I4C A;  4DZ1 A;  3FZV A;  4NF4 A;  1MXX A;  5HPQ A;  4OVJ A;  2Q9T A;  5ICQ A;  3SEW A;  4OET A;  1P1N A;  4ZEC A;  1B5I A;  2FNC A;  4P0G A;  3U72 A;  3M3L A;  3SEX A;  5JK4 A;  3K1P A;  3TDJ A;  5IAI A;  4YKP A;  1QUJ A;  2RCB A;  5BUU A;  1UTH B;  1FQF A;  1Y4T A;  4KYE A;  1TT1 A;  5M2V A;  3FJG A;  2ABH A;  4OHN A;  3Q28 A;  4MFI A;  3ECR A;  3MAM A;  3FAS A;  1D3K A;  2B65 A;  3KZG A;  3KG2 A;  3OEK A;  4THI A;  1YPN A;  3E9X A;  2OWT A;  5ISU A;  4F3P A;  4HCW A;  4ELP A;  4U1O A;  3PPP A;  4QRZ A;  1LAF E;  1MQG A;  1OQG A;  1SDX A;  1P1W A;  1FCK A;  1H44 A;  3CSB A;  4OES A;  3VFJ A;  3PUV E;  1QUI A;  5DEX A;  1MY0 A;  1DPE A;  4F22 A;  1M5E A;  3ZKL A;  5CBR A;  1LLS A;  1MPD A;  4YB7 A;  1A8F A;  1BIY A;  4HS7 A;  1MY4 A;  4ND9 A;  2XD3 A;  1IXI A;  2UVG A;  3UN6 A;  3OO7 A;  3TCF A;  1H3D A;  3DP6 A;  1SYI A;  4ZEK A;  3VLU A;  4OXV A;  3E3K A;  3SER A;  4F3B A;  4JWX A;  4NF8 A;  3ILU B;  5AA3 A;  2ZYM A;  4KPT A;  1UTB B;  1B7H A;  2DXY A;  4H67 A;  4KD5 A;  2XXI A;  4FAT A;  1B3E A;  3E4R A;  3T9X B;  3QUJ A;  1B05 A;  1L5T A;  5ELV A;  3FAT A;  5K2Y A;  3MVX A;  2I49 A;  1POY 1;  3QIM A;  5FTI A;  4R75 A;  4P11 A;  3L6H A;  4UAC A;  3FIR A;  4OFJ A;  3GZG A;  3PPO A;  2YLN A;  3EHS A;  3V83 A;  4QSE A;  3A09 A;  1ZMG A;  2B3F A;  2XD2 A;  5DVF A;  1OQH A;  2V3Q A;  3U94 A;  1HSJ A;  5TPA A;  3Q26 A;  1M5D A;  3S9L C;  3G3F A;  1IEJ A;  3FUZ A;  4ZS9 A;  2ONR A;  3C31 A;  4ECF A;  4F18 A;  1Y9U A;  2I6E A;  3JYR A;  4GXA A;  1VFE A;  3SES A;  4H5G A;  3TTK A;  2RC7 A;  3HN0 A;  4EDP A;  4GRK A;  3V5A A;  4FJP A;  1QUL A;  2F34 A;  3IK6 B;  3OEN A;  3OSQ A;  2HQ0 A;  3UIF A;  2X26 A;  3O97 A;  4DXU A;  3D4C A;  1UQW A;  5B7D A;  1MH4 A;  4F19 A;  2DSF A;  1PB9 A;  4NF4 B;  1LB8 A;  4PE5 B;  5H8Q A;  2V3U A;  2DVC A;  2F5X A;  1HSL A;  3ZSF A;  4ESX A;  2XXP A;  4TLL B;  3IR1 A;  1ZLQ A;  2FA7 A;  3H4Z A;  2Q89 A;  3JZJ A;  3THI A;  1XHY A;  2I58 A;  2HAU A;  3EHT A;  1D9V A;  1EZ9 A;  1US4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...