5AA2A

Crystal structure of mltf from pseudomonas aeruginosa in complex with nam-pentapeptide.
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
419
structure length
419
Chain Sequence
KEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFTQHLQQRLPRYESHFKQSGKQKDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE F
publication title Activation by Allostery in Cell-Wall Remodeling by a Modular Membrane-Bound Lytic Transglycosylase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 143
structure length 419
sequence length 419
chains with identical sequence C
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa2A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa2A02
5ELVA 3QAXA 2ZNTA 1B52A 4EDPA 1NNKA 1B7HA 2H98A 1MM7A 3UN6A 4RYAA 4ECFA 3OSRA 3QYTA 5EHMA 3OELA 4HTGA 3HHFA 1OQGA 4KFQA 3WAEA 1H3DA 3SERA 4OZ9A 1IZ1A 2F36A 1HSLA 4DDDA 1XOCA 3K6VA 4C1UA 5I57A 3O2AA 1MM6A 3I3VA 2F78A 2P2AA 2YJPA 4OVJA 3VLVA 3ODBA 1ZBMA 3W9VA 2ZYNA 4POWA 3ILUB 2UYFA 3FXUA 3D4GA 3SEYA 3RQTA 1EH3A 1B32A 3O6HA 4M4GA 2F7AA 4DCXA 2GRVA 2D3IA 3TCHA 1B3HA 3SETA 5H8NB 2I49A 4F29A 1GTKA 2Q89A 5CM6A 2VGQA 1SBPA 2DSFA 1FQFA 5H8HA 1OMPA 3UGWA 1VSOA 1B5IA 4GLIA 3VLUA 2YLNA 4GOTA 1NH8A 2H4IA 4ESWA 2DP8A 1LSTA 5DVFA 3T93B 2V25A 3CFXA 3HN0A 2OK2A 4Q5TA 3K00A 4LUBA 1Y4CA 1I6BA 2RKMA 2DWIA 4WEDA 1BP5A 3K2DA 3G3GA 4ND9A 3K6XA 4R6HA 1O7TA 5B70A 4XKNA 5CC2A 3O97A 1B1XA 3G3FA 2DWHA 1JEVA 3T9XB 4BDLA 4Q0CA 4KI0E 1B4HA 1B9JA 5I84A 4GIZA 4HCWA 4K3FA 4DCYA 1R6ZA 1OVTA 3IOTA 4H67A 1S9TA 3RN8A 2ALUA 2OBGA 1B46A 3MW0A 1A54A 1MQIA 1FQAA 2ABHA 5A5XA 2XXYA 4U22A 5L8DA 4PFUA 2HXWA 3S2VA 3TCFA 3KFMA 4QFPA 3UA8A 5H8NA 1XT8A 1B6HA 3OEMA 1MXUA 3THIA 3MQ9A 3UORA 1MQJA 3GBAA 4H8IA 3SEWA 3T9VA 4ELRA 3N6UA 5DTBA 2XXHA 2PMSA 3PD8A 4OERA 4P0GA 2I0CA 3VDFA 3FJMA 3MVZA 1EU8A 4YKIA 4P0IA 2F34A 1USYH 5TU0A 4OFLA 2A5TB 2DVZA 4MLVA 1SQYA 3K6WA 3CI8A 3IJOB 4X1BA 4JWOA 1IIWA 5K2YA 3TCGA 1EZOA 3U8QA 4OWDA 4EQ9A 5FTIA 1RYXA 1B58A 1ELJA 1MY2A 2ZXTA 4G4PA 2FNCA 2RC9A 1ZLQA 4OESA 2NUVA 1IXGA 1MS7A 5IAIA 1QVSA 5L9OA 3UK4A 1MXYA 3TUSA 3C34A 1N3XA 2Y7RA 2DWJA 3DELB 4BDOA 4KPTA 2REGA 3OEKA 4FORA 1US4A 1S50A 4R75A 4KYDA 2F5XA 2GFEA 3OD7A 4TLLB 4FIMA 3CG3A 1UQWA 3S9EA 3FV1A 1Q35A 1KWHA 2O69A 3QK6A 1FTKA 3PUXE 3BFTA 3K0VA 4LQ5A 1A55A 4H5GA 4ONYA 4LZ5A 1ZJLA 2A5SA 3MZ1A 3MP1A 4R6KA 1VFDA 2QS4A 3L6GA 4I62A 2UVHA 4U4XA 2HFBA 1XVYA 2H25A 5JEIA 3EHUA 1UTHB 2R9JA 3T9HB 5B7DA 2O7IA 4RPNA 4OYVA 4AB5A 3PPRA 2DOJA 4ZEBA 3K4UA 3M3KA 1YCJA 5AA4A 3MWBA 3GZGA 4X48A 2P1SA 3KOSA 1QKAA 4NF8A 4EF2A 3KEIA 3LUYA 1MPBA 3OENA 1MY0A 4I8CA 1EZPA 1UIUA 1AOVA 3C33A 3RY3A 5I56A 2B3FA 5F7VA 3E9XA 1WVJA 3IO4A 2KLFA 4ZEKA 2I0BA 4YKPA 4XKPA 3TMGA 2VHAA 4G68B 4GL0A 3IJXB 5AA2A 2DE2A 2ZNSA 2ZMBA 4KYSA 1AMFA 3IB2A 4DIGA 2HAVA 3PPQA 3I5OA 4NF6A 3S9LC 1MPDA 3ZKKA 2XXRA 4QRZA 1LAXA 5H8QB 1M5DA 4H65A 4IO4A 4P11A 2XXTA 3QUFA 1UTBB 4GVOA 4FECA 3TTKA 1GR2A 4RK2A 5M2VA 2D5WA 4XXUA 1Y1ZA 3E13X 4EXKA 2GH9A 2M8CA 3SEUA 3BBRA 2B65A 3KJ7A 3KOTA 5I2KA 4F39A 3T22A 4OFOA 3UP9A 1B7ZA 3DM0A 4RA1A 3SEXA 3TZAA 4RK9A 3LBSA 5KCJA 3SDFA 4YB7A 4F1VA 1O63A 2ANJA 1NNFA 4U4SA 2AL5A 2NXOA 3IOWA 5ICTA 1QUJA 3PPOA 1CB6A 4H0WA 4LVQA 5H8FA 2YPNA 1MQHA 3KJTA 2X7QA 3ECRA 3G3JA 1JVYA 4AB6A 4LONB 4N13A 5L9SA 4KQPA 4HW8A 3C35A 3H3GA 5H8QA 1B7UA 3I6VA 4BDNA 1XC1A 1UTBA 1H76A 3USDA 4F2OA 3LSFB 3GLBA 3RTFB 1IUDA 4G77A 1LBCA 2E0SA 4QF9A 1YTVA 4ISUA 4DE8A 2NOOA 2O51A 2HZLA 1PB8A 3U92A 1TT1A 3FD3A 2AYSA 3CSBA 1OLAA 2O6AA 1LAHE 2D21A 1ANFA 1LFHA 4QFNA 3IB1A 3HSTA 1MY1A 2NWJA 3CIJA 3T9UA 3U94A 3MP8A 3PUZE 4F3BA 4F1YA 5HPQA 3C4MA 2UYEA 1MXXA 2ZYMA 3IORA 2I58A 2HCAA 3Q28A 1T0KA 1P1WA 2ONKE 3O6GA 2H9BA 2IA4A 3IX1A 1VR5A 2QMXA 4Q8RA 1B05A 1BTJA 3LC8A 1RKMA 1Y20A 2DE4A 4RPOA 4NF4B 4KR5A 4UACA 1JNFA 4DZ1A 3PU5A 1DMBA 1HSJA 3B6TA 3S4UA 3FVGA 1Q1KA 2DYXA 1Y1MA 3K6UA 2NVUB 1IXCA 3OOAA 3O9PA 4E0XA 2Y7KA 3QSLA 4MF3A 4OHNA 3U72A 5CMMA 3BFUA 1SVXB 1FTJA 2XD3A 1VE4A 1IITA 2OWTA 5CMCA 2OCUA 3OO7A 3E3KA 4JXIA 2R71A 4IO6A 1JW1A 2O68A 3EN3A 1B2HA 2X26A 3EHSA 2QL3A 4YZZA 5TP9B 3E4RA 3FASA 2F7CA 4YKJA 1SW4A 1Y3QA 3IOVA 1M5FA 4OTEA 3C9HA 1DTZA 1SYHA 1QJMA 3FXRA 4TLMB 2V3TA 4IGRA 3MVWA 3Q26A 4C1TA 4IO3A 4BDMA 4OFJA 4FE8A 3LSLA 2RF1A 1QW0A 4I1DA 4R9FA 2QJEA 1B0HA 3IR1A 3BKIB 2QRYA 4DLDA 3HHGA 4R2BA 1PDAA 1Z7NE 4NTLA 1MY4A 1DPPA 1B0LA 1PB9A 5I59B 3Q27A 2ZNUA 3JZJA 2Y7PA 1GVCA 4GFRA 1P1NA 3EQ1A 3C31A 2AIXA 1QUIA 4IO5A 3O28A 3ZKLA 4YU0A 3H06B 5DVIA 1XHYA 3G3KA 3B7DA 1B5HA 1YAEA 1FQBA 1JW4A 5FTHA 2DWAA 4N07A 3IAZA 3VVFA 4NF5B 3FUZA 2H99A 3JV9A 2XX9A 3PMXA 3TYHA 3MPKA 3TEPA 1SW2A 4IY5A 1B51A 4WXJA 1Y9UA 1N7WA 2I4BA 1URDA 4Z0IA 1NNTA 4M1VA 1GGGA 3QUJA 2DQVA 2O1LA 3DP8A 5TP9A 5HBCA 1B3GA 3RPWA 2OJTA 4E0WA 4POXA 3H03A 2G29A 4GXAA 3G3HA 1FQCA 2DE3A 1IXHA 4BDQA 1A99A 2VD3A 1LCTA 2HEUA 2CZLA 3DLNA 5KDTB 2HQ0A 3FVKA 3D4CA 4TQUQ 4NMYA 1ATGA 3RT6B 2HAUA 1N76A 3KG2A 2UVIA 3TQWA 2PYYA 5I58B 5ITOA 4R6YA 3VVEA 5I59A 3VE1B 2GHAA 1MY3A 4JWYA 3FXQA 2O7UA 4KYEA 5AA2D 1RYOA 2A5TA 3H7MA 1M5EA 3UIFA 3TELA 1LBBA 3TTRA 4EQ7A 1TWYA 4FAJA 4YICA 1JVXA 4F19A 2QPQA 2PX1A 5HM4B 3H6WA 4O3BA 3P7IA 1HSEA 4OEVA 3IB0A 5I2NB 2V3UA 3N26A 1SD3A 2Y7IA 4FEDA 1MXZA 4NF5A 4NEDA 3LSXA 3V89B 1USYE 3R7XA 1WDNA 4F3GA 1A8FA 1D4NA 1P99A 4R9GA 1B3LA 5DYHA 1H43A 2B3BA 1SI1A 5CBSA 5AE4A 3K1PA 3TTLA 3A3UA 3T66A 4GXSB 5ITPA 3SESA 3M3LA 2THIA 4IB2A 3RTWB 4F22A 3OO8A 2F6GA 5FHNA 1OQHA 3OMBA 1LAFE 2PVUA 1H44A 3FATA 1Z7ME 5IKBA 3KN7A 1N84A 4FATA 4YAHX 2UVJA 5L9MA 2XXVA 4ZE8A 3KN3A 3QXMA 1R9LA 5FHMA 3FVOA 3VLWA 3N6TA 1OLCA 4YKKA 2DXRA 2BJJX 3MUQA 3W15C 3MVXA 1ZTYA 4H1XA 1MH4A 1P1UA 3FJ7A 4QHQA 1II5A 3TDJA 2XXUA 3Q29A 1UTHA 4PFWA 1S7YA 4ZS9A 2X7PA 3SEVA 1CE2A 3PD9A 3KZGA 5I57B 4JBZA 2DS9A 3KBRA 3B6WA 4F3SA 3OXNA 4IGTA 1LB8A 2RCBA 5CMBA 3HPIA 1BKAA 4MFIA 4PP0A 1P1OA 2V3QA 1R1NA 1MQDA 1JQFA 2Q9TA 4DXCA 1POY1 1NH7A 2F97A 4TOZA 2G93A 1FCKA 4ZZEA 2OLBA 4QSCA 3TODA 4YMBA 2XXWA 3ZSFA 2ZYKA 3CVGA 3H6UA 4EUOA 2P0SA 4R73A 3MZBA 4FEBA 4JWXA 3ZS6A 2Z8FA 2QS1A 3H6TA 4NE4A 4MBPA 3G7WA 2Q8JA 4F18A 3O29A 4G68A 4F1UA 3MZ9A 2Y84A 5ISUA 4O3CA 3L6HA 3PUYE 2QS3A 3RT8A 1FTMA 1LB9A 3DP4A 5EHSA 3N94A 2Z22A 4JSOA 1UIVA 3O66A 2F35A 4ZDMA 1DOTA 1SW1A 5KZTA 2H5YA 1N7XA 4QFLA 4ZEIA 2Z8EA 4LATA 3CR9A 2RINA 1DTGA 3A3CA 1N3WA 1D9YA 3U1OA 4YB6A 3PUWE 2R6GE 2XX8A 1P1QA 3CSGA 2ZYOA 1XVXA 3GXAA 1SYIA 3B6QA 2V84A 1GV8A 2VP1A 1IQ7A 5JK4A 3MP6A 4H8JA 3KGCA 3U93A 1MG1A 4LQ2A 3VXBA 4JSDA 2DXYA 1O64A 3PMVA 5A5XB 4NWCA 5J1DA 4ELPA 2Q2AA 4LZ7A 1Y3PA 3VVDA 1A40A 3CG1A 4WKMA 4RNSA 3PUVE 5K2XA 3VFJA 3K02A 5FHOA 4G2ZA 5AA1A 1M5BA 1Y3NA 4RY1A 1LFGA 2GHBA 4ELQA 5DT6A 2OZZA 2XXQA 1LCFA 4HCYA 3KN8A 3VXCA 2W7YA 2PT2A 2V93A 3F11A 4OEUA 2RC7A 1TXFA 4X1DA 3MAMA 4KCDA 2Z23A 5BUUA 1EZ9A 4C0RA 4QFKA 3TAJA 2VD2A 1N04A 3HO7A 2I3WA 4F2QA 3FIRA 2I6EA 1D9VA 2F7BA 3G3IA 2O1MA 5F1QA 4OENA 1URSA 1JEUA 4RJZA 1BIYA 1B3EA 3TFLA 3CFLA 4GWOA 3LSWA 1PEBA 3MVYA 1NMUA 4U1OA 5TPAB 2UXAA 4PE5B 4G8MA 4G8HA 4R2FA 4IO2A 1FTLA 3OO6A 4JB7A 5DEXB 1R9QA 4X9TA 2XX7A 1JW5A 4EQBA 4OETA 3PPNA 2FYIA 1IEJA 5ICQA 4NF4A 3FVNA 1TFDA 3TKDA 1FQDA 4KCCA 1POTA 3RNNA 4R74A 2LAOA 5CMKA 4GF8A 2HZKA 1I6QA 1AH5A 5CRYA 2QMWA 4GD5A 1I6AA 3MJNA 4U23A 2XD2A 5DVJA 5CI5A 3A09A 1SDXA 2WKYA 5BWJA 4OQOA 4ELOA 1D3KA 1B4ZA 4U21A 3Q25A 3MPLA 3IL1B 2OWSA 2I4CA 2DVCA 4BDRA 3OSQA 2Q2CA 3EF7A 4YB5A 3K1MA 1ZMGA 4OMBA 4UA8A 3IO6A 5AA4B 1ZU0A 4R72A 4GL8A 3TTMA 4LP2B 1A7LA 4DXBA 3T96B 4G8NA 3GBBA 5TPAA 4NF8B 2I48A 4ZZAA 2RCAA 3H4ZA 4XKRA 2PT1A 1AL3A 4GRKA 1NKXA 1Y4TA 1MDP1 3C32A 3W9WA 5DEXA 5I56B 1F9BA 3R26A 4QSEA 3RGYA 1LFIA 3CFZA 1H45A 3PPPA 5AA2B 4L17A 3TPAA 3S9NC 1QULA 2ONRA 4JDFA 4F31B 3EHTA 2QS2A 1IXIA 3M3FA 1DSNA 4KHZE 3H6VA 1QKBA 4GQOA 4DXUA 1LLSA 4NF6B 1MH3A 3PMWA 3IK6B 4G68C 2QSXA 4RXLA 3SKPA 2CMOA 4MLQA 5CBRA 3RUMA 2ESNA 2PBWA 4XTCQ 4LA9A 1BLFA 2Z8DA 4ZE9A 4BLAA 1B3FA 2F8DA 2ONSA 3V83A 4ESXA 4YMAA 4H6DA 4EXLA 1VFEA 1OIBA 4XKQA 3N5LA 2AL4A 1B5JA 4QFOA 5I2KB 1B40A 3QIMA 1ZKBA 4I9DA 4U2RA 1MDQA 1DPEA 4U1ZA 1MRPA 1TFAA 4MH5A 1PB7A 3M8UA 1PBQA 1PC3A 2XHDA 4Q30B 4N6PA 4OXVA 5KCJB 1PBPA 2UVGA 4PFYA 4ZECA 5KDTA 2Q88A 1SW5A 2FA7A 5JTYB 4KD5A 3VV5A 2RC8A 5H8SA 3KSXA 5LOMA 3K01A 1M5CA 3DP6A 1WODA 3KSJA 5H8FB 1NFTA 4LZ8A 3V8XB 5I58A 3TQLA 1NNPA 3WAFA 3S9MC 4EF1A 3R6UA 2O84X 3EPEA 3ILTB 2F6PA 1LAGE 1OVBA 4ZEDA 2E1SA 3MC2A 2REJA 4PQJA 4NWDA 3AXFA 3FJGA 2Y7WA 1I69A 3HV1A 5I2NA 1AIVA 1US5A 4WEPA 2XXPA 2I3VA 4QSDA 3PGFA 4F3PA 4IY6A 3C36A 2XXIA 3FGSA 1QUKA 5AA3A 5EYFA 3V5AA 1LGBC 1MQGA 3FV2A 1A8EA 1JETA 4FJPA 1MXVA 1URGA 1L5TA 1FW0A 3ONMA 4PETA 1MPCA 2XXXA 3IOUA 4Z7EA 1FTOA 3LR1A 1N0TA 3JYRA 3CRBA 4O3AA 3HCQA 1NL5A 3RLFE 4THIA 3OO9A 4PFTA 2VOZA 5H8HB 1B1HA 1SI0A 4XIGQ 4HS7A 1YPNA 3PV0E 4H5FA 1ZIUA 3TTNA 3FZVA 1J1NA 1FQEA 3MBPA 3O6IA 4AQ4A 1MXWA 3K1NA 4ZEFA 5JTYA 4IO7A 1XS5A 2IEEA
chains in the Genus database with same CATH superfamily
5ELVA 3QAXA 2ZNTA 1B52A 4EDPA 1NNKA 1B7HA 2H98A 1MM7A 3UN6A 4RYAA 4ECFA 3OSRA 3QYTA 5EHMA 3OELA 4GWSA 2QVUA 4HTGA 3ROJA 3HHFA 1OQGA 3E78A 4KFQA 3WAEA 2CZKA 2XA5A 4OVPA 1H3DA 3SERA 4OZ9A 3GYYA 5ESYA 1IZ1A 2F36A 1HSLA 4DDDA 4MNIA 2V4CA 1XOCA 3K6VA 4C1UA 5I57A 3HFUA 3O2AA 1MM6A 3I3VA 2F78A 2P2AA 2YJPA 4OVJA 3VLVA 3ODBA 1ZBMA 3W9VA 2ZYNA 4POWA 3ILUB 2UYFA 2WYPA 2R8TA 3FXUA 2Q8MA 3D4GA 3SEYA 3RQTA 1EH3A 1B32A 3O6HA 4M4GA 2F7AA 4DCXA 4OVQA 2GRVA 2D3IA 3TCHA 1FPFA 1Q9DA 4PAIA 1B3HA 3SETA 5H8NB 2I49A 4F29A 1GTKA 2Q89A 5CM6A 1IMDA 2VGQA 1SBPA 2DSFA 4P8BA 1FQFA 5H8HA 1OMPA 3UGWA 1VSOA 4N8YA 1B5IA 4GLIA 4NAPA 3VLUA 2YLNA 4GOTA 2ZZWA 1NH8A 2H4IA 4ESWA 2DP8A 1LSTA 5DVFA 3T93B 1IMBA 2V25A 1KA0A 2JJKA 3CFXA 3HN0A 2OK2A 4Q5TA 3K00A 4LUBA 1Y4CA 1I6BA 2RKMA 2DWIA 4WEDA 1BP5A 3QMFA 3K2DA 3G3GA 4FBPA 4R6HA 3K6XA 4JVIA 4ND9A 1O7TA 1LBVA 5B70A 4XKNA 4PE3A 5CC2A 3O97A 1B1XA 2QFLA 3G3FA 2DWHA 1JEVA 3T9XB 4BDLA 4Q0CA 4KI0E 1B4HA 1B9JA 5I84A 4GIZA 4HCWA 4K3FA 4DCYA 1R6ZA 1OVTA 3IOTA 4H67A 1S9TA 3RN8A 2ALUA 2OBGA 1B46A 1FPLA 3MW0A 1A54A 5IZZA 1MQIA 4I3EA 1FQAA 2ABHA 5A5XA 1D9QA 2XXYA 4U22A 5L8DA 2HHMA 4PFUA 2HXWA 3S2VA 3TCFA 3KFMA 4QFPA 3UA8A 5H8NA 1XT8A 1B6HA 2WBBA 4N91A 3OEMA 1MXUA 3THIA 3KC0A 3MQ9A 3RPLA 1MQJA 3UORA 3GBAA 4H8IA 3SEWA 3T9VA 4ELRA 3N6UA 5DTBA 2XXHA 4GX6A 2PMSA 3PD8A 2FIEA 4OERA 4P0GA 1FSAA 2I0CA 3VDFA 3FJMA 3MVZA 1EU8A 4YKIA 4P0IA 2F34A 1USYH 5TU0A 4OFLA 2A5TB 2DVZA 4MLVA 1SQYA 3K6WA 3CI8A 3IJOB 4X1BA 4JWOA 1IIWA 1LBXA 5K2YA 3TCGA 1EZOA 3U8QA 4OWDA 4EQ9A 5FTIA 1RYXA 1B58A 1ELJA 1MY2A 2ZXTA 4G4PA 2FNCA 2RC9A 1ZLQA 4OESA 2NUVA 1IXGA 1MS7A 5IAIA 1QVSA 1NV4A 5L9OA 3UK4A 1MXYA 3TUSA 3C34A 1N3XA 2Y7RA 3ISPA 2DWJA 3DELB 1G0IA 4BDOA 5I5PA 4MEVA 4KPTA 2REGA 3OEKA 4FORA 1US4A 5T3JA 1S50A 4R75A 4KYDA 2F5XA 2GFEA 3OD7A 4TLLB 4FIMA 4PGPA 3CG3A 1UQWA 2Y5LA 4HXVA 1NUWA 3S9EA 3FV1A 1Q35A 1CNQA 1KWHA 2O69A 3QK6A 1FTKA 3PUXE 2PFZA 3BFTA 3K0VA 4NN3A 4LQ5A 4KXPA 1A55A 4H5GA 4ONYA 1AWBA 4LZ5A 1ZJLA 1LBZA 2A5SA 3MZ1A 3MP1A 4PF8A 4R6KA 1VFDA 2QS4A 3L6GA 4I62A 2UVHA 4U4XA 2HFBA 1XVYA 2H25A 5JEIA 1RDXA 3EHUA 1UTHB 2R9JA 1LBYA 3T9HB 5B7DA 2O7IA 4RPNA 4OYVA 4AB5A 3PPRA 2DOJA 4OVSA 4ZEBA 3K4UA 3M3KA 4QBAA 1YCJA 5AA4A 3MWBA 3GZGA 4X48A 1RDZA 1QGXA 2P1SA 3KOSA 5EQ7A 4LN5A 1QKAA 4NF8A 4EF2A 3KEIA 3LUYA 3T0JA 1MPBA 3OENA 1MY0A 4I8CA 1EZPA 1UIUA 3LUZA 4AS4A 1AOVA 4PDDA 3C33A 3RY3A 5I56A 2B3FA 5F7VA 3E9XA 1WVJA 3IO4A 2KLFA 4ZEKA 2I0BA 4YKPA 4XKPA 3TMGA 2VHAA 4G68B 1FBHA 4GL0A 3IJXB 4O8MA 5AA2A 2DE2A 2ZNSA 2ZMBA 4KYSA 1AMFA 4O94A 3IB2A 4DIGA 1FPEA 2Y5KA 2HAVA 2ZZXA 3I5OA 3PPQA 4N15A 4NF6A 3S9LC 1MPDA 4OVRA 3ZKKA 2XXRA 4QRZA 1LAXA 5H8QB 1M5DA 4H65A 4IO4A 4P11A 2XXTA 3QUFA 1UTBB 4GVOA 4FECA 3TTKA 1GR2A 4RK2A 4N6KA 2GQ1A 2XXKA 2DDKA 5M2VA 2D5WA 3BIHA 4XXUA 1Y1ZA 3E13X 4EXKA 2GH9A 2M8CA 1K9ZA 3SEUA 1NUYA 1FPDA 3BBRA 2B65A 3KJ7A 3KOTA 5I2KA 4F39A 3T22A 4OFOA 3UP9A 1B7ZA 3DM0A 4RA1A 3SEXA 3E79A 4OVTA 3TZAA 4RK9A 3LBSA 5KCJA 3SDFA 4YB7A 4F1VA 4GWXA 1O63A 2ANJA 5I7IA 1NNFA 4U4SA 2AL5A 2NXOA 3IOWA 3KC1A 5ICTA 1QUJA 3PPOA 1CB6A 4H0WA 4LVQA 5H8FA 2YPNA 1MQHA 3KJTA 2X7QA 1XI6A 3ECRA 3G3JA 1JVYA 4AB6A 4LONB 4N13A 5L9SA 4KQPA 4HW8A 3C35A 3H3GA 5H8QA 1B7UA 3I6VA 4BDNA 1XC1A 1UTBA 1H76A 3USDA 4F2OA 3LSFB 3GLBA 3RTFB 1IUDA 4IR8A 4G77A 1LBCA 2E0SA 4QF9A 1YTVA 4ISUA 4DE8A 2NOOA 3KBZA 2O51A 2HZLA 1PB8A 3U92A 1TT1A 3FD3A 2AYSA 3CSBA 1OLAA 2O6AA 1LAHE 2D21A 1ANFA 1LFHA 4QFNA 3IB1A 3HSTA 1MY1A 2NWJA 3CIJA 3T9UA 3U94A 5LDZA 3MP8A 4PFBA 3PUZE 4F3BA 4F1YA 1NI9A 5HPQA 4GWZA 3C4MA 2UYEA 1MXXA 2ZYMA 3IORA 2I58A 2HCAA 4G61A 3Q28A 1T0KA 1P1WA 2ONKE 3BIGA 3O6GA 2H9BA 2IA4A 3IX1A 1VR5A 2F3DA 2MKZA 2QMXA 4NX1A 4Q8RA 1B05A 1BTJA 3LC8A 1RKMA 4NQ8A 1NV6A 1Y20A 2DE4A 4RPOA 4NF4B 2XWIA 4KR5A 4UACA 1JNFA 3SZPA 4NG7A 4DZ1A 3PU5A 1DMBA 2P3NA 4NF0A 4JVDA 1HSJA 2WX9A 3B6TA 4MIJA 5I3SA 3S4UA 3FVGA 1Q1KA 2DYXA 1Y1MA 3K6UA 3FBPA 1IXCA 2NVUB 3OOAA 5EYHA 3O9PA 4E0XA 2Y7KA 3QSLA 4MF3A 4OHNA 3U72A 5CMMA 3BFUA 1SVXB 1FTJA 2XD3A 1VE4A 1IITA 4X04A 2OWTA 5CMCA 2OCUA 3OO7A 3E3KA 4JXIA 2R71A 4IO6A 1JW1A 2O68A 1VDWA 5ET7A 4PAKA 3EN3A 4XFEA 4O7MA 1B2HA 2OWZA 2X26A 3EHSA 2QL3A 4DI4B 4YZZA 5TP9B 3E4RA 3FASA 2F7CA 4YKJA 1SW4A 1LEVA 1Y3QA 3IOVA 1M5FA 4OTEA 3C9HA 1DTZA 1SYHA 1QJMA 3FXRA 4TLMB 2V3TA 4IGRA 3MVWA 5EYGA 3Q26A 4C1TA 4IO3A 4BDMA 4OFJA 4FE8A 3LSLA 2RF1A 1DK4A 1QW0A 4I1DA 4R9FA 2QJEA 1B0HA 3IR1A 3BKIB 2QRYA 4DLDA 3HHGA 4R2BA 1PDAA 1Z7NE 4GX4A 4NTLA 5J16A 1MY4A 4PAFA 1DPPA 1B0LA 1PB9A 2B4LA 2CZHA 2Q74A 5I59B 3Q27A 2ZNUA 3JZJA 1FJ9A 4N17A 4P47A 1RDYA 2Y7PA 2VPNA 5EQ8A 1GVCA 4GFRA 1P1NA 3EQ1A 3C31A 2AIXA 4IO5A 1QUIA 3O28A 3ZKLA 4YU0A 3H06B 5DVIA 1XHYA 3G3KA 3B7DA 1B5HA 1YAEA 1FQBA 4QXDA 1JW4A 5FTHA 5DW8A 2DWAA 4N07A 3IAZA 3VVFA 4NF5B 3FUZA 4PFRA 2QVRA 2H99A 3JV9A 2XX9A 3PMXA 3TYHA 4X8RA 3MPKA 3TEPA 1SW2A 4IY5A 1B51A 4WXJA 1Y9UA 1N7WA 2I4BA 1YXIA 1URDA 4Z0IA 1NNTA 4PDHA 4M1VA 1GGGA 3CHGA 3QUJA 5F24A 2DQVA 2O1LA 3DP8A 3U65A 5TP9A 5HBCA 1B3GA 4PCDA 2OJTA 3RPWA 4E0WA 2L5VA 1NV7A 3H03A 4POXA 1IMEA 2G29A 4GXAA 4PFIA 3G3HA 1FQCA 2DE3A 1IXHA 1A99A 4BDQA 2VD3A 1LCTA 2HEUA 2CZLA 3DLNA 5KDTB 2HQ0A 3FVKA 4AS5A 3D4CA 2CEYA 4TQUQ 4NMYA 1ATGA 3RT6B 2HAUA 1N76A 3KG2A 2UVIA 3TQWA 2PYYA 5I58B 5ITOA 4R6YA 3VVEA 5I59A 3VE1B 2GHAA 1MY3A 4JWYA 1NV5A 5IZ3B 3FXQA 2O7UA 4KYEA 1NV2A 5AA2D 1LBWA 1RYOA 2A5TA 5EQ9A 3H7MA 1M5EA 3UIFA 3TELA 1LBBA 3TTRA 4EQ7A 1TWYA 4FAJA 4YICA 1JVXA 4F19A 2QPQA 1YZ0A 2PX1A 5HM4B 3H6WA 4O3BA 3P7IA 1HSEA 4OEVA 3IB0A 5I2NB 2V3UA 3N26A 1SD3A 2Y7IA 4FEDA 1MXZA 4NF5A 4N4UA 4NEDA 3LSXA 1FPJA 3V89B 4GWUA 1USYE 3R7XA 1WDNA 4F3GA 1A8FA 1D4NA 1P99A 4R9GA 1B3LA 5DYHA 1H43A 2OX3A 2B3BA 1SI1A 5CBSA 1YYZA 5AE4A 3K1PA 4GBWA 3TTLA 3A3UA 3T66A 4GXSB 5ITPA 3SESA 3M3LA 2THIA 4IB2A 3RTWB 4F22A 4P56A 3OO8A 2F6GA 5FHNA 1OQHA 3OMBA 1LAFE 2PVUA 1H44A 3PTYA 3FATA 1Z7ME 5IKBA 2VT5A 3KN7A 1N84A 4FATA 4YAHX 2UVJA 2FBPA 5L9MA 2XXVA 4GWWA 4ZE8A 3KN3A 1EYKA 3QXMA 1R9LA 5FHMA 3FVOA 3VLWA 3N6TA 4PTKA 1OLCA 1NV1A 4YKKA 2DXRA 2BJJX 3MUQA 3W15C 3MVXA 1ZTYA 4H1XA 1MH4A 1P1UA 3FJ7A 5A5LA 1SPIA 4QHQA 1II5A 3TDJA 2XXUA 3Q29A 5ET5A 1UTHA 4PFWA 1S7YA 1EYIA 4ZS9A 2X7PA 3SEVA 1CE2A 3PD9A 3KZGA 5I57B 3T1BA 4JBZA 2DS9A 3KBRA 3B6WA 4F3SA 3OXNA 4IGTA 1IMFA 1LB8A 2RCBA 5CMBA 3HPIA 1BKAA 1INPA 4MFIA 4PP0A 1P1OA 2FVZA 2V3QA 4MMPA 1R1NA 1MQDA 2CEXA 1JQFA 2Q9TA 4DXCA 1POY1 1NH7A 2F97A 4TOZA 2WBDA 4XF5A 2G93A 1FCKA 4ZZEA 2OLBA 4QSCA 3TODA 4YMBA 2BJIA 2XXWA 3ZSFA 2ZYKA 3CVGA 3H6UA 4DI3D 2P0SA 4GWYA 4R73A 4EUOA 3MZBA 4FEBA 4H46A 4JWXA 3ZS6A 2Z8FA 2QS1A 3H6TA 4NE4A 4MBPA 3G7WA 2Q8JA 4F18A 3O29A 1NV0A 4G68A 4F1UA 3MZ9A 1FBCA 2XWVA 2Y84A 5ISUA 4O3CA 4P1EA 3L6HA 3PUYE 2QS3A 3RT8A 2ZZVA 1FTMA 1LB9A 3DP4A 5EHSA 3N94A 2Z22A 4JSOA 5LTCA 1UIVA 4PBHA 3O66A 2F35A 4ZDMA 4PC9A 1DOTA 1SW1A 5KZTA 2H5YA 1N7XA 4QFLA 4ZEIA 2Z8EA 2HPGA 4GX3A 1NUXA 1K9YA 1JP4A 4LATA 3CR9A 2RINA 1DTGA 3A3CA 1N3WA 1D9YA 3U1OA 4YB6A 2QVVA 3B8BA 3PUWE 2R6GE 1IMAA 2XX8A 1P1QA 3CSGA 2ZYOA 1XVXA 3IFCA 3GXAA 1SYIA 3B6QA 2V84A 4O7IA 1GV8A 2VP1A 1IQ7A 1FBPA 5JK4A 3MP6A 4H8JA 3KGCA 3U93A 4OA4A 1MG1A 4LQ2A 3VXBA 4JSDA 2DXYA 1O64A 3PMVA 5A5XB 4NWCA 5J1DA 4ELPA 2Q2AA 4LZ7A 1Y3PA 3VVDA 1A40A 3CG1A 4WKMA 2B4MA 4RNSA 5ET8A 3PUVE 5K2XA 3VFJA 3K02A 5FHOA 4G2ZA 5AA1A 3RPLB 1M5BA 1Y3NA 4RY1A 1LFGA 2GHBA 3MSTA 4ELQA 5DT6A 2OZZA 2XXQA 1LCFA 4HCYA 3KN8A 3VXCA 2W7YA 2F3BA 2PT2A 2V93A 3F11A 4NGUA 4OEUA 2RC7A 1NV3A 1TXFA 4X1DA 3MAMA 4KCDA 2Z23A 5BUUA 2WEFA 1EZ9A 4MHFA 4N81A 1NUZA 4C0RA 4JVCA 4QFKA 3TAJA 2VD2A 1N04A 1FPBA 3HO7A 2I3WA 4F2QA 3FIRA 1FPIA 2I6EA 3A29A 1D9VA 2F7BA 3G3IA 1G0HA 3RYDA 2O1MA 5F1QA 4OENA 1URSA 5IGAA 1JEUA 4RJZA 1BIYA 1B3EA 3TFLA 3CFLA 4GWOA 3LSWA 1PEBA 3MVYA 4MNPA 2HXRA 1NMUA 4U1OA 5TPAB 2UXAA 4PE5B 2XWOA 4G8MA 4G8HA 4R2FA 4IO2A 1FTLA 3OO6A 4JB7A 4H45A 5DEXB 1R9QA 2KR0A 4X9TA 2XX7A 1JW5A 4EQBA 1KZ8A 4OETA 3PPNA 2FYIA 5ET6A 1IEJA 5ICQA 4NF4A 3FVNA 1TFDA 3TKDA 1FQDA 4KCCA 5IZ1A 1POTA 3RNNA 4R74A 5EQAA 2LAOA 5CMKA 4PF6A 4GF8A 2HZKA 1I6QA 1AH5A 3LV0A 5CRYA 2QMWA 4GD5A 1I6AA 4UABA 3MJNA 4U23A 2XD2A 5DVJA 4GBVA 5CI5A 3A09A 1SDXA 2KQZA 2WKYA 4MCOA 5BWJA 4OQOA 4ELOA 1BK4A 3IFAA 1D3KA 1B4ZA 4U21A 3Q25A 4PBQA 1FTAA 5IM2A 3MPLA 3IL1B 2OWSA 2I4CA 2DVCA 3FXBA 4BDRA 3OSQA 2Q2CA 3EF7A 4YB5A 3K1MA 1ZMGA 4OMBA 4UA8A 3IO6A 5AA4B 1ZU0A 4R72A 4GL8A 3TTMA 4LP2B 1A7LA 4DXBA 3T96B 4G8NA 3GBBA 5TPAA 4NF8B 2I48A 4ZZAA 2RCAA 3H4ZA 4XKRA 2PT1A 1AL3A 4N6DA 4GRKA 1NKXA 1Y4TA 1MDP1 3C32A 3W9WA 5DEXA 5I56B 1F9BA 3D1RA 3R26A 4PGNA 4QSEA 2PCRA 3RGYA 1LFIA 3CFZA 1DBZA 1H45A 3PPPA 4OANA 5AA2B 1FBFA 4L17A 3TPAA 1FPKA 3S9NC 1QULA 2ONRA 4JDFA 4F31B 3B50A 2QS2A 3EHTA 1IXIA 3M3FA 1DSNA 4KHZE 3H6VA 1QKBA 4GQOA 4P1LA 4DXUA 1LLSA 4NF6B 1MH3A 3PMWA 3IK6B 4G68C 2QSXA 4RXLA 3SKPA 2CMOA 2CZIA 4MLQA 5CBRA 3RUMA 2ESNA 2PBWA 4XTCQ 4LA9A 1BLFA 2Z8DA 4ZE9A 4BLAA 1B3FA 2F8DA 2ONSA 3V83A 4ESXA 4YMAA 4H6DA 4EXLA 1VFEA 1OIBA 4XKQA 3N5LA 2AL4A 1B5JA 4QFOA 5I2KB 1EYJA 1B40A 3QIMA 1FPGA 1ZKBA 4I9DA 1FBGA 4U2RA 1MDQA 1DPEA 2PFYA 4U1ZA 1MRPA 1TFAA 4MH5A 1PB7A 4I3YA 1DCUA 3M8UA 1PBQA 1FRPA 1IMCA 1PC3A 4MJOA 2XHDA 4Q30B 4N6PA 4OXVA 5KCJB 1PBPA 2UVGA 1FJ6A 4PFYA 4ZECA 5KDTA 2Q88A 1SW5A 2FA7A 5JTYB 4KD5A 3VV5A 2WYKA 4I40A 2RC8A 5H8SA 3KSXA 5LOMA 3K01A 2XWKA 4MX6A 1M5CA 3DP6A 1WODA 2FHYA 3KSJA 5H8FB 1NFTA 4LZ8A 3V8XB 5I58A 1KA1A 3TQLA 3NOHA 1NNPA 1FBEA 3WAFA 4P9KA 3S9MC 5IZ3A 4EF1A 3R6UA 2O84X 3EPEA 3ILTB 2F6PA 1LAGE 1OVBA 4ZEDA 4HE0A 4MNCA 2E1SA 3MC2A 2REJA 4PQJA 4NWDA 3AXFA 3FJGA 2Y7WA 1I69A 3HV1A 5I2NA 1AIVA 1US5A 4WEPA 2XXPA 2I3VA 4QSDA 3PGFA 1FBDA 4F3PA 4IY6A 3C36A 2XXIA 3FGSA 1QUKA 5AA3A 2FIXA 5EYFA 3V5AA 1LGBC 4NHBA 1MQGA 3FV2A 1A8EA 1JETA 4FJPA 1MXVA 1URGA 1L5TA 1FW0A 3ONMA 4PETA 1MPCA 2XXXA 3EKIA 3IOUA 5FBPA 4HE2A 1FTOA 3LR1A 4Z7EA 4XEQA 1N0TA 3JYRA 3CRBA 4O3AA 3HCQA 1NL5A 3RLFE 4THIA 3OO9A 4PFTA 2VOZA 4N8GA 5H8HB 3MYUA 2P3VA 1B1HA 4HE1A 1SI0A 4XIGQ 4HS7A 1YPNA 3PV0E 4H5FA 4P3LA 1ZIUA 3TTNA 3FZVA 4MAGA 1J1NA 1FQEA 3MBPA 3O6IA 4AQ4A 1MXWA 3K1NA 4ZEFA 5JTYA 4IO7A 1XS5A 2VPOA 2IEEA
chains in the Genus database with same CATH topology
5ELVA 3QAXA 2ZNTA 1B52A 4EDPA 1NNKA 1B7HA 2H98A 1MM7A 3UN6A 4RYAA 4ECFA 3OSRA 3QYTA 5EHMA 3OELA 4HTGA 3HHFA 1OQGA 4KFQA 3WAEA 1H3DA 3SERA 4OZ9A 1IZ1A 2F36A 1HSLA 4DDDA 1XOCA 3K6VA 4C1UA 5I57A 3O2AA 1MM6A 3I3VA 2F78A 2P2AA 2YJPA 4OVJA 3VLVA 3ODBA 1ZBMA 3W9VA 2ZYNA 4POWA 3ILUB 2UYFA 3FXUA 3D4GA 3SEYA 3RQTA 1EH3A 1B32A 3O6HA 4M4GA 2F7AA 4DCXA 2GRVA 2D3IA 3TCHA 1B3HA 3SETA 5H8NB 2I49A 4F29A 1GTKA 2Q89A 5CM6A 2VGQA 1SBPA 2DSFA 1FQFA 5H8HA 1OMPA 3UGWA 1VSOA 1B5IA 4GLIA 3VLUA 2YLNA 4GOTA 1NH8A 2H4IA 4ESWA 2DP8A 1LSTA 5DVFA 3T93B 2V25A 3CFXA 3HN0A 2OK2A 4Q5TA 3K00A 4LUBA 1Y4CA 1I6BA 2RKMA 2DWIA 4WEDA 1BP5A 3K2DA 3G3GA 4ND9A 3K6XA 4R6HA 1O7TA 5B70A 4XKNA 5CC2A 3O97A 1B1XA 3G3FA 2DWHA 1JEVA 3T9XB 4BDLA 4Q0CA 4KI0E 1B4HA 1B9JA 5I84A 4GIZA 4HCWA 4K3FA 4DCYA 1R6ZA 1OVTA 3IOTA 4H67A 1S9TA 3RN8A 2ALUA 2OBGA 1B46A 3MW0A 1A54A 1MQIA 1FQAA 2ABHA 5A5XA 2XXYA 4U22A 5L8DA 4PFUA 2HXWA 3S2VA 3TCFA 3KFMA 4QFPA 3UA8A 5H8NA 1XT8A 1B6HA 3OEMA 1MXUA 3THIA 3MQ9A 3UORA 1MQJA 3GBAA 4H8IA 3SEWA 3T9VA 4ELRA 3N6UA 5DTBA 2XXHA 2PMSA 3PD8A 4OERA 4P0GA 2I0CA 3VDFA 3FJMA 3MVZA 1EU8A 4YKIA 4P0IA 2F34A 1USYH 5TU0A 4OFLA 2A5TB 2DVZA 4MLVA 1SQYA 3K6WA 3CI8A 3IJOB 4X1BA 4JWOA 1IIWA 5K2YA 3TCGA 1EZOA 3U8QA 4OWDA 4EQ9A 5FTIA 1RYXA 1B58A 1ELJA 1MY2A 2ZXTA 4G4PA 2FNCA 2RC9A 1ZLQA 4OESA 2NUVA 1IXGA 1MS7A 5IAIA 1QVSA 5L9OA 3UK4A 1MXYA 3TUSA 3C34A 1N3XA 2Y7RA 2DWJA 3DELB 4BDOA 4KPTA 2REGA 3OEKA 4FORA 1US4A 1S50A 4R75A 4KYDA 2F5XA 2GFEA 3OD7A 4TLLB 4FIMA 3CG3A 1UQWA 3S9EA 3FV1A 1Q35A 1KWHA 2O69A 3QK6A 1FTKA 3PUXE 3BFTA 3K0VA 4LQ5A 1A55A 4H5GA 4ONYA 4LZ5A 1ZJLA 2A5SA 3MZ1A 3MP1A 4R6KA 1VFDA 2QS4A 3L6GA 4I62A 2UVHA 4U4XA 2HFBA 1XVYA 2H25A 5JEIA 3EHUA 1UTHB 2R9JA 3T9HB 5B7DA 2O7IA 4RPNA 4OYVA 4AB5A 3PPRA 2DOJA 4ZEBA 3K4UA 3M3KA 1YCJA 5AA4A 3MWBA 3GZGA 4X48A 2P1SA 3KOSA 1QKAA 4NF8A 4EF2A 3KEIA 3LUYA 1MPBA 3OENA 1MY0A 4I8CA 1EZPA 1UIUA 1AOVA 3C33A 3RY3A 5I56A 2B3FA 5F7VA 3E9XA 1WVJA 3IO4A 2KLFA 4ZEKA 2I0BA 4YKPA 4XKPA 3TMGA 2VHAA 4G68B 4GL0A 3IJXB 5AA2A 2DE2A 2ZNSA 2ZMBA 4KYSA 1AMFA 3IB2A 4DIGA 2HAVA 3PPQA 3I5OA 4NF6A 3S9LC 1MPDA 3ZKKA 2XXRA 4QRZA 1LAXA 5H8QB 1M5DA 4H65A 4IO4A 4P11A 2XXTA 3QUFA 1UTBB 4GVOA 4FECA 3TTKA 1GR2A 4RK2A 5M2VA 2D5WA 4XXUA 1Y1ZA 3E13X 4EXKA 2GH9A 2M8CA 3SEUA 3BBRA 2B65A 3KJ7A 3KOTA 5I2KA 4F39A 3T22A 4OFOA 3UP9A 1B7ZA 3DM0A 4RA1A 3SEXA 3TZAA 4RK9A 3LBSA 5KCJA 3SDFA 4YB7A 4F1VA 1O63A 2ANJA 1NNFA 4U4SA 2AL5A 2NXOA 3IOWA 5ICTA 1QUJA 3PPOA 1CB6A 4H0WA 4LVQA 5H8FA 2YPNA 1MQHA 3KJTA 2X7QA 3ECRA 3G3JA 1JVYA 4AB6A 4LONB 4N13A 5L9SA 4KQPA 4HW8A 3C35A 3H3GA 5H8QA 1B7UA 3I6VA 4BDNA 1XC1A 1UTBA 1H76A 3USDA 4F2OA 3LSFB 3GLBA 3RTFB 1IUDA 4G77A 1LBCA 2E0SA 4QF9A 1YTVA 4ISUA 4DE8A 2NOOA 2O51A 2HZLA 1PB8A 3U92A 1TT1A 3FD3A 2AYSA 3CSBA 1OLAA 2O6AA 1LAHE 2D21A 1ANFA 1LFHA 4QFNA 3IB1A 3HSTA 1MY1A 2NWJA 3CIJA 3T9UA 3U94A 3MP8A 3PUZE 4F3BA 4F1YA 5HPQA 3C4MA 2UYEA 1MXXA 2ZYMA 3IORA 2I58A 2HCAA 3Q28A 1T0KA 1P1WA 2ONKE 3O6GA 2H9BA 2IA4A 3IX1A 1VR5A 2QMXA 4Q8RA 1B05A 1BTJA 3LC8A 1RKMA 1Y20A 2DE4A 4RPOA 4NF4B 4KR5A 4UACA 1JNFA 4DZ1A 3PU5A 1DMBA 1HSJA 3B6TA 3S4UA 3FVGA 1Q1KA 2DYXA 1Y1MA 3K6UA 2NVUB 1IXCA 3OOAA 3O9PA 4E0XA 2Y7KA 3QSLA 4MF3A 4OHNA 3U72A 5CMMA 3BFUA 1SVXB 1FTJA 2XD3A 1VE4A 1IITA 2OWTA 5CMCA 2OCUA 3OO7A 3E3KA 4JXIA 2R71A 4IO6A 1JW1A 2O68A 3EN3A 1B2HA 2X26A 3EHSA 2QL3A 4YZZA 5TP9B 3E4RA 3FASA 2F7CA 4YKJA 1SW4A 1Y3QA 3IOVA 1M5FA 4OTEA 3C9HA 1DTZA 1SYHA 1QJMA 3FXRA 4TLMB 2V3TA 4IGRA 3MVWA 3Q26A 4C1TA 4IO3A 4BDMA 4OFJA 4FE8A 3LSLA 2RF1A 1QW0A 4I1DA 4R9FA 2QJEA 1B0HA 3IR1A 3BKIB 2QRYA 4DLDA 3HHGA 4R2BA 1PDAA 1Z7NE 4NTLA 1MY4A 1DPPA 1B0LA 1PB9A 5I59B 3Q27A 2ZNUA 3JZJA 2Y7PA 1GVCA 4GFRA 1P1NA 3EQ1A 3C31A 2AIXA 1QUIA 4IO5A 3O28A 3ZKLA 4YU0A 3H06B 5DVIA 1XHYA 3G3KA 3B7DA 1B5HA 1YAEA 1FQBA 1JW4A 5FTHA 2DWAA 4N07A 3IAZA 3VVFA 4NF5B 3FUZA 2H99A 3JV9A 2XX9A 3PMXA 3TYHA 3MPKA 3TEPA 1SW2A 4IY5A 1B51A 4WXJA 1Y9UA 1N7WA 2I4BA 1URDA 4Z0IA 1NNTA 4M1VA 1GGGA 3QUJA 2DQVA 2O1LA 3DP8A 5TP9A 5HBCA 1B3GA 3RPWA 2OJTA 4E0WA 4POXA 3H03A 2G29A 4GXAA 3G3HA 1FQCA 2DE3A 1IXHA 4BDQA 1A99A 2VD3A 1LCTA 2HEUA 2CZLA 3DLNA 5KDTB 2HQ0A 3FVKA 3D4CA 4TQUQ 4NMYA 1ATGA 3RT6B 2HAUA 1N76A 3KG2A 2UVIA 3TQWA 2PYYA 5I58B 5ITOA 4R6YA 3VVEA 5I59A 3VE1B 2GHAA 1MY3A 4JWYA 3FXQA 2O7UA 4KYEA 5AA2D 1RYOA 2A5TA 3H7MA 1M5EA 3UIFA 3TELA 1LBBA 3TTRA 4EQ7A 1TWYA 4FAJA 4YICA 1JVXA 4F19A 2QPQA 2PX1A 5HM4B 3H6WA 4O3BA 3P7IA 1HSEA 4OEVA 3IB0A 5I2NB 2V3UA 3N26A 1SD3A 2Y7IA 4FEDA 1MXZA 4NF5A 4NEDA 3LSXA 3V89B 1USYE 3R7XA 1WDNA 4F3GA 1A8FA 1D4NA 1P99A 4R9GA 1B3LA 5DYHA 1H43A 2B3BA 1SI1A 5CBSA 5AE4A 3K1PA 3TTLA 3A3UA 3T66A 4GXSB 5ITPA 3SESA 3M3LA 2THIA 4IB2A 3RTWB 4F22A 3OO8A 2F6GA 5FHNA 1OQHA 3OMBA 1LAFE 2PVUA 1H44A 3FATA 1Z7ME 5IKBA 3KN7A 1N84A 4FATA 4YAHX 2UVJA 5L9MA 2XXVA 4ZE8A 3KN3A 3QXMA 1R9LA 5FHMA 3FVOA 3VLWA 3N6TA 1OLCA 4YKKA 2DXRA 2BJJX 3MUQA 3W15C 3MVXA 1ZTYA 4H1XA 1MH4A 1P1UA 3FJ7A 4QHQA 1II5A 3TDJA 2XXUA 3Q29A 1UTHA 4PFWA 1S7YA 4ZS9A 2X7PA 3SEVA 1CE2A 3PD9A 3KZGA 5I57B 4JBZA 2DS9A 3KBRA 3B6WA 4F3SA 3OXNA 4IGTA 1LB8A 2RCBA 5CMBA 3HPIA 1BKAA 4MFIA 4PP0A 1P1OA 2V3QA 1R1NA 1MQDA 1JQFA 2Q9TA 4DXCA 1POY1 1NH7A 2F97A 4TOZA 2G93A 1FCKA 4ZZEA 2OLBA 4QSCA 3TODA 4YMBA 2XXWA 3ZSFA 2ZYKA 3CVGA 3H6UA 4EUOA 2P0SA 4R73A 3MZBA 4FEBA 4JWXA 3ZS6A 2Z8FA 2QS1A 3H6TA 4NE4A 4MBPA 3G7WA 2Q8JA 4F18A 3O29A 4G68A 4F1UA 3MZ9A 2Y84A 5ISUA 4O3CA 3L6HA 3PUYE 2QS3A 3RT8A 1FTMA 1LB9A 3DP4A 5EHSA 3N94A 2Z22A 4JSOA 1UIVA 3O66A 2F35A 4ZDMA 1DOTA 1SW1A 5KZTA 2H5YA 1N7XA 4QFLA 4ZEIA 2Z8EA 4LATA 3CR9A 2RINA 1DTGA 3A3CA 1N3WA 1D9YA 3U1OA 4YB6A 3PUWE 2R6GE 2XX8A 1P1QA 3CSGA 2ZYOA 1XVXA 3GXAA 1SYIA 3B6QA 2V84A 1GV8A 2VP1A 1IQ7A 5JK4A 3MP6A 4H8JA 3KGCA 3U93A 1MG1A 4LQ2A 3VXBA 4JSDA 2DXYA 1O64A 3PMVA 5A5XB 4NWCA 5J1DA 4ELPA 2Q2AA 4LZ7A 1Y3PA 3VVDA 1A40A 3CG1A 4WKMA 4RNSA 3PUVE 5K2XA 3VFJA 3K02A 5FHOA 4G2ZA 5AA1A 1M5BA 1Y3NA 4RY1A 1LFGA 2GHBA 4ELQA 5DT6A 2OZZA 2XXQA 1LCFA 4HCYA 3KN8A 3VXCA 2W7YA 2PT2A 2V93A 3F11A 4OEUA 2RC7A 1TXFA 4X1DA 3MAMA 4KCDA 2Z23A 5BUUA 1EZ9A 4C0RA 4QFKA 3TAJA 2VD2A 1N04A 3HO7A 2I3WA 4F2QA 3FIRA 2I6EA 1D9VA 2F7BA 3G3IA 2O1MA 5F1QA 4OENA 1URSA 1JEUA 4RJZA 1BIYA 1B3EA 3TFLA 3CFLA 4GWOA 3LSWA 1PEBA 3MVYA 1NMUA 4U1OA 5TPAB 2UXAA 4PE5B 4G8MA 4G8HA 4R2FA 4IO2A 1FTLA 3OO6A 4JB7A 5DEXB 1R9QA 4X9TA 2XX7A 1JW5A 4EQBA 4OETA 3PPNA 2FYIA 1IEJA 5ICQA 4NF4A 3FVNA 1TFDA 3TKDA 1FQDA 4KCCA 1POTA 3RNNA 4R74A 2LAOA 5CMKA 4GF8A 2HZKA 1I6QA 1AH5A 5CRYA 2QMWA 4GD5A 1I6AA 3MJNA 4U23A 2XD2A 5DVJA 5CI5A 3A09A 1SDXA 2WKYA 5BWJA 4OQOA 4ELOA 1D3KA 1B4ZA 4U21A 3Q25A 3MPLA 3IL1B 2OWSA 2I4CA 2DVCA 4BDRA 3OSQA 2Q2CA 3EF7A 4YB5A 3K1MA 1ZMGA 4OMBA 4UA8A 3IO6A 5AA4B 1ZU0A 4R72A 4GL8A 3TTMA 4LP2B 1A7LA 4DXBA 3T96B 4G8NA 3GBBA 5TPAA 4NF8B 2I48A 4ZZAA 2RCAA 3H4ZA 4XKRA 2PT1A 1AL3A 4GRKA 1NKXA 1Y4TA 1MDP1 3C32A 3W9WA 5DEXA 5I56B 1F9BA 3R26A 4QSEA 3RGYA 1LFIA 3CFZA 1H45A 3PPPA 5AA2B 4L17A 3TPAA 3S9NC 1QULA 2ONRA 4JDFA 4F31B 3EHTA 2QS2A 1IXIA 3M3FA 1DSNA 4KHZE 3H6VA 1QKBA 4GQOA 4DXUA 1LLSA 4NF6B 1MH3A 3PMWA 3IK6B 4G68C 2QSXA 4RXLA 3SKPA 2CMOA 4MLQA 5CBRA 3RUMA 2ESNA 2PBWA 4XTCQ 4LA9A 1BLFA 2Z8DA 4ZE9A 4BLAA 1B3FA 2F8DA 2ONSA 3V83A 4ESXA 4YMAA 4H6DA 4EXLA 1VFEA 1OIBA 4XKQA 3N5LA 2AL4A 1B5JA 4QFOA 5I2KB 1B40A 3QIMA 1ZKBA 4I9DA 4U2RA 1MDQA 1DPEA 4U1ZA 1MRPA 1TFAA 4MH5A 1PB7A 3M8UA 1PBQA 1PC3A 2XHDA 4Q30B 4N6PA 4OXVA 5KCJB 1PBPA 2UVGA 4PFYA 4ZECA 5KDTA 2Q88A 1SW5A 2FA7A 5JTYB 4KD5A 3VV5A 2RC8A 5H8SA 3KSXA 5LOMA 3K01A 1M5CA 3DP6A 1WODA 3KSJA 5H8FB 1NFTA 4LZ8A 3V8XB 5I58A 3TQLA 1NNPA 3WAFA 3S9MC 4EF1A 3R6UA 2O84X 3EPEA 3ILTB 2F6PA 1LAGE 1OVBA 4ZEDA 2E1SA 3MC2A 2REJA 4PQJA 4NWDA 3AXFA 3FJGA 2Y7WA 1I69A 3HV1A 5I2NA 1AIVA 1US5A 4WEPA 2XXPA 2I3VA 4QSDA 3PGFA 4F3PA 4IY6A 3C36A 2XXIA 3FGSA 1QUKA 5AA3A 5EYFA 3V5AA 1LGBC 1MQGA 3FV2A 1A8EA 1JETA 4FJPA 1MXVA 1URGA 1L5TA 1FW0A 3ONMA 4PETA 1MPCA 2XXXA 3IOUA 4Z7EA 1FTOA 3LR1A 1N0TA 3JYRA 3CRBA 4O3AA 3HCQA 1NL5A 3RLFE 4THIA 3OO9A 4PFTA 2VOZA 5H8HB 1B1HA 1SI0A 4XIGQ 4HS7A 1YPNA 3PV0E 4H5FA 1ZIUA 3TTNA 3FZVA 1J1NA 1FQEA 3MBPA 3O6IA 4AQ4A 1MXWA 3K1NA 4ZEFA 5JTYA 4IO7A 1XS5A 2IEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELV A;  3QAX A;  2ZNT A;  1B52 A;  4EDP A;  1NNK A;  1B7H A;  2H98 A;  1MM7 A;  3UN6 A;  4RYA A;  4ECF A;  3OSR A;  3QYT A;  5EHM A;  3OEL A;  4HTG A;  3HHF A;  1OQG A;  4KFQ A;  3WAE A;  1H3D A;  3SER A;  4OZ9 A;  1IZ1 A;  2F36 A;  1HSL A;  4DDD A;  1XOC A;  3K6V A;  4C1U A;  5I57 A;  3O2A A;  1MM6 A;  3I3V A;  2F78 A;  2P2A A;  2YJP A;  4OVJ A;  3VLV A;  3ODB A;  1ZBM A;  3W9V A;  2ZYN A;  4POW A;  3ILU B;  2UYF A;  3FXU A;  3D4G A;  3SEY A;  3RQT A;  1EH3 A;  1B32 A;  3O6H A;  4M4G A;  2F7A A;  4DCX A;  2GRV A;  2D3I A;  3TCH A;  1B3H A;  3SET A;  5H8N B;  2I49 A;  4F29 A;  1GTK A;  2Q89 A;  5CM6 A;  2VGQ A;  1SBP A;  2DSF A;  1FQF A;  5H8H A;  1OMP A;  3UGW A;  1VSO A;  1B5I A;  4GLI A;  3VLU A;  2YLN A;  4GOT A;  1NH8 A;  2H4I A;  4ESW A;  2DP8 A;  1LST A;  5DVF A;  3T93 B;  2V25 A;  3CFX A;  3HN0 A;  2OK2 A;  4Q5T A;  3K00 A;  4LUB A;  1Y4C A;  1I6B A;  2RKM A;  2DWI A;  4WED A;  1BP5 A;  3K2D A;  3G3G A;  4ND9 A;  3K6X A;  4R6H A;  1O7T A;  5B70 A;  4XKN A;  5CC2 A;  3O97 A;  1B1X A;  3G3F A;  2DWH A;  1JEV A;  3T9X B;  4BDL A;  4Q0C A;  4KI0 E;  1B4H A;  1B9J A;  5I84 A;  4GIZ A;  4HCW A;  4K3F A;  4DCY A;  1R6Z A;  1OVT A;  3IOT A;  4H67 A;  1S9T A;  3RN8 A;  2ALU A;  2OBG A;  1B46 A;  3MW0 A;  1A54 A;  1MQI A;  1FQA A;  2ABH A;  5A5X A;  2XXY A;  4U22 A;  5L8D A;  4PFU A;  2HXW A;  3S2V A;  3TCF A;  3KFM A;  4QFP A;  3UA8 A;  5H8N A;  1XT8 A;  1B6H A;  3OEM A;  1MXU A;  3THI A;  3MQ9 A;  3UOR A;  1MQJ A;  3GBA A;  4H8I A;  3SEW A;  3T9V A;  4ELR A;  3N6U A;  5DTB A;  2XXH A;  2PMS A;  3PD8 A;  4OER A;  4P0G A;  2I0C A;  3VDF A;  3FJM A;  3MVZ A;  1EU8 A;  4YKI A;  4P0I A;  2F34 A;  1USY H;  5TU0 A;  4OFL A;  2A5T B;  2DVZ A;  4MLV A;  1SQY A;  3K6W A;  3CI8 A;  3IJO B;  4X1B A;  4JWO A;  1IIW A;  5K2Y A;  3TCG A;  1EZO A;  3U8Q A;  4OWD A;  4EQ9 A;  5FTI A;  1RYX A;  1B58 A;  1ELJ A;  1MY2 A;  2ZXT A;  4G4P A;  2FNC A;  2RC9 A;  1ZLQ A;  4OES A;  2NUV A;  1IXG A;  1MS7 A;  5IAI A;  1QVS A;  5L9O A;  3UK4 A;  1MXY A;  3TUS A;  3C34 A;  1N3X A;  2Y7R A;  2DWJ A;  3DEL B;  4BDO A;  4KPT A;  2REG A;  3OEK A;  4FOR A;  1US4 A;  1S50 A;  4R75 A;  4KYD A;  2F5X A;  2GFE A;  3OD7 A;  4TLL B;  4FIM A;  3CG3 A;  1UQW A;  3S9E A;  3FV1 A;  1Q35 A;  1KWH A;  2O69 A;  3QK6 A;  1FTK A;  3PUX E;  3BFT A;  3K0V A;  4LQ5 A;  1A55 A;  4H5G A;  4ONY A;  4LZ5 A;  1ZJL A;  2A5S A;  3MZ1 A;  3MP1 A;  4R6K A;  1VFD A;  2QS4 A;  3L6G A;  4I62 A;  2UVH A;  4U4X A;  2HFB A;  1XVY A;  2H25 A;  5JEI A;  3EHU A;  1UTH B;  2R9J A;  3T9H B;  5B7D A;  2O7I A;  4RPN A;  4OYV A;  4AB5 A;  3PPR A;  2DOJ A;  4ZEB A;  3K4U A;  3M3K A;  1YCJ A;  5AA4 A;  3MWB A;  3GZG A;  4X48 A;  2P1S A;  3KOS A;  1QKA A;  4NF8 A;  4EF2 A;  3KEI A;  3LUY A;  1MPB A;  3OEN A;  1MY0 A;  4I8C A;  1EZP A;  1UIU A;  1AOV A;  3C33 A;  3RY3 A;  5I56 A;  2B3F A;  5F7V A;  3E9X A;  1WVJ A;  3IO4 A;  2KLF A;  4ZEK A;  2I0B A;  4YKP A;  4XKP A;  3TMG A;  2VHA A;  4G68 B;  4GL0 A;  3IJX B;  5AA2 A;  2DE2 A;  2ZNS A;  2ZMB A;  4KYS A;  1AMF A;  3IB2 A;  4DIG A;  2HAV A;  3PPQ A;  3I5O A;  4NF6 A;  3S9L C;  1MPD A;  3ZKK A;  2XXR A;  4QRZ A;  1LAX A;  5H8Q B;  1M5D A;  4H65 A;  4IO4 A;  4P11 A;  2XXT A;  3QUF A;  1UTB B;  4GVO A;  4FEC A;  3TTK A;  1GR2 A;  4RK2 A;  5M2V A;  2D5W A;  4XXU A;  1Y1Z A;  3E13 X;  4EXK A;  2GH9 A;  2M8C A;  3SEU A;  3BBR A;  2B65 A;  3KJ7 A;  3KOT A;  5I2K A;  4F39 A;  3T22 A;  4OFO A;  3UP9 A;  1B7Z A;  3DM0 A;  4RA1 A;  3SEX A;  3TZA A;  4RK9 A;  3LBS A;  5KCJ A;  3SDF A;  4YB7 A;  4F1V A;  1O63 A;  2ANJ A;  1NNF A;  4U4S A;  2AL5 A;  2NXO A;  3IOW A;  5ICT A;  1QUJ A;  3PPO A;  1CB6 A;  4H0W A;  4LVQ A;  5H8F A;  2YPN A;  1MQH A;  3KJT A;  2X7Q A;  3ECR A;  3G3J A;  1JVY A;  4AB6 A;  4LON B;  4N13 A;  5L9S A;  4KQP A;  4HW8 A;  3C35 A;  3H3G A;  5H8Q A;  1B7U A;  3I6V A;  4BDN A;  1XC1 A;  1UTB A;  1H76 A;  3USD A;  4F2O A;  3LSF B;  3GLB A;  3RTF B;  1IUD A;  4G77 A;  1LBC A;  2E0S A;  4QF9 A;  1YTV A;  4ISU A;  4DE8 A;  2NOO A;  2O51 A;  2HZL A;  1PB8 A;  3U92 A;  1TT1 A;  3FD3 A;  2AYS A;  3CSB A;  1OLA A;  2O6A A;  1LAH E;  2D21 A;  1ANF A;  1LFH A;  4QFN A;  3IB1 A;  3HST A;  1MY1 A;  2NWJ A;  3CIJ A;  3T9U A;  3U94 A;  3MP8 A;  3PUZ E;  4F3B A;  4F1Y A;  5HPQ A;  3C4M A;  2UYE A;  1MXX A;  2ZYM A;  3IOR A;  2I58 A;  2HCA A;  3Q28 A;  1T0K A;  1P1W A;  2ONK E;  3O6G A;  2H9B A;  2IA4 A;  3IX1 A;  1VR5 A;  2QMX A;  4Q8R A;  1B05 A;  1BTJ A;  3LC8 A;  1RKM A;  1Y20 A;  2DE4 A;  4RPO A;  4NF4 B;  4KR5 A;  4UAC A;  1JNF A;  4DZ1 A;  3PU5 A;  1DMB A;  1HSJ A;  3B6T A;  3S4U A;  3FVG A;  1Q1K A;  2DYX A;  1Y1M A;  3K6U A;  2NVU B;  1IXC A;  3OOA A;  3O9P A;  4E0X A;  2Y7K A;  3QSL A;  4MF3 A;  4OHN A;  3U72 A;  5CMM A;  3BFU A;  1SVX B;  1FTJ A;  2XD3 A;  1VE4 A;  1IIT A;  2OWT A;  5CMC A;  2OCU A;  3OO7 A;  3E3K A;  4JXI A;  2R71 A;  4IO6 A;  1JW1 A;  2O68 A;  3EN3 A;  1B2H A;  2X26 A;  3EHS A;  2QL3 A;  4YZZ A;  5TP9 B;  3E4R A;  3FAS A;  2F7C A;  4YKJ A;  1SW4 A;  1Y3Q A;  3IOV A;  1M5F A;  4OTE A;  3C9H A;  1DTZ A;  1SYH A;  1QJM A;  3FXR A;  4TLM B;  2V3T A;  4IGR A;  3MVW A;  3Q26 A;  4C1T A;  4IO3 A;  4BDM A;  4OFJ A;  4FE8 A;  3LSL A;  2RF1 A;  1QW0 A;  4I1D A;  4R9F A;  2QJE A;  1B0H A;  3IR1 A;  3BKI B;  2QRY A;  4DLD A;  3HHG A;  4R2B A;  1PDA A;  1Z7N E;  4NTL A;  1MY4 A;  1DPP A;  1B0L A;  1PB9 A;  5I59 B;  3Q27 A;  2ZNU A;  3JZJ A;  2Y7P A;  1GVC A;  4GFR A;  1P1N A;  3EQ1 A;  3C31 A;  2AIX A;  1QUI A;  4IO5 A;  3O28 A;  3ZKL A;  4YU0 A;  3H06 B;  5DVI A;  1XHY A;  3G3K A;  3B7D A;  1B5H A;  1YAE A;  1FQB A;  1JW4 A;  5FTH A;  2DWA A;  4N07 A;  3IAZ A;  3VVF A;  4NF5 B;  3FUZ A;  2H99 A;  3JV9 A;  2XX9 A;  3PMX A;  3TYH A;  3MPK A;  3TEP A;  1SW2 A;  4IY5 A;  1B51 A;  4WXJ A;  1Y9U A;  1N7W A;  2I4B A;  1URD A;  4Z0I A;  1NNT A;  4M1V A;  1GGG A;  3QUJ A;  2DQV A;  2O1L A;  3DP8 A;  5TP9 A;  5HBC A;  1B3G A;  3RPW A;  2OJT A;  4E0W A;  4POX A;  3H03 A;  2G29 A;  4GXA A;  3G3H A;  1FQC A;  2DE3 A;  1IXH A;  4BDQ A;  1A99 A;  2VD3 A;  1LCT A;  2HEU A;  2CZL A;  3DLN A;  5KDT B;  2HQ0 A;  3FVK A;  3D4C A;  4TQU Q;  4NMY A;  1ATG A;  3RT6 B;  2HAU A;  1N76 A;  3KG2 A;  2UVI A;  3TQW A;  2PYY A;  5I58 B;  5ITO A;  4R6Y A;  3VVE A;  5I59 A;  3VE1 B;  2GHA A;  1MY3 A;  4JWY A;  3FXQ A;  2O7U A;  4KYE A;  5AA2 D;  1RYO A;  2A5T A;  3H7M A;  1M5E A;  3UIF A;  3TEL A;  1LBB A;  3TTR A;  4EQ7 A;  1TWY A;  4FAJ A;  4YIC A;  1JVX A;  4F19 A;  2QPQ A;  2PX1 A;  5HM4 B;  3H6W A;  4O3B A;  3P7I A;  1HSE A;  4OEV A;  3IB0 A;  5I2N B;  2V3U A;  3N26 A;  1SD3 A;  2Y7I A;  4FED A;  1MXZ A;  4NF5 A;  4NED A;  3LSX A;  3V89 B;  1USY E;  3R7X A;  1WDN A;  4F3G A;  1A8F A;  1D4N A;  1P99 A;  4R9G A;  1B3L A;  5DYH A;  1H43 A;  2B3B A;  1SI1 A;  5CBS A;  5AE4 A;  3K1P A;  3TTL A;  3A3U A;  3T66 A;  4GXS B;  5ITP A;  3SES A;  3M3L A;  2THI A;  4IB2 A;  3RTW B;  4F22 A;  3OO8 A;  2F6G A;  5FHN A;  1OQH A;  3OMB A;  1LAF E;  2PVU A;  1H44 A;  3FAT A;  1Z7M E;  5IKB A;  3KN7 A;  1N84 A;  4FAT A;  4YAH X;  2UVJ A;  5L9M A;  2XXV A;  4ZE8 A;  3KN3 A;  3QXM A;  1R9L A;  5FHM A;  3FVO A;  3VLW A;  3N6T A;  1OLC A;  4YKK A;  2DXR A;  2BJJ X;  3MUQ A;  3W15 C;  3MVX A;  1ZTY A;  4H1X A;  1MH4 A;  1P1U A;  3FJ7 A;  4QHQ A;  1II5 A;  3TDJ A;  2XXU A;  3Q29 A;  1UTH A;  4PFW A;  1S7Y A;  4ZS9 A;  2X7P A;  3SEV A;  1CE2 A;  3PD9 A;  3KZG A;  5I57 B;  4JBZ A;  2DS9 A;  3KBR A;  3B6W A;  4F3S A;  3OXN A;  4IGT A;  1LB8 A;  2RCB A;  5CMB A;  3HPI A;  1BKA A;  4MFI A;  4PP0 A;  1P1O A;  2V3Q A;  1R1N A;  1MQD A;  1JQF A;  2Q9T A;  4DXC A;  1POY 1;  1NH7 A;  2F97 A;  4TOZ A;  2G93 A;  1FCK A;  4ZZE A;  2OLB A;  4QSC A;  3TOD A;  4YMB A;  2XXW A;  3ZSF A;  2ZYK A;  3CVG A;  3H6U A;  4EUO A;  2P0S A;  4R73 A;  3MZB A;  4FEB A;  4JWX A;  3ZS6 A;  2Z8F A;  2QS1 A;  3H6T A;  4NE4 A;  4MBP A;  3G7W A;  2Q8J A;  4F18 A;  3O29 A;  4G68 A;  4F1U A;  3MZ9 A;  2Y84 A;  5ISU A;  4O3C A;  3L6H A;  3PUY E;  2QS3 A;  3RT8 A;  1FTM A;  1LB9 A;  3DP4 A;  5EHS A;  3N94 A;  2Z22 A;  4JSO A;  1UIV A;  3O66 A;  2F35 A;  4ZDM A;  1DOT A;  1SW1 A;  5KZT A;  2H5Y A;  1N7X A;  4QFL A;  4ZEI A;  2Z8E A;  4LAT A;  3CR9 A;  2RIN A;  1DTG A;  3A3C A;  1N3W A;  1D9Y A;  3U1O A;  4YB6 A;  3PUW E;  2R6G E;  2XX8 A;  1P1Q A;  3CSG A;  2ZYO A;  1XVX A;  3GXA A;  1SYI A;  3B6Q A;  2V84 A;  1GV8 A;  2VP1 A;  1IQ7 A;  5JK4 A;  3MP6 A;  4H8J A;  3KGC A;  3U93 A;  1MG1 A;  4LQ2 A;  3VXB A;  4JSD A;  2DXY A;  1O64 A;  3PMV A;  5A5X B;  4NWC A;  5J1D A;  4ELP A;  2Q2A A;  4LZ7 A;  1Y3P A;  3VVD A;  1A40 A;  3CG1 A;  4WKM A;  4RNS A;  3PUV E;  5K2X A;  3VFJ A;  3K02 A;  5FHO A;  4G2Z A;  5AA1 A;  1M5B A;  1Y3N A;  4RY1 A;  1LFG A;  2GHB A;  4ELQ A;  5DT6 A;  2OZZ A;  2XXQ A;  1LCF A;  4HCY A;  3KN8 A;  3VXC A;  2W7Y A;  2PT2 A;  2V93 A;  3F11 A;  4OEU A;  2RC7 A;  1TXF A;  4X1D A;  3MAM A;  4KCD A;  2Z23 A;  5BUU A;  1EZ9 A;  4C0R A;  4QFK A;  3TAJ A;  2VD2 A;  1N04 A;  3HO7 A;  2I3W A;  4F2Q A;  3FIR A;  2I6E A;  1D9V A;  2F7B A;  3G3I A;  2O1M A;  5F1Q A;  4OEN A;  1URS A;  1JEU A;  4RJZ A;  1BIY A;  1B3E A;  3TFL A;  3CFL A;  4GWO A;  3LSW A;  1PEB A;  3MVY A;  1NMU A;  4U1O A;  5TPA B;  2UXA A;  4PE5 B;  4G8M A;  4G8H A;  4R2F A;  4IO2 A;  1FTL A;  3OO6 A;  4JB7 A;  5DEX B;  1R9Q A;  4X9T A;  2XX7 A;  1JW5 A;  4EQB A;  4OET A;  3PPN A;  2FYI A;  1IEJ A;  5ICQ A;  4NF4 A;  3FVN A;  1TFD A;  3TKD A;  1FQD A;  4KCC A;  1POT A;  3RNN A;  4R74 A;  2LAO A;  5CMK A;  4GF8 A;  2HZK A;  1I6Q A;  1AH5 A;  5CRY A;  2QMW A;  4GD5 A;  1I6A A;  3MJN A;  4U23 A;  2XD2 A;  5DVJ A;  5CI5 A;  3A09 A;  1SDX A;  2WKY A;  5BWJ A;  4OQO A;  4ELO A;  1D3K A;  1B4Z A;  4U21 A;  3Q25 A;  3MPL A;  3IL1 B;  2OWS A;  2I4C A;  2DVC A;  4BDR A;  3OSQ A;  2Q2C A;  3EF7 A;  4YB5 A;  3K1M A;  1ZMG A;  4OMB A;  4UA8 A;  3IO6 A;  5AA4 B;  1ZU0 A;  4R72 A;  4GL8 A;  3TTM A;  4LP2 B;  1A7L A;  4DXB A;  3T96 B;  4G8N A;  3GBB A;  5TPA A;  4NF8 B;  2I48 A;  4ZZA A;  2RCA A;  3H4Z A;  4XKR A;  2PT1 A;  1AL3 A;  4GRK A;  1NKX A;  1Y4T A;  1MDP 1;  3C32 A;  3W9W A;  5DEX A;  5I56 B;  1F9B A;  3R26 A;  4QSE A;  3RGY A;  1LFI A;  3CFZ A;  1H45 A;  3PPP A;  5AA2 B;  4L17 A;  3TPA A;  3S9N C;  1QUL A;  2ONR A;  4JDF A;  4F31 B;  3EHT A;  2QS2 A;  1IXI A;  3M3F A;  1DSN A;  4KHZ E;  3H6V A;  1QKB A;  4GQO A;  4DXU A;  1LLS A;  4NF6 B;  1MH3 A;  3PMW A;  3IK6 B;  4G68 C;  2QSX A;  4RXL A;  3SKP A;  2CMO A;  4MLQ A;  5CBR A;  3RUM A;  2ESN A;  2PBW A;  4XTC Q;  4LA9 A;  1BLF A;  2Z8D A;  4ZE9 A;  4BLA A;  1B3F A;  2F8D A;  2ONS A;  3V83 A;  4ESX A;  4YMA A;  4H6D A;  4EXL A;  1VFE A;  1OIB A;  4XKQ A;  3N5L A;  2AL4 A;  1B5J A;  4QFO A;  5I2K B;  1B40 A;  3QIM A;  1ZKB A;  4I9D A;  4U2R A;  1MDQ A;  1DPE A;  4U1Z A;  1MRP A;  1TFA A;  4MH5 A;  1PB7 A;  3M8U A;  1PBQ A;  1PC3 A;  2XHD A;  4Q30 B;  4N6P A;  4OXV A;  5KCJ B;  1PBP A;  2UVG A;  4PFY A;  4ZEC A;  5KDT A;  2Q88 A;  1SW5 A;  2FA7 A;  5JTY B;  4KD5 A;  3VV5 A;  2RC8 A;  5H8S A;  3KSX A;  5LOM A;  3K01 A;  1M5C A;  3DP6 A;  1WOD A;  3KSJ A;  5H8F B;  1NFT A;  4LZ8 A;  3V8X B;  5I58 A;  3TQL A;  1NNP A;  3WAF A;  3S9M C;  4EF1 A;  3R6U A;  2O84 X;  3EPE A;  3ILT B;  2F6P A;  1LAG E;  1OVB A;  4ZED A;  2E1S A;  3MC2 A;  2REJ A;  4PQJ A;  4NWD A;  3AXF A;  3FJG A;  2Y7W A;  1I69 A;  3HV1 A;  5I2N A;  1AIV A;  1US5 A;  4WEP A;  2XXP A;  2I3V A;  4QSD A;  3PGF A;  4F3P A;  4IY6 A;  3C36 A;  2XXI A;  3FGS A;  1QUK A;  5AA3 A;  5EYF A;  3V5A A;  1LGB C;  1MQG A;  3FV2 A;  1A8E A;  1JET A;  4FJP A;  1MXV A;  1URG A;  1L5T A;  1FW0 A;  3ONM A;  4PET A;  1MPC A;  2XXX A;  3IOU A;  4Z7E A;  1FTO A;  3LR1 A;  1N0T A;  3JYR A;  3CRB A;  4O3A A;  3HCQ A;  1NL5 A;  3RLF E;  4THI A;  3OO9 A;  4PFT A;  2VOZ A;  5H8H B;  1B1H A;  1SI0 A;  4XIG Q;  4HS7 A;  1YPN A;  3PV0 E;  4H5F A;  1ZIU A;  3TTN A;  3FZV A;  1J1N A;  1FQE A;  3MBP A;  3O6I A;  4AQ4 A;  1MXW A;  3K1N A;  4ZEF A;  5JTY A;  4IO7 A;  1XS5 A;  2IEE A; 
#chains in the Genus database with same CATH topology
 5ELV A;  3QAX A;  2ZNT A;  1B52 A;  4EDP A;  1NNK A;  1B7H A;  2H98 A;  1MM7 A;  3UN6 A;  4RYA A;  4ECF A;  3OSR A;  3QYT A;  5EHM A;  3OEL A;  4GWS A;  2QVU A;  4HTG A;  3ROJ A;  3HHF A;  1OQG A;  3E78 A;  4KFQ A;  3WAE A;  2CZK A;  2XA5 A;  4OVP A;  1H3D A;  3SER A;  4OZ9 A;  3GYY A;  5ESY A;  1IZ1 A;  2F36 A;  1HSL A;  4DDD A;  4MNI A;  2V4C A;  1XOC A;  3K6V A;  4C1U A;  5I57 A;  3HFU A;  3O2A A;  1MM6 A;  3I3V A;  2F78 A;  2P2A A;  2YJP A;  4OVJ A;  3VLV A;  3ODB A;  1ZBM A;  3W9V A;  2ZYN A;  4POW A;  3ILU B;  2UYF A;  2WYP A;  2R8T A;  3FXU A;  2Q8M A;  3D4G A;  3SEY A;  3RQT A;  1EH3 A;  1B32 A;  3O6H A;  4M4G A;  2F7A A;  4DCX A;  4OVQ A;  2GRV A;  2D3I A;  3TCH A;  1FPF A;  1Q9D A;  4PAI A;  1B3H A;  3SET A;  5H8N B;  2I49 A;  4F29 A;  1GTK A;  2Q89 A;  5CM6 A;  1IMD A;  2VGQ A;  1SBP A;  2DSF A;  4P8B A;  1FQF A;  5H8H A;  1OMP A;  3UGW A;  1VSO A;  4N8Y A;  1B5I A;  4GLI A;  4NAP A;  3VLU A;  2YLN A;  4GOT A;  2ZZW A;  1NH8 A;  2H4I A;  4ESW A;  2DP8 A;  1LST A;  5DVF A;  3T93 B;  1IMB A;  2V25 A;  1KA0 A;  2JJK A;  3CFX A;  3HN0 A;  2OK2 A;  4Q5T A;  3K00 A;  4LUB A;  1Y4C A;  1I6B A;  2RKM A;  2DWI A;  4WED A;  1BP5 A;  3QMF A;  3K2D A;  3G3G A;  4FBP A;  4R6H A;  3K6X A;  4JVI A;  4ND9 A;  1O7T A;  1LBV A;  5B70 A;  4XKN A;  4PE3 A;  5CC2 A;  3O97 A;  1B1X A;  2QFL A;  3G3F A;  2DWH A;  1JEV A;  3T9X B;  4BDL A;  4Q0C A;  4KI0 E;  1B4H A;  1B9J A;  5I84 A;  4GIZ A;  4HCW A;  4K3F A;  4DCY A;  1R6Z A;  1OVT A;  3IOT A;  4H67 A;  1S9T A;  3RN8 A;  2ALU A;  2OBG A;  1B46 A;  1FPL A;  3MW0 A;  1A54 A;  5IZZ A;  1MQI A;  4I3E A;  1FQA A;  2ABH A;  5A5X A;  1D9Q A;  2XXY A;  4U22 A;  5L8D A;  2HHM A;  4PFU A;  2HXW A;  3S2V A;  3TCF A;  3KFM A;  4QFP A;  3UA8 A;  5H8N A;  1XT8 A;  1B6H A;  2WBB A;  4N91 A;  3OEM A;  1MXU A;  3THI A;  3KC0 A;  3MQ9 A;  3RPL A;  1MQJ A;  3UOR A;  3GBA A;  4H8I A;  3SEW A;  3T9V A;  4ELR A;  3N6U A;  5DTB A;  2XXH A;  4GX6 A;  2PMS A;  3PD8 A;  2FIE A;  4OER A;  4P0G A;  1FSA A;  2I0C A;  3VDF A;  3FJM A;  3MVZ A;  1EU8 A;  4YKI A;  4P0I A;  2F34 A;  1USY H;  5TU0 A;  4OFL A;  2A5T B;  2DVZ A;  4MLV A;  1SQY A;  3K6W A;  3CI8 A;  3IJO B;  4X1B A;  4JWO A;  1IIW A;  1LBX A;  5K2Y A;  3TCG A;  1EZO A;  3U8Q A;  4OWD A;  4EQ9 A;  5FTI A;  1RYX A;  1B58 A;  1ELJ A;  1MY2 A;  2ZXT A;  4G4P A;  2FNC A;  2RC9 A;  1ZLQ A;  4OES A;  2NUV A;  1IXG A;  1MS7 A;  5IAI A;  1QVS A;  1NV4 A;  5L9O A;  3UK4 A;  1MXY A;  3TUS A;  3C34 A;  1N3X A;  2Y7R A;  3ISP A;  2DWJ A;  3DEL B;  1G0I A;  4BDO A;  5I5P A;  4MEV A;  4KPT A;  2REG A;  3OEK A;  4FOR A;  1US4 A;  5T3J A;  1S50 A;  4R75 A;  4KYD A;  2F5X A;  2GFE A;  3OD7 A;  4TLL B;  4FIM A;  4PGP A;  3CG3 A;  1UQW A;  2Y5L A;  4HXV A;  1NUW A;  3S9E A;  3FV1 A;  1Q35 A;  1CNQ A;  1KWH A;  2O69 A;  3QK6 A;  1FTK A;  3PUX E;  2PFZ A;  3BFT A;  3K0V A;  4NN3 A;  4LQ5 A;  4KXP A;  1A55 A;  4H5G A;  4ONY A;  1AWB A;  4LZ5 A;  1ZJL A;  1LBZ A;  2A5S A;  3MZ1 A;  3MP1 A;  4PF8 A;  4R6K A;  1VFD A;  2QS4 A;  3L6G A;  4I62 A;  2UVH A;  4U4X A;  2HFB A;  1XVY A;  2H25 A;  5JEI A;  1RDX A;  3EHU A;  1UTH B;  2R9J A;  1LBY A;  3T9H B;  5B7D A;  2O7I A;  4RPN A;  4OYV A;  4AB5 A;  3PPR A;  2DOJ A;  4OVS A;  4ZEB A;  3K4U A;  3M3K A;  4QBA A;  1YCJ A;  5AA4 A;  3MWB A;  3GZG A;  4X48 A;  1RDZ A;  1QGX A;  2P1S A;  3KOS A;  5EQ7 A;  4LN5 A;  1QKA A;  4NF8 A;  4EF2 A;  3KEI A;  3LUY A;  3T0J A;  1MPB A;  3OEN A;  1MY0 A;  4I8C A;  1EZP A;  1UIU A;  3LUZ A;  4AS4 A;  1AOV A;  4PDD A;  3C33 A;  3RY3 A;  5I56 A;  2B3F A;  5F7V A;  3E9X A;  1WVJ A;  3IO4 A;  2KLF A;  4ZEK A;  2I0B A;  4YKP A;  4XKP A;  3TMG A;  2VHA A;  4G68 B;  1FBH A;  4GL0 A;  3IJX B;  4O8M A;  5AA2 A;  2DE2 A;  2ZNS A;  2ZMB A;  4KYS A;  1AMF A;  4O94 A;  3IB2 A;  4DIG A;  1FPE A;  2Y5K A;  2HAV A;  2ZZX A;  3I5O A;  3PPQ A;  4N15 A;  4NF6 A;  3S9L C;  1MPD A;  4OVR A;  3ZKK A;  2XXR A;  4QRZ A;  1LAX A;  5H8Q B;  1M5D A;  4H65 A;  4IO4 A;  4P11 A;  2XXT A;  3QUF A;  1UTB B;  4GVO A;  4FEC A;  3TTK A;  1GR2 A;  4RK2 A;  4N6K A;  2GQ1 A;  2XXK A;  2DDK A;  5M2V A;  2D5W A;  3BIH A;  4XXU A;  1Y1Z A;  3E13 X;  4EXK A;  2GH9 A;  2M8C A;  1K9Z A;  3SEU A;  1NUY A;  1FPD A;  3BBR A;  2B65 A;  3KJ7 A;  3KOT A;  5I2K A;  4F39 A;  3T22 A;  4OFO A;  3UP9 A;  1B7Z A;  3DM0 A;  4RA1 A;  3SEX A;  3E79 A;  4OVT A;  3TZA A;  4RK9 A;  3LBS A;  5KCJ A;  3SDF A;  4YB7 A;  4F1V A;  4GWX A;  1O63 A;  2ANJ A;  5I7I A;  1NNF A;  4U4S A;  2AL5 A;  2NXO A;  3IOW A;  3KC1 A;  5ICT A;  1QUJ A;  3PPO A;  1CB6 A;  4H0W A;  4LVQ A;  5H8F A;  2YPN A;  1MQH A;  3KJT A;  2X7Q A;  1XI6 A;  3ECR A;  3G3J A;  1JVY A;  4AB6 A;  4LON B;  4N13 A;  5L9S A;  4KQP A;  4HW8 A;  3C35 A;  3H3G A;  5H8Q A;  1B7U A;  3I6V A;  4BDN A;  1XC1 A;  1UTB A;  1H76 A;  3USD A;  4F2O A;  3LSF B;  3GLB A;  3RTF B;  1IUD A;  4IR8 A;  4G77 A;  1LBC A;  2E0S A;  4QF9 A;  1YTV A;  4ISU A;  4DE8 A;  2NOO A;  3KBZ A;  2O51 A;  2HZL A;  1PB8 A;  3U92 A;  1TT1 A;  3FD3 A;  2AYS A;  3CSB A;  1OLA A;  2O6A A;  1LAH E;  2D21 A;  1ANF A;  1LFH A;  4QFN A;  3IB1 A;  3HST A;  1MY1 A;  2NWJ A;  3CIJ A;  3T9U A;  3U94 A;  5LDZ A;  3MP8 A;  4PFB A;  3PUZ E;  4F3B A;  4F1Y A;  1NI9 A;  5HPQ A;  4GWZ A;  3C4M A;  2UYE A;  1MXX A;  2ZYM A;  3IOR A;  2I58 A;  2HCA A;  4G61 A;  3Q28 A;  1T0K A;  1P1W A;  2ONK E;  3BIG A;  3O6G A;  2H9B A;  2IA4 A;  3IX1 A;  1VR5 A;  2F3D A;  2MKZ A;  2QMX A;  4NX1 A;  4Q8R A;  1B05 A;  1BTJ A;  3LC8 A;  1RKM A;  4NQ8 A;  1NV6 A;  1Y20 A;  2DE4 A;  4RPO A;  4NF4 B;  2XWI A;  4KR5 A;  4UAC A;  1JNF A;  3SZP A;  4NG7 A;  4DZ1 A;  3PU5 A;  1DMB A;  2P3N A;  4NF0 A;  4JVD A;  1HSJ A;  2WX9 A;  3B6T A;  4MIJ A;  5I3S A;  3S4U A;  3FVG A;  1Q1K A;  2DYX A;  1Y1M A;  3K6U A;  3FBP A;  1IXC A;  2NVU B;  3OOA A;  5EYH A;  3O9P A;  4E0X A;  2Y7K A;  3QSL A;  4MF3 A;  4OHN A;  3U72 A;  5CMM A;  3BFU A;  1SVX B;  1FTJ A;  2XD3 A;  1VE4 A;  1IIT A;  4X04 A;  2OWT A;  5CMC A;  2OCU A;  3OO7 A;  3E3K A;  4JXI A;  2R71 A;  4IO6 A;  1JW1 A;  2O68 A;  1VDW A;  5ET7 A;  4PAK A;  3EN3 A;  4XFE A;  4O7M A;  1B2H A;  2OWZ A;  2X26 A;  3EHS A;  2QL3 A;  4DI4 B;  4YZZ A;  5TP9 B;  3E4R A;  3FAS A;  2F7C A;  4YKJ A;  1SW4 A;  1LEV A;  1Y3Q A;  3IOV A;  1M5F A;  4OTE A;  3C9H A;  1DTZ A;  1SYH A;  1QJM A;  3FXR A;  4TLM B;  2V3T A;  4IGR A;  3MVW A;  5EYG A;  3Q26 A;  4C1T A;  4IO3 A;  4BDM A;  4OFJ A;  4FE8 A;  3LSL A;  2RF1 A;  1DK4 A;  1QW0 A;  4I1D A;  4R9F A;  2QJE A;  1B0H A;  3IR1 A;  3BKI B;  2QRY A;  4DLD A;  3HHG A;  4R2B A;  1PDA A;  1Z7N E;  4GX4 A;  4NTL A;  5J16 A;  1MY4 A;  4PAF A;  1DPP A;  1B0L A;  1PB9 A;  2B4L A;  2CZH A;  2Q74 A;  5I59 B;  3Q27 A;  2ZNU A;  3JZJ A;  1FJ9 A;  4N17 A;  4P47 A;  1RDY A;  2Y7P A;  2VPN A;  5EQ8 A;  1GVC A;  4GFR A;  1P1N A;  3EQ1 A;  3C31 A;  2AIX A;  4IO5 A;  1QUI A;  3O28 A;  3ZKL A;  4YU0 A;  3H06 B;  5DVI A;  1XHY A;  3G3K A;  3B7D A;  1B5H A;  1YAE A;  1FQB A;  4QXD A;  1JW4 A;  5FTH A;  5DW8 A;  2DWA A;  4N07 A;  3IAZ A;  3VVF A;  4NF5 B;  3FUZ A;  4PFR A;  2QVR A;  2H99 A;  3JV9 A;  2XX9 A;  3PMX A;  3TYH A;  4X8R A;  3MPK A;  3TEP A;  1SW2 A;  4IY5 A;  1B51 A;  4WXJ A;  1Y9U A;  1N7W A;  2I4B A;  1YXI A;  1URD A;  4Z0I A;  1NNT A;  4PDH A;  4M1V A;  1GGG A;  3CHG A;  3QUJ A;  5F24 A;  2DQV A;  2O1L A;  3DP8 A;  3U65 A;  5TP9 A;  5HBC A;  1B3G A;  4PCD A;  2OJT A;  3RPW A;  4E0W A;  2L5V A;  1NV7 A;  3H03 A;  4POX A;  1IME A;  2G29 A;  4GXA A;  4PFI A;  3G3H A;  1FQC A;  2DE3 A;  1IXH A;  1A99 A;  4BDQ A;  2VD3 A;  1LCT A;  2HEU A;  2CZL A;  3DLN A;  5KDT B;  2HQ0 A;  3FVK A;  4AS5 A;  3D4C A;  2CEY A;  4TQU Q;  4NMY A;  1ATG A;  3RT6 B;  2HAU A;  1N76 A;  3KG2 A;  2UVI A;  3TQW A;  2PYY A;  5I58 B;  5ITO A;  4R6Y A;  3VVE A;  5I59 A;  3VE1 B;  2GHA A;  1MY3 A;  4JWY A;  1NV5 A;  5IZ3 B;  3FXQ A;  2O7U A;  4KYE A;  1NV2 A;  5AA2 D;  1LBW A;  1RYO A;  2A5T A;  5EQ9 A;  3H7M A;  1M5E A;  3UIF A;  3TEL A;  1LBB A;  3TTR A;  4EQ7 A;  1TWY A;  4FAJ A;  4YIC A;  1JVX A;  4F19 A;  2QPQ A;  1YZ0 A;  2PX1 A;  5HM4 B;  3H6W A;  4O3B A;  3P7I A;  1HSE A;  4OEV A;  3IB0 A;  5I2N B;  2V3U A;  3N26 A;  1SD3 A;  2Y7I A;  4FED A;  1MXZ A;  4NF5 A;  4N4U A;  4NED A;  3LSX A;  1FPJ A;  3V89 B;  4GWU A;  1USY E;  3R7X A;  1WDN A;  4F3G A;  1A8F A;  1D4N A;  1P99 A;  4R9G A;  1B3L A;  5DYH A;  1H43 A;  2OX3 A;  2B3B A;  1SI1 A;  5CBS A;  1YYZ A;  5AE4 A;  3K1P A;  4GBW A;  3TTL A;  3A3U A;  3T66 A;  4GXS B;  5ITP A;  3SES A;  3M3L A;  2THI A;  4IB2 A;  3RTW B;  4F22 A;  4P56 A;  3OO8 A;  2F6G A;  5FHN A;  1OQH A;  3OMB A;  1LAF E;  2PVU A;  1H44 A;  3PTY A;  3FAT A;  1Z7M E;  5IKB A;  2VT5 A;  3KN7 A;  1N84 A;  4FAT A;  4YAH X;  2UVJ A;  2FBP A;  5L9M A;  2XXV A;  4GWW A;  4ZE8 A;  3KN3 A;  1EYK A;  3QXM A;  1R9L A;  5FHM A;  3FVO A;  3VLW A;  3N6T A;  4PTK A;  1OLC A;  1NV1 A;  4YKK A;  2DXR A;  2BJJ X;  3MUQ A;  3W15 C;  3MVX A;  1ZTY A;  4H1X A;  1MH4 A;  1P1U A;  3FJ7 A;  5A5L A;  1SPI A;  4QHQ A;  1II5 A;  3TDJ A;  2XXU A;  3Q29 A;  5ET5 A;  1UTH A;  4PFW A;  1S7Y A;  1EYI A;  4ZS9 A;  2X7P A;  3SEV A;  1CE2 A;  3PD9 A;  3KZG A;  5I57 B;  3T1B A;  4JBZ A;  2DS9 A;  3KBR A;  3B6W A;  4F3S A;  3OXN A;  4IGT A;  1IMF A;  1LB8 A;  2RCB A;  5CMB A;  3HPI A;  1BKA A;  1INP A;  4MFI A;  4PP0 A;  1P1O A;  2FVZ A;  2V3Q A;  4MMP A;  1R1N A;  1MQD A;  2CEX A;  1JQF A;  2Q9T A;  4DXC A;  1POY 1;  1NH7 A;  2F97 A;  4TOZ A;  2WBD A;  4XF5 A;  2G93 A;  1FCK A;  4ZZE A;  2OLB A;  4QSC A;  3TOD A;  4YMB A;  2BJI A;  2XXW A;  3ZSF A;  2ZYK A;  3CVG A;  3H6U A;  4DI3 D;  2P0S A;  4GWY A;  4R73 A;  4EUO A;  3MZB A;  4FEB A;  4H46 A;  4JWX A;  3ZS6 A;  2Z8F A;  2QS1 A;  3H6T A;  4NE4 A;  4MBP A;  3G7W A;  2Q8J A;  4F18 A;  3O29 A;  1NV0 A;  4G68 A;  4F1U A;  3MZ9 A;  1FBC A;  2XWV A;  2Y84 A;  5ISU A;  4O3C A;  4P1E A;  3L6H A;  3PUY E;  2QS3 A;  3RT8 A;  2ZZV A;  1FTM A;  1LB9 A;  3DP4 A;  5EHS A;  3N94 A;  2Z22 A;  4JSO A;  5LTC A;  1UIV A;  4PBH A;  3O66 A;  2F35 A;  4ZDM A;  4PC9 A;  1DOT A;  1SW1 A;  5KZT A;  2H5Y A;  1N7X A;  4QFL A;  4ZEI A;  2Z8E A;  2HPG A;  4GX3 A;  1NUX A;  1K9Y A;  1JP4 A;  4LAT A;  3CR9 A;  2RIN A;  1DTG A;  3A3C A;  1N3W A;  1D9Y A;  3U1O A;  4YB6 A;  2QVV A;  3B8B A;  3PUW E;  2R6G E;  1IMA A;  2XX8 A;  1P1Q A;  3CSG A;  2ZYO A;  1XVX A;  3IFC A;  3GXA A;  1SYI A;  3B6Q A;  2V84 A;  4O7I A;  1GV8 A;  2VP1 A;  1IQ7 A;  1FBP A;  5JK4 A;  3MP6 A;  4H8J A;  3KGC A;  3U93 A;  4OA4 A;  1MG1 A;  4LQ2 A;  3VXB A;  4JSD A;  2DXY A;  1O64 A;  3PMV A;  5A5X B;  4NWC A;  5J1D A;  4ELP A;  2Q2A A;  4LZ7 A;  1Y3P A;  3VVD A;  1A40 A;  3CG1 A;  4WKM A;  2B4M A;  4RNS A;  5ET8 A;  3PUV E;  5K2X A;  3VFJ A;  3K02 A;  5FHO A;  4G2Z A;  5AA1 A;  3RPL B;  1M5B A;  1Y3N A;  4RY1 A;  1LFG A;  2GHB A;  3MST A;  4ELQ A;  5DT6 A;  2OZZ A;  2XXQ A;  1LCF A;  4HCY A;  3KN8 A;  3VXC A;  2W7Y A;  2F3B A;  2PT2 A;  2V93 A;  3F11 A;  4NGU A;  4OEU A;  2RC7 A;  1NV3 A;  1TXF A;  4X1D A;  3MAM A;  4KCD A;  2Z23 A;  5BUU A;  2WEF A;  1EZ9 A;  4MHF A;  4N81 A;  1NUZ A;  4C0R A;  4JVC A;  4QFK A;  3TAJ A;  2VD2 A;  1N04 A;  1FPB A;  3HO7 A;  2I3W A;  4F2Q A;  3FIR A;  1FPI A;  2I6E A;  3A29 A;  1D9V A;  2F7B A;  3G3I A;  1G0H A;  3RYD A;  2O1M A;  5F1Q A;  4OEN A;  1URS A;  5IGA A;  1JEU A;  4RJZ A;  1BIY A;  1B3E A;  3TFL A;  3CFL A;  4GWO A;  3LSW A;  1PEB A;  3MVY A;  4MNP A;  2HXR A;  1NMU A;  4U1O A;  5TPA B;  2UXA A;  4PE5 B;  2XWO A;  4G8M A;  4G8H A;  4R2F A;  4IO2 A;  1FTL A;  3OO6 A;  4JB7 A;  4H45 A;  5DEX B;  1R9Q A;  2KR0 A;  4X9T A;  2XX7 A;  1JW5 A;  4EQB A;  1KZ8 A;  4OET A;  3PPN A;  2FYI A;  5ET6 A;  1IEJ A;  5ICQ A;  4NF4 A;  3FVN A;  1TFD A;  3TKD A;  1FQD A;  4KCC A;  5IZ1 A;  1POT A;  3RNN A;  4R74 A;  5EQA A;  2LAO A;  5CMK A;  4PF6 A;  4GF8 A;  2HZK A;  1I6Q A;  1AH5 A;  3LV0 A;  5CRY A;  2QMW A;  4GD5 A;  1I6A A;  4UAB A;  3MJN A;  4U23 A;  2XD2 A;  5DVJ A;  4GBV A;  5CI5 A;  3A09 A;  1SDX A;  2KQZ A;  2WKY A;  4MCO A;  5BWJ A;  4OQO A;  4ELO A;  1BK4 A;  3IFA A;  1D3K A;  1B4Z A;  4U21 A;  3Q25 A;  4PBQ A;  1FTA A;  5IM2 A;  3MPL A;  3IL1 B;  2OWS A;  2I4C A;  2DVC A;  3FXB A;  4BDR A;  3OSQ A;  2Q2C A;  3EF7 A;  4YB5 A;  3K1M A;  1ZMG A;  4OMB A;  4UA8 A;  3IO6 A;  5AA4 B;  1ZU0 A;  4R72 A;  4GL8 A;  3TTM A;  4LP2 B;  1A7L A;  4DXB A;  3T96 B;  4G8N A;  3GBB A;  5TPA A;  4NF8 B;  2I48 A;  4ZZA A;  2RCA A;  3H4Z A;  4XKR A;  2PT1 A;  1AL3 A;  4N6D A;  4GRK A;  1NKX A;  1Y4T A;  1MDP 1;  3C32 A;  3W9W A;  5DEX A;  5I56 B;  1F9B A;  3D1R A;  3R26 A;  4PGN A;  4QSE A;  2PCR A;  3RGY A;  1LFI A;  3CFZ A;  1DBZ A;  1H45 A;  3PPP A;  4OAN A;  5AA2 B;  1FBF A;  4L17 A;  3TPA A;  1FPK A;  3S9N C;  1QUL A;  2ONR A;  4JDF A;  4F31 B;  3B50 A;  2QS2 A;  3EHT A;  1IXI A;  3M3F A;  1DSN A;  4KHZ E;  3H6V A;  1QKB A;  4GQO A;  4P1L A;  4DXU A;  1LLS A;  4NF6 B;  1MH3 A;  3PMW A;  3IK6 B;  4G68 C;  2QSX A;  4RXL A;  3SKP A;  2CMO A;  2CZI A;  4MLQ A;  5CBR A;  3RUM A;  2ESN A;  2PBW A;  4XTC Q;  4LA9 A;  1BLF A;  2Z8D A;  4ZE9 A;  4BLA A;  1B3F A;  2F8D A;  2ONS A;  3V83 A;  4ESX A;  4YMA A;  4H6D A;  4EXL A;  1VFE A;  1OIB A;  4XKQ A;  3N5L A;  2AL4 A;  1B5J A;  4QFO A;  5I2K B;  1EYJ A;  1B40 A;  3QIM A;  1FPG A;  1ZKB A;  4I9D A;  1FBG A;  4U2R A;  1MDQ A;  1DPE A;  2PFY A;  4U1Z A;  1MRP A;  1TFA A;  4MH5 A;  1PB7 A;  4I3Y A;  1DCU A;  3M8U A;  1PBQ A;  1FRP A;  1IMC A;  1PC3 A;  4MJO A;  2XHD A;  4Q30 B;  4N6P A;  4OXV A;  5KCJ B;  1PBP A;  2UVG A;  1FJ6 A;  4PFY A;  4ZEC A;  5KDT A;  2Q88 A;  1SW5 A;  2FA7 A;  5JTY B;  4KD5 A;  3VV5 A;  2WYK A;  4I40 A;  2RC8 A;  5H8S A;  3KSX A;  5LOM A;  3K01 A;  2XWK A;  4MX6 A;  1M5C A;  3DP6 A;  1WOD A;  2FHY A;  3KSJ A;  5H8F B;  1NFT A;  4LZ8 A;  3V8X B;  5I58 A;  1KA1 A;  3TQL A;  3NOH A;  1NNP A;  1FBE A;  3WAF A;  4P9K A;  3S9M C;  5IZ3 A;  4EF1 A;  3R6U A;  2O84 X;  3EPE A;  3ILT B;  2F6P A;  1LAG E;  1OVB A;  4ZED A;  4HE0 A;  4MNC A;  2E1S A;  3MC2 A;  2REJ A;  4PQJ A;  4NWD A;  3AXF A;  3FJG A;  2Y7W A;  1I69 A;  3HV1 A;  5I2N A;  1AIV A;  1US5 A;  4WEP A;  2XXP A;  2I3V A;  4QSD A;  3PGF A;  1FBD A;  4F3P A;  4IY6 A;  3C36 A;  2XXI A;  3FGS A;  1QUK A;  5AA3 A;  2FIX A;  5EYF A;  3V5A A;  1LGB C;  4NHB A;  1MQG A;  3FV2 A;  1A8E A;  1JET A;  4FJP A;  1MXV A;  1URG A;  1L5T A;  1FW0 A;  3ONM A;  4PET A;  1MPC A;  2XXX A;  3EKI A;  3IOU A;  5FBP A;  4HE2 A;  1FTO A;  3LR1 A;  4Z7E A;  4XEQ A;  1N0T A;  3JYR A;  3CRB A;  4O3A A;  3HCQ A;  1NL5 A;  3RLF E;  4THI A;  3OO9 A;  4PFT A;  2VOZ A;  4N8G A;  5H8H B;  3MYU A;  2P3V A;  1B1H A;  4HE1 A;  1SI0 A;  4XIG Q;  4HS7 A;  1YPN A;  3PV0 E;  4H5F A;  4P3L A;  1ZIU A;  3TTN A;  3FZV A;  4MAG A;  1J1N A;  1FQE A;  3MBP A;  3O6I A;  4AQ4 A;  1MXW A;  3K1N A;  4ZEF A;  5JTY A;  4IO7 A;  1XS5 A;  2VPO A;  2IEE A; 
#chains in the Genus database with same CATH homology
 5ELV A;  3QAX A;  2ZNT A;  1B52 A;  4EDP A;  1NNK A;  1B7H A;  2H98 A;  1MM7 A;  3UN6 A;  4RYA A;  4ECF A;  3OSR A;  3QYT A;  5EHM A;  3OEL A;  4HTG A;  3HHF A;  1OQG A;  4KFQ A;  3WAE A;  1H3D A;  3SER A;  4OZ9 A;  1IZ1 A;  2F36 A;  1HSL A;  4DDD A;  1XOC A;  3K6V A;  4C1U A;  5I57 A;  3O2A A;  1MM6 A;  3I3V A;  2F78 A;  2P2A A;  2YJP A;  4OVJ A;  3VLV A;  3ODB A;  1ZBM A;  3W9V A;  2ZYN A;  4POW A;  3ILU B;  2UYF A;  3FXU A;  3D4G A;  3SEY A;  3RQT A;  1EH3 A;  1B32 A;  3O6H A;  4M4G A;  2F7A A;  4DCX A;  2GRV A;  2D3I A;  3TCH A;  1B3H A;  3SET A;  5H8N B;  2I49 A;  4F29 A;  1GTK A;  2Q89 A;  5CM6 A;  2VGQ A;  1SBP A;  2DSF A;  1FQF A;  5H8H A;  1OMP A;  3UGW A;  1VSO A;  1B5I A;  4GLI A;  3VLU A;  2YLN A;  4GOT A;  1NH8 A;  2H4I A;  4ESW A;  2DP8 A;  1LST A;  5DVF A;  3T93 B;  2V25 A;  3CFX A;  3HN0 A;  2OK2 A;  4Q5T A;  3K00 A;  4LUB A;  1Y4C A;  1I6B A;  2RKM A;  2DWI A;  4WED A;  1BP5 A;  3K2D A;  3G3G A;  4ND9 A;  3K6X A;  4R6H A;  1O7T A;  5B70 A;  4XKN A;  5CC2 A;  3O97 A;  1B1X A;  3G3F A;  2DWH A;  1JEV A;  3T9X B;  4BDL A;  4Q0C A;  4KI0 E;  1B4H A;  1B9J A;  5I84 A;  4GIZ A;  4HCW A;  4K3F A;  4DCY A;  1R6Z A;  1OVT A;  3IOT A;  4H67 A;  1S9T A;  3RN8 A;  2ALU A;  2OBG A;  1B46 A;  3MW0 A;  1A54 A;  1MQI A;  1FQA A;  2ABH A;  5A5X A;  2XXY A;  4U22 A;  5L8D A;  4PFU A;  2HXW A;  3S2V A;  3TCF A;  3KFM A;  4QFP A;  3UA8 A;  5H8N A;  1XT8 A;  1B6H A;  3OEM A;  1MXU A;  3THI A;  3MQ9 A;  3UOR A;  1MQJ A;  3GBA A;  4H8I A;  3SEW A;  3T9V A;  4ELR A;  3N6U A;  5DTB A;  2XXH A;  2PMS A;  3PD8 A;  4OER A;  4P0G A;  2I0C A;  3VDF A;  3FJM A;  3MVZ A;  1EU8 A;  4YKI A;  4P0I A;  2F34 A;  1USY H;  5TU0 A;  4OFL A;  2A5T B;  2DVZ A;  4MLV A;  1SQY A;  3K6W A;  3CI8 A;  3IJO B;  4X1B A;  4JWO A;  1IIW A;  5K2Y A;  3TCG A;  1EZO A;  3U8Q A;  4OWD A;  4EQ9 A;  5FTI A;  1RYX A;  1B58 A;  1ELJ A;  1MY2 A;  2ZXT A;  4G4P A;  2FNC A;  2RC9 A;  1ZLQ A;  4OES A;  2NUV A;  1IXG A;  1MS7 A;  5IAI A;  1QVS A;  5L9O A;  3UK4 A;  1MXY A;  3TUS A;  3C34 A;  1N3X A;  2Y7R A;  2DWJ A;  3DEL B;  4BDO A;  4KPT A;  2REG A;  3OEK A;  4FOR A;  1US4 A;  1S50 A;  4R75 A;  4KYD A;  2F5X A;  2GFE A;  3OD7 A;  4TLL B;  4FIM A;  3CG3 A;  1UQW A;  3S9E A;  3FV1 A;  1Q35 A;  1KWH A;  2O69 A;  3QK6 A;  1FTK A;  3PUX E;  3BFT A;  3K0V A;  4LQ5 A;  1A55 A;  4H5G A;  4ONY A;  4LZ5 A;  1ZJL A;  2A5S A;  3MZ1 A;  3MP1 A;  4R6K A;  1VFD A;  2QS4 A;  3L6G A;  4I62 A;  2UVH A;  4U4X A;  2HFB A;  1XVY A;  2H25 A;  5JEI A;  3EHU A;  1UTH B;  2R9J A;  3T9H B;  5B7D A;  2O7I A;  4RPN A;  4OYV A;  4AB5 A;  3PPR A;  2DOJ A;  4ZEB A;  3K4U A;  3M3K A;  1YCJ A;  5AA4 A;  3MWB A;  3GZG A;  4X48 A;  2P1S A;  3KOS A;  1QKA A;  4NF8 A;  4EF2 A;  3KEI A;  3LUY A;  1MPB A;  3OEN A;  1MY0 A;  4I8C A;  1EZP A;  1UIU A;  1AOV A;  3C33 A;  3RY3 A;  5I56 A;  2B3F A;  5F7V A;  3E9X A;  1WVJ A;  3IO4 A;  2KLF A;  4ZEK A;  2I0B A;  4YKP A;  4XKP A;  3TMG A;  2VHA A;  4G68 B;  4GL0 A;  3IJX B;  5AA2 A;  2DE2 A;  2ZNS A;  2ZMB A;  4KYS A;  1AMF A;  3IB2 A;  4DIG A;  2HAV A;  3PPQ A;  3I5O A;  4NF6 A;  3S9L C;  1MPD A;  3ZKK A;  2XXR A;  4QRZ A;  1LAX A;  5H8Q B;  1M5D A;  4H65 A;  4IO4 A;  4P11 A;  2XXT A;  3QUF A;  1UTB B;  4GVO A;  4FEC A;  3TTK A;  1GR2 A;  4RK2 A;  5M2V A;  2D5W A;  4XXU A;  1Y1Z A;  3E13 X;  4EXK A;  2GH9 A;  2M8C A;  3SEU A;  3BBR A;  2B65 A;  3KJ7 A;  3KOT A;  5I2K A;  4F39 A;  3T22 A;  4OFO A;  3UP9 A;  1B7Z A;  3DM0 A;  4RA1 A;  3SEX A;  3TZA A;  4RK9 A;  3LBS A;  5KCJ A;  3SDF A;  4YB7 A;  4F1V A;  1O63 A;  2ANJ A;  1NNF A;  4U4S A;  2AL5 A;  2NXO A;  3IOW A;  5ICT A;  1QUJ A;  3PPO A;  1CB6 A;  4H0W A;  4LVQ A;  5H8F A;  2YPN A;  1MQH A;  3KJT A;  2X7Q A;  3ECR A;  3G3J A;  1JVY A;  4AB6 A;  4LON B;  4N13 A;  5L9S A;  4KQP A;  4HW8 A;  3C35 A;  3H3G A;  5H8Q A;  1B7U A;  3I6V A;  4BDN A;  1XC1 A;  1UTB A;  1H76 A;  3USD A;  4F2O A;  3LSF B;  3GLB A;  3RTF B;  1IUD A;  4G77 A;  1LBC A;  2E0S A;  4QF9 A;  1YTV A;  4ISU A;  4DE8 A;  2NOO A;  2O51 A;  2HZL A;  1PB8 A;  3U92 A;  1TT1 A;  3FD3 A;  2AYS A;  3CSB A;  1OLA A;  2O6A A;  1LAH E;  2D21 A;  1ANF A;  1LFH A;  4QFN A;  3IB1 A;  3HST A;  1MY1 A;  2NWJ A;  3CIJ A;  3T9U A;  3U94 A;  3MP8 A;  3PUZ E;  4F3B A;  4F1Y A;  5HPQ A;  3C4M A;  2UYE A;  1MXX A;  2ZYM A;  3IOR A;  2I58 A;  2HCA A;  3Q28 A;  1T0K A;  1P1W A;  2ONK E;  3O6G A;  2H9B A;  2IA4 A;  3IX1 A;  1VR5 A;  2QMX A;  4Q8R A;  1B05 A;  1BTJ A;  3LC8 A;  1RKM A;  1Y20 A;  2DE4 A;  4RPO A;  4NF4 B;  4KR5 A;  4UAC A;  1JNF A;  4DZ1 A;  3PU5 A;  1DMB A;  1HSJ A;  3B6T A;  3S4U A;  3FVG A;  1Q1K A;  2DYX A;  1Y1M A;  3K6U A;  2NVU B;  1IXC A;  3OOA A;  3O9P A;  4E0X A;  2Y7K A;  3QSL A;  4MF3 A;  4OHN A;  3U72 A;  5CMM A;  3BFU A;  1SVX B;  1FTJ A;  2XD3 A;  1VE4 A;  1IIT A;  2OWT A;  5CMC A;  2OCU A;  3OO7 A;  3E3K A;  4JXI A;  2R71 A;  4IO6 A;  1JW1 A;  2O68 A;  3EN3 A;  1B2H A;  2X26 A;  3EHS A;  2QL3 A;  4YZZ A;  5TP9 B;  3E4R A;  3FAS A;  2F7C A;  4YKJ A;  1SW4 A;  1Y3Q A;  3IOV A;  1M5F A;  4OTE A;  3C9H A;  1DTZ A;  1SYH A;  1QJM A;  3FXR A;  4TLM B;  2V3T A;  4IGR A;  3MVW A;  3Q26 A;  4C1T A;  4IO3 A;  4BDM A;  4OFJ A;  4FE8 A;  3LSL A;  2RF1 A;  1QW0 A;  4I1D A;  4R9F A;  2QJE A;  1B0H A;  3IR1 A;  3BKI B;  2QRY A;  4DLD A;  3HHG A;  4R2B A;  1PDA A;  1Z7N E;  4NTL A;  1MY4 A;  1DPP A;  1B0L A;  1PB9 A;  5I59 B;  3Q27 A;  2ZNU A;  3JZJ A;  2Y7P A;  1GVC A;  4GFR A;  1P1N A;  3EQ1 A;  3C31 A;  2AIX A;  1QUI A;  4IO5 A;  3O28 A;  3ZKL A;  4YU0 A;  3H06 B;  5DVI A;  1XHY A;  3G3K A;  3B7D A;  1B5H A;  1YAE A;  1FQB A;  1JW4 A;  5FTH A;  2DWA A;  4N07 A;  3IAZ A;  3VVF A;  4NF5 B;  3FUZ A;  2H99 A;  3JV9 A;  2XX9 A;  3PMX A;  3TYH A;  3MPK A;  3TEP A;  1SW2 A;  4IY5 A;  1B51 A;  4WXJ A;  1Y9U A;  1N7W A;  2I4B A;  1URD A;  4Z0I A;  1NNT A;  4M1V A;  1GGG A;  3QUJ A;  2DQV A;  2O1L A;  3DP8 A;  5TP9 A;  5HBC A;  1B3G A;  3RPW A;  2OJT A;  4E0W A;  4POX A;  3H03 A;  2G29 A;  4GXA A;  3G3H A;  1FQC A;  2DE3 A;  1IXH A;  4BDQ A;  1A99 A;  2VD3 A;  1LCT A;  2HEU A;  2CZL A;  3DLN A;  5KDT B;  2HQ0 A;  3FVK A;  3D4C A;  4TQU Q;  4NMY A;  1ATG A;  3RT6 B;  2HAU A;  1N76 A;  3KG2 A;  2UVI A;  3TQW A;  2PYY A;  5I58 B;  5ITO A;  4R6Y A;  3VVE A;  5I59 A;  3VE1 B;  2GHA A;  1MY3 A;  4JWY A;  3FXQ A;  2O7U A;  4KYE A;  5AA2 D;  1RYO A;  2A5T A;  3H7M A;  1M5E A;  3UIF A;  3TEL A;  1LBB A;  3TTR A;  4EQ7 A;  1TWY A;  4FAJ A;  4YIC A;  1JVX A;  4F19 A;  2QPQ A;  2PX1 A;  5HM4 B;  3H6W A;  4O3B A;  3P7I A;  1HSE A;  4OEV A;  3IB0 A;  5I2N B;  2V3U A;  3N26 A;  1SD3 A;  2Y7I A;  4FED A;  1MXZ A;  4NF5 A;  4NED A;  3LSX A;  3V89 B;  1USY E;  3R7X A;  1WDN A;  4F3G A;  1A8F A;  1D4N A;  1P99 A;  4R9G A;  1B3L A;  5DYH A;  1H43 A;  2B3B A;  1SI1 A;  5CBS A;  5AE4 A;  3K1P A;  3TTL A;  3A3U A;  3T66 A;  4GXS B;  5ITP A;  3SES A;  3M3L A;  2THI A;  4IB2 A;  3RTW B;  4F22 A;  3OO8 A;  2F6G A;  5FHN A;  1OQH A;  3OMB A;  1LAF E;  2PVU A;  1H44 A;  3FAT A;  1Z7M E;  5IKB A;  3KN7 A;  1N84 A;  4FAT A;  4YAH X;  2UVJ A;  5L9M A;  2XXV A;  4ZE8 A;  3KN3 A;  3QXM A;  1R9L A;  5FHM A;  3FVO A;  3VLW A;  3N6T A;  1OLC A;  4YKK A;  2DXR A;  2BJJ X;  3MUQ A;  3W15 C;  3MVX A;  1ZTY A;  4H1X A;  1MH4 A;  1P1U A;  3FJ7 A;  4QHQ A;  1II5 A;  3TDJ A;  2XXU A;  3Q29 A;  1UTH A;  4PFW A;  1S7Y A;  4ZS9 A;  2X7P A;  3SEV A;  1CE2 A;  3PD9 A;  3KZG A;  5I57 B;  4JBZ A;  2DS9 A;  3KBR A;  3B6W A;  4F3S A;  3OXN A;  4IGT A;  1LB8 A;  2RCB A;  5CMB A;  3HPI A;  1BKA A;  4MFI A;  4PP0 A;  1P1O A;  2V3Q A;  1R1N A;  1MQD A;  1JQF A;  2Q9T A;  4DXC A;  1POY 1;  1NH7 A;  2F97 A;  4TOZ A;  2G93 A;  1FCK A;  4ZZE A;  2OLB A;  4QSC A;  3TOD A;  4YMB A;  2XXW A;  3ZSF A;  2ZYK A;  3CVG A;  3H6U A;  4EUO A;  2P0S A;  4R73 A;  3MZB A;  4FEB A;  4JWX A;  3ZS6 A;  2Z8F A;  2QS1 A;  3H6T A;  4NE4 A;  4MBP A;  3G7W A;  2Q8J A;  4F18 A;  3O29 A;  4G68 A;  4F1U A;  3MZ9 A;  2Y84 A;  5ISU A;  4O3C A;  3L6H A;  3PUY E;  2QS3 A;  3RT8 A;  1FTM A;  1LB9 A;  3DP4 A;  5EHS A;  3N94 A;  2Z22 A;  4JSO A;  1UIV A;  3O66 A;  2F35 A;  4ZDM A;  1DOT A;  1SW1 A;  5KZT A;  2H5Y A;  1N7X A;  4QFL A;  4ZEI A;  2Z8E A;  4LAT A;  3CR9 A;  2RIN A;  1DTG A;  3A3C A;  1N3W A;  1D9Y A;  3U1O A;  4YB6 A;  3PUW E;  2R6G E;  2XX8 A;  1P1Q A;  3CSG A;  2ZYO A;  1XVX A;  3GXA A;  1SYI A;  3B6Q A;  2V84 A;  1GV8 A;  2VP1 A;  1IQ7 A;  5JK4 A;  3MP6 A;  4H8J A;  3KGC A;  3U93 A;  1MG1 A;  4LQ2 A;  3VXB A;  4JSD A;  2DXY A;  1O64 A;  3PMV A;  5A5X B;  4NWC A;  5J1D A;  4ELP A;  2Q2A A;  4LZ7 A;  1Y3P A;  3VVD A;  1A40 A;  3CG1 A;  4WKM A;  4RNS A;  3PUV E;  5K2X A;  3VFJ A;  3K02 A;  5FHO A;  4G2Z A;  5AA1 A;  1M5B A;  1Y3N A;  4RY1 A;  1LFG A;  2GHB A;  4ELQ A;  5DT6 A;  2OZZ A;  2XXQ A;  1LCF A;  4HCY A;  3KN8 A;  3VXC A;  2W7Y A;  2PT2 A;  2V93 A;  3F11 A;  4OEU A;  2RC7 A;  1TXF A;  4X1D A;  3MAM A;  4KCD A;  2Z23 A;  5BUU A;  1EZ9 A;  4C0R A;  4QFK A;  3TAJ A;  2VD2 A;  1N04 A;  3HO7 A;  2I3W A;  4F2Q A;  3FIR A;  2I6E A;  1D9V A;  2F7B A;  3G3I A;  2O1M A;  5F1Q A;  4OEN A;  1URS A;  1JEU A;  4RJZ A;  1BIY A;  1B3E A;  3TFL A;  3CFL A;  4GWO A;  3LSW A;  1PEB A;  3MVY A;  1NMU A;  4U1O A;  5TPA B;  2UXA A;  4PE5 B;  4G8M A;  4G8H A;  4R2F A;  4IO2 A;  1FTL A;  3OO6 A;  4JB7 A;  5DEX B;  1R9Q A;  4X9T A;  2XX7 A;  1JW5 A;  4EQB A;  4OET A;  3PPN A;  2FYI A;  1IEJ A;  5ICQ A;  4NF4 A;  3FVN A;  1TFD A;  3TKD A;  1FQD A;  4KCC A;  1POT A;  3RNN A;  4R74 A;  2LAO A;  5CMK A;  4GF8 A;  2HZK A;  1I6Q A;  1AH5 A;  5CRY A;  2QMW A;  4GD5 A;  1I6A A;  3MJN A;  4U23 A;  2XD2 A;  5DVJ A;  5CI5 A;  3A09 A;  1SDX A;  2WKY A;  5BWJ A;  4OQO A;  4ELO A;  1D3K A;  1B4Z A;  4U21 A;  3Q25 A;  3MPL A;  3IL1 B;  2OWS A;  2I4C A;  2DVC A;  4BDR A;  3OSQ A;  2Q2C A;  3EF7 A;  4YB5 A;  3K1M A;  1ZMG A;  4OMB A;  4UA8 A;  3IO6 A;  5AA4 B;  1ZU0 A;  4R72 A;  4GL8 A;  3TTM A;  4LP2 B;  1A7L A;  4DXB A;  3T96 B;  4G8N A;  3GBB A;  5TPA A;  4NF8 B;  2I48 A;  4ZZA A;  2RCA A;  3H4Z A;  4XKR A;  2PT1 A;  1AL3 A;  4GRK A;  1NKX A;  1Y4T A;  1MDP 1;  3C32 A;  3W9W A;  5DEX A;  5I56 B;  1F9B A;  3R26 A;  4QSE A;  3RGY A;  1LFI A;  3CFZ A;  1H45 A;  3PPP A;  5AA2 B;  4L17 A;  3TPA A;  3S9N C;  1QUL A;  2ONR A;  4JDF A;  4F31 B;  3EHT A;  2QS2 A;  1IXI A;  3M3F A;  1DSN A;  4KHZ E;  3H6V A;  1QKB A;  4GQO A;  4DXU A;  1LLS A;  4NF6 B;  1MH3 A;  3PMW A;  3IK6 B;  4G68 C;  2QSX A;  4RXL A;  3SKP A;  2CMO A;  4MLQ A;  5CBR A;  3RUM A;  2ESN A;  2PBW A;  4XTC Q;  4LA9 A;  1BLF A;  2Z8D A;  4ZE9 A;  4BLA A;  1B3F A;  2F8D A;  2ONS A;  3V83 A;  4ESX A;  4YMA A;  4H6D A;  4EXL A;  1VFE A;  1OIB A;  4XKQ A;  3N5L A;  2AL4 A;  1B5J A;  4QFO A;  5I2K B;  1B40 A;  3QIM A;  1ZKB A;  4I9D A;  4U2R A;  1MDQ A;  1DPE A;  4U1Z A;  1MRP A;  1TFA A;  4MH5 A;  1PB7 A;  3M8U A;  1PBQ A;  1PC3 A;  2XHD A;  4Q30 B;  4N6P A;  4OXV A;  5KCJ B;  1PBP A;  2UVG A;  4PFY A;  4ZEC A;  5KDT A;  2Q88 A;  1SW5 A;  2FA7 A;  5JTY B;  4KD5 A;  3VV5 A;  2RC8 A;  5H8S A;  3KSX A;  5LOM A;  3K01 A;  1M5C A;  3DP6 A;  1WOD A;  3KSJ A;  5H8F B;  1NFT A;  4LZ8 A;  3V8X B;  5I58 A;  3TQL A;  1NNP A;  3WAF A;  3S9M C;  4EF1 A;  3R6U A;  2O84 X;  3EPE A;  3ILT B;  2F6P A;  1LAG E;  1OVB A;  4ZED A;  2E1S A;  3MC2 A;  2REJ A;  4PQJ A;  4NWD A;  3AXF A;  3FJG A;  2Y7W A;  1I69 A;  3HV1 A;  5I2N A;  1AIV A;  1US5 A;  4WEP A;  2XXP A;  2I3V A;  4QSD A;  3PGF A;  4F3P A;  4IY6 A;  3C36 A;  2XXI A;  3FGS A;  1QUK A;  5AA3 A;  5EYF A;  3V5A A;  1LGB C;  1MQG A;  3FV2 A;  1A8E A;  1JET A;  4FJP A;  1MXV A;  1URG A;  1L5T A;  1FW0 A;  3ONM A;  4PET A;  1MPC A;  2XXX A;  3IOU A;  4Z7E A;  1FTO A;  3LR1 A;  1N0T A;  3JYR A;  3CRB A;  4O3A A;  3HCQ A;  1NL5 A;  3RLF E;  4THI A;  3OO9 A;  4PFT A;  2VOZ A;  5H8H B;  1B1H A;  1SI0 A;  4XIG Q;  4HS7 A;  1YPN A;  3PV0 E;  4H5F A;  1ZIU A;  3TTN A;  3FZV A;  1J1N A;  1FQE A;  3MBP A;  3O6I A;  4AQ4 A;  1MXW A;  3K1N A;  4ZEF A;  5JTY A;  4IO7 A;  1XS5 A;  2IEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...