5AA2A

Crystal structure of mltf from pseudomonas aeruginosa in complex with nam-pentapeptide.
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
419
structure length
419
Chain Sequence
KEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFTQHLQQRLPRYESHFKQSGKQKDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE F
publication title Activation by Allostery in Cell-Wall Remodeling by a Modular Membrane-Bound Lytic Transglycosylase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
total genus 143
structure length 419
sequence length 419
chains with identical sequence C
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa2A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa2A02
4TLLB 1UTHB 3W9WA 1OMPA 3KN8A 3CFXA 1H76A 3K4UA 4Q8RA 2XXVA 3IOTA 5BUUA 4EF2A 4LQ5A 2XX9A 1R1NA 2O6AA 2NWJA 2VGQA 1L5TA 1DOTA 2Q8JA 4MLQA 1URDA 4QSCA 4F3PA 4NMYA 3TTRA 1N84A 4I62A 2AL4A 1MH4A 2VD3A 4KYDA 2RCAA 3H4ZA 4P0IA 5DEXB 2HQ0A 4PFTA 4F29A 3D4CA 2GFEA 4FORA 1GTKA 1OIBA 1B7UA 1USYE 1NMUA 5AA2D 3G3JA 3N5LA 5CM6A 2UVIA 4MFIA 5ISUA 4ND9A 3BBRA 3O66A 1LAXA 3FV2A 1FQEA 3MWBA 1N76A 2F97A 1F9BA 1Q35A 1FTJA 5KCJA 1PDAA 1B7ZA 4RPNA 1LB9A 2GHAA 3UGWA 2REJA 4FAJA 4YAHX 4KR5A 4LP2B 4KYSA 4GXSB 1B5IA 1O7TA 2DXYA 4YKKA 5M2VA 1QKAA 5H8QB 5I2NA 3PPQA 2O7IA 3PPRA 1B3EA 5CRYA 1SBPA 4MLVA 3IOUA 3QYTA 2DOJA 5CMCA 3G3FA 5JTYB 1XT8A 1ZMGA 4WKMA 2ZYNA 4HTGA 3PUXE 3TTKA 4U1ZA 1MQJA 2Q9TA 3KSXA 1ZIUA 3VLUA 3Q28A 2QRYA 3Q25A 5DVJA 5CMKA 3C35A 1D4NA 1P1QA 4GWOA 3R26A 1OLAA 4JSOA 4BLAA 3TEPA 2XX7A 3K1NA 4E0XA 3TFLA 1PB7A 3O2AA 2ZYKA 1VFEA 4QSEA 4ELRA 4ELQA 3M3LA 4BDLA 4F39A 3MZBA 4F1UA 3PGFA 4KPTA 4ZZEA 3A3UA 3TCFA 2UYFA 2UXAA 4GVOA 4OERA 3IJXB 1DSNA 3LBSA 3U93A 4EQ9A 4YKIA 2F8DA 3KZGA 2OLBA 1YTVA 4OEUA 2DQVA 3DELB 1Y9UA 3QSLA 3O6GA 2PMSA 3U8QA 5DEXA 1Y1ZA 3C31A 1OVTA 2OCUA 2Y84A 1P1WA 2HXWA 3VLWA 1CB6A 1FQBA 2QL3A 3FASA 1ZJLA 2DE2A 1JETA 3FJ7A 3EN3A 1OQGA 3F11A 3H03A 1MXWA 1IIWA 1MQHA 3FXQA 3IB2A 2XX8A 2PVUA 2Z8EA 4XKNA 4QFLA 3JV9A 1EU8A 1OQHA 4RXLA 1P1UA 3S9LC 4PFYA 1DTGA 4EDPA 3TZAA 5F7VA 4OFOA 4M4GA 3O6IA 5I56A 2OWTA 3CFZA 3N6TA 4OXVA 2XXIA 4RK9A 1M5FA 3FVGA 3K6UA 3G7WA 2PYYA 4YKPA 3IO6A 1VE4A 3CSGA 4BDRA 4RPOA 4PQJA 2DWJA 4FIMA 1FTOA 1JVXA 1ZLQA 1QJMA 1B46A 3FVOA 5TPAA 3JZJA 4KYEA 4WEPA 3RT8A 3PPOA 4PFUA 3DLNA 5HBCA 4NF6B 2B65A 2V3QA 1R6ZA 4G77A 4OVJA 1N04A 1UQWA 4H67A 1FQFA 5DTBA 3PMXA 4IY5A 1II5A 2IA4A 1Y4TA 3U92A 5A5XB 3QAXA 3OMBA 2XD3A 4KQPA 1FQDA 3S9EA 1IEJA 3IJOB 4JWXA 4C0RA 3H6TA 5H8NB 4OZ9A 4JWYA 4DXCA 2RINA 3E9XA 2M8CA 3D4GA 3DP6A 4JDFA 1YCJA 1MXYA 2DP8A 4IO5A 4OQOA 4F2QA 5EHSA 2HCAA 3IO4A 2V84A 2ABHA 5AA4A 2R71A 2QJEA 5DYHA 3VDFA 1XVXA 1JQFA 3TPAA 3V8XB 5I57A 2HFBA 2D21A 4IO4A 4WEDA 4OWDA 1D9YA 4IGTA 3DM0A 2QMWA 2V3UA 4TLMB 2H9BA 1MM6A 3QIMA 3MP1A 4R6YA 2ALUA 1A54A 4QSDA 3OEMA 1B40A 1B2HA 2OBGA 3LSFB 4JXIA 1R9LA 3L6HA 1LAFE 1B9JA 3UN6A 4I9DA 4X1DA 2UVJA 3K6WA 4BDNA 1Y20A 1H3DA 5K2XA 3MVWA 4U2RA 1SW4A 1QUKA 3PUZE 3T9VA 2RCBA 2GH9A 1NFTA 1S7YA 1SVXB 2G93A 4F3BA 2Z8DA 4ZEBA 4R6HA 4TQUQ 2XHDA 2A5SA 5I2KB 3IOVA 4GF8A 4GXAA 3PUYE 3P7IA 4R9FA 1XS5A 2OK2A 2HAUA 3A09A 1QUJA 1B52A 4N07A 1VR5A 5EHMA 4OFLA 1B3HA 4EXKA 1M5BA 4F18A 3PV0E 3O28A 3KSJA 4P0GA 4ZZAA 1RYXA 1BTJA 1O64A 1SI1A 4IO7A 3RQTA 1MM7A 4AB6A 2Y7IA 2O68A 4XIGQ 3TAJA 1JW4A 1SI0A 4BDMA 4POWA 1NH7A 3H6UA 3W15C 4I1DA 3ONMA 3K1MA 4R75A 2O1MA 1MQGA 1VSOA 1MY3A 3SEYA 4ZS9A 1MDP1 2XXYA 4GL8A 1BP5A 2I3WA 3MZ9A 1LSTA 3VXBA 4ESWA 4DIGA 4LZ7A 4QFPA 3SEUA 5CI5A 1QW0A 2I48A 2DSFA 4X48A 2Z23A 4E0WA 3MVYA 1A55A 2I0CA 1B1XA 2AYSA 3S2VA 1Y3PA 2DS9A 3HHGA 2Q89A 4C1TA 3R7XA 1FCKA 5B7DA 3SDFA 1MQDA 3CG3A 4H8IA 3CIJA 3TTNA 4OEVA 4G68C 4HW8A 1IXHA 5JEIA 3L6GA 4IGRA 3I5OA 4X1BA 2P0SA 2OWSA 1IZ1A 4AQ4A 3G3KA 3M8UA 3EHTA 1TXFA 2D3IA 1WVJA 5KDTB 4EXLA 2CZLA 4PP0A 4QF9A 1JW5A 5I58A 1Z7ME 4YMAA 1IXGA 4OENA 2QMXA 3RY3A 3UP9A 4YB7A 1QUIA 1Y3QA 4KD5A 4R9GA 1YPNA 3RTWB 3KN3A 3U72A 4H5GA 4LUBA 5H8FB 2F7CA 1A8EA 5TP9B 5CBSA 2FNCA 2X7QA 5CMMA 3VVDA 3ILUB 1MY4A 4GOTA 4F3SA 5K2YA 4FATA 4GL0A 4YB5A 3H6WA 1B5JA 4XKPA 1XOCA 1B32A 3A3CA 3T96B 1HSEA 4NWDA 3KJ7A 1NNTA 4JBZA 1FQAA 4NTLA 4RA1A 2P2AA 3W9VA 2I4BA 2DVCA 5ICTA 3VE1B 5HPQA 1EH3A 3IAZA 1MY2A 4WXJA 1PEBA 3LSWA 1UTHA 3K01A 3FATA 2YJPA 3Q29A 2XXUA 3TDJA 5AA2B 2I58A 3S4UA 3WAFA 3FJMA 1JEUA 1VFDA 3B6TA 1B3GA 2VOZA 3S9MC 1TT1A 1AIVA 3AXFA 5FHOA 1UTBB 2G29A 4ZE8A 4JSDA 3C33A 2HZLA 1IITA 4NF5B 1EZOA 4OFJA 1AOVA 2BJJX 5ITOA 3T9HB 2H4IA 4PETA 4RK2A 1JW1A 1Q1KA 1DTZA 4EF1A 5FHNA 3KEIA 3U94A 1I6BA 4QFOA 2PX1A 3VV5A 3TMGA 1UIUA 1A7LA 2AL5A 1LAGE 2RF1A 1ZTYA 1LAHE 4LATA 4NF4B 1HSJA 1B7HA 1PC3A 4IO6A 1LFHA 1S9TA 4U22A 3EHSA 5H8QA 4XKQA 2Q2CA 4XXUA 2P1SA 2XD2A 2QSXA 2F78A 3ZKLA 4U23A 2A5TB 1QKBA 1FW0A 5JTYA 3HCQA 3H06B 5KZTA 3GLBA 1MH3A 4Q30B 3CFLA 4ZEDA 4IO3A 3V83A 1N3XA 1IXCA 1AL3A 4HS7A 3VFJA 2XXRA 4G68B 2F35A 2ONSA 1ANFA 2D5WA 1US4A 3IR1A 2ZYOA 3GZGA 4U1OA 3QUFA 3B6QA 2E0SA 3OO7A 3HO7A 3FXUA 1R9QA 4EQ7A 4RYAA 1ELJA 4X9TA 3LSXA 3ZKKA 5CC2A 2V25A 2XXPA 1GV8A 4LVQA 2H98A 3B7DA 5TU0A 4DDDA 4NF8B 3MC2A 4OMBA 3PMVA 1M5EA 1URSA 1MRPA 2ONRA 3M3KA 2ANJA 3MP6A 5FHMA 3IORA 3EF7A 1DPEA 3G3HA 2F5XA 3OO9A 4G8MA 1WDNA 2ZYMA 4NE4A 4KFQA 1N3WA 1XC1A 1M5CA 2ZXTA 3QXMA 1CE2A 3FZVA 2I6EA 4F1YA 1Y3NA 3K2DA 4R74A 3Q26A 3ZSFA 1MPCA 3C34A 1NL5A 1B51A 1MY1A 3CSBA 1B4ZA 1LCFA 1P1OA 2R6GE 4GLIA 2ESNA 5DVFA 1XVYA 3HSTA 3IX1A 3KG2A 3KOSA 1TFAA 3MVZA 4DE8A 4NF4A 3TCGA 3LUYA 1B0HA 3RT6B 1N0TA 2VD2A 2PBWA 1RKMA 1N7XA 4LONB 3T93B 2QPQA 3FIRA 3QK6A 3KGCA 3FXRA 4YB6A 3K00A 3EQ1A 4Q0CA 2O7UA 5CBRA 4HCYA 4ZE9A 1B1HA 3PMWA 3U1OA 3E13X 2NVUB 4R2BA 4GD5A 3MP8A 3OXNA 4H1XA 3VVEA 2X7PA 1BIYA 1NH8A 2YLNA 2F7AA 2DXRA 1A8FA 4H65A 3LC8A 5KCJB 5FTIA 4YMBA 2OZZA 3V5AA 2AIXA 3Q27A 4NF6A 4P11A 3UA8A 3FJGA 3HV1A 5I2NB 3B6WA 3TCHA 3KN7A 3M3FA 1J1NA 4NF8A 4RJZA 2NOOA 1US5A 4H6DA 2RKMA 3I3VA 3OD7A 5A5XA 3FUZA 5B70A 4C1UA 3VXCA 4R2FA 5DVIA 3MBPA 4DXBA 4LA9A 3GBBA 4DLDA 1NNKA 2DYXA 1JNFA 2XXXA 1SW1A 1MXVA 1LFGA 4FE8A 4BDQA 5H8NA 4G4PA 4OHNA 2DWHA 4OESA 4F2OA 1MQIA 1D3KA 4QFKA 2RC7A 2O51A 3OEKA 5L9OA 3C4MA 4QFNA 3K02A 4FEBA 4R6KA 4FJPA 5CMBA 3H7MA 1I69A 1B0LA 1NKXA 3FGSA 4G2ZA 5L9MA 4POXA 3IOWA 5ITPA 3RN8A 1B05A 5L8DA 2F36A 1B5HA 4K3FA 3MJNA 4MBPA 3RGYA 2OJTA 4XKRA 1H44A 3H3GA 4RY1A 1DPPA 1SD3A 4LQ2A 3FV1A 3CI8A 3GXAA 3SESA 1WODA 4ZDMA 4Z7EA 4H0WA 3K6VA 3N26A 2IEEA 5F1QA 5I84A 2GRVA 1FTLA 3T22A 1B4HA 3SEVA 3E4RA 3PPPA 3IL1B 2F7BA 1LCTA 3KOTA 2I0BA 1H43A 3O97A 1RYOA 1GVCA 2O84X 1TFDA 1USYH 4PFWA 1D9VA 1DMBA 4DCYA 3RLFE 3KJTA 2Q2AA 3ODBA 4F22A 5I2KA 1P1NA 2ZNUA 1SYIA 3OO6A 3PD9A 2DE4A 1O63A 3CVGA 3H6VA 3O6HA 4HCWA 3C9HA 3MPLA 1T0KA 3LR1A 2W7YA 3KBRA 5AA3A 4ELOA 4FECA 5I56B 1ZU0A 1SDXA 3HPIA 2PT1A 3RTFB 1SW5A 2H99A 5I59B 2KLFA 1YAEA 3SERA 2ZNTA 2NUVA 1PB8A 4GRKA 4G8NA 4KHZE 5IAIA 2THIA 3SEXA 4THIA 3UORA 1LBBA 3O29A 3RUMA 1IXIA 3MPKA 1LLSA 4MH5A 1M5DA 2QS2A 2O1LA 4R73A 5TPAB 1GGGA 1ZKBA 2XXHA 4Z0IA 4GIZA 4IB2A 5HM4B 4LZ5A 4O3BA 3DP4A 3USDA 1Y4CA 1MPBA 2ZNSA 3G3IA 3KFMA 4O3CA 1B6HA 1B58A 1B3LA 2ONKE 1BLFA 2HEUA 1B3FA 2LAOA 3BFTA 2Y7RA 1OVBA 2H25A 1QULA 2ZMBA 2HZKA 4AB5A 2F6PA 1PBQA 3OENA 5H8HB 3K0VA 1Z7NE 2RC9A 1ZBMA 5ELVA 5ICQA 3LSLA 4GQOA 3BFUA 5AA1A 4XTCQ 2I3VA 4KI0E 2QS4A 3HHFA 5AA4B 3MAMA 3IB1A 4O3AA 5KDTA 1MS7A 4IO2A 2GHBA 1P99A 2UYEA 4QHQA 4YKJA 2XXQA 2Z8FA 5I57B 2QS1A 3C32A 1EZPA 3DP8A 4U4SA 4ZEKA 2F34A 1XHYA 2XXTA 2WKYA 4F19A 3TQWA 4F3GA 2B3BA 1MG1A 2DE3A 1FTMA 1NNFA 3TODA 5H8FA 5TP9A 4ONYA 2HAVA 3K1PA 3PD8A 1UIVA 4QRZA 4N13A 1MXUA 4YU0A 5JK4A 4KCCA 4RNSA 1LB8A 5I59A 3N94A 3EHUA 1I6QA 2DWAA 5IKBA 3S9NC 1QVSA 1IQ7A 3TTMA 1FTKA 3CG1A 4F31B 1KWHA 3UIFA 2Q88A 1OLCA 4GFRA 1NNPA 3T66A 2DVZA 2Y7KA 3T9UA 4UACA 5AA2A 1URGA 4F1VA 2VP1A 5AE4A 3HN0A 3OELA 1PBPA 3RPWA 4PE5B 3WAEA 1UTBA 1HSLA 3MZ1A 3G3GA 4N6PA 2R9JA 4NWCA 4OTEA 2NXOA 3SETA 4NF5A 1EZ9A 3SKPA 4Q5TA 2B3FA 2X26A 1MXXA 5H8HA 4U4XA 1SYHA 4NEDA 1TWYA 4YZZA 3T9XB 4KCDA 4OYVA 3OOAA 4R72A 1MPDA 2O69A 3BKIB 4H8JA 1AMFA 3THIA 4DXUA 3E3KA 2I49A 4ELPA 2XXWA 2CMOA 5L9SA 5DT6A 3JYRA 4U21A 3ILTB 3MQ9A 4ESXA 1POTA 2F6GA 4I8CA 1FQCA 3PUWE 3UK4A 1POY1 4ZECA 4ECFA 3MW0A 3ZS6A 2A5TA 3FD3A 4JB7A 2V3TA 3OSRA 2I4CA 4TOZA 1AH5A 3MUQA 2Y7PA 4UA8A 4IY6A 3TKDA 4ZEFA 5LOMA 4EUOA 3TYHA 3TUSA 4G68A 3FVNA 4OETA 4EQBA 4JWOA 1JVYA 3MVXA 3R6UA 1SQYA 3V89B 1ATGA 2UVHA 1LFIA 2REGA 3PU5A 5BWJA 1JEVA 3OO8A 1H45A 1PB9A 4G8HA 4ISUA 4DZ1A 1I6AA 2Z22A 4BDOA 3VLVA 1IUDA 2V93A 1SW2A 5EYFA 1S50A 3QUJA 3ECRA 5I58B 5H8SA 3SEWA 3CRBA 2PT2A 5FTHA 3TQLA 1A99A 1MXZA 4DCXA 2RC8A 3IK6B 1LBCA 4LZ8A 3K6XA 1A40A 2QS3A 3EPEA 1N7WA 3PPNA 1GR2A 4ZEIA 3N6UA 1Y1MA 2VHAA 4M1VA 3TTLA 3TELA 2UVGA 3GBAA 3RNNA 2FA7A 2Y7WA 2DWIA 4H5FA 2H5YA 4YICA 3O9PA 5J1DA 3FVKA 4MF3A 1MY0A 4L17A 1MDQA 3C36A 3I6VA 4FEDA 2FYIA 3PUVE 3VVFA 3CR9A 3IB0A 3OSQA 1LGBC 1BKAA 2YPNA 2E1SA
chains in the Genus database with same CATH superfamily
4TLLB 1UTHB 3W9WA 1OMPA 3KN8A 3CFXA 1H76A 3K4UA 4MAGA 4Q8RA 2XXVA 3IOTA 5BUUA 4EF2A 4LQ5A 3MSTA 3PTYA 5EQ7A 2XX9A 1R1NA 2O6AA 1LBYA 2NWJA 2VGQA 1L5TA 1RDYA 1DOTA 2Q8JA 4N17A 4MEVA 4MLQA 1URDA 4QSCA 4F3PA 4NMYA 3TTRA 1N84A 5EQ9A 4I62A 4LN5A 2AL4A 1MH4A 2VD3A 2WYKA 4KYDA 2RCAA 3H4ZA 4P0IA 5DEXB 2HQ0A 4PFTA 1NV5A 4F29A 3D4CA 2GFEA 4FORA 1GTKA 1OIBA 1B7UA 1USYE 1NMUA 5AA2D 3G3JA 3N5LA 5CM6A 2UVIA 4MFIA 5ISUA 4ND9A 3BBRA 3O66A 1LAXA 3FV2A 4KXPA 1FQEA 4PFRA 3MWBA 1N76A 2F97A 1F9BA 1Q35A 1FTJA 5KCJA 2L5VA 1PDAA 1B7ZA 4RPNA 1LB9A 2GHAA 3UGWA 2REJA 4FAJA 4YAHX 4KR5A 4LP2B 4KYSA 1IMFA 4GXSB 4O7IA 1B5IA 1O7TA 2DXYA 4YKKA 5M2VA 1QKAA 2ZZVA 5H8QB 5I2NA 3PPQA 2O7IA 3PPRA 1B3EA 5CRYA 5LTCA 1SBPA 4MLVA 3IOUA 3QYTA 1DCUA 4GBVA 4GX3A 2DOJA 5CMCA 3G3FA 5JTYB 1XT8A 1ZMGA 4JVIA 4WKMA 4AS4A 2ZYNA 4HTGA 3PUXE 3TTKA 4U1ZA 1MQJA 4N91A 2Q9TA 3KSXA 1ZIUA 3VLUA 3B8BA 3Q28A 2QRYA 5IGAA 3Q25A 5DVJA 1YXIA 5CMKA 5I7IA 4OANA 3C35A 1D4NA 1P1QA 4GWOA 3R26A 1EYKA 1OLAA 4JSOA 4BLAA 3TEPA 2XX7A 1K9YA 3K1NA 4E0XA 3TFLA 1PB7A 1FBCA 3O2AA 2MKZA 2ZYKA 1VFEA 4QSEA 4ELRA 1SPIA 4ELQA 3M3LA 2CEYA 4BDLA 4F39A 3MZBA 4F1UA 3PGFA 4KPTA 4ZZEA 3A3UA 3TCFA 4O8MA 2UYFA 2UXAA 4GVOA 4OERA 1FPKA 3IJXB 1DSNA 3LBSA 3U93A 4EQ9A 1FPJA 4YKIA 2F8DA 3KZGA 1FPBA 1XI6A 1NV3A 2OLBA 1YTVA 4OEUA 2DQVA 4P47A 3DELB 1Y9UA 3QSLA 3KC1A 2HPGA 3O6GA 2PMSA 3U8QA 4PC9A 5DEXA 1Y1ZA 3C31A 1LEVA 1OVTA 2OCUA 2Y84A 2XWOA 1P1WA 2HXWA 3VLWA 1CB6A 1FQBA 2QL3A 3FASA 1ZJLA 2DE2A 3A29A 1JETA 3FJ7A 1IMCA 3EN3A 1OQGA 3F11A 4PF8A 2OWZA 3H03A 1MXWA 1IIWA 1MQHA 3FXQA 3IB2A 2XX8A 2PVUA 2Z8EA 4XKNA 4QFLA 3JV9A 1EU8A 1OQHA 4RXLA 1P1UA 3S9LC 4PFYA 4JVDA 1DTGA 4EDPA 3TZAA 2FIEA 5F7VA 4OFOA 4M4GA 3O6IA 1JP4A 5I56A 2OWTA 3CFZA 3N6TA 4OXVA 2XXIA 5J16A 4RK9A 1M5FA 2CZHA 3FVGA 3K6UA 3G7WA 2PYYA 4YKPA 3IO6A 1VE4A 3CSGA 5FBPA 4BDRA 4RPOA 4PQJA 2DWJA 4FIMA 4NQ8A 1FTOA 1JVXA 2QVUA 1ZLQA 1QJMA 1NV6A 1B46A 3FVOA 5TPAA 3JZJA 4KYEA 4WEPA 2CEXA 1G0HA 3RT8A 3PPOA 4PFUA 3DLNA 5HBCA 4NF6B 2B65A 2V3QA 1R6ZA 4G77A 4OVJA 4NGUA 1N04A 1UQWA 4N81A 4H67A 1FQFA 5DTBA 3PMXA 4IY5A 4PGNA 1II5A 2IA4A 1Y4TA 3U92A 5A5XB 3QAXA 1FBGA 3OMBA 2XD3A 4KQPA 1FQDA 4MNCA 4PFIA 3S9EA 4PDDA 1IEJA 3IJOB 4JWXA 4C0RA 3H6TA 2KQZA 5H8NB 1VDWA 4OZ9A 3IFCA 4JWYA 4DXCA 2RINA 3E9XA 2M8CA 5F24A 4GWXA 3D4GA 3DP6A 4JDFA 2FHYA 4MJOA 1YCJA 1MXYA 2DP8A 4IO5A 4OQOA 4F2QA 5EHSA 2HCAA 3IO4A 2V84A 2ABHA 5AA4A 2R71A 2QJEA 2P3NA 5DYHA 4PAFA 3VDFA 1XVXA 1JQFA 3TPAA 3V8XB 5I57A 2HFBA 2D21A 4P1EA 4IO4A 4WEDA 4OWDA 1D9YA 4IGTA 3U65A 3DM0A 2QMWA 2V3UA 1FTAA 1FBEA 4TLMB 2H9BA 1MM6A 3QIMA 5IZZA 3B50A 4PTKA 3MP1A 1FBHA 4R6YA 2ALUA 1A54A 1NV4A 4QSDA 3OEMA 3RPLA 1B40A 2XWVA 1B2HA 2OBGA 3LSFB 4JXIA 1R9LA 3L6HA 1LAFE 1B9JA 3UN6A 4I9DA 4X1DA 2UVJA 3K6WA 4BDNA 1Y20A 4MMPA 1NUZA 1H3DA 5K2XA 3MVWA 4U2RA 1SW4A 1QUKA 3PUZE 3T9VA 2RCBA 2GH9A 1NFTA 1S7YA 1SVXB 4MNIA 2G93A 4F3BA 2Z8DA 4ZEBA 4AS5A 4R6HA 2XWKA 4TQUQ 2XHDA 2A5SA 4MCOA 5I2KB 3IOVA 4GF8A 4PF6A 4GXAA 3PUYE 3P7IA 4R9FA 1XS5A 2OK2A 3NOHA 2HAUA 3A09A 1QUJA 5EQ8A 1B52A 4N07A 1VR5A 5EHMA 4OFLA 1B3HA 4EXKA 1M5BA 2FVZA 4F18A 3PV0E 3O28A 3KSJA 4P0GA 4ZZAA 1RYXA 1BTJA 1O64A 1SI1A 4IO7A 3RQTA 1MM7A 4AB6A 2Y7IA 2O68A 3LUZA 4XIGQ 3TAJA 1JW4A 5A5LA 1SI0A 4BDMA 4POWA 1NH7A 3H6UA 3W15C 4I1DA 5ESYA 3ONMA 3K1MA 4R75A 4QBAA 2R8TA 2O1MA 1YYZA 1MQGA 1VSOA 1MY3A 2Q8MA 2HHMA 3SEYA 3KBZA 4ZS9A 1MDP1 1IMBA 2XXYA 4GL8A 1BP5A 1FJ9A 1FPEA 2XA5A 2I3WA 3MZ9A 1LSTA 3VXBA 4ESWA 4DIGA 4LZ7A 4QFPA 3SEUA 5CI5A 1QW0A 2I48A 2DSFA 1LBVA 2KR0A 4X48A 2Z23A 4E0WA 3MVYA 3RYDA 1A55A 1FBPA 2I0CA 1B1XA 2AYSA 3S2VA 1Y3PA 2DS9A 3HHGA 2Q89A 4C1TA 3R7XA 1FCKA 5B7DA 3SDFA 4I3EA 1MQDA 3CG3A 4DI4B 4H8IA 3CIJA 3GYYA 3TTNA 4OEVA 4G68C 4HW8A 1IXHA 5JEIA 3L6GA 4IGRA 3I5OA 4X1BA 2P0SA 2OWSA 1IZ1A 5IZ3A 4AQ4A 3G3KA 3M8UA 3EHTA 1TXFA 2D3IA 1WVJA 5KDTB 5T3JA 4EXLA 2CZLA 4PP0A 4QF9A 1JW5A 5I58A 1NV1A 4NN3A 1Z7ME 4YMAA 1LBZA 1IXGA 4HE1A 4OENA 2QMXA 5ET5A 3RY3A 3UP9A 2QVVA 1NV0A 4YB7A 1QUIA 1Y3QA 4KD5A 4R9GA 1YPNA 3RTWB 3KN3A 3U72A 2CZIA 4H5GA 4LUBA 5H8FB 4PBHA 2F7CA 1A8EA 5TP9B 5CBSA 2FNCA 2X7QA 5CMMA 3VVDA 3ILUB 1MY4A 4GOTA 4F3SA 5K2YA 4FATA 4GL0A 4YB5A 3H6WA 1B5JA 1XOCA 4XKPA 2ZZXA 1B32A 3A3CA 3T96B 1HSEA 4NWDA 3KJ7A 1NNTA 4JBZA 1FQAA 1Q9DA 4NTLA 4RA1A 4MHFA 2P2AA 3W9VA 2I4BA 2DVCA 5ICTA 3VE1B 5HPQA 1EH3A 3IAZA 1MY2A 4WXJA 4DI3D 4OVPA 1PEBA 3LSWA 1UTHA 1FBDA 3K01A 3FATA 2YJPA 3Q29A 2XXUA 3TDJA 5AA2B 2P3VA 2I58A 3S4UA 1G0IA 3WAFA 3FJMA 1JEUA 1VFDA 1NV7A 3B6TA 1B3GA 2VOZA 3S9MC 1TT1A 1AIVA 3AXFA 5FHOA 1UTBB 2G29A 4ZE8A 4PAKA 4JSDA 3C33A 2GQ1A 4N8GA 2HZLA 1IITA 4NF5B 1EZOA 4OFJA 1FPIA 1AOVA 2BJJX 5ITOA 1KZ8A 3T9HB 2H4IA 4PETA 4RK2A 1JW1A 1Q1KA 1DTZA 4EF1A 5FHNA 3KEIA 3U94A 3E79A 1I6BA 4QFOA 2PX1A 3TMGA 3VV5A 1UIUA 4OVSA 1A7LA 2AL5A 1LAGE 2RF1A 1ZTYA 1LAHE 4LATA 4NF4B 1HSJA 4OVQA 4P1LA 2V4CA 1B7HA 1PC3A 4IO6A 1LFHA 1S9TA 4U22A 3EHSA 5H8QA 4XKQA 2Q2CA 4XXUA 2P1SA 2XD2A 2QSXA 2F78A 3ZKLA 4U23A 2A5TB 4OVTA 1QKBA 1FW0A 4N8YA 5JTYA 3HCQA 3H06B 5KZTA 3GLBA 1MH3A 4Q30B 3CFLA 4ZEDA 4IO3A 3V83A 1N3XA 1IXCA 2Y5LA 1AL3A 4HS7A 3VFJA 2XXRA 4G68B 2F35A 2ONSA 1ANFA 1QGXA 2D5WA 1US4A 3IR1A 2ZYOA 3GZGA 4U1OA 3QUFA 3B6QA 1NUXA 2E0SA 2F3DA 3HO7A 3OO7A 3FXUA 1R9QA 4EQ7A 4RYAA 1ELJA 4X9TA 3LSXA 3ZKKA 5CC2A 2V25A 2XXPA 1GV8A 4LVQA 4O94A 2H98A 3B7DA 1NUYA 5TU0A 4DDDA 4GWYA 4NF8B 3MC2A 1BK4A 4NX1A 4OMBA 3PMVA 1M5EA 1URSA 1MRPA 2ONRA 3M3KA 2ANJA 3MP6A 5FHMA 3IORA 3EF7A 4NAPA 1DPEA 4UABA 3G3HA 2F5XA 3OO9A 4G8MA 1WDNA 2ZYMA 4NE4A 4KFQA 1N3WA 1XC1A 1M5CA 2ZXTA 3QXMA 1CE2A 3FZVA 2I6EA 4N6DA 4F1YA 1Y3NA 3K2DA 4R74A 3Q26A 3ZSFA 1MPCA 3C34A 1NL5A 1B51A 1MY1A 3CSBA 3HFUA 1B4ZA 1LCFA 1P1OA 2R6GE 4GLIA 2ESNA 2PFYA 1LBXA 5DVFA 1XVYA 3HSTA 3IX1A 3KG2A 4P3LA 3KOSA 4HE2A 1TFAA 3MVZA 4DE8A 4NF4A 3TCGA 3LUYA 1B0HA 3RT6B 1N0TA 2VD2A 3KC0A 2PBWA 1RKMA 1N7XA 3LV0A 4LONB 3T93B 2QPQA 3FIRA 3QK6A 2PFZA 3KGCA 3FXRA 4GX6A 4YB6A 3K00A 3T1BA 3EQ1A 4Q0CA 2O7UA 5CBRA 4HCYA 4ZE9A 1B1HA 3PMWA 3U1OA 3E13X 2NVUB 1K9ZA 4R2BA 4GD5A 3MP8A 3OXNA 2BJIA 4H1XA 3FBPA 4I40A 2X7PA 3IFAA 1BIYA 3VVEA 1NH8A 2YLNA 2F7AA 2DXRA 1A8FA 4H65A 3LC8A 5KCJB 5FTIA 4YMBA 2OZZA 3V5AA 2AIXA 3Q27A 4NF6A 4P11A 1FSAA 3UA8A 3FJGA 3HV1A 5I2NB 3B6WA 3TCHA 3KN7A 3M3FA 1J1NA 4NF8A 4RJZA 2NOOA 1US5A 4H6DA 2RKMA 3I3VA 3OD7A 5A5XA 3FUZA 5EYHA 4N6KA 5B70A 3SZPA 4C1UA 3VXCA 4R2FA 4JVCA 5DVIA 1KA0A 3MBPA 4DXBA 4GWUA 4MNPA 4LA9A 3GBBA 4DLDA 1NNKA 2DYXA 1JNFA 2XXXA 1SW1A 4NHBA 1MXVA 1LFGA 4FE8A 4BDQA 5H8NA 2XXKA 4G4PA 2F3BA 4OHNA 1DK4A 2DWHA 4MX6A 4OESA 4F2OA 1MQIA 1D3KA 4QFKA 2RC7A 2ZZWA 2O51A 2WBDA 3OEKA 5L9OA 3C4MA 4QFNA 3K02A 4FEBA 4R6KA 4FJPA 4PE3A 5CMBA 1NUWA 3H7MA 1I69A 1B0LA 1NKXA 3FGSA 4G2ZA 5L9MA 4POXA 3IOWA 5ITPA 4P9KA 3RN8A 1B05A 2JJKA 5L8DA 2F36A 1B5HA 4K3FA 3MJNA 5ET6A 4MBPA 3RGYA 2OJTA 4P8BA 4XKRA 1H44A 3H3GA 4RY1A 1DPPA 1SD3A 1NI9A 1AWBA 4LQ2A 3FV1A 3CI8A 3GXAA 3SESA 1WODA 4ZDMA 3EKIA 4Z7EA 4H46A 4H0WA 3K6VA 3N26A 2IEEA 4PBQA 5F1QA 5I84A 2GRVA 1IMEA 1FTLA 5DW8A 3T22A 1B4HA 3SEVA 3E4RA 3PPPA 3D1RA 3IL1B 2F7BA 1LCTA 3KOTA 2I0BA 1H43A 2WX9A 3O97A 1RYOA 1GVCA 2O84X 1TFDA 1USYH 4PFWA 1D9QA 1D9VA 1DMBA 5IM2A 3RLFE 4DCYA 3KJTA 2Q2AA 3ODBA 4F22A 5I2KA 1P1NA 2ZNUA 1SYIA 4IR8A 3OO6A 3PD9A 2DE4A 1O63A 1RDXA 3CVGA 3H6VA 4XFEA 3O6HA 4HCWA 3C9HA 3MPLA 1T0KA 3LR1A 2W7YA 3KBRA 5AA3A 4ELOA 4G61A 4FECA 4PCDA 5I56B 1ZU0A 1SDXA 3HPIA 2PT1A 4P56A 3RTFB 1SW5A 2H99A 5I59B 2KLFA 1YAEA 3SERA 2ZNTA 2NUVA 1PB8A 4GRKA 4G8NA 4KHZE 4H45A 5IAIA 2THIA 3SEXA 4THIA 3UORA 1LBBA 3O29A 3RUMA 1IXIA 3MPKA 1LLSA 4MH5A 1M5DA 2QS2A 2QVRA 2O1LA 4R73A 5TPAB 4N4UA 3BIGA 4PFBA 1GGGA 1ZKBA 2XXHA 4OA4A 1YZ0A 1FJ6A 2B4LA 4Z0IA 4GIZA 4IB2A 5HM4B 4LZ5A 4O3BA 3DP4A 3USDA 1Y4CA 1MPBA 2ZNSA 3G3IA 3KFMA 2FIXA 4O3CA 1B6HA 1B58A 1B3LA 2ONKE 1BLFA 1IMDA 2HEUA 1B3FA 2LAOA 3BFTA 5EQAA 2Y7RA 1OVBA 2H25A 1QULA 2ZMBA 2HZKA 3FXBA 4AB5A 2F6PA 1DBZA 1PBQA 3OENA 5H8HB 3K0VA 1Z7NE 2RC9A 2PCRA 1ZBMA 5ELVA 5ICQA 5LDZA 3LSLA 3ROJA 4GQOA 3BFUA 5AA1A 4XTCQ 2I3VA 4GBWA 4KI0E 2QS4A 2FBPA 3HHFA 1FPDA 5AA4B 3MAMA 3IB1A 4O3AA 5KDTA 1MS7A 4IO2A 2GHBA 4GWZA 2Q74A 1P99A 2UYEA 4QHQA 4YKJA 2XXQA 5IZ1A 2Z8FA 5I57B 2QS1A 3C32A 2OX3A 1EZPA 3DP8A 3ISPA 2VPNA 4U4SA 2QFLA 4MIJA 4ZEKA 2F34A 1XHYA 2XXTA 2WKYA 4F19A 3TQWA 4F3GA 2B3BA 1MG1A 2DE3A 1FTMA 1NNFA 3TODA 5H8FA 5TP9A 4ONYA 4GWWA 3RPLB 2HAVA 3K1PA 3PD8A 1UIVA 4QRZA 4N13A 1MXUA 4YU0A 5JK4A 4KCCA 4RNSA 1FPGA 1LB8A 5I59A 3N94A 3EHUA 1I6QA 5ET8A 2DWAA 5IKBA 3S9NC 2WYPA 1QVSA 1IQ7A 3TTMA 1FTKA 3CG1A 4F31B 1KWHA 1NV2A 1EYJA 3UIFA 2Q88A 1OLCA 1FPLA 4GFRA 1NNPA 3T66A 2HXRA 4XF5A 2DVZA 1RDZA 2Y7KA 3T9UA 4UACA 5AA2A 1URGA 4PGPA 4F1VA 2VP1A 5AE4A 3HN0A 1FPFA 3OELA 1PBPA 3RPWA 4PE5B 3WAEA 4X8RA 1LBWA 2Y5KA 1UTBA 1HSLA 3MZ1A 3G3GA 4N6PA 4GX4A 2R9JA 4NWCA 1CNQA 4OTEA 2NXOA 3SETA 4NF5A 1EZ9A 3SKPA 4Q5TA 2B3FA 2X26A 1MXXA 5H8HA 4U4XA 1SYHA 2CZKA 4NEDA 1TWYA 4YZZA 3T9XB 4KCDA 4OYVA 3OOAA 4R72A 1MPDA 4PDHA 2VT5A 2O69A 3BKIB 4H8JA 1AMFA 3THIA 4DXUA 3E3KA 2I49A 4ELPA 2XXWA 2CMOA 5L9SA 5DT6A 3JYRA 2WBBA 4U21A 3ILTB 4XEQA 1IMAA 3MQ9A 4ESXA 1POTA 2F6GA 4I8CA 1FQCA 3PUWE 3UK4A 1POY1 4ZECA 4ECFA 3MW0A 3ZS6A 1EYIA 3MYUA 4HE0A 2A5TA 3FD3A 4JB7A 2V3TA 3OSRA 5I5PA 4NF0A 2I4CA 4TOZA 1AH5A 3CHGA 3MUQA 2Y7PA 4UA8A 4IY6A 3TKDA 4ZEFA 5LOMA 4EUOA 3TYHA 1FRPA 3TUSA 4G68A 2XWIA 3FVNA 4OETA 4EQBA 4JWOA 1JVYA 3MVXA 3R6UA 4HXVA 4OVRA 1SQYA 3V89B 1ATGA 1KA1A 3T0JA 2UVHA 1LFIA 2B4MA 2REGA 3PU5A 4GWSA 5BWJA 1JEVA 3OO8A 1H45A 1PB9A 4G8HA 4ISUA 4DZ1A 1FBFA 5IZ3B 1I6AA 2Z22A 4O7MA 4BDOA 3VLVA 1IUDA 3BIHA 2V93A 1SW2A 5EYFA 1S50A 3QUJA 5ET7A 3ECRA 4QXDA 5I58B 5H8SA 3SEWA 3CRBA 2PT2A 5FTHA 3TQLA 1A99A 1MXZA 4DCXA 2VPOA 2RC8A 3IK6B 1LBCA 4LZ8A 3K6XA 1A40A 2QS3A 3EPEA 1N7WA 3PPNA 1GR2A 4ZEIA 3N6UA 4I3YA 1Y1MA 2VHAA 2WEFA 4M1VA 4FBPA 3TTLA 3TELA 2UVGA 3GBAA 3RNNA 2FA7A 2Y7WA 2DWIA 4H5FA 4N15A 2H5YA 4YICA 3O9PA 5J1DA 4X04A 3FVKA 4MF3A 1MY0A 4L17A 1MDQA 3QMFA 3C36A 3I6VA 3E78A 4FEDA 2FYIA 3PUVE 3VVFA 2DDKA 3CR9A 5I3SA 1INPA 4NG7A 5EYGA 3IB0A 3OSQA 1LGBC 4PAIA 1BKAA 2YPNA 2E1SA
chains in the Genus database with same CATH topology
4TLLB 1UTHB 3W9WA 1OMPA 3KN8A 3CFXA 1H76A 3K4UA 4Q8RA 2XXVA 3IOTA 5BUUA 4EF2A 4LQ5A 2XX9A 1R1NA 2O6AA 2NWJA 2VGQA 1L5TA 1DOTA 2Q8JA 4MLQA 1URDA 4QSCA 4F3PA 4NMYA 3TTRA 1N84A 4I62A 2AL4A 1MH4A 2VD3A 4KYDA 2RCAA 3H4ZA 4P0IA 5DEXB 2HQ0A 4PFTA 4F29A 3D4CA 2GFEA 4FORA 1GTKA 1OIBA 1B7UA 1USYE 1NMUA 5AA2D 3G3JA 3N5LA 5CM6A 2UVIA 4MFIA 5ISUA 4ND9A 3BBRA 3O66A 1LAXA 3FV2A 1FQEA 3MWBA 1N76A 2F97A 1F9BA 1Q35A 1FTJA 5KCJA 1PDAA 1B7ZA 4RPNA 1LB9A 2GHAA 3UGWA 2REJA 4FAJA 4YAHX 4KR5A 4LP2B 4KYSA 4GXSB 1B5IA 1O7TA 2DXYA 4YKKA 5M2VA 1QKAA 5H8QB 5I2NA 3PPQA 2O7IA 3PPRA 1B3EA 5CRYA 1SBPA 4MLVA 3IOUA 3QYTA 2DOJA 5CMCA 3G3FA 5JTYB 1XT8A 1ZMGA 4WKMA 2ZYNA 4HTGA 3PUXE 3TTKA 4U1ZA 1MQJA 2Q9TA 3KSXA 1ZIUA 3VLUA 3Q28A 2QRYA 3Q25A 5DVJA 5CMKA 3C35A 1D4NA 1P1QA 4GWOA 3R26A 1OLAA 4JSOA 4BLAA 3TEPA 2XX7A 3K1NA 4E0XA 3TFLA 1PB7A 3O2AA 2ZYKA 1VFEA 4QSEA 4ELRA 4ELQA 3M3LA 4BDLA 4F39A 3MZBA 4F1UA 3PGFA 4KPTA 4ZZEA 3A3UA 3TCFA 2UYFA 2UXAA 4GVOA 4OERA 3IJXB 1DSNA 3LBSA 3U93A 4EQ9A 4YKIA 2F8DA 3KZGA 2OLBA 1YTVA 4OEUA 2DQVA 3DELB 1Y9UA 3QSLA 3O6GA 2PMSA 3U8QA 5DEXA 1Y1ZA 3C31A 1OVTA 2OCUA 2Y84A 1P1WA 2HXWA 3VLWA 1CB6A 1FQBA 2QL3A 3FASA 1ZJLA 2DE2A 1JETA 3FJ7A 3EN3A 1OQGA 3F11A 3H03A 1MXWA 1IIWA 1MQHA 3FXQA 3IB2A 2XX8A 2PVUA 2Z8EA 4XKNA 4QFLA 3JV9A 1EU8A 1OQHA 4RXLA 1P1UA 3S9LC 4PFYA 1DTGA 4EDPA 3TZAA 5F7VA 4OFOA 4M4GA 3O6IA 5I56A 2OWTA 3CFZA 3N6TA 4OXVA 2XXIA 4RK9A 1M5FA 3FVGA 3K6UA 3G7WA 2PYYA 4YKPA 3IO6A 1VE4A 3CSGA 4BDRA 4RPOA 4PQJA 2DWJA 4FIMA 1FTOA 1JVXA 1ZLQA 1QJMA 1B46A 3FVOA 5TPAA 3JZJA 4KYEA 4WEPA 3RT8A 3PPOA 4PFUA 3DLNA 5HBCA 4NF6B 2B65A 2V3QA 1R6ZA 4G77A 4OVJA 1N04A 1UQWA 4H67A 1FQFA 5DTBA 3PMXA 4IY5A 1II5A 2IA4A 1Y4TA 3U92A 5A5XB 3QAXA 3OMBA 2XD3A 4KQPA 1FQDA 3S9EA 1IEJA 3IJOB 4JWXA 4C0RA 3H6TA 5H8NB 4OZ9A 4JWYA 4DXCA 2RINA 3E9XA 2M8CA 3D4GA 3DP6A 4JDFA 1YCJA 1MXYA 2DP8A 4IO5A 4OQOA 4F2QA 5EHSA 2HCAA 3IO4A 2V84A 2ABHA 5AA4A 2R71A 2QJEA 5DYHA 3VDFA 1XVXA 1JQFA 3TPAA 3V8XB 5I57A 2HFBA 2D21A 4IO4A 4WEDA 4OWDA 1D9YA 4IGTA 3DM0A 2QMWA 2V3UA 4TLMB 2H9BA 1MM6A 3QIMA 3MP1A 4R6YA 2ALUA 1A54A 4QSDA 3OEMA 1B40A 1B2HA 2OBGA 3LSFB 4JXIA 1R9LA 3L6HA 1LAFE 1B9JA 3UN6A 4I9DA 4X1DA 2UVJA 3K6WA 4BDNA 1Y20A 1H3DA 5K2XA 3MVWA 4U2RA 1SW4A 1QUKA 3PUZE 3T9VA 2RCBA 2GH9A 1NFTA 1S7YA 1SVXB 2G93A 4F3BA 2Z8DA 4ZEBA 4R6HA 4TQUQ 2XHDA 2A5SA 5I2KB 3IOVA 4GF8A 4GXAA 3PUYE 3P7IA 4R9FA 1XS5A 2OK2A 2HAUA 3A09A 1QUJA 1B52A 4N07A 1VR5A 5EHMA 4OFLA 1B3HA 4EXKA 1M5BA 4F18A 3PV0E 3O28A 3KSJA 4P0GA 4ZZAA 1RYXA 1BTJA 1O64A 1SI1A 4IO7A 3RQTA 1MM7A 4AB6A 2Y7IA 2O68A 4XIGQ 3TAJA 1JW4A 1SI0A 4BDMA 4POWA 1NH7A 3H6UA 3W15C 4I1DA 3ONMA 3K1MA 4R75A 2O1MA 1MQGA 1VSOA 1MY3A 3SEYA 4ZS9A 1MDP1 2XXYA 4GL8A 1BP5A 2I3WA 3MZ9A 1LSTA 3VXBA 4ESWA 4DIGA 4LZ7A 4QFPA 3SEUA 5CI5A 1QW0A 2I48A 2DSFA 4X48A 2Z23A 4E0WA 3MVYA 1A55A 2I0CA 1B1XA 2AYSA 3S2VA 1Y3PA 2DS9A 3HHGA 2Q89A 4C1TA 3R7XA 1FCKA 5B7DA 3SDFA 1MQDA 3CG3A 4H8IA 3CIJA 3TTNA 4OEVA 4G68C 4HW8A 1IXHA 5JEIA 3L6GA 4IGRA 3I5OA 4X1BA 2P0SA 2OWSA 1IZ1A 4AQ4A 3G3KA 3M8UA 3EHTA 1TXFA 2D3IA 1WVJA 5KDTB 4EXLA 2CZLA 4PP0A 4QF9A 1JW5A 5I58A 1Z7ME 4YMAA 1IXGA 4OENA 2QMXA 3RY3A 3UP9A 4YB7A 1QUIA 1Y3QA 4KD5A 4R9GA 1YPNA 3RTWB 3KN3A 3U72A 4H5GA 4LUBA 5H8FB 2F7CA 1A8EA 5TP9B 5CBSA 2FNCA 2X7QA 5CMMA 3VVDA 3ILUB 1MY4A 4GOTA 4F3SA 5K2YA 4FATA 4GL0A 4YB5A 3H6WA 1B5JA 4XKPA 1XOCA 1B32A 3A3CA 3T96B 1HSEA 4NWDA 3KJ7A 1NNTA 4JBZA 1FQAA 4NTLA 4RA1A 2P2AA 3W9VA 2I4BA 2DVCA 5ICTA 3VE1B 5HPQA 1EH3A 3IAZA 1MY2A 4WXJA 1PEBA 3LSWA 1UTHA 3K01A 3FATA 2YJPA 3Q29A 2XXUA 3TDJA 5AA2B 2I58A 3S4UA 3WAFA 3FJMA 1JEUA 1VFDA 3B6TA 1B3GA 2VOZA 3S9MC 1TT1A 1AIVA 3AXFA 5FHOA 1UTBB 2G29A 4ZE8A 4JSDA 3C33A 2HZLA 1IITA 4NF5B 1EZOA 4OFJA 1AOVA 2BJJX 5ITOA 3T9HB 2H4IA 4PETA 4RK2A 1JW1A 1Q1KA 1DTZA 4EF1A 5FHNA 3KEIA 3U94A 1I6BA 4QFOA 2PX1A 3VV5A 3TMGA 1UIUA 1A7LA 2AL5A 1LAGE 2RF1A 1ZTYA 1LAHE 4LATA 4NF4B 1HSJA 1B7HA 1PC3A 4IO6A 1LFHA 1S9TA 4U22A 3EHSA 5H8QA 4XKQA 2Q2CA 4XXUA 2P1SA 2XD2A 2QSXA 2F78A 3ZKLA 4U23A 2A5TB 1QKBA 1FW0A 5JTYA 3HCQA 3H06B 5KZTA 3GLBA 1MH3A 4Q30B 3CFLA 4ZEDA 4IO3A 3V83A 1N3XA 1IXCA 1AL3A 4HS7A 3VFJA 2XXRA 4G68B 2F35A 2ONSA 1ANFA 2D5WA 1US4A 3IR1A 2ZYOA 3GZGA 4U1OA 3QUFA 3B6QA 2E0SA 3OO7A 3HO7A 3FXUA 1R9QA 4EQ7A 4RYAA 1ELJA 4X9TA 3LSXA 3ZKKA 5CC2A 2V25A 2XXPA 1GV8A 4LVQA 2H98A 3B7DA 5TU0A 4DDDA 4NF8B 3MC2A 4OMBA 3PMVA 1M5EA 1URSA 1MRPA 2ONRA 3M3KA 2ANJA 3MP6A 5FHMA 3IORA 3EF7A 1DPEA 3G3HA 2F5XA 3OO9A 4G8MA 1WDNA 2ZYMA 4NE4A 4KFQA 1N3WA 1XC1A 1M5CA 2ZXTA 3QXMA 1CE2A 3FZVA 2I6EA 4F1YA 1Y3NA 3K2DA 4R74A 3Q26A 3ZSFA 1MPCA 3C34A 1NL5A 1B51A 1MY1A 3CSBA 1B4ZA 1LCFA 1P1OA 2R6GE 4GLIA 2ESNA 5DVFA 1XVYA 3HSTA 3IX1A 3KG2A 3KOSA 1TFAA 3MVZA 4DE8A 4NF4A 3TCGA 3LUYA 1B0HA 3RT6B 1N0TA 2VD2A 2PBWA 1RKMA 1N7XA 4LONB 3T93B 2QPQA 3FIRA 3QK6A 3KGCA 3FXRA 4YB6A 3K00A 3EQ1A 4Q0CA 2O7UA 5CBRA 4HCYA 4ZE9A 1B1HA 3PMWA 3U1OA 3E13X 2NVUB 4R2BA 4GD5A 3MP8A 3OXNA 4H1XA 3VVEA 2X7PA 1BIYA 1NH8A 2YLNA 2F7AA 2DXRA 1A8FA 4H65A 3LC8A 5KCJB 5FTIA 4YMBA 2OZZA 3V5AA 2AIXA 3Q27A 4NF6A 4P11A 3UA8A 3FJGA 3HV1A 5I2NB 3B6WA 3TCHA 3KN7A 3M3FA 1J1NA 4NF8A 4RJZA 2NOOA 1US5A 4H6DA 2RKMA 3I3VA 3OD7A 5A5XA 3FUZA 5B70A 4C1UA 3VXCA 4R2FA 5DVIA 3MBPA 4DXBA 4LA9A 3GBBA 4DLDA 1NNKA 2DYXA 1JNFA 2XXXA 1SW1A 1MXVA 1LFGA 4FE8A 4BDQA 5H8NA 4G4PA 4OHNA 2DWHA 4OESA 4F2OA 1MQIA 1D3KA 4QFKA 2RC7A 2O51A 3OEKA 5L9OA 3C4MA 4QFNA 3K02A 4FEBA 4R6KA 4FJPA 5CMBA 3H7MA 1I69A 1B0LA 1NKXA 3FGSA 4G2ZA 5L9MA 4POXA 3IOWA 5ITPA 3RN8A 1B05A 5L8DA 2F36A 1B5HA 4K3FA 3MJNA 4MBPA 3RGYA 2OJTA 4XKRA 1H44A 3H3GA 4RY1A 1DPPA 1SD3A 4LQ2A 3FV1A 3CI8A 3GXAA 3SESA 1WODA 4ZDMA 4Z7EA 4H0WA 3K6VA 3N26A 2IEEA 5F1QA 5I84A 2GRVA 1FTLA 3T22A 1B4HA 3SEVA 3E4RA 3PPPA 3IL1B 2F7BA 1LCTA 3KOTA 2I0BA 1H43A 3O97A 1RYOA 1GVCA 2O84X 1TFDA 1USYH 4PFWA 1D9VA 1DMBA 4DCYA 3RLFE 3KJTA 2Q2AA 3ODBA 4F22A 5I2KA 1P1NA 2ZNUA 1SYIA 3OO6A 3PD9A 2DE4A 1O63A 3CVGA 3H6VA 3O6HA 4HCWA 3C9HA 3MPLA 1T0KA 3LR1A 2W7YA 3KBRA 5AA3A 4ELOA 4FECA 5I56B 1ZU0A 1SDXA 3HPIA 2PT1A 3RTFB 1SW5A 2H99A 5I59B 2KLFA 1YAEA 3SERA 2ZNTA 2NUVA 1PB8A 4GRKA 4G8NA 4KHZE 5IAIA 2THIA 3SEXA 4THIA 3UORA 1LBBA 3O29A 3RUMA 1IXIA 3MPKA 1LLSA 4MH5A 1M5DA 2QS2A 2O1LA 4R73A 5TPAB 1GGGA 1ZKBA 2XXHA 4Z0IA 4GIZA 4IB2A 5HM4B 4LZ5A 4O3BA 3DP4A 3USDA 1Y4CA 1MPBA 2ZNSA 3G3IA 3KFMA 4O3CA 1B6HA 1B58A 1B3LA 2ONKE 1BLFA 2HEUA 1B3FA 2LAOA 3BFTA 2Y7RA 1OVBA 2H25A 1QULA 2ZMBA 2HZKA 4AB5A 2F6PA 1PBQA 3OENA 5H8HB 3K0VA 1Z7NE 2RC9A 1ZBMA 5ELVA 5ICQA 3LSLA 4GQOA 3BFUA 5AA1A 4XTCQ 2I3VA 4KI0E 2QS4A 3HHFA 5AA4B 3MAMA 3IB1A 4O3AA 5KDTA 1MS7A 4IO2A 2GHBA 1P99A 2UYEA 4QHQA 4YKJA 2XXQA 2Z8FA 5I57B 2QS1A 3C32A 1EZPA 3DP8A 4U4SA 4ZEKA 2F34A 1XHYA 2XXTA 2WKYA 4F19A 3TQWA 4F3GA 2B3BA 1MG1A 2DE3A 1FTMA 1NNFA 3TODA 5H8FA 5TP9A 4ONYA 2HAVA 3K1PA 3PD8A 1UIVA 4QRZA 4N13A 1MXUA 4YU0A 5JK4A 4KCCA 4RNSA 1LB8A 5I59A 3N94A 3EHUA 1I6QA 2DWAA 5IKBA 3S9NC 1QVSA 1IQ7A 3TTMA 1FTKA 3CG1A 4F31B 1KWHA 3UIFA 2Q88A 1OLCA 4GFRA 1NNPA 3T66A 2DVZA 2Y7KA 3T9UA 4UACA 5AA2A 1URGA 4F1VA 2VP1A 5AE4A 3HN0A 3OELA 1PBPA 3RPWA 4PE5B 3WAEA 1UTBA 1HSLA 3MZ1A 3G3GA 4N6PA 2R9JA 4NWCA 4OTEA 2NXOA 3SETA 4NF5A 1EZ9A 3SKPA 4Q5TA 2B3FA 2X26A 1MXXA 5H8HA 4U4XA 1SYHA 4NEDA 1TWYA 4YZZA 3T9XB 4KCDA 4OYVA 3OOAA 4R72A 1MPDA 2O69A 3BKIB 4H8JA 1AMFA 3THIA 4DXUA 3E3KA 2I49A 4ELPA 2XXWA 2CMOA 5L9SA 5DT6A 3JYRA 4U21A 3ILTB 3MQ9A 4ESXA 1POTA 2F6GA 4I8CA 1FQCA 3PUWE 3UK4A 1POY1 4ZECA 4ECFA 3MW0A 3ZS6A 2A5TA 3FD3A 4JB7A 2V3TA 3OSRA 2I4CA 4TOZA 1AH5A 3MUQA 2Y7PA 4UA8A 4IY6A 3TKDA 4ZEFA 5LOMA 4EUOA 3TYHA 3TUSA 4G68A 3FVNA 4OETA 4EQBA 4JWOA 1JVYA 3MVXA 3R6UA 1SQYA 3V89B 1ATGA 2UVHA 1LFIA 2REGA 3PU5A 5BWJA 1JEVA 3OO8A 1H45A 1PB9A 4G8HA 4ISUA 4DZ1A 1I6AA 2Z22A 4BDOA 3VLVA 1IUDA 2V93A 1SW2A 5EYFA 1S50A 3QUJA 3ECRA 5I58B 5H8SA 3SEWA 3CRBA 2PT2A 5FTHA 3TQLA 1A99A 1MXZA 4DCXA 2RC8A 3IK6B 1LBCA 4LZ8A 3K6XA 1A40A 2QS3A 3EPEA 1N7WA 3PPNA 1GR2A 4ZEIA 3N6UA 1Y1MA 2VHAA 4M1VA 3TTLA 3TELA 2UVGA 3GBAA 3RNNA 2FA7A 2Y7WA 2DWIA 4H5FA 2H5YA 4YICA 3O9PA 5J1DA 3FVKA 4MF3A 1MY0A 4L17A 1MDQA 3C36A 3I6VA 4FEDA 2FYIA 3PUVE 3VVFA 3CR9A 3IB0A 3OSQA 1LGBC 1BKAA 2YPNA 2E1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TLL B;  1UTH B;  3W9W A;  1OMP A;  3KN8 A;  3CFX A;  1H76 A;  3K4U A;  4Q8R A;  2XXV A;  3IOT A;  5BUU A;  4EF2 A;  4LQ5 A;  2XX9 A;  1R1N A;  2O6A A;  2NWJ A;  2VGQ A;  1L5T A;  1DOT A;  2Q8J A;  4MLQ A;  1URD A;  4QSC A;  4F3P A;  4NMY A;  3TTR A;  1N84 A;  4I62 A;  2AL4 A;  1MH4 A;  2VD3 A;  4KYD A;  2RCA A;  3H4Z A;  4P0I A;  5DEX B;  2HQ0 A;  4PFT A;  4F29 A;  3D4C A;  2GFE A;  4FOR A;  1GTK A;  1OIB A;  1B7U A;  1USY E;  1NMU A;  5AA2 D;  3G3J A;  3N5L A;  5CM6 A;  2UVI A;  4MFI A;  5ISU A;  4ND9 A;  3BBR A;  3O66 A;  1LAX A;  3FV2 A;  1FQE A;  3MWB A;  1N76 A;  2F97 A;  1F9B A;  1Q35 A;  1FTJ A;  5KCJ A;  1PDA A;  1B7Z A;  4RPN A;  1LB9 A;  2GHA A;  3UGW A;  2REJ A;  4FAJ A;  4YAH X;  4KR5 A;  4LP2 B;  4KYS A;  4GXS B;  1B5I A;  1O7T A;  2DXY A;  4YKK A;  5M2V A;  1QKA A;  5H8Q B;  5I2N A;  3PPQ A;  2O7I A;  3PPR A;  1B3E A;  5CRY A;  1SBP A;  4MLV A;  3IOU A;  3QYT A;  2DOJ A;  5CMC A;  3G3F A;  5JTY B;  1XT8 A;  1ZMG A;  4WKM A;  2ZYN A;  4HTG A;  3PUX E;  3TTK A;  4U1Z A;  1MQJ A;  2Q9T A;  3KSX A;  1ZIU A;  3VLU A;  3Q28 A;  2QRY A;  3Q25 A;  5DVJ A;  5CMK A;  3C35 A;  1D4N A;  1P1Q A;  4GWO A;  3R26 A;  1OLA A;  4JSO A;  4BLA A;  3TEP A;  2XX7 A;  3K1N A;  4E0X A;  3TFL A;  1PB7 A;  3O2A A;  2ZYK A;  1VFE A;  4QSE A;  4ELR A;  4ELQ A;  3M3L A;  4BDL A;  4F39 A;  3MZB A;  4F1U A;  3PGF A;  4KPT A;  4ZZE A;  3A3U A;  3TCF A;  2UYF A;  2UXA A;  4GVO A;  4OER A;  3IJX B;  1DSN A;  3LBS A;  3U93 A;  4EQ9 A;  4YKI A;  2F8D A;  3KZG A;  2OLB A;  1YTV A;  4OEU A;  2DQV A;  3DEL B;  1Y9U A;  3QSL A;  3O6G A;  2PMS A;  3U8Q A;  5DEX A;  1Y1Z A;  3C31 A;  1OVT A;  2OCU A;  2Y84 A;  1P1W A;  2HXW A;  3VLW A;  1CB6 A;  1FQB A;  2QL3 A;  3FAS A;  1ZJL A;  2DE2 A;  1JET A;  3FJ7 A;  3EN3 A;  1OQG A;  3F11 A;  3H03 A;  1MXW A;  1IIW A;  1MQH A;  3FXQ A;  3IB2 A;  2XX8 A;  2PVU A;  2Z8E A;  4XKN A;  4QFL A;  3JV9 A;  1EU8 A;  1OQH A;  4RXL A;  1P1U A;  3S9L C;  4PFY A;  1DTG A;  4EDP A;  3TZA A;  5F7V A;  4OFO A;  4M4G A;  3O6I A;  5I56 A;  2OWT A;  3CFZ A;  3N6T A;  4OXV A;  2XXI A;  4RK9 A;  1M5F A;  3FVG A;  3K6U A;  3G7W A;  2PYY A;  4YKP A;  3IO6 A;  1VE4 A;  3CSG A;  4BDR A;  4RPO A;  4PQJ A;  2DWJ A;  4FIM A;  1FTO A;  1JVX A;  1ZLQ A;  1QJM A;  1B46 A;  3FVO A;  5TPA A;  3JZJ A;  4KYE A;  4WEP A;  3RT8 A;  3PPO A;  4PFU A;  3DLN A;  5HBC A;  4NF6 B;  2B65 A;  2V3Q A;  1R6Z A;  4G77 A;  4OVJ A;  1N04 A;  1UQW A;  4H67 A;  1FQF A;  5DTB A;  3PMX A;  4IY5 A;  1II5 A;  2IA4 A;  1Y4T A;  3U92 A;  5A5X B;  3QAX A;  3OMB A;  2XD3 A;  4KQP A;  1FQD A;  3S9E A;  1IEJ A;  3IJO B;  4JWX A;  4C0R A;  3H6T A;  5H8N B;  4OZ9 A;  4JWY A;  4DXC A;  2RIN A;  3E9X A;  2M8C A;  3D4G A;  3DP6 A;  4JDF A;  1YCJ A;  1MXY A;  2DP8 A;  4IO5 A;  4OQO A;  4F2Q A;  5EHS A;  2HCA A;  3IO4 A;  2V84 A;  2ABH A;  5AA4 A;  2R71 A;  2QJE A;  5DYH A;  3VDF A;  1XVX A;  1JQF A;  3TPA A;  3V8X B;  5I57 A;  2HFB A;  2D21 A;  4IO4 A;  4WED A;  4OWD A;  1D9Y A;  4IGT A;  3DM0 A;  2QMW A;  2V3U A;  4TLM B;  2H9B A;  1MM6 A;  3QIM A;  3MP1 A;  4R6Y A;  2ALU A;  1A54 A;  4QSD A;  3OEM A;  1B40 A;  1B2H A;  2OBG A;  3LSF B;  4JXI A;  1R9L A;  3L6H A;  1LAF E;  1B9J A;  3UN6 A;  4I9D A;  4X1D A;  2UVJ A;  3K6W A;  4BDN A;  1Y20 A;  1H3D A;  5K2X A;  3MVW A;  4U2R A;  1SW4 A;  1QUK A;  3PUZ E;  3T9V A;  2RCB A;  2GH9 A;  1NFT A;  1S7Y A;  1SVX B;  2G93 A;  4F3B A;  2Z8D A;  4ZEB A;  4R6H A;  4TQU Q;  2XHD A;  2A5S A;  5I2K B;  3IOV A;  4GF8 A;  4GXA A;  3PUY E;  3P7I A;  4R9F A;  1XS5 A;  2OK2 A;  2HAU A;  3A09 A;  1QUJ A;  1B52 A;  4N07 A;  1VR5 A;  5EHM A;  4OFL A;  1B3H A;  4EXK A;  1M5B A;  4F18 A;  3PV0 E;  3O28 A;  3KSJ A;  4P0G A;  4ZZA A;  1RYX A;  1BTJ A;  1O64 A;  1SI1 A;  4IO7 A;  3RQT A;  1MM7 A;  4AB6 A;  2Y7I A;  2O68 A;  4XIG Q;  3TAJ A;  1JW4 A;  1SI0 A;  4BDM A;  4POW A;  1NH7 A;  3H6U A;  3W15 C;  4I1D A;  3ONM A;  3K1M A;  4R75 A;  2O1M A;  1MQG A;  1VSO A;  1MY3 A;  3SEY A;  4ZS9 A;  1MDP 1;  2XXY A;  4GL8 A;  1BP5 A;  2I3W A;  3MZ9 A;  1LST A;  3VXB A;  4ESW A;  4DIG A;  4LZ7 A;  4QFP A;  3SEU A;  5CI5 A;  1QW0 A;  2I48 A;  2DSF A;  4X48 A;  2Z23 A;  4E0W A;  3MVY A;  1A55 A;  2I0C A;  1B1X A;  2AYS A;  3S2V A;  1Y3P A;  2DS9 A;  3HHG A;  2Q89 A;  4C1T A;  3R7X A;  1FCK A;  5B7D A;  3SDF A;  1MQD A;  3CG3 A;  4H8I A;  3CIJ A;  3TTN A;  4OEV A;  4G68 C;  4HW8 A;  1IXH A;  5JEI A;  3L6G A;  4IGR A;  3I5O A;  4X1B A;  2P0S A;  2OWS A;  1IZ1 A;  4AQ4 A;  3G3K A;  3M8U A;  3EHT A;  1TXF A;  2D3I A;  1WVJ A;  5KDT B;  4EXL A;  2CZL A;  4PP0 A;  4QF9 A;  1JW5 A;  5I58 A;  1Z7M E;  4YMA A;  1IXG A;  4OEN A;  2QMX A;  3RY3 A;  3UP9 A;  4YB7 A;  1QUI A;  1Y3Q A;  4KD5 A;  4R9G A;  1YPN A;  3RTW B;  3KN3 A;  3U72 A;  4H5G A;  4LUB A;  5H8F B;  2F7C A;  1A8E A;  5TP9 B;  5CBS A;  2FNC A;  2X7Q A;  5CMM A;  3VVD A;  3ILU B;  1MY4 A;  4GOT A;  4F3S A;  5K2Y A;  4FAT A;  4GL0 A;  4YB5 A;  3H6W A;  1B5J A;  4XKP A;  1XOC A;  1B32 A;  3A3C A;  3T96 B;  1HSE A;  4NWD A;  3KJ7 A;  1NNT A;  4JBZ A;  1FQA A;  4NTL A;  4RA1 A;  2P2A A;  3W9V A;  2I4B A;  2DVC A;  5ICT A;  3VE1 B;  5HPQ A;  1EH3 A;  3IAZ A;  1MY2 A;  4WXJ A;  1PEB A;  3LSW A;  1UTH A;  3K01 A;  3FAT A;  2YJP A;  3Q29 A;  2XXU A;  3TDJ A;  5AA2 B;  2I58 A;  3S4U A;  3WAF A;  3FJM A;  1JEU A;  1VFD A;  3B6T A;  1B3G A;  2VOZ A;  3S9M C;  1TT1 A;  1AIV A;  3AXF A;  5FHO A;  1UTB B;  2G29 A;  4ZE8 A;  4JSD A;  3C33 A;  2HZL A;  1IIT A;  4NF5 B;  1EZO A;  4OFJ A;  1AOV A;  2BJJ X;  5ITO A;  3T9H B;  2H4I A;  4PET A;  4RK2 A;  1JW1 A;  1Q1K A;  1DTZ A;  4EF1 A;  5FHN A;  3KEI A;  3U94 A;  1I6B A;  4QFO A;  2PX1 A;  3VV5 A;  3TMG A;  1UIU A;  1A7L A;  2AL5 A;  1LAG E;  2RF1 A;  1ZTY A;  1LAH E;  4LAT A;  4NF4 B;  1HSJ A;  1B7H A;  1PC3 A;  4IO6 A;  1LFH A;  1S9T A;  4U22 A;  3EHS A;  5H8Q A;  4XKQ A;  2Q2C A;  4XXU A;  2P1S A;  2XD2 A;  2QSX A;  2F78 A;  3ZKL A;  4U23 A;  2A5T B;  1QKB A;  1FW0 A;  5JTY A;  3HCQ A;  3H06 B;  5KZT A;  3GLB A;  1MH3 A;  4Q30 B;  3CFL A;  4ZED A;  4IO3 A;  3V83 A;  1N3X A;  1IXC A;  1AL3 A;  4HS7 A;  3VFJ A;  2XXR A;  4G68 B;  2F35 A;  2ONS A;  1ANF A;  2D5W A;  1US4 A;  3IR1 A;  2ZYO A;  3GZG A;  4U1O A;  3QUF A;  3B6Q A;  2E0S A;  3OO7 A;  3HO7 A;  3FXU A;  1R9Q A;  4EQ7 A;  4RYA A;  1ELJ A;  4X9T A;  3LSX A;  3ZKK A;  5CC2 A;  2V25 A;  2XXP A;  1GV8 A;  4LVQ A;  2H98 A;  3B7D A;  5TU0 A;  4DDD A;  4NF8 B;  3MC2 A;  4OMB A;  3PMV A;  1M5E A;  1URS A;  1MRP A;  2ONR A;  3M3K A;  2ANJ A;  3MP6 A;  5FHM A;  3IOR A;  3EF7 A;  1DPE A;  3G3H A;  2F5X A;  3OO9 A;  4G8M A;  1WDN A;  2ZYM A;  4NE4 A;  4KFQ A;  1N3W A;  1XC1 A;  1M5C A;  2ZXT A;  3QXM A;  1CE2 A;  3FZV A;  2I6E A;  4F1Y A;  1Y3N A;  3K2D A;  4R74 A;  3Q26 A;  3ZSF A;  1MPC A;  3C34 A;  1NL5 A;  1B51 A;  1MY1 A;  3CSB A;  1B4Z A;  1LCF A;  1P1O A;  2R6G E;  4GLI A;  2ESN A;  5DVF A;  1XVY A;  3HST A;  3IX1 A;  3KG2 A;  3KOS A;  1TFA A;  3MVZ A;  4DE8 A;  4NF4 A;  3TCG A;  3LUY A;  1B0H A;  3RT6 B;  1N0T A;  2VD2 A;  2PBW A;  1RKM A;  1N7X A;  4LON B;  3T93 B;  2QPQ A;  3FIR A;  3QK6 A;  3KGC A;  3FXR A;  4YB6 A;  3K00 A;  3EQ1 A;  4Q0C A;  2O7U A;  5CBR A;  4HCY A;  4ZE9 A;  1B1H A;  3PMW A;  3U1O A;  3E13 X;  2NVU B;  4R2B A;  4GD5 A;  3MP8 A;  3OXN A;  4H1X A;  3VVE A;  2X7P A;  1BIY A;  1NH8 A;  2YLN A;  2F7A A;  2DXR A;  1A8F A;  4H65 A;  3LC8 A;  5KCJ B;  5FTI A;  4YMB A;  2OZZ A;  3V5A A;  2AIX A;  3Q27 A;  4NF6 A;  4P11 A;  3UA8 A;  3FJG A;  3HV1 A;  5I2N B;  3B6W A;  3TCH A;  3KN7 A;  3M3F A;  1J1N A;  4NF8 A;  4RJZ A;  2NOO A;  1US5 A;  4H6D A;  2RKM A;  3I3V A;  3OD7 A;  5A5X A;  3FUZ A;  5B70 A;  4C1U A;  3VXC A;  4R2F A;  5DVI A;  3MBP A;  4DXB A;  4LA9 A;  3GBB A;  4DLD A;  1NNK A;  2DYX A;  1JNF A;  2XXX A;  1SW1 A;  1MXV A;  1LFG A;  4FE8 A;  4BDQ A;  5H8N A;  4G4P A;  4OHN A;  2DWH A;  4OES A;  4F2O A;  1MQI A;  1D3K A;  4QFK A;  2RC7 A;  2O51 A;  3OEK A;  5L9O A;  3C4M A;  4QFN A;  3K02 A;  4FEB A;  4R6K A;  4FJP A;  5CMB A;  3H7M A;  1I69 A;  1B0L A;  1NKX A;  3FGS A;  4G2Z A;  5L9M A;  4POX A;  3IOW A;  5ITP A;  3RN8 A;  1B05 A;  5L8D A;  2F36 A;  1B5H A;  4K3F A;  3MJN A;  4MBP A;  3RGY A;  2OJT A;  4XKR A;  1H44 A;  3H3G A;  4RY1 A;  1DPP A;  1SD3 A;  4LQ2 A;  3FV1 A;  3CI8 A;  3GXA A;  3SES A;  1WOD A;  4ZDM A;  4Z7E A;  4H0W A;  3K6V A;  3N26 A;  2IEE A;  5F1Q A;  5I84 A;  2GRV A;  1FTL A;  3T22 A;  1B4H A;  3SEV A;  3E4R A;  3PPP A;  3IL1 B;  2F7B A;  1LCT A;  3KOT A;  2I0B A;  1H43 A;  3O97 A;  1RYO A;  1GVC A;  2O84 X;  1TFD A;  1USY H;  4PFW A;  1D9V A;  1DMB A;  4DCY A;  3RLF E;  3KJT A;  2Q2A A;  3ODB A;  4F22 A;  5I2K A;  1P1N A;  2ZNU A;  1SYI A;  3OO6 A;  3PD9 A;  2DE4 A;  1O63 A;  3CVG A;  3H6V A;  3O6H A;  4HCW A;  3C9H A;  3MPL A;  1T0K A;  3LR1 A;  2W7Y A;  3KBR A;  5AA3 A;  4ELO A;  4FEC A;  5I56 B;  1ZU0 A;  1SDX A;  3HPI A;  2PT1 A;  3RTF B;  1SW5 A;  2H99 A;  5I59 B;  2KLF A;  1YAE A;  3SER A;  2ZNT A;  2NUV A;  1PB8 A;  4GRK A;  4G8N A;  4KHZ E;  5IAI A;  2THI A;  3SEX A;  4THI A;  3UOR A;  1LBB A;  3O29 A;  3RUM A;  1IXI A;  3MPK A;  1LLS A;  4MH5 A;  1M5D A;  2QS2 A;  2O1L A;  4R73 A;  5TPA B;  1GGG A;  1ZKB A;  2XXH A;  4Z0I A;  4GIZ A;  4IB2 A;  5HM4 B;  4LZ5 A;  4O3B A;  3DP4 A;  3USD A;  1Y4C A;  1MPB A;  2ZNS A;  3G3I A;  3KFM A;  4O3C A;  1B6H A;  1B58 A;  1B3L A;  2ONK E;  1BLF A;  2HEU A;  1B3F A;  2LAO A;  3BFT A;  2Y7R A;  1OVB A;  2H25 A;  1QUL A;  2ZMB A;  2HZK A;  4AB5 A;  2F6P A;  1PBQ A;  3OEN A;  5H8H B;  3K0V A;  1Z7N E;  2RC9 A;  1ZBM A;  5ELV A;  5ICQ A;  3LSL A;  4GQO A;  3BFU A;  5AA1 A;  4XTC Q;  2I3V A;  4KI0 E;  2QS4 A;  3HHF A;  5AA4 B;  3MAM A;  3IB1 A;  4O3A A;  5KDT A;  1MS7 A;  4IO2 A;  2GHB A;  1P99 A;  2UYE A;  4QHQ A;  4YKJ A;  2XXQ A;  2Z8F A;  5I57 B;  2QS1 A;  3C32 A;  1EZP A;  3DP8 A;  4U4S A;  4ZEK A;  2F34 A;  1XHY A;  2XXT A;  2WKY A;  4F19 A;  3TQW A;  4F3G A;  2B3B A;  1MG1 A;  2DE3 A;  1FTM A;  1NNF A;  3TOD A;  5H8F A;  5TP9 A;  4ONY A;  2HAV A;  3K1P A;  3PD8 A;  1UIV A;  4QRZ A;  4N13 A;  1MXU A;  4YU0 A;  5JK4 A;  4KCC A;  4RNS A;  1LB8 A;  5I59 A;  3N94 A;  3EHU A;  1I6Q A;  2DWA A;  5IKB A;  3S9N C;  1QVS A;  1IQ7 A;  3TTM A;  1FTK A;  3CG1 A;  4F31 B;  1KWH A;  3UIF A;  2Q88 A;  1OLC A;  4GFR A;  1NNP A;  3T66 A;  2DVZ A;  2Y7K A;  3T9U A;  4UAC A;  5AA2 A;  1URG A;  4F1V A;  2VP1 A;  5AE4 A;  3HN0 A;  3OEL A;  1PBP A;  3RPW A;  4PE5 B;  3WAE A;  1UTB A;  1HSL A;  3MZ1 A;  3G3G A;  4N6P A;  2R9J A;  4NWC A;  4OTE A;  2NXO A;  3SET A;  4NF5 A;  1EZ9 A;  3SKP A;  4Q5T A;  2B3F A;  2X26 A;  1MXX A;  5H8H A;  4U4X A;  1SYH A;  4NED A;  1TWY A;  4YZZ A;  3T9X B;  4KCD A;  4OYV A;  3OOA A;  4R72 A;  1MPD A;  2O69 A;  3BKI B;  4H8J A;  1AMF A;  3THI A;  4DXU A;  3E3K A;  2I49 A;  4ELP A;  2XXW A;  2CMO A;  5L9S A;  5DT6 A;  3JYR A;  4U21 A;  3ILT B;  3MQ9 A;  4ESX A;  1POT A;  2F6G A;  4I8C A;  1FQC A;  3PUW E;  3UK4 A;  1POY 1;  4ZEC A;  4ECF A;  3MW0 A;  3ZS6 A;  2A5T A;  3FD3 A;  4JB7 A;  2V3T A;  3OSR A;  2I4C A;  4TOZ A;  1AH5 A;  3MUQ A;  2Y7P A;  4UA8 A;  4IY6 A;  3TKD A;  4ZEF A;  5LOM A;  4EUO A;  3TYH A;  3TUS A;  4G68 A;  3FVN A;  4OET A;  4EQB A;  4JWO A;  1JVY A;  3MVX A;  3R6U A;  1SQY A;  3V89 B;  1ATG A;  2UVH A;  1LFI A;  2REG A;  3PU5 A;  5BWJ A;  1JEV A;  3OO8 A;  1H45 A;  1PB9 A;  4G8H A;  4ISU A;  4DZ1 A;  1I6A A;  2Z22 A;  4BDO A;  3VLV A;  1IUD A;  2V93 A;  1SW2 A;  5EYF A;  1S50 A;  3QUJ A;  3ECR A;  5I58 B;  5H8S A;  3SEW A;  3CRB A;  2PT2 A;  5FTH A;  3TQL A;  1A99 A;  1MXZ A;  4DCX A;  2RC8 A;  3IK6 B;  1LBC A;  4LZ8 A;  3K6X A;  1A40 A;  2QS3 A;  3EPE A;  1N7W A;  3PPN A;  1GR2 A;  4ZEI A;  3N6U A;  1Y1M A;  2VHA A;  4M1V A;  3TTL A;  3TEL A;  2UVG A;  3GBA A;  3RNN A;  2FA7 A;  2Y7W A;  2DWI A;  4H5F A;  2H5Y A;  4YIC A;  3O9P A;  5J1D A;  3FVK A;  4MF3 A;  1MY0 A;  4L17 A;  1MDQ A;  3C36 A;  3I6V A;  4FED A;  2FYI A;  3PUV E;  3VVF A;  3CR9 A;  3IB0 A;  3OSQ A;  1LGB C;  1BKA A;  2YPN A;  2E1S A; 
#chains in the Genus database with same CATH topology
 4TLL B;  1UTH B;  3W9W A;  1OMP A;  3KN8 A;  3CFX A;  1H76 A;  3K4U A;  4MAG A;  4Q8R A;  2XXV A;  3IOT A;  5BUU A;  4EF2 A;  4LQ5 A;  3MST A;  3PTY A;  5EQ7 A;  2XX9 A;  1R1N A;  2O6A A;  1LBY A;  2NWJ A;  2VGQ A;  1L5T A;  1RDY A;  1DOT A;  2Q8J A;  4N17 A;  4MEV A;  4MLQ A;  1URD A;  4QSC A;  4F3P A;  4NMY A;  3TTR A;  1N84 A;  5EQ9 A;  4I62 A;  4LN5 A;  2AL4 A;  1MH4 A;  2VD3 A;  2WYK A;  4KYD A;  2RCA A;  3H4Z A;  4P0I A;  5DEX B;  2HQ0 A;  4PFT A;  1NV5 A;  4F29 A;  3D4C A;  2GFE A;  4FOR A;  1GTK A;  1OIB A;  1B7U A;  1USY E;  1NMU A;  5AA2 D;  3G3J A;  3N5L A;  5CM6 A;  2UVI A;  4MFI A;  5ISU A;  4ND9 A;  3BBR A;  3O66 A;  1LAX A;  3FV2 A;  4KXP A;  1FQE A;  4PFR A;  3MWB A;  1N76 A;  2F97 A;  1F9B A;  1Q35 A;  1FTJ A;  5KCJ A;  2L5V A;  1PDA A;  1B7Z A;  4RPN A;  1LB9 A;  2GHA A;  3UGW A;  2REJ A;  4FAJ A;  4YAH X;  4KR5 A;  4LP2 B;  4KYS A;  1IMF A;  4GXS B;  4O7I A;  1B5I A;  1O7T A;  2DXY A;  4YKK A;  5M2V A;  1QKA A;  2ZZV A;  5H8Q B;  5I2N A;  3PPQ A;  2O7I A;  3PPR A;  1B3E A;  5CRY A;  5LTC A;  1SBP A;  4MLV A;  3IOU A;  3QYT A;  1DCU A;  4GBV A;  4GX3 A;  2DOJ A;  5CMC A;  3G3F A;  5JTY B;  1XT8 A;  1ZMG A;  4JVI A;  4WKM A;  4AS4 A;  2ZYN A;  4HTG A;  3PUX E;  3TTK A;  4U1Z A;  1MQJ A;  4N91 A;  2Q9T A;  3KSX A;  1ZIU A;  3VLU A;  3B8B A;  3Q28 A;  2QRY A;  5IGA A;  3Q25 A;  5DVJ A;  1YXI A;  5CMK A;  5I7I A;  4OAN A;  3C35 A;  1D4N A;  1P1Q A;  4GWO A;  3R26 A;  1EYK A;  1OLA A;  4JSO A;  4BLA A;  3TEP A;  2XX7 A;  1K9Y A;  3K1N A;  4E0X A;  3TFL A;  1PB7 A;  1FBC A;  3O2A A;  2MKZ A;  2ZYK A;  1VFE A;  4QSE A;  4ELR A;  1SPI A;  4ELQ A;  3M3L A;  2CEY A;  4BDL A;  4F39 A;  3MZB A;  4F1U A;  3PGF A;  4KPT A;  4ZZE A;  3A3U A;  3TCF A;  4O8M A;  2UYF A;  2UXA A;  4GVO A;  4OER A;  1FPK A;  3IJX B;  1DSN A;  3LBS A;  3U93 A;  4EQ9 A;  1FPJ A;  4YKI A;  2F8D A;  3KZG A;  1FPB A;  1XI6 A;  1NV3 A;  2OLB A;  1YTV A;  4OEU A;  2DQV A;  4P47 A;  3DEL B;  1Y9U A;  3QSL A;  3KC1 A;  2HPG A;  3O6G A;  2PMS A;  3U8Q A;  4PC9 A;  5DEX A;  1Y1Z A;  3C31 A;  1LEV A;  1OVT A;  2OCU A;  2Y84 A;  2XWO A;  1P1W A;  2HXW A;  3VLW A;  1CB6 A;  1FQB A;  2QL3 A;  3FAS A;  1ZJL A;  2DE2 A;  3A29 A;  1JET A;  3FJ7 A;  1IMC A;  3EN3 A;  1OQG A;  3F11 A;  4PF8 A;  2OWZ A;  3H03 A;  1MXW A;  1IIW A;  1MQH A;  3FXQ A;  3IB2 A;  2XX8 A;  2PVU A;  2Z8E A;  4XKN A;  4QFL A;  3JV9 A;  1EU8 A;  1OQH A;  4RXL A;  1P1U A;  3S9L C;  4PFY A;  4JVD A;  1DTG A;  4EDP A;  3TZA A;  2FIE A;  5F7V A;  4OFO A;  4M4G A;  3O6I A;  1JP4 A;  5I56 A;  2OWT A;  3CFZ A;  3N6T A;  4OXV A;  2XXI A;  5J16 A;  4RK9 A;  1M5F A;  2CZH A;  3FVG A;  3K6U A;  3G7W A;  2PYY A;  4YKP A;  3IO6 A;  1VE4 A;  3CSG A;  5FBP A;  4BDR A;  4RPO A;  4PQJ A;  2DWJ A;  4FIM A;  4NQ8 A;  1FTO A;  1JVX A;  2QVU A;  1ZLQ A;  1QJM A;  1NV6 A;  1B46 A;  3FVO A;  5TPA A;  3JZJ A;  4KYE A;  4WEP A;  2CEX A;  1G0H A;  3RT8 A;  3PPO A;  4PFU A;  3DLN A;  5HBC A;  4NF6 B;  2B65 A;  2V3Q A;  1R6Z A;  4G77 A;  4OVJ A;  4NGU A;  1N04 A;  1UQW A;  4N81 A;  4H67 A;  1FQF A;  5DTB A;  3PMX A;  4IY5 A;  4PGN A;  1II5 A;  2IA4 A;  1Y4T A;  3U92 A;  5A5X B;  3QAX A;  1FBG A;  3OMB A;  2XD3 A;  4KQP A;  1FQD A;  4MNC A;  4PFI A;  3S9E A;  4PDD A;  1IEJ A;  3IJO B;  4JWX A;  4C0R A;  3H6T A;  2KQZ A;  5H8N B;  1VDW A;  4OZ9 A;  3IFC A;  4JWY A;  4DXC A;  2RIN A;  3E9X A;  2M8C A;  5F24 A;  4GWX A;  3D4G A;  3DP6 A;  4JDF A;  2FHY A;  4MJO A;  1YCJ A;  1MXY A;  2DP8 A;  4IO5 A;  4OQO A;  4F2Q A;  5EHS A;  2HCA A;  3IO4 A;  2V84 A;  2ABH A;  5AA4 A;  2R71 A;  2QJE A;  2P3N A;  5DYH A;  4PAF A;  3VDF A;  1XVX A;  1JQF A;  3TPA A;  3V8X B;  5I57 A;  2HFB A;  2D21 A;  4P1E A;  4IO4 A;  4WED A;  4OWD A;  1D9Y A;  4IGT A;  3U65 A;  3DM0 A;  2QMW A;  2V3U A;  1FTA A;  1FBE A;  4TLM B;  2H9B A;  1MM6 A;  3QIM A;  5IZZ A;  3B50 A;  4PTK A;  3MP1 A;  1FBH A;  4R6Y A;  2ALU A;  1A54 A;  1NV4 A;  4QSD A;  3OEM A;  3RPL A;  1B40 A;  2XWV A;  1B2H A;  2OBG A;  3LSF B;  4JXI A;  1R9L A;  3L6H A;  1LAF E;  1B9J A;  3UN6 A;  4I9D A;  4X1D A;  2UVJ A;  3K6W A;  4BDN A;  1Y20 A;  4MMP A;  1NUZ A;  1H3D A;  5K2X A;  3MVW A;  4U2R A;  1SW4 A;  1QUK A;  3PUZ E;  3T9V A;  2RCB A;  2GH9 A;  1NFT A;  1S7Y A;  1SVX B;  4MNI A;  2G93 A;  4F3B A;  2Z8D A;  4ZEB A;  4AS5 A;  4R6H A;  2XWK A;  4TQU Q;  2XHD A;  2A5S A;  4MCO A;  5I2K B;  3IOV A;  4GF8 A;  4PF6 A;  4GXA A;  3PUY E;  3P7I A;  4R9F A;  1XS5 A;  2OK2 A;  3NOH A;  2HAU A;  3A09 A;  1QUJ A;  5EQ8 A;  1B52 A;  4N07 A;  1VR5 A;  5EHM A;  4OFL A;  1B3H A;  4EXK A;  1M5B A;  2FVZ A;  4F18 A;  3PV0 E;  3O28 A;  3KSJ A;  4P0G A;  4ZZA A;  1RYX A;  1BTJ A;  1O64 A;  1SI1 A;  4IO7 A;  3RQT A;  1MM7 A;  4AB6 A;  2Y7I A;  2O68 A;  3LUZ A;  4XIG Q;  3TAJ A;  1JW4 A;  5A5L A;  1SI0 A;  4BDM A;  4POW A;  1NH7 A;  3H6U A;  3W15 C;  4I1D A;  5ESY A;  3ONM A;  3K1M A;  4R75 A;  4QBA A;  2R8T A;  2O1M A;  1YYZ A;  1MQG A;  1VSO A;  1MY3 A;  2Q8M A;  2HHM A;  3SEY A;  3KBZ A;  4ZS9 A;  1MDP 1;  1IMB A;  2XXY A;  4GL8 A;  1BP5 A;  1FJ9 A;  1FPE A;  2XA5 A;  2I3W A;  3MZ9 A;  1LST A;  3VXB A;  4ESW A;  4DIG A;  4LZ7 A;  4QFP A;  3SEU A;  5CI5 A;  1QW0 A;  2I48 A;  2DSF A;  1LBV A;  2KR0 A;  4X48 A;  2Z23 A;  4E0W A;  3MVY A;  3RYD A;  1A55 A;  1FBP A;  2I0C A;  1B1X A;  2AYS A;  3S2V A;  1Y3P A;  2DS9 A;  3HHG A;  2Q89 A;  4C1T A;  3R7X A;  1FCK A;  5B7D A;  3SDF A;  4I3E A;  1MQD A;  3CG3 A;  4DI4 B;  4H8I A;  3CIJ A;  3GYY A;  3TTN A;  4OEV A;  4G68 C;  4HW8 A;  1IXH A;  5JEI A;  3L6G A;  4IGR A;  3I5O A;  4X1B A;  2P0S A;  2OWS A;  1IZ1 A;  5IZ3 A;  4AQ4 A;  3G3K A;  3M8U A;  3EHT A;  1TXF A;  2D3I A;  1WVJ A;  5KDT B;  5T3J A;  4EXL A;  2CZL A;  4PP0 A;  4QF9 A;  1JW5 A;  5I58 A;  1NV1 A;  4NN3 A;  1Z7M E;  4YMA A;  1LBZ A;  1IXG A;  4HE1 A;  4OEN A;  2QMX A;  5ET5 A;  3RY3 A;  3UP9 A;  2QVV A;  1NV0 A;  4YB7 A;  1QUI A;  1Y3Q A;  4KD5 A;  4R9G A;  1YPN A;  3RTW B;  3KN3 A;  3U72 A;  2CZI A;  4H5G A;  4LUB A;  5H8F B;  4PBH A;  2F7C A;  1A8E A;  5TP9 B;  5CBS A;  2FNC A;  2X7Q A;  5CMM A;  3VVD A;  3ILU B;  1MY4 A;  4GOT A;  4F3S A;  5K2Y A;  4FAT A;  4GL0 A;  4YB5 A;  3H6W A;  1B5J A;  1XOC A;  4XKP A;  2ZZX A;  1B32 A;  3A3C A;  3T96 B;  1HSE A;  4NWD A;  3KJ7 A;  1NNT A;  4JBZ A;  1FQA A;  1Q9D A;  4NTL A;  4RA1 A;  4MHF A;  2P2A A;  3W9V A;  2I4B A;  2DVC A;  5ICT A;  3VE1 B;  5HPQ A;  1EH3 A;  3IAZ A;  1MY2 A;  4WXJ A;  4DI3 D;  4OVP A;  1PEB A;  3LSW A;  1UTH A;  1FBD A;  3K01 A;  3FAT A;  2YJP A;  3Q29 A;  2XXU A;  3TDJ A;  5AA2 B;  2P3V A;  2I58 A;  3S4U A;  1G0I A;  3WAF A;  3FJM A;  1JEU A;  1VFD A;  1NV7 A;  3B6T A;  1B3G A;  2VOZ A;  3S9M C;  1TT1 A;  1AIV A;  3AXF A;  5FHO A;  1UTB B;  2G29 A;  4ZE8 A;  4PAK A;  4JSD A;  3C33 A;  2GQ1 A;  4N8G A;  2HZL A;  1IIT A;  4NF5 B;  1EZO A;  4OFJ A;  1FPI A;  1AOV A;  2BJJ X;  5ITO A;  1KZ8 A;  3T9H B;  2H4I A;  4PET A;  4RK2 A;  1JW1 A;  1Q1K A;  1DTZ A;  4EF1 A;  5FHN A;  3KEI A;  3U94 A;  3E79 A;  1I6B A;  4QFO A;  2PX1 A;  3TMG A;  3VV5 A;  1UIU A;  4OVS A;  1A7L A;  2AL5 A;  1LAG E;  2RF1 A;  1ZTY A;  1LAH E;  4LAT A;  4NF4 B;  1HSJ A;  4OVQ A;  4P1L A;  2V4C A;  1B7H A;  1PC3 A;  4IO6 A;  1LFH A;  1S9T A;  4U22 A;  3EHS A;  5H8Q A;  4XKQ A;  2Q2C A;  4XXU A;  2P1S A;  2XD2 A;  2QSX A;  2F78 A;  3ZKL A;  4U23 A;  2A5T B;  4OVT A;  1QKB A;  1FW0 A;  4N8Y A;  5JTY A;  3HCQ A;  3H06 B;  5KZT A;  3GLB A;  1MH3 A;  4Q30 B;  3CFL A;  4ZED A;  4IO3 A;  3V83 A;  1N3X A;  1IXC A;  2Y5L A;  1AL3 A;  4HS7 A;  3VFJ A;  2XXR A;  4G68 B;  2F35 A;  2ONS A;  1ANF A;  1QGX A;  2D5W A;  1US4 A;  3IR1 A;  2ZYO A;  3GZG A;  4U1O A;  3QUF A;  3B6Q A;  1NUX A;  2E0S A;  2F3D A;  3HO7 A;  3OO7 A;  3FXU A;  1R9Q A;  4EQ7 A;  4RYA A;  1ELJ A;  4X9T A;  3LSX A;  3ZKK A;  5CC2 A;  2V25 A;  2XXP A;  1GV8 A;  4LVQ A;  4O94 A;  2H98 A;  3B7D A;  1NUY A;  5TU0 A;  4DDD A;  4GWY A;  4NF8 B;  3MC2 A;  1BK4 A;  4NX1 A;  4OMB A;  3PMV A;  1M5E A;  1URS A;  1MRP A;  2ONR A;  3M3K A;  2ANJ A;  3MP6 A;  5FHM A;  3IOR A;  3EF7 A;  4NAP A;  1DPE A;  4UAB A;  3G3H A;  2F5X A;  3OO9 A;  4G8M A;  1WDN A;  2ZYM A;  4NE4 A;  4KFQ A;  1N3W A;  1XC1 A;  1M5C A;  2ZXT A;  3QXM A;  1CE2 A;  3FZV A;  2I6E A;  4N6D A;  4F1Y A;  1Y3N A;  3K2D A;  4R74 A;  3Q26 A;  3ZSF A;  1MPC A;  3C34 A;  1NL5 A;  1B51 A;  1MY1 A;  3CSB A;  3HFU A;  1B4Z A;  1LCF A;  1P1O A;  2R6G E;  4GLI A;  2ESN A;  2PFY A;  1LBX A;  5DVF A;  1XVY A;  3HST A;  3IX1 A;  3KG2 A;  4P3L A;  3KOS A;  4HE2 A;  1TFA A;  3MVZ A;  4DE8 A;  4NF4 A;  3TCG A;  3LUY A;  1B0H A;  3RT6 B;  1N0T A;  2VD2 A;  3KC0 A;  2PBW A;  1RKM A;  1N7X A;  3LV0 A;  4LON B;  3T93 B;  2QPQ A;  3FIR A;  3QK6 A;  2PFZ A;  3KGC A;  3FXR A;  4GX6 A;  4YB6 A;  3K00 A;  3T1B A;  3EQ1 A;  4Q0C A;  2O7U A;  5CBR A;  4HCY A;  4ZE9 A;  1B1H A;  3PMW A;  3U1O A;  3E13 X;  2NVU B;  1K9Z A;  4R2B A;  4GD5 A;  3MP8 A;  3OXN A;  2BJI A;  4H1X A;  3FBP A;  4I40 A;  2X7P A;  3IFA A;  1BIY A;  3VVE A;  1NH8 A;  2YLN A;  2F7A A;  2DXR A;  1A8F A;  4H65 A;  3LC8 A;  5KCJ B;  5FTI A;  4YMB A;  2OZZ A;  3V5A A;  2AIX A;  3Q27 A;  4NF6 A;  4P11 A;  1FSA A;  3UA8 A;  3FJG A;  3HV1 A;  5I2N B;  3B6W A;  3TCH A;  3KN7 A;  3M3F A;  1J1N A;  4NF8 A;  4RJZ A;  2NOO A;  1US5 A;  4H6D A;  2RKM A;  3I3V A;  3OD7 A;  5A5X A;  3FUZ A;  5EYH A;  4N6K A;  5B70 A;  3SZP A;  4C1U A;  3VXC A;  4R2F A;  4JVC A;  5DVI A;  1KA0 A;  3MBP A;  4DXB A;  4GWU A;  4MNP A;  4LA9 A;  3GBB A;  4DLD A;  1NNK A;  2DYX A;  1JNF A;  2XXX A;  1SW1 A;  4NHB A;  1MXV A;  1LFG A;  4FE8 A;  4BDQ A;  5H8N A;  2XXK A;  4G4P A;  2F3B A;  4OHN A;  1DK4 A;  2DWH A;  4MX6 A;  4OES A;  4F2O A;  1MQI A;  1D3K A;  4QFK A;  2RC7 A;  2ZZW A;  2O51 A;  2WBD A;  3OEK A;  5L9O A;  3C4M A;  4QFN A;  3K02 A;  4FEB A;  4R6K A;  4FJP A;  4PE3 A;  5CMB A;  1NUW A;  3H7M A;  1I69 A;  1B0L A;  1NKX A;  3FGS A;  4G2Z A;  5L9M A;  4POX A;  3IOW A;  5ITP A;  4P9K A;  3RN8 A;  1B05 A;  2JJK A;  5L8D A;  2F36 A;  1B5H A;  4K3F A;  3MJN A;  5ET6 A;  4MBP A;  3RGY A;  2OJT A;  4P8B A;  4XKR A;  1H44 A;  3H3G A;  4RY1 A;  1DPP A;  1SD3 A;  1NI9 A;  1AWB A;  4LQ2 A;  3FV1 A;  3CI8 A;  3GXA A;  3SES A;  1WOD A;  4ZDM A;  3EKI A;  4Z7E A;  4H46 A;  4H0W A;  3K6V A;  3N26 A;  2IEE A;  4PBQ A;  5F1Q A;  5I84 A;  2GRV A;  1IME A;  1FTL A;  5DW8 A;  3T22 A;  1B4H A;  3SEV A;  3E4R A;  3PPP A;  3D1R A;  3IL1 B;  2F7B A;  1LCT A;  3KOT A;  2I0B A;  1H43 A;  2WX9 A;  3O97 A;  1RYO A;  1GVC A;  2O84 X;  1TFD A;  1USY H;  4PFW A;  1D9Q A;  1D9V A;  1DMB A;  5IM2 A;  3RLF E;  4DCY A;  3KJT A;  2Q2A A;  3ODB A;  4F22 A;  5I2K A;  1P1N A;  2ZNU A;  1SYI A;  4IR8 A;  3OO6 A;  3PD9 A;  2DE4 A;  1O63 A;  1RDX A;  3CVG A;  3H6V A;  4XFE A;  3O6H A;  4HCW A;  3C9H A;  3MPL A;  1T0K A;  3LR1 A;  2W7Y A;  3KBR A;  5AA3 A;  4ELO A;  4G61 A;  4FEC A;  4PCD A;  5I56 B;  1ZU0 A;  1SDX A;  3HPI A;  2PT1 A;  4P56 A;  3RTF B;  1SW5 A;  2H99 A;  5I59 B;  2KLF A;  1YAE A;  3SER A;  2ZNT A;  2NUV A;  1PB8 A;  4GRK A;  4G8N A;  4KHZ E;  4H45 A;  5IAI A;  2THI A;  3SEX A;  4THI A;  3UOR A;  1LBB A;  3O29 A;  3RUM A;  1IXI A;  3MPK A;  1LLS A;  4MH5 A;  1M5D A;  2QS2 A;  2QVR A;  2O1L A;  4R73 A;  5TPA B;  4N4U A;  3BIG A;  4PFB A;  1GGG A;  1ZKB A;  2XXH A;  4OA4 A;  1YZ0 A;  1FJ6 A;  2B4L A;  4Z0I A;  4GIZ A;  4IB2 A;  5HM4 B;  4LZ5 A;  4O3B A;  3DP4 A;  3USD A;  1Y4C A;  1MPB A;  2ZNS A;  3G3I A;  3KFM A;  2FIX A;  4O3C A;  1B6H A;  1B58 A;  1B3L A;  2ONK E;  1BLF A;  1IMD A;  2HEU A;  1B3F A;  2LAO A;  3BFT A;  5EQA A;  2Y7R A;  1OVB A;  2H25 A;  1QUL A;  2ZMB A;  2HZK A;  3FXB A;  4AB5 A;  2F6P A;  1DBZ A;  1PBQ A;  3OEN A;  5H8H B;  3K0V A;  1Z7N E;  2RC9 A;  2PCR A;  1ZBM A;  5ELV A;  5ICQ A;  5LDZ A;  3LSL A;  3ROJ A;  4GQO A;  3BFU A;  5AA1 A;  4XTC Q;  2I3V A;  4GBW A;  4KI0 E;  2QS4 A;  2FBP A;  3HHF A;  1FPD A;  5AA4 B;  3MAM A;  3IB1 A;  4O3A A;  5KDT A;  1MS7 A;  4IO2 A;  2GHB A;  4GWZ A;  2Q74 A;  1P99 A;  2UYE A;  4QHQ A;  4YKJ A;  2XXQ A;  5IZ1 A;  2Z8F A;  5I57 B;  2QS1 A;  3C32 A;  2OX3 A;  1EZP A;  3DP8 A;  3ISP A;  2VPN A;  4U4S A;  2QFL A;  4MIJ A;  4ZEK A;  2F34 A;  1XHY A;  2XXT A;  2WKY A;  4F19 A;  3TQW A;  4F3G A;  2B3B A;  1MG1 A;  2DE3 A;  1FTM A;  1NNF A;  3TOD A;  5H8F A;  5TP9 A;  4ONY A;  4GWW A;  3RPL B;  2HAV A;  3K1P A;  3PD8 A;  1UIV A;  4QRZ A;  4N13 A;  1MXU A;  4YU0 A;  5JK4 A;  4KCC A;  4RNS A;  1FPG A;  1LB8 A;  5I59 A;  3N94 A;  3EHU A;  1I6Q A;  5ET8 A;  2DWA A;  5IKB A;  3S9N C;  2WYP A;  1QVS A;  1IQ7 A;  3TTM A;  1FTK A;  3CG1 A;  4F31 B;  1KWH A;  1NV2 A;  1EYJ A;  3UIF A;  2Q88 A;  1OLC A;  1FPL A;  4GFR A;  1NNP A;  3T66 A;  2HXR A;  4XF5 A;  2DVZ A;  1RDZ A;  2Y7K A;  3T9U A;  4UAC A;  5AA2 A;  1URG A;  4PGP A;  4F1V A;  2VP1 A;  5AE4 A;  3HN0 A;  1FPF A;  3OEL A;  1PBP A;  3RPW A;  4PE5 B;  3WAE A;  4X8R A;  1LBW A;  2Y5K A;  1UTB A;  1HSL A;  3MZ1 A;  3G3G A;  4N6P A;  4GX4 A;  2R9J A;  4NWC A;  1CNQ A;  4OTE A;  2NXO A;  3SET A;  4NF5 A;  1EZ9 A;  3SKP A;  4Q5T A;  2B3F A;  2X26 A;  1MXX A;  5H8H A;  4U4X A;  1SYH A;  2CZK A;  4NED A;  1TWY A;  4YZZ A;  3T9X B;  4KCD A;  4OYV A;  3OOA A;  4R72 A;  1MPD A;  4PDH A;  2VT5 A;  2O69 A;  3BKI B;  4H8J A;  1AMF A;  3THI A;  4DXU A;  3E3K A;  2I49 A;  4ELP A;  2XXW A;  2CMO A;  5L9S A;  5DT6 A;  3JYR A;  2WBB A;  4U21 A;  3ILT B;  4XEQ A;  1IMA A;  3MQ9 A;  4ESX A;  1POT A;  2F6G A;  4I8C A;  1FQC A;  3PUW E;  3UK4 A;  1POY 1;  4ZEC A;  4ECF A;  3MW0 A;  3ZS6 A;  1EYI A;  3MYU A;  4HE0 A;  2A5T A;  3FD3 A;  4JB7 A;  2V3T A;  3OSR A;  5I5P A;  4NF0 A;  2I4C A;  4TOZ A;  1AH5 A;  3CHG A;  3MUQ A;  2Y7P A;  4UA8 A;  4IY6 A;  3TKD A;  4ZEF A;  5LOM A;  4EUO A;  3TYH A;  1FRP A;  3TUS A;  4G68 A;  2XWI A;  3FVN A;  4OET A;  4EQB A;  4JWO A;  1JVY A;  3MVX A;  3R6U A;  4HXV A;  4OVR A;  1SQY A;  3V89 B;  1ATG A;  1KA1 A;  3T0J A;  2UVH A;  1LFI A;  2B4M A;  2REG A;  3PU5 A;  4GWS A;  5BWJ A;  1JEV A;  3OO8 A;  1H45 A;  1PB9 A;  4G8H A;  4ISU A;  4DZ1 A;  1FBF A;  5IZ3 B;  1I6A A;  2Z22 A;  4O7M A;  4BDO A;  3VLV A;  1IUD A;  3BIH A;  2V93 A;  1SW2 A;  5EYF A;  1S50 A;  3QUJ A;  5ET7 A;  3ECR A;  4QXD A;  5I58 B;  5H8S A;  3SEW A;  3CRB A;  2PT2 A;  5FTH A;  3TQL A;  1A99 A;  1MXZ A;  4DCX A;  2VPO A;  2RC8 A;  3IK6 B;  1LBC A;  4LZ8 A;  3K6X A;  1A40 A;  2QS3 A;  3EPE A;  1N7W A;  3PPN A;  1GR2 A;  4ZEI A;  3N6U A;  4I3Y A;  1Y1M A;  2VHA A;  2WEF A;  4M1V A;  4FBP A;  3TTL A;  3TEL A;  2UVG A;  3GBA A;  3RNN A;  2FA7 A;  2Y7W A;  2DWI A;  4H5F A;  4N15 A;  2H5Y A;  4YIC A;  3O9P A;  5J1D A;  4X04 A;  3FVK A;  4MF3 A;  1MY0 A;  4L17 A;  1MDQ A;  3QMF A;  3C36 A;  3I6V A;  3E78 A;  4FED A;  2FYI A;  3PUV E;  3VVF A;  2DDK A;  3CR9 A;  5I3S A;  1INP A;  4NG7 A;  5EYG A;  3IB0 A;  3OSQ A;  1LGB C;  4PAI A;  1BKA A;  2YPN A;  2E1S A; 
#chains in the Genus database with same CATH homology
 4TLL B;  1UTH B;  3W9W A;  1OMP A;  3KN8 A;  3CFX A;  1H76 A;  3K4U A;  4Q8R A;  2XXV A;  3IOT A;  5BUU A;  4EF2 A;  4LQ5 A;  2XX9 A;  1R1N A;  2O6A A;  2NWJ A;  2VGQ A;  1L5T A;  1DOT A;  2Q8J A;  4MLQ A;  1URD A;  4QSC A;  4F3P A;  4NMY A;  3TTR A;  1N84 A;  4I62 A;  2AL4 A;  1MH4 A;  2VD3 A;  4KYD A;  2RCA A;  3H4Z A;  4P0I A;  5DEX B;  2HQ0 A;  4PFT A;  4F29 A;  3D4C A;  2GFE A;  4FOR A;  1GTK A;  1OIB A;  1B7U A;  1USY E;  1NMU A;  5AA2 D;  3G3J A;  3N5L A;  5CM6 A;  2UVI A;  4MFI A;  5ISU A;  4ND9 A;  3BBR A;  3O66 A;  1LAX A;  3FV2 A;  1FQE A;  3MWB A;  1N76 A;  2F97 A;  1F9B A;  1Q35 A;  1FTJ A;  5KCJ A;  1PDA A;  1B7Z A;  4RPN A;  1LB9 A;  2GHA A;  3UGW A;  2REJ A;  4FAJ A;  4YAH X;  4KR5 A;  4LP2 B;  4KYS A;  4GXS B;  1B5I A;  1O7T A;  2DXY A;  4YKK A;  5M2V A;  1QKA A;  5H8Q B;  5I2N A;  3PPQ A;  2O7I A;  3PPR A;  1B3E A;  5CRY A;  1SBP A;  4MLV A;  3IOU A;  3QYT A;  2DOJ A;  5CMC A;  3G3F A;  5JTY B;  1XT8 A;  1ZMG A;  4WKM A;  2ZYN A;  4HTG A;  3PUX E;  3TTK A;  4U1Z A;  1MQJ A;  2Q9T A;  3KSX A;  1ZIU A;  3VLU A;  3Q28 A;  2QRY A;  3Q25 A;  5DVJ A;  5CMK A;  3C35 A;  1D4N A;  1P1Q A;  4GWO A;  3R26 A;  1OLA A;  4JSO A;  4BLA A;  3TEP A;  2XX7 A;  3K1N A;  4E0X A;  3TFL A;  1PB7 A;  3O2A A;  2ZYK A;  1VFE A;  4QSE A;  4ELR A;  4ELQ A;  3M3L A;  4BDL A;  4F39 A;  3MZB A;  4F1U A;  3PGF A;  4KPT A;  4ZZE A;  3A3U A;  3TCF A;  2UYF A;  2UXA A;  4GVO A;  4OER A;  3IJX B;  1DSN A;  3LBS A;  3U93 A;  4EQ9 A;  4YKI A;  2F8D A;  3KZG A;  2OLB A;  1YTV A;  4OEU A;  2DQV A;  3DEL B;  1Y9U A;  3QSL A;  3O6G A;  2PMS A;  3U8Q A;  5DEX A;  1Y1Z A;  3C31 A;  1OVT A;  2OCU A;  2Y84 A;  1P1W A;  2HXW A;  3VLW A;  1CB6 A;  1FQB A;  2QL3 A;  3FAS A;  1ZJL A;  2DE2 A;  1JET A;  3FJ7 A;  3EN3 A;  1OQG A;  3F11 A;  3H03 A;  1MXW A;  1IIW A;  1MQH A;  3FXQ A;  3IB2 A;  2XX8 A;  2PVU A;  2Z8E A;  4XKN A;  4QFL A;  3JV9 A;  1EU8 A;  1OQH A;  4RXL A;  1P1U A;  3S9L C;  4PFY A;  1DTG A;  4EDP A;  3TZA A;  5F7V A;  4OFO A;  4M4G A;  3O6I A;  5I56 A;  2OWT A;  3CFZ A;  3N6T A;  4OXV A;  2XXI A;  4RK9 A;  1M5F A;  3FVG A;  3K6U A;  3G7W A;  2PYY A;  4YKP A;  3IO6 A;  1VE4 A;  3CSG A;  4BDR A;  4RPO A;  4PQJ A;  2DWJ A;  4FIM A;  1FTO A;  1JVX A;  1ZLQ A;  1QJM A;  1B46 A;  3FVO A;  5TPA A;  3JZJ A;  4KYE A;  4WEP A;  3RT8 A;  3PPO A;  4PFU A;  3DLN A;  5HBC A;  4NF6 B;  2B65 A;  2V3Q A;  1R6Z A;  4G77 A;  4OVJ A;  1N04 A;  1UQW A;  4H67 A;  1FQF A;  5DTB A;  3PMX A;  4IY5 A;  1II5 A;  2IA4 A;  1Y4T A;  3U92 A;  5A5X B;  3QAX A;  3OMB A;  2XD3 A;  4KQP A;  1FQD A;  3S9E A;  1IEJ A;  3IJO B;  4JWX A;  4C0R A;  3H6T A;  5H8N B;  4OZ9 A;  4JWY A;  4DXC A;  2RIN A;  3E9X A;  2M8C A;  3D4G A;  3DP6 A;  4JDF A;  1YCJ A;  1MXY A;  2DP8 A;  4IO5 A;  4OQO A;  4F2Q A;  5EHS A;  2HCA A;  3IO4 A;  2V84 A;  2ABH A;  5AA4 A;  2R71 A;  2QJE A;  5DYH A;  3VDF A;  1XVX A;  1JQF A;  3TPA A;  3V8X B;  5I57 A;  2HFB A;  2D21 A;  4IO4 A;  4WED A;  4OWD A;  1D9Y A;  4IGT A;  3DM0 A;  2QMW A;  2V3U A;  4TLM B;  2H9B A;  1MM6 A;  3QIM A;  3MP1 A;  4R6Y A;  2ALU A;  1A54 A;  4QSD A;  3OEM A;  1B40 A;  1B2H A;  2OBG A;  3LSF B;  4JXI A;  1R9L A;  3L6H A;  1LAF E;  1B9J A;  3UN6 A;  4I9D A;  4X1D A;  2UVJ A;  3K6W A;  4BDN A;  1Y20 A;  1H3D A;  5K2X A;  3MVW A;  4U2R A;  1SW4 A;  1QUK A;  3PUZ E;  3T9V A;  2RCB A;  2GH9 A;  1NFT A;  1S7Y A;  1SVX B;  2G93 A;  4F3B A;  2Z8D A;  4ZEB A;  4R6H A;  4TQU Q;  2XHD A;  2A5S A;  5I2K B;  3IOV A;  4GF8 A;  4GXA A;  3PUY E;  3P7I A;  4R9F A;  1XS5 A;  2OK2 A;  2HAU A;  3A09 A;  1QUJ A;  1B52 A;  4N07 A;  1VR5 A;  5EHM A;  4OFL A;  1B3H A;  4EXK A;  1M5B A;  4F18 A;  3PV0 E;  3O28 A;  3KSJ A;  4P0G A;  4ZZA A;  1RYX A;  1BTJ A;  1O64 A;  1SI1 A;  4IO7 A;  3RQT A;  1MM7 A;  4AB6 A;  2Y7I A;  2O68 A;  4XIG Q;  3TAJ A;  1JW4 A;  1SI0 A;  4BDM A;  4POW A;  1NH7 A;  3H6U A;  3W15 C;  4I1D A;  3ONM A;  3K1M A;  4R75 A;  2O1M A;  1MQG A;  1VSO A;  1MY3 A;  3SEY A;  4ZS9 A;  1MDP 1;  2XXY A;  4GL8 A;  1BP5 A;  2I3W A;  3MZ9 A;  1LST A;  3VXB A;  4ESW A;  4DIG A;  4LZ7 A;  4QFP A;  3SEU A;  5CI5 A;  1QW0 A;  2I48 A;  2DSF A;  4X48 A;  2Z23 A;  4E0W A;  3MVY A;  1A55 A;  2I0C A;  1B1X A;  2AYS A;  3S2V A;  1Y3P A;  2DS9 A;  3HHG A;  2Q89 A;  4C1T A;  3R7X A;  1FCK A;  5B7D A;  3SDF A;  1MQD A;  3CG3 A;  4H8I A;  3CIJ A;  3TTN A;  4OEV A;  4G68 C;  4HW8 A;  1IXH A;  5JEI A;  3L6G A;  4IGR A;  3I5O A;  4X1B A;  2P0S A;  2OWS A;  1IZ1 A;  4AQ4 A;  3G3K A;  3M8U A;  3EHT A;  1TXF A;  2D3I A;  1WVJ A;  5KDT B;  4EXL A;  2CZL A;  4PP0 A;  4QF9 A;  1JW5 A;  5I58 A;  1Z7M E;  4YMA A;  1IXG A;  4OEN A;  2QMX A;  3RY3 A;  3UP9 A;  4YB7 A;  1QUI A;  1Y3Q A;  4KD5 A;  4R9G A;  1YPN A;  3RTW B;  3KN3 A;  3U72 A;  4H5G A;  4LUB A;  5H8F B;  2F7C A;  1A8E A;  5TP9 B;  5CBS A;  2FNC A;  2X7Q A;  5CMM A;  3VVD A;  3ILU B;  1MY4 A;  4GOT A;  4F3S A;  5K2Y A;  4FAT A;  4GL0 A;  4YB5 A;  3H6W A;  1B5J A;  4XKP A;  1XOC A;  1B32 A;  3A3C A;  3T96 B;  1HSE A;  4NWD A;  3KJ7 A;  1NNT A;  4JBZ A;  1FQA A;  4NTL A;  4RA1 A;  2P2A A;  3W9V A;  2I4B A;  2DVC A;  5ICT A;  3VE1 B;  5HPQ A;  1EH3 A;  3IAZ A;  1MY2 A;  4WXJ A;  1PEB A;  3LSW A;  1UTH A;  3K01 A;  3FAT A;  2YJP A;  3Q29 A;  2XXU A;  3TDJ A;  5AA2 B;  2I58 A;  3S4U A;  3WAF A;  3FJM A;  1JEU A;  1VFD A;  3B6T A;  1B3G A;  2VOZ A;  3S9M C;  1TT1 A;  1AIV A;  3AXF A;  5FHO A;  1UTB B;  2G29 A;  4ZE8 A;  4JSD A;  3C33 A;  2HZL A;  1IIT A;  4NF5 B;  1EZO A;  4OFJ A;  1AOV A;  2BJJ X;  5ITO A;  3T9H B;  2H4I A;  4PET A;  4RK2 A;  1JW1 A;  1Q1K A;  1DTZ A;  4EF1 A;  5FHN A;  3KEI A;  3U94 A;  1I6B A;  4QFO A;  2PX1 A;  3VV5 A;  3TMG A;  1UIU A;  1A7L A;  2AL5 A;  1LAG E;  2RF1 A;  1ZTY A;  1LAH E;  4LAT A;  4NF4 B;  1HSJ A;  1B7H A;  1PC3 A;  4IO6 A;  1LFH A;  1S9T A;  4U22 A;  3EHS A;  5H8Q A;  4XKQ A;  2Q2C A;  4XXU A;  2P1S A;  2XD2 A;  2QSX A;  2F78 A;  3ZKL A;  4U23 A;  2A5T B;  1QKB A;  1FW0 A;  5JTY A;  3HCQ A;  3H06 B;  5KZT A;  3GLB A;  1MH3 A;  4Q30 B;  3CFL A;  4ZED A;  4IO3 A;  3V83 A;  1N3X A;  1IXC A;  1AL3 A;  4HS7 A;  3VFJ A;  2XXR A;  4G68 B;  2F35 A;  2ONS A;  1ANF A;  2D5W A;  1US4 A;  3IR1 A;  2ZYO A;  3GZG A;  4U1O A;  3QUF A;  3B6Q A;  2E0S A;  3OO7 A;  3HO7 A;  3FXU A;  1R9Q A;  4EQ7 A;  4RYA A;  1ELJ A;  4X9T A;  3LSX A;  3ZKK A;  5CC2 A;  2V25 A;  2XXP A;  1GV8 A;  4LVQ A;  2H98 A;  3B7D A;  5TU0 A;  4DDD A;  4NF8 B;  3MC2 A;  4OMB A;  3PMV A;  1M5E A;  1URS A;  1MRP A;  2ONR A;  3M3K A;  2ANJ A;  3MP6 A;  5FHM A;  3IOR A;  3EF7 A;  1DPE A;  3G3H A;  2F5X A;  3OO9 A;  4G8M A;  1WDN A;  2ZYM A;  4NE4 A;  4KFQ A;  1N3W A;  1XC1 A;  1M5C A;  2ZXT A;  3QXM A;  1CE2 A;  3FZV A;  2I6E A;  4F1Y A;  1Y3N A;  3K2D A;  4R74 A;  3Q26 A;  3ZSF A;  1MPC A;  3C34 A;  1NL5 A;  1B51 A;  1MY1 A;  3CSB A;  1B4Z A;  1LCF A;  1P1O A;  2R6G E;  4GLI A;  2ESN A;  5DVF A;  1XVY A;  3HST A;  3IX1 A;  3KG2 A;  3KOS A;  1TFA A;  3MVZ A;  4DE8 A;  4NF4 A;  3TCG A;  3LUY A;  1B0H A;  3RT6 B;  1N0T A;  2VD2 A;  2PBW A;  1RKM A;  1N7X A;  4LON B;  3T93 B;  2QPQ A;  3FIR A;  3QK6 A;  3KGC A;  3FXR A;  4YB6 A;  3K00 A;  3EQ1 A;  4Q0C A;  2O7U A;  5CBR A;  4HCY A;  4ZE9 A;  1B1H A;  3PMW A;  3U1O A;  3E13 X;  2NVU B;  4R2B A;  4GD5 A;  3MP8 A;  3OXN A;  4H1X A;  3VVE A;  2X7P A;  1BIY A;  1NH8 A;  2YLN A;  2F7A A;  2DXR A;  1A8F A;  4H65 A;  3LC8 A;  5KCJ B;  5FTI A;  4YMB A;  2OZZ A;  3V5A A;  2AIX A;  3Q27 A;  4NF6 A;  4P11 A;  3UA8 A;  3FJG A;  3HV1 A;  5I2N B;  3B6W A;  3TCH A;  3KN7 A;  3M3F A;  1J1N A;  4NF8 A;  4RJZ A;  2NOO A;  1US5 A;  4H6D A;  2RKM A;  3I3V A;  3OD7 A;  5A5X A;  3FUZ A;  5B70 A;  4C1U A;  3VXC A;  4R2F A;  5DVI A;  3MBP A;  4DXB A;  4LA9 A;  3GBB A;  4DLD A;  1NNK A;  2DYX A;  1JNF A;  2XXX A;  1SW1 A;  1MXV A;  1LFG A;  4FE8 A;  4BDQ A;  5H8N A;  4G4P A;  4OHN A;  2DWH A;  4OES A;  4F2O A;  1MQI A;  1D3K A;  4QFK A;  2RC7 A;  2O51 A;  3OEK A;  5L9O A;  3C4M A;  4QFN A;  3K02 A;  4FEB A;  4R6K A;  4FJP A;  5CMB A;  3H7M A;  1I69 A;  1B0L A;  1NKX A;  3FGS A;  4G2Z A;  5L9M A;  4POX A;  3IOW A;  5ITP A;  3RN8 A;  1B05 A;  5L8D A;  2F36 A;  1B5H A;  4K3F A;  3MJN A;  4MBP A;  3RGY A;  2OJT A;  4XKR A;  1H44 A;  3H3G A;  4RY1 A;  1DPP A;  1SD3 A;  4LQ2 A;  3FV1 A;  3CI8 A;  3GXA A;  3SES A;  1WOD A;  4ZDM A;  4Z7E A;  4H0W A;  3K6V A;  3N26 A;  2IEE A;  5F1Q A;  5I84 A;  2GRV A;  1FTL A;  3T22 A;  1B4H A;  3SEV A;  3E4R A;  3PPP A;  3IL1 B;  2F7B A;  1LCT A;  3KOT A;  2I0B A;  1H43 A;  3O97 A;  1RYO A;  1GVC A;  2O84 X;  1TFD A;  1USY H;  4PFW A;  1D9V A;  1DMB A;  4DCY A;  3RLF E;  3KJT A;  2Q2A A;  3ODB A;  4F22 A;  5I2K A;  1P1N A;  2ZNU A;  1SYI A;  3OO6 A;  3PD9 A;  2DE4 A;  1O63 A;  3CVG A;  3H6V A;  3O6H A;  4HCW A;  3C9H A;  3MPL A;  1T0K A;  3LR1 A;  2W7Y A;  3KBR A;  5AA3 A;  4ELO A;  4FEC A;  5I56 B;  1ZU0 A;  1SDX A;  3HPI A;  2PT1 A;  3RTF B;  1SW5 A;  2H99 A;  5I59 B;  2KLF A;  1YAE A;  3SER A;  2ZNT A;  2NUV A;  1PB8 A;  4GRK A;  4G8N A;  4KHZ E;  5IAI A;  2THI A;  3SEX A;  4THI A;  3UOR A;  1LBB A;  3O29 A;  3RUM A;  1IXI A;  3MPK A;  1LLS A;  4MH5 A;  1M5D A;  2QS2 A;  2O1L A;  4R73 A;  5TPA B;  1GGG A;  1ZKB A;  2XXH A;  4Z0I A;  4GIZ A;  4IB2 A;  5HM4 B;  4LZ5 A;  4O3B A;  3DP4 A;  3USD A;  1Y4C A;  1MPB A;  2ZNS A;  3G3I A;  3KFM A;  4O3C A;  1B6H A;  1B58 A;  1B3L A;  2ONK E;  1BLF A;  2HEU A;  1B3F A;  2LAO A;  3BFT A;  2Y7R A;  1OVB A;  2H25 A;  1QUL A;  2ZMB A;  2HZK A;  4AB5 A;  2F6P A;  1PBQ A;  3OEN A;  5H8H B;  3K0V A;  1Z7N E;  2RC9 A;  1ZBM A;  5ELV A;  5ICQ A;  3LSL A;  4GQO A;  3BFU A;  5AA1 A;  4XTC Q;  2I3V A;  4KI0 E;  2QS4 A;  3HHF A;  5AA4 B;  3MAM A;  3IB1 A;  4O3A A;  5KDT A;  1MS7 A;  4IO2 A;  2GHB A;  1P99 A;  2UYE A;  4QHQ A;  4YKJ A;  2XXQ A;  2Z8F A;  5I57 B;  2QS1 A;  3C32 A;  1EZP A;  3DP8 A;  4U4S A;  4ZEK A;  2F34 A;  1XHY A;  2XXT A;  2WKY A;  4F19 A;  3TQW A;  4F3G A;  2B3B A;  1MG1 A;  2DE3 A;  1FTM A;  1NNF A;  3TOD A;  5H8F A;  5TP9 A;  4ONY A;  2HAV A;  3K1P A;  3PD8 A;  1UIV A;  4QRZ A;  4N13 A;  1MXU A;  4YU0 A;  5JK4 A;  4KCC A;  4RNS A;  1LB8 A;  5I59 A;  3N94 A;  3EHU A;  1I6Q A;  2DWA A;  5IKB A;  3S9N C;  1QVS A;  1IQ7 A;  3TTM A;  1FTK A;  3CG1 A;  4F31 B;  1KWH A;  3UIF A;  2Q88 A;  1OLC A;  4GFR A;  1NNP A;  3T66 A;  2DVZ A;  2Y7K A;  3T9U A;  4UAC A;  5AA2 A;  1URG A;  4F1V A;  2VP1 A;  5AE4 A;  3HN0 A;  3OEL A;  1PBP A;  3RPW A;  4PE5 B;  3WAE A;  1UTB A;  1HSL A;  3MZ1 A;  3G3G A;  4N6P A;  2R9J A;  4NWC A;  4OTE A;  2NXO A;  3SET A;  4NF5 A;  1EZ9 A;  3SKP A;  4Q5T A;  2B3F A;  2X26 A;  1MXX A;  5H8H A;  4U4X A;  1SYH A;  4NED A;  1TWY A;  4YZZ A;  3T9X B;  4KCD A;  4OYV A;  3OOA A;  4R72 A;  1MPD A;  2O69 A;  3BKI B;  4H8J A;  1AMF A;  3THI A;  4DXU A;  3E3K A;  2I49 A;  4ELP A;  2XXW A;  2CMO A;  5L9S A;  5DT6 A;  3JYR A;  4U21 A;  3ILT B;  3MQ9 A;  4ESX A;  1POT A;  2F6G A;  4I8C A;  1FQC A;  3PUW E;  3UK4 A;  1POY 1;  4ZEC A;  4ECF A;  3MW0 A;  3ZS6 A;  2A5T A;  3FD3 A;  4JB7 A;  2V3T A;  3OSR A;  2I4C A;  4TOZ A;  1AH5 A;  3MUQ A;  2Y7P A;  4UA8 A;  4IY6 A;  3TKD A;  4ZEF A;  5LOM A;  4EUO A;  3TYH A;  3TUS A;  4G68 A;  3FVN A;  4OET A;  4EQB A;  4JWO A;  1JVY A;  3MVX A;  3R6U A;  1SQY A;  3V89 B;  1ATG A;  2UVH A;  1LFI A;  2REG A;  3PU5 A;  5BWJ A;  1JEV A;  3OO8 A;  1H45 A;  1PB9 A;  4G8H A;  4ISU A;  4DZ1 A;  1I6A A;  2Z22 A;  4BDO A;  3VLV A;  1IUD A;  2V93 A;  1SW2 A;  5EYF A;  1S50 A;  3QUJ A;  3ECR A;  5I58 B;  5H8S A;  3SEW A;  3CRB A;  2PT2 A;  5FTH A;  3TQL A;  1A99 A;  1MXZ A;  4DCX A;  2RC8 A;  3IK6 B;  1LBC A;  4LZ8 A;  3K6X A;  1A40 A;  2QS3 A;  3EPE A;  1N7W A;  3PPN A;  1GR2 A;  4ZEI A;  3N6U A;  1Y1M A;  2VHA A;  4M1V A;  3TTL A;  3TEL A;  2UVG A;  3GBA A;  3RNN A;  2FA7 A;  2Y7W A;  2DWI A;  4H5F A;  2H5Y A;  4YIC A;  3O9P A;  5J1D A;  3FVK A;  4MF3 A;  1MY0 A;  4L17 A;  1MDQ A;  3C36 A;  3I6V A;  4FED A;  2FYI A;  3PUV E;  3VVF A;  3CR9 A;  3IB0 A;  3OSQ A;  1LGB C;  1BKA A;  2YPN A;  2E1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...