4G68C

Biochemical and structural insights into xylan utilization by the thermophilic bacteriumcaldanaerobius polysaccharolyticus
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
392
structure length
392
Chain Sequence
ITLTFWNLFTGEPAKTKVKEIIDQWNKENPNVQIVESVTENDAYKTKIKAAIAANEAPDIFQTWAGGFSQPFVEAGKVLQLDSYLNDGTKDQLLPGSFDNVTYNGKIYGIPFDQQASVLYINKELFDKYNVKVPTTFSELIDAIKTFKSKGVTPFALGEKDEWPGMWYYDMIALREGGVQLTRDALNGKASFDNQAFTDAAQKLQDMVNAGAFDSGFMGLTRDEATAEFNQGKAAMYFGGNFDAAAFVSDPSSLVKGKIEAVRFPTIEGGKGDPTEYIGGTVGALMVSANSKYKDEAVRAAKYLAKQLSDMDYLIATGLPAWKYDNIDQSKVDPLEIQIMNNIVANAKGSVPAWDIYLSGDAAQTHKDLVAQLFAKQITPEEYSKQMQQKIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Insights into Xylan Utilization by the Thermophilic Bacterium Caldanaerobius polysaccharolyticus.
pubmed doi rcsb
source organism Caldanaerobius
molecule tags Transport protein
molecule keywords ABC transporter
total genus 142
structure length 392
sequence length 392
ec nomenclature
pdb deposition date 2012-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g68C01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g68C02
3FUZA 4P0IA 1Y1ZA 4H1XA 4RA1A 4XTCQ 1I6BA 2YPNA 3M3LA 4RY1A 3SEXA 3DP8A 3LBSA 4YB7A 5H8SA 3WAFA 5I58B 3EHUA 3H7MA 1VR5A 1SYIA 2FA7A 1MXUA 2Z8FA 3E3KA 2XXWA 2XXHA 1VSOA 3O28A 3KZGA 3Q29A 5K2XA 5TP9B 5AA2B 2UVJA 5AE4A 1AOVA 1BIYA 1VFDA 1DSNA 1FW0A 2O51A 4K3FA 2QL3A 2DSFA 2XHDA 3M8UA 1MXWA 1QULA 1Y3QA 4XKNA 4RPNA 4ESWA 4QRZA 3E13X 1IITA 3FVKA 3KBRA 1SW4A 1DTGA 3KOSA 4HCYA 1ZBMA 2ALUA 2UYEA 4NF8A 5I57A 4F29A 4U4SA 2H5YA 2ANJA 3M3FA 1IZ1A 2DOJA 4OEVA 1B58A 3TFLA 5FHOA 4RK9A 2HAUA 3C34A 4QFNA 1R6ZA 3VV5A 2GHAA 2F78A 3B6QA 2XD3A 1RKMA 5B7DA 5DVIA 3TAJA 3V83A 1B6HA 2P1SA 1ZU0A 2F97A 2FNCA 2Q2AA 2DWIA 3VLVA 4OMBA 1B46A 3EHTA 1NNKA 1ELJA 4U22A 3VE1B 1NMUA 1PC3A 2V3TA 3OO9A 3DP4A 3IOVA 1B52A 5L8DA 2Z8EA 1Z7ME 1A54A 1B4ZA 1B5IA 1FTLA 3MBPA 3USDA 4ZDMA 1M5DA 1SYHA 2HZLA 1NNPA 2OWTA 3HHGA 3FJMA 3RN8A 2H25A 1US5A 4Q30B 1ZMGA 1MXVA 3VXCA 2R71A 3TYHA 5DYHA 3FASA 3HSTA 4LZ8A 1EH3A 2DE3A 2ZMBA 1JETA 3HV1A 4FJPA 3RTWB 3TTRA 2OK2A 4F39A 4PE5B 2OLBA 4FECA 2RC7A 5HBCA 4BDNA 2RKMA 4LP2B 4XKRA 1LAXA 4FIMA 2W7YA 2ONSA 3PD9A 3SDFA 1VFEA 3VVEA 1LBCA 2H9BA 3SEUA 4GIZA 2QMXA 1PEBA 5FTHA 1T0KA 4O3BA 1MDQA 4H65A 1LAGE 5ITOA 2Q9TA 3RLFE 1MQHA 2DVCA 2PVUA 1S7YA 1MPCA 5DEXA 3V8XB 4HTGA 4HW8A 2V84A 3G3KA 3RT8A 3IAZA 2Y7WA 2CZLA 3LR1A 4ZEKA 3TTMA 4EF2A 5I84A 3A09A 1B3FA 1H45A 1TFAA 4MBPA 1EZPA 1YPNA 1LB8A 3N26A 1OLAA 3G3JA 3PV0E 1URDA 3U8QA 4F2OA 1PB7A 4NF4A 1S9TA 3H4ZA 3S9NC 4IGTA 3FVOA 3RGYA 1SI1A 2V25A 3CFXA 3TODA 2Y7RA 3JV9A 2RCBA 3IL1B 4UA8A 1B05A 3RTFB 5CBSA 1BKAA 1FTMA 4IO2A 3GLBA 4Z7EA 4IY6A 4NF6B 1MM6A 5TPAB 4NWDA 1UIUA 1IUDA 1MXYA 2IEEA 1N76A 3GXAA 1A7LA 1B1HA 2OCUA 3IOUA 4KQPA 3RT6B 1QUKA 2UVIA 3ZKLA 3CI8A 2ONRA 4Q0CA 2PYYA 1NNTA 2I0CA 4OERA 5DEXB 1Y20A 2XX9A 4OVJA 4DE8A 1ZIUA 3L6HA 2ZNUA 2DP8A 3MZBA 2AIXA 4NWCA 1P1QA 3MPKA 3Q25A 5KCJA 4AB6A 1B0LA 1II5A 3N5LA 2XXRA 1N0TA 3PUZE 1LSTA 3K1MA 3KN7A 3IB0A 4QF9A 2KLFA 1M5CA 2UVHA 2UYFA 3G3IA 4RJZA 2H98A 2V3UA 4OFOA 2HCAA 5FHNA 1Z7NE 1IXCA 2THIA 4PETA 4G2ZA 1SI0A 2I0BA 1GTKA 1I6QA 2GH9A 3K1PA 2REGA 3KJ7A 3N6TA 2PT1A 4XXUA 1D3KA 1JW4A 3PMXA 4OQOA 4C0RA 4F1VA 3QIMA 3EPEA 3MAMA 5KDTA 3WAEA 3OSQA 5JTYB 5TP9A 4H8JA 4X48A 4JSDA 3TCHA 1AH5A 1B1XA 3TKDA 2G93A 5I59B 5DVJA 3LSLA 3U94A 2H4IA 2Z22A 3V89B 3MUQA 3B7DA 4TLMB 2NVUB 2DWJA 1FTJA 1XC1A 5CMCA 3THIA 5KCJB 1FCKA 1LLSA 4U2RA 4NE4A 4NF8B 4PP0A 2ZXTA 5I57B 2A5SA 4DCXA 5AA1A 2GHBA 3H6UA 3TZAA 3OOAA 4ZE9A 4G8HA 3VXBA 2RC9A 5A5XB 1MY0A 1N3XA 1NH8A 3OO8A 2NOOA 2HFBA 5F1QA 3TQLA 4GXSB 3TQWA 3LSWA 4AB5A 1SD3A 5J1DA 3BKIB 4I1DA 1Y3PA 4QFKA 1PB9A 1YTVA 1POY1 4IB2A 4JXIA 3MVWA 4IO5A 1M5EA 4YKPA 3OO6A 1I69A 2M8CA 3CRBA 3UIFA 4N6PA 4MLVA 1DPEA 3C9HA 2DE4A 1FQFA 4ND9A 2QS4A 1AIVA 4ZEFA 1Y4CA 2B65A 1FTOA 3TPAA 2QSXA 5CMBA 1ZJLA 4NTLA 1R9LA 3N94A 3AXFA 2XXUA 3KG2A 4G8NA 3QYTA 1MPDA 2HEUA 4OENA 4F3GA 3K02A 4LVQA 4R75A 3MP6A 3RNNA 3IB1A 1JVXA 3BFTA 3P7IA 1JW1A 5A5XA 5CMMA 1MQDA 1USYH 4R72A 4F1YA 3HN0A 4ISUA 5CI5A 1B3EA 1MQJA 4YKKA 4OXVA 2YJPA 4ZZAA 3TCGA 3D4GA 3ECRA 3FVNA 4ONYA 3VVDA 1P1WA 2X7PA 1CB6A 2QPQA 4NF5B 1UTHA 1BLFA 3HPIA 1ZKBA 2XXYA 1FQCA 1URGA 3G3FA 1H3DA 1UQWA 3OEMA 3PMVA 1A55A 5K2YA 1HSEA 5DVFA 4EDPA 1MXXA 3Q28A 4PFWA 4RYAA 4ZE8A 4N07A 3RPWA 2PMSA 2RC8A 4WEDA 3IORA 4XIGQ 4AQ4A 4NF4B 3GZGA 2I48A 4G4PA 3H03A 3H6WA 1A99A 3DELB 4IO4A 1NH7A 4H0WA 3FD3A 4FATA 3KJTA 2Z8DA 4EQ7A 2XX8A 3H6TA 1JQFA 4YB6A 4E0XA 4JBZA 1EZ9A 4POWA 3UN6A 1MS7A 2GFEA 2QS1A 4Q5TA 5EHMA 4WEPA 1GV8A 1LCFA 2QMWA 1GVCA 5ELVA 2YLNA 4GOTA 4R2BA 1JVYA 1A40A 1US4A 2E1SA 3K6WA 4QSDA 4DXBA 2I3VA 5IKBA 1UTHB 2D3IA 2Q8JA 4H6DA 4ZEIA 1SW5A 3S4UA 2P2AA 5TU0A 3HO7A 3PUWE 4QHQA 3ZS6A 4U23A 4BLAA 3UORA 4F18A 1M5BA 4KCCA 3A3CA 1SVXB 1LFIA 1B3HA 3IOTA 4N13A 3FVGA 4KR5A 2HAVA 3LC8A 4MH5A 4GL0A 4OYVA 1MY2A 4IY5A 1B7ZA 3OSRA 1SQYA 4GXAA 4TOZA 5JEIA 1ZLQA 4LQ5A 2G29A 3CVGA 2DS9A 3K0VA 1IQ7A 4LZ7A 3VLWA 3QXMA 2DVZA 3CSGA 1R1NA 2QS3A 2GRVA 4XKQA 1XS5A 3R6UA 5AA4B 4X1DA 4OEUA 1MY4A 3CFLA 1QKBA 4R9GA 1ANFA 1P1UA 3C35A 5KDTB 5JTYA 3G7WA 1H76A 3MJNA 3IJOB 1OLCA 3UGWA 2AL4A 3CG3A 3VFJA 4C1TA 4EXLA 5HPQA 2F35A 2X7QA 5I59A 1MRPA 1MY1A 1B4HA 3ILTB 4RPOA 1QKAA 2H99A 2OBGA 1TXFA 2B3BA 2QJEA 2VD2A 3K2DA 1MG1A 3Q27A 4LZ5A 1N04A 1MQIA 3FATA 3MP1A 4DLDA 3ILUB 1I6AA 4R6HA 4BDQA 1FQDA 2F6PA 2IA4A 5LOMA 1JW5A 1LBBA 2VHAA 3O6IA 1JEUA 1WODA 2F7CA 3IOWA 3CR9A 5KZTA 1Q35A 3O9PA 4OFJA 5EYFA 3DLNA 3GBBA 3PUYE 1OVBA 5ITPA 2DE2A 1Y1MA 4ZS9A 4RK2A 3PMWA 3VLUA 3U72A 3W9WA 3U1OA 3OD7A 5AA4A 1LB9A 3OO7A 1OMPA 5DTBA 3O29A 3SEYA 4YMAA 1B7UA 4O3AA 1FQAA 1TFDA 2Y7KA 1YCJA 3KOTA 3Q26A 5DT6A 4F31B 4FAJA 1WVJA 1XVYA 2E0SA 4R9FA 4F1UA 5BUUA 1EZOA 2ZYOA 2REJA 1XT8A 2NWJA 2RF1A 1USYE 2DYXA 3BBRA 3R7XA 2D21A 2ZNTA 4X9TA 1Y4TA 1O63A 2ABHA 2HZKA 1O7TA 3KN8A 4I62A 1D9YA 2ZYNA 3V5AA 3MW0A 4GF8A 2QRYA 2XXIA 3C36A 2F36A 4PFTA 4U1OA 3RQTA 3HCQA 3IO4A 4KYSA 2HXWA 4BDLA 3UP9A 5CC2A 5L9SA 3IJXB 1QUIA 2DWHA 4YAHX 3FIRA 4YKIA 5I2NA 3PD8A 3FV1A 3EF7A 3KSJA 3PPQA 1Y9UA 2BJJX 4G68A 4GFRA 4L17A 4RNSA 4EF1A 4F3BA 2I3WA 1MY3A 4EXKA 3N6UA 3K01A 4GQOA 3IO6A 3VDFA 4BDMA 1LFHA 4JWOA 4H5FA 3R26A 3O2AA 4TQUQ 3OMBA 5I2KA 2UXAA 1MQGA 1RYOA 3QK6A 2F7BA 3JZJA 4F22A 4NF5A 3FZVA 3MQ9A 5H8QB 3G3HA 2F6GA 3MZ9A 3FXQA 4DCYA 3ODBA 3TTKA 1TT1A 3OELA 3OEKA 3RY3A 3DM0A 1URSA 4NMYA 4DIGA 2I4BA 4YU0A 3T9VA 1L5TA 4YZZA 5IAIA 2O1LA 4YKJA 2XXTA 2Y7IA 4FE8A 3ZKKA 1PBPA 4DDDA 3ZSFA 3MVXA 4LONB 3ONMA 3H06B 3T9HB 3CG1A 3U93A 1N7XA 4BDRA 1IIWA 1SDXA 3D4CA 4IGRA 4ZECA 1SBPA 2I6EA 2I58A 2Q2CA 1HSLA 3HHFA 3FXRA 2VD3A 3KFMA 1JNFA 4I8CA 3W15C 5H8HB 1PBQA 5I2KB 1DMBA 2RINA 2O1MA 2ESNA 1AMFA 1LGBC 2LAOA 4IO6A 3EN3A 3KEIA 4U1ZA 4OTEA 3SKPA 2RCAA 2F34A 5H8QA 3L6GA 4U4XA 3O6HA 3LUYA 3CIJA 2V3QA 1QJMA 1IXHA 3CSBA 4KD5A 3I5OA 3H6VA 4ZZEA 4ECFA 3KN3A 2Q89A 5L9OA 4ZEDA 1TWYA 3T96B 4FEDA 5B70A 1UIVA 3BFUA 3FGSA 3LSXA 3QSLA 3TDJA 1DPPA 1NL5A 4R73A 3B6TA 3T22A 3E4RA 2WKYA 3MVYA 4QSEA 4XKPA 1B7HA 5CBRA 2I49A 3PGFA 1B5JA 4HS7A 3T93B 2AYSA 1B3GA 1R9QA 1OVTA 1FTKA 5F7VA 2ZYKA 2Z23A 1ATGA 3FJ7A 1BP5A 4MFIA 4PFYA 1B3LA 4YICA 3RUMA 1H44A 1UTBB 4WXJA 5H8HA 4P0GA 4ZEBA 1Y3NA 2XXXA 2ZYMA 2XXPA 3MPLA 4OESA 4R2FA 4LUBA 2XX7A 5L9MA 3SEWA 5I58A 5HM4B 1LCTA 2DQVA 1D9VA 2XD2A 3I6VA 3K6VA 1MDP1 5JK4A 4MF3A 5AA2A 3S9LC 2R9JA 2UVGA 4G68C 4WKMA 1B9JA 4C1UA 2HQ0A 1A8EA 2Q88A 3IB2A 1B32A 4GWOA 1SW2A 1B2HA 1QUJA 1NNFA 1QW0A 4JDFA 1MH4A 3TTNA 2XXVA 2QS2A 4KYDA 4MLQA 3EQ1A 5FTIA 4QFLA 5I56A 4H8IA 4R74A 3OXNA 4KYEA 4OFLA 3O97A 4EQ9A 3O6GA 3EHSA 4LQ2A 4OWDA 4QFPA 4M1VA 1UTBA 1FQBA 1XHYA 1XOCA 1MH3A 1M5FA 4U21A 4KHZE 1O64A 4DXUA 1P1OA 4NEDA 5ICTA 2VP1A 1WDNA 3LSFB 3PPOA 3MVZA 4H5GA 5CM6A 1MPBA 1H43A 2B3FA 3S9MC 3PPPA 4OZ9A 1OIBA 3QUFA 4M4GA 4KPTA 4ELPA 4GD5A 1GGGA 4JB7A 4JWYA 1P1NA 2ONKE 1LAHE 4GRKA 3S2VA 5AA3A 1B5HA 2NUVA 3VVFA 5ICQA 1LAFE 5ISUA 3PUVE 4F3SA 1FQEA 3K1NA 3C4MA 3C32A 1LFGA 3T9XB 2VOZA 4EUOA 3DP6A 3GBAA 2R6GE 3FJGA 3C33A 4ELQA 2DWAA 1OQHA 5I2NB 1QVSA 3CFZA 3M3KA 4QFOA 1A8FA 3KSXA 4G68B 5M2VA 3U92A 2O7UA 5I56B 3TUSA 5H8FA 4RXLA 3PU5A 4G77A 4DZ1A 3MC2A 4LA9A 4Q8RA 3FXUA 1CE2A 1PDAA 4Z0IA 2DXRA 2PT2A 4GL8A 4BDOA 2CMOA 4KFQA 1S50A 1SW1A 1D4NA 4GVOA 3TMGA 4F19A 3A3UA 3PPNA 3TELA 4E0WA 2X26A 4ESXA 1PB8A 1JEVA 2Y7PA 3PPRA 2OJTA 2O84X 4PFUA 3TEPA 4F2QA 4JWXA 3K4UA 4X1BA 1ZTYA 4O3CA 5FHMA 2F5XA 4P11A 4ELRA 3FV2A 4ELOA 1B40A 1IEJA 1YAEA 3W9VA 4R6KA 4KCDA 3JYRA 1NFTA 1DOTA 3MZ1A 4OHNA 3K00A 1MXZA 1N7WA 1OQGA 1P99A 2O69A 2XXQA 4IO3A 4FEBA 5H8FB 2A5TA 4F3PA 1N3WA 3KGCA 4POXA 2F8DA 3MP8A 4IO7A 1GR2A 3SERA 1IXGA 2O7IA 3QUJA 4YB5A 3E9XA 4YMBA 4I9DA 5H8NB 1J1NA 2F7AA 2NXOA 2VGQA 1B51A 4R6YA 1XVXA 1BTJA 2PBWA 3H3GA 4KI0E 4DXCA 4NF6A 4GLIA 3TCFA 2DXYA 1KWHA 1Q1KA 2D5WA 3K6UA 4QSCA 1RYXA 5CRYA 5TPAA 3UA8A 1N84A 1EU8A 1DTZA 2AL5A 2OZZA 3O66A 2P0SA 1POTA 2ZNSA 3C31A 4PQJA 3SEVA 3TTLA 1MM7A 3PUXE 1NKXA 4EQBA 3B6WA 3K6XA 1B0HA 4HCWA 4OETA 1HSJA 3G3GA 3UK4A 3SETA 3OENA 3IX1A 1F9BA 2PX1A 2I4CA 3IK6B 4UACA 2OWSA 3MWBA 4G8MA 2FYIA 4FORA 4JSOA 4H67A 2A5TB 3I3VA 3QAXA 4THIA 1VE4A 2O6AA 4TLLB 2V93A 5AA2D 5BWJA 1IXIA 3F11A 3S9EA 3IR1A 3SESA 5H8NA 5CMKA 2Y84A 4LATA 5EHSA 1AL3A 3T66A 2O68A 3T9UA
chains in the Genus database with same CATH superfamily
4OA4A 3DP8A 2XXWA 3KZGA 2F3BA 1FPIA 2O51A 3M8UA 1MXWA 4HE2A 4RPNA 4PFRA 3KBRA 3FVKA 3KOSA 1SW4A 1ZBMA 3CHGA 1IZ1A 4OEVA 1B58A 2HAUA 1RKMA 2Y5KA 2Q2AA 2PFZA 1B46A 4OMBA 1SPIA 1ELJA 4U22A 2V3TA 3OO9A 3MBPA 4ZDMA 4I3YA 2R71A 3TYHA 5DYHA 1EH3A 2OK2A 4PE5B 3VVEA 2H9BA 4GWWA 1MDQA 5ITOA 2Q9TA 4HW8A 3G3KA 3IAZA 2Y7WA 1YPNA 4NAPA 1BKAA 1FTMA 4IO2A 4Z7EA 4IY6A 4KXPA 5TPAB 1IUDA 3IOUA 4PFBA 2ONRA 1NNTA 5DEXB 2DP8A 4NWCA 5KCJA 4MCOA 4LN5A 3PUZE 2XXRA 1EYIA 1M5CA 4RJZA 4NHBA 1DCUA 5FHNA 4PETA 4P1EA 2I0BA 3K1PA 3KJ7A 4OQOA 3OSQA 5JTYB 5TP9A 4H8JA 4JSDA 1AH5A 1B1XA 2G93A 5DVJA 3LSLA 2DWJA 4U2RA 5I57B 2A5SA 4DCXA 4ZE9A 4G8HA 1N3XA 1NH8A 5F1QA 4GXSB 3LSWA 1PB9A 1POY1 3OO6A 1I69A 4N6PA 5IZ3A 2DE4A 1FQFA 1AIVA 1Y4CA 2XXUA 3KG2A 4G8NA 3IFCA 4GX3A 4LVQA 4R75A 5I3SA 4R72A 5CI5A 4YKKA 3D4GA 2X7PA 4NF5B 1ZKBA 3RYDA 3OEMA 3KC1A 1MXXA 1NV0A 4PFWA 4ZE8A 2PMSA 2RC8A 4XIGQ 3IORA 3H03A 3H6WA 2PFYA 4H0WA 4FATA 2XX8A 4YB6A 4XF5A 4JBZA 1MS7A 2GFEA 1GV8A 4WEPA 2QMWA 3K6WA 2E1SA 1FBDA 4DXBA 2I3VA 4H6DA 3HO7A 3PUWE 4QHQA 4U23A 4F18A 4MIJA 4PBQA 4KCCA 4MH5A 4TOZA 2DS9A 1IQ7A 3KC0A 2DVZA 2GRVA 5AA4B 1XS5A 4X1DA 4OEUA 1EYKA 3MJNA 5HPQA 2X7QA 1JP4A 5I59A 1TXFA 2VD2A 3K2DA 1MG1A 4LZ5A 4P1LA 3FATA 4DLDA 1I6AA 3O6IA 3IOWA 3GBBA 2DE2A 1Y1MA 3VLUA 3U1OA 3OO7A 5DTBA 4YMAA 4O3AA 1FQAA 1TFDA 5DW8A 4F31B 4N8YA 5DT6A 2E0SA 4MNCA 2ZNTA 5FBPA 1Y4TA 4H45A 4I62A 1O7TA 1D9YA 4U1OA 2F36A 3HCQA 3IO4A 4N6DA 5CC2A 2DWHA 4YAHX 2VPNA 4YKIA 3PD8A 3FV1A 3EF7A 4GFRA 4G68A 1Y9UA 5I2NA 2XA5A 4L17A 3N6UA 4XEQA 3IO6A 4NN3A 3O2AA 4TQUQ 5I2KA 1MQGA 5EQAA 3DM0A 4DIGA 2I4BA 2Y7IA 1RDXA 3NOHA 3U93A 1IMEA 1SBPA 3PTYA 2XWKA 2I6EA 3HHFA 3KFMA 2VD3A 2V4CA 4I8CA 1AMFA 3SKPA 4IO6A 4U1ZA 1IXHA 3T96B 4FEDA 3B6TA 1NUXA 3MVYA 1B5JA 1B3GA 1R9QA 3FJ7A 1ATGA 3RUMA 1H44A 1UTBB 4ZEBA 2ZYMA 2XXPA 4O7MA 2DQVA 1D9VA 5AA2A 4GWOA 1A8EA 1SW2A 5ESYA 1QUJA 4MLQA 4H8IA 4NF0A 2WEFA 3O97A 4M1VA 1VDWA 1MH3A 5ICTA 3MVZA 5CM6A 2B3FA 3FBPA 3VVFA 3T9XB 3DP6A 2DWAA 1OQHA 3CFZA 5M2VA 3U92A 2O7UA 1FBHA 3PU5A 3FXUA 4Z0IA 2PT2A 4BDOA 1S50A 5ET6A 2HHMA 4ESXA 3PPRA 4GX6A 2OJTA 3K4UA 2F5XA 4ELRA 4ELOA 4R6KA 1FPFA 1OQGA 1P99A 2O69A 4FEBA 5H8FB 2A5TA 3KGCA 3MP8A 3SERA 1IXGA 2BJIA 2P3NA 1J1NA 2NXOA 4R6YA 2PBWA 3TCFA 1KWHA 5TPAA 5CRYA 4I3EA 3PMVA 1N84A 3TTLA 2P0SA 2QVRA 1YXIA 3PUXE 3K6XA 2PX1A 4G8MA 2FYIA 4JSOA 4H67A 3I3VA 5BWJA 1VE4A 3S9EA 3IR1A 2Y84A 4NQ8A 4PDDA 1NV7A 1Y1ZA 2XWOA 4RA1A 4XTCQ 1I6BA 3WAFA 3EHUA 1SYIA 2FA7A 5TP9B 5K2XA 4AS4A 1AOVA 1DSNA 2DSFA 2XHDA 4ESWA 4PAKA 1IITA 1DTGA 5I57A 4JVDA 2H5YA 2CZHA 3TFLA 4RK9A 1R6ZA 2XD3A 5B7DA 5T3JA 1ZU0A 1G0IA 4MNIA 3DP4A 3IOVA 1B52A 1Z7ME 1A54A 1FTLA 5IZ3B 3E78A 1SYHA 1NNPA 3RN8A 2H25A 1ZMGA 2HXRA 3HSTA 2OLBA 5HBCA 4LP2B 4XKRA 1YYZA 2ONSA 3ROJA 1VFEA 1LBCA 2QMXA 3RLFE 1MQHA 5DEXA 1MPCA 5KZTA 4PCDA 1H45A 1LB8A 1G0HA 3PV0E 1S9TA 3H4ZA 5IM2A 4IGTA 3RGYA 1SI1A 3IL1B 1B05A 3GLBA 4NF6B 1FBGA 1UIUA 1A7LA 3MSTA 2UVIA 4Q0CA 2XWIA 2PYYA 4OERA 1Y20A 2XX9A 2ZNUA 1N0TA 2KLFA 2H98A 2HCAA 1IXCA 4G2ZA 2GH9A 3N6TA 1D3KA 1JW4A 4MNPA 3MAMA 5KDTA 4X48A 4N4UA 5I59B 5KCJB 3B7DA 2VPOA 2ZZVA 1FCKA 4PP0A 3H6UA 1CNQA 3TZAA 3VXBA 1MY0A 3TQLA 4PGNA 3U65A 4IB2A 4JXIA 3MVWA 1M5EA 2M8CA 3CRBA 3UIFA 4MLVA 1DPEA 3C9HA 4ZEFA 2QSXA 1ZJLA 3AXFA 3QYTA 2HEUA 4OENA 1FBEA 3MP6A 4GBWA 3P7IA 1JW1A 5A5XA 3HN0A 4OXVA 1D9QA 4ZZAA 1CB6A 4N6KA 2XXYA 1FQCA 4IR8A 5K2YA 1XI6A 4HE0A 4WEDA 4NF4B 4G4PA 3DELB 1NH7A 4NGUA 4E0XA 1JQFA 4POWA 3UN6A 1UTHB 2D3IA 2ZZWA 3UORA 4UABA 4KR5A 2HAVA 4IY5A 5JEIA 1SQYA 4LQ5A 2G29A 3K0VA 4LZ7A 1MY4A 3CFLA 1ANFA 1P1UA 5JTYA 5EQ8A 1MRPA 1MY1A 3B8BA 4O94A 2QJEA 3ILUB 1NUWA 4R6HA 4H46A 1FQDA 1JW5A 1WODA 2F7CA 3CR9A 1Q35A 3O9PA 3PUYE 3W9WA 5AA4A 1LB9A 1B7UA 1YCJA 1WVJA 1XVYA 1EZOA 2ZYOA 2REJA 1XT8A 1USYE 2DYXA 3R7XA 2ABHA 4PDHA 4DZ1A 1LBVA 2ZYNA 4PFTA 3RQTA 1RDYA 2Q8MA 2HXWA 4BDLA 3UP9A 3FIRA 4RNSA 2BJJX 2I3WA 2GQ1A 4EXKA 3K01A 4GQOA 3VDFA 4JWOA 3R26A 4F22A 5ET8A 3FXQA 1BK4A 4N81A 3T9VA 1L5TA 4YZZA 3ZKKA 3ZSFA 1NV3A 3MVXA 4LONB 3ONMA 4BDRA 3D4CA 2Q2CA 3FXRA 2Q74A 1JNFA 1PBQA 2RINA 2ESNA 3KEIA 2RCAA 4U4XA 3O6HA 1FBCA 3CIJA 3CSBA 4KD5A 3H6VA 1TWYA 5B70A 3BFUA 3FGSA 4PBHA 4R73A 3MYUA 3E4RA 5CBRA 4XKPA 1B7HA 3PGFA 4HS7A 2AYSA 1FTKA 4PGPA 2Z23A 4BDQA 5H8HA 4P0GA 2XXXA 5L9MA 4LUBA 3SEWA 5HM4B 3K6VA 1KA0A 3S9LC 1B9JA 2HQ0A 2Q88A 1B2HA 4JDFA 4QFLA 4R74A 4P3LA 4I40A 4EQ9A 4LQ2A 3EHSA 1UTBA 1FQBA 1XOCA 4KHZE 3PPOA 4H5GA 3LSFB 1MPBA 3S9MC 1P1NA 5IGAA 3RPLA 5ISUA 1EYJA 3C4MA 3C32A 4EUOA 4P47A 3GBAA 2R6GE 1QVSA 4QFOA 3KSXA 4G68B 4Q8RA 2DXRA 4GL8A 4KFQA 2FVZA 1SW1A 3PPNA 4GWUA 3TELA 2X26A 2OWZA 2Y7PA 3TEPA 4JWXA 4OANA 4QXDA 4P11A 3FXBA 1B40A 1IMFA 4KCDA 1NFTA 3MZ1A 4OHNA 3K00A 4IO3A 4F3PA 1N3WA 2F8DA 4IO7A 5H8NB 4PF6A 2F7AA 1B51A 4DXCA 1BTJA 3H3GA 4KI0E 1RYXA 2OZZA 1NKXA 3BIGA 4OETA 3UK4A 3SETA 3IX1A 3IK6B 4O8MA 3QAXA 4TLLB 2O6AA 2B4MA 1IXIA 5CMKA 3T9UA 3FUZA 4P0IA 2YPNA 3SEXA 5I58B 3LBSA 4YB7A 5H8SA 3H7MA 2Z8FA 3E3KA 2XXHA 1VSOA 3O28A 3Q29A 5AA2B 5AE4A 1BIYA 1FW0A 4P8BA 1Y3QA 4QRZA 4NF8A 5EYGA 2UYEA 4F29A 4U4SA 2ANJA 2DOJA 3VV5A 2GHAA 3B6QA 3TAJA 1B6HA 2P1SA 2F97A 2FNCA 3VLVA 2DWIA 1NV6A 1NNKA 3VE1B 1NMUA 1PC3A 5L8DA 3USDA 1M5DA 5EYHA 3HHGA 1US5A 4Q30B 1MXVA 2FIEA 2DE3A 3HV1A 4FJPA 4F39A 5IZZA 4BDNA 2RKMA 5EQ7A 1LBWA 1T0KA 1LAGE 2DVCA 2PVUA 1S7YA 2WYPA 3V8XB 2V84A 5I84A 3LR1A 3TTMA 4EF2A 3A09A 1B3FA 3N26A 1URDA 4F2OA 1PB7A 4NF4A 3FVOA 3CFXA 2Y7RA 2KQZA 2RCBA 4UA8A 3RTFB 5CBSA 4NWDA 2WBBA 3GXAA 2IEEA 1N76A 4KQPA 5IZ1A 3ZKLA 1QUKA 4GWZA 2I0CA 4DE8A 3MZBA 1P1QA 3Q25A 4AB6A 3N5LA 3KN7A 3IB0A 4N8GA 2UVHA 3G3IA 4P9KA 4OFOA 1Z7NE 1QGXA 2THIA 1GTKA 1I6QA 4C0RA 3PMXA 3QIMA 3EPEA 3U94A 2H4IA 3HFUA 3V89B 4TLMB 2NVUB 1XC1A 5CMCA 1LLSA 4NE4A 2GHBA 2WYKA 4MX6A 5A5XB 2NOOA 5J1DA 1SD3A 3BKIB 4I1DA 2XWVA 3KBZA 5EQ9A 4GWYA 4YKPA 5ET7A 1FTOA 2B65A 5CMBA 4NTLA 1R9LA 3N94A 1FPKA 1MPDA 4F3GA 3K02A 2KR0A 4N91A 5CMMA 1USYH 4ISUA 1MQJA 4N15A 1P1WA 2QPQA 1UTHA 1URGA 1H3DA 4EDPA 3RPWA 4N07A 3GZGA 1A99A 3FD3A 3KJTA 4EQ7A 1EZ9A 2QS1A 1LCFA 1GVCA 5ELVA 4GOTA 4R2BA 4QSDA 1Q9DA 4ZEIA 2P2AA 5TU0A 3QMFA 4BLAA 4GWXA 1M5BA 4MEVA 1SVXB 1B3HA 3IOTA 3FVGA 3LC8A 4GL0A 3OSRA 4GXAA 2OX3A 3CVGA 3VLWA 3CSGA 2QS3A 3R6UA 4PF8A 3C35A 5KDTB 2VT5A 1H76A 3IJOB 1OLCA 2AL4A 3CG3A 3VFJA 4C1TA 4EXLA 5LDZA 4RPOA 2H99A 4MMPA 1AWBA 1MQIA 5LOMA 2ZZXA 1LBBA 2VHAA 4OVRA 3ISPA 3DLNA 5ITPA 1OVBA 3U72A 3OD7A 1OMPA 3SEYA 3O29A 5BUUA 4R9FA 4F1UA 3BBRA 4X9TA 1O63A 3V5AA 4GF8A 2XXIA 5L9SA 3IJXB 2JJKA 3KSJA 3PPQA 2WBDA 4N17A 4EF1A 4BDMA 4OVQA 3OMBA 3QK6A 3JZJA 2HPGA 3MQ9A 5H8QB 3G3HA 3MZ9A 1INPA 3ODBA 3OELA 1URSA 4YU0A 3LUZA 2XXTA 4FE8A 1PBPA 3T1BA 3T9HB 3CG1A 1N7XA 1IIWA 1SDXA 4ZECA 4IGRA 2I58A 1HSLA 3W15C 5H8HB 4PTKA 2LAOA 3EN3A 3L6GA 4GX4A 2V3QA 1QJMA 4ECFA 3I5OA 4X8RA 4X04A 4ZEDA 3LSXA 1DPPA 1NL5A 2WKYA 4QSEA 2I49A 3T93B 1FJ6A 1OVTA 5F7VA 1BP5A 4OESA 4R2FA 5I58A 1LCTA 3I6VA 1MDP1 1DK4A 1LBYA 4MF3A 4C1UA 1QW0A 2QS2A 3EQ1A 5FTIA 3OXNA 4QFPA 1M5FA 4OVTA 1H43A 3D1RA 3PPPA 2FIXA 4JB7A 5AA3A 4GRKA 2NUVA 4ELQA 5I56B 1FSAA 4RXLA 1CE2A 1PDAA 4HE1A 3TMGA 1D4NA 3A3UA 3T0JA 1JEVA 3RPLB 2O84X 4F2QA 4GWSA 1IMCA 4O3CA 3FV2A 1IMDA 1IEJA 3W9VA 1DOTA 4NX1A 2O7IA 4I9DA 1XVXA 2DXYA 3K6UA 1Q1KA 2D5WA 3UA8A 4QSCA 3O66A 3SEVA 3C31A 1POTA 2ZNSA 4PQJA 1NI9A 3G3GA 4OVSA 3OENA 1LEVA 2I4CA 3MWBA 4FORA 5AA2D 2L5VA 4MJOA 5H8NA 4HXVA 4H1XA 3M3LA 4RY1A 1FTAA 4G61A 1VR5A 1MXUA 5I5PA 2UVJA 1VFDA 4K3FA 2QL3A 4O7IA 1QULA 4XKNA 3E13X 4HCYA 4DI3D 2ALUA 4OVPA 4FBPA 1YZ0A 3M3FA 1NUYA 5FHOA 3C34A 4QFNA 2F78A 5F24A 5DVIA 3V83A 2MKZA 3EHTA 2Z8EA 1B5IA 1B4ZA 2R8TA 2HZLA 2OWTA 3FJMA 1KZ8A 3VXCA 3FASA 4LZ8A 2ZMBA 1JETA 3TTRA 3RTWB 5I7IA 4FECA 2RC7A 1LAXA 4FIMA 2W7YA 3PD9A 3SDFA 3SEUA 4GIZA 1PEBA 5FTHA 4O3BA 4H65A 4HTGA 3RT8A 2CZLA 4ZEKA 2FHYA 1TFAA 4MBPA 1EZPA 1OLAA 3A29A 3G3JA 3U8QA 3S9NC 2V25A 3TODA 3JV9A 1NV1A 2CEXA 1MM6A 1MXYA 3RT6B 1B1HA 2OCUA 3CI8A 5A5LA 4OVJA 1ZIUA 3L6HA 2AIXA 3MPKA 1FPDA 1B0LA 1FBFA 1II5A 1LSTA 4AS5A 3K1MA 4QF9A 2UYFA 2QFLA 2V3UA 1SI0A 4XXUA 4PAFA 2REGA 2PT1A 4F1VA 3WAEA 3TCHA 3TKDA 1FPBA 2Z22A 2CZIA 3MUQA 1FTJA 3THIA 4QBAA 4NF8B 2ZXTA 5AA1A 3OOAA 2FBPA 2RC9A 3OO8A 2HFBA 3TQWA 4AB5A 1Y3PA 1FBPA 4QFKA 5ET5A 1YTVA 4IO5A 1IMAA 4PAIA 4ND9A 2QS4A 3TPAA 3GYYA 3RNNA 3IB1A 1JVXA 3BFTA 1NV2A 1FRPA 1MQDA 4F1YA 1B3EA 2YJPA 3TCGA 2CZKA 3ECRA 3FVNA 4ONYA 3VVDA 4NG7A 1BLFA 1FJ9A 3HPIA 3G3FA 1UQWA 1A55A 1KA1A 1HSEA 4PC9A 5DVFA 3Q28A 4RYAA 4AQ4A 2I48A 4GBVA 4IO4A 2P3VA 2Z8DA 3H6TA 4PFIA 5EHMA 4Q5TA 1LBXA 4P56A 3SZPA 2YLNA 1JVYA 1A40A 1US4A 2DDKA 5IKBA 5J16A 2Q8JA 3S4UA 1SW5A 2CEYA 3ZS6A 3A3CA 4MHFA 1LFIA 1FPJA 4N13A 4OYVA 1MY2A 1B7ZA 1ZLQA 1K9YA 2QVVA 3QXMA 1NV4A 4XKQA 1R1NA 1QKBA 4R9GA 4MAGA 3G7WA 3UGWA 2F35A 1B4HA 3ILTB 1QKAA 2OBGA 2B3BA 3Q27A 3E79A 1N04A 3MP1A 2F6PA 2IA4A 1JEUA 4OFJA 2XXKA 2WX9A 4JVIA 5EYFA 2QVUA 1LBZA 4ZS9A 4RK2A 3PMWA 3Q26A 3KOTA 2Y7KA 4FAJA 2NWJA 2RF1A 2D21A 2HZKA 3KN8A 3MW0A 2QRYA 3C36A 4KYSA 1FPLA 1QUIA 3TTKA 4F3BA 1MY3A 1LFHA 4H5FA 2UXAA 2F3DA 1RYOA 2F7BA 1IMBA 4NF5A 3FZVA 1RDZA 2F6GA 4DCYA 1TT1A 2B4LA 3OEKA 3RY3A 4NMYA 5IAIA 2O1LA 3IFAA 4YKJA 4DDDA 3H06B 5I2KB 1DMBA 2O1MA 4PE3A 1LGBC 4OTEA 2F34A 5H8QA 3LUYA 5LTCA 4ZZEA 3KN3A 3EKIA 2Q89A 5L9OA 1UIVA 2PCRA 3QSLA 3TDJA 3T22A 2ZYKA 4PFYA 4YICA 4MFIA 1B3LA 4WXJA 1Y3NA 3MPLA 2XX7A 5JK4A 2XD2A 2R9JA 2UVGA 4G68C 4WKMA 3IB2A 1B32A 1NNFA 1MH4A 3TTNA 2XXVA 2Y5LA 4KYDA 5I56A 4KYEA 4OFLA 3O6GA 4OWDA 1XHYA 4U21A 4DXUA 1O64A 1P1OA 4NEDA 2VP1A 1WDNA 4OZ9A 1OIBA 3QUFA 4M4GA 4KPTA 4ELPA 4GD5A 1GGGA 4JWYA 3S2VA 2ONKE 1LAHE 1B5HA 5ICQA 1LAFE 3PUVE 4F3SA 1FQEA 3K1NA 1LFGA 2VOZA 3FJGA 3C33A 5I2NB 3M3KA 1A8FA 3TUSA 5H8FA 1NV5A 1FPEA 4G77A 1DBZA 3MC2A 4LA9A 4JVCA 2CMOA 4F19A 4GVOA 4XFEA 4E0WA 1PB8A 4PFUA 4X1BA 1ZTYA 5FHMA 1YAEA 3JYRA 1MXZA 1N7WA 2XXQA 4POXA 1GR2A 4YB5A 3QUJA 4YMBA 3E9XA 4DI4B 2VGQA 1FPGA 4NF6A 4GLIA 1K9ZA 1EU8A 1DTZA 2AL5A 1MM7A 4EQBA 3B6WA 3B50A 1B0HA 1NUZA 4HCWA 1HSJA 3BIHA 1F9BA 4UACA 2OWSA 2A5TB 4THIA 2V93A 3F11A 3SESA 3LV0A 5EHSA 4LATA 1AL3A 3T66A 2O68A
chains in the Genus database with same CATH topology
3FUZA 4P0IA 1Y1ZA 4H1XA 4RA1A 4XTCQ 1I6BA 2YPNA 3M3LA 4RY1A 3SEXA 3DP8A 3LBSA 4YB7A 5H8SA 3WAFA 5I58B 3EHUA 3H7MA 1VR5A 1SYIA 2FA7A 1MXUA 2Z8FA 3E3KA 2XXWA 2XXHA 1VSOA 3O28A 3KZGA 3Q29A 5K2XA 5TP9B 5AA2B 2UVJA 5AE4A 1AOVA 1BIYA 1VFDA 1DSNA 1FW0A 2O51A 4K3FA 2QL3A 2DSFA 2XHDA 3M8UA 1MXWA 1QULA 1Y3QA 4XKNA 4RPNA 4ESWA 4QRZA 3E13X 1IITA 3FVKA 3KBRA 1SW4A 1DTGA 3KOSA 4HCYA 1ZBMA 2ALUA 2UYEA 4NF8A 5I57A 4F29A 4U4SA 2H5YA 2ANJA 3M3FA 1IZ1A 2DOJA 4OEVA 1B58A 3TFLA 5FHOA 4RK9A 2HAUA 3C34A 4QFNA 1R6ZA 3VV5A 2GHAA 2F78A 3B6QA 2XD3A 1RKMA 5B7DA 5DVIA 3TAJA 3V83A 1B6HA 2P1SA 1ZU0A 2F97A 2FNCA 2Q2AA 2DWIA 3VLVA 4OMBA 1B46A 3EHTA 1NNKA 1ELJA 4U22A 3VE1B 1NMUA 1PC3A 2V3TA 3OO9A 3DP4A 3IOVA 1B52A 5L8DA 2Z8EA 1Z7ME 1A54A 1B4ZA 1B5IA 1FTLA 3MBPA 3USDA 4ZDMA 1M5DA 1SYHA 2HZLA 1NNPA 2OWTA 3HHGA 3FJMA 3RN8A 2H25A 1US5A 4Q30B 1ZMGA 1MXVA 3VXCA 2R71A 3TYHA 5DYHA 3FASA 3HSTA 4LZ8A 1EH3A 2DE3A 2ZMBA 1JETA 3HV1A 4FJPA 3RTWB 3TTRA 2OK2A 4F39A 4PE5B 2OLBA 4FECA 2RC7A 5HBCA 4BDNA 2RKMA 4LP2B 4XKRA 1LAXA 4FIMA 2W7YA 2ONSA 3PD9A 3SDFA 1VFEA 3VVEA 1LBCA 2H9BA 3SEUA 4GIZA 2QMXA 1PEBA 5FTHA 1T0KA 4O3BA 1MDQA 4H65A 1LAGE 5ITOA 2Q9TA 3RLFE 1MQHA 2DVCA 2PVUA 1S7YA 1MPCA 5DEXA 3V8XB 4HTGA 4HW8A 2V84A 3G3KA 3RT8A 3IAZA 2Y7WA 2CZLA 3LR1A 4ZEKA 3TTMA 4EF2A 5I84A 3A09A 1B3FA 1H45A 1TFAA 4MBPA 1EZPA 1YPNA 1LB8A 3N26A 1OLAA 3G3JA 3PV0E 1URDA 3U8QA 4F2OA 1PB7A 4NF4A 1S9TA 3H4ZA 3S9NC 4IGTA 3FVOA 3RGYA 1SI1A 2V25A 3CFXA 3TODA 2Y7RA 3JV9A 2RCBA 3IL1B 4UA8A 1B05A 3RTFB 5CBSA 1BKAA 1FTMA 4IO2A 3GLBA 4Z7EA 4IY6A 4NF6B 1MM6A 5TPAB 4NWDA 1UIUA 1IUDA 1MXYA 2IEEA 1N76A 3GXAA 1A7LA 1B1HA 2OCUA 3IOUA 4KQPA 3RT6B 1QUKA 2UVIA 3ZKLA 3CI8A 2ONRA 4Q0CA 2PYYA 1NNTA 2I0CA 4OERA 5DEXB 1Y20A 2XX9A 4OVJA 4DE8A 1ZIUA 3L6HA 2ZNUA 2DP8A 3MZBA 2AIXA 4NWCA 1P1QA 3MPKA 3Q25A 5KCJA 4AB6A 1B0LA 1II5A 3N5LA 2XXRA 1N0TA 3PUZE 1LSTA 3K1MA 3KN7A 3IB0A 4QF9A 2KLFA 1M5CA 2UVHA 2UYFA 3G3IA 4RJZA 2H98A 2V3UA 4OFOA 2HCAA 5FHNA 1Z7NE 1IXCA 2THIA 4PETA 4G2ZA 1SI0A 2I0BA 1GTKA 1I6QA 2GH9A 3K1PA 2REGA 3KJ7A 3N6TA 2PT1A 4XXUA 1D3KA 1JW4A 3PMXA 4OQOA 4C0RA 4F1VA 3QIMA 3EPEA 3MAMA 5KDTA 3WAEA 3OSQA 5JTYB 5TP9A 4H8JA 4X48A 4JSDA 3TCHA 1AH5A 1B1XA 3TKDA 2G93A 5I59B 5DVJA 3LSLA 3U94A 2H4IA 2Z22A 3V89B 3MUQA 3B7DA 4TLMB 2NVUB 2DWJA 1FTJA 1XC1A 5CMCA 3THIA 5KCJB 1FCKA 1LLSA 4U2RA 4NE4A 4NF8B 4PP0A 2ZXTA 5I57B 2A5SA 4DCXA 5AA1A 2GHBA 3H6UA 3TZAA 3OOAA 4ZE9A 4G8HA 3VXBA 2RC9A 5A5XB 1MY0A 1N3XA 1NH8A 3OO8A 2NOOA 2HFBA 5F1QA 3TQLA 4GXSB 3TQWA 3LSWA 4AB5A 1SD3A 5J1DA 3BKIB 4I1DA 1Y3PA 4QFKA 1PB9A 1YTVA 1POY1 4IB2A 4JXIA 3MVWA 4IO5A 1M5EA 4YKPA 3OO6A 1I69A 2M8CA 3CRBA 3UIFA 4N6PA 4MLVA 1DPEA 3C9HA 2DE4A 1FQFA 4ND9A 2QS4A 1AIVA 4ZEFA 1Y4CA 2B65A 1FTOA 3TPAA 2QSXA 5CMBA 1ZJLA 4NTLA 1R9LA 3N94A 3AXFA 2XXUA 3KG2A 4G8NA 3QYTA 1MPDA 2HEUA 4OENA 4F3GA 3K02A 4LVQA 4R75A 3MP6A 3RNNA 3IB1A 1JVXA 3BFTA 3P7IA 1JW1A 5A5XA 5CMMA 1MQDA 1USYH 4R72A 4F1YA 3HN0A 4ISUA 5CI5A 1B3EA 1MQJA 4YKKA 4OXVA 2YJPA 4ZZAA 3TCGA 3D4GA 3ECRA 3FVNA 4ONYA 3VVDA 1P1WA 2X7PA 1CB6A 2QPQA 4NF5B 1UTHA 1BLFA 3HPIA 1ZKBA 2XXYA 1FQCA 1URGA 3G3FA 1H3DA 1UQWA 3OEMA 3PMVA 1A55A 5K2YA 1HSEA 5DVFA 4EDPA 1MXXA 3Q28A 4PFWA 4RYAA 4ZE8A 4N07A 3RPWA 2PMSA 2RC8A 4WEDA 3IORA 4XIGQ 4AQ4A 4NF4B 3GZGA 2I48A 4G4PA 3H03A 3H6WA 1A99A 3DELB 4IO4A 1NH7A 4H0WA 3FD3A 4FATA 3KJTA 2Z8DA 4EQ7A 2XX8A 3H6TA 1JQFA 4YB6A 4E0XA 4JBZA 1EZ9A 4POWA 3UN6A 1MS7A 2GFEA 2QS1A 4Q5TA 5EHMA 4WEPA 1GV8A 1LCFA 2QMWA 1GVCA 5ELVA 2YLNA 4GOTA 4R2BA 1JVYA 1A40A 1US4A 2E1SA 3K6WA 4QSDA 4DXBA 2I3VA 5IKBA 1UTHB 2D3IA 2Q8JA 4H6DA 4ZEIA 1SW5A 3S4UA 2P2AA 5TU0A 3HO7A 3PUWE 4QHQA 3ZS6A 4U23A 4BLAA 3UORA 4F18A 1M5BA 4KCCA 3A3CA 1SVXB 1LFIA 1B3HA 3IOTA 4N13A 3FVGA 4KR5A 2HAVA 3LC8A 4MH5A 4GL0A 4OYVA 1MY2A 4IY5A 1B7ZA 3OSRA 1SQYA 4GXAA 4TOZA 5JEIA 1ZLQA 4LQ5A 2G29A 3CVGA 2DS9A 3K0VA 1IQ7A 4LZ7A 3VLWA 3QXMA 2DVZA 3CSGA 1R1NA 2QS3A 2GRVA 4XKQA 1XS5A 3R6UA 5AA4B 4X1DA 4OEUA 1MY4A 3CFLA 1QKBA 4R9GA 1ANFA 1P1UA 3C35A 5KDTB 5JTYA 3G7WA 1H76A 3MJNA 3IJOB 1OLCA 3UGWA 2AL4A 3CG3A 3VFJA 4C1TA 4EXLA 5HPQA 2F35A 2X7QA 5I59A 1MRPA 1MY1A 1B4HA 3ILTB 4RPOA 1QKAA 2H99A 2OBGA 1TXFA 2B3BA 2QJEA 2VD2A 3K2DA 1MG1A 3Q27A 4LZ5A 1N04A 1MQIA 3FATA 3MP1A 4DLDA 3ILUB 1I6AA 4R6HA 4BDQA 1FQDA 2F6PA 2IA4A 5LOMA 1JW5A 1LBBA 2VHAA 3O6IA 1JEUA 1WODA 2F7CA 3IOWA 3CR9A 5KZTA 1Q35A 3O9PA 4OFJA 5EYFA 3DLNA 3GBBA 3PUYE 1OVBA 5ITPA 2DE2A 1Y1MA 4ZS9A 4RK2A 3PMWA 3VLUA 3U72A 3W9WA 3U1OA 3OD7A 5AA4A 1LB9A 3OO7A 1OMPA 5DTBA 3O29A 3SEYA 4YMAA 1B7UA 4O3AA 1FQAA 1TFDA 2Y7KA 1YCJA 3KOTA 3Q26A 5DT6A 4F31B 4FAJA 1WVJA 1XVYA 2E0SA 4R9FA 4F1UA 5BUUA 1EZOA 2ZYOA 2REJA 1XT8A 2NWJA 2RF1A 1USYE 2DYXA 3BBRA 3R7XA 2D21A 2ZNTA 4X9TA 1Y4TA 1O63A 2ABHA 2HZKA 1O7TA 3KN8A 4I62A 1D9YA 2ZYNA 3V5AA 3MW0A 4GF8A 2QRYA 2XXIA 3C36A 2F36A 4PFTA 4U1OA 3RQTA 3HCQA 3IO4A 4KYSA 2HXWA 4BDLA 3UP9A 5CC2A 5L9SA 3IJXB 1QUIA 2DWHA 4YAHX 3FIRA 4YKIA 5I2NA 3PD8A 3FV1A 3EF7A 3KSJA 3PPQA 1Y9UA 2BJJX 4G68A 4GFRA 4L17A 4RNSA 4EF1A 4F3BA 2I3WA 1MY3A 4EXKA 3N6UA 3K01A 4GQOA 3IO6A 3VDFA 4BDMA 1LFHA 4JWOA 4H5FA 3R26A 3O2AA 4TQUQ 3OMBA 5I2KA 2UXAA 1MQGA 1RYOA 3QK6A 2F7BA 3JZJA 4F22A 4NF5A 3FZVA 3MQ9A 5H8QB 3G3HA 2F6GA 3MZ9A 3FXQA 4DCYA 3ODBA 3TTKA 1TT1A 3OELA 3OEKA 3RY3A 3DM0A 1URSA 4NMYA 4DIGA 2I4BA 4YU0A 3T9VA 1L5TA 4YZZA 5IAIA 2O1LA 4YKJA 2XXTA 2Y7IA 4FE8A 3ZKKA 1PBPA 4DDDA 3ZSFA 3MVXA 4LONB 3ONMA 3H06B 3T9HB 3CG1A 3U93A 1N7XA 4BDRA 1IIWA 1SDXA 3D4CA 4IGRA 4ZECA 1SBPA 2I6EA 2I58A 2Q2CA 1HSLA 3HHFA 3FXRA 2VD3A 3KFMA 1JNFA 4I8CA 3W15C 5H8HB 1PBQA 5I2KB 1DMBA 2RINA 2O1MA 2ESNA 1AMFA 1LGBC 2LAOA 4IO6A 3EN3A 3KEIA 4U1ZA 4OTEA 3SKPA 2RCAA 2F34A 5H8QA 3L6GA 4U4XA 3O6HA 3LUYA 3CIJA 2V3QA 1QJMA 1IXHA 3CSBA 4KD5A 3I5OA 3H6VA 4ZZEA 4ECFA 3KN3A 2Q89A 5L9OA 4ZEDA 1TWYA 3T96B 4FEDA 5B70A 1UIVA 3BFUA 3FGSA 3LSXA 3QSLA 3TDJA 1DPPA 1NL5A 4R73A 3B6TA 3T22A 3E4RA 2WKYA 3MVYA 4QSEA 4XKPA 1B7HA 5CBRA 2I49A 3PGFA 1B5JA 4HS7A 3T93B 2AYSA 1B3GA 1R9QA 1OVTA 1FTKA 5F7VA 2ZYKA 2Z23A 1ATGA 3FJ7A 1BP5A 4MFIA 4PFYA 1B3LA 4YICA 3RUMA 1H44A 1UTBB 4WXJA 5H8HA 4P0GA 4ZEBA 1Y3NA 2XXXA 2ZYMA 2XXPA 3MPLA 4OESA 4R2FA 4LUBA 2XX7A 5L9MA 3SEWA 5I58A 5HM4B 1LCTA 2DQVA 1D9VA 2XD2A 3I6VA 3K6VA 1MDP1 5JK4A 4MF3A 5AA2A 3S9LC 2R9JA 2UVGA 4G68C 4WKMA 1B9JA 4C1UA 2HQ0A 1A8EA 2Q88A 3IB2A 1B32A 4GWOA 1SW2A 1B2HA 1QUJA 1NNFA 1QW0A 4JDFA 1MH4A 3TTNA 2XXVA 2QS2A 4KYDA 4MLQA 3EQ1A 5FTIA 4QFLA 5I56A 4H8IA 4R74A 3OXNA 4KYEA 4OFLA 3O97A 4EQ9A 3O6GA 3EHSA 4LQ2A 4OWDA 4QFPA 4M1VA 1UTBA 1FQBA 1XHYA 1XOCA 1MH3A 1M5FA 4U21A 4KHZE 1O64A 4DXUA 1P1OA 4NEDA 5ICTA 2VP1A 1WDNA 3LSFB 3PPOA 3MVZA 4H5GA 5CM6A 1MPBA 1H43A 2B3FA 3S9MC 3PPPA 4OZ9A 1OIBA 3QUFA 4M4GA 4KPTA 4ELPA 4GD5A 1GGGA 4JB7A 4JWYA 1P1NA 2ONKE 1LAHE 4GRKA 3S2VA 5AA3A 1B5HA 2NUVA 3VVFA 5ICQA 1LAFE 5ISUA 3PUVE 4F3SA 1FQEA 3K1NA 3C4MA 3C32A 1LFGA 3T9XB 2VOZA 4EUOA 3DP6A 3GBAA 2R6GE 3FJGA 3C33A 4ELQA 2DWAA 1OQHA 5I2NB 1QVSA 3CFZA 3M3KA 4QFOA 1A8FA 3KSXA 4G68B 5M2VA 3U92A 2O7UA 5I56B 3TUSA 5H8FA 4RXLA 3PU5A 4G77A 4DZ1A 3MC2A 4LA9A 4Q8RA 3FXUA 1CE2A 1PDAA 4Z0IA 2DXRA 2PT2A 4GL8A 4BDOA 2CMOA 4KFQA 1S50A 1SW1A 1D4NA 4GVOA 3TMGA 4F19A 3A3UA 3PPNA 3TELA 4E0WA 2X26A 4ESXA 1PB8A 1JEVA 2Y7PA 3PPRA 2OJTA 2O84X 4PFUA 3TEPA 4F2QA 4JWXA 3K4UA 4X1BA 1ZTYA 4O3CA 5FHMA 2F5XA 4P11A 4ELRA 3FV2A 4ELOA 1B40A 1IEJA 1YAEA 3W9VA 4R6KA 4KCDA 3JYRA 1NFTA 1DOTA 3MZ1A 4OHNA 3K00A 1MXZA 1N7WA 1OQGA 1P99A 2O69A 2XXQA 4IO3A 4FEBA 5H8FB 2A5TA 4F3PA 1N3WA 3KGCA 4POXA 2F8DA 3MP8A 4IO7A 1GR2A 3SERA 1IXGA 2O7IA 3QUJA 4YB5A 3E9XA 4YMBA 4I9DA 5H8NB 1J1NA 2F7AA 2NXOA 2VGQA 1B51A 4R6YA 1XVXA 1BTJA 2PBWA 3H3GA 4KI0E 4DXCA 4NF6A 4GLIA 3TCFA 2DXYA 1KWHA 1Q1KA 2D5WA 3K6UA 4QSCA 1RYXA 5CRYA 5TPAA 3UA8A 1N84A 1EU8A 1DTZA 2AL5A 2OZZA 3O66A 2P0SA 1POTA 2ZNSA 3C31A 4PQJA 3SEVA 3TTLA 1MM7A 3PUXE 1NKXA 4EQBA 3B6WA 3K6XA 1B0HA 4HCWA 4OETA 1HSJA 3G3GA 3UK4A 3SETA 3OENA 3IX1A 1F9BA 2PX1A 2I4CA 3IK6B 4UACA 2OWSA 3MWBA 4G8MA 2FYIA 4FORA 4JSOA 4H67A 2A5TB 3I3VA 3QAXA 4THIA 1VE4A 2O6AA 4TLLB 2V93A 5AA2D 5BWJA 1IXIA 3F11A 3S9EA 3IR1A 3SESA 5H8NA 5CMKA 2Y84A 4LATA 5EHSA 1AL3A 3T66A 2O68A 3T9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FUZ A;  4P0I A;  1Y1Z A;  4H1X A;  4RA1 A;  4XTC Q;  1I6B A;  2YPN A;  3M3L A;  4RY1 A;  3SEX A;  3DP8 A;  3LBS A;  4YB7 A;  5H8S A;  3WAF A;  5I58 B;  3EHU A;  3H7M A;  1VR5 A;  1SYI A;  2FA7 A;  1MXU A;  2Z8F A;  3E3K A;  2XXW A;  2XXH A;  1VSO A;  3O28 A;  3KZG A;  3Q29 A;  5K2X A;  5TP9 B;  5AA2 B;  2UVJ A;  5AE4 A;  1AOV A;  1BIY A;  1VFD A;  1DSN A;  1FW0 A;  2O51 A;  4K3F A;  2QL3 A;  2DSF A;  2XHD A;  3M8U A;  1MXW A;  1QUL A;  1Y3Q A;  4XKN A;  4RPN A;  4ESW A;  4QRZ A;  3E13 X;  1IIT A;  3FVK A;  3KBR A;  1SW4 A;  1DTG A;  3KOS A;  4HCY A;  1ZBM A;  2ALU A;  2UYE A;  4NF8 A;  5I57 A;  4F29 A;  4U4S A;  2H5Y A;  2ANJ A;  3M3F A;  1IZ1 A;  2DOJ A;  4OEV A;  1B58 A;  3TFL A;  5FHO A;  4RK9 A;  2HAU A;  3C34 A;  4QFN A;  1R6Z A;  3VV5 A;  2GHA A;  2F78 A;  3B6Q A;  2XD3 A;  1RKM A;  5B7D A;  5DVI A;  3TAJ A;  3V83 A;  1B6H A;  2P1S A;  1ZU0 A;  2F97 A;  2FNC A;  2Q2A A;  2DWI A;  3VLV A;  4OMB A;  1B46 A;  3EHT A;  1NNK A;  1ELJ A;  4U22 A;  3VE1 B;  1NMU A;  1PC3 A;  2V3T A;  3OO9 A;  3DP4 A;  3IOV A;  1B52 A;  5L8D A;  2Z8E A;  1Z7M E;  1A54 A;  1B4Z A;  1B5I A;  1FTL A;  3MBP A;  3USD A;  4ZDM A;  1M5D A;  1SYH A;  2HZL A;  1NNP A;  2OWT A;  3HHG A;  3FJM A;  3RN8 A;  2H25 A;  1US5 A;  4Q30 B;  1ZMG A;  1MXV A;  3VXC A;  2R71 A;  3TYH A;  5DYH A;  3FAS A;  3HST A;  4LZ8 A;  1EH3 A;  2DE3 A;  2ZMB A;  1JET A;  3HV1 A;  4FJP A;  3RTW B;  3TTR A;  2OK2 A;  4F39 A;  4PE5 B;  2OLB A;  4FEC A;  2RC7 A;  5HBC A;  4BDN A;  2RKM A;  4LP2 B;  4XKR A;  1LAX A;  4FIM A;  2W7Y A;  2ONS A;  3PD9 A;  3SDF A;  1VFE A;  3VVE A;  1LBC A;  2H9B A;  3SEU A;  4GIZ A;  2QMX A;  1PEB A;  5FTH A;  1T0K A;  4O3B A;  1MDQ A;  4H65 A;  1LAG E;  5ITO A;  2Q9T A;  3RLF E;  1MQH A;  2DVC A;  2PVU A;  1S7Y A;  1MPC A;  5DEX A;  3V8X B;  4HTG A;  4HW8 A;  2V84 A;  3G3K A;  3RT8 A;  3IAZ A;  2Y7W A;  2CZL A;  3LR1 A;  4ZEK A;  3TTM A;  4EF2 A;  5I84 A;  3A09 A;  1B3F A;  1H45 A;  1TFA A;  4MBP A;  1EZP A;  1YPN A;  1LB8 A;  3N26 A;  1OLA A;  3G3J A;  3PV0 E;  1URD A;  3U8Q A;  4F2O A;  1PB7 A;  4NF4 A;  1S9T A;  3H4Z A;  3S9N C;  4IGT A;  3FVO A;  3RGY A;  1SI1 A;  2V25 A;  3CFX A;  3TOD A;  2Y7R A;  3JV9 A;  2RCB A;  3IL1 B;  4UA8 A;  1B05 A;  3RTF B;  5CBS A;  1BKA A;  1FTM A;  4IO2 A;  3GLB A;  4Z7E A;  4IY6 A;  4NF6 B;  1MM6 A;  5TPA B;  4NWD A;  1UIU A;  1IUD A;  1MXY A;  2IEE A;  1N76 A;  3GXA A;  1A7L A;  1B1H A;  2OCU A;  3IOU A;  4KQP A;  3RT6 B;  1QUK A;  2UVI A;  3ZKL A;  3CI8 A;  2ONR A;  4Q0C A;  2PYY A;  1NNT A;  2I0C A;  4OER A;  5DEX B;  1Y20 A;  2XX9 A;  4OVJ A;  4DE8 A;  1ZIU A;  3L6H A;  2ZNU A;  2DP8 A;  3MZB A;  2AIX A;  4NWC A;  1P1Q A;  3MPK A;  3Q25 A;  5KCJ A;  4AB6 A;  1B0L A;  1II5 A;  3N5L A;  2XXR A;  1N0T A;  3PUZ E;  1LST A;  3K1M A;  3KN7 A;  3IB0 A;  4QF9 A;  2KLF A;  1M5C A;  2UVH A;  2UYF A;  3G3I A;  4RJZ A;  2H98 A;  2V3U A;  4OFO A;  2HCA A;  5FHN A;  1Z7N E;  1IXC A;  2THI A;  4PET A;  4G2Z A;  1SI0 A;  2I0B A;  1GTK A;  1I6Q A;  2GH9 A;  3K1P A;  2REG A;  3KJ7 A;  3N6T A;  2PT1 A;  4XXU A;  1D3K A;  1JW4 A;  3PMX A;  4OQO A;  4C0R A;  4F1V A;  3QIM A;  3EPE A;  3MAM A;  5KDT A;  3WAE A;  3OSQ A;  5JTY B;  5TP9 A;  4H8J A;  4X48 A;  4JSD A;  3TCH A;  1AH5 A;  1B1X A;  3TKD A;  2G93 A;  5I59 B;  5DVJ A;  3LSL A;  3U94 A;  2H4I A;  2Z22 A;  3V89 B;  3MUQ A;  3B7D A;  4TLM B;  2NVU B;  2DWJ A;  1FTJ A;  1XC1 A;  5CMC A;  3THI A;  5KCJ B;  1FCK A;  1LLS A;  4U2R A;  4NE4 A;  4NF8 B;  4PP0 A;  2ZXT A;  5I57 B;  2A5S A;  4DCX A;  5AA1 A;  2GHB A;  3H6U A;  3TZA A;  3OOA A;  4ZE9 A;  4G8H A;  3VXB A;  2RC9 A;  5A5X B;  1MY0 A;  1N3X A;  1NH8 A;  3OO8 A;  2NOO A;  2HFB A;  5F1Q A;  3TQL A;  4GXS B;  3TQW A;  3LSW A;  4AB5 A;  1SD3 A;  5J1D A;  3BKI B;  4I1D A;  1Y3P A;  4QFK A;  1PB9 A;  1YTV A;  1POY 1;  4IB2 A;  4JXI A;  3MVW A;  4IO5 A;  1M5E A;  4YKP A;  3OO6 A;  1I69 A;  2M8C A;  3CRB A;  3UIF A;  4N6P A;  4MLV A;  1DPE A;  3C9H A;  2DE4 A;  1FQF A;  4ND9 A;  2QS4 A;  1AIV A;  4ZEF A;  1Y4C A;  2B65 A;  1FTO A;  3TPA A;  2QSX A;  5CMB A;  1ZJL A;  4NTL A;  1R9L A;  3N94 A;  3AXF A;  2XXU A;  3KG2 A;  4G8N A;  3QYT A;  1MPD A;  2HEU A;  4OEN A;  4F3G A;  3K02 A;  4LVQ A;  4R75 A;  3MP6 A;  3RNN A;  3IB1 A;  1JVX A;  3BFT A;  3P7I A;  1JW1 A;  5A5X A;  5CMM A;  1MQD A;  1USY H;  4R72 A;  4F1Y A;  3HN0 A;  4ISU A;  5CI5 A;  1B3E A;  1MQJ A;  4YKK A;  4OXV A;  2YJP A;  4ZZA A;  3TCG A;  3D4G A;  3ECR A;  3FVN A;  4ONY A;  3VVD A;  1P1W A;  2X7P A;  1CB6 A;  2QPQ A;  4NF5 B;  1UTH A;  1BLF A;  3HPI A;  1ZKB A;  2XXY A;  1FQC A;  1URG A;  3G3F A;  1H3D A;  1UQW A;  3OEM A;  3PMV A;  1A55 A;  5K2Y A;  1HSE A;  5DVF A;  4EDP A;  1MXX A;  3Q28 A;  4PFW A;  4RYA A;  4ZE8 A;  4N07 A;  3RPW A;  2PMS A;  2RC8 A;  4WED A;  3IOR A;  4XIG Q;  4AQ4 A;  4NF4 B;  3GZG A;  2I48 A;  4G4P A;  3H03 A;  3H6W A;  1A99 A;  3DEL B;  4IO4 A;  1NH7 A;  4H0W A;  3FD3 A;  4FAT A;  3KJT A;  2Z8D A;  4EQ7 A;  2XX8 A;  3H6T A;  1JQF A;  4YB6 A;  4E0X A;  4JBZ A;  1EZ9 A;  4POW A;  3UN6 A;  1MS7 A;  2GFE A;  2QS1 A;  4Q5T A;  5EHM A;  4WEP A;  1GV8 A;  1LCF A;  2QMW A;  1GVC A;  5ELV A;  2YLN A;  4GOT A;  4R2B A;  1JVY A;  1A40 A;  1US4 A;  2E1S A;  3K6W A;  4QSD A;  4DXB A;  2I3V A;  5IKB A;  1UTH B;  2D3I A;  2Q8J A;  4H6D A;  4ZEI A;  1SW5 A;  3S4U A;  2P2A A;  5TU0 A;  3HO7 A;  3PUW E;  4QHQ A;  3ZS6 A;  4U23 A;  4BLA A;  3UOR A;  4F18 A;  1M5B A;  4KCC A;  3A3C A;  1SVX B;  1LFI A;  1B3H A;  3IOT A;  4N13 A;  3FVG A;  4KR5 A;  2HAV A;  3LC8 A;  4MH5 A;  4GL0 A;  4OYV A;  1MY2 A;  4IY5 A;  1B7Z A;  3OSR A;  1SQY A;  4GXA A;  4TOZ A;  5JEI A;  1ZLQ A;  4LQ5 A;  2G29 A;  3CVG A;  2DS9 A;  3K0V A;  1IQ7 A;  4LZ7 A;  3VLW A;  3QXM A;  2DVZ A;  3CSG A;  1R1N A;  2QS3 A;  2GRV A;  4XKQ A;  1XS5 A;  3R6U A;  5AA4 B;  4X1D A;  4OEU A;  1MY4 A;  3CFL A;  1QKB A;  4R9G A;  1ANF A;  1P1U A;  3C35 A;  5KDT B;  5JTY A;  3G7W A;  1H76 A;  3MJN A;  3IJO B;  1OLC A;  3UGW A;  2AL4 A;  3CG3 A;  3VFJ A;  4C1T A;  4EXL A;  5HPQ A;  2F35 A;  2X7Q A;  5I59 A;  1MRP A;  1MY1 A;  1B4H A;  3ILT B;  4RPO A;  1QKA A;  2H99 A;  2OBG A;  1TXF A;  2B3B A;  2QJE A;  2VD2 A;  3K2D A;  1MG1 A;  3Q27 A;  4LZ5 A;  1N04 A;  1MQI A;  3FAT A;  3MP1 A;  4DLD A;  3ILU B;  1I6A A;  4R6H A;  4BDQ A;  1FQD A;  2F6P A;  2IA4 A;  5LOM A;  1JW5 A;  1LBB A;  2VHA A;  3O6I A;  1JEU A;  1WOD A;  2F7C A;  3IOW A;  3CR9 A;  5KZT A;  1Q35 A;  3O9P A;  4OFJ A;  5EYF A;  3DLN A;  3GBB A;  3PUY E;  1OVB A;  5ITP A;  2DE2 A;  1Y1M A;  4ZS9 A;  4RK2 A;  3PMW A;  3VLU A;  3U72 A;  3W9W A;  3U1O A;  3OD7 A;  5AA4 A;  1LB9 A;  3OO7 A;  1OMP A;  5DTB A;  3O29 A;  3SEY A;  4YMA A;  1B7U A;  4O3A A;  1FQA A;  1TFD A;  2Y7K A;  1YCJ A;  3KOT A;  3Q26 A;  5DT6 A;  4F31 B;  4FAJ A;  1WVJ A;  1XVY A;  2E0S A;  4R9F A;  4F1U A;  5BUU A;  1EZO A;  2ZYO A;  2REJ A;  1XT8 A;  2NWJ A;  2RF1 A;  1USY E;  2DYX A;  3BBR A;  3R7X A;  2D21 A;  2ZNT A;  4X9T A;  1Y4T A;  1O63 A;  2ABH A;  2HZK A;  1O7T A;  3KN8 A;  4I62 A;  1D9Y A;  2ZYN A;  3V5A A;  3MW0 A;  4GF8 A;  2QRY A;  2XXI A;  3C36 A;  2F36 A;  4PFT A;  4U1O A;  3RQT A;  3HCQ A;  3IO4 A;  4KYS A;  2HXW A;  4BDL A;  3UP9 A;  5CC2 A;  5L9S A;  3IJX B;  1QUI A;  2DWH A;  4YAH X;  3FIR A;  4YKI A;  5I2N A;  3PD8 A;  3FV1 A;  3EF7 A;  3KSJ A;  3PPQ A;  1Y9U A;  2BJJ X;  4G68 A;  4GFR A;  4L17 A;  4RNS A;  4EF1 A;  4F3B A;  2I3W A;  1MY3 A;  4EXK A;  3N6U A;  3K01 A;  4GQO A;  3IO6 A;  3VDF A;  4BDM A;  1LFH A;  4JWO A;  4H5F A;  3R26 A;  3O2A A;  4TQU Q;  3OMB A;  5I2K A;  2UXA A;  1MQG A;  1RYO A;  3QK6 A;  2F7B A;  3JZJ A;  4F22 A;  4NF5 A;  3FZV A;  3MQ9 A;  5H8Q B;  3G3H A;  2F6G A;  3MZ9 A;  3FXQ A;  4DCY A;  3ODB A;  3TTK A;  1TT1 A;  3OEL A;  3OEK A;  3RY3 A;  3DM0 A;  1URS A;  4NMY A;  4DIG A;  2I4B A;  4YU0 A;  3T9V A;  1L5T A;  4YZZ A;  5IAI A;  2O1L A;  4YKJ A;  2XXT A;  2Y7I A;  4FE8 A;  3ZKK A;  1PBP A;  4DDD A;  3ZSF A;  3MVX A;  4LON B;  3ONM A;  3H06 B;  3T9H B;  3CG1 A;  3U93 A;  1N7X A;  4BDR A;  1IIW A;  1SDX A;  3D4C A;  4IGR A;  4ZEC A;  1SBP A;  2I6E A;  2I58 A;  2Q2C A;  1HSL A;  3HHF A;  3FXR A;  2VD3 A;  3KFM A;  1JNF A;  4I8C A;  3W15 C;  5H8H B;  1PBQ A;  5I2K B;  1DMB A;  2RIN A;  2O1M A;  2ESN A;  1AMF A;  1LGB C;  2LAO A;  4IO6 A;  3EN3 A;  3KEI A;  4U1Z A;  4OTE A;  3SKP A;  2RCA A;  2F34 A;  5H8Q A;  3L6G A;  4U4X A;  3O6H A;  3LUY A;  3CIJ A;  2V3Q A;  1QJM A;  1IXH A;  3CSB A;  4KD5 A;  3I5O A;  3H6V A;  4ZZE A;  4ECF A;  3KN3 A;  2Q89 A;  5L9O A;  4ZED A;  1TWY A;  3T96 B;  4FED A;  5B70 A;  1UIV A;  3BFU A;  3FGS A;  3LSX A;  3QSL A;  3TDJ A;  1DPP A;  1NL5 A;  4R73 A;  3B6T A;  3T22 A;  3E4R A;  2WKY A;  3MVY A;  4QSE A;  4XKP A;  1B7H A;  5CBR A;  2I49 A;  3PGF A;  1B5J A;  4HS7 A;  3T93 B;  2AYS A;  1B3G A;  1R9Q A;  1OVT A;  1FTK A;  5F7V A;  2ZYK A;  2Z23 A;  1ATG A;  3FJ7 A;  1BP5 A;  4MFI A;  4PFY A;  1B3L A;  4YIC A;  3RUM A;  1H44 A;  1UTB B;  4WXJ A;  5H8H A;  4P0G A;  4ZEB A;  1Y3N A;  2XXX A;  2ZYM A;  2XXP A;  3MPL A;  4OES A;  4R2F A;  4LUB A;  2XX7 A;  5L9M A;  3SEW A;  5I58 A;  5HM4 B;  1LCT A;  2DQV A;  1D9V A;  2XD2 A;  3I6V A;  3K6V A;  1MDP 1;  5JK4 A;  4MF3 A;  5AA2 A;  3S9L C;  2R9J A;  2UVG A;  4G68 C;  4WKM A;  1B9J A;  4C1U A;  2HQ0 A;  1A8E A;  2Q88 A;  3IB2 A;  1B32 A;  4GWO A;  1SW2 A;  1B2H A;  1QUJ A;  1NNF A;  1QW0 A;  4JDF A;  1MH4 A;  3TTN A;  2XXV A;  2QS2 A;  4KYD A;  4MLQ A;  3EQ1 A;  5FTI A;  4QFL A;  5I56 A;  4H8I A;  4R74 A;  3OXN A;  4KYE A;  4OFL A;  3O97 A;  4EQ9 A;  3O6G A;  3EHS A;  4LQ2 A;  4OWD A;  4QFP A;  4M1V A;  1UTB A;  1FQB A;  1XHY A;  1XOC A;  1MH3 A;  1M5F A;  4U21 A;  4KHZ E;  1O64 A;  4DXU A;  1P1O A;  4NED A;  5ICT A;  2VP1 A;  1WDN A;  3LSF B;  3PPO A;  3MVZ A;  4H5G A;  5CM6 A;  1MPB A;  1H43 A;  2B3F A;  3S9M C;  3PPP A;  4OZ9 A;  1OIB A;  3QUF A;  4M4G A;  4KPT A;  4ELP A;  4GD5 A;  1GGG A;  4JB7 A;  4JWY A;  1P1N A;  2ONK E;  1LAH E;  4GRK A;  3S2V A;  5AA3 A;  1B5H A;  2NUV A;  3VVF A;  5ICQ A;  1LAF E;  5ISU A;  3PUV E;  4F3S A;  1FQE A;  3K1N A;  3C4M A;  3C32 A;  1LFG A;  3T9X B;  2VOZ A;  4EUO A;  3DP6 A;  3GBA A;  2R6G E;  3FJG A;  3C33 A;  4ELQ A;  2DWA A;  1OQH A;  5I2N B;  1QVS A;  3CFZ A;  3M3K A;  4QFO A;  1A8F A;  3KSX A;  4G68 B;  5M2V A;  3U92 A;  2O7U A;  5I56 B;  3TUS A;  5H8F A;  4RXL A;  3PU5 A;  4G77 A;  4DZ1 A;  3MC2 A;  4LA9 A;  4Q8R A;  3FXU A;  1CE2 A;  1PDA A;  4Z0I A;  2DXR A;  2PT2 A;  4GL8 A;  4BDO A;  2CMO A;  4KFQ A;  1S50 A;  1SW1 A;  1D4N A;  4GVO A;  3TMG A;  4F19 A;  3A3U A;  3PPN A;  3TEL A;  4E0W A;  2X26 A;  4ESX A;  1PB8 A;  1JEV A;  2Y7P A;  3PPR A;  2OJT A;  2O84 X;  4PFU A;  3TEP A;  4F2Q A;  4JWX A;  3K4U A;  4X1B A;  1ZTY A;  4O3C A;  5FHM A;  2F5X A;  4P11 A;  4ELR A;  3FV2 A;  4ELO A;  1B40 A;  1IEJ A;  1YAE A;  3W9V A;  4R6K A;  4KCD A;  3JYR A;  1NFT A;  1DOT A;  3MZ1 A;  4OHN A;  3K00 A;  1MXZ A;  1N7W A;  1OQG A;  1P99 A;  2O69 A;  2XXQ A;  4IO3 A;  4FEB A;  5H8F B;  2A5T A;  4F3P A;  1N3W A;  3KGC A;  4POX A;  2F8D A;  3MP8 A;  4IO7 A;  1GR2 A;  3SER A;  1IXG A;  2O7I A;  3QUJ A;  4YB5 A;  3E9X A;  4YMB A;  4I9D A;  5H8N B;  1J1N A;  2F7A A;  2NXO A;  2VGQ A;  1B51 A;  4R6Y A;  1XVX A;  1BTJ A;  2PBW A;  3H3G A;  4KI0 E;  4DXC A;  4NF6 A;  4GLI A;  3TCF A;  2DXY A;  1KWH A;  1Q1K A;  2D5W A;  3K6U A;  4QSC A;  1RYX A;  5CRY A;  5TPA A;  3UA8 A;  1N84 A;  1EU8 A;  1DTZ A;  2AL5 A;  2OZZ A;  3O66 A;  2P0S A;  1POT A;  2ZNS A;  3C31 A;  4PQJ A;  3SEV A;  3TTL A;  1MM7 A;  3PUX E;  1NKX A;  4EQB A;  3B6W A;  3K6X A;  1B0H A;  4HCW A;  4OET A;  1HSJ A;  3G3G A;  3UK4 A;  3SET A;  3OEN A;  3IX1 A;  1F9B A;  2PX1 A;  2I4C A;  3IK6 B;  4UAC A;  2OWS A;  3MWB A;  4G8M A;  2FYI A;  4FOR A;  4JSO A;  4H67 A;  2A5T B;  3I3V A;  3QAX A;  4THI A;  1VE4 A;  2O6A A;  4TLL B;  2V93 A;  5AA2 D;  5BWJ A;  1IXI A;  3F11 A;  3S9E A;  3IR1 A;  3SES A;  5H8N A;  5CMK A;  2Y84 A;  4LAT A;  5EHS A;  1AL3 A;  3T66 A;  2O68 A;  3T9U A; 
#chains in the Genus database with same CATH topology
 4OA4 A;  3DP8 A;  2XXW A;  3KZG A;  2F3B A;  1FPI A;  2O51 A;  3M8U A;  1MXW A;  4HE2 A;  4RPN A;  4PFR A;  3KBR A;  3FVK A;  3KOS A;  1SW4 A;  1ZBM A;  3CHG A;  1IZ1 A;  4OEV A;  1B58 A;  2HAU A;  1RKM A;  2Y5K A;  2Q2A A;  2PFZ A;  1B46 A;  4OMB A;  1SPI A;  1ELJ A;  4U22 A;  2V3T A;  3OO9 A;  3MBP A;  4ZDM A;  4I3Y A;  2R71 A;  3TYH A;  5DYH A;  1EH3 A;  2OK2 A;  4PE5 B;  3VVE A;  2H9B A;  4GWW A;  1MDQ A;  5ITO A;  2Q9T A;  4HW8 A;  3G3K A;  3IAZ A;  2Y7W A;  1YPN A;  4NAP A;  1BKA A;  1FTM A;  4IO2 A;  4Z7E A;  4IY6 A;  4KXP A;  5TPA B;  1IUD A;  3IOU A;  4PFB A;  2ONR A;  1NNT A;  5DEX B;  2DP8 A;  4NWC A;  5KCJ A;  4MCO A;  4LN5 A;  3PUZ E;  2XXR A;  1EYI A;  1M5C A;  4RJZ A;  4NHB A;  1DCU A;  5FHN A;  4PET A;  4P1E A;  2I0B A;  3K1P A;  3KJ7 A;  4OQO A;  3OSQ A;  5JTY B;  5TP9 A;  4H8J A;  4JSD A;  1AH5 A;  1B1X A;  2G93 A;  5DVJ A;  3LSL A;  2DWJ A;  4U2R A;  5I57 B;  2A5S A;  4DCX A;  4ZE9 A;  4G8H A;  1N3X A;  1NH8 A;  5F1Q A;  4GXS B;  3LSW A;  1PB9 A;  1POY 1;  3OO6 A;  1I69 A;  4N6P A;  5IZ3 A;  2DE4 A;  1FQF A;  1AIV A;  1Y4C A;  2XXU A;  3KG2 A;  4G8N A;  3IFC A;  4GX3 A;  4LVQ A;  4R75 A;  5I3S A;  4R72 A;  5CI5 A;  4YKK A;  3D4G A;  2X7P A;  4NF5 B;  1ZKB A;  3RYD A;  3OEM A;  3KC1 A;  1MXX A;  1NV0 A;  4PFW A;  4ZE8 A;  2PMS A;  2RC8 A;  4XIG Q;  3IOR A;  3H03 A;  3H6W A;  2PFY A;  4H0W A;  4FAT A;  2XX8 A;  4YB6 A;  4XF5 A;  4JBZ A;  1MS7 A;  2GFE A;  1GV8 A;  4WEP A;  2QMW A;  3K6W A;  2E1S A;  1FBD A;  4DXB A;  2I3V A;  4H6D A;  3HO7 A;  3PUW E;  4QHQ A;  4U23 A;  4F18 A;  4MIJ A;  4PBQ A;  4KCC A;  4MH5 A;  4TOZ A;  2DS9 A;  1IQ7 A;  3KC0 A;  2DVZ A;  2GRV A;  5AA4 B;  1XS5 A;  4X1D A;  4OEU A;  1EYK A;  3MJN A;  5HPQ A;  2X7Q A;  1JP4 A;  5I59 A;  1TXF A;  2VD2 A;  3K2D A;  1MG1 A;  4LZ5 A;  4P1L A;  3FAT A;  4DLD A;  1I6A A;  3O6I A;  3IOW A;  3GBB A;  2DE2 A;  1Y1M A;  3VLU A;  3U1O A;  3OO7 A;  5DTB A;  4YMA A;  4O3A A;  1FQA A;  1TFD A;  5DW8 A;  4F31 B;  4N8Y A;  5DT6 A;  2E0S A;  4MNC A;  2ZNT A;  5FBP A;  1Y4T A;  4H45 A;  4I62 A;  1O7T A;  1D9Y A;  4U1O A;  2F36 A;  3HCQ A;  3IO4 A;  4N6D A;  5CC2 A;  2DWH A;  4YAH X;  2VPN A;  4YKI A;  3PD8 A;  3FV1 A;  3EF7 A;  4GFR A;  4G68 A;  1Y9U A;  5I2N A;  2XA5 A;  4L17 A;  3N6U A;  4XEQ A;  3IO6 A;  4NN3 A;  3O2A A;  4TQU Q;  5I2K A;  1MQG A;  5EQA A;  3DM0 A;  4DIG A;  2I4B A;  2Y7I A;  1RDX A;  3NOH A;  3U93 A;  1IME A;  1SBP A;  3PTY A;  2XWK A;  2I6E A;  3HHF A;  3KFM A;  2VD3 A;  2V4C A;  4I8C A;  1AMF A;  3SKP A;  4IO6 A;  4U1Z A;  1IXH A;  3T96 B;  4FED A;  3B6T A;  1NUX A;  3MVY A;  1B5J A;  1B3G A;  1R9Q A;  3FJ7 A;  1ATG A;  3RUM A;  1H44 A;  1UTB B;  4ZEB A;  2ZYM A;  2XXP A;  4O7M A;  2DQV A;  1D9V A;  5AA2 A;  4GWO A;  1A8E A;  1SW2 A;  5ESY A;  1QUJ A;  4MLQ A;  4H8I A;  4NF0 A;  2WEF A;  3O97 A;  4M1V A;  1VDW A;  1MH3 A;  5ICT A;  3MVZ A;  5CM6 A;  2B3F A;  3FBP A;  3VVF A;  3T9X B;  3DP6 A;  2DWA A;  1OQH A;  3CFZ A;  5M2V A;  3U92 A;  2O7U A;  1FBH A;  3PU5 A;  3FXU A;  4Z0I A;  2PT2 A;  4BDO A;  1S50 A;  5ET6 A;  2HHM A;  4ESX A;  3PPR A;  4GX6 A;  2OJT A;  3K4U A;  2F5X A;  4ELR A;  4ELO A;  4R6K A;  1FPF A;  1OQG A;  1P99 A;  2O69 A;  4FEB A;  5H8F B;  2A5T A;  3KGC A;  3MP8 A;  3SER A;  1IXG A;  2BJI A;  2P3N A;  1J1N A;  2NXO A;  4R6Y A;  2PBW A;  3TCF A;  1KWH A;  5TPA A;  5CRY A;  4I3E A;  3PMV A;  1N84 A;  3TTL A;  2P0S A;  2QVR A;  1YXI A;  3PUX E;  3K6X A;  2PX1 A;  4G8M A;  2FYI A;  4JSO A;  4H67 A;  3I3V A;  5BWJ A;  1VE4 A;  3S9E A;  3IR1 A;  2Y84 A;  4NQ8 A;  4PDD A;  1NV7 A;  1Y1Z A;  2XWO A;  4RA1 A;  4XTC Q;  1I6B A;  3WAF A;  3EHU A;  1SYI A;  2FA7 A;  5TP9 B;  5K2X A;  4AS4 A;  1AOV A;  1DSN A;  2DSF A;  2XHD A;  4ESW A;  4PAK A;  1IIT A;  1DTG A;  5I57 A;  4JVD A;  2H5Y A;  2CZH A;  3TFL A;  4RK9 A;  1R6Z A;  2XD3 A;  5B7D A;  5T3J A;  1ZU0 A;  1G0I A;  4MNI A;  3DP4 A;  3IOV A;  1B52 A;  1Z7M E;  1A54 A;  1FTL A;  5IZ3 B;  3E78 A;  1SYH A;  1NNP A;  3RN8 A;  2H25 A;  1ZMG A;  2HXR A;  3HST A;  2OLB A;  5HBC A;  4LP2 B;  4XKR A;  1YYZ A;  2ONS A;  3ROJ A;  1VFE A;  1LBC A;  2QMX A;  3RLF E;  1MQH A;  5DEX A;  1MPC A;  5KZT A;  4PCD A;  1H45 A;  1LB8 A;  1G0H A;  3PV0 E;  1S9T A;  3H4Z A;  5IM2 A;  4IGT A;  3RGY A;  1SI1 A;  3IL1 B;  1B05 A;  3GLB A;  4NF6 B;  1FBG A;  1UIU A;  1A7L A;  3MST A;  2UVI A;  4Q0C A;  2XWI A;  2PYY A;  4OER A;  1Y20 A;  2XX9 A;  2ZNU A;  1N0T A;  2KLF A;  2H98 A;  2HCA A;  1IXC A;  4G2Z A;  2GH9 A;  3N6T A;  1D3K A;  1JW4 A;  4MNP A;  3MAM A;  5KDT A;  4X48 A;  4N4U A;  5I59 B;  5KCJ B;  3B7D A;  2VPO A;  2ZZV A;  1FCK A;  4PP0 A;  3H6U A;  1CNQ A;  3TZA A;  3VXB A;  1MY0 A;  3TQL A;  4PGN A;  3U65 A;  4IB2 A;  4JXI A;  3MVW A;  1M5E A;  2M8C A;  3CRB A;  3UIF A;  4MLV A;  1DPE A;  3C9H A;  4ZEF A;  2QSX A;  1ZJL A;  3AXF A;  3QYT A;  2HEU A;  4OEN A;  1FBE A;  3MP6 A;  4GBW A;  3P7I A;  1JW1 A;  5A5X A;  3HN0 A;  4OXV A;  1D9Q A;  4ZZA A;  1CB6 A;  4N6K A;  2XXY A;  1FQC A;  4IR8 A;  5K2Y A;  1XI6 A;  4HE0 A;  4WED A;  4NF4 B;  4G4P A;  3DEL B;  1NH7 A;  4NGU A;  4E0X A;  1JQF A;  4POW A;  3UN6 A;  1UTH B;  2D3I A;  2ZZW A;  3UOR A;  4UAB A;  4KR5 A;  2HAV A;  4IY5 A;  5JEI A;  1SQY A;  4LQ5 A;  2G29 A;  3K0V A;  4LZ7 A;  1MY4 A;  3CFL A;  1ANF A;  1P1U A;  5JTY A;  5EQ8 A;  1MRP A;  1MY1 A;  3B8B A;  4O94 A;  2QJE A;  3ILU B;  1NUW A;  4R6H A;  4H46 A;  1FQD A;  1JW5 A;  1WOD A;  2F7C A;  3CR9 A;  1Q35 A;  3O9P A;  3PUY E;  3W9W A;  5AA4 A;  1LB9 A;  1B7U A;  1YCJ A;  1WVJ A;  1XVY A;  1EZO A;  2ZYO A;  2REJ A;  1XT8 A;  1USY E;  2DYX A;  3R7X A;  2ABH A;  4PDH A;  4DZ1 A;  1LBV A;  2ZYN A;  4PFT A;  3RQT A;  1RDY A;  2Q8M A;  2HXW A;  4BDL A;  3UP9 A;  3FIR A;  4RNS A;  2BJJ X;  2I3W A;  2GQ1 A;  4EXK A;  3K01 A;  4GQO A;  3VDF A;  4JWO A;  3R26 A;  4F22 A;  5ET8 A;  3FXQ A;  1BK4 A;  4N81 A;  3T9V A;  1L5T A;  4YZZ A;  3ZKK A;  3ZSF A;  1NV3 A;  3MVX A;  4LON B;  3ONM A;  4BDR A;  3D4C A;  2Q2C A;  3FXR A;  2Q74 A;  1JNF A;  1PBQ A;  2RIN A;  2ESN A;  3KEI A;  2RCA A;  4U4X A;  3O6H A;  1FBC A;  3CIJ A;  3CSB A;  4KD5 A;  3H6V A;  1TWY A;  5B70 A;  3BFU A;  3FGS A;  4PBH A;  4R73 A;  3MYU A;  3E4R A;  5CBR A;  4XKP A;  1B7H A;  3PGF A;  4HS7 A;  2AYS A;  1FTK A;  4PGP A;  2Z23 A;  4BDQ A;  5H8H A;  4P0G A;  2XXX A;  5L9M A;  4LUB A;  3SEW A;  5HM4 B;  3K6V A;  1KA0 A;  3S9L C;  1B9J A;  2HQ0 A;  2Q88 A;  1B2H A;  4JDF A;  4QFL A;  4R74 A;  4P3L A;  4I40 A;  4EQ9 A;  4LQ2 A;  3EHS A;  1UTB A;  1FQB A;  1XOC A;  4KHZ E;  3PPO A;  4H5G A;  3LSF B;  1MPB A;  3S9M C;  1P1N A;  5IGA A;  3RPL A;  5ISU A;  1EYJ A;  3C4M A;  3C32 A;  4EUO A;  4P47 A;  3GBA A;  2R6G E;  1QVS A;  4QFO A;  3KSX A;  4G68 B;  4Q8R A;  2DXR A;  4GL8 A;  4KFQ A;  2FVZ A;  1SW1 A;  3PPN A;  4GWU A;  3TEL A;  2X26 A;  2OWZ A;  2Y7P A;  3TEP A;  4JWX A;  4OAN A;  4QXD A;  4P11 A;  3FXB A;  1B40 A;  1IMF A;  4KCD A;  1NFT A;  3MZ1 A;  4OHN A;  3K00 A;  4IO3 A;  4F3P A;  1N3W A;  2F8D A;  4IO7 A;  5H8N B;  4PF6 A;  2F7A A;  1B51 A;  4DXC A;  1BTJ A;  3H3G A;  4KI0 E;  1RYX A;  2OZZ A;  1NKX A;  3BIG A;  4OET A;  3UK4 A;  3SET A;  3IX1 A;  3IK6 B;  4O8M A;  3QAX A;  4TLL B;  2O6A A;  2B4M A;  1IXI A;  5CMK A;  3T9U A;  3FUZ A;  4P0I A;  2YPN A;  3SEX A;  5I58 B;  3LBS A;  4YB7 A;  5H8S A;  3H7M A;  2Z8F A;  3E3K A;  2XXH A;  1VSO A;  3O28 A;  3Q29 A;  5AA2 B;  5AE4 A;  1BIY A;  1FW0 A;  4P8B A;  1Y3Q A;  4QRZ A;  4NF8 A;  5EYG A;  2UYE A;  4F29 A;  4U4S A;  2ANJ A;  2DOJ A;  3VV5 A;  2GHA A;  3B6Q A;  3TAJ A;  1B6H A;  2P1S A;  2F97 A;  2FNC A;  3VLV A;  2DWI A;  1NV6 A;  1NNK A;  3VE1 B;  1NMU A;  1PC3 A;  5L8D A;  3USD A;  1M5D A;  5EYH A;  3HHG A;  1US5 A;  4Q30 B;  1MXV A;  2FIE A;  2DE3 A;  3HV1 A;  4FJP A;  4F39 A;  5IZZ A;  4BDN A;  2RKM A;  5EQ7 A;  1LBW A;  1T0K A;  1LAG E;  2DVC A;  2PVU A;  1S7Y A;  2WYP A;  3V8X B;  2V84 A;  5I84 A;  3LR1 A;  3TTM A;  4EF2 A;  3A09 A;  1B3F A;  3N26 A;  1URD A;  4F2O A;  1PB7 A;  4NF4 A;  3FVO A;  3CFX A;  2Y7R A;  2KQZ A;  2RCB A;  4UA8 A;  3RTF B;  5CBS A;  4NWD A;  2WBB A;  3GXA A;  2IEE A;  1N76 A;  4KQP A;  5IZ1 A;  3ZKL A;  1QUK A;  4GWZ A;  2I0C A;  4DE8 A;  3MZB A;  1P1Q A;  3Q25 A;  4AB6 A;  3N5L A;  3KN7 A;  3IB0 A;  4N8G A;  2UVH A;  3G3I A;  4P9K A;  4OFO A;  1Z7N E;  1QGX A;  2THI A;  1GTK A;  1I6Q A;  4C0R A;  3PMX A;  3QIM A;  3EPE A;  3U94 A;  2H4I A;  3HFU A;  3V89 B;  4TLM B;  2NVU B;  1XC1 A;  5CMC A;  1LLS A;  4NE4 A;  2GHB A;  2WYK A;  4MX6 A;  5A5X B;  2NOO A;  5J1D A;  1SD3 A;  3BKI B;  4I1D A;  2XWV A;  3KBZ A;  5EQ9 A;  4GWY A;  4YKP A;  5ET7 A;  1FTO A;  2B65 A;  5CMB A;  4NTL A;  1R9L A;  3N94 A;  1FPK A;  1MPD A;  4F3G A;  3K02 A;  2KR0 A;  4N91 A;  5CMM A;  1USY H;  4ISU A;  1MQJ A;  4N15 A;  1P1W A;  2QPQ A;  1UTH A;  1URG A;  1H3D A;  4EDP A;  3RPW A;  4N07 A;  3GZG A;  1A99 A;  3FD3 A;  3KJT A;  4EQ7 A;  1EZ9 A;  2QS1 A;  1LCF A;  1GVC A;  5ELV A;  4GOT A;  4R2B A;  4QSD A;  1Q9D A;  4ZEI A;  2P2A A;  5TU0 A;  3QMF A;  4BLA A;  4GWX A;  1M5B A;  4MEV A;  1SVX B;  1B3H A;  3IOT A;  3FVG A;  3LC8 A;  4GL0 A;  3OSR A;  4GXA A;  2OX3 A;  3CVG A;  3VLW A;  3CSG A;  2QS3 A;  3R6U A;  4PF8 A;  3C35 A;  5KDT B;  2VT5 A;  1H76 A;  3IJO B;  1OLC A;  2AL4 A;  3CG3 A;  3VFJ A;  4C1T A;  4EXL A;  5LDZ A;  4RPO A;  2H99 A;  4MMP A;  1AWB A;  1MQI A;  5LOM A;  2ZZX A;  1LBB A;  2VHA A;  4OVR A;  3ISP A;  3DLN A;  5ITP A;  1OVB A;  3U72 A;  3OD7 A;  1OMP A;  3SEY A;  3O29 A;  5BUU A;  4R9F A;  4F1U A;  3BBR A;  4X9T A;  1O63 A;  3V5A A;  4GF8 A;  2XXI A;  5L9S A;  3IJX B;  2JJK A;  3KSJ A;  3PPQ A;  2WBD A;  4N17 A;  4EF1 A;  4BDM A;  4OVQ A;  3OMB A;  3QK6 A;  3JZJ A;  2HPG A;  3MQ9 A;  5H8Q B;  3G3H A;  3MZ9 A;  1INP A;  3ODB A;  3OEL A;  1URS A;  4YU0 A;  3LUZ A;  2XXT A;  4FE8 A;  1PBP A;  3T1B A;  3T9H B;  3CG1 A;  1N7X A;  1IIW A;  1SDX A;  4ZEC A;  4IGR A;  2I58 A;  1HSL A;  3W15 C;  5H8H B;  4PTK A;  2LAO A;  3EN3 A;  3L6G A;  4GX4 A;  2V3Q A;  1QJM A;  4ECF A;  3I5O A;  4X8R A;  4X04 A;  4ZED A;  3LSX A;  1DPP A;  1NL5 A;  2WKY A;  4QSE A;  2I49 A;  3T93 B;  1FJ6 A;  1OVT A;  5F7V A;  1BP5 A;  4OES A;  4R2F A;  5I58 A;  1LCT A;  3I6V A;  1MDP 1;  1DK4 A;  1LBY A;  4MF3 A;  4C1U A;  1QW0 A;  2QS2 A;  3EQ1 A;  5FTI A;  3OXN A;  4QFP A;  1M5F A;  4OVT A;  1H43 A;  3D1R A;  3PPP A;  2FIX A;  4JB7 A;  5AA3 A;  4GRK A;  2NUV A;  4ELQ A;  5I56 B;  1FSA A;  4RXL A;  1CE2 A;  1PDA A;  4HE1 A;  3TMG A;  1D4N A;  3A3U A;  3T0J A;  1JEV A;  3RPL B;  2O84 X;  4F2Q A;  4GWS A;  1IMC A;  4O3C A;  3FV2 A;  1IMD A;  1IEJ A;  3W9V A;  1DOT A;  4NX1 A;  2O7I A;  4I9D A;  1XVX A;  2DXY A;  3K6U A;  1Q1K A;  2D5W A;  3UA8 A;  4QSC A;  3O66 A;  3SEV A;  3C31 A;  1POT A;  2ZNS A;  4PQJ A;  1NI9 A;  3G3G A;  4OVS A;  3OEN A;  1LEV A;  2I4C A;  3MWB A;  4FOR A;  5AA2 D;  2L5V A;  4MJO A;  5H8N A;  4HXV A;  4H1X A;  3M3L A;  4RY1 A;  1FTA A;  4G61 A;  1VR5 A;  1MXU A;  5I5P A;  2UVJ A;  1VFD A;  4K3F A;  2QL3 A;  4O7I A;  1QUL A;  4XKN A;  3E13 X;  4HCY A;  4DI3 D;  2ALU A;  4OVP A;  4FBP A;  1YZ0 A;  3M3F A;  1NUY A;  5FHO A;  3C34 A;  4QFN A;  2F78 A;  5F24 A;  5DVI A;  3V83 A;  2MKZ A;  3EHT A;  2Z8E A;  1B5I A;  1B4Z A;  2R8T A;  2HZL A;  2OWT A;  3FJM A;  1KZ8 A;  3VXC A;  3FAS A;  4LZ8 A;  2ZMB A;  1JET A;  3TTR A;  3RTW B;  5I7I A;  4FEC A;  2RC7 A;  1LAX A;  4FIM A;  2W7Y A;  3PD9 A;  3SDF A;  3SEU A;  4GIZ A;  1PEB A;  5FTH A;  4O3B A;  4H65 A;  4HTG A;  3RT8 A;  2CZL A;  4ZEK A;  2FHY A;  1TFA A;  4MBP A;  1EZP A;  1OLA A;  3A29 A;  3G3J A;  3U8Q A;  3S9N C;  2V25 A;  3TOD A;  3JV9 A;  1NV1 A;  2CEX A;  1MM6 A;  1MXY A;  3RT6 B;  1B1H A;  2OCU A;  3CI8 A;  5A5L A;  4OVJ A;  1ZIU A;  3L6H A;  2AIX A;  3MPK A;  1FPD A;  1B0L A;  1FBF A;  1II5 A;  1LST A;  4AS5 A;  3K1M A;  4QF9 A;  2UYF A;  2QFL A;  2V3U A;  1SI0 A;  4XXU A;  4PAF A;  2REG A;  2PT1 A;  4F1V A;  3WAE A;  3TCH A;  3TKD A;  1FPB A;  2Z22 A;  2CZI A;  3MUQ A;  1FTJ A;  3THI A;  4QBA A;  4NF8 B;  2ZXT A;  5AA1 A;  3OOA A;  2FBP A;  2RC9 A;  3OO8 A;  2HFB A;  3TQW A;  4AB5 A;  1Y3P A;  1FBP A;  4QFK A;  5ET5 A;  1YTV A;  4IO5 A;  1IMA A;  4PAI A;  4ND9 A;  2QS4 A;  3TPA A;  3GYY A;  3RNN A;  3IB1 A;  1JVX A;  3BFT A;  1NV2 A;  1FRP A;  1MQD A;  4F1Y A;  1B3E A;  2YJP A;  3TCG A;  2CZK A;  3ECR A;  3FVN A;  4ONY A;  3VVD A;  4NG7 A;  1BLF A;  1FJ9 A;  3HPI A;  3G3F A;  1UQW A;  1A55 A;  1KA1 A;  1HSE A;  4PC9 A;  5DVF A;  3Q28 A;  4RYA A;  4AQ4 A;  2I48 A;  4GBV A;  4IO4 A;  2P3V A;  2Z8D A;  3H6T A;  4PFI A;  5EHM A;  4Q5T A;  1LBX A;  4P56 A;  3SZP A;  2YLN A;  1JVY A;  1A40 A;  1US4 A;  2DDK A;  5IKB A;  5J16 A;  2Q8J A;  3S4U A;  1SW5 A;  2CEY A;  3ZS6 A;  3A3C A;  4MHF A;  1LFI A;  1FPJ A;  4N13 A;  4OYV A;  1MY2 A;  1B7Z A;  1ZLQ A;  1K9Y A;  2QVV A;  3QXM A;  1NV4 A;  4XKQ A;  1R1N A;  1QKB A;  4R9G A;  4MAG A;  3G7W A;  3UGW A;  2F35 A;  1B4H A;  3ILT B;  1QKA A;  2OBG A;  2B3B A;  3Q27 A;  3E79 A;  1N04 A;  3MP1 A;  2F6P A;  2IA4 A;  1JEU A;  4OFJ A;  2XXK A;  2WX9 A;  4JVI A;  5EYF A;  2QVU A;  1LBZ A;  4ZS9 A;  4RK2 A;  3PMW A;  3Q26 A;  3KOT A;  2Y7K A;  4FAJ A;  2NWJ A;  2RF1 A;  2D21 A;  2HZK A;  3KN8 A;  3MW0 A;  2QRY A;  3C36 A;  4KYS A;  1FPL A;  1QUI A;  3TTK A;  4F3B A;  1MY3 A;  1LFH A;  4H5F A;  2UXA A;  2F3D A;  1RYO A;  2F7B A;  1IMB A;  4NF5 A;  3FZV A;  1RDZ A;  2F6G A;  4DCY A;  1TT1 A;  2B4L A;  3OEK A;  3RY3 A;  4NMY A;  5IAI A;  2O1L A;  3IFA A;  4YKJ A;  4DDD A;  3H06 B;  5I2K B;  1DMB A;  2O1M A;  4PE3 A;  1LGB C;  4OTE A;  2F34 A;  5H8Q A;  3LUY A;  5LTC A;  4ZZE A;  3KN3 A;  3EKI A;  2Q89 A;  5L9O A;  1UIV A;  2PCR A;  3QSL A;  3TDJ A;  3T22 A;  2ZYK A;  4PFY A;  4YIC A;  4MFI A;  1B3L A;  4WXJ A;  1Y3N A;  3MPL A;  2XX7 A;  5JK4 A;  2XD2 A;  2R9J A;  2UVG A;  4G68 C;  4WKM A;  3IB2 A;  1B32 A;  1NNF A;  1MH4 A;  3TTN A;  2XXV A;  2Y5L A;  4KYD A;  5I56 A;  4KYE A;  4OFL A;  3O6G A;  4OWD A;  1XHY A;  4U21 A;  4DXU A;  1O64 A;  1P1O A;  4NED A;  2VP1 A;  1WDN A;  4OZ9 A;  1OIB A;  3QUF A;  4M4G A;  4KPT A;  4ELP A;  4GD5 A;  1GGG A;  4JWY A;  3S2V A;  2ONK E;  1LAH E;  1B5H A;  5ICQ A;  1LAF E;  3PUV E;  4F3S A;  1FQE A;  3K1N A;  1LFG A;  2VOZ A;  3FJG A;  3C33 A;  5I2N B;  3M3K A;  1A8F A;  3TUS A;  5H8F A;  1NV5 A;  1FPE A;  4G77 A;  1DBZ A;  3MC2 A;  4LA9 A;  4JVC A;  2CMO A;  4F19 A;  4GVO A;  4XFE A;  4E0W A;  1PB8 A;  4PFU A;  4X1B A;  1ZTY A;  5FHM A;  1YAE A;  3JYR A;  1MXZ A;  1N7W A;  2XXQ A;  4POX A;  1GR2 A;  4YB5 A;  3QUJ A;  4YMB A;  3E9X A;  4DI4 B;  2VGQ A;  1FPG A;  4NF6 A;  4GLI A;  1K9Z A;  1EU8 A;  1DTZ A;  2AL5 A;  1MM7 A;  4EQB A;  3B6W A;  3B50 A;  1B0H A;  1NUZ A;  4HCW A;  1HSJ A;  3BIH A;  1F9B A;  4UAC A;  2OWS A;  2A5T B;  4THI A;  2V93 A;  3F11 A;  3SES A;  3LV0 A;  5EHS A;  4LAT A;  1AL3 A;  3T66 A;  2O68 A; 
#chains in the Genus database with same CATH homology
 3FUZ A;  4P0I A;  1Y1Z A;  4H1X A;  4RA1 A;  4XTC Q;  1I6B A;  2YPN A;  3M3L A;  4RY1 A;  3SEX A;  3DP8 A;  3LBS A;  4YB7 A;  5H8S A;  3WAF A;  5I58 B;  3EHU A;  3H7M A;  1VR5 A;  1SYI A;  2FA7 A;  1MXU A;  2Z8F A;  3E3K A;  2XXW A;  2XXH A;  1VSO A;  3O28 A;  3KZG A;  3Q29 A;  5K2X A;  5TP9 B;  5AA2 B;  2UVJ A;  5AE4 A;  1AOV A;  1BIY A;  1VFD A;  1DSN A;  1FW0 A;  2O51 A;  4K3F A;  2QL3 A;  2DSF A;  2XHD A;  3M8U A;  1MXW A;  1QUL A;  1Y3Q A;  4XKN A;  4RPN A;  4ESW A;  4QRZ A;  3E13 X;  1IIT A;  3FVK A;  3KBR A;  1SW4 A;  1DTG A;  3KOS A;  4HCY A;  1ZBM A;  2ALU A;  2UYE A;  4NF8 A;  5I57 A;  4F29 A;  4U4S A;  2H5Y A;  2ANJ A;  3M3F A;  1IZ1 A;  2DOJ A;  4OEV A;  1B58 A;  3TFL A;  5FHO A;  4RK9 A;  2HAU A;  3C34 A;  4QFN A;  1R6Z A;  3VV5 A;  2GHA A;  2F78 A;  3B6Q A;  2XD3 A;  1RKM A;  5B7D A;  5DVI A;  3TAJ A;  3V83 A;  1B6H A;  2P1S A;  1ZU0 A;  2F97 A;  2FNC A;  2Q2A A;  2DWI A;  3VLV A;  4OMB A;  1B46 A;  3EHT A;  1NNK A;  1ELJ A;  4U22 A;  3VE1 B;  1NMU A;  1PC3 A;  2V3T A;  3OO9 A;  3DP4 A;  3IOV A;  1B52 A;  5L8D A;  2Z8E A;  1Z7M E;  1A54 A;  1B4Z A;  1B5I A;  1FTL A;  3MBP A;  3USD A;  4ZDM A;  1M5D A;  1SYH A;  2HZL A;  1NNP A;  2OWT A;  3HHG A;  3FJM A;  3RN8 A;  2H25 A;  1US5 A;  4Q30 B;  1ZMG A;  1MXV A;  3VXC A;  2R71 A;  3TYH A;  5DYH A;  3FAS A;  3HST A;  4LZ8 A;  1EH3 A;  2DE3 A;  2ZMB A;  1JET A;  3HV1 A;  4FJP A;  3RTW B;  3TTR A;  2OK2 A;  4F39 A;  4PE5 B;  2OLB A;  4FEC A;  2RC7 A;  5HBC A;  4BDN A;  2RKM A;  4LP2 B;  4XKR A;  1LAX A;  4FIM A;  2W7Y A;  2ONS A;  3PD9 A;  3SDF A;  1VFE A;  3VVE A;  1LBC A;  2H9B A;  3SEU A;  4GIZ A;  2QMX A;  1PEB A;  5FTH A;  1T0K A;  4O3B A;  1MDQ A;  4H65 A;  1LAG E;  5ITO A;  2Q9T A;  3RLF E;  1MQH A;  2DVC A;  2PVU A;  1S7Y A;  1MPC A;  5DEX A;  3V8X B;  4HTG A;  4HW8 A;  2V84 A;  3G3K A;  3RT8 A;  3IAZ A;  2Y7W A;  2CZL A;  3LR1 A;  4ZEK A;  3TTM A;  4EF2 A;  5I84 A;  3A09 A;  1B3F A;  1H45 A;  1TFA A;  4MBP A;  1EZP A;  1YPN A;  1LB8 A;  3N26 A;  1OLA A;  3G3J A;  3PV0 E;  1URD A;  3U8Q A;  4F2O A;  1PB7 A;  4NF4 A;  1S9T A;  3H4Z A;  3S9N C;  4IGT A;  3FVO A;  3RGY A;  1SI1 A;  2V25 A;  3CFX A;  3TOD A;  2Y7R A;  3JV9 A;  2RCB A;  3IL1 B;  4UA8 A;  1B05 A;  3RTF B;  5CBS A;  1BKA A;  1FTM A;  4IO2 A;  3GLB A;  4Z7E A;  4IY6 A;  4NF6 B;  1MM6 A;  5TPA B;  4NWD A;  1UIU A;  1IUD A;  1MXY A;  2IEE A;  1N76 A;  3GXA A;  1A7L A;  1B1H A;  2OCU A;  3IOU A;  4KQP A;  3RT6 B;  1QUK A;  2UVI A;  3ZKL A;  3CI8 A;  2ONR A;  4Q0C A;  2PYY A;  1NNT A;  2I0C A;  4OER A;  5DEX B;  1Y20 A;  2XX9 A;  4OVJ A;  4DE8 A;  1ZIU A;  3L6H A;  2ZNU A;  2DP8 A;  3MZB A;  2AIX A;  4NWC A;  1P1Q A;  3MPK A;  3Q25 A;  5KCJ A;  4AB6 A;  1B0L A;  1II5 A;  3N5L A;  2XXR A;  1N0T A;  3PUZ E;  1LST A;  3K1M A;  3KN7 A;  3IB0 A;  4QF9 A;  2KLF A;  1M5C A;  2UVH A;  2UYF A;  3G3I A;  4RJZ A;  2H98 A;  2V3U A;  4OFO A;  2HCA A;  5FHN A;  1Z7N E;  1IXC A;  2THI A;  4PET A;  4G2Z A;  1SI0 A;  2I0B A;  1GTK A;  1I6Q A;  2GH9 A;  3K1P A;  2REG A;  3KJ7 A;  3N6T A;  2PT1 A;  4XXU A;  1D3K A;  1JW4 A;  3PMX A;  4OQO A;  4C0R A;  4F1V A;  3QIM A;  3EPE A;  3MAM A;  5KDT A;  3WAE A;  3OSQ A;  5JTY B;  5TP9 A;  4H8J A;  4X48 A;  4JSD A;  3TCH A;  1AH5 A;  1B1X A;  3TKD A;  2G93 A;  5I59 B;  5DVJ A;  3LSL A;  3U94 A;  2H4I A;  2Z22 A;  3V89 B;  3MUQ A;  3B7D A;  4TLM B;  2NVU B;  2DWJ A;  1FTJ A;  1XC1 A;  5CMC A;  3THI A;  5KCJ B;  1FCK A;  1LLS A;  4U2R A;  4NE4 A;  4NF8 B;  4PP0 A;  2ZXT A;  5I57 B;  2A5S A;  4DCX A;  5AA1 A;  2GHB A;  3H6U A;  3TZA A;  3OOA A;  4ZE9 A;  4G8H A;  3VXB A;  2RC9 A;  5A5X B;  1MY0 A;  1N3X A;  1NH8 A;  3OO8 A;  2NOO A;  2HFB A;  5F1Q A;  3TQL A;  4GXS B;  3TQW A;  3LSW A;  4AB5 A;  1SD3 A;  5J1D A;  3BKI B;  4I1D A;  1Y3P A;  4QFK A;  1PB9 A;  1YTV A;  1POY 1;  4IB2 A;  4JXI A;  3MVW A;  4IO5 A;  1M5E A;  4YKP A;  3OO6 A;  1I69 A;  2M8C A;  3CRB A;  3UIF A;  4N6P A;  4MLV A;  1DPE A;  3C9H A;  2DE4 A;  1FQF A;  4ND9 A;  2QS4 A;  1AIV A;  4ZEF A;  1Y4C A;  2B65 A;  1FTO A;  3TPA A;  2QSX A;  5CMB A;  1ZJL A;  4NTL A;  1R9L A;  3N94 A;  3AXF A;  2XXU A;  3KG2 A;  4G8N A;  3QYT A;  1MPD A;  2HEU A;  4OEN A;  4F3G A;  3K02 A;  4LVQ A;  4R75 A;  3MP6 A;  3RNN A;  3IB1 A;  1JVX A;  3BFT A;  3P7I A;  1JW1 A;  5A5X A;  5CMM A;  1MQD A;  1USY H;  4R72 A;  4F1Y A;  3HN0 A;  4ISU A;  5CI5 A;  1B3E A;  1MQJ A;  4YKK A;  4OXV A;  2YJP A;  4ZZA A;  3TCG A;  3D4G A;  3ECR A;  3FVN A;  4ONY A;  3VVD A;  1P1W A;  2X7P A;  1CB6 A;  2QPQ A;  4NF5 B;  1UTH A;  1BLF A;  3HPI A;  1ZKB A;  2XXY A;  1FQC A;  1URG A;  3G3F A;  1H3D A;  1UQW A;  3OEM A;  3PMV A;  1A55 A;  5K2Y A;  1HSE A;  5DVF A;  4EDP A;  1MXX A;  3Q28 A;  4PFW A;  4RYA A;  4ZE8 A;  4N07 A;  3RPW A;  2PMS A;  2RC8 A;  4WED A;  3IOR A;  4XIG Q;  4AQ4 A;  4NF4 B;  3GZG A;  2I48 A;  4G4P A;  3H03 A;  3H6W A;  1A99 A;  3DEL B;  4IO4 A;  1NH7 A;  4H0W A;  3FD3 A;  4FAT A;  3KJT A;  2Z8D A;  4EQ7 A;  2XX8 A;  3H6T A;  1JQF A;  4YB6 A;  4E0X A;  4JBZ A;  1EZ9 A;  4POW A;  3UN6 A;  1MS7 A;  2GFE A;  2QS1 A;  4Q5T A;  5EHM A;  4WEP A;  1GV8 A;  1LCF A;  2QMW A;  1GVC A;  5ELV A;  2YLN A;  4GOT A;  4R2B A;  1JVY A;  1A40 A;  1US4 A;  2E1S A;  3K6W A;  4QSD A;  4DXB A;  2I3V A;  5IKB A;  1UTH B;  2D3I A;  2Q8J A;  4H6D A;  4ZEI A;  1SW5 A;  3S4U A;  2P2A A;  5TU0 A;  3HO7 A;  3PUW E;  4QHQ A;  3ZS6 A;  4U23 A;  4BLA A;  3UOR A;  4F18 A;  1M5B A;  4KCC A;  3A3C A;  1SVX B;  1LFI A;  1B3H A;  3IOT A;  4N13 A;  3FVG A;  4KR5 A;  2HAV A;  3LC8 A;  4MH5 A;  4GL0 A;  4OYV A;  1MY2 A;  4IY5 A;  1B7Z A;  3OSR A;  1SQY A;  4GXA A;  4TOZ A;  5JEI A;  1ZLQ A;  4LQ5 A;  2G29 A;  3CVG A;  2DS9 A;  3K0V A;  1IQ7 A;  4LZ7 A;  3VLW A;  3QXM A;  2DVZ A;  3CSG A;  1R1N A;  2QS3 A;  2GRV A;  4XKQ A;  1XS5 A;  3R6U A;  5AA4 B;  4X1D A;  4OEU A;  1MY4 A;  3CFL A;  1QKB A;  4R9G A;  1ANF A;  1P1U A;  3C35 A;  5KDT B;  5JTY A;  3G7W A;  1H76 A;  3MJN A;  3IJO B;  1OLC A;  3UGW A;  2AL4 A;  3CG3 A;  3VFJ A;  4C1T A;  4EXL A;  5HPQ A;  2F35 A;  2X7Q A;  5I59 A;  1MRP A;  1MY1 A;  1B4H A;  3ILT B;  4RPO A;  1QKA A;  2H99 A;  2OBG A;  1TXF A;  2B3B A;  2QJE A;  2VD2 A;  3K2D A;  1MG1 A;  3Q27 A;  4LZ5 A;  1N04 A;  1MQI A;  3FAT A;  3MP1 A;  4DLD A;  3ILU B;  1I6A A;  4R6H A;  4BDQ A;  1FQD A;  2F6P A;  2IA4 A;  5LOM A;  1JW5 A;  1LBB A;  2VHA A;  3O6I A;  1JEU A;  1WOD A;  2F7C A;  3IOW A;  3CR9 A;  5KZT A;  1Q35 A;  3O9P A;  4OFJ A;  5EYF A;  3DLN A;  3GBB A;  3PUY E;  1OVB A;  5ITP A;  2DE2 A;  1Y1M A;  4ZS9 A;  4RK2 A;  3PMW A;  3VLU A;  3U72 A;  3W9W A;  3U1O A;  3OD7 A;  5AA4 A;  1LB9 A;  3OO7 A;  1OMP A;  5DTB A;  3O29 A;  3SEY A;  4YMA A;  1B7U A;  4O3A A;  1FQA A;  1TFD A;  2Y7K A;  1YCJ A;  3KOT A;  3Q26 A;  5DT6 A;  4F31 B;  4FAJ A;  1WVJ A;  1XVY A;  2E0S A;  4R9F A;  4F1U A;  5BUU A;  1EZO A;  2ZYO A;  2REJ A;  1XT8 A;  2NWJ A;  2RF1 A;  1USY E;  2DYX A;  3BBR A;  3R7X A;  2D21 A;  2ZNT A;  4X9T A;  1Y4T A;  1O63 A;  2ABH A;  2HZK A;  1O7T A;  3KN8 A;  4I62 A;  1D9Y A;  2ZYN A;  3V5A A;  3MW0 A;  4GF8 A;  2QRY A;  2XXI A;  3C36 A;  2F36 A;  4PFT A;  4U1O A;  3RQT A;  3HCQ A;  3IO4 A;  4KYS A;  2HXW A;  4BDL A;  3UP9 A;  5CC2 A;  5L9S A;  3IJX B;  1QUI A;  2DWH A;  4YAH X;  3FIR A;  4YKI A;  5I2N A;  3PD8 A;  3FV1 A;  3EF7 A;  3KSJ A;  3PPQ A;  1Y9U A;  2BJJ X;  4G68 A;  4GFR A;  4L17 A;  4RNS A;  4EF1 A;  4F3B A;  2I3W A;  1MY3 A;  4EXK A;  3N6U A;  3K01 A;  4GQO A;  3IO6 A;  3VDF A;  4BDM A;  1LFH A;  4JWO A;  4H5F A;  3R26 A;  3O2A A;  4TQU Q;  3OMB A;  5I2K A;  2UXA A;  1MQG A;  1RYO A;  3QK6 A;  2F7B A;  3JZJ A;  4F22 A;  4NF5 A;  3FZV A;  3MQ9 A;  5H8Q B;  3G3H A;  2F6G A;  3MZ9 A;  3FXQ A;  4DCY A;  3ODB A;  3TTK A;  1TT1 A;  3OEL A;  3OEK A;  3RY3 A;  3DM0 A;  1URS A;  4NMY A;  4DIG A;  2I4B A;  4YU0 A;  3T9V A;  1L5T A;  4YZZ A;  5IAI A;  2O1L A;  4YKJ A;  2XXT A;  2Y7I A;  4FE8 A;  3ZKK A;  1PBP A;  4DDD A;  3ZSF A;  3MVX A;  4LON B;  3ONM A;  3H06 B;  3T9H B;  3CG1 A;  3U93 A;  1N7X A;  4BDR A;  1IIW A;  1SDX A;  3D4C A;  4IGR A;  4ZEC A;  1SBP A;  2I6E A;  2I58 A;  2Q2C A;  1HSL A;  3HHF A;  3FXR A;  2VD3 A;  3KFM A;  1JNF A;  4I8C A;  3W15 C;  5H8H B;  1PBQ A;  5I2K B;  1DMB A;  2RIN A;  2O1M A;  2ESN A;  1AMF A;  1LGB C;  2LAO A;  4IO6 A;  3EN3 A;  3KEI A;  4U1Z A;  4OTE A;  3SKP A;  2RCA A;  2F34 A;  5H8Q A;  3L6G A;  4U4X A;  3O6H A;  3LUY A;  3CIJ A;  2V3Q A;  1QJM A;  1IXH A;  3CSB A;  4KD5 A;  3I5O A;  3H6V A;  4ZZE A;  4ECF A;  3KN3 A;  2Q89 A;  5L9O A;  4ZED A;  1TWY A;  3T96 B;  4FED A;  5B70 A;  1UIV A;  3BFU A;  3FGS A;  3LSX A;  3QSL A;  3TDJ A;  1DPP A;  1NL5 A;  4R73 A;  3B6T A;  3T22 A;  3E4R A;  2WKY A;  3MVY A;  4QSE A;  4XKP A;  1B7H A;  5CBR A;  2I49 A;  3PGF A;  1B5J A;  4HS7 A;  3T93 B;  2AYS A;  1B3G A;  1R9Q A;  1OVT A;  1FTK A;  5F7V A;  2ZYK A;  2Z23 A;  1ATG A;  3FJ7 A;  1BP5 A;  4MFI A;  4PFY A;  1B3L A;  4YIC A;  3RUM A;  1H44 A;  1UTB B;  4WXJ A;  5H8H A;  4P0G A;  4ZEB A;  1Y3N A;  2XXX A;  2ZYM A;  2XXP A;  3MPL A;  4OES A;  4R2F A;  4LUB A;  2XX7 A;  5L9M A;  3SEW A;  5I58 A;  5HM4 B;  1LCT A;  2DQV A;  1D9V A;  2XD2 A;  3I6V A;  3K6V A;  1MDP 1;  5JK4 A;  4MF3 A;  5AA2 A;  3S9L C;  2R9J A;  2UVG A;  4G68 C;  4WKM A;  1B9J A;  4C1U A;  2HQ0 A;  1A8E A;  2Q88 A;  3IB2 A;  1B32 A;  4GWO A;  1SW2 A;  1B2H A;  1QUJ A;  1NNF A;  1QW0 A;  4JDF A;  1MH4 A;  3TTN A;  2XXV A;  2QS2 A;  4KYD A;  4MLQ A;  3EQ1 A;  5FTI A;  4QFL A;  5I56 A;  4H8I A;  4R74 A;  3OXN A;  4KYE A;  4OFL A;  3O97 A;  4EQ9 A;  3O6G A;  3EHS A;  4LQ2 A;  4OWD A;  4QFP A;  4M1V A;  1UTB A;  1FQB A;  1XHY A;  1XOC A;  1MH3 A;  1M5F A;  4U21 A;  4KHZ E;  1O64 A;  4DXU A;  1P1O A;  4NED A;  5ICT A;  2VP1 A;  1WDN A;  3LSF B;  3PPO A;  3MVZ A;  4H5G A;  5CM6 A;  1MPB A;  1H43 A;  2B3F A;  3S9M C;  3PPP A;  4OZ9 A;  1OIB A;  3QUF A;  4M4G A;  4KPT A;  4ELP A;  4GD5 A;  1GGG A;  4JB7 A;  4JWY A;  1P1N A;  2ONK E;  1LAH E;  4GRK A;  3S2V A;  5AA3 A;  1B5H A;  2NUV A;  3VVF A;  5ICQ A;  1LAF E;  5ISU A;  3PUV E;  4F3S A;  1FQE A;  3K1N A;  3C4M A;  3C32 A;  1LFG A;  3T9X B;  2VOZ A;  4EUO A;  3DP6 A;  3GBA A;  2R6G E;  3FJG A;  3C33 A;  4ELQ A;  2DWA A;  1OQH A;  5I2N B;  1QVS A;  3CFZ A;  3M3K A;  4QFO A;  1A8F A;  3KSX A;  4G68 B;  5M2V A;  3U92 A;  2O7U A;  5I56 B;  3TUS A;  5H8F A;  4RXL A;  3PU5 A;  4G77 A;  4DZ1 A;  3MC2 A;  4LA9 A;  4Q8R A;  3FXU A;  1CE2 A;  1PDA A;  4Z0I A;  2DXR A;  2PT2 A;  4GL8 A;  4BDO A;  2CMO A;  4KFQ A;  1S50 A;  1SW1 A;  1D4N A;  4GVO A;  3TMG A;  4F19 A;  3A3U A;  3PPN A;  3TEL A;  4E0W A;  2X26 A;  4ESX A;  1PB8 A;  1JEV A;  2Y7P A;  3PPR A;  2OJT A;  2O84 X;  4PFU A;  3TEP A;  4F2Q A;  4JWX A;  3K4U A;  4X1B A;  1ZTY A;  4O3C A;  5FHM A;  2F5X A;  4P11 A;  4ELR A;  3FV2 A;  4ELO A;  1B40 A;  1IEJ A;  1YAE A;  3W9V A;  4R6K A;  4KCD A;  3JYR A;  1NFT A;  1DOT A;  3MZ1 A;  4OHN A;  3K00 A;  1MXZ A;  1N7W A;  1OQG A;  1P99 A;  2O69 A;  2XXQ A;  4IO3 A;  4FEB A;  5H8F B;  2A5T A;  4F3P A;  1N3W A;  3KGC A;  4POX A;  2F8D A;  3MP8 A;  4IO7 A;  1GR2 A;  3SER A;  1IXG A;  2O7I A;  3QUJ A;  4YB5 A;  3E9X A;  4YMB A;  4I9D A;  5H8N B;  1J1N A;  2F7A A;  2NXO A;  2VGQ A;  1B51 A;  4R6Y A;  1XVX A;  1BTJ A;  2PBW A;  3H3G A;  4KI0 E;  4DXC A;  4NF6 A;  4GLI A;  3TCF A;  2DXY A;  1KWH A;  1Q1K A;  2D5W A;  3K6U A;  4QSC A;  1RYX A;  5CRY A;  5TPA A;  3UA8 A;  1N84 A;  1EU8 A;  1DTZ A;  2AL5 A;  2OZZ A;  3O66 A;  2P0S A;  1POT A;  2ZNS A;  3C31 A;  4PQJ A;  3SEV A;  3TTL A;  1MM7 A;  3PUX E;  1NKX A;  4EQB A;  3B6W A;  3K6X A;  1B0H A;  4HCW A;  4OET A;  1HSJ A;  3G3G A;  3UK4 A;  3SET A;  3OEN A;  3IX1 A;  1F9B A;  2PX1 A;  2I4C A;  3IK6 B;  4UAC A;  2OWS A;  3MWB A;  4G8M A;  2FYI A;  4FOR A;  4JSO A;  4H67 A;  2A5T B;  3I3V A;  3QAX A;  4THI A;  1VE4 A;  2O6A A;  4TLL B;  2V93 A;  5AA2 D;  5BWJ A;  1IXI A;  3F11 A;  3S9E A;  3IR1 A;  3SES A;  5H8N A;  5CMK A;  2Y84 A;  4LAT A;  5EHS A;  1AL3 A;  3T66 A;  2O68 A;  3T9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...