4G68C

Biochemical and structural insights into xylan utilization by the thermophilic bacteriumcaldanaerobius polysaccharolyticus
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
392
structure length
392
Chain Sequence
ITLTFWNLFTGEPAKTKVKEIIDQWNKENPNVQIVESVTENDAYKTKIKAAIAANEAPDIFQTWAGGFSQPFVEAGKVLQLDSYLNDGTKDQLLPGSFDNVTYNGKIYGIPFDQQASVLYINKELFDKYNVKVPTTFSELIDAIKTFKSKGVTPFALGEKDEWPGMWYYDMIALREGGVQLTRDALNGKASFDNQAFTDAAQKLQDMVNAGAFDSGFMGLTRDEATAEFNQGKAAMYFGGNFDAAAFVSDPSSLVKGKIEAVRFPTIEGGKGDPTEYIGGTVGALMVSANSKYKDEAVRAAKYLAKQLSDMDYLIATGLPAWKYDNIDQSKVDPLEIQIMNNIVANAKGSVPAWDIYLSGDAAQTHKDLVAQLFAKQITPEEYSKQMQQKIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter
publication title Biochemical and Structural Insights into Xylan Utilization by the Thermophilic Bacterium Caldanaerobius polysaccharolyticus.
pubmed doi rcsb
source organism Caldanaerobius
molecule tags Transport protein
total genus 142
structure length 392
sequence length 392
ec nomenclature
pdb deposition date 2012-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g68C01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g68C02
2XXIA 3B6QA 2H98A 5H8NB 1N84A 1H45A 2F35A 3CIJA 5AA2A 4POWA 3PD8A 1A54A 2HZKA 1JVYA 1XC1A 1MXXA 4ZZAA 3ILUB 2XXVA 4I62A 1WVJA 3PUZE 5ITOA 3M8UA 4YKIA 1ZIUA 1ZKBA 2GRVA 3UA8A 5B70A 3TKDA 4LZ8A 3Q29A 3UGWA 1B3GA 2YLNA 4MLVA 4EXLA 2V93A 1XVYA 5L9OA 3IORA 2FNCA 2Y7PA 5CRYA 2D5WA 4H8IA 4MF3A 1EZPA 2DWHA 4F1VA 2GHBA 1MY3A 1R6ZA 5TPAA 2GHAA 3SETA 1AOVA 4IY5A 5H8FB 2DE4A 1B1XA 1QKBA 4EF1A 3ZKLA 5H8HA 3E3KA 2ESNA 3IO4A 4AQ4A 4F3GA 5M2VA 3QYTA 4OEUA 2IA4A 1SYIA 3DP4A 3T9HB 1Q35A 4OVJA 2AL5A 4PP0A 2I48A 2O68A 1KWHA 4FEBA 4O3BA 3CSGA 2ZYMA 2QJEA 2PBWA 2OBGA 4RXLA 5TP9A 3N26A 3OENA 3V83A 5HPQA 1VFDA 3ILTB 5I57A 3Q25A 3FV2A 1XHYA 1Y3PA 4ND9A 4YZZA 1P1UA 1LB8A 5A5XA 1XT8A 4XTCQ 5DEXB 2ZYKA 2W7YA 3MZ9A 4KCDA 4H67A 5CMBA 3O29A 2F36A 1I6QA 5I59A 3QXMA 5DT6A 4GXSB 2XX9A 2G29A 3PPOA 1B4HA 1USYE 3IOTA 4OFOA 2UVHA 4NF6A 1ELJA 3JZJA 1LAGE 4N07A 1VSOA 2DXRA 3MVYA 5L8DA 4YAHX 4X1DA 1B1HA 3C32A 1OLAA 2E1SA 1URGA 3E13X 3GBAA 3PPQA 1ZTYA 3A09A 3RTFB 3N6TA 5BUUA 4XIGQ 3UORA 5CMMA 4BDQA 1MXWA 1DPPA 1DTZA 2UVJA 1Z7NE 2XXXA 3MWBA 3U72A 4WKMA 4RJZA 4FE8A 4KYDA 2DOJA 2ZNUA 3MBPA 3PMWA 3CFXA 3EF7A 2LAOA 1US4A 2I3WA 4U4XA 3OEMA 1B58A 4BDLA 2M8CA 4DCXA 4GL8A 3PV0E 1S50A 4QSCA 2QL3A 2RC7A 3FGSA 5IAIA 1LCFA 3VFJA 3IX1A 1H3DA 1IQ7A 1Y20A 4FAJA 5H8SA 4GWOA 5ICQA 3A3CA 5CBRA 3FUZA 2Z8DA 4ELOA 3HSTA 1EZ9A 1QW0A 3SDFA 3WAEA 4OERA 3EHUA 4MH5A 1FTMA 2NOOA 2PMSA 5I2NB 3G3FA 5L9MA 3UN6A 2PYYA 4GIZA 3Q27A 1O63A 4F3PA 1PBQA 1LAXA 3LSFB 5AA2D 3LSLA 2P0SA 4NWCA 1N3WA 1PEBA 3CVGA 4KD5A 5KCJB 3LR1A 4GL0A 1P1WA 1B5JA 4MFIA 3FXQA 1B9JA 1P1NA 1URSA 2A5TB 1Q1KA 2V25A 5FHOA 4O3AA 4OWDA 4TLMB 2PT2A 3I6VA 4EQBA 4KHZE 1BIYA 3DP6A 5AA2B 4BDOA 2XD3A 1MH3A 3DP8A 4H8JA 1FQFA 1DTGA 1N3XA 3OSRA 1MDQA 5H8FA 1PB7A 3THIA 4QFLA 4YMAA 4PFUA 4R6YA 5F7VA 3FJ7A 1NH8A 2I58A 1AMFA 1A8EA 2FA7A 4WEPA 3PUYE 4EUOA 3TCHA 3IJOB 5I56A 1M5FA 3H6WA 4WXJA 2ZNSA 3FVKA 1NMUA 3FVGA 2P1SA 4LZ5A 1USYH 1I6BA 1JEVA 1B7UA 5FHNA 3FIRA 4DLDA 4HCWA 5AA3A 4NTLA 2OJTA 5DEXA 4G68A 1FTLA 3D4GA 4BDRA 1II5A 3FATA 2HEUA 3CFLA 4ZDMA 3O66A 4N6PA 4JB7A 5ISUA 2YJPA 1T0KA 4BDNA 3SKPA 2QMXA 2H4IA 3K00A 4U2RA 4OQOA 2Q2AA 2OZZA 4R9GA 1PC3A 1A7LA 4NWDA 4AB5A 3E9XA 2QS4A 1D4NA 5TU0A 3RT6B 3TELA 3BBRA 3SEYA 2Y7KA 3EHSA 5A5XB 3TTKA 1MRPA 1WODA 2DYXA 3SEWA 3RN8A 3V8XB 5DVFA 1MDP1 4Z0IA 5KZTA 3PGFA 1P1OA 1B7HA 2Q2CA 2WKYA 3LBSA 4JWOA 4LONB 5H8QB 3G3IA 4NF5B 3IO6A 1OQHA 4WEDA 2F8DA 1B5IA 1HSJA 4ESWA 1A55A 1B32A 4IO3A 2XXYA 4RPOA 2ONSA 4ZEIA 2UYFA 4QFNA 5FHMA 4F2QA 2D21A 4ZEBA 5I2NA 4EXKA 1BLFA 5EHMA 1LCTA 3GZGA 4YB6A 3KG2A 1R9QA 3K0VA 4ONYA 4QF9A 4C1TA 1N76A 3CR9A 3PUWE 3OO8A 3VV5A 3K1MA 3LSXA 4ZEFA 4HCYA 1SW2A 1PBPA 5KCJA 4R75A 1SW5A 4ZECA 4DXBA 4R72A 2A5TA 1XS5A 3R7XA 1IIWA 5ELVA 4GQOA 4IO6A 1TFDA 2BJJX 3HHFA 2I0CA 4G68C 3CI8A 2F97A 3U93A 4DZ1A 1UTBA 4K3FA 4R6KA 3FVOA 2XXRA 3I5OA 2QS3A 4U21A 1BTJA 5AE4A 3CG1A 1QULA 5BWJA 2Y84A 4MBPA 2Z22A 3R6UA 4OFJA 1S7YA 4DE8A 1JVXA 2X26A 3TYHA 2B65A 2VD3A 2X7PA 1PB9A 4GVOA 3QIMA 2THIA 1MM6A 4FJPA 1A40A 3E4RA 5DTBA 4R6HA 1TWYA 2I6EA 2QSXA 2Y7IA 1B46A 3TTMA 4N13A 1B05A 2ZNTA 3PMXA 3V89B 3EQ1A 1XOCA 2F34A 5CMCA 4RK9A 4EF2A 3P7IA 1Y3QA 3LUYA 4QFKA 3BKIB 3FD3A 5L9SA 5I56B 1MPBA 1TT1A 1N7XA 4DXUA 3T22A 4KQPA 4TLLB 3U92A 3CFZA 1MY4A 1R9LA 4EQ7A 5EYFA 1TFAA 3F11A 1OVBA 3VXCA 3ZSFA 4GD5A 4O3CA 3K6XA 4R2BA 4XKRA 2F7CA 3BFUA 1B7ZA 1QJMA 2R9JA 1LAHE 3RLFE 1HSEA 3PU5A 1Y3NA 3O6HA 3DELB 2XD2A 4G68B 3IK6B 4ESXA 2RCAA 2QS2A 1QVSA 2NVUB 1ZJLA 3QAXA 3WAFA 1N7WA 1B3FA 1A99A 2DVCA 3TMGA 3TCFA 2NXOA 3K02A 4OESA 2CZLA 4IO5A 1POY1 4FORA 4EQ9A 3C31A 4UA8A 1US5A 5H8QA 2O51A 4NF5A 1LFIA 2XX8A 4GOTA 1PB8A 4GLIA 4YKJA 3KSXA 2F7BA 3GXAA 4ZZEA 2O1MA 2PT1A 4P0IA 3ONMA 2Z23A 5KDTB 4NF4A 4RK2A 3TFLA 4JSOA 3K6UA 3KOTA 2R71A 4UACA 4Q0CA 5LOMA 2ZYOA 2O1LA 4YB5A 3TQWA 4X48A 1GTKA 1MQGA 3V5AA 1B3LA 3RQTA 1JQFA 2VOZA 2V3UA 3TODA 1SVXB 1Y4CA 2F6PA 1MH4A 4ZEKA 4ELQA 1NNFA 3ODBA 4ELPA 3H06B 1OVTA 1BKAA 3MVZA 3IB2A 3FXUA 5FTHA 3OO6A 1O64A 2H9BA 3EPEA 2OLBA 1MY2A 2YPNA 1LAFE 3DM0A 3PUXE 2DWIA 2OWSA 4LVQA 1IXCA 4H5FA 4QFPA 2HQ0A 2UXAA 2RC9A 1O7TA 2HAUA 3UIFA 2O84X 1MM7A 3PMVA 3TTLA 3Q26A 4ZEDA 3W9VA 3UP9A 1GR2A 2DVZA 4R73A 1FW0A 4X9TA 4KR5A 1SI0A 4NF8B 2Q89A 4ISUA 5HBCA 1BP5A 2XHDA 3FZVA 2CMOA 2UYEA 1M5CA 5JTYB 4Q8RA 1JETA 1M5EA 3UK4A 3KJ7A 4I1DA 2G93A 3VVFA 5B7DA 1UTBB 1NKXA 4GF8A 3TCGA 2QPQA 1H43A 4OTEA 3RGYA 4L17A 4H0WA 4OZ9A 2VD2A 3IOUA 1YTVA 4F2OA 2RF1A 2ABHA 1I69A 3MUQA 3T96B 1Y1MA 4BLAA 2O6AA 2ZXTA 3K4UA 3TPAA 4P11A 4U1ZA 3QUFA 5CBSA 1QUIA 1URDA 1OIBA 1J1NA 1LLSA 3MP1A 5HM4B 3G7WA 1OMPA 3MAMA 3H03A 4E0XA 4TQUQ 3LSWA 3OELA 1L5TA 3RTWB 2Q88A 2V3TA 1EH3A 2F5XA 4HS7A 3W15C 4IO7A 4DIGA 2AYSA 1FQBA 1NH7A 4OEVA 1DMBA 3IOVA 2RC8A 1Y9UA 1B2HA 4H5GA 3IAZA 1MQJA 3C4MA 1P1QA 4ELRA 3FASA 3KBRA 2REJA 3M3KA 3U94A 3MVXA 3SERA 1IUDA 1YAEA 3FJMA 3K1NA 1TXFA 1N04A 1POTA 4QSEA 1HSLA 1UQWA 4LATA 1MQDA 2Y7WA 3VLVA 3AXFA 2PX1A 3O28A 3D4CA 5KDTA 1M5BA 4KYEA 3SEVA 4PETA 4IY6A 3MJNA 4H1XA 3KN8A 4IO2A 2XXTA 1LBCA 2F6GA 4JWXA 3HV1A 3S4UA 3IJXB 4F3SA 4HW8A 1H44A 3C9HA 4KFQA 2XXUA 3K6WA 3RPWA 3H6UA 2I49A 2RKMA 3QK6A 1SYHA 3PPNA 2UVGA 4LQ5A 4ZE8A 3MQ9A 4THIA 3C33A 4ZS9A 2O7IA 1RKMA 5EHSA 3BFTA 1FQDA 3KSJA 3ZKKA 5ITPA 4JWYA 3G3KA 1MY1A 4NF4B 3M3FA 2FYIA 4XKPA 4NE4A 1PDAA 2H5YA 2VGQA 5IKBA 1FCKA 1MS7A 1FQCA 4RY1A 3K01A 5DYHA 1B5HA 4U22A 3CRBA 4DXCA 5DVIA 2DS9A 1MXVA 1IITA 3MW0A 3B7DA 5CMKA 4EDPA 1SW1A 3B6TA 4RA1A 3FV1A 4PQJA 1OLCA 1MG1A 3MPLA 1LFGA 1ZMGA 4I8CA 3VLUA 5I84A 1IXGA 3L6GA 3GBBA 3N94A 3HHGA 3GLBA 4NF8A 1SBPA 3VDFA 3PPPA 1D9VA 3MPKA 1WDNA 1XVXA 1LSTA 5JTYA 3OSQA 3PD9A 1UIUA 1CB6A 3RNNA 3OXNA 4OMBA 2OCUA 1B51A 1IXHA 1QKAA 1EU8A 4YB7A 1SQYA 2OWTA 3SEXA 4BDMA 2H99A 3OEKA 2RINA 2XXQA 2I3VA 3H4ZA 3K6VA 4G2ZA 3MP8A 4G77A 3MP6A 2H25A 4C0RA 5AA4B 2Q9TA 2DWAA 1A8FA 1FQAA 3QUJA 4TOZA 1SI1A 3K2DA 2HCAA 3T9VA 1QUJA 1QUKA 3VVEA 1UIVA 1UTHB 3MZBA 4X1BA 3HCQA 2DP8A 3KGCA 4I9DA 3N6UA 3Q28A 3N5LA 4OETA 3TEPA 4JXIA 3IOWA 4XKQA 2DE2A 3H6TA 2ALUA 3U1OA 1MQIA 3KN7A 1F9BA 4QSDA 3HN0A 1GGGA 1N0TA 3TTNA 2Q8JA 3MZ1A 4RYAA 4OENA 5I2KA 1LB9A 3H6VA 3OMBA 4HTGA 2ONRA 2V3QA 2XX7A 4F29A 2P2AA 1B40A 1MQHA 2O7UA 4MLQA 4U1OA 1MY0A 4G4PA 3S9EA 1ZBMA 1B6HA 1D9YA 2GH9A 4NEDA 1H76A 2I0BA 3W9WA 1YCJA 4AB6A 1JEUA 4F22A 5CM6A 4YKKA 4POXA 2ONKE 3DLNA 3FJGA 1NL5A 4F39A 1AL3A 4OFLA 5JEIA 3VE1B 1B52A 1NNTA 1NNKA 2A5SA 5F1QA 2GFEA 1DSNA 4FATA 4DCYA 2E0SA 4FIMA 4ECFA 5I58B 4F19A 3L6HA 3O2AA 3HPIA 1MXYA 1EZOA 1S9TA 4NMYA 5DVJA 3VLWA 1FTKA 2XXWA 2RCBA 4G8NA 4F1YA 3CG3A 4YKPA 3KEIA 2VP1A 3S9MC 3KJTA 4LA9A 3A3UA 4OXVA 4G8MA 3TUSA 3T9XB 1NNPA 2QMWA 3G3HA 4KCCA 1YPNA 4LP2B 2HFBA 1GVCA 3H7MA 2KLFA 1MPCA 2DQVA 4IGRA 1MXUA 4R9FA 1LBBA 4IO4A 4PFTA 1B0LA 2HXWA 3O6IA 1B0HA 2ZYNA 3ZS6A 4OHNA 5H8NA 5K2XA 1Z7ME 1M5DA 4M4GA 1JW5A 4G8HA 3IR1A 4LUBA 3TDJA 4R2FA 2HZLA 1FTJA 2VHAA 4KI0E 4XKNA 4U4SA 4R74A 2Y7RA 1ZU0A 5AA4A 4KYSA 1P99A 3KFMA 3USDA 3FVNA 3IB1A 2AL4A 1VE4A 3TAJA 2IEEA 1SW4A 2QS1A 4YU0A 2AIXA 3MVWA 4F3BA 3SESA 1MXZA 4GXAA 1UTHA 1JW4A 4H6DA 1SD3A 3HO7A 1FQEA 1I6AA 5J1DA 3G3JA 4PFWA 4RPNA 2XXPA 4FECA 1JNFA 2OK2A 3CSBA 2R6GE 4JSDA 1ATGA 3C34A 3H3GA 3R26A 1R1NA 4Q5TA 1DOTA 1MPDA 2X7QA 4YICA 1CE2A 1LGBC 1Y1ZA 2DSFA 3I3VA 4DDDA 1VFEA 3PPRA 4IGTA 3MC2A 4E0WA 2DWJA 1D3KA 1OQGA 3KZGA 4U23A 3S9NC 2I4CA 3O9PA 2NUVA 5TPAB 1IXIA 3G3GA 3VVDA 4F18A 4JBZA 1RYXA 1DPEA 3OD7A 5H8HB 1FTOA 3OOAA 2D3IA 4Q30B 4ZE9A 1B3HA 5I2KB 1B3EA 5FTIA 4F31B 2ZMBA 4KPTA 1ANFA 1AIVA 3RT8A 5I58A 5K2YA 3C36A 5AA1A 5TP9B 2UVIA 3O97A 2ANJA 3OO9A 2F78A 2HAVA 1IZ1A 4YMBA 5I57B 2O69A 1B4ZA 4P0GA 4LQ2A 3IB0A 2PVUA 1NFTA 4PE5B 4QFOA 5CI5A 2XXHA 1ZLQA 2DE3A 1VR5A 3TQLA 5CC2A 3B6WA 2DXYA 1Y4TA 4XXUA 4M1VA 2F7AA 1LFHA 1SDXA 5I59B 3QSLA 3O6GA 4Z7EA 3KN3A 4NF6B 4IB2A 1RYOA 4RNSA 3PUVE 4C1UA 4H65A 3SEUA 3S9LC 4PFYA 5ICTA 3IL1B 3K1PA 4JDFA 4GFRA 4QHQA 5JK4A 3C35A 3TZAA 2Z8FA 3VXBA 3M3LA 3KOSA 3RY3A 3EN3A 1GV8A 3JV9A 1AH5A 2B3FA 2NWJA 2REGA 3FXRA 4LZ7A 2Z8EA 3T93B 2I4BA 3TTRA 3OO7A 2QRYA 3S2VA 3JYRA 3EHTA 3T66A 1JW1A 3LC8A 3U8QA 3RUMA 4GRKA 4QRZA 4OYVA 3ECRA 2V84A 4FEDA 3T9UA 1IEJA 2B3BA 4F1UA
chains in the Genus database with same CATH superfamily
2XXIA 3B6QA 2H98A 5H8NB 1N84A 1H45A 2F35A 3CIJA 5AA2A 4POWA 1FJ6A 3PD8A 1A54A 2HZKA 5IZZA 1JVYA 1XC1A 1DBZA 1MXXA 4ZZAA 3ILUB 3T1BA 2XXVA 4I62A 1WVJA 3PUZE 5ITOA 1KZ8A 3M8UA 4YKIA 1ZIUA 3GYYA 1ZKBA 2GRVA 3UA8A 4PBQA 5B70A 3TKDA 4LZ8A 3Q29A 3UGWA 1B3GA 2YLNA 4MLVA 4EXLA 2V93A 1XVYA 5L9OA 1G0IA 3IORA 2FNCA 2Y7PA 5EQ8A 2P3VA 4PCDA 5CRYA 2D5WA 4H8IA 4MF3A 1EZPA 2DWHA 4F1VA 2GHBA 1MY3A 1R6ZA 1FBPA 2GHAA 5TPAA 3SETA 1AOVA 4IY5A 5H8FB 2DE4A 1B1XA 1QKBA 1QGXA 4EF1A 3ZKLA 5H8HA 3E3KA 2ESNA 3IO4A 4AQ4A 4F3GA 3NOHA 5M2VA 3QYTA 4OEUA 2IA4A 1SYIA 3DP4A 3T9HB 1Q35A 4OVJA 2AL5A 4PP0A 2I48A 2O68A 4FBPA 1KWHA 1INPA 4FEBA 4O3BA 3CSGA 2ZYMA 2QJEA 2PBWA 2OBGA 4RXLA 5TP9A 5IM2A 3N26A 2DDKA 3OENA 3V83A 5HPQA 2Q74A 1VFDA 3ILTB 5I57A 3Q25A 3FV2A 1XHYA 1Y3PA 4ND9A 4YZZA 1P1UA 1LB8A 5A5XA 1XI6A 1XT8A 4XTCQ 5DEXB 4MNIA 2ZYKA 2W7YA 3MZ9A 4KCDA 4H67A 5CMBA 3O29A 2F36A 1I6QA 5I59A 3QXMA 4NGUA 4MIJA 5DT6A 4GXSB 2XX9A 2WBBA 2G29A 3PPOA 1B4HA 1USYE 3IOTA 4OFOA 2UVHA 4NF6A 1ELJA 3JZJA 1LAGE 4N07A 2PFZA 1VSOA 2FHYA 2HXRA 2DXRA 3MVYA 5L8DA 2PCRA 4YAHX 4X1DA 1B1HA 3C32A 1OLAA 2XA5A 4PGNA 2E1SA 1URGA 3E13X 3GBAA 5ESYA 3PPQA 1NUWA 1ZTYA 3A09A 3RTFB 3N6TA 5BUUA 4XIGQ 1JP4A 3UORA 3U65A 5CMMA 4DI4B 5LDZA 4P1LA 4BDQA 1MXWA 1DPPA 4N6DA 1DTZA 2BJIA 2UVJA 1Z7NE 4NF0A 2XXXA 2HHMA 3MWBA 3U72A 4WKMA 4RJZA 4FE8A 4MAGA 4KYDA 1NV0A 2DOJA 2ZNUA 3MBPA 3PMWA 4N8GA 3CFXA 3EF7A 2LAOA 1US4A 2I3WA 4U4XA 3OEMA 1B58A 4BDLA 2M8CA 4DCXA 4GL8A 1FJ9A 5ET5A 3PV0E 1S50A 4QSCA 2QL3A 2RC7A 3FGSA 5I3SA 5IAIA 1LCFA 3VFJA 3IX1A 1H3DA 1IQ7A 5A5LA 1Y20A 3BIGA 4FAJA 5H8SA 4GWOA 5ICQA 3A3CA 5CBRA 3FUZA 2Z8DA 4ELOA 3HSTA 4I40A 1EZ9A 1D9QA 1QW0A 4JVIA 3SDFA 3WAEA 4OERA 3EHUA 4MH5A 1FTMA 3ISPA 2NOOA 2PMSA 5I2NB 3G3FA 5L9MA 3UN6A 1NV6A 2PYYA 4PDDA 4GIZA 4PFIA 3Q27A 1O63A 4F3PA 1NV1A 1PBQA 1LAXA 3LSFB 5AA2D 3LSLA 2P0SA 4NWCA 1N3WA 2FBPA 1PEBA 3CVGA 4KD5A 5KCJB 3LR1A 4GL0A 4GBWA 1P1WA 1B5JA 4MFIA 3FXQA 1B9JA 1P1NA 1URSA 2A5TB 1Q1KA 2V25A 5FHOA 4O3AA 4OWDA 4TLMB 2PT2A 3FBPA 3I6VA 5IZ1A 4EQBA 4KHZE 1BIYA 3DP6A 4MNCA 5AA2B 4BDOA 2FVZA 2XD3A 4LN5A 1MH3A 3DP8A 1LBVA 4H8JA 1FQFA 1DTGA 1N3XA 3OSRA 1MDQA 5H8FA 1PB7A 3THIA 4QFLA 4YMAA 4PFUA 4R6YA 4P56A 5F7VA 2B4MA 4P3LA 3FJ7A 1NH8A 2I58A 1AMFA 4OA4A 1A8EA 4H45A 2FA7A 4WEPA 3PUYE 4XEQA 2CZKA 4EUOA 3TCHA 3IJOB 5I56A 1M5FA 3H6WA 4WXJA 2ZNSA 3FVKA 1NMUA 1KA1A 3FVGA 2P1SA 4LZ5A 1FBDA 1USYH 4I3EA 1I6BA 1JEVA 1B7UA 5FHNA 3FIRA 4DLDA 4HCWA 4PGPA 5AA3A 1NUXA 4NTLA 4PTKA 2OJTA 5DEXA 4G68A 1FTLA 2CZHA 4OVSA 3D4GA 4BDRA 1II5A 1Q9DA 3FATA 2HEUA 3CFLA 4ZDMA 3FXBA 3O66A 4N6PA 4JB7A 5ISUA 4GX6A 1LBWA 2YJPA 2XXKA 4NX1A 1T0KA 4BDNA 3SKPA 2QMXA 2H4IA 3K00A 4U2RA 4OQOA 1NV2A 2Q2AA 2XWVA 2OZZA 4R9GA 1PC3A 1A7LA 4NWDA 4AB5A 4PAKA 5FBPA 1FBGA 3KC0A 3E9XA 2QS4A 1D4NA 4GWSA 3IFAA 5TU0A 3RT6B 3TELA 3BBRA 3SEYA 2Y7KA 3EHSA 5A5XB 3TTKA 4PC9A 4P1EA 1MRPA 2OX3A 1WODA 2DYXA 3SEWA 4DI3D 3RN8A 3V8XB 5DVFA 1MDP1 4Z0IA 5EYHA 1AWBA 5KZTA 3PGFA 1P1OA 5F24A 1B7HA 2Q2CA 2WKYA 3LBSA 4JWOA 4LONB 5H8QB 2QVVA 3G3IA 4NF5B 3IO6A 1OQHA 4WEDA 2R8TA 2F8DA 1BK4A 2VPOA 1B5IA 1HSJA 1FSAA 4ESWA 1A55A 1B32A 4IO3A 2XXYA 4RPOA 2ONSA 1FPGA 3IFCA 4ZEIA 2UYFA 4QFNA 5FHMA 3RPLA 3KBZA 4QBAA 4F2QA 2D21A 4ZEBA 5I2NA 4EXKA 1BLFA 5EHMA 4HE1A 4AS5A 1LCTA 3GZGA 1NUYA 4YB6A 3KG2A 1R9QA 3K0VA 4ONYA 4QF9A 4C1TA 1N76A 3CR9A 3E78A 2WYKA 3PUWE 3OO8A 3VV5A 3K1MA 2XWOA 3LSXA 4IR8A 4ZEFA 4HCYA 1SW2A 1PBPA 5KCJA 4R75A 1SW5A 4ZECA 4DXBA 4R72A 2A5TA 1XS5A 3R7XA 1IIWA 5ELVA 1FPLA 4GQOA 4IO6A 1TFDA 2BJJX 3HHFA 2I0CA 4X04A 2B4LA 4G68C 4NG7A 3CI8A 2F97A 3U93A 4DZ1A 3KC1A 1UTBA 4K3FA 4R6KA 1K9ZA 4N6KA 3FVOA 2XXRA 3I5OA 2QS3A 4U21A 1BTJA 3RYDA 5AE4A 1IMAA 3CG1A 1QULA 1FBHA 2CEXA 5BWJA 2Y84A 4MBPA 2Z22A 3R6UA 4OFJA 1S7YA 4DE8A 1JVXA 2X26A 3TYHA 2B65A 2VD3A 2X7PA 1PB9A 4GVOA 4JVDA 3QIMA 2THIA 1MM6A 4FJPA 1A40A 4I3YA 3E4RA 5DTBA 4UABA 2MKZA 4R6HA 1TWYA 2I6EA 2QSXA 2Y7IA 4G61A 1B46A 3TTMA 4N13A 1B05A 2ZNTA 3PMXA 3V89B 3EQ1A 1XOCA 2F34A 5CMCA 4RK9A 4EF2A 2F3BA 3P7IA 3MSTA 5T3JA 1Y3QA 3LUYA 4O94A 4QFKA 3BKIB 3FD3A 5L9SA 5I56B 1MPBA 1TT1A 1N7XA 4DXUA 3T22A 4KQPA 4TLLB 4MJOA 3U92A 3CFZA 1MY4A 1R9LA 4EQ7A 5EYFA 1TFAA 3F11A 3ROJA 1OVBA 3VXCA 3ZSFA 4N81A 1CNQA 4GD5A 4O3CA 3K6XA 4R2BA 4XKRA 4GX3A 2F7CA 3BFUA 1B7ZA 1QJMA 2R9JA 4PFRA 1LAHE 4GWUA 3RLFE 3BIHA 2ZZWA 1HSEA 3PU5A 1Y3NA 3O6HA 3DELB 2XD2A 4G68B 3IK6B 4ESXA 2RCAA 2QS2A 1QVSA 2NVUB 1ZJLA 3QAXA 4OVQA 3WAFA 1N7WA 1B3FA 1A99A 2DVCA 3TMGA 3TCFA 2NXOA 3K02A 4QXDA 4OESA 2CZLA 2HPGA 4IO5A 3CHGA 1POY1 4FORA 4EQ9A 3C31A 4UA8A 1US5A 2O51A 5H8QA 5IZ3A 4NF5A 1LFIA 2XX8A 4GOTA 1PB8A 4GLIA 4YKJA 3KSXA 2F7BA 3GXAA 4ZZEA 2O1MA 2PT1A 4P0IA 4N4UA 3ONMA 2Z23A 5KDTB 4GX4A 4NF4A 4RK2A 3TFLA 4JSOA 3K6UA 3KOTA 2R71A 4UACA 3MYUA 4Q0CA 4GWXA 5LOMA 2ZYOA 2O1LA 5ET8A 4YB5A 3TQWA 1NUZA 2GQ1A 4X48A 1GTKA 1MQGA 3V5AA 1B3LA 3RQTA 1JQFA 2VOZA 2V3UA 3TODA 1SVXB 3B50A 2WEFA 1Y4CA 2F6PA 1MH4A 1FPIA 4ZEKA 4ELQA 4PE3A 1NNFA 3ODBA 4ELPA 3H06B 1OVTA 1BKAA 2WX9A 1RDYA 3MVZA 4NN3A 3IB2A 3FXUA 5DW8A 3RPLB 5FTHA 3OO6A 1O64A 2H9BA 3EPEA 2OLBA 1VDWA 1MY2A 2YPNA 1LAFE 3DM0A 3PUXE 2DWIA 2OWSA 4GWWA 4LVQA 1IXCA 4H5FA 4QFPA 4PDHA 4KXPA 2HQ0A 2UXAA 2RC9A 1O7TA 2HAUA 2JJKA 3UIFA 2O84X 4OVTA 1MM7A 3PMVA 3TTLA 5LTCA 3Q26A 4ZEDA 3W9VA 4P47A 3UP9A 1GR2A 2DVZA 4R73A 1YZ0A 1FW0A 4X9TA 5I7IA 4KR5A 1SI0A 4NF8B 2Q89A 4ISUA 4HE0A 5HBCA 1BP5A 2XHDA 3FZVA 4OVRA 2CMOA 2UYEA 1M5CA 4MCOA 5JTYB 4Q8RA 1JETA 1M5EA 3UK4A 3KJ7A 4I1DA 2G93A 3VVFA 5B7DA 1UTBB 1NKXA 2QVUA 4GF8A 2KQZA 3TCGA 2QPQA 1H43A 4OTEA 3RGYA 4L17A 4H0WA 4OZ9A 2VD2A 3IOUA 1EYJA 1YTVA 4F2OA 1K9YA 4N15A 2RF1A 2ABHA 1I69A 3MUQA 4GWYA 3T96B 1Y1MA 4BLAA 2O6AA 2ZXTA 3K4UA 3TPAA 4P11A 5J16A 4U1ZA 3QUFA 5CBSA 1QUIA 1URDA 1OIBA 1J1NA 5ET6A 1LLSA 3MP1A 5HM4B 3G7WA 1OMPA 4MX6A 5I5PA 3MAMA 3H03A 2Y5LA 4E0XA 4TQUQ 3LSWA 4PAFA 3OELA 1L5TA 3RTWB 2Q88A 2V3TA 1EH3A 2F5XA 4HS7A 3W15C 4IO7A 2ZZVA 4DIGA 2AYSA 1FQBA 2V4CA 1NH7A 4OEVA 1DMBA 3IOVA 2RC8A 1Y9UA 1B2HA 1RDZA 4PFBA 4H5GA 3IAZA 1MQJA 3C4MA 1P1QA 1LBZA 4ELRA 3FASA 3KBRA 2REJA 2XWIA 3M3KA 3U94A 3MVXA 3SERA 1IUDA 1YAEA 4X8RA 3FJMA 3K1NA 1TXFA 1N04A 1POTA 4QSEA 1HSLA 1UQWA 4LATA 1MQDA 2Y7WA 3VLVA 3AXFA 2PX1A 4GWZA 3O28A 3D4CA 5KDTA 1LBXA 1DK4A 1M5BA 4KYEA 3SEVA 4PETA 4IY6A 3MJNA 4H1XA 3KN8A 4IO2A 4XF5A 2XXTA 1LBCA 2F6GA 4JWXA 3HV1A 3S4UA 3IJXB 4F3SA 4HW8A 1H44A 3C9HA 4KFQA 2XXUA 3K6WA 2VT5A 3RPWA 3H6UA 2I49A 2RKMA 5IZ3B 3QK6A 1SYHA 3PPNA 2UVGA 4LQ5A 1NV4A 4ZE8A 3MQ9A 1IMDA 4THIA 3C33A 4ZS9A 2O7IA 4P8BA 1RKMA 5EHSA 3BFTA 1FQDA 3KSJA 3ZKKA 5ITPA 4JWYA 3G3KA 1FPJA 1MY1A 4NF4B 1FPBA 3M3FA 2FYIA 4XKPA 4N8YA 4NE4A 1PDAA 2H5YA 4MNPA 2VGQA 1RDXA 5IKBA 1FCKA 1MS7A 1FQCA 4RY1A 3K01A 5DYHA 1B5HA 4U22A 1LEVA 3CRBA 5ET7A 4DXCA 1EYKA 5DVIA 2DS9A 1MXVA 1IITA 3QMFA 3MW0A 3LUZA 3B7DA 5CMKA 4EDPA 1SW1A 3B6TA 4RA1A 3B8BA 3FV1A 4PQJA 1OLCA 2L5VA 3MPLA 1MG1A 1LFGA 1ZMGA 4I8CA 3VLUA 5I84A 1IXGA 3L6GA 3GBBA 3N94A 3HHGA 3GLBA 4NF8A 1SBPA 3VDFA 3PPPA 1D9VA 4MMPA 3MPKA 1WDNA 1XVXA 1NV7A 1LSTA 5JTYA 3OSQA 3PD9A 4OANA 2XWKA 1UIUA 1CB6A 3RNNA 3OXNA 4OMBA 2OCUA 1B51A 1IXHA 1QKAA 1EU8A 4YB7A 1SQYA 2OWTA 3SEXA 2Q8MA 2H99A 3OEKA 4BDMA 2RINA 3E79A 2XXQA 2I3VA 3H4ZA 3K6VA 4G2ZA 3MP8A 1LBYA 4G77A 3MP6A 1NI9A 2H25A 4C0RA 1FBFA 5AA4B 2Q9TA 2DWAA 1A8FA 1FQAA 3QUJA 4TOZA 1SI1A 3K2DA 2HCAA 3T9VA 1QUJA 1QUKA 3VVEA 4HXVA 1UIVA 1UTHB 3MZBA 4X1BA 3HCQA 2DP8A 3KGCA 4I9DA 3N6UA 3Q28A 3N5LA 4MEVA 4OETA 3TEPA 4JXIA 1FBCA 3IOWA 2OWZA 4XKQA 2DE2A 3H6TA 2QVRA 2ALUA 3U1OA 1MQIA 3KN7A 1F9BA 4QSDA 3HN0A 1GGGA 1N0TA 3TTNA 2Q8JA 3MZ1A 4N91A 4RYAA 4OENA 5I2KA 1LB9A 3H6VA 3OMBA 3PTYA 2ONRA 2V3QA 4HTGA 2XX7A 4F29A 2P2AA 1EYIA 1B40A 1MQHA 2CZIA 2O7UA 4MLQA 4U1OA 1MY0A 4G4PA 3S9EA 4NAPA 1ZBMA 1B6HA 1D9YA 2GH9A 4NEDA 1H76A 3SZPA 2I0BA 3W9WA 1YCJA 4AB6A 1JEUA 4F22A 5CM6A 3HFUA 5EQAA 4YKKA 4PF8A 2P3NA 4POXA 2KR0A 2ONKE 3DLNA 1FRPA 3FJGA 1NL5A 4F39A 1AL3A 4OFLA 5JEIA 3VE1B 1B52A 1NNTA 1NNKA 2A5SA 5F1QA 2GFEA 1DSNA 4FATA 4DCYA 2E0SA 4FIMA 2F3DA 4ECFA 5I58B 4F19A 3L6HA 3O2AA 3HPIA 1MXYA 1EZOA 1S9TA 4NMYA 5DVJA 3VLWA 1FPEA 1FTKA 2XXWA 2RCBA 4G8NA 4F1YA 1IMBA 3CG3A 4YKPA 3KEIA 2VP1A 5EYGA 3S9MC 4PBHA 3KJTA 4LA9A 3A3UA 4OXVA 4AS4A 1FPDA 1YXIA 4G8MA 3TUSA 3T9XB 1NNPA 2QMWA 3G3HA 4KCCA 1YPNA 4LP2B 2HFBA 1GVCA 2Y5KA 1KA0A 3H7MA 2KLFA 1MPCA 2FIXA 2DQVA 1IMEA 4IGRA 1MXUA 4R9FA 1LBBA 4IO4A 3T0JA 4PFTA 1B0LA 2HXWA 3O6IA 1B0HA 2ZYNA 3ZS6A 4OHNA 5H8NA 5K2XA 1Z7ME 1M5DA 4M4GA 1JW5A 2WYPA 4G8HA 2VPNA 3IR1A 4LUBA 3TDJA 4R2FA 2HZLA 1FTJA 2VHAA 4KI0E 4XKNA 4U4SA 4R74A 2Y7RA 1ZU0A 5AA4A 4KYSA 4MHFA 1P99A 3KFMA 3USDA 3FVNA 3IB1A 2AL4A 1VE4A 3TAJA 2IEEA 2WBDA 1SW4A 2QS1A 4YU0A 2AIXA 3MVWA 1FBEA 4F3BA 3SESA 1MXZA 4GXAA 4JVCA 1UTHA 1JW4A 4H6DA 4OVPA 1SD3A 3HO7A 1FQEA 1I6AA 5J1DA 3G3JA 4PFWA 4RPNA 2XXPA 3EKIA 4FECA 1JNFA 2OK2A 3CSBA 2R6GE 3D1RA 4JSDA 1ATGA 3C34A 3H3GA 3R26A 4P9KA 1R1NA 4Q5TA 1DOTA 1MPDA 2X7QA 4YICA 3A29A 1CE2A 1LGBC 1Y1ZA 2DSFA 3I3VA 4DDDA 1VFEA 3PPRA 4IGTA 3MC2A 4E0WA 2DWJA 1D3KA 1OQGA 3KZGA 4U23A 4XFEA 3S9NC 2I4CA 3O9PA 2NUVA 5TPAB 1IXIA 1NV3A 3G3GA 3VVDA 4F18A 4JBZA 1RYXA 1DPEA 3OD7A 5H8HB 5EQ9A 4N17A 4NHBA 1NV5A 1FTOA 3OOAA 2D3IA 4Q30B 4H46A 1DCUA 4ZE9A 1B3HA 2FIEA 5I2KB 1FPFA 1B3EA 5FTIA 4F31B 2QFLA 2ZMBA 4KPTA 4O8MA 1ANFA 1AIVA 3RT8A 5I58A 4PAIA 5K2YA 3C36A 5AA1A 5TP9B 2UVIA 3O97A 2ANJA 3OO9A 2F78A 2HAVA 1IZ1A 1SPIA 4YMBA 5I57B 2O69A 4HE2A 1B4ZA 4P0GA 4LQ2A 3IB0A 2PVUA 1NFTA 4PE5B 4QFOA 5CI5A 2XXHA 1ZLQA 2DE3A 1VR5A 3TQLA 5CC2A 3B6WA 2DXYA 1Y4TA 2ZZXA 4XXUA 4M1VA 2F7AA 1LFHA 5EQ7A 1SDXA 5I59B 3QSLA 3O6GA 1YYZA 4Z7EA 3KN3A 4NF6B 4IB2A 1RYOA 4RNSA 3PUVE 4O7IA 4C1UA 4H65A 3SEUA 3S9LC 4PFYA 5ICTA 3IL1B 3K1PA 1G0HA 4JDFA 1FTAA 4GFRA 4QHQA 5JK4A 3LV0A 3C35A 3TZAA 4PF6A 2Z8FA 3VXBA 3M3LA 3KOSA 3RY3A 3EN3A 4NQ8A 1GV8A 3JV9A 1AH5A 2B3FA 2PFYA 2NWJA 2REGA 2CEYA 4GBVA 3FXRA 4LZ7A 2Z8EA 4O7MA 3T93B 2I4BA 3TTRA 3OO7A 2QRYA 3S2VA 5IGAA 1FPKA 3JYRA 3EHTA 3T66A 1JW1A 3LC8A 3U8QA 3RUMA 4GRKA 4QRZA 4OYVA 3ECRA 2V84A 4FEDA 3T9UA 1IMCA 1IEJA 2B3BA 4F1UA 1IMFA
chains in the Genus database with same CATH topology
2XXIA 3B6QA 2H98A 5H8NB 1N84A 1H45A 2F35A 3CIJA 5AA2A 4POWA 3PD8A 1A54A 2HZKA 1JVYA 1XC1A 1MXXA 4ZZAA 3ILUB 2XXVA 4I62A 1WVJA 3PUZE 5ITOA 3M8UA 4YKIA 1ZIUA 1ZKBA 2GRVA 3UA8A 5B70A 3TKDA 4LZ8A 3Q29A 3UGWA 1B3GA 2YLNA 4MLVA 4EXLA 2V93A 1XVYA 5L9OA 3IORA 2FNCA 2Y7PA 5CRYA 2D5WA 4H8IA 4MF3A 1EZPA 2DWHA 4F1VA 2GHBA 1MY3A 1R6ZA 5TPAA 2GHAA 3SETA 1AOVA 4IY5A 5H8FB 2DE4A 1B1XA 1QKBA 4EF1A 3ZKLA 5H8HA 3E3KA 2ESNA 3IO4A 4AQ4A 4F3GA 5M2VA 3QYTA 4OEUA 2IA4A 1SYIA 3DP4A 3T9HB 1Q35A 4OVJA 2AL5A 4PP0A 2I48A 2O68A 1KWHA 4FEBA 4O3BA 3CSGA 2ZYMA 2QJEA 2PBWA 2OBGA 4RXLA 5TP9A 3N26A 3OENA 3V83A 5HPQA 1VFDA 3ILTB 5I57A 3Q25A 3FV2A 1XHYA 1Y3PA 4ND9A 4YZZA 1P1UA 1LB8A 5A5XA 1XT8A 4XTCQ 5DEXB 2ZYKA 2W7YA 3MZ9A 4KCDA 4H67A 5CMBA 3O29A 2F36A 1I6QA 5I59A 3QXMA 5DT6A 4GXSB 2XX9A 2G29A 3PPOA 1B4HA 1USYE 3IOTA 4OFOA 2UVHA 4NF6A 1ELJA 3JZJA 1LAGE 4N07A 1VSOA 2DXRA 3MVYA 5L8DA 4YAHX 4X1DA 1B1HA 3C32A 1OLAA 2E1SA 1URGA 3E13X 3GBAA 3PPQA 1ZTYA 3A09A 3RTFB 3N6TA 5BUUA 4XIGQ 3UORA 5CMMA 4BDQA 1MXWA 1DPPA 1DTZA 2UVJA 1Z7NE 2XXXA 3MWBA 3U72A 4WKMA 4RJZA 4FE8A 4KYDA 2DOJA 2ZNUA 3MBPA 3PMWA 3CFXA 3EF7A 2LAOA 1US4A 2I3WA 4U4XA 3OEMA 1B58A 4BDLA 2M8CA 4DCXA 4GL8A 3PV0E 1S50A 4QSCA 2QL3A 2RC7A 3FGSA 5IAIA 1LCFA 3VFJA 3IX1A 1H3DA 1IQ7A 1Y20A 4FAJA 5H8SA 4GWOA 5ICQA 3A3CA 5CBRA 3FUZA 2Z8DA 4ELOA 3HSTA 1EZ9A 1QW0A 3SDFA 3WAEA 4OERA 3EHUA 4MH5A 1FTMA 2NOOA 2PMSA 5I2NB 3G3FA 5L9MA 3UN6A 2PYYA 4GIZA 3Q27A 1O63A 4F3PA 1PBQA 1LAXA 3LSFB 5AA2D 3LSLA 2P0SA 4NWCA 1N3WA 1PEBA 3CVGA 4KD5A 5KCJB 3LR1A 4GL0A 1P1WA 1B5JA 4MFIA 3FXQA 1B9JA 1P1NA 1URSA 2A5TB 1Q1KA 2V25A 5FHOA 4O3AA 4OWDA 4TLMB 2PT2A 3I6VA 4EQBA 4KHZE 1BIYA 3DP6A 5AA2B 4BDOA 2XD3A 1MH3A 3DP8A 4H8JA 1FQFA 1DTGA 1N3XA 3OSRA 1MDQA 5H8FA 1PB7A 3THIA 4QFLA 4YMAA 4PFUA 4R6YA 5F7VA 3FJ7A 1NH8A 2I58A 1AMFA 1A8EA 2FA7A 4WEPA 3PUYE 4EUOA 3TCHA 3IJOB 5I56A 1M5FA 3H6WA 4WXJA 2ZNSA 3FVKA 1NMUA 3FVGA 2P1SA 4LZ5A 1USYH 1I6BA 1JEVA 1B7UA 5FHNA 3FIRA 4DLDA 4HCWA 5AA3A 4NTLA 2OJTA 5DEXA 4G68A 1FTLA 3D4GA 4BDRA 1II5A 3FATA 2HEUA 3CFLA 4ZDMA 3O66A 4N6PA 4JB7A 5ISUA 2YJPA 1T0KA 4BDNA 3SKPA 2QMXA 2H4IA 3K00A 4U2RA 4OQOA 2Q2AA 2OZZA 4R9GA 1PC3A 1A7LA 4NWDA 4AB5A 3E9XA 2QS4A 1D4NA 5TU0A 3RT6B 3TELA 3BBRA 3SEYA 2Y7KA 3EHSA 5A5XB 3TTKA 1MRPA 1WODA 2DYXA 3SEWA 3RN8A 3V8XB 5DVFA 1MDP1 4Z0IA 5KZTA 3PGFA 1P1OA 1B7HA 2Q2CA 2WKYA 3LBSA 4JWOA 4LONB 5H8QB 3G3IA 4NF5B 3IO6A 1OQHA 4WEDA 2F8DA 1B5IA 1HSJA 4ESWA 1A55A 1B32A 4IO3A 2XXYA 4RPOA 2ONSA 4ZEIA 2UYFA 4QFNA 5FHMA 4F2QA 2D21A 4ZEBA 5I2NA 4EXKA 1BLFA 5EHMA 1LCTA 3GZGA 4YB6A 3KG2A 1R9QA 3K0VA 4ONYA 4QF9A 4C1TA 1N76A 3CR9A 3PUWE 3OO8A 3VV5A 3K1MA 3LSXA 4ZEFA 4HCYA 1SW2A 1PBPA 5KCJA 4R75A 1SW5A 4ZECA 4DXBA 4R72A 2A5TA 1XS5A 3R7XA 1IIWA 5ELVA 4GQOA 4IO6A 1TFDA 2BJJX 3HHFA 2I0CA 4G68C 3CI8A 2F97A 3U93A 4DZ1A 1UTBA 4K3FA 4R6KA 3FVOA 2XXRA 3I5OA 2QS3A 4U21A 1BTJA 5AE4A 3CG1A 1QULA 5BWJA 2Y84A 4MBPA 2Z22A 3R6UA 4OFJA 1S7YA 4DE8A 1JVXA 2X26A 3TYHA 2B65A 2VD3A 2X7PA 1PB9A 4GVOA 3QIMA 2THIA 1MM6A 4FJPA 1A40A 3E4RA 5DTBA 4R6HA 1TWYA 2I6EA 2QSXA 2Y7IA 1B46A 3TTMA 4N13A 1B05A 2ZNTA 3PMXA 3V89B 3EQ1A 1XOCA 2F34A 5CMCA 4RK9A 4EF2A 3P7IA 1Y3QA 3LUYA 4QFKA 3BKIB 3FD3A 5L9SA 5I56B 1MPBA 1TT1A 1N7XA 4DXUA 3T22A 4KQPA 4TLLB 3U92A 3CFZA 1MY4A 1R9LA 4EQ7A 5EYFA 1TFAA 3F11A 1OVBA 3VXCA 3ZSFA 4GD5A 4O3CA 3K6XA 4R2BA 4XKRA 2F7CA 3BFUA 1B7ZA 1QJMA 2R9JA 1LAHE 3RLFE 1HSEA 3PU5A 1Y3NA 3O6HA 3DELB 2XD2A 4G68B 3IK6B 4ESXA 2RCAA 2QS2A 1QVSA 2NVUB 1ZJLA 3QAXA 3WAFA 1N7WA 1B3FA 1A99A 2DVCA 3TMGA 3TCFA 2NXOA 3K02A 4OESA 2CZLA 4IO5A 1POY1 4FORA 4EQ9A 3C31A 4UA8A 1US5A 5H8QA 2O51A 4NF5A 1LFIA 2XX8A 4GOTA 1PB8A 4GLIA 4YKJA 3KSXA 2F7BA 3GXAA 4ZZEA 2O1MA 2PT1A 4P0IA 3ONMA 2Z23A 5KDTB 4NF4A 4RK2A 3TFLA 4JSOA 3K6UA 3KOTA 2R71A 4UACA 4Q0CA 5LOMA 2ZYOA 2O1LA 4YB5A 3TQWA 4X48A 1GTKA 1MQGA 3V5AA 1B3LA 3RQTA 1JQFA 2VOZA 2V3UA 3TODA 1SVXB 1Y4CA 2F6PA 1MH4A 4ZEKA 4ELQA 1NNFA 3ODBA 4ELPA 3H06B 1OVTA 1BKAA 3MVZA 3IB2A 3FXUA 5FTHA 3OO6A 1O64A 2H9BA 3EPEA 2OLBA 1MY2A 2YPNA 1LAFE 3DM0A 3PUXE 2DWIA 2OWSA 4LVQA 1IXCA 4H5FA 4QFPA 2HQ0A 2UXAA 2RC9A 1O7TA 2HAUA 3UIFA 2O84X 1MM7A 3PMVA 3TTLA 3Q26A 4ZEDA 3W9VA 3UP9A 1GR2A 2DVZA 4R73A 1FW0A 4X9TA 4KR5A 1SI0A 4NF8B 2Q89A 4ISUA 5HBCA 1BP5A 2XHDA 3FZVA 2CMOA 2UYEA 1M5CA 5JTYB 4Q8RA 1JETA 1M5EA 3UK4A 3KJ7A 4I1DA 2G93A 3VVFA 5B7DA 1UTBB 1NKXA 4GF8A 3TCGA 2QPQA 1H43A 4OTEA 3RGYA 4L17A 4H0WA 4OZ9A 2VD2A 3IOUA 1YTVA 4F2OA 2RF1A 2ABHA 1I69A 3MUQA 3T96B 1Y1MA 4BLAA 2O6AA 2ZXTA 3K4UA 3TPAA 4P11A 4U1ZA 3QUFA 5CBSA 1QUIA 1URDA 1OIBA 1J1NA 1LLSA 3MP1A 5HM4B 3G7WA 1OMPA 3MAMA 3H03A 4E0XA 4TQUQ 3LSWA 3OELA 1L5TA 3RTWB 2Q88A 2V3TA 1EH3A 2F5XA 4HS7A 3W15C 4IO7A 4DIGA 2AYSA 1FQBA 1NH7A 4OEVA 1DMBA 3IOVA 2RC8A 1Y9UA 1B2HA 4H5GA 3IAZA 1MQJA 3C4MA 1P1QA 4ELRA 3FASA 3KBRA 2REJA 3M3KA 3U94A 3MVXA 3SERA 1IUDA 1YAEA 3FJMA 3K1NA 1TXFA 1N04A 1POTA 4QSEA 1HSLA 1UQWA 4LATA 1MQDA 2Y7WA 3VLVA 3AXFA 2PX1A 3O28A 3D4CA 5KDTA 1M5BA 4KYEA 3SEVA 4PETA 4IY6A 3MJNA 4H1XA 3KN8A 4IO2A 2XXTA 1LBCA 2F6GA 4JWXA 3HV1A 3S4UA 3IJXB 4F3SA 4HW8A 1H44A 3C9HA 4KFQA 2XXUA 3K6WA 3RPWA 3H6UA 2I49A 2RKMA 3QK6A 1SYHA 3PPNA 2UVGA 4LQ5A 4ZE8A 3MQ9A 4THIA 3C33A 4ZS9A 2O7IA 1RKMA 5EHSA 3BFTA 1FQDA 3KSJA 3ZKKA 5ITPA 4JWYA 3G3KA 1MY1A 4NF4B 3M3FA 2FYIA 4XKPA 4NE4A 1PDAA 2H5YA 2VGQA 5IKBA 1FCKA 1MS7A 1FQCA 4RY1A 3K01A 5DYHA 1B5HA 4U22A 3CRBA 4DXCA 5DVIA 2DS9A 1MXVA 1IITA 3MW0A 3B7DA 5CMKA 4EDPA 1SW1A 3B6TA 4RA1A 3FV1A 4PQJA 1OLCA 1MG1A 3MPLA 1LFGA 1ZMGA 4I8CA 3VLUA 5I84A 1IXGA 3L6GA 3GBBA 3N94A 3HHGA 3GLBA 4NF8A 1SBPA 3VDFA 3PPPA 1D9VA 3MPKA 1WDNA 1XVXA 1LSTA 5JTYA 3OSQA 3PD9A 1UIUA 1CB6A 3RNNA 3OXNA 4OMBA 2OCUA 1B51A 1IXHA 1QKAA 1EU8A 4YB7A 1SQYA 2OWTA 3SEXA 4BDMA 2H99A 3OEKA 2RINA 2XXQA 2I3VA 3H4ZA 3K6VA 4G2ZA 3MP8A 4G77A 3MP6A 2H25A 4C0RA 5AA4B 2Q9TA 2DWAA 1A8FA 1FQAA 3QUJA 4TOZA 1SI1A 3K2DA 2HCAA 3T9VA 1QUJA 1QUKA 3VVEA 1UIVA 1UTHB 3MZBA 4X1BA 3HCQA 2DP8A 3KGCA 4I9DA 3N6UA 3Q28A 3N5LA 4OETA 3TEPA 4JXIA 3IOWA 4XKQA 2DE2A 3H6TA 2ALUA 3U1OA 1MQIA 3KN7A 1F9BA 4QSDA 3HN0A 1GGGA 1N0TA 3TTNA 2Q8JA 3MZ1A 4RYAA 4OENA 5I2KA 1LB9A 3H6VA 3OMBA 4HTGA 2ONRA 2V3QA 2XX7A 4F29A 2P2AA 1B40A 1MQHA 2O7UA 4MLQA 4U1OA 1MY0A 4G4PA 3S9EA 1ZBMA 1B6HA 1D9YA 2GH9A 4NEDA 1H76A 2I0BA 3W9WA 1YCJA 4AB6A 1JEUA 4F22A 5CM6A 4YKKA 4POXA 2ONKE 3DLNA 3FJGA 1NL5A 4F39A 1AL3A 4OFLA 5JEIA 3VE1B 1B52A 1NNTA 1NNKA 2A5SA 5F1QA 2GFEA 1DSNA 4FATA 4DCYA 2E0SA 4FIMA 4ECFA 5I58B 4F19A 3L6HA 3O2AA 3HPIA 1MXYA 1EZOA 1S9TA 4NMYA 5DVJA 3VLWA 1FTKA 2XXWA 2RCBA 4G8NA 4F1YA 3CG3A 4YKPA 3KEIA 2VP1A 3S9MC 3KJTA 4LA9A 3A3UA 4OXVA 4G8MA 3TUSA 3T9XB 1NNPA 2QMWA 3G3HA 4KCCA 1YPNA 4LP2B 2HFBA 1GVCA 3H7MA 2KLFA 1MPCA 2DQVA 4IGRA 1MXUA 4R9FA 1LBBA 4IO4A 4PFTA 1B0LA 2HXWA 3O6IA 1B0HA 2ZYNA 3ZS6A 4OHNA 5H8NA 5K2XA 1Z7ME 1M5DA 4M4GA 1JW5A 4G8HA 3IR1A 4LUBA 3TDJA 4R2FA 2HZLA 1FTJA 2VHAA 4KI0E 4XKNA 4U4SA 4R74A 2Y7RA 1ZU0A 5AA4A 4KYSA 1P99A 3KFMA 3USDA 3FVNA 3IB1A 2AL4A 1VE4A 3TAJA 2IEEA 1SW4A 2QS1A 4YU0A 2AIXA 3MVWA 4F3BA 3SESA 1MXZA 4GXAA 1UTHA 1JW4A 4H6DA 1SD3A 3HO7A 1FQEA 1I6AA 5J1DA 3G3JA 4PFWA 4RPNA 2XXPA 4FECA 1JNFA 2OK2A 3CSBA 2R6GE 4JSDA 1ATGA 3C34A 3H3GA 3R26A 1R1NA 4Q5TA 1DOTA 1MPDA 2X7QA 4YICA 1CE2A 1LGBC 1Y1ZA 2DSFA 3I3VA 4DDDA 1VFEA 3PPRA 4IGTA 3MC2A 4E0WA 2DWJA 1D3KA 1OQGA 3KZGA 4U23A 3S9NC 2I4CA 3O9PA 2NUVA 5TPAB 1IXIA 3G3GA 3VVDA 4F18A 4JBZA 1RYXA 1DPEA 3OD7A 5H8HB 1FTOA 3OOAA 2D3IA 4Q30B 4ZE9A 1B3HA 5I2KB 1B3EA 5FTIA 4F31B 2ZMBA 4KPTA 1ANFA 1AIVA 3RT8A 5I58A 5K2YA 3C36A 5AA1A 5TP9B 2UVIA 3O97A 2ANJA 3OO9A 2F78A 2HAVA 1IZ1A 4YMBA 5I57B 2O69A 1B4ZA 4P0GA 4LQ2A 3IB0A 2PVUA 1NFTA 4PE5B 4QFOA 5CI5A 2XXHA 1ZLQA 2DE3A 1VR5A 3TQLA 5CC2A 3B6WA 2DXYA 1Y4TA 4XXUA 4M1VA 2F7AA 1LFHA 1SDXA 5I59B 3QSLA 3O6GA 4Z7EA 3KN3A 4NF6B 4IB2A 1RYOA 4RNSA 3PUVE 4C1UA 4H65A 3SEUA 3S9LC 4PFYA 5ICTA 3IL1B 3K1PA 4JDFA 4GFRA 4QHQA 5JK4A 3C35A 3TZAA 2Z8FA 3VXBA 3M3LA 3KOSA 3RY3A 3EN3A 1GV8A 3JV9A 1AH5A 2B3FA 2NWJA 2REGA 3FXRA 4LZ7A 2Z8EA 3T93B 2I4BA 3TTRA 3OO7A 2QRYA 3S2VA 3JYRA 3EHTA 3T66A 1JW1A 3LC8A 3U8QA 3RUMA 4GRKA 4QRZA 4OYVA 3ECRA 2V84A 4FEDA 3T9UA 1IEJA 2B3BA 4F1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXI A;  3B6Q A;  2H98 A;  5H8N B;  1N84 A;  1H45 A;  2F35 A;  3CIJ A;  5AA2 A;  4POW A;  3PD8 A;  1A54 A;  2HZK A;  1JVY A;  1XC1 A;  1MXX A;  4ZZA A;  3ILU B;  2XXV A;  4I62 A;  1WVJ A;  3PUZ E;  5ITO A;  3M8U A;  4YKI A;  1ZIU A;  1ZKB A;  2GRV A;  3UA8 A;  5B70 A;  3TKD A;  4LZ8 A;  3Q29 A;  3UGW A;  1B3G A;  2YLN A;  4MLV A;  4EXL A;  2V93 A;  1XVY A;  5L9O A;  3IOR A;  2FNC A;  2Y7P A;  5CRY A;  2D5W A;  4H8I A;  4MF3 A;  1EZP A;  2DWH A;  4F1V A;  2GHB A;  1MY3 A;  1R6Z A;  5TPA A;  2GHA A;  3SET A;  1AOV A;  4IY5 A;  5H8F B;  2DE4 A;  1B1X A;  1QKB A;  4EF1 A;  3ZKL A;  5H8H A;  3E3K A;  2ESN A;  3IO4 A;  4AQ4 A;  4F3G A;  5M2V A;  3QYT A;  4OEU A;  2IA4 A;  1SYI A;  3DP4 A;  3T9H B;  1Q35 A;  4OVJ A;  2AL5 A;  4PP0 A;  2I48 A;  2O68 A;  1KWH A;  4FEB A;  4O3B A;  3CSG A;  2ZYM A;  2QJE A;  2PBW A;  2OBG A;  4RXL A;  5TP9 A;  3N26 A;  3OEN A;  3V83 A;  5HPQ A;  1VFD A;  3ILT B;  5I57 A;  3Q25 A;  3FV2 A;  1XHY A;  1Y3P A;  4ND9 A;  4YZZ A;  1P1U A;  1LB8 A;  5A5X A;  1XT8 A;  4XTC Q;  5DEX B;  2ZYK A;  2W7Y A;  3MZ9 A;  4KCD A;  4H67 A;  5CMB A;  3O29 A;  2F36 A;  1I6Q A;  5I59 A;  3QXM A;  5DT6 A;  4GXS B;  2XX9 A;  2G29 A;  3PPO A;  1B4H A;  1USY E;  3IOT A;  4OFO A;  2UVH A;  4NF6 A;  1ELJ A;  3JZJ A;  1LAG E;  4N07 A;  1VSO A;  2DXR A;  3MVY A;  5L8D A;  4YAH X;  4X1D A;  1B1H A;  3C32 A;  1OLA A;  2E1S A;  1URG A;  3E13 X;  3GBA A;  3PPQ A;  1ZTY A;  3A09 A;  3RTF B;  3N6T A;  5BUU A;  4XIG Q;  3UOR A;  5CMM A;  4BDQ A;  1MXW A;  1DPP A;  1DTZ A;  2UVJ A;  1Z7N E;  2XXX A;  3MWB A;  3U72 A;  4WKM A;  4RJZ A;  4FE8 A;  4KYD A;  2DOJ A;  2ZNU A;  3MBP A;  3PMW A;  3CFX A;  3EF7 A;  2LAO A;  1US4 A;  2I3W A;  4U4X A;  3OEM A;  1B58 A;  4BDL A;  2M8C A;  4DCX A;  4GL8 A;  3PV0 E;  1S50 A;  4QSC A;  2QL3 A;  2RC7 A;  3FGS A;  5IAI A;  1LCF A;  3VFJ A;  3IX1 A;  1H3D A;  1IQ7 A;  1Y20 A;  4FAJ A;  5H8S A;  4GWO A;  5ICQ A;  3A3C A;  5CBR A;  3FUZ A;  2Z8D A;  4ELO A;  3HST A;  1EZ9 A;  1QW0 A;  3SDF A;  3WAE A;  4OER A;  3EHU A;  4MH5 A;  1FTM A;  2NOO A;  2PMS A;  5I2N B;  3G3F A;  5L9M A;  3UN6 A;  2PYY A;  4GIZ A;  3Q27 A;  1O63 A;  4F3P A;  1PBQ A;  1LAX A;  3LSF B;  5AA2 D;  3LSL A;  2P0S A;  4NWC A;  1N3W A;  1PEB A;  3CVG A;  4KD5 A;  5KCJ B;  3LR1 A;  4GL0 A;  1P1W A;  1B5J A;  4MFI A;  3FXQ A;  1B9J A;  1P1N A;  1URS A;  2A5T B;  1Q1K A;  2V25 A;  5FHO A;  4O3A A;  4OWD A;  4TLM B;  2PT2 A;  3I6V A;  4EQB A;  4KHZ E;  1BIY A;  3DP6 A;  5AA2 B;  4BDO A;  2XD3 A;  1MH3 A;  3DP8 A;  4H8J A;  1FQF A;  1DTG A;  1N3X A;  3OSR A;  1MDQ A;  5H8F A;  1PB7 A;  3THI A;  4QFL A;  4YMA A;  4PFU A;  4R6Y A;  5F7V A;  3FJ7 A;  1NH8 A;  2I58 A;  1AMF A;  1A8E A;  2FA7 A;  4WEP A;  3PUY E;  4EUO A;  3TCH A;  3IJO B;  5I56 A;  1M5F A;  3H6W A;  4WXJ A;  2ZNS A;  3FVK A;  1NMU A;  3FVG A;  2P1S A;  4LZ5 A;  1USY H;  1I6B A;  1JEV A;  1B7U A;  5FHN A;  3FIR A;  4DLD A;  4HCW A;  5AA3 A;  4NTL A;  2OJT A;  5DEX A;  4G68 A;  1FTL A;  3D4G A;  4BDR A;  1II5 A;  3FAT A;  2HEU A;  3CFL A;  4ZDM A;  3O66 A;  4N6P A;  4JB7 A;  5ISU A;  2YJP A;  1T0K A;  4BDN A;  3SKP A;  2QMX A;  2H4I A;  3K00 A;  4U2R A;  4OQO A;  2Q2A A;  2OZZ A;  4R9G A;  1PC3 A;  1A7L A;  4NWD A;  4AB5 A;  3E9X A;  2QS4 A;  1D4N A;  5TU0 A;  3RT6 B;  3TEL A;  3BBR A;  3SEY A;  2Y7K A;  3EHS A;  5A5X B;  3TTK A;  1MRP A;  1WOD A;  2DYX A;  3SEW A;  3RN8 A;  3V8X B;  5DVF A;  1MDP 1;  4Z0I A;  5KZT A;  3PGF A;  1P1O A;  1B7H A;  2Q2C A;  2WKY A;  3LBS A;  4JWO A;  4LON B;  5H8Q B;  3G3I A;  4NF5 B;  3IO6 A;  1OQH A;  4WED A;  2F8D A;  1B5I A;  1HSJ A;  4ESW A;  1A55 A;  1B32 A;  4IO3 A;  2XXY A;  4RPO A;  2ONS A;  4ZEI A;  2UYF A;  4QFN A;  5FHM A;  4F2Q A;  2D21 A;  4ZEB A;  5I2N A;  4EXK A;  1BLF A;  5EHM A;  1LCT A;  3GZG A;  4YB6 A;  3KG2 A;  1R9Q A;  3K0V A;  4ONY A;  4QF9 A;  4C1T A;  1N76 A;  3CR9 A;  3PUW E;  3OO8 A;  3VV5 A;  3K1M A;  3LSX A;  4ZEF A;  4HCY A;  1SW2 A;  1PBP A;  5KCJ A;  4R75 A;  1SW5 A;  4ZEC A;  4DXB A;  4R72 A;  2A5T A;  1XS5 A;  3R7X A;  1IIW A;  5ELV A;  4GQO A;  4IO6 A;  1TFD A;  2BJJ X;  3HHF A;  2I0C A;  4G68 C;  3CI8 A;  2F97 A;  3U93 A;  4DZ1 A;  1UTB A;  4K3F A;  4R6K A;  3FVO A;  2XXR A;  3I5O A;  2QS3 A;  4U21 A;  1BTJ A;  5AE4 A;  3CG1 A;  1QUL A;  5BWJ A;  2Y84 A;  4MBP A;  2Z22 A;  3R6U A;  4OFJ A;  1S7Y A;  4DE8 A;  1JVX A;  2X26 A;  3TYH A;  2B65 A;  2VD3 A;  2X7P A;  1PB9 A;  4GVO A;  3QIM A;  2THI A;  1MM6 A;  4FJP A;  1A40 A;  3E4R A;  5DTB A;  4R6H A;  1TWY A;  2I6E A;  2QSX A;  2Y7I A;  1B46 A;  3TTM A;  4N13 A;  1B05 A;  2ZNT A;  3PMX A;  3V89 B;  3EQ1 A;  1XOC A;  2F34 A;  5CMC A;  4RK9 A;  4EF2 A;  3P7I A;  1Y3Q A;  3LUY A;  4QFK A;  3BKI B;  3FD3 A;  5L9S A;  5I56 B;  1MPB A;  1TT1 A;  1N7X A;  4DXU A;  3T22 A;  4KQP A;  4TLL B;  3U92 A;  3CFZ A;  1MY4 A;  1R9L A;  4EQ7 A;  5EYF A;  1TFA A;  3F11 A;  1OVB A;  3VXC A;  3ZSF A;  4GD5 A;  4O3C A;  3K6X A;  4R2B A;  4XKR A;  2F7C A;  3BFU A;  1B7Z A;  1QJM A;  2R9J A;  1LAH E;  3RLF E;  1HSE A;  3PU5 A;  1Y3N A;  3O6H A;  3DEL B;  2XD2 A;  4G68 B;  3IK6 B;  4ESX A;  2RCA A;  2QS2 A;  1QVS A;  2NVU B;  1ZJL A;  3QAX A;  3WAF A;  1N7W A;  1B3F A;  1A99 A;  2DVC A;  3TMG A;  3TCF A;  2NXO A;  3K02 A;  4OES A;  2CZL A;  4IO5 A;  1POY 1;  4FOR A;  4EQ9 A;  3C31 A;  4UA8 A;  1US5 A;  5H8Q A;  2O51 A;  4NF5 A;  1LFI A;  2XX8 A;  4GOT A;  1PB8 A;  4GLI A;  4YKJ A;  3KSX A;  2F7B A;  3GXA A;  4ZZE A;  2O1M A;  2PT1 A;  4P0I A;  3ONM A;  2Z23 A;  5KDT B;  4NF4 A;  4RK2 A;  3TFL A;  4JSO A;  3K6U A;  3KOT A;  2R71 A;  4UAC A;  4Q0C A;  5LOM A;  2ZYO A;  2O1L A;  4YB5 A;  3TQW A;  4X48 A;  1GTK A;  1MQG A;  3V5A A;  1B3L A;  3RQT A;  1JQF A;  2VOZ A;  2V3U A;  3TOD A;  1SVX B;  1Y4C A;  2F6P A;  1MH4 A;  4ZEK A;  4ELQ A;  1NNF A;  3ODB A;  4ELP A;  3H06 B;  1OVT A;  1BKA A;  3MVZ A;  3IB2 A;  3FXU A;  5FTH A;  3OO6 A;  1O64 A;  2H9B A;  3EPE A;  2OLB A;  1MY2 A;  2YPN A;  1LAF E;  3DM0 A;  3PUX E;  2DWI A;  2OWS A;  4LVQ A;  1IXC A;  4H5F A;  4QFP A;  2HQ0 A;  2UXA A;  2RC9 A;  1O7T A;  2HAU A;  3UIF A;  2O84 X;  1MM7 A;  3PMV A;  3TTL A;  3Q26 A;  4ZED A;  3W9V A;  3UP9 A;  1GR2 A;  2DVZ A;  4R73 A;  1FW0 A;  4X9T A;  4KR5 A;  1SI0 A;  4NF8 B;  2Q89 A;  4ISU A;  5HBC A;  1BP5 A;  2XHD A;  3FZV A;  2CMO A;  2UYE A;  1M5C A;  5JTY B;  4Q8R A;  1JET A;  1M5E A;  3UK4 A;  3KJ7 A;  4I1D A;  2G93 A;  3VVF A;  5B7D A;  1UTB B;  1NKX A;  4GF8 A;  3TCG A;  2QPQ A;  1H43 A;  4OTE A;  3RGY A;  4L17 A;  4H0W A;  4OZ9 A;  2VD2 A;  3IOU A;  1YTV A;  4F2O A;  2RF1 A;  2ABH A;  1I69 A;  3MUQ A;  3T96 B;  1Y1M A;  4BLA A;  2O6A A;  2ZXT A;  3K4U A;  3TPA A;  4P11 A;  4U1Z A;  3QUF A;  5CBS A;  1QUI A;  1URD A;  1OIB A;  1J1N A;  1LLS A;  3MP1 A;  5HM4 B;  3G7W A;  1OMP A;  3MAM A;  3H03 A;  4E0X A;  4TQU Q;  3LSW A;  3OEL A;  1L5T A;  3RTW B;  2Q88 A;  2V3T A;  1EH3 A;  2F5X A;  4HS7 A;  3W15 C;  4IO7 A;  4DIG A;  2AYS A;  1FQB A;  1NH7 A;  4OEV A;  1DMB A;  3IOV A;  2RC8 A;  1Y9U A;  1B2H A;  4H5G A;  3IAZ A;  1MQJ A;  3C4M A;  1P1Q A;  4ELR A;  3FAS A;  3KBR A;  2REJ A;  3M3K A;  3U94 A;  3MVX A;  3SER A;  1IUD A;  1YAE A;  3FJM A;  3K1N A;  1TXF A;  1N04 A;  1POT A;  4QSE A;  1HSL A;  1UQW A;  4LAT A;  1MQD A;  2Y7W A;  3VLV A;  3AXF A;  2PX1 A;  3O28 A;  3D4C A;  5KDT A;  1M5B A;  4KYE A;  3SEV A;  4PET A;  4IY6 A;  3MJN A;  4H1X A;  3KN8 A;  4IO2 A;  2XXT A;  1LBC A;  2F6G A;  4JWX A;  3HV1 A;  3S4U A;  3IJX B;  4F3S A;  4HW8 A;  1H44 A;  3C9H A;  4KFQ A;  2XXU A;  3K6W A;  3RPW A;  3H6U A;  2I49 A;  2RKM A;  3QK6 A;  1SYH A;  3PPN A;  2UVG A;  4LQ5 A;  4ZE8 A;  3MQ9 A;  4THI A;  3C33 A;  4ZS9 A;  2O7I A;  1RKM A;  5EHS A;  3BFT A;  1FQD A;  3KSJ A;  3ZKK A;  5ITP A;  4JWY A;  3G3K A;  1MY1 A;  4NF4 B;  3M3F A;  2FYI A;  4XKP A;  4NE4 A;  1PDA A;  2H5Y A;  2VGQ A;  5IKB A;  1FCK A;  1MS7 A;  1FQC A;  4RY1 A;  3K01 A;  5DYH A;  1B5H A;  4U22 A;  3CRB A;  4DXC A;  5DVI A;  2DS9 A;  1MXV A;  1IIT A;  3MW0 A;  3B7D A;  5CMK A;  4EDP A;  1SW1 A;  3B6T A;  4RA1 A;  3FV1 A;  4PQJ A;  1OLC A;  1MG1 A;  3MPL A;  1LFG A;  1ZMG A;  4I8C A;  3VLU A;  5I84 A;  1IXG A;  3L6G A;  3GBB A;  3N94 A;  3HHG A;  3GLB A;  4NF8 A;  1SBP A;  3VDF A;  3PPP A;  1D9V A;  3MPK A;  1WDN A;  1XVX A;  1LST A;  5JTY A;  3OSQ A;  3PD9 A;  1UIU A;  1CB6 A;  3RNN A;  3OXN A;  4OMB A;  2OCU A;  1B51 A;  1IXH A;  1QKA A;  1EU8 A;  4YB7 A;  1SQY A;  2OWT A;  3SEX A;  4BDM A;  2H99 A;  3OEK A;  2RIN A;  2XXQ A;  2I3V A;  3H4Z A;  3K6V A;  4G2Z A;  3MP8 A;  4G77 A;  3MP6 A;  2H25 A;  4C0R A;  5AA4 B;  2Q9T A;  2DWA A;  1A8F A;  1FQA A;  3QUJ A;  4TOZ A;  1SI1 A;  3K2D A;  2HCA A;  3T9V A;  1QUJ A;  1QUK A;  3VVE A;  1UIV A;  1UTH B;  3MZB A;  4X1B A;  3HCQ A;  2DP8 A;  3KGC A;  4I9D A;  3N6U A;  3Q28 A;  3N5L A;  4OET A;  3TEP A;  4JXI A;  3IOW A;  4XKQ A;  2DE2 A;  3H6T A;  2ALU A;  3U1O A;  1MQI A;  3KN7 A;  1F9B A;  4QSD A;  3HN0 A;  1GGG A;  1N0T A;  3TTN A;  2Q8J A;  3MZ1 A;  4RYA A;  4OEN A;  5I2K A;  1LB9 A;  3H6V A;  3OMB A;  4HTG A;  2ONR A;  2V3Q A;  2XX7 A;  4F29 A;  2P2A A;  1B40 A;  1MQH A;  2O7U A;  4MLQ A;  4U1O A;  1MY0 A;  4G4P A;  3S9E A;  1ZBM A;  1B6H A;  1D9Y A;  2GH9 A;  4NED A;  1H76 A;  2I0B A;  3W9W A;  1YCJ A;  4AB6 A;  1JEU A;  4F22 A;  5CM6 A;  4YKK A;  4POX A;  2ONK E;  3DLN A;  3FJG A;  1NL5 A;  4F39 A;  1AL3 A;  4OFL A;  5JEI A;  3VE1 B;  1B52 A;  1NNT A;  1NNK A;  2A5S A;  5F1Q A;  2GFE A;  1DSN A;  4FAT A;  4DCY A;  2E0S A;  4FIM A;  4ECF A;  5I58 B;  4F19 A;  3L6H A;  3O2A A;  3HPI A;  1MXY A;  1EZO A;  1S9T A;  4NMY A;  5DVJ A;  3VLW A;  1FTK A;  2XXW A;  2RCB A;  4G8N A;  4F1Y A;  3CG3 A;  4YKP A;  3KEI A;  2VP1 A;  3S9M C;  3KJT A;  4LA9 A;  3A3U A;  4OXV A;  4G8M A;  3TUS A;  3T9X B;  1NNP A;  2QMW A;  3G3H A;  4KCC A;  1YPN A;  4LP2 B;  2HFB A;  1GVC A;  3H7M A;  2KLF A;  1MPC A;  2DQV A;  4IGR A;  1MXU A;  4R9F A;  1LBB A;  4IO4 A;  4PFT A;  1B0L A;  2HXW A;  3O6I A;  1B0H A;  2ZYN A;  3ZS6 A;  4OHN A;  5H8N A;  5K2X A;  1Z7M E;  1M5D A;  4M4G A;  1JW5 A;  4G8H A;  3IR1 A;  4LUB A;  3TDJ A;  4R2F A;  2HZL A;  1FTJ A;  2VHA A;  4KI0 E;  4XKN A;  4U4S A;  4R74 A;  2Y7R A;  1ZU0 A;  5AA4 A;  4KYS A;  1P99 A;  3KFM A;  3USD A;  3FVN A;  3IB1 A;  2AL4 A;  1VE4 A;  3TAJ A;  2IEE A;  1SW4 A;  2QS1 A;  4YU0 A;  2AIX A;  3MVW A;  4F3B A;  3SES A;  1MXZ A;  4GXA A;  1UTH A;  1JW4 A;  4H6D A;  1SD3 A;  3HO7 A;  1FQE A;  1I6A A;  5J1D A;  3G3J A;  4PFW A;  4RPN A;  2XXP A;  4FEC A;  1JNF A;  2OK2 A;  3CSB A;  2R6G E;  4JSD A;  1ATG A;  3C34 A;  3H3G A;  3R26 A;  1R1N A;  4Q5T A;  1DOT A;  1MPD A;  2X7Q A;  4YIC A;  1CE2 A;  1LGB C;  1Y1Z A;  2DSF A;  3I3V A;  4DDD A;  1VFE A;  3PPR A;  4IGT A;  3MC2 A;  4E0W A;  2DWJ A;  1D3K A;  1OQG A;  3KZG A;  4U23 A;  3S9N C;  2I4C A;  3O9P A;  2NUV A;  5TPA B;  1IXI A;  3G3G A;  3VVD A;  4F18 A;  4JBZ A;  1RYX A;  1DPE A;  3OD7 A;  5H8H B;  1FTO A;  3OOA A;  2D3I A;  4Q30 B;  4ZE9 A;  1B3H A;  5I2K B;  1B3E A;  5FTI A;  4F31 B;  2ZMB A;  4KPT A;  1ANF A;  1AIV A;  3RT8 A;  5I58 A;  5K2Y A;  3C36 A;  5AA1 A;  5TP9 B;  2UVI A;  3O97 A;  2ANJ A;  3OO9 A;  2F78 A;  2HAV A;  1IZ1 A;  4YMB A;  5I57 B;  2O69 A;  1B4Z A;  4P0G A;  4LQ2 A;  3IB0 A;  2PVU A;  1NFT A;  4PE5 B;  4QFO A;  5CI5 A;  2XXH A;  1ZLQ A;  2DE3 A;  1VR5 A;  3TQL A;  5CC2 A;  3B6W A;  2DXY A;  1Y4T A;  4XXU A;  4M1V A;  2F7A A;  1LFH A;  1SDX A;  5I59 B;  3QSL A;  3O6G A;  4Z7E A;  3KN3 A;  4NF6 B;  4IB2 A;  1RYO A;  4RNS A;  3PUV E;  4C1U A;  4H65 A;  3SEU A;  3S9L C;  4PFY A;  5ICT A;  3IL1 B;  3K1P A;  4JDF A;  4GFR A;  4QHQ A;  5JK4 A;  3C35 A;  3TZA A;  2Z8F A;  3VXB A;  3M3L A;  3KOS A;  3RY3 A;  3EN3 A;  1GV8 A;  3JV9 A;  1AH5 A;  2B3F A;  2NWJ A;  2REG A;  3FXR A;  4LZ7 A;  2Z8E A;  3T93 B;  2I4B A;  3TTR A;  3OO7 A;  2QRY A;  3S2V A;  3JYR A;  3EHT A;  3T66 A;  1JW1 A;  3LC8 A;  3U8Q A;  3RUM A;  4GRK A;  4QRZ A;  4OYV A;  3ECR A;  2V84 A;  4FED A;  3T9U A;  1IEJ A;  2B3B A;  4F1U A; 
#chains in the Genus database with same CATH topology
 2XXI A;  3B6Q A;  2H98 A;  5H8N B;  1N84 A;  1H45 A;  2F35 A;  3CIJ A;  5AA2 A;  4POW A;  1FJ6 A;  3PD8 A;  1A54 A;  2HZK A;  5IZZ A;  1JVY A;  1XC1 A;  1DBZ A;  1MXX A;  4ZZA A;  3ILU B;  3T1B A;  2XXV A;  4I62 A;  1WVJ A;  3PUZ E;  5ITO A;  1KZ8 A;  3M8U A;  4YKI A;  1ZIU A;  3GYY A;  1ZKB A;  2GRV A;  3UA8 A;  4PBQ A;  5B70 A;  3TKD A;  4LZ8 A;  3Q29 A;  3UGW A;  1B3G A;  2YLN A;  4MLV A;  4EXL A;  2V93 A;  1XVY A;  5L9O A;  1G0I A;  3IOR A;  2FNC A;  2Y7P A;  5EQ8 A;  2P3V A;  4PCD A;  5CRY A;  2D5W A;  4H8I A;  4MF3 A;  1EZP A;  2DWH A;  4F1V A;  2GHB A;  1MY3 A;  1R6Z A;  1FBP A;  2GHA A;  5TPA A;  3SET A;  1AOV A;  4IY5 A;  5H8F B;  2DE4 A;  1B1X A;  1QKB A;  1QGX A;  4EF1 A;  3ZKL A;  5H8H A;  3E3K A;  2ESN A;  3IO4 A;  4AQ4 A;  4F3G A;  3NOH A;  5M2V A;  3QYT A;  4OEU A;  2IA4 A;  1SYI A;  3DP4 A;  3T9H B;  1Q35 A;  4OVJ A;  2AL5 A;  4PP0 A;  2I48 A;  2O68 A;  4FBP A;  1KWH A;  1INP A;  4FEB A;  4O3B A;  3CSG A;  2ZYM A;  2QJE A;  2PBW A;  2OBG A;  4RXL A;  5TP9 A;  5IM2 A;  3N26 A;  2DDK A;  3OEN A;  3V83 A;  5HPQ A;  2Q74 A;  1VFD A;  3ILT B;  5I57 A;  3Q25 A;  3FV2 A;  1XHY A;  1Y3P A;  4ND9 A;  4YZZ A;  1P1U A;  1LB8 A;  5A5X A;  1XI6 A;  1XT8 A;  4XTC Q;  5DEX B;  4MNI A;  2ZYK A;  2W7Y A;  3MZ9 A;  4KCD A;  4H67 A;  5CMB A;  3O29 A;  2F36 A;  1I6Q A;  5I59 A;  3QXM A;  4NGU A;  4MIJ A;  5DT6 A;  4GXS B;  2XX9 A;  2WBB A;  2G29 A;  3PPO A;  1B4H A;  1USY E;  3IOT A;  4OFO A;  2UVH A;  4NF6 A;  1ELJ A;  3JZJ A;  1LAG E;  4N07 A;  2PFZ A;  1VSO A;  2FHY A;  2HXR A;  2DXR A;  3MVY A;  5L8D A;  2PCR A;  4YAH X;  4X1D A;  1B1H A;  3C32 A;  1OLA A;  2XA5 A;  4PGN A;  2E1S A;  1URG A;  3E13 X;  3GBA A;  5ESY A;  3PPQ A;  1NUW A;  1ZTY A;  3A09 A;  3RTF B;  3N6T A;  5BUU A;  4XIG Q;  1JP4 A;  3UOR A;  3U65 A;  5CMM A;  4DI4 B;  5LDZ A;  4P1L A;  4BDQ A;  1MXW A;  1DPP A;  4N6D A;  1DTZ A;  2BJI A;  2UVJ A;  1Z7N E;  4NF0 A;  2XXX A;  2HHM A;  3MWB A;  3U72 A;  4WKM A;  4RJZ A;  4FE8 A;  4MAG A;  4KYD A;  1NV0 A;  2DOJ A;  2ZNU A;  3MBP A;  3PMW A;  4N8G A;  3CFX A;  3EF7 A;  2LAO A;  1US4 A;  2I3W A;  4U4X A;  3OEM A;  1B58 A;  4BDL A;  2M8C A;  4DCX A;  4GL8 A;  1FJ9 A;  5ET5 A;  3PV0 E;  1S50 A;  4QSC A;  2QL3 A;  2RC7 A;  3FGS A;  5I3S A;  5IAI A;  1LCF A;  3VFJ A;  3IX1 A;  1H3D A;  1IQ7 A;  5A5L A;  1Y20 A;  3BIG A;  4FAJ A;  5H8S A;  4GWO A;  5ICQ A;  3A3C A;  5CBR A;  3FUZ A;  2Z8D A;  4ELO A;  3HST A;  4I40 A;  1EZ9 A;  1D9Q A;  1QW0 A;  4JVI A;  3SDF A;  3WAE A;  4OER A;  3EHU A;  4MH5 A;  1FTM A;  3ISP A;  2NOO A;  2PMS A;  5I2N B;  3G3F A;  5L9M A;  3UN6 A;  1NV6 A;  2PYY A;  4PDD A;  4GIZ A;  4PFI A;  3Q27 A;  1O63 A;  4F3P A;  1NV1 A;  1PBQ A;  1LAX A;  3LSF B;  5AA2 D;  3LSL A;  2P0S A;  4NWC A;  1N3W A;  2FBP A;  1PEB A;  3CVG A;  4KD5 A;  5KCJ B;  3LR1 A;  4GL0 A;  4GBW A;  1P1W A;  1B5J A;  4MFI A;  3FXQ A;  1B9J A;  1P1N A;  1URS A;  2A5T B;  1Q1K A;  2V25 A;  5FHO A;  4O3A A;  4OWD A;  4TLM B;  2PT2 A;  3FBP A;  3I6V A;  5IZ1 A;  4EQB A;  4KHZ E;  1BIY A;  3DP6 A;  4MNC A;  5AA2 B;  4BDO A;  2FVZ A;  2XD3 A;  4LN5 A;  1MH3 A;  3DP8 A;  1LBV A;  4H8J A;  1FQF A;  1DTG A;  1N3X A;  3OSR A;  1MDQ A;  5H8F A;  1PB7 A;  3THI A;  4QFL A;  4YMA A;  4PFU A;  4R6Y A;  4P56 A;  5F7V A;  2B4M A;  4P3L A;  3FJ7 A;  1NH8 A;  2I58 A;  1AMF A;  4OA4 A;  1A8E A;  4H45 A;  2FA7 A;  4WEP A;  3PUY E;  4XEQ A;  2CZK A;  4EUO A;  3TCH A;  3IJO B;  5I56 A;  1M5F A;  3H6W A;  4WXJ A;  2ZNS A;  3FVK A;  1NMU A;  1KA1 A;  3FVG A;  2P1S A;  4LZ5 A;  1FBD A;  1USY H;  4I3E A;  1I6B A;  1JEV A;  1B7U A;  5FHN A;  3FIR A;  4DLD A;  4HCW A;  4PGP A;  5AA3 A;  1NUX A;  4NTL A;  4PTK A;  2OJT A;  5DEX A;  4G68 A;  1FTL A;  2CZH A;  4OVS A;  3D4G A;  4BDR A;  1II5 A;  1Q9D A;  3FAT A;  2HEU A;  3CFL A;  4ZDM A;  3FXB A;  3O66 A;  4N6P A;  4JB7 A;  5ISU A;  4GX6 A;  1LBW A;  2YJP A;  2XXK A;  4NX1 A;  1T0K A;  4BDN A;  3SKP A;  2QMX A;  2H4I A;  3K00 A;  4U2R A;  4OQO A;  1NV2 A;  2Q2A A;  2XWV A;  2OZZ A;  4R9G A;  1PC3 A;  1A7L A;  4NWD A;  4AB5 A;  4PAK A;  5FBP A;  1FBG A;  3KC0 A;  3E9X A;  2QS4 A;  1D4N A;  4GWS A;  3IFA A;  5TU0 A;  3RT6 B;  3TEL A;  3BBR A;  3SEY A;  2Y7K A;  3EHS A;  5A5X B;  3TTK A;  4PC9 A;  4P1E A;  1MRP A;  2OX3 A;  1WOD A;  2DYX A;  3SEW A;  4DI3 D;  3RN8 A;  3V8X B;  5DVF A;  1MDP 1;  4Z0I A;  5EYH A;  1AWB A;  5KZT A;  3PGF A;  1P1O A;  5F24 A;  1B7H A;  2Q2C A;  2WKY A;  3LBS A;  4JWO A;  4LON B;  5H8Q B;  2QVV A;  3G3I A;  4NF5 B;  3IO6 A;  1OQH A;  4WED A;  2R8T A;  2F8D A;  1BK4 A;  2VPO A;  1B5I A;  1HSJ A;  1FSA A;  4ESW A;  1A55 A;  1B32 A;  4IO3 A;  2XXY A;  4RPO A;  2ONS A;  1FPG A;  3IFC A;  4ZEI A;  2UYF A;  4QFN A;  5FHM A;  3RPL A;  3KBZ A;  4QBA A;  4F2Q A;  2D21 A;  4ZEB A;  5I2N A;  4EXK A;  1BLF A;  5EHM A;  4HE1 A;  4AS5 A;  1LCT A;  3GZG A;  1NUY A;  4YB6 A;  3KG2 A;  1R9Q A;  3K0V A;  4ONY A;  4QF9 A;  4C1T A;  1N76 A;  3CR9 A;  3E78 A;  2WYK A;  3PUW E;  3OO8 A;  3VV5 A;  3K1M A;  2XWO A;  3LSX A;  4IR8 A;  4ZEF A;  4HCY A;  1SW2 A;  1PBP A;  5KCJ A;  4R75 A;  1SW5 A;  4ZEC A;  4DXB A;  4R72 A;  2A5T A;  1XS5 A;  3R7X A;  1IIW A;  5ELV A;  1FPL A;  4GQO A;  4IO6 A;  1TFD A;  2BJJ X;  3HHF A;  2I0C A;  4X04 A;  2B4L A;  4G68 C;  4NG7 A;  3CI8 A;  2F97 A;  3U93 A;  4DZ1 A;  3KC1 A;  1UTB A;  4K3F A;  4R6K A;  1K9Z A;  4N6K A;  3FVO A;  2XXR A;  3I5O A;  2QS3 A;  4U21 A;  1BTJ A;  3RYD A;  5AE4 A;  1IMA A;  3CG1 A;  1QUL A;  1FBH A;  2CEX A;  5BWJ A;  2Y84 A;  4MBP A;  2Z22 A;  3R6U A;  4OFJ A;  1S7Y A;  4DE8 A;  1JVX A;  2X26 A;  3TYH A;  2B65 A;  2VD3 A;  2X7P A;  1PB9 A;  4GVO A;  4JVD A;  3QIM A;  2THI A;  1MM6 A;  4FJP A;  1A40 A;  4I3Y A;  3E4R A;  5DTB A;  4UAB A;  2MKZ A;  4R6H A;  1TWY A;  2I6E A;  2QSX A;  2Y7I A;  4G61 A;  1B46 A;  3TTM A;  4N13 A;  1B05 A;  2ZNT A;  3PMX A;  3V89 B;  3EQ1 A;  1XOC A;  2F34 A;  5CMC A;  4RK9 A;  4EF2 A;  2F3B A;  3P7I A;  3MST A;  5T3J A;  1Y3Q A;  3LUY A;  4O94 A;  4QFK A;  3BKI B;  3FD3 A;  5L9S A;  5I56 B;  1MPB A;  1TT1 A;  1N7X A;  4DXU A;  3T22 A;  4KQP A;  4TLL B;  4MJO A;  3U92 A;  3CFZ A;  1MY4 A;  1R9L A;  4EQ7 A;  5EYF A;  1TFA A;  3F11 A;  3ROJ A;  1OVB A;  3VXC A;  3ZSF A;  4N81 A;  1CNQ A;  4GD5 A;  4O3C A;  3K6X A;  4R2B A;  4XKR A;  4GX3 A;  2F7C A;  3BFU A;  1B7Z A;  1QJM A;  2R9J A;  4PFR A;  1LAH E;  4GWU A;  3RLF E;  3BIH A;  2ZZW A;  1HSE A;  3PU5 A;  1Y3N A;  3O6H A;  3DEL B;  2XD2 A;  4G68 B;  3IK6 B;  4ESX A;  2RCA A;  2QS2 A;  1QVS A;  2NVU B;  1ZJL A;  3QAX A;  4OVQ A;  3WAF A;  1N7W A;  1B3F A;  1A99 A;  2DVC A;  3TMG A;  3TCF A;  2NXO A;  3K02 A;  4QXD A;  4OES A;  2CZL A;  2HPG A;  4IO5 A;  3CHG A;  1POY 1;  4FOR A;  4EQ9 A;  3C31 A;  4UA8 A;  1US5 A;  2O51 A;  5H8Q A;  5IZ3 A;  4NF5 A;  1LFI A;  2XX8 A;  4GOT A;  1PB8 A;  4GLI A;  4YKJ A;  3KSX A;  2F7B A;  3GXA A;  4ZZE A;  2O1M A;  2PT1 A;  4P0I A;  4N4U A;  3ONM A;  2Z23 A;  5KDT B;  4GX4 A;  4NF4 A;  4RK2 A;  3TFL A;  4JSO A;  3K6U A;  3KOT A;  2R71 A;  4UAC A;  3MYU A;  4Q0C A;  4GWX A;  5LOM A;  2ZYO A;  2O1L A;  5ET8 A;  4YB5 A;  3TQW A;  1NUZ A;  2GQ1 A;  4X48 A;  1GTK A;  1MQG A;  3V5A A;  1B3L A;  3RQT A;  1JQF A;  2VOZ A;  2V3U A;  3TOD A;  1SVX B;  3B50 A;  2WEF A;  1Y4C A;  2F6P A;  1MH4 A;  1FPI A;  4ZEK A;  4ELQ A;  4PE3 A;  1NNF A;  3ODB A;  4ELP A;  3H06 B;  1OVT A;  1BKA A;  2WX9 A;  1RDY A;  3MVZ A;  4NN3 A;  3IB2 A;  3FXU A;  5DW8 A;  3RPL B;  5FTH A;  3OO6 A;  1O64 A;  2H9B A;  3EPE A;  2OLB A;  1VDW A;  1MY2 A;  2YPN A;  1LAF E;  3DM0 A;  3PUX E;  2DWI A;  2OWS A;  4GWW A;  4LVQ A;  1IXC A;  4H5F A;  4QFP A;  4PDH A;  4KXP A;  2HQ0 A;  2UXA A;  2RC9 A;  1O7T A;  2HAU A;  2JJK A;  3UIF A;  2O84 X;  4OVT A;  1MM7 A;  3PMV A;  3TTL A;  5LTC A;  3Q26 A;  4ZED A;  3W9V A;  4P47 A;  3UP9 A;  1GR2 A;  2DVZ A;  4R73 A;  1YZ0 A;  1FW0 A;  4X9T A;  5I7I A;  4KR5 A;  1SI0 A;  4NF8 B;  2Q89 A;  4ISU A;  4HE0 A;  5HBC A;  1BP5 A;  2XHD A;  3FZV A;  4OVR A;  2CMO A;  2UYE A;  1M5C A;  4MCO A;  5JTY B;  4Q8R A;  1JET A;  1M5E A;  3UK4 A;  3KJ7 A;  4I1D A;  2G93 A;  3VVF A;  5B7D A;  1UTB B;  1NKX A;  2QVU A;  4GF8 A;  2KQZ A;  3TCG A;  2QPQ A;  1H43 A;  4OTE A;  3RGY A;  4L17 A;  4H0W A;  4OZ9 A;  2VD2 A;  3IOU A;  1EYJ A;  1YTV A;  4F2O A;  1K9Y A;  4N15 A;  2RF1 A;  2ABH A;  1I69 A;  3MUQ A;  4GWY A;  3T96 B;  1Y1M A;  4BLA A;  2O6A A;  2ZXT A;  3K4U A;  3TPA A;  4P11 A;  5J16 A;  4U1Z A;  3QUF A;  5CBS A;  1QUI A;  1URD A;  1OIB A;  1J1N A;  5ET6 A;  1LLS A;  3MP1 A;  5HM4 B;  3G7W A;  1OMP A;  4MX6 A;  5I5P A;  3MAM A;  3H03 A;  2Y5L A;  4E0X A;  4TQU Q;  3LSW A;  4PAF A;  3OEL A;  1L5T A;  3RTW B;  2Q88 A;  2V3T A;  1EH3 A;  2F5X A;  4HS7 A;  3W15 C;  4IO7 A;  2ZZV A;  4DIG A;  2AYS A;  1FQB A;  2V4C A;  1NH7 A;  4OEV A;  1DMB A;  3IOV A;  2RC8 A;  1Y9U A;  1B2H A;  1RDZ A;  4PFB A;  4H5G A;  3IAZ A;  1MQJ A;  3C4M A;  1P1Q A;  1LBZ A;  4ELR A;  3FAS A;  3KBR A;  2REJ A;  2XWI A;  3M3K A;  3U94 A;  3MVX A;  3SER A;  1IUD A;  1YAE A;  4X8R A;  3FJM A;  3K1N A;  1TXF A;  1N04 A;  1POT A;  4QSE A;  1HSL A;  1UQW A;  4LAT A;  1MQD A;  2Y7W A;  3VLV A;  3AXF A;  2PX1 A;  4GWZ A;  3O28 A;  3D4C A;  5KDT A;  1LBX A;  1DK4 A;  1M5B A;  4KYE A;  3SEV A;  4PET A;  4IY6 A;  3MJN A;  4H1X A;  3KN8 A;  4IO2 A;  4XF5 A;  2XXT A;  1LBC A;  2F6G A;  4JWX A;  3HV1 A;  3S4U A;  3IJX B;  4F3S A;  4HW8 A;  1H44 A;  3C9H A;  4KFQ A;  2XXU A;  3K6W A;  2VT5 A;  3RPW A;  3H6U A;  2I49 A;  2RKM A;  5IZ3 B;  3QK6 A;  1SYH A;  3PPN A;  2UVG A;  4LQ5 A;  1NV4 A;  4ZE8 A;  3MQ9 A;  1IMD A;  4THI A;  3C33 A;  4ZS9 A;  2O7I A;  4P8B A;  1RKM A;  5EHS A;  3BFT A;  1FQD A;  3KSJ A;  3ZKK A;  5ITP A;  4JWY A;  3G3K A;  1FPJ A;  1MY1 A;  4NF4 B;  1FPB A;  3M3F A;  2FYI A;  4XKP A;  4N8Y A;  4NE4 A;  1PDA A;  2H5Y A;  4MNP A;  2VGQ A;  1RDX A;  5IKB A;  1FCK A;  1MS7 A;  1FQC A;  4RY1 A;  3K01 A;  5DYH A;  1B5H A;  4U22 A;  1LEV A;  3CRB A;  5ET7 A;  4DXC A;  1EYK A;  5DVI A;  2DS9 A;  1MXV A;  1IIT A;  3QMF A;  3MW0 A;  3LUZ A;  3B7D A;  5CMK A;  4EDP A;  1SW1 A;  3B6T A;  4RA1 A;  3B8B A;  3FV1 A;  4PQJ A;  1OLC A;  2L5V A;  3MPL A;  1MG1 A;  1LFG A;  1ZMG A;  4I8C A;  3VLU A;  5I84 A;  1IXG A;  3L6G A;  3GBB A;  3N94 A;  3HHG A;  3GLB A;  4NF8 A;  1SBP A;  3VDF A;  3PPP A;  1D9V A;  4MMP A;  3MPK A;  1WDN A;  1XVX A;  1NV7 A;  1LST A;  5JTY A;  3OSQ A;  3PD9 A;  4OAN A;  2XWK A;  1UIU A;  1CB6 A;  3RNN A;  3OXN A;  4OMB A;  2OCU A;  1B51 A;  1IXH A;  1QKA A;  1EU8 A;  4YB7 A;  1SQY A;  2OWT A;  3SEX A;  2Q8M A;  2H99 A;  3OEK A;  4BDM A;  2RIN A;  3E79 A;  2XXQ A;  2I3V A;  3H4Z A;  3K6V A;  4G2Z A;  3MP8 A;  1LBY A;  4G77 A;  3MP6 A;  1NI9 A;  2H25 A;  4C0R A;  1FBF A;  5AA4 B;  2Q9T A;  2DWA A;  1A8F A;  1FQA A;  3QUJ A;  4TOZ A;  1SI1 A;  3K2D A;  2HCA A;  3T9V A;  1QUJ A;  1QUK A;  3VVE A;  4HXV A;  1UIV A;  1UTH B;  3MZB A;  4X1B A;  3HCQ A;  2DP8 A;  3KGC A;  4I9D A;  3N6U A;  3Q28 A;  3N5L A;  4MEV A;  4OET A;  3TEP A;  4JXI A;  1FBC A;  3IOW A;  2OWZ A;  4XKQ A;  2DE2 A;  3H6T A;  2QVR A;  2ALU A;  3U1O A;  1MQI A;  3KN7 A;  1F9B A;  4QSD A;  3HN0 A;  1GGG A;  1N0T A;  3TTN A;  2Q8J A;  3MZ1 A;  4N91 A;  4RYA A;  4OEN A;  5I2K A;  1LB9 A;  3H6V A;  3OMB A;  3PTY A;  2ONR A;  2V3Q A;  4HTG A;  2XX7 A;  4F29 A;  2P2A A;  1EYI A;  1B40 A;  1MQH A;  2CZI A;  2O7U A;  4MLQ A;  4U1O A;  1MY0 A;  4G4P A;  3S9E A;  4NAP A;  1ZBM A;  1B6H A;  1D9Y A;  2GH9 A;  4NED A;  1H76 A;  3SZP A;  2I0B A;  3W9W A;  1YCJ A;  4AB6 A;  1JEU A;  4F22 A;  5CM6 A;  3HFU A;  5EQA A;  4YKK A;  4PF8 A;  2P3N A;  4POX A;  2KR0 A;  2ONK E;  3DLN A;  1FRP A;  3FJG A;  1NL5 A;  4F39 A;  1AL3 A;  4OFL A;  5JEI A;  3VE1 B;  1B52 A;  1NNT A;  1NNK A;  2A5S A;  5F1Q A;  2GFE A;  1DSN A;  4FAT A;  4DCY A;  2E0S A;  4FIM A;  2F3D A;  4ECF A;  5I58 B;  4F19 A;  3L6H A;  3O2A A;  3HPI A;  1MXY A;  1EZO A;  1S9T A;  4NMY A;  5DVJ A;  3VLW A;  1FPE A;  1FTK A;  2XXW A;  2RCB A;  4G8N A;  4F1Y A;  1IMB A;  3CG3 A;  4YKP A;  3KEI A;  2VP1 A;  5EYG A;  3S9M C;  4PBH A;  3KJT A;  4LA9 A;  3A3U A;  4OXV A;  4AS4 A;  1FPD A;  1YXI A;  4G8M A;  3TUS A;  3T9X B;  1NNP A;  2QMW A;  3G3H A;  4KCC A;  1YPN A;  4LP2 B;  2HFB A;  1GVC A;  2Y5K A;  1KA0 A;  3H7M A;  2KLF A;  1MPC A;  2FIX A;  2DQV A;  1IME A;  4IGR A;  1MXU A;  4R9F A;  1LBB A;  4IO4 A;  3T0J A;  4PFT A;  1B0L A;  2HXW A;  3O6I A;  1B0H A;  2ZYN A;  3ZS6 A;  4OHN A;  5H8N A;  5K2X A;  1Z7M E;  1M5D A;  4M4G A;  1JW5 A;  2WYP A;  4G8H A;  2VPN A;  3IR1 A;  4LUB A;  3TDJ A;  4R2F A;  2HZL A;  1FTJ A;  2VHA A;  4KI0 E;  4XKN A;  4U4S A;  4R74 A;  2Y7R A;  1ZU0 A;  5AA4 A;  4KYS A;  4MHF A;  1P99 A;  3KFM A;  3USD A;  3FVN A;  3IB1 A;  2AL4 A;  1VE4 A;  3TAJ A;  2IEE A;  2WBD A;  1SW4 A;  2QS1 A;  4YU0 A;  2AIX A;  3MVW A;  1FBE A;  4F3B A;  3SES A;  1MXZ A;  4GXA A;  4JVC A;  1UTH A;  1JW4 A;  4H6D A;  4OVP A;  1SD3 A;  3HO7 A;  1FQE A;  1I6A A;  5J1D A;  3G3J A;  4PFW A;  4RPN A;  2XXP A;  3EKI A;  4FEC A;  1JNF A;  2OK2 A;  3CSB A;  2R6G E;  3D1R A;  4JSD A;  1ATG A;  3C34 A;  3H3G A;  3R26 A;  4P9K A;  1R1N A;  4Q5T A;  1DOT A;  1MPD A;  2X7Q A;  4YIC A;  3A29 A;  1CE2 A;  1LGB C;  1Y1Z A;  2DSF A;  3I3V A;  4DDD A;  1VFE A;  3PPR A;  4IGT A;  3MC2 A;  4E0W A;  2DWJ A;  1D3K A;  1OQG A;  3KZG A;  4U23 A;  4XFE A;  3S9N C;  2I4C A;  3O9P A;  2NUV A;  5TPA B;  1IXI A;  1NV3 A;  3G3G A;  3VVD A;  4F18 A;  4JBZ A;  1RYX A;  1DPE A;  3OD7 A;  5H8H B;  5EQ9 A;  4N17 A;  4NHB A;  1NV5 A;  1FTO A;  3OOA A;  2D3I A;  4Q30 B;  4H46 A;  1DCU A;  4ZE9 A;  1B3H A;  2FIE A;  5I2K B;  1FPF A;  1B3E A;  5FTI A;  4F31 B;  2QFL A;  2ZMB A;  4KPT A;  4O8M A;  1ANF A;  1AIV A;  3RT8 A;  5I58 A;  4PAI A;  5K2Y A;  3C36 A;  5AA1 A;  5TP9 B;  2UVI A;  3O97 A;  2ANJ A;  3OO9 A;  2F78 A;  2HAV A;  1IZ1 A;  1SPI A;  4YMB A;  5I57 B;  2O69 A;  4HE2 A;  1B4Z A;  4P0G A;  4LQ2 A;  3IB0 A;  2PVU A;  1NFT A;  4PE5 B;  4QFO A;  5CI5 A;  2XXH A;  1ZLQ A;  2DE3 A;  1VR5 A;  3TQL A;  5CC2 A;  3B6W A;  2DXY A;  1Y4T A;  2ZZX A;  4XXU A;  4M1V A;  2F7A A;  1LFH A;  5EQ7 A;  1SDX A;  5I59 B;  3QSL A;  3O6G A;  1YYZ A;  4Z7E A;  3KN3 A;  4NF6 B;  4IB2 A;  1RYO A;  4RNS A;  3PUV E;  4O7I A;  4C1U A;  4H65 A;  3SEU A;  3S9L C;  4PFY A;  5ICT A;  3IL1 B;  3K1P A;  1G0H A;  4JDF A;  1FTA A;  4GFR A;  4QHQ A;  5JK4 A;  3LV0 A;  3C35 A;  3TZA A;  4PF6 A;  2Z8F A;  3VXB A;  3M3L A;  3KOS A;  3RY3 A;  3EN3 A;  4NQ8 A;  1GV8 A;  3JV9 A;  1AH5 A;  2B3F A;  2PFY A;  2NWJ A;  2REG A;  2CEY A;  4GBV A;  3FXR A;  4LZ7 A;  2Z8E A;  4O7M A;  3T93 B;  2I4B A;  3TTR A;  3OO7 A;  2QRY A;  3S2V A;  5IGA A;  1FPK A;  3JYR A;  3EHT A;  3T66 A;  1JW1 A;  3LC8 A;  3U8Q A;  3RUM A;  4GRK A;  4QRZ A;  4OYV A;  3ECR A;  2V84 A;  4FED A;  3T9U A;  1IMC A;  1IEJ A;  2B3B A;  4F1U A;  1IMF A; 
#chains in the Genus database with same CATH homology
 2XXI A;  3B6Q A;  2H98 A;  5H8N B;  1N84 A;  1H45 A;  2F35 A;  3CIJ A;  5AA2 A;  4POW A;  3PD8 A;  1A54 A;  2HZK A;  1JVY A;  1XC1 A;  1MXX A;  4ZZA A;  3ILU B;  2XXV A;  4I62 A;  1WVJ A;  3PUZ E;  5ITO A;  3M8U A;  4YKI A;  1ZIU A;  1ZKB A;  2GRV A;  3UA8 A;  5B70 A;  3TKD A;  4LZ8 A;  3Q29 A;  3UGW A;  1B3G A;  2YLN A;  4MLV A;  4EXL A;  2V93 A;  1XVY A;  5L9O A;  3IOR A;  2FNC A;  2Y7P A;  5CRY A;  2D5W A;  4H8I A;  4MF3 A;  1EZP A;  2DWH A;  4F1V A;  2GHB A;  1MY3 A;  1R6Z A;  5TPA A;  2GHA A;  3SET A;  1AOV A;  4IY5 A;  5H8F B;  2DE4 A;  1B1X A;  1QKB A;  4EF1 A;  3ZKL A;  5H8H A;  3E3K A;  2ESN A;  3IO4 A;  4AQ4 A;  4F3G A;  5M2V A;  3QYT A;  4OEU A;  2IA4 A;  1SYI A;  3DP4 A;  3T9H B;  1Q35 A;  4OVJ A;  2AL5 A;  4PP0 A;  2I48 A;  2O68 A;  1KWH A;  4FEB A;  4O3B A;  3CSG A;  2ZYM A;  2QJE A;  2PBW A;  2OBG A;  4RXL A;  5TP9 A;  3N26 A;  3OEN A;  3V83 A;  5HPQ A;  1VFD A;  3ILT B;  5I57 A;  3Q25 A;  3FV2 A;  1XHY A;  1Y3P A;  4ND9 A;  4YZZ A;  1P1U A;  1LB8 A;  5A5X A;  1XT8 A;  4XTC Q;  5DEX B;  2ZYK A;  2W7Y A;  3MZ9 A;  4KCD A;  4H67 A;  5CMB A;  3O29 A;  2F36 A;  1I6Q A;  5I59 A;  3QXM A;  5DT6 A;  4GXS B;  2XX9 A;  2G29 A;  3PPO A;  1B4H A;  1USY E;  3IOT A;  4OFO A;  2UVH A;  4NF6 A;  1ELJ A;  3JZJ A;  1LAG E;  4N07 A;  1VSO A;  2DXR A;  3MVY A;  5L8D A;  4YAH X;  4X1D A;  1B1H A;  3C32 A;  1OLA A;  2E1S A;  1URG A;  3E13 X;  3GBA A;  3PPQ A;  1ZTY A;  3A09 A;  3RTF B;  3N6T A;  5BUU A;  4XIG Q;  3UOR A;  5CMM A;  4BDQ A;  1MXW A;  1DPP A;  1DTZ A;  2UVJ A;  1Z7N E;  2XXX A;  3MWB A;  3U72 A;  4WKM A;  4RJZ A;  4FE8 A;  4KYD A;  2DOJ A;  2ZNU A;  3MBP A;  3PMW A;  3CFX A;  3EF7 A;  2LAO A;  1US4 A;  2I3W A;  4U4X A;  3OEM A;  1B58 A;  4BDL A;  2M8C A;  4DCX A;  4GL8 A;  3PV0 E;  1S50 A;  4QSC A;  2QL3 A;  2RC7 A;  3FGS A;  5IAI A;  1LCF A;  3VFJ A;  3IX1 A;  1H3D A;  1IQ7 A;  1Y20 A;  4FAJ A;  5H8S A;  4GWO A;  5ICQ A;  3A3C A;  5CBR A;  3FUZ A;  2Z8D A;  4ELO A;  3HST A;  1EZ9 A;  1QW0 A;  3SDF A;  3WAE A;  4OER A;  3EHU A;  4MH5 A;  1FTM A;  2NOO A;  2PMS A;  5I2N B;  3G3F A;  5L9M A;  3UN6 A;  2PYY A;  4GIZ A;  3Q27 A;  1O63 A;  4F3P A;  1PBQ A;  1LAX A;  3LSF B;  5AA2 D;  3LSL A;  2P0S A;  4NWC A;  1N3W A;  1PEB A;  3CVG A;  4KD5 A;  5KCJ B;  3LR1 A;  4GL0 A;  1P1W A;  1B5J A;  4MFI A;  3FXQ A;  1B9J A;  1P1N A;  1URS A;  2A5T B;  1Q1K A;  2V25 A;  5FHO A;  4O3A A;  4OWD A;  4TLM B;  2PT2 A;  3I6V A;  4EQB A;  4KHZ E;  1BIY A;  3DP6 A;  5AA2 B;  4BDO A;  2XD3 A;  1MH3 A;  3DP8 A;  4H8J A;  1FQF A;  1DTG A;  1N3X A;  3OSR A;  1MDQ A;  5H8F A;  1PB7 A;  3THI A;  4QFL A;  4YMA A;  4PFU A;  4R6Y A;  5F7V A;  3FJ7 A;  1NH8 A;  2I58 A;  1AMF A;  1A8E A;  2FA7 A;  4WEP A;  3PUY E;  4EUO A;  3TCH A;  3IJO B;  5I56 A;  1M5F A;  3H6W A;  4WXJ A;  2ZNS A;  3FVK A;  1NMU A;  3FVG A;  2P1S A;  4LZ5 A;  1USY H;  1I6B A;  1JEV A;  1B7U A;  5FHN A;  3FIR A;  4DLD A;  4HCW A;  5AA3 A;  4NTL A;  2OJT A;  5DEX A;  4G68 A;  1FTL A;  3D4G A;  4BDR A;  1II5 A;  3FAT A;  2HEU A;  3CFL A;  4ZDM A;  3O66 A;  4N6P A;  4JB7 A;  5ISU A;  2YJP A;  1T0K A;  4BDN A;  3SKP A;  2QMX A;  2H4I A;  3K00 A;  4U2R A;  4OQO A;  2Q2A A;  2OZZ A;  4R9G A;  1PC3 A;  1A7L A;  4NWD A;  4AB5 A;  3E9X A;  2QS4 A;  1D4N A;  5TU0 A;  3RT6 B;  3TEL A;  3BBR A;  3SEY A;  2Y7K A;  3EHS A;  5A5X B;  3TTK A;  1MRP A;  1WOD A;  2DYX A;  3SEW A;  3RN8 A;  3V8X B;  5DVF A;  1MDP 1;  4Z0I A;  5KZT A;  3PGF A;  1P1O A;  1B7H A;  2Q2C A;  2WKY A;  3LBS A;  4JWO A;  4LON B;  5H8Q B;  3G3I A;  4NF5 B;  3IO6 A;  1OQH A;  4WED A;  2F8D A;  1B5I A;  1HSJ A;  4ESW A;  1A55 A;  1B32 A;  4IO3 A;  2XXY A;  4RPO A;  2ONS A;  4ZEI A;  2UYF A;  4QFN A;  5FHM A;  4F2Q A;  2D21 A;  4ZEB A;  5I2N A;  4EXK A;  1BLF A;  5EHM A;  1LCT A;  3GZG A;  4YB6 A;  3KG2 A;  1R9Q A;  3K0V A;  4ONY A;  4QF9 A;  4C1T A;  1N76 A;  3CR9 A;  3PUW E;  3OO8 A;  3VV5 A;  3K1M A;  3LSX A;  4ZEF A;  4HCY A;  1SW2 A;  1PBP A;  5KCJ A;  4R75 A;  1SW5 A;  4ZEC A;  4DXB A;  4R72 A;  2A5T A;  1XS5 A;  3R7X A;  1IIW A;  5ELV A;  4GQO A;  4IO6 A;  1TFD A;  2BJJ X;  3HHF A;  2I0C A;  4G68 C;  3CI8 A;  2F97 A;  3U93 A;  4DZ1 A;  1UTB A;  4K3F A;  4R6K A;  3FVO A;  2XXR A;  3I5O A;  2QS3 A;  4U21 A;  1BTJ A;  5AE4 A;  3CG1 A;  1QUL A;  5BWJ A;  2Y84 A;  4MBP A;  2Z22 A;  3R6U A;  4OFJ A;  1S7Y A;  4DE8 A;  1JVX A;  2X26 A;  3TYH A;  2B65 A;  2VD3 A;  2X7P A;  1PB9 A;  4GVO A;  3QIM A;  2THI A;  1MM6 A;  4FJP A;  1A40 A;  3E4R A;  5DTB A;  4R6H A;  1TWY A;  2I6E A;  2QSX A;  2Y7I A;  1B46 A;  3TTM A;  4N13 A;  1B05 A;  2ZNT A;  3PMX A;  3V89 B;  3EQ1 A;  1XOC A;  2F34 A;  5CMC A;  4RK9 A;  4EF2 A;  3P7I A;  1Y3Q A;  3LUY A;  4QFK A;  3BKI B;  3FD3 A;  5L9S A;  5I56 B;  1MPB A;  1TT1 A;  1N7X A;  4DXU A;  3T22 A;  4KQP A;  4TLL B;  3U92 A;  3CFZ A;  1MY4 A;  1R9L A;  4EQ7 A;  5EYF A;  1TFA A;  3F11 A;  1OVB A;  3VXC A;  3ZSF A;  4GD5 A;  4O3C A;  3K6X A;  4R2B A;  4XKR A;  2F7C A;  3BFU A;  1B7Z A;  1QJM A;  2R9J A;  1LAH E;  3RLF E;  1HSE A;  3PU5 A;  1Y3N A;  3O6H A;  3DEL B;  2XD2 A;  4G68 B;  3IK6 B;  4ESX A;  2RCA A;  2QS2 A;  1QVS A;  2NVU B;  1ZJL A;  3QAX A;  3WAF A;  1N7W A;  1B3F A;  1A99 A;  2DVC A;  3TMG A;  3TCF A;  2NXO A;  3K02 A;  4OES A;  2CZL A;  4IO5 A;  1POY 1;  4FOR A;  4EQ9 A;  3C31 A;  4UA8 A;  1US5 A;  5H8Q A;  2O51 A;  4NF5 A;  1LFI A;  2XX8 A;  4GOT A;  1PB8 A;  4GLI A;  4YKJ A;  3KSX A;  2F7B A;  3GXA A;  4ZZE A;  2O1M A;  2PT1 A;  4P0I A;  3ONM A;  2Z23 A;  5KDT B;  4NF4 A;  4RK2 A;  3TFL A;  4JSO A;  3K6U A;  3KOT A;  2R71 A;  4UAC A;  4Q0C A;  5LOM A;  2ZYO A;  2O1L A;  4YB5 A;  3TQW A;  4X48 A;  1GTK A;  1MQG A;  3V5A A;  1B3L A;  3RQT A;  1JQF A;  2VOZ A;  2V3U A;  3TOD A;  1SVX B;  1Y4C A;  2F6P A;  1MH4 A;  4ZEK A;  4ELQ A;  1NNF A;  3ODB A;  4ELP A;  3H06 B;  1OVT A;  1BKA A;  3MVZ A;  3IB2 A;  3FXU A;  5FTH A;  3OO6 A;  1O64 A;  2H9B A;  3EPE A;  2OLB A;  1MY2 A;  2YPN A;  1LAF E;  3DM0 A;  3PUX E;  2DWI A;  2OWS A;  4LVQ A;  1IXC A;  4H5F A;  4QFP A;  2HQ0 A;  2UXA A;  2RC9 A;  1O7T A;  2HAU A;  3UIF A;  2O84 X;  1MM7 A;  3PMV A;  3TTL A;  3Q26 A;  4ZED A;  3W9V A;  3UP9 A;  1GR2 A;  2DVZ A;  4R73 A;  1FW0 A;  4X9T A;  4KR5 A;  1SI0 A;  4NF8 B;  2Q89 A;  4ISU A;  5HBC A;  1BP5 A;  2XHD A;  3FZV A;  2CMO A;  2UYE A;  1M5C A;  5JTY B;  4Q8R A;  1JET A;  1M5E A;  3UK4 A;  3KJ7 A;  4I1D A;  2G93 A;  3VVF A;  5B7D A;  1UTB B;  1NKX A;  4GF8 A;  3TCG A;  2QPQ A;  1H43 A;  4OTE A;  3RGY A;  4L17 A;  4H0W A;  4OZ9 A;  2VD2 A;  3IOU A;  1YTV A;  4F2O A;  2RF1 A;  2ABH A;  1I69 A;  3MUQ A;  3T96 B;  1Y1M A;  4BLA A;  2O6A A;  2ZXT A;  3K4U A;  3TPA A;  4P11 A;  4U1Z A;  3QUF A;  5CBS A;  1QUI A;  1URD A;  1OIB A;  1J1N A;  1LLS A;  3MP1 A;  5HM4 B;  3G7W A;  1OMP A;  3MAM A;  3H03 A;  4E0X A;  4TQU Q;  3LSW A;  3OEL A;  1L5T A;  3RTW B;  2Q88 A;  2V3T A;  1EH3 A;  2F5X A;  4HS7 A;  3W15 C;  4IO7 A;  4DIG A;  2AYS A;  1FQB A;  1NH7 A;  4OEV A;  1DMB A;  3IOV A;  2RC8 A;  1Y9U A;  1B2H A;  4H5G A;  3IAZ A;  1MQJ A;  3C4M A;  1P1Q A;  4ELR A;  3FAS A;  3KBR A;  2REJ A;  3M3K A;  3U94 A;  3MVX A;  3SER A;  1IUD A;  1YAE A;  3FJM A;  3K1N A;  1TXF A;  1N04 A;  1POT A;  4QSE A;  1HSL A;  1UQW A;  4LAT A;  1MQD A;  2Y7W A;  3VLV A;  3AXF A;  2PX1 A;  3O28 A;  3D4C A;  5KDT A;  1M5B A;  4KYE A;  3SEV A;  4PET A;  4IY6 A;  3MJN A;  4H1X A;  3KN8 A;  4IO2 A;  2XXT A;  1LBC A;  2F6G A;  4JWX A;  3HV1 A;  3S4U A;  3IJX B;  4F3S A;  4HW8 A;  1H44 A;  3C9H A;  4KFQ A;  2XXU A;  3K6W A;  3RPW A;  3H6U A;  2I49 A;  2RKM A;  3QK6 A;  1SYH A;  3PPN A;  2UVG A;  4LQ5 A;  4ZE8 A;  3MQ9 A;  4THI A;  3C33 A;  4ZS9 A;  2O7I A;  1RKM A;  5EHS A;  3BFT A;  1FQD A;  3KSJ A;  3ZKK A;  5ITP A;  4JWY A;  3G3K A;  1MY1 A;  4NF4 B;  3M3F A;  2FYI A;  4XKP A;  4NE4 A;  1PDA A;  2H5Y A;  2VGQ A;  5IKB A;  1FCK A;  1MS7 A;  1FQC A;  4RY1 A;  3K01 A;  5DYH A;  1B5H A;  4U22 A;  3CRB A;  4DXC A;  5DVI A;  2DS9 A;  1MXV A;  1IIT A;  3MW0 A;  3B7D A;  5CMK A;  4EDP A;  1SW1 A;  3B6T A;  4RA1 A;  3FV1 A;  4PQJ A;  1OLC A;  1MG1 A;  3MPL A;  1LFG A;  1ZMG A;  4I8C A;  3VLU A;  5I84 A;  1IXG A;  3L6G A;  3GBB A;  3N94 A;  3HHG A;  3GLB A;  4NF8 A;  1SBP A;  3VDF A;  3PPP A;  1D9V A;  3MPK A;  1WDN A;  1XVX A;  1LST A;  5JTY A;  3OSQ A;  3PD9 A;  1UIU A;  1CB6 A;  3RNN A;  3OXN A;  4OMB A;  2OCU A;  1B51 A;  1IXH A;  1QKA A;  1EU8 A;  4YB7 A;  1SQY A;  2OWT A;  3SEX A;  4BDM A;  2H99 A;  3OEK A;  2RIN A;  2XXQ A;  2I3V A;  3H4Z A;  3K6V A;  4G2Z A;  3MP8 A;  4G77 A;  3MP6 A;  2H25 A;  4C0R A;  5AA4 B;  2Q9T A;  2DWA A;  1A8F A;  1FQA A;  3QUJ A;  4TOZ A;  1SI1 A;  3K2D A;  2HCA A;  3T9V A;  1QUJ A;  1QUK A;  3VVE A;  1UIV A;  1UTH B;  3MZB A;  4X1B A;  3HCQ A;  2DP8 A;  3KGC A;  4I9D A;  3N6U A;  3Q28 A;  3N5L A;  4OET A;  3TEP A;  4JXI A;  3IOW A;  4XKQ A;  2DE2 A;  3H6T A;  2ALU A;  3U1O A;  1MQI A;  3KN7 A;  1F9B A;  4QSD A;  3HN0 A;  1GGG A;  1N0T A;  3TTN A;  2Q8J A;  3MZ1 A;  4RYA A;  4OEN A;  5I2K A;  1LB9 A;  3H6V A;  3OMB A;  4HTG A;  2ONR A;  2V3Q A;  2XX7 A;  4F29 A;  2P2A A;  1B40 A;  1MQH A;  2O7U A;  4MLQ A;  4U1O A;  1MY0 A;  4G4P A;  3S9E A;  1ZBM A;  1B6H A;  1D9Y A;  2GH9 A;  4NED A;  1H76 A;  2I0B A;  3W9W A;  1YCJ A;  4AB6 A;  1JEU A;  4F22 A;  5CM6 A;  4YKK A;  4POX A;  2ONK E;  3DLN A;  3FJG A;  1NL5 A;  4F39 A;  1AL3 A;  4OFL A;  5JEI A;  3VE1 B;  1B52 A;  1NNT A;  1NNK A;  2A5S A;  5F1Q A;  2GFE A;  1DSN A;  4FAT A;  4DCY A;  2E0S A;  4FIM A;  4ECF A;  5I58 B;  4F19 A;  3L6H A;  3O2A A;  3HPI A;  1MXY A;  1EZO A;  1S9T A;  4NMY A;  5DVJ A;  3VLW A;  1FTK A;  2XXW A;  2RCB A;  4G8N A;  4F1Y A;  3CG3 A;  4YKP A;  3KEI A;  2VP1 A;  3S9M C;  3KJT A;  4LA9 A;  3A3U A;  4OXV A;  4G8M A;  3TUS A;  3T9X B;  1NNP A;  2QMW A;  3G3H A;  4KCC A;  1YPN A;  4LP2 B;  2HFB A;  1GVC A;  3H7M A;  2KLF A;  1MPC A;  2DQV A;  4IGR A;  1MXU A;  4R9F A;  1LBB A;  4IO4 A;  4PFT A;  1B0L A;  2HXW A;  3O6I A;  1B0H A;  2ZYN A;  3ZS6 A;  4OHN A;  5H8N A;  5K2X A;  1Z7M E;  1M5D A;  4M4G A;  1JW5 A;  4G8H A;  3IR1 A;  4LUB A;  3TDJ A;  4R2F A;  2HZL A;  1FTJ A;  2VHA A;  4KI0 E;  4XKN A;  4U4S A;  4R74 A;  2Y7R A;  1ZU0 A;  5AA4 A;  4KYS A;  1P99 A;  3KFM A;  3USD A;  3FVN A;  3IB1 A;  2AL4 A;  1VE4 A;  3TAJ A;  2IEE A;  1SW4 A;  2QS1 A;  4YU0 A;  2AIX A;  3MVW A;  4F3B A;  3SES A;  1MXZ A;  4GXA A;  1UTH A;  1JW4 A;  4H6D A;  1SD3 A;  3HO7 A;  1FQE A;  1I6A A;  5J1D A;  3G3J A;  4PFW A;  4RPN A;  2XXP A;  4FEC A;  1JNF A;  2OK2 A;  3CSB A;  2R6G E;  4JSD A;  1ATG A;  3C34 A;  3H3G A;  3R26 A;  1R1N A;  4Q5T A;  1DOT A;  1MPD A;  2X7Q A;  4YIC A;  1CE2 A;  1LGB C;  1Y1Z A;  2DSF A;  3I3V A;  4DDD A;  1VFE A;  3PPR A;  4IGT A;  3MC2 A;  4E0W A;  2DWJ A;  1D3K A;  1OQG A;  3KZG A;  4U23 A;  3S9N C;  2I4C A;  3O9P A;  2NUV A;  5TPA B;  1IXI A;  3G3G A;  3VVD A;  4F18 A;  4JBZ A;  1RYX A;  1DPE A;  3OD7 A;  5H8H B;  1FTO A;  3OOA A;  2D3I A;  4Q30 B;  4ZE9 A;  1B3H A;  5I2K B;  1B3E A;  5FTI A;  4F31 B;  2ZMB A;  4KPT A;  1ANF A;  1AIV A;  3RT8 A;  5I58 A;  5K2Y A;  3C36 A;  5AA1 A;  5TP9 B;  2UVI A;  3O97 A;  2ANJ A;  3OO9 A;  2F78 A;  2HAV A;  1IZ1 A;  4YMB A;  5I57 B;  2O69 A;  1B4Z A;  4P0G A;  4LQ2 A;  3IB0 A;  2PVU A;  1NFT A;  4PE5 B;  4QFO A;  5CI5 A;  2XXH A;  1ZLQ A;  2DE3 A;  1VR5 A;  3TQL A;  5CC2 A;  3B6W A;  2DXY A;  1Y4T A;  4XXU A;  4M1V A;  2F7A A;  1LFH A;  1SDX A;  5I59 B;  3QSL A;  3O6G A;  4Z7E A;  3KN3 A;  4NF6 B;  4IB2 A;  1RYO A;  4RNS A;  3PUV E;  4C1U A;  4H65 A;  3SEU A;  3S9L C;  4PFY A;  5ICT A;  3IL1 B;  3K1P A;  4JDF A;  4GFR A;  4QHQ A;  5JK4 A;  3C35 A;  3TZA A;  2Z8F A;  3VXB A;  3M3L A;  3KOS A;  3RY3 A;  3EN3 A;  1GV8 A;  3JV9 A;  1AH5 A;  2B3F A;  2NWJ A;  2REG A;  3FXR A;  4LZ7 A;  2Z8E A;  3T93 B;  2I4B A;  3TTR A;  3OO7 A;  2QRY A;  3S2V A;  3JYR A;  3EHT A;  3T66 A;  1JW1 A;  3LC8 A;  3U8Q A;  3RUM A;  4GRK A;  4QRZ A;  4OYV A;  3ECR A;  2V84 A;  4FED A;  3T9U A;  1IEJ A;  2B3B A;  4F1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...