4G68C

Biochemical and structural insights into xylan utilization by the thermophilic bacteriumcaldanaerobius polysaccharolyticus
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
392
structure length
392
Chain Sequence
ITLTFWNLFTGEPAKTKVKEIIDQWNKENPNVQIVESVTENDAYKTKIKAAIAANEAPDIFQTWAGGFSQPFVEAGKVLQLDSYLNDGTKDQLLPGSFDNVTYNGKIYGIPFDQQASVLYINKELFDKYNVKVPTTFSELIDAIKTFKSKGVTPFALGEKDEWPGMWYYDMIALREGGVQLTRDALNGKASFDNQAFTDAAQKLQDMVNAGAFDSGFMGLTRDEATAEFNQGKAAMYFGGNFDAAAFVSDPSSLVKGKIEAVRFPTIEGGKGDPTEYIGGTVGALMVSANSKYKDEAVRAAKYLAKQLSDMDYLIATGLPAWKYDNIDQSKVDPLEIQIMNNIVANAKGSVPAWDIYLSGDAAQTHKDLVAQLFAKQITPEEYSKQMQQKIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter
publication title Biochemical and Structural Insights into Xylan Utilization by the Thermophilic Bacterium Caldanaerobius polysaccharolyticus.
pubmed doi rcsb
source organism Caldanaerobius
total genus 142
structure length 392
sequence length 392
ec nomenclature
pdb deposition date 2012-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g68C01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g68C02
5ISUA 4KR5A 4F22A 3H03A 4Z0IA 5K2XA 3K2DA 3S9MC 4BDRA 4QFOA 4HCYA 3TMGA 3SEVA 1TT1A 1MPBA 4QFPA 1Y3QA 3AXFA 2QS2A 1B32A 2V93A 4ZZAA 1R6ZA 2GHBA 2Q89A 3I6VA 1D9YA 4C0RA 1P99A 4EF2A 3ECRA 5F7VA 1XS5A 3FATA 1AMFA 3UK4A 3CFXA 3PU5A 2FNCA 3HCQA 4FEDA 4ZEBA 2DWHA 4G4PA 3K0VA 5AA2B 4ZE9A 4OVJA 1IXIA 2KLFA 3RQTA 3FJGA 3KOTA 4IY5A 4OEVA 3KJTA 1WDNA 3LSXA 1LCTA 4ZEFA 5KDTA 5AA4B 1LAHE 3RNNA 1P1UA 4NF4B 4BDLA 1UIUA 2Y7KA 1B7UA 3I5OA 1VSOA 3V89B 1BIYA 1DSNA 3ILTB 5I2KB 5TPAB 3R26A 2ZYNA 4ISUA 3MPKA 2XXVA 4XIGQ 4OHNA 3HSTA 2P0SA 1JW1A 3FXRA 1B0LA 4TOZA 3RLFE 1B6HA 1IUDA 1OVTA 3N94A 2RINA 1ZIUA 3GXAA 1A8FA 5CMKA 1Y4TA 4RPNA 3IOVA 1ZTYA 3RGYA 2G93A 3A09A 1IITA 3VE1B 5CMMA 4U4XA 4F2OA 2RC8A 3CIJA 4F29A 3DP4A 3HPIA 1A8EA 4MH5A 4BDNA 1ZMGA 2X26A 1LFIA 1EZPA 1NH7A 2O1MA 2F7CA 2GRVA 1MXYA 4GLIA 4O3AA 3LSWA 1OIBA 2H98A 5JTYA 3G3GA 5M2VA 4GWOA 3GBBA 1N7XA 4U2RA 3K02A 2Y7IA 2AL5A 4R9GA 3S9EA 2P2AA 4I8CA 3OD7A 1J1NA 3FGSA 3UORA 4YB6A 2ALUA 3O9PA 3DM0A 3OSQA 2ANJA 1MM6A 4U4SA 4G2ZA 2Q9TA 1FTOA 3WAEA 3K1PA 2D3IA 2QPQA 4JBZA 1WVJA 4YZZA 4X1DA 2HFBA 2F6GA 1MXWA 2UYFA 2DSFA 3T9UA 5CI5A 4F39A 3BFUA 2QSXA 1H45A 3K6UA 1LGBC 4R9FA 1IQ7A 5I57A 4I1DA 1KWHA 3FVNA 1B3EA 1YTVA 4NF8B 1RYOA 4F3SA 5A5XB 3TAJA 4X9TA 3PUVE 5I59B 3QYTA 3RT6B 3PMWA 3CI8A 5I58A 1LAXA 1BLFA 1QKAA 1US5A 4LUBA 2O84X 3CVGA 4QSCA 4WKMA 4NWCA 3K00A 1DPPA 3O6HA 3IX1A 1MXVA 2FA7A 2V3UA 5DVIA 4ESXA 5ICTA 4O3BA 4H8IA 2ONRA 4KYDA 4FATA 4GVOA 2A5TA 2Z8DA 4KD5A 4P0IA 3I3VA 3FXUA 2D21A 2DWJA 2YLNA 3HHFA 1TXFA 1LBBA 3T22A 3IOUA 3RTWB 4F1YA 5JEIA 1LLSA 1Z7ME 3K1MA 1SW1A 4AB6A 5L9OA 4R6YA 1QW0A 1SDXA 3C31A 3H7MA 4GL0A 4H5GA 3MP6A 4RY1A 3FJMA 2F97A 3LSFB 4TLLB 4DXBA 4GXAA 3E3KA 1D9VA 1PBQA 3H6TA 3U94A 4MFIA 5JK4A 4DCYA 2VD3A 1N04A 2GH9A 1Y3NA 1GTKA 2QL3A 3EHTA 4JWOA 4R74A 4HCWA 1MDP1 3PV0E 3Q25A 4KCCA 1FTKA 2DWIA 3BKIB 3OO8A 2DP8A 4IGTA 2V3TA 5K2YA 5FHOA 3VFJA 2IEEA 1M5EA 1MDQA 4KPTA 4U21A 5F1QA 5JTYB 4P0GA 1UQWA 3FZVA 1SD3A 1USYH 1NH8A 4NF5A 3L6HA 4U1ZA 4AQ4A 2QJEA 1B7ZA 2XXRA 3PUYE 4DE8A 1FQBA 4N07A 2YPNA 4F3BA 1FQDA 4PETA 4DLDA 1MQHA 3B7DA 3B6WA 3KSXA 4BLAA 3OXNA 4F19A 1FTJA 1RYXA 3KSJA 3TCHA 3G3FA 4RYAA 3UIFA 3PPQA 3ONMA 1GGGA 2F6PA 2O7IA 2DE4A 3HN0A 5B7DA 2REJA 4IO7A 4XTCQ 3CFLA 4OQOA 3Q26A 3IB1A 5IKBA 3N26A 4RA1A 3TUSA 3T9XB 4OESA 2QMWA 2OWTA 1FQFA 2DVCA 2F35A 3QSLA 2O7UA 4EF1A 3EHUA 1B3HA 2R9JA 5H8NB 1DMBA 4RK2A 1LB8A 3K6WA 5CRYA 4KYSA 3VXCA 3UA8A 1Y9UA 1WODA 3N6UA 4OYVA 1NFTA 4ESWA 3MP1A 3TCFA 4WXJA 3O97A 2F78A 2Y84A 1MXXA 5LOMA 1Y3PA 2A5TB 3Q27A 1MQIA 3PD9A 5DEXA 4DXUA 1MM7A 3CSBA 4P11A 3IL1B 1Y4CA 2I6EA 1PEBA 5TP9A 4MLQA 2PBWA 3H06B 1SW5A 2H99A 4TLMB 1BTJA 3M3LA 4U22A 4UACA 4KQPA 4PQJA 4EXKA 1CE2A 4LP2B 1GV8A 1IXGA 4C1TA 4ZEIA 3QIMA 2PT2A 3T9HB 2V3QA 4QHQA 2F7BA 3N6TA 1N76A 3SERA 4X1BA 5CBRA 3FIRA 3K4UA 4BDOA 3OEKA 1QVSA 3OO7A 3U93A 2HAVA 2UXAA 1USYE 3PUXE 1I69A 4EDPA 3KGCA 4MLVA 5DYHA 1YCJA 4IO6A 1HSJA 4MBPA 2I4CA 3VDFA 3MPLA 1DPEA 3QK6A 1M5DA 4C1UA 2NVUB 4GRKA 1NKXA 5KCJB 3TTLA 3VLWA 4XKRA 1P1QA 4UA8A 4QSDA 1NNKA 1AIVA 3OO6A 4G8MA 1IZ1A 3MQ9A 4G77A 3S2VA 3SEXA 1LFHA 5H8SA 3PPRA 1I6BA 2XX9A 2XXQA 1UTBA 1ZBMA 4ND9A 1Z7NE 5H8QA 1QUJA 1UTHB 5AE4A 5IAIA 4RJZA 3RTFB 3M3FA 4ZEDA 2OCUA 5ELVA 2ZYMA 2OZZA 4WEDA 1B46A 4JWXA 5KZTA 4XKPA 5I56A 5L9SA 4XXUA 4NE4A 4R73A 5I2NA 1QUIA 3T66A 3TKDA 1SQYA 3MW0A 1XHYA 3LBSA 1DTZA 2DVZA 4LZ8A 2RKMA 3TYHA 2HAUA 1QUKA 2X7QA 4JSOA 3C35A 3MZBA 4H6DA 1XVYA 4GFRA 1B1XA 2XXIA 3KOSA 3RN8A 3W9WA 1LAFE 4FEBA 4YAHX 1OQGA 3OO9A 4ZS9A 1SW2A 1TFDA 2A5SA 1YPNA 1T0KA 4PFTA 3V5AA 3C36A 3O29A 1MG1A 4H1XA 5ITOA 2ZNSA 2B3FA 1I6AA 1POY1 2DS9A 2QS4A 5FHNA 4QRZA 3H6UA 2V84A 3T96B 4LA9A 2XXPA 2DXRA 2XXXA 4NTLA 2I0BA 1I6QA 4PP0A 4F3PA 4IO2A 1HSLA 4KYEA 1II5A 3MUQA 2GFEA 3SESA 3TQWA 5HPQA 2Q2CA 5CBSA 5DEXB 1B0HA 3T93B 3VV5A 1H76A 1JETA 3Q29A 4YKKA 3EPEA 2G29A 3HO7A 3HHGA 2DQVA 2Z22A 1A55A 3PGFA 2VHAA 1URSA 2RCBA 4IB2A 4RNSA 5TP9B 3VLVA 4H5FA 1N3WA 4FJPA 4LATA 2OBGA 1EU8A 1LBCA 3MVWA 4R2BA 3M8UA 1ZJLA 1Q35A 3K01A 3JZJA 1DTGA 2F5XA 1H44A 4OFLA 3U92A 2E0SA 2PMSA 3M3KA 4N6PA 4R72A 4F31B 4RXLA 1JW4A 2ZNTA 3H6WA 1VFDA 3G3JA 3ZKKA 5AA1A 1SI0A 2WKYA 2Y7WA 4YMAA 2QS1A 3R7XA 4IY6A 2UVHA 3OEMA 1A54A 4EQ9A 1SYIA 3MVYA 1B2HA 3OELA 2ZMBA 4F1UA 1B1HA 4OTEA 3O6GA 1FQEA 1XC1A 3L6GA 1BP5A 1B9JA 5KDTB 4EXLA 5EHSA 3RUMA 5FHMA 3QUJA 1PDAA 2V25A 3C33A 3H6VA 3BBRA 1MY3A 4KCDA 5H8HA 3TTNA 4XKNA 4QFKA 5H8FA 2GHAA 1IXHA 2LAOA 3HV1A 2ZYOA 4YU0A 1YAEA 3KG2A 2UYEA 1BKAA 3G3HA 4R6HA 2XD3A 3PMVA 4JWYA 4OERA 4M1VA 3O66A 4E0XA 4YKIA 3FXQA 3TTMA 1LAGE 4ELPA 2DE3A 2HXWA 2O69A 2XHDA 3MJNA 2UVGA 1EZ9A 3TTKA 4QFNA 4LQ2A 4U1OA 2I0CA 1SI1A 3TTRA 1EH3A 5AA2A 1P1NA 2F34A 4R2FA 1B4ZA 1O64A 2VGQA 3C4MA 3CR9A 4LONB 4RK9A 5DVJA 2CZLA 1O63A 4F3GA 1NMUA 4H67A 1AH5A 3CSGA 1MQGA 1PBPA 3O28A 5TU0A 2XXUA 4M4GA 4FORA 5AA4A 2Y7RA 1OMPA 4BDQA 3E4RA 4GOTA 4H8JA 2NUVA 2Z8FA 3JV9A 1MS7A 3GBAA 2REGA 3S4UA 1MQDA 1B4HA 2BJJX 1JQFA 4KHZE 4L17A 3F11A 1N0TA 2RCAA 1S7YA 4G68A 5I2KA 1MY2A 4IO4A 2F8DA 4H65A 5TPAA 4BDMA 1URGA 2DE2A 3IR1A 2DXYA 3TCGA 1OVBA 4OZ9A 3MZ1A 3N5LA 1ATGA 5I57B 3KZGA 3MZ9A 4GD5A 4FECA 4HTGA 3IOWA 4YB7A 1Y1ZA 1O7TA 1CB6A 5I58B 3FASA 1IXCA 4HW8A 5DVFA 3MVZA 2DYXA 2ESNA 3G7WA 1B05A 3IJXB 1UIVA 4GQOA 1XVXA 1VFEA 1QULA 3G3KA 1FTMA 4ONYA 5ICQA 4Q30B 1D3KA 1PC3A 1MH3A 4I62A 2XXHA 3U8QA 1JVYA 1TFAA 3RPWA 1Y1MA 4PFUA 3C32A 4NWDA 4Q5TA 3TDJA 3PUZE 1OLCA 2IA4A 1AL3A 3PPPA 1JEUA 1JVXA 3KFMA 4G8NA 1NNTA 3ILUB 3G3IA 3IB2A 1B3FA 1B7HA 1FTLA 1EZOA 1M5FA 4ELRA 1QJMA 1MY1A 3SEYA 1A40A 3D4GA 1B51A 3DELB 4IO5A 4MF3A 5CMCA 2PX1A 4X48A 1MPDA 2RC9A 2ONSA 3THIA 1ZU0A 4KFQA 2NWJA 1MXZA 5AA2D 4R75A 3EQ1A 3C34A 4F18A 3VVDA 4Q0CA 2DOJA 1B3GA 3UGWA 3FVGA 1S9TA 4NF8A 2RF1A 5A5XA 2ZYKA 2H4IA 2Z23A 5I59A 2ONKE 3C9HA 4ELOA 1SBPA 1SW4A 1R9QA 3TQLA 3EHSA 3FD3A 4F1VA 2CMOA 2F36A 1B40A 3DP6A 2E1SA 3W9VA 3KN8A 4U23A 4NF5B 1F9BA 4O3CA 3BFTA 5BWJA 3IK6B 1M5CA 3O2AA 5CC2A 1IEJA 3PMXA 2HZKA 2D5WA 2M8CA 5CM6A 1MH4A 2XXWA 4ECFA 2O6AA 1JW5A 2PVUA 3KEIA 3LC8A 3FV1A 4FIMA 5ITPA 4RPOA 2I58A 4FAJA 3K1NA 3FV2A 3K6VA 2Q8JA 4HS7A 3V83A 3FUZA 2I48A 4QFLA 3MC2A 4G68B 2F7AA 4JB7A 1JEVA 4Q8RA 4I9DA 2OLBA 4IO3A 3EN3A 3QXMA 2O1LA 4R6KA 5I84A 1ZLQA 3USDA 4YICA 4NF6A 3T9VA 2YJPA 1IIWA 3VLUA 2HZLA 4K3FA 2OWSA 2XX7A 4DCXA 4GXSB 1LB9A 3KN3A 2FYIA 4LQ5A 3WAFA 3CRBA 1B5JA 3PPOA 2H25A 2ZNUA 3LR1A 4YKJA 3IAZA 5DTBA 5BUUA 2HEUA 3CFZA 3OMBA 5HBCA 3LUYA 3TEPA 2RC7A 1NNPA 3P7IA 2UVIA 2QS3A 1P1WA 2I49A 4YKPA 2B65A 4GIZA 1ZKBA 3PUWE 3IOTA 2O68A 3H3GA 4LVQA 4PE5B 3RY3A 3A3CA 5L8DA 1HSEA 4Z7EA 2PT1A 1FQAA 1S50A 3IO6A 4DDDA 4OFOA 4EUOA 5FTIA 3SETA 3ZSFA 3IJOB 3IB0A 4ZEKA 2VOZA 3GLBA 4ZDMA 3KJ7A 1DOTA 1MPCA 1N84A 3MAMA 2H9BA 1B58A 4TQUQ 4PFWA 3EF7A 3FVKA 1US4A 4JSDA 1TWYA 1URDA 4G68C 3GZGA 4QSEA 1H3DA 1B3LA 3Q28A 1NL5A 1R9LA 3IO4A 5J1DA 2XXYA 3S9NC 4POWA 3D4CA 2ZXTA 1NNFA 2I3WA 1GVCA 5L9MA 3E9XA 4YMBA 2R6GE 4N13A 3UN6A 2O51A 3VVEA 3JYRA 1M5BA 5H8NA 1JNFA 1VR5A 2AL4A 3MBPA 3QAXA 2Y7PA 2QRYA 4OEUA 1FW0A 5AA3A 4EQBA 2UVJA 1R1NA 3V8XB 3IORA 3MP8A 1MQJA 4NMYA 5B70A 2ABHA 2H5YA 1OQHA 3ODBA 1Y20A 1UTBB 5H8QB 3R6UA 1N7WA 2P1SA 2THIA 3TPAA 2X7PA 1PB8A 3OOAA 3TFLA 2Q88A 4EQ7A 5I56B 1OLAA 3E13X 1N3XA 2Q2AA 1GR2A 5I2NB 2HCAA 4YB5A 1MXUA 3LSLA 4NF6B 3H4ZA 4ZECA 4KI0E 4E0WA 1LCFA 1LFGA 2NOOA 3KN7A 3TZAA 2DWAA 4OXVA 1B5HA 1ANFA 3B6TA 3SEUA 2I4BA 3DP8A 1XOCA 4GL8A 2R71A 2B3BA 2VP1A 4LZ5A 4QF9A 4XKQA 1AOVA 2XD2A 3OENA 4OFJA 1P1OA 2QMXA 4JDFA 5EYFA 2XXTA 3SKPA 3SEWA 4OENA 5KCJA 3VXBA 1B52A 3QUFA 2HQ0A 1POTA 1MY0A 3PPNA 3TODA 1PB9A 4DZ1A 3FVOA 4POXA 1H43A 3SDFA 5CMBA 4NF4A 1VE4A 3MWBA 1FCKA 3TELA 1MRPA 5FTHA 4PFYA 2OJTA 3MVXA 1UTHA 4FE8A 1L5TA 4NEDA 5DT6A 3UP9A 1FQCA 4AB5A 1PB7A 4JXIA 1ELJA 4DXCA 1XT8A 4WEPA 4H0WA 4G8HA 3O6IA 4ZE8A 5HM4B 2VD2A 3RT8A 1SVXB 1SYHA 2OK2A 3OSRA 4LZ7A 4GF8A 1LSTA 3W15C 1Q1KA 3ZS6A 4F2QA 4THIA 1QKBA 3CG1A 3PD8A 3U1OA 4DIGA 2W7YA 1D4NA 1A99A 2PYYA 1RKMA 3K6XA 4OETA 5EHMA 3VVFA 3ZKLA 3FJ7A 4OMBA 3CG3A 4IGRA 4OWDA 1B5IA 3DLNA 3U72A 1MY4A 1A7LA 2AYSA 2NXOA 3B6QA 3S9LC 3KBRA 4ELQA 2AIXA 3A3UA 5H8HB 2Z8EA 2I3VA 5H8FB 2XX8A 4ZZEA
chains in the Genus database with same CATH superfamily
5ISUA 4KR5A 4F22A 3H03A 4Z0IA 4P8BA 5K2XA 3K2DA 3S9MC 4BDRA 4QFOA 4HCYA 3TMGA 3SEVA 1TT1A 1MPBA 4QFPA 1Y3QA 3AXFA 1K9YA 2QS2A 1B32A 2V93A 4ZZAA 1R6ZA 3GYYA 2GHBA 2Q89A 3I6VA 1D9YA 4C0RA 5ET5A 1P99A 3NOHA 4EF2A 3ECRA 5F7VA 1XS5A 3FATA 1AMFA 4PDDA 3B8BA 3UK4A 3CFXA 3PU5A 2FNCA 2QVRA 4O94A 4GBWA 3HCQA 4FEDA 4ZEBA 4GBVA 2DWHA 1FBGA 4G4PA 3K0VA 5AA2B 4ZE9A 4OVJA 1NUYA 1IXIA 2KLFA 3KC0A 3RQTA 3FJGA 3KOTA 4IY5A 4N8YA 1G0IA 4OEVA 3KJTA 1WDNA 3LSXA 4OVTA 1LCTA 4ZEFA 5KDTA 5AA4B 1LAHE 3RNNA 1P1UA 1LBYA 2FIXA 4NF4B 4MNCA 4BDLA 1UIUA 2Y7KA 1B7UA 3I5OA 1VSOA 3V89B 1BIYA 1DSNA 3ILTB 5I2KB 3CHGA 5TPAB 3R26A 2ZYNA 4ISUA 3MPKA 2XXVA 4XIGQ 4OHNA 3HSTA 2P0SA 1JW1A 3FXRA 1B0LA 4TOZA 3RLFE 1IMFA 1B6HA 1IUDA 1OVTA 3N94A 2RINA 1ZIUA 3GXAA 4N81A 1A8FA 5CMKA 1Y4TA 4RPNA 3IOVA 4PBHA 3FXBA 1ZTYA 3RGYA 1NV7A 2G93A 3A09A 4PC9A 1IITA 3VE1B 5CMMA 4U4XA 5IM2A 2HXRA 4F2OA 2RC8A 3CIJA 4F29A 1KZ8A 1VDWA 3DP4A 3HPIA 1A8EA 4MH5A 1K9ZA 4BDNA 5IZ3A 1ZMGA 1XI6A 2X26A 1LFIA 1EZPA 1NH7A 2O1MA 2F7CA 2GRVA 1MXYA 4G61A 4GLIA 4O3AA 3LSWA 4PCDA 1OIBA 2H98A 5JTYA 3G3GA 5M2VA 4GWOA 3GBBA 1N7XA 4U2RA 3K02A 2Y7IA 2AL5A 4R9GA 3S9EA 2P2AA 4I8CA 3OD7A 1J1NA 3FGSA 3UORA 5I5PA 4YB6A 2ALUA 3O9PA 4PE3A 3DM0A 3OSQA 2ANJA 1MM6A 4U4SA 4G2ZA 2Q9TA 4PFBA 1FTOA 4PDHA 3WAEA 3K1PA 2D3IA 2QPQA 4JBZA 4AS5A 4KXPA 1WVJA 3ROJA 4GWZA 2FIEA 4YZZA 2GQ1A 4X1DA 2HFBA 2F6GA 1IMCA 1MXWA 2UYFA 2DSFA 3T9UA 5CI5A 4F39A 4N8GA 3BFUA 2XA5A 2CZIA 4PTKA 2QSXA 1H45A 3K6UA 1LGBC 4R9FA 1IQ7A 5I57A 4I1DA 1KWHA 3FVNA 1B3EA 1YTVA 4NF8B 1RYOA 4F3SA 3E78A 5A5XB 4I3EA 3TAJA 4X9TA 3PUVE 5I59B 3QYTA 3RT6B 3PMWA 3CI8A 5I58A 1LAXA 1BLFA 1QKAA 1US5A 4LUBA 2O84X 3CVGA 4QSCA 4WKMA 4NWCA 3K00A 1DPPA 3O6HA 3IX1A 1MXVA 1YXIA 2FA7A 2V3UA 5DVIA 4MJOA 4ESXA 5ICTA 4GWYA 4O3BA 4H8IA 2ONRA 4KYDA 4FATA 4GVOA 2A5TA 2Z8DA 4KD5A 4P0IA 3I3VA 3FXUA 2D21A 1NV6A 2DWJA 2VPOA 2YLNA 3HHFA 1TXFA 1LBBA 3T22A 3IOUA 3RTWB 4F1YA 5JEIA 1LLSA 3K1MA 1Z7ME 2QFLA 1SW1A 4AB6A 5L9OA 4R6YA 1QW0A 1SDXA 3C31A 3H7MA 4GL0A 2KR0A 4H5GA 3MP6A 4N6DA 4RY1A 3FJMA 2F97A 4OVSA 1FPBA 1EYIA 3LSFB 1D9QA 1FPGA 4TLLB 4DXBA 4GXAA 3E3KA 1D9VA 1PBQA 3H6TA 3U94A 4MFIA 5JK4A 4DCYA 2VD3A 1N04A 2GH9A 3MSTA 1Y3NA 1GTKA 2QL3A 3EHTA 4JWOA 4R74A 4HCWA 1MDP1 2MKZA 3PV0E 3Q25A 4KCCA 3B50A 1FTKA 2DWIA 1LBWA 3BKIB 4JVIA 3OO8A 2DP8A 4IGTA 2V3TA 5K2YA 4O8MA 5FHOA 3VFJA 1LEVA 2IEEA 1M5EA 1MDQA 4KPTA 4U21A 5F1QA 3BIGA 5JTYB 4P0GA 1UQWA 3FZVA 1SD3A 1USYH 1NH8A 4NF5A 3L6HA 4U1ZA 3U65A 4AQ4A 3PTYA 2QJEA 1B7ZA 2XXRA 3PUYE 4DE8A 1FQBA 4N07A 2YPNA 4F3BA 1FQDA 4PETA 4NX1A 4DLDA 1MQHA 3B7DA 3B6WA 1FBHA 3KSXA 4BLAA 4GWUA 3OXNA 4F19A 1FBPA 1FTJA 1RYXA 2PCRA 3KSJA 4MCOA 3TCHA 3G3FA 4HE2A 4RYAA 3UIFA 5EQ9A 3PPQA 3ONMA 1GGGA 4P9KA 2F6PA 2O7IA 2DE4A 3HN0A 5B7DA 2REJA 4IO7A 4XTCQ 3CFLA 4OQOA 1FJ9A 3Q26A 3IB1A 1YYZA 4OA4A 5IKBA 4MX6A 4GX4A 3N26A 4RA1A 2Q8MA 3T9XB 3TUSA 4OESA 2QMWA 2OWTA 1NUZA 1FQFA 1FSAA 2DVCA 2F35A 3QSLA 2O7UA 5T3JA 4EF1A 3EHUA 1B3HA 2R9JA 5H8NB 1DMBA 4RK2A 1LB8A 4N17A 3K6WA 1DBZA 5EQ8A 5CRYA 4KYSA 3VXCA 4OVRA 3UA8A 1Y9UA 1WODA 3N6UA 4OYVA 1NFTA 4ESWA 3MP1A 3TCFA 4WXJA 3O97A 2F78A 2Y84A 1MXXA 5LOMA 1Y3PA 2A5TB 3Q27A 1MQIA 3PD9A 3A29A 5DEXA 4DXUA 1MM7A 3CSBA 4P11A 1DCUA 3IL1B 1Y4CA 2I6EA 1PEBA 5TP9A 4MLQA 4P3LA 4HE1A 2PBWA 3H06B 1SW5A 2H99A 4TLMB 1BTJA 1FBEA 3M3LA 4U22A 4UACA 4KQPA 4PQJA 5ESYA 4EXKA 2WBBA 1CE2A 4LP2B 1GV8A 1IXGA 4C1TA 4ZEIA 3QIMA 2PT2A 3T9HB 2V3QA 4QHQA 2F7BA 3N6TA 1N76A 3SERA 4X1BA 4XEQA 5CBRA 3FIRA 3K4UA 4BDOA 3OEKA 5EQAA 1QVSA 3OO7A 3U93A 2HAVA 2UXAA 1USYE 2B4LA 3PUXE 1I69A 4EDPA 3KGCA 4MLVA 5DYHA 1YCJA 4IO6A 1HSJA 4MBPA 3RYDA 2I4CA 1NV1A 3MPLA 3VDFA 1DPEA 3QK6A 1M5DA 2FVZA 4C1UA 2NVUB 4GRKA 1NKXA 5KCJB 3TTLA 3VLWA 4XKRA 1P1QA 4UA8A 4QSDA 1NNKA 1AIVA 3OO6A 2JJKA 4G8MA 1IZ1A 3MQ9A 4G77A 3S2VA 3SEXA 4FBPA 1LBVA 1LFHA 5H8SA 3PPRA 1I6BA 2XX9A 2XXQA 1UTBA 1ZBMA 4ND9A 1Z7NE 5H8QA 4PAFA 1QUJA 1UTHB 1G0HA 5AE4A 5IAIA 2PFYA 4RJZA 2XWKA 1FBDA 3RTFB 3M3FA 4ZEDA 2KQZA 2OCUA 5ELVA 2WYPA 4PBQA 2ZYMA 2OZZA 4WEDA 2VT5A 1B46A 4JWXA 5KZTA 4XKPA 5I56A 5L9SA 4XXUA 4NE4A 4R73A 5I2NA 1QUIA 3T66A 3TKDA 1SQYA 3MW0A 3BIHA 1XHYA 3LBSA 1DTZA 2DVZA 4LZ8A 2RKMA 3TYHA 2HAUA 1QUKA 2X7QA 4JSOA 4JVCA 3C35A 1FPJA 4NF0A 3MZBA 4H6DA 1XVYA 4GFRA 1B1XA 2ZZXA 2XXIA 3KOSA 3RN8A 3W9WA 1LAFE 4FEBA 4YAHX 1OQGA 3OO9A 4ZS9A 2FHYA 1QGXA 1SW2A 1TFDA 5ET6A 1YPNA 2A5SA 1T0KA 4PFTA 1IMBA 3V5AA 2B4MA 3C36A 1MG1A 3O29A 4H1XA 5ITOA 2ZNSA 2B3FA 1I6AA 1POY1 2DS9A 2QS4A 5FHNA 4QRZA 3H6UA 2V84A 3T96B 4LA9A 4AS4A 2XXPA 2DXRA 2HPGA 2XXXA 4NTLA 2I0BA 1I6QA 4X04A 4PP0A 4F3PA 4QXDA 4IO2A 1HSLA 4KYEA 4PGPA 1II5A 3MUQA 2GFEA 2CZHA 3SESA 3TQWA 1CNQA 5HPQA 2Q2CA 5CBSA 5DEXB 1B0HA 3T93B 3VV5A 1H76A 1JETA 3Q29A 4YKKA 3EPEA 2G29A 3HO7A 3HHGA 2DQVA 2Z22A 1A55A 3PGFA 2VHAA 1URSA 2RCBA 4IB2A 4RNSA 5TP9B 3VLVA 4H5FA 1N3WA 2WX9A 4PF6A 4FJPA 4LATA 2OBGA 4GX6A 1EU8A 1LBCA 3MVWA 1RDYA 1NV0A 4R2BA 3M8UA 1ZJLA 1Q35A 3K01A 3JZJA 1DTGA 2F5XA 1H44A 4OFLA 3U92A 2E0SA 2PMSA 4P1LA 3M3KA 4N6PA 4R72A 4F31B 4RXLA 1JW4A 2ZNTA 3H6WA 1VFDA 3G3JA 2P3VA 3ZKKA 5AA1A 1SI0A 2WKYA 2Y7WA 4YMAA 2QS1A 3R7XA 4IY6A 2UVHA 3OEMA 1A54A 4EQ9A 1SYIA 3MVYA 1B2HA 3OELA 2ZMBA 4F1UA 1B1HA 1FPIA 4OTEA 3O6GA 4DI4B 1FQEA 1XC1A 3L6GA 1BP5A 4JVDA 1B9JA 5KDTB 4EXLA 5EHSA 3RUMA 4XF5A 5FHMA 3QUJA 4P47A 1PDAA 3RPLA 2V25A 3C33A 4GX3A 3H6VA 3BBRA 1MY3A 5IZ1A 5ET8A 4KCDA 5H8HA 3TTNA 4XKNA 4QFKA 5H8FA 2GHAA 1IXHA 2LAOA 3HV1A 2ZYOA 4YU0A 1YAEA 3KG2A 2UYEA 1BKAA 3G3HA 4R6HA 2XD3A 3PMVA 4JWYA 4OERA 4M1VA 5IZZA 3O66A 2Y5LA 4E0XA 4YKIA 3FXQA 3TTMA 1LAGE 4ELPA 2DE3A 2HXWA 2O69A 2XHDA 3MJNA 2UVGA 1EZ9A 1DK4A 2WBDA 1BK4A 3TTKA 4QFNA 4LQ2A 4U1OA 2I0CA 4IR8A 5IZ3B 1SI1A 3LV0A 3E79A 4GWWA 1LBZA 3TTRA 1EH3A 5AA2A 1P1NA 3KBZA 2F34A 4R2FA 1B4ZA 1O64A 2VGQA 3C4MA 3CR9A 4LONB 4RK9A 5DVJA 1FPKA 2CZLA 2WYKA 1O63A 2ZZWA 4F3GA 1NMUA 4H67A 1AH5A 3CSGA 1JP4A 1MQGA 4PF8A 1PBPA 3O28A 3EKIA 5TU0A 2XXUA 4M4GA 4FORA 2Y7RA 5AA4A 1OMPA 4MHFA 4BDQA 3E4RA 4GOTA 4H8JA 2NUVA 2Z8FA 3JV9A 1MS7A 5FBPA 3GBAA 2REGA 3S4UA 5ET7A 1MQDA 1B4HA 2BJJX 1JQFA 4KHZE 4LN5A 4L17A 3F11A 1N0TA 2RCAA 1S7YA 4G68A 5I2KA 1MY2A 4IO4A 2F8DA 4H65A 5TPAA 4BDMA 1FPFA 1NV4A 1URGA 2DDKA 2DE2A 1NUWA 3IR1A 2DXYA 1OVBA 3TCGA 4OZ9A 3MZ1A 3N5LA 1ATGA 5I57B 3KZGA 3MZ9A 4HXVA 4N6KA 4GD5A 4FECA 4HTGA 3IOWA 5I7IA 2CEYA 4YB7A 1Y1ZA 1O7TA 1CB6A 4GWXA 5I58B 3FASA 1IXCA 4HW8A 5DVFA 1YZ0A 4I40A 3MVZA 2DYXA 2ESNA 3G7WA 4N4UA 1B05A 3IJXB 1UIVA 4GQOA 1XVXA 1VFEA 1QULA 3G3KA 1FTMA 4ONYA 5ICQA 4Q30B 1D3KA 1PC3A 1MH3A 4I62A 4N91A 3QMFA 2XXHA 3U8QA 1JVYA 1TFAA 3RPWA 1Y1MA 4PFUA 3C32A 4NWDA 4Q5TA 3TDJA 3PUZE 1NV2A 1OLCA 2IA4A 1AL3A 3PPPA 1JEUA 1JVXA 3KFMA 4G8NA 1NNTA 3ILUB 3RPLB 1FPDA 3G3IA 3IB2A 5EYGA 1B3FA 2Q74A 5J16A 1B7HA 1FTLA 1EZOA 1M5FA 4ELRA 1QJMA 1MY1A 3SEYA 1A40A 3D4GA 1B51A 4H46A 3DELB 1FJ6A 4IO5A 4MF3A 5CMCA 2PX1A 4X48A 1MPDA 2F3DA 2RC9A 2ONSA 5LDZA 3THIA 1ZU0A 4KFQA 2NWJA 1MXZA 5AA2D 4R75A 4PAKA 3EQ1A 3C34A 4F18A 3VVDA 4Q0CA 2DOJA 1B3GA 3UGWA 2XXKA 3FVGA 1KA1A 1S9TA 4NF8A 2RF1A 1FBFA 3HFUA 2BJIA 5A5XA 2ZYKA 1INPA 2H4IA 2Z23A 1IMEA 5I59A 2ONKE 4MMPA 3C9HA 4ELOA 1SBPA 1SW4A 1R9QA 3TQLA 3EHSA 3FD3A 4F1VA 2CMOA 2F36A 1B40A 3DP6A 2E1SA 3W9VA 4GWSA 2CEXA 1FTAA 2PFZA 3KN8A 4U23A 4NF5B 1F9BA 5EQ7A 4O3CA 3BFTA 5BWJA 3IK6B 1M5CA 3O2AA 5CC2A 1IEJA 3PMXA 2HZKA 2D5WA 2M8CA 5CM6A 3D1RA 1MH4A 2XXWA 4ECFA 2O6AA 1JW5A 2PVUA 3KEIA 3LC8A 3FV1A 4FIMA 5EYHA 5ITPA 4RPOA 2I58A 4FAJA 3K1NA 1EYKA 3FV2A 4PGNA 3K6VA 2Q8JA 4HS7A 3V83A 3FUZA 2I48A 4QFLA 3MC2A 1NUXA 4G68B 2F7AA 4JB7A 1JEVA 4Q8RA 4I9DA 2OLBA 4IO3A 3EN3A 3QXMA 2O1LA 4R6KA 2QVUA 1NV3A 5I84A 1ZLQA 3USDA 4YICA 4NF6A 3T9VA 2YJPA 1IIWA 3VLUA 5LTCA 4HE0A 2HZLA 4OVPA 3MYUA 4K3FA 2OWSA 2XX7A 3ISPA 4DCXA 4P1EA 4GXSB 1IMDA 1LB9A 4NGUA 3KN3A 2FYIA 4LQ5A 3WAFA 3CRBA 1B5JA 3PPOA 2H25A 2ZNUA 3LR1A 4YKJA 4P56A 3IAZA 5DTBA 5BUUA 2HEUA 3CFZA 4QBAA 1EYJA 3OMBA 4MEVA 5HBCA 3LUYA 3TEPA 2RC7A 3LUZA 1NNPA 3P7IA 2UVIA 2QS3A 1P1WA 2I49A 4YKPA 2B65A 4GIZA 1ZKBA 3PUWE 3IOTA 2O68A 3H3GA 4LVQA 4PE5B 1FPLA 3RY3A 1RDZA 3KC1A 3A3CA 1FBCA 5L8DA 1HSEA 4I3YA 4Z7EA 2PT1A 1FQAA 1S50A 2P3NA 3IO6A 4DDDA 4OFOA 4EUOA 4X8RA 5FTIA 2OWZA 3SETA 2Y5KA 3ZSFA 3IJOB 3IB0A 4ZEKA 5IGAA 1Q9DA 2VOZA 3GLBA 4ZDMA 2CZKA 3KJ7A 1SPIA 2WEFA 1DOTA 1MPCA 1N84A 3MAMA 2ZZVA 2H9BA 1B58A 4TQUQ 4PFWA 3EF7A 1FPEA 3FVKA 1US4A 4JSDA 1TWYA 4N15A 1URDA 4H45A 2XWOA 4G68C 3GZGA 4QSEA 1H3DA 1B3LA 3Q28A 1NL5A 1R9LA 3IO4A 3T0JA 5J1DA 2XXYA 3S9NC 4POWA 1NI9A 3D4CA 2ZXTA 1NNFA 2F3BA 2HHMA 2I3WA 1GVCA 4PAIA 5L9MA 3E9XA 4YMBA 2L5VA 2R6GE 4N13A 3UN6A 2O51A 3VVEA 3JYRA 1M5BA 5H8NA 1JNFA 1VR5A 1RDXA 2AL4A 3MBPA 3QAXA 2Y7PA 2QRYA 4OEUA 3T1BA 1FW0A 5AA3A 4EQBA 2UVJA 1R1NA 3V8XB 3IORA 3MP8A 1MQJA 2R8TA 4NMYA 5B70A 2ABHA 5DW8A 2H5YA 1OQHA 3ODBA 1Y20A 1UTBB 4MNIA 5H8QB 4UABA 3R6UA 4PFRA 1N7WA 2P1SA 2THIA 4PFIA 2X7PA 1PB8A 3TPAA 4NN3A 3OOAA 4NG7A 3TFLA 1AWBA 4DI3D 2Q88A 4EQ7A 2XWIA 5I56B 1OLAA 3E13X 4O7MA 1N3XA 2Q2AA 1GR2A 5I2NB 2HCAA 4YB5A 1MXUA 3LSLA 3SZPA 4NF6B 3H4ZA 4ZECA 4KI0E 4E0WA 1LCFA 1LFGA 2NOOA 3KN7A 3TZAA 2DWAA 4OXVA 1B5HA 1ANFA 3B6TA 1LBXA 4O7IA 5A5LA 3FBPA 3SEUA 2I4BA 3DP8A 1XOCA 4GL8A 2R71A 2B3BA 2VP1A 5I3SA 4LZ5A 4QF9A 4XKQA 1AOVA 2XD2A 3OENA 4OFJA 1P1OA 2QMXA 4JDFA 5EYFA 2XXTA 3SKPA 3SEWA 4OENA 5KCJA 3VXBA 1B52A 3QUFA 2HQ0A 1POTA 1MY0A 3PPNA 4OVQA 3TODA 1PB9A 4DZ1A 3FVOA 4POXA 1IMAA 1H43A 3SDFA 5CMBA 4NF4A 1VE4A 3MWBA 1FCKA 3TELA 1MRPA 5FTHA 4PFYA 2OJTA 3MVXA 1UTHA 4FE8A 1L5TA 2QVVA 4NEDA 5DT6A 3UP9A 1FQCA 4AB5A 1PB7A 4JXIA 1ELJA 4DXCA 1XT8A 4MNPA 2FBPA 4WEPA 4H0WA 4G8HA 4MIJA 3O6IA 4ZE8A 5HM4B 2VD2A 3RT8A 1SVXB 1SYHA 2OK2A 5F24A 3OSRA 4LZ7A 4GF8A 1FRPA 1LSTA 3W15C 2XWVA 1Q1KA 3ZS6A 4F2QA 4NHBA 4THIA 1QKBA 3CG1A 3PD8A 3U1OA 4DIGA 2W7YA 1D4NA 1A99A 2PYYA 2VPNA 1RKMA 3K6XA 4OETA 5EHMA 3VVFA 3ZKLA 3FJ7A 4OMBA 3CG3A 4IGRA 4OWDA 1B5IA 3DLNA 3U72A 4OANA 4XFEA 1MY4A 4NQ8A 1A7LA 2AYSA 2NXOA 4MAGA 3B6QA 3IFCA 3S9LC 3KBRA 2V4CA 4NAPA 4ELQA 2AIXA 3A3UA 1NV5A 2Z8EA 5H8HB 2I3VA 1KA0A 5H8FB 2XX8A 2OX3A 4ZZEA 3IFAA
chains in the Genus database with same CATH topology
5ISUA 4KR5A 4F22A 3H03A 4Z0IA 5K2XA 3K2DA 3S9MC 4BDRA 4QFOA 4HCYA 3TMGA 3SEVA 1TT1A 1MPBA 4QFPA 1Y3QA 3AXFA 2QS2A 1B32A 2V93A 4ZZAA 1R6ZA 2GHBA 2Q89A 3I6VA 1D9YA 4C0RA 1P99A 4EF2A 3ECRA 5F7VA 1XS5A 3FATA 1AMFA 3UK4A 3CFXA 3PU5A 2FNCA 3HCQA 4FEDA 4ZEBA 2DWHA 4G4PA 3K0VA 5AA2B 4ZE9A 4OVJA 1IXIA 2KLFA 3RQTA 3FJGA 3KOTA 4IY5A 4OEVA 3KJTA 1WDNA 3LSXA 1LCTA 4ZEFA 5KDTA 5AA4B 1LAHE 3RNNA 1P1UA 4NF4B 4BDLA 1UIUA 2Y7KA 1B7UA 3I5OA 1VSOA 3V89B 1BIYA 1DSNA 3ILTB 5I2KB 5TPAB 3R26A 2ZYNA 4ISUA 3MPKA 2XXVA 4XIGQ 4OHNA 3HSTA 2P0SA 1JW1A 3FXRA 1B0LA 4TOZA 3RLFE 1B6HA 1IUDA 1OVTA 3N94A 2RINA 1ZIUA 3GXAA 1A8FA 5CMKA 1Y4TA 4RPNA 3IOVA 1ZTYA 3RGYA 2G93A 3A09A 1IITA 3VE1B 5CMMA 4U4XA 4F2OA 2RC8A 3CIJA 4F29A 3DP4A 3HPIA 1A8EA 4MH5A 4BDNA 1ZMGA 2X26A 1LFIA 1EZPA 1NH7A 2O1MA 2F7CA 2GRVA 1MXYA 4GLIA 4O3AA 3LSWA 1OIBA 2H98A 5JTYA 3G3GA 5M2VA 4GWOA 3GBBA 1N7XA 4U2RA 3K02A 2Y7IA 2AL5A 4R9GA 3S9EA 2P2AA 4I8CA 3OD7A 1J1NA 3FGSA 3UORA 4YB6A 2ALUA 3O9PA 3DM0A 3OSQA 2ANJA 1MM6A 4U4SA 4G2ZA 2Q9TA 1FTOA 3WAEA 3K1PA 2D3IA 2QPQA 4JBZA 1WVJA 4YZZA 4X1DA 2HFBA 2F6GA 1MXWA 2UYFA 2DSFA 3T9UA 5CI5A 4F39A 3BFUA 2QSXA 1H45A 3K6UA 1LGBC 4R9FA 1IQ7A 5I57A 4I1DA 1KWHA 3FVNA 1B3EA 1YTVA 4NF8B 1RYOA 4F3SA 5A5XB 3TAJA 4X9TA 3PUVE 5I59B 3QYTA 3RT6B 3PMWA 3CI8A 5I58A 1LAXA 1BLFA 1QKAA 1US5A 4LUBA 2O84X 3CVGA 4QSCA 4WKMA 4NWCA 3K00A 1DPPA 3O6HA 3IX1A 1MXVA 2FA7A 2V3UA 5DVIA 4ESXA 5ICTA 4O3BA 4H8IA 2ONRA 4KYDA 4FATA 4GVOA 2A5TA 2Z8DA 4KD5A 4P0IA 3I3VA 3FXUA 2D21A 2DWJA 2YLNA 3HHFA 1TXFA 1LBBA 3T22A 3IOUA 3RTWB 4F1YA 5JEIA 1LLSA 1Z7ME 3K1MA 1SW1A 4AB6A 5L9OA 4R6YA 1QW0A 1SDXA 3C31A 3H7MA 4GL0A 4H5GA 3MP6A 4RY1A 3FJMA 2F97A 3LSFB 4TLLB 4DXBA 4GXAA 3E3KA 1D9VA 1PBQA 3H6TA 3U94A 4MFIA 5JK4A 4DCYA 2VD3A 1N04A 2GH9A 1Y3NA 1GTKA 2QL3A 3EHTA 4JWOA 4R74A 4HCWA 1MDP1 3PV0E 3Q25A 4KCCA 1FTKA 2DWIA 3BKIB 3OO8A 2DP8A 4IGTA 2V3TA 5K2YA 5FHOA 3VFJA 2IEEA 1M5EA 1MDQA 4KPTA 4U21A 5F1QA 5JTYB 4P0GA 1UQWA 3FZVA 1SD3A 1USYH 1NH8A 4NF5A 3L6HA 4U1ZA 4AQ4A 2QJEA 1B7ZA 2XXRA 3PUYE 4DE8A 1FQBA 4N07A 2YPNA 4F3BA 1FQDA 4PETA 4DLDA 1MQHA 3B7DA 3B6WA 3KSXA 4BLAA 3OXNA 4F19A 1FTJA 1RYXA 3KSJA 3TCHA 3G3FA 4RYAA 3UIFA 3PPQA 3ONMA 1GGGA 2F6PA 2O7IA 2DE4A 3HN0A 5B7DA 2REJA 4IO7A 4XTCQ 3CFLA 4OQOA 3Q26A 3IB1A 5IKBA 3N26A 4RA1A 3TUSA 3T9XB 4OESA 2QMWA 2OWTA 1FQFA 2DVCA 2F35A 3QSLA 2O7UA 4EF1A 3EHUA 1B3HA 2R9JA 5H8NB 1DMBA 4RK2A 1LB8A 3K6WA 5CRYA 4KYSA 3VXCA 3UA8A 1Y9UA 1WODA 3N6UA 4OYVA 1NFTA 4ESWA 3MP1A 3TCFA 4WXJA 3O97A 2F78A 2Y84A 1MXXA 5LOMA 1Y3PA 2A5TB 3Q27A 1MQIA 3PD9A 5DEXA 4DXUA 1MM7A 3CSBA 4P11A 3IL1B 1Y4CA 2I6EA 1PEBA 5TP9A 4MLQA 2PBWA 3H06B 1SW5A 2H99A 4TLMB 1BTJA 3M3LA 4U22A 4UACA 4KQPA 4PQJA 4EXKA 1CE2A 4LP2B 1GV8A 1IXGA 4C1TA 4ZEIA 3QIMA 2PT2A 3T9HB 2V3QA 4QHQA 2F7BA 3N6TA 1N76A 3SERA 4X1BA 5CBRA 3FIRA 3K4UA 4BDOA 3OEKA 1QVSA 3OO7A 3U93A 2HAVA 2UXAA 1USYE 3PUXE 1I69A 4EDPA 3KGCA 4MLVA 5DYHA 1YCJA 4IO6A 1HSJA 4MBPA 2I4CA 3VDFA 3MPLA 1DPEA 3QK6A 1M5DA 4C1UA 2NVUB 4GRKA 1NKXA 5KCJB 3TTLA 3VLWA 4XKRA 1P1QA 4UA8A 4QSDA 1NNKA 1AIVA 3OO6A 4G8MA 1IZ1A 3MQ9A 4G77A 3S2VA 3SEXA 1LFHA 5H8SA 3PPRA 1I6BA 2XX9A 2XXQA 1UTBA 1ZBMA 4ND9A 1Z7NE 5H8QA 1QUJA 1UTHB 5AE4A 5IAIA 4RJZA 3RTFB 3M3FA 4ZEDA 2OCUA 5ELVA 2ZYMA 2OZZA 4WEDA 1B46A 4JWXA 5KZTA 4XKPA 5I56A 5L9SA 4XXUA 4NE4A 4R73A 5I2NA 1QUIA 3T66A 3TKDA 1SQYA 3MW0A 1XHYA 3LBSA 1DTZA 2DVZA 4LZ8A 2RKMA 3TYHA 2HAUA 1QUKA 2X7QA 4JSOA 3C35A 3MZBA 4H6DA 1XVYA 4GFRA 1B1XA 2XXIA 3KOSA 3RN8A 3W9WA 1LAFE 4FEBA 4YAHX 1OQGA 3OO9A 4ZS9A 1SW2A 1TFDA 2A5SA 1YPNA 1T0KA 4PFTA 3V5AA 3C36A 3O29A 1MG1A 4H1XA 5ITOA 2ZNSA 2B3FA 1I6AA 1POY1 2DS9A 2QS4A 5FHNA 4QRZA 3H6UA 2V84A 3T96B 4LA9A 2XXPA 2DXRA 2XXXA 4NTLA 2I0BA 1I6QA 4PP0A 4F3PA 4IO2A 1HSLA 4KYEA 1II5A 3MUQA 2GFEA 3SESA 3TQWA 5HPQA 2Q2CA 5CBSA 5DEXB 1B0HA 3T93B 3VV5A 1H76A 1JETA 3Q29A 4YKKA 3EPEA 2G29A 3HO7A 3HHGA 2DQVA 2Z22A 1A55A 3PGFA 2VHAA 1URSA 2RCBA 4IB2A 4RNSA 5TP9B 3VLVA 4H5FA 1N3WA 4FJPA 4LATA 2OBGA 1EU8A 1LBCA 3MVWA 4R2BA 3M8UA 1ZJLA 1Q35A 3K01A 3JZJA 1DTGA 2F5XA 1H44A 4OFLA 3U92A 2E0SA 2PMSA 3M3KA 4N6PA 4R72A 4F31B 4RXLA 1JW4A 2ZNTA 3H6WA 1VFDA 3G3JA 3ZKKA 5AA1A 1SI0A 2WKYA 2Y7WA 4YMAA 2QS1A 3R7XA 4IY6A 2UVHA 3OEMA 1A54A 4EQ9A 1SYIA 3MVYA 1B2HA 3OELA 2ZMBA 4F1UA 1B1HA 4OTEA 3O6GA 1FQEA 1XC1A 3L6GA 1BP5A 1B9JA 5KDTB 4EXLA 5EHSA 3RUMA 5FHMA 3QUJA 1PDAA 2V25A 3C33A 3H6VA 3BBRA 1MY3A 4KCDA 5H8HA 3TTNA 4XKNA 4QFKA 5H8FA 2GHAA 1IXHA 2LAOA 3HV1A 2ZYOA 4YU0A 1YAEA 3KG2A 2UYEA 1BKAA 3G3HA 4R6HA 2XD3A 3PMVA 4JWYA 4OERA 4M1VA 3O66A 4E0XA 4YKIA 3FXQA 3TTMA 1LAGE 4ELPA 2DE3A 2HXWA 2O69A 2XHDA 3MJNA 2UVGA 1EZ9A 3TTKA 4QFNA 4LQ2A 4U1OA 2I0CA 1SI1A 3TTRA 1EH3A 5AA2A 1P1NA 2F34A 4R2FA 1B4ZA 1O64A 2VGQA 3C4MA 3CR9A 4LONB 4RK9A 5DVJA 2CZLA 1O63A 4F3GA 1NMUA 4H67A 1AH5A 3CSGA 1MQGA 1PBPA 3O28A 5TU0A 2XXUA 4M4GA 4FORA 5AA4A 2Y7RA 1OMPA 4BDQA 3E4RA 4GOTA 4H8JA 2NUVA 2Z8FA 3JV9A 1MS7A 3GBAA 2REGA 3S4UA 1MQDA 1B4HA 2BJJX 1JQFA 4KHZE 4L17A 3F11A 1N0TA 2RCAA 1S7YA 4G68A 5I2KA 1MY2A 4IO4A 2F8DA 4H65A 5TPAA 4BDMA 1URGA 2DE2A 3IR1A 2DXYA 3TCGA 1OVBA 4OZ9A 3MZ1A 3N5LA 1ATGA 5I57B 3KZGA 3MZ9A 4GD5A 4FECA 4HTGA 3IOWA 4YB7A 1Y1ZA 1O7TA 1CB6A 5I58B 3FASA 1IXCA 4HW8A 5DVFA 3MVZA 2DYXA 2ESNA 3G7WA 1B05A 3IJXB 1UIVA 4GQOA 1XVXA 1VFEA 1QULA 3G3KA 1FTMA 4ONYA 5ICQA 4Q30B 1D3KA 1PC3A 1MH3A 4I62A 2XXHA 3U8QA 1JVYA 1TFAA 3RPWA 1Y1MA 4PFUA 3C32A 4NWDA 4Q5TA 3TDJA 3PUZE 1OLCA 2IA4A 1AL3A 3PPPA 1JEUA 1JVXA 3KFMA 4G8NA 1NNTA 3ILUB 3G3IA 3IB2A 1B3FA 1B7HA 1FTLA 1EZOA 1M5FA 4ELRA 1QJMA 1MY1A 3SEYA 1A40A 3D4GA 1B51A 3DELB 4IO5A 4MF3A 5CMCA 2PX1A 4X48A 1MPDA 2RC9A 2ONSA 3THIA 1ZU0A 4KFQA 2NWJA 1MXZA 5AA2D 4R75A 3EQ1A 3C34A 4F18A 3VVDA 4Q0CA 2DOJA 1B3GA 3UGWA 3FVGA 1S9TA 4NF8A 2RF1A 5A5XA 2ZYKA 2H4IA 2Z23A 5I59A 2ONKE 3C9HA 4ELOA 1SBPA 1SW4A 1R9QA 3TQLA 3EHSA 3FD3A 4F1VA 2CMOA 2F36A 1B40A 3DP6A 2E1SA 3W9VA 3KN8A 4U23A 4NF5B 1F9BA 4O3CA 3BFTA 5BWJA 3IK6B 1M5CA 3O2AA 5CC2A 1IEJA 3PMXA 2HZKA 2D5WA 2M8CA 5CM6A 1MH4A 2XXWA 4ECFA 2O6AA 1JW5A 2PVUA 3KEIA 3LC8A 3FV1A 4FIMA 5ITPA 4RPOA 2I58A 4FAJA 3K1NA 3FV2A 3K6VA 2Q8JA 4HS7A 3V83A 3FUZA 2I48A 4QFLA 3MC2A 4G68B 2F7AA 4JB7A 1JEVA 4Q8RA 4I9DA 2OLBA 4IO3A 3EN3A 3QXMA 2O1LA 4R6KA 5I84A 1ZLQA 3USDA 4YICA 4NF6A 3T9VA 2YJPA 1IIWA 3VLUA 2HZLA 4K3FA 2OWSA 2XX7A 4DCXA 4GXSB 1LB9A 3KN3A 2FYIA 4LQ5A 3WAFA 3CRBA 1B5JA 3PPOA 2H25A 2ZNUA 3LR1A 4YKJA 3IAZA 5DTBA 5BUUA 2HEUA 3CFZA 3OMBA 5HBCA 3LUYA 3TEPA 2RC7A 1NNPA 3P7IA 2UVIA 2QS3A 1P1WA 2I49A 4YKPA 2B65A 4GIZA 1ZKBA 3PUWE 3IOTA 2O68A 3H3GA 4LVQA 4PE5B 3RY3A 3A3CA 5L8DA 1HSEA 4Z7EA 2PT1A 1FQAA 1S50A 3IO6A 4DDDA 4OFOA 4EUOA 5FTIA 3SETA 3ZSFA 3IJOB 3IB0A 4ZEKA 2VOZA 3GLBA 4ZDMA 3KJ7A 1DOTA 1MPCA 1N84A 3MAMA 2H9BA 1B58A 4TQUQ 4PFWA 3EF7A 3FVKA 1US4A 4JSDA 1TWYA 1URDA 4G68C 3GZGA 4QSEA 1H3DA 1B3LA 3Q28A 1NL5A 1R9LA 3IO4A 5J1DA 2XXYA 3S9NC 4POWA 3D4CA 2ZXTA 1NNFA 2I3WA 1GVCA 5L9MA 3E9XA 4YMBA 2R6GE 4N13A 3UN6A 2O51A 3VVEA 3JYRA 1M5BA 5H8NA 1JNFA 1VR5A 2AL4A 3MBPA 3QAXA 2Y7PA 2QRYA 4OEUA 1FW0A 5AA3A 4EQBA 2UVJA 1R1NA 3V8XB 3IORA 3MP8A 1MQJA 4NMYA 5B70A 2ABHA 2H5YA 1OQHA 3ODBA 1Y20A 1UTBB 5H8QB 3R6UA 1N7WA 2P1SA 2THIA 3TPAA 2X7PA 1PB8A 3OOAA 3TFLA 2Q88A 4EQ7A 5I56B 1OLAA 3E13X 1N3XA 2Q2AA 1GR2A 5I2NB 2HCAA 4YB5A 1MXUA 3LSLA 4NF6B 3H4ZA 4ZECA 4KI0E 4E0WA 1LCFA 1LFGA 2NOOA 3KN7A 3TZAA 2DWAA 4OXVA 1B5HA 1ANFA 3B6TA 3SEUA 2I4BA 3DP8A 1XOCA 4GL8A 2R71A 2B3BA 2VP1A 4LZ5A 4QF9A 4XKQA 1AOVA 2XD2A 3OENA 4OFJA 1P1OA 2QMXA 4JDFA 5EYFA 2XXTA 3SKPA 3SEWA 4OENA 5KCJA 3VXBA 1B52A 3QUFA 2HQ0A 1POTA 1MY0A 3PPNA 3TODA 1PB9A 4DZ1A 3FVOA 4POXA 1H43A 3SDFA 5CMBA 4NF4A 1VE4A 3MWBA 1FCKA 3TELA 1MRPA 5FTHA 4PFYA 2OJTA 3MVXA 1UTHA 4FE8A 1L5TA 4NEDA 5DT6A 3UP9A 1FQCA 4AB5A 1PB7A 4JXIA 1ELJA 4DXCA 1XT8A 4WEPA 4H0WA 4G8HA 3O6IA 4ZE8A 5HM4B 2VD2A 3RT8A 1SVXB 1SYHA 2OK2A 3OSRA 4LZ7A 4GF8A 1LSTA 3W15C 1Q1KA 3ZS6A 4F2QA 4THIA 1QKBA 3CG1A 3PD8A 3U1OA 4DIGA 2W7YA 1D4NA 1A99A 2PYYA 1RKMA 3K6XA 4OETA 5EHMA 3VVFA 3ZKLA 3FJ7A 4OMBA 3CG3A 4IGRA 4OWDA 1B5IA 3DLNA 3U72A 1MY4A 1A7LA 2AYSA 2NXOA 3B6QA 3S9LC 3KBRA 4ELQA 2AIXA 3A3UA 5H8HB 2Z8EA 2I3VA 5H8FB 2XX8A 4ZZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ISU A;  4KR5 A;  4F22 A;  3H03 A;  4Z0I A;  5K2X A;  3K2D A;  3S9M C;  4BDR A;  4QFO A;  4HCY A;  3TMG A;  3SEV A;  1TT1 A;  1MPB A;  4QFP A;  1Y3Q A;  3AXF A;  2QS2 A;  1B32 A;  2V93 A;  4ZZA A;  1R6Z A;  2GHB A;  2Q89 A;  3I6V A;  1D9Y A;  4C0R A;  1P99 A;  4EF2 A;  3ECR A;  5F7V A;  1XS5 A;  3FAT A;  1AMF A;  3UK4 A;  3CFX A;  3PU5 A;  2FNC A;  3HCQ A;  4FED A;  4ZEB A;  2DWH A;  4G4P A;  3K0V A;  5AA2 B;  4ZE9 A;  4OVJ A;  1IXI A;  2KLF A;  3RQT A;  3FJG A;  3KOT A;  4IY5 A;  4OEV A;  3KJT A;  1WDN A;  3LSX A;  1LCT A;  4ZEF A;  5KDT A;  5AA4 B;  1LAH E;  3RNN A;  1P1U A;  4NF4 B;  4BDL A;  1UIU A;  2Y7K A;  1B7U A;  3I5O A;  1VSO A;  3V89 B;  1BIY A;  1DSN A;  3ILT B;  5I2K B;  5TPA B;  3R26 A;  2ZYN A;  4ISU A;  3MPK A;  2XXV A;  4XIG Q;  4OHN A;  3HST A;  2P0S A;  1JW1 A;  3FXR A;  1B0L A;  4TOZ A;  3RLF E;  1B6H A;  1IUD A;  1OVT A;  3N94 A;  2RIN A;  1ZIU A;  3GXA A;  1A8F A;  5CMK A;  1Y4T A;  4RPN A;  3IOV A;  1ZTY A;  3RGY A;  2G93 A;  3A09 A;  1IIT A;  3VE1 B;  5CMM A;  4U4X A;  4F2O A;  2RC8 A;  3CIJ A;  4F29 A;  3DP4 A;  3HPI A;  1A8E A;  4MH5 A;  4BDN A;  1ZMG A;  2X26 A;  1LFI A;  1EZP A;  1NH7 A;  2O1M A;  2F7C A;  2GRV A;  1MXY A;  4GLI A;  4O3A A;  3LSW A;  1OIB A;  2H98 A;  5JTY A;  3G3G A;  5M2V A;  4GWO A;  3GBB A;  1N7X A;  4U2R A;  3K02 A;  2Y7I A;  2AL5 A;  4R9G A;  3S9E A;  2P2A A;  4I8C A;  3OD7 A;  1J1N A;  3FGS A;  3UOR A;  4YB6 A;  2ALU A;  3O9P A;  3DM0 A;  3OSQ A;  2ANJ A;  1MM6 A;  4U4S A;  4G2Z A;  2Q9T A;  1FTO A;  3WAE A;  3K1P A;  2D3I A;  2QPQ A;  4JBZ A;  1WVJ A;  4YZZ A;  4X1D A;  2HFB A;  2F6G A;  1MXW A;  2UYF A;  2DSF A;  3T9U A;  5CI5 A;  4F39 A;  3BFU A;  2QSX A;  1H45 A;  3K6U A;  1LGB C;  4R9F A;  1IQ7 A;  5I57 A;  4I1D A;  1KWH A;  3FVN A;  1B3E A;  1YTV A;  4NF8 B;  1RYO A;  4F3S A;  5A5X B;  3TAJ A;  4X9T A;  3PUV E;  5I59 B;  3QYT A;  3RT6 B;  3PMW A;  3CI8 A;  5I58 A;  1LAX A;  1BLF A;  1QKA A;  1US5 A;  4LUB A;  2O84 X;  3CVG A;  4QSC A;  4WKM A;  4NWC A;  3K00 A;  1DPP A;  3O6H A;  3IX1 A;  1MXV A;  2FA7 A;  2V3U A;  5DVI A;  4ESX A;  5ICT A;  4O3B A;  4H8I A;  2ONR A;  4KYD A;  4FAT A;  4GVO A;  2A5T A;  2Z8D A;  4KD5 A;  4P0I A;  3I3V A;  3FXU A;  2D21 A;  2DWJ A;  2YLN A;  3HHF A;  1TXF A;  1LBB A;  3T22 A;  3IOU A;  3RTW B;  4F1Y A;  5JEI A;  1LLS A;  1Z7M E;  3K1M A;  1SW1 A;  4AB6 A;  5L9O A;  4R6Y A;  1QW0 A;  1SDX A;  3C31 A;  3H7M A;  4GL0 A;  4H5G A;  3MP6 A;  4RY1 A;  3FJM A;  2F97 A;  3LSF B;  4TLL B;  4DXB A;  4GXA A;  3E3K A;  1D9V A;  1PBQ A;  3H6T A;  3U94 A;  4MFI A;  5JK4 A;  4DCY A;  2VD3 A;  1N04 A;  2GH9 A;  1Y3N A;  1GTK A;  2QL3 A;  3EHT A;  4JWO A;  4R74 A;  4HCW A;  1MDP 1;  3PV0 E;  3Q25 A;  4KCC A;  1FTK A;  2DWI A;  3BKI B;  3OO8 A;  2DP8 A;  4IGT A;  2V3T A;  5K2Y A;  5FHO A;  3VFJ A;  2IEE A;  1M5E A;  1MDQ A;  4KPT A;  4U21 A;  5F1Q A;  5JTY B;  4P0G A;  1UQW A;  3FZV A;  1SD3 A;  1USY H;  1NH8 A;  4NF5 A;  3L6H A;  4U1Z A;  4AQ4 A;  2QJE A;  1B7Z A;  2XXR A;  3PUY E;  4DE8 A;  1FQB A;  4N07 A;  2YPN A;  4F3B A;  1FQD A;  4PET A;  4DLD A;  1MQH A;  3B7D A;  3B6W A;  3KSX A;  4BLA A;  3OXN A;  4F19 A;  1FTJ A;  1RYX A;  3KSJ A;  3TCH A;  3G3F A;  4RYA A;  3UIF A;  3PPQ A;  3ONM A;  1GGG A;  2F6P A;  2O7I A;  2DE4 A;  3HN0 A;  5B7D A;  2REJ A;  4IO7 A;  4XTC Q;  3CFL A;  4OQO A;  3Q26 A;  3IB1 A;  5IKB A;  3N26 A;  4RA1 A;  3TUS A;  3T9X B;  4OES A;  2QMW A;  2OWT A;  1FQF A;  2DVC A;  2F35 A;  3QSL A;  2O7U A;  4EF1 A;  3EHU A;  1B3H A;  2R9J A;  5H8N B;  1DMB A;  4RK2 A;  1LB8 A;  3K6W A;  5CRY A;  4KYS A;  3VXC A;  3UA8 A;  1Y9U A;  1WOD A;  3N6U A;  4OYV A;  1NFT A;  4ESW A;  3MP1 A;  3TCF A;  4WXJ A;  3O97 A;  2F78 A;  2Y84 A;  1MXX A;  5LOM A;  1Y3P A;  2A5T B;  3Q27 A;  1MQI A;  3PD9 A;  5DEX A;  4DXU A;  1MM7 A;  3CSB A;  4P11 A;  3IL1 B;  1Y4C A;  2I6E A;  1PEB A;  5TP9 A;  4MLQ A;  2PBW A;  3H06 B;  1SW5 A;  2H99 A;  4TLM B;  1BTJ A;  3M3L A;  4U22 A;  4UAC A;  4KQP A;  4PQJ A;  4EXK A;  1CE2 A;  4LP2 B;  1GV8 A;  1IXG A;  4C1T A;  4ZEI A;  3QIM A;  2PT2 A;  3T9H B;  2V3Q A;  4QHQ A;  2F7B A;  3N6T A;  1N76 A;  3SER A;  4X1B A;  5CBR A;  3FIR A;  3K4U A;  4BDO A;  3OEK A;  1QVS A;  3OO7 A;  3U93 A;  2HAV A;  2UXA A;  1USY E;  3PUX E;  1I69 A;  4EDP A;  3KGC A;  4MLV A;  5DYH A;  1YCJ A;  4IO6 A;  1HSJ A;  4MBP A;  2I4C A;  3VDF A;  3MPL A;  1DPE A;  3QK6 A;  1M5D A;  4C1U A;  2NVU B;  4GRK A;  1NKX A;  5KCJ B;  3TTL A;  3VLW A;  4XKR A;  1P1Q A;  4UA8 A;  4QSD A;  1NNK A;  1AIV A;  3OO6 A;  4G8M A;  1IZ1 A;  3MQ9 A;  4G77 A;  3S2V A;  3SEX A;  1LFH A;  5H8S A;  3PPR A;  1I6B A;  2XX9 A;  2XXQ A;  1UTB A;  1ZBM A;  4ND9 A;  1Z7N E;  5H8Q A;  1QUJ A;  1UTH B;  5AE4 A;  5IAI A;  4RJZ A;  3RTF B;  3M3F A;  4ZED A;  2OCU A;  5ELV A;  2ZYM A;  2OZZ A;  4WED A;  1B46 A;  4JWX A;  5KZT A;  4XKP A;  5I56 A;  5L9S A;  4XXU A;  4NE4 A;  4R73 A;  5I2N A;  1QUI A;  3T66 A;  3TKD A;  1SQY A;  3MW0 A;  1XHY A;  3LBS A;  1DTZ A;  2DVZ A;  4LZ8 A;  2RKM A;  3TYH A;  2HAU A;  1QUK A;  2X7Q A;  4JSO A;  3C35 A;  3MZB A;  4H6D A;  1XVY A;  4GFR A;  1B1X A;  2XXI A;  3KOS A;  3RN8 A;  3W9W A;  1LAF E;  4FEB A;  4YAH X;  1OQG A;  3OO9 A;  4ZS9 A;  1SW2 A;  1TFD A;  2A5S A;  1YPN A;  1T0K A;  4PFT A;  3V5A A;  3C36 A;  3O29 A;  1MG1 A;  4H1X A;  5ITO A;  2ZNS A;  2B3F A;  1I6A A;  1POY 1;  2DS9 A;  2QS4 A;  5FHN A;  4QRZ A;  3H6U A;  2V84 A;  3T96 B;  4LA9 A;  2XXP A;  2DXR A;  2XXX A;  4NTL A;  2I0B A;  1I6Q A;  4PP0 A;  4F3P A;  4IO2 A;  1HSL A;  4KYE A;  1II5 A;  3MUQ A;  2GFE A;  3SES A;  3TQW A;  5HPQ A;  2Q2C A;  5CBS A;  5DEX B;  1B0H A;  3T93 B;  3VV5 A;  1H76 A;  1JET A;  3Q29 A;  4YKK A;  3EPE A;  2G29 A;  3HO7 A;  3HHG A;  2DQV A;  2Z22 A;  1A55 A;  3PGF A;  2VHA A;  1URS A;  2RCB A;  4IB2 A;  4RNS A;  5TP9 B;  3VLV A;  4H5F A;  1N3W A;  4FJP A;  4LAT A;  2OBG A;  1EU8 A;  1LBC A;  3MVW A;  4R2B A;  3M8U A;  1ZJL A;  1Q35 A;  3K01 A;  3JZJ A;  1DTG A;  2F5X A;  1H44 A;  4OFL A;  3U92 A;  2E0S A;  2PMS A;  3M3K A;  4N6P A;  4R72 A;  4F31 B;  4RXL A;  1JW4 A;  2ZNT A;  3H6W A;  1VFD A;  3G3J A;  3ZKK A;  5AA1 A;  1SI0 A;  2WKY A;  2Y7W A;  4YMA A;  2QS1 A;  3R7X A;  4IY6 A;  2UVH A;  3OEM A;  1A54 A;  4EQ9 A;  1SYI A;  3MVY A;  1B2H A;  3OEL A;  2ZMB A;  4F1U A;  1B1H A;  4OTE A;  3O6G A;  1FQE A;  1XC1 A;  3L6G A;  1BP5 A;  1B9J A;  5KDT B;  4EXL A;  5EHS A;  3RUM A;  5FHM A;  3QUJ A;  1PDA A;  2V25 A;  3C33 A;  3H6V A;  3BBR A;  1MY3 A;  4KCD A;  5H8H A;  3TTN A;  4XKN A;  4QFK A;  5H8F A;  2GHA A;  1IXH A;  2LAO A;  3HV1 A;  2ZYO A;  4YU0 A;  1YAE A;  3KG2 A;  2UYE A;  1BKA A;  3G3H A;  4R6H A;  2XD3 A;  3PMV A;  4JWY A;  4OER A;  4M1V A;  3O66 A;  4E0X A;  4YKI A;  3FXQ A;  3TTM A;  1LAG E;  4ELP A;  2DE3 A;  2HXW A;  2O69 A;  2XHD A;  3MJN A;  2UVG A;  1EZ9 A;  3TTK A;  4QFN A;  4LQ2 A;  4U1O A;  2I0C A;  1SI1 A;  3TTR A;  1EH3 A;  5AA2 A;  1P1N A;  2F34 A;  4R2F A;  1B4Z A;  1O64 A;  2VGQ A;  3C4M A;  3CR9 A;  4LON B;  4RK9 A;  5DVJ A;  2CZL A;  1O63 A;  4F3G A;  1NMU A;  4H67 A;  1AH5 A;  3CSG A;  1MQG A;  1PBP A;  3O28 A;  5TU0 A;  2XXU A;  4M4G A;  4FOR A;  5AA4 A;  2Y7R A;  1OMP A;  4BDQ A;  3E4R A;  4GOT A;  4H8J A;  2NUV A;  2Z8F A;  3JV9 A;  1MS7 A;  3GBA A;  2REG A;  3S4U A;  1MQD A;  1B4H A;  2BJJ X;  1JQF A;  4KHZ E;  4L17 A;  3F11 A;  1N0T A;  2RCA A;  1S7Y A;  4G68 A;  5I2K A;  1MY2 A;  4IO4 A;  2F8D A;  4H65 A;  5TPA A;  4BDM A;  1URG A;  2DE2 A;  3IR1 A;  2DXY A;  3TCG A;  1OVB A;  4OZ9 A;  3MZ1 A;  3N5L A;  1ATG A;  5I57 B;  3KZG A;  3MZ9 A;  4GD5 A;  4FEC A;  4HTG A;  3IOW A;  4YB7 A;  1Y1Z A;  1O7T A;  1CB6 A;  5I58 B;  3FAS A;  1IXC A;  4HW8 A;  5DVF A;  3MVZ A;  2DYX A;  2ESN A;  3G7W A;  1B05 A;  3IJX B;  1UIV A;  4GQO A;  1XVX A;  1VFE A;  1QUL A;  3G3K A;  1FTM A;  4ONY A;  5ICQ A;  4Q30 B;  1D3K A;  1PC3 A;  1MH3 A;  4I62 A;  2XXH A;  3U8Q A;  1JVY A;  1TFA A;  3RPW A;  1Y1M A;  4PFU A;  3C32 A;  4NWD A;  4Q5T A;  3TDJ A;  3PUZ E;  1OLC A;  2IA4 A;  1AL3 A;  3PPP A;  1JEU A;  1JVX A;  3KFM A;  4G8N A;  1NNT A;  3ILU B;  3G3I A;  3IB2 A;  1B3F A;  1B7H A;  1FTL A;  1EZO A;  1M5F A;  4ELR A;  1QJM A;  1MY1 A;  3SEY A;  1A40 A;  3D4G A;  1B51 A;  3DEL B;  4IO5 A;  4MF3 A;  5CMC A;  2PX1 A;  4X48 A;  1MPD A;  2RC9 A;  2ONS A;  3THI A;  1ZU0 A;  4KFQ A;  2NWJ A;  1MXZ A;  5AA2 D;  4R75 A;  3EQ1 A;  3C34 A;  4F18 A;  3VVD A;  4Q0C A;  2DOJ A;  1B3G A;  3UGW A;  3FVG A;  1S9T A;  4NF8 A;  2RF1 A;  5A5X A;  2ZYK A;  2H4I A;  2Z23 A;  5I59 A;  2ONK E;  3C9H A;  4ELO A;  1SBP A;  1SW4 A;  1R9Q A;  3TQL A;  3EHS A;  3FD3 A;  4F1V A;  2CMO A;  2F36 A;  1B40 A;  3DP6 A;  2E1S A;  3W9V A;  3KN8 A;  4U23 A;  4NF5 B;  1F9B A;  4O3C A;  3BFT A;  5BWJ A;  3IK6 B;  1M5C A;  3O2A A;  5CC2 A;  1IEJ A;  3PMX A;  2HZK A;  2D5W A;  2M8C A;  5CM6 A;  1MH4 A;  2XXW A;  4ECF A;  2O6A A;  1JW5 A;  2PVU A;  3KEI A;  3LC8 A;  3FV1 A;  4FIM A;  5ITP A;  4RPO A;  2I58 A;  4FAJ A;  3K1N A;  3FV2 A;  3K6V A;  2Q8J A;  4HS7 A;  3V83 A;  3FUZ A;  2I48 A;  4QFL A;  3MC2 A;  4G68 B;  2F7A A;  4JB7 A;  1JEV A;  4Q8R A;  4I9D A;  2OLB A;  4IO3 A;  3EN3 A;  3QXM A;  2O1L A;  4R6K A;  5I84 A;  1ZLQ A;  3USD A;  4YIC A;  4NF6 A;  3T9V A;  2YJP A;  1IIW A;  3VLU A;  2HZL A;  4K3F A;  2OWS A;  2XX7 A;  4DCX A;  4GXS B;  1LB9 A;  3KN3 A;  2FYI A;  4LQ5 A;  3WAF A;  3CRB A;  1B5J A;  3PPO A;  2H25 A;  2ZNU A;  3LR1 A;  4YKJ A;  3IAZ A;  5DTB A;  5BUU A;  2HEU A;  3CFZ A;  3OMB A;  5HBC A;  3LUY A;  3TEP A;  2RC7 A;  1NNP A;  3P7I A;  2UVI A;  2QS3 A;  1P1W A;  2I49 A;  4YKP A;  2B65 A;  4GIZ A;  1ZKB A;  3PUW E;  3IOT A;  2O68 A;  3H3G A;  4LVQ A;  4PE5 B;  3RY3 A;  3A3C A;  5L8D A;  1HSE A;  4Z7E A;  2PT1 A;  1FQA A;  1S50 A;  3IO6 A;  4DDD A;  4OFO A;  4EUO A;  5FTI A;  3SET A;  3ZSF A;  3IJO B;  3IB0 A;  4ZEK A;  2VOZ A;  3GLB A;  4ZDM A;  3KJ7 A;  1DOT A;  1MPC A;  1N84 A;  3MAM A;  2H9B A;  1B58 A;  4TQU Q;  4PFW A;  3EF7 A;  3FVK A;  1US4 A;  4JSD A;  1TWY A;  1URD A;  4G68 C;  3GZG A;  4QSE A;  1H3D A;  1B3L A;  3Q28 A;  1NL5 A;  1R9L A;  3IO4 A;  5J1D A;  2XXY A;  3S9N C;  4POW A;  3D4C A;  2ZXT A;  1NNF A;  2I3W A;  1GVC A;  5L9M A;  3E9X A;  4YMB A;  2R6G E;  4N13 A;  3UN6 A;  2O51 A;  3VVE A;  3JYR A;  1M5B A;  5H8N A;  1JNF A;  1VR5 A;  2AL4 A;  3MBP A;  3QAX A;  2Y7P A;  2QRY A;  4OEU A;  1FW0 A;  5AA3 A;  4EQB A;  2UVJ A;  1R1N A;  3V8X B;  3IOR A;  3MP8 A;  1MQJ A;  4NMY A;  5B70 A;  2ABH A;  2H5Y A;  1OQH A;  3ODB A;  1Y20 A;  1UTB B;  5H8Q B;  3R6U A;  1N7W A;  2P1S A;  2THI A;  3TPA A;  2X7P A;  1PB8 A;  3OOA A;  3TFL A;  2Q88 A;  4EQ7 A;  5I56 B;  1OLA A;  3E13 X;  1N3X A;  2Q2A A;  1GR2 A;  5I2N B;  2HCA A;  4YB5 A;  1MXU A;  3LSL A;  4NF6 B;  3H4Z A;  4ZEC A;  4KI0 E;  4E0W A;  1LCF A;  1LFG A;  2NOO A;  3KN7 A;  3TZA A;  2DWA A;  4OXV A;  1B5H A;  1ANF A;  3B6T A;  3SEU A;  2I4B A;  3DP8 A;  1XOC A;  4GL8 A;  2R71 A;  2B3B A;  2VP1 A;  4LZ5 A;  4QF9 A;  4XKQ A;  1AOV A;  2XD2 A;  3OEN A;  4OFJ A;  1P1O A;  2QMX A;  4JDF A;  5EYF A;  2XXT A;  3SKP A;  3SEW A;  4OEN A;  5KCJ A;  3VXB A;  1B52 A;  3QUF A;  2HQ0 A;  1POT A;  1MY0 A;  3PPN A;  3TOD A;  1PB9 A;  4DZ1 A;  3FVO A;  4POX A;  1H43 A;  3SDF A;  5CMB A;  4NF4 A;  1VE4 A;  3MWB A;  1FCK A;  3TEL A;  1MRP A;  5FTH A;  4PFY A;  2OJT A;  3MVX A;  1UTH A;  4FE8 A;  1L5T A;  4NED A;  5DT6 A;  3UP9 A;  1FQC A;  4AB5 A;  1PB7 A;  4JXI A;  1ELJ A;  4DXC A;  1XT8 A;  4WEP A;  4H0W A;  4G8H A;  3O6I A;  4ZE8 A;  5HM4 B;  2VD2 A;  3RT8 A;  1SVX B;  1SYH A;  2OK2 A;  3OSR A;  4LZ7 A;  4GF8 A;  1LST A;  3W15 C;  1Q1K A;  3ZS6 A;  4F2Q A;  4THI A;  1QKB A;  3CG1 A;  3PD8 A;  3U1O A;  4DIG A;  2W7Y A;  1D4N A;  1A99 A;  2PYY A;  1RKM A;  3K6X A;  4OET A;  5EHM A;  3VVF A;  3ZKL A;  3FJ7 A;  4OMB A;  3CG3 A;  4IGR A;  4OWD A;  1B5I A;  3DLN A;  3U72 A;  1MY4 A;  1A7L A;  2AYS A;  2NXO A;  3B6Q A;  3S9L C;  3KBR A;  4ELQ A;  2AIX A;  3A3U A;  5H8H B;  2Z8E A;  2I3V A;  5H8F B;  2XX8 A;  4ZZE A; 
#chains in the Genus database with same CATH topology
 5ISU A;  4KR5 A;  4F22 A;  3H03 A;  4Z0I A;  4P8B A;  5K2X A;  3K2D A;  3S9M C;  4BDR A;  4QFO A;  4HCY A;  3TMG A;  3SEV A;  1TT1 A;  1MPB A;  4QFP A;  1Y3Q A;  3AXF A;  1K9Y A;  2QS2 A;  1B32 A;  2V93 A;  4ZZA A;  1R6Z A;  3GYY A;  2GHB A;  2Q89 A;  3I6V A;  1D9Y A;  4C0R A;  5ET5 A;  1P99 A;  3NOH A;  4EF2 A;  3ECR A;  5F7V A;  1XS5 A;  3FAT A;  1AMF A;  4PDD A;  3B8B A;  3UK4 A;  3CFX A;  3PU5 A;  2FNC A;  2QVR A;  4O94 A;  4GBW A;  3HCQ A;  4FED A;  4ZEB A;  4GBV A;  2DWH A;  1FBG A;  4G4P A;  3K0V A;  5AA2 B;  4ZE9 A;  4OVJ A;  1NUY A;  1IXI A;  2KLF A;  3KC0 A;  3RQT A;  3FJG A;  3KOT A;  4IY5 A;  4N8Y A;  1G0I A;  4OEV A;  3KJT A;  1WDN A;  3LSX A;  4OVT A;  1LCT A;  4ZEF A;  5KDT A;  5AA4 B;  1LAH E;  3RNN A;  1P1U A;  1LBY A;  2FIX A;  4NF4 B;  4MNC A;  4BDL A;  1UIU A;  2Y7K A;  1B7U A;  3I5O A;  1VSO A;  3V89 B;  1BIY A;  1DSN A;  3ILT B;  5I2K B;  3CHG A;  5TPA B;  3R26 A;  2ZYN A;  4ISU A;  3MPK A;  2XXV A;  4XIG Q;  4OHN A;  3HST A;  2P0S A;  1JW1 A;  3FXR A;  1B0L A;  4TOZ A;  3RLF E;  1IMF A;  1B6H A;  1IUD A;  1OVT A;  3N94 A;  2RIN A;  1ZIU A;  3GXA A;  4N81 A;  1A8F A;  5CMK A;  1Y4T A;  4RPN A;  3IOV A;  4PBH A;  3FXB A;  1ZTY A;  3RGY A;  1NV7 A;  2G93 A;  3A09 A;  4PC9 A;  1IIT A;  3VE1 B;  5CMM A;  4U4X A;  5IM2 A;  2HXR A;  4F2O A;  2RC8 A;  3CIJ A;  4F29 A;  1KZ8 A;  1VDW A;  3DP4 A;  3HPI A;  1A8E A;  4MH5 A;  1K9Z A;  4BDN A;  5IZ3 A;  1ZMG A;  1XI6 A;  2X26 A;  1LFI A;  1EZP A;  1NH7 A;  2O1M A;  2F7C A;  2GRV A;  1MXY A;  4G61 A;  4GLI A;  4O3A A;  3LSW A;  4PCD A;  1OIB A;  2H98 A;  5JTY A;  3G3G A;  5M2V A;  4GWO A;  3GBB A;  1N7X A;  4U2R A;  3K02 A;  2Y7I A;  2AL5 A;  4R9G A;  3S9E A;  2P2A A;  4I8C A;  3OD7 A;  1J1N A;  3FGS A;  3UOR A;  5I5P A;  4YB6 A;  2ALU A;  3O9P A;  4PE3 A;  3DM0 A;  3OSQ A;  2ANJ A;  1MM6 A;  4U4S A;  4G2Z A;  2Q9T A;  4PFB A;  1FTO A;  4PDH A;  3WAE A;  3K1P A;  2D3I A;  2QPQ A;  4JBZ A;  4AS5 A;  4KXP A;  1WVJ A;  3ROJ A;  4GWZ A;  2FIE A;  4YZZ A;  2GQ1 A;  4X1D A;  2HFB A;  2F6G A;  1IMC A;  1MXW A;  2UYF A;  2DSF A;  3T9U A;  5CI5 A;  4F39 A;  4N8G A;  3BFU A;  2XA5 A;  2CZI A;  4PTK A;  2QSX A;  1H45 A;  3K6U A;  1LGB C;  4R9F A;  1IQ7 A;  5I57 A;  4I1D A;  1KWH A;  3FVN A;  1B3E A;  1YTV A;  4NF8 B;  1RYO A;  4F3S A;  3E78 A;  5A5X B;  4I3E A;  3TAJ A;  4X9T A;  3PUV E;  5I59 B;  3QYT A;  3RT6 B;  3PMW A;  3CI8 A;  5I58 A;  1LAX A;  1BLF A;  1QKA A;  1US5 A;  4LUB A;  2O84 X;  3CVG A;  4QSC A;  4WKM A;  4NWC A;  3K00 A;  1DPP A;  3O6H A;  3IX1 A;  1MXV A;  1YXI A;  2FA7 A;  2V3U A;  5DVI A;  4MJO A;  4ESX A;  5ICT A;  4GWY A;  4O3B A;  4H8I A;  2ONR A;  4KYD A;  4FAT A;  4GVO A;  2A5T A;  2Z8D A;  4KD5 A;  4P0I A;  3I3V A;  3FXU A;  2D21 A;  1NV6 A;  2DWJ A;  2VPO A;  2YLN A;  3HHF A;  1TXF A;  1LBB A;  3T22 A;  3IOU A;  3RTW B;  4F1Y A;  5JEI A;  1LLS A;  3K1M A;  1Z7M E;  2QFL A;  1SW1 A;  4AB6 A;  5L9O A;  4R6Y A;  1QW0 A;  1SDX A;  3C31 A;  3H7M A;  4GL0 A;  2KR0 A;  4H5G A;  3MP6 A;  4N6D A;  4RY1 A;  3FJM A;  2F97 A;  4OVS A;  1FPB A;  1EYI A;  3LSF B;  1D9Q A;  1FPG A;  4TLL B;  4DXB A;  4GXA A;  3E3K A;  1D9V A;  1PBQ A;  3H6T A;  3U94 A;  4MFI A;  5JK4 A;  4DCY A;  2VD3 A;  1N04 A;  2GH9 A;  3MST A;  1Y3N A;  1GTK A;  2QL3 A;  3EHT A;  4JWO A;  4R74 A;  4HCW A;  1MDP 1;  2MKZ A;  3PV0 E;  3Q25 A;  4KCC A;  3B50 A;  1FTK A;  2DWI A;  1LBW A;  3BKI B;  4JVI A;  3OO8 A;  2DP8 A;  4IGT A;  2V3T A;  5K2Y A;  4O8M A;  5FHO A;  3VFJ A;  1LEV A;  2IEE A;  1M5E A;  1MDQ A;  4KPT A;  4U21 A;  5F1Q A;  3BIG A;  5JTY B;  4P0G A;  1UQW A;  3FZV A;  1SD3 A;  1USY H;  1NH8 A;  4NF5 A;  3L6H A;  4U1Z A;  3U65 A;  4AQ4 A;  3PTY A;  2QJE A;  1B7Z A;  2XXR A;  3PUY E;  4DE8 A;  1FQB A;  4N07 A;  2YPN A;  4F3B A;  1FQD A;  4PET A;  4NX1 A;  4DLD A;  1MQH A;  3B7D A;  3B6W A;  1FBH A;  3KSX A;  4BLA A;  4GWU A;  3OXN A;  4F19 A;  1FBP A;  1FTJ A;  1RYX A;  2PCR A;  3KSJ A;  4MCO A;  3TCH A;  3G3F A;  4HE2 A;  4RYA A;  3UIF A;  5EQ9 A;  3PPQ A;  3ONM A;  1GGG A;  4P9K A;  2F6P A;  2O7I A;  2DE4 A;  3HN0 A;  5B7D A;  2REJ A;  4IO7 A;  4XTC Q;  3CFL A;  4OQO A;  1FJ9 A;  3Q26 A;  3IB1 A;  1YYZ A;  4OA4 A;  5IKB A;  4MX6 A;  4GX4 A;  3N26 A;  4RA1 A;  2Q8M A;  3T9X B;  3TUS A;  4OES A;  2QMW A;  2OWT A;  1NUZ A;  1FQF A;  1FSA A;  2DVC A;  2F35 A;  3QSL A;  2O7U A;  5T3J A;  4EF1 A;  3EHU A;  1B3H A;  2R9J A;  5H8N B;  1DMB A;  4RK2 A;  1LB8 A;  4N17 A;  3K6W A;  1DBZ A;  5EQ8 A;  5CRY A;  4KYS A;  3VXC A;  4OVR A;  3UA8 A;  1Y9U A;  1WOD A;  3N6U A;  4OYV A;  1NFT A;  4ESW A;  3MP1 A;  3TCF A;  4WXJ A;  3O97 A;  2F78 A;  2Y84 A;  1MXX A;  5LOM A;  1Y3P A;  2A5T B;  3Q27 A;  1MQI A;  3PD9 A;  3A29 A;  5DEX A;  4DXU A;  1MM7 A;  3CSB A;  4P11 A;  1DCU A;  3IL1 B;  1Y4C A;  2I6E A;  1PEB A;  5TP9 A;  4MLQ A;  4P3L A;  4HE1 A;  2PBW A;  3H06 B;  1SW5 A;  2H99 A;  4TLM B;  1BTJ A;  1FBE A;  3M3L A;  4U22 A;  4UAC A;  4KQP A;  4PQJ A;  5ESY A;  4EXK A;  2WBB A;  1CE2 A;  4LP2 B;  1GV8 A;  1IXG A;  4C1T A;  4ZEI A;  3QIM A;  2PT2 A;  3T9H B;  2V3Q A;  4QHQ A;  2F7B A;  3N6T A;  1N76 A;  3SER A;  4X1B A;  4XEQ A;  5CBR A;  3FIR A;  3K4U A;  4BDO A;  3OEK A;  5EQA A;  1QVS A;  3OO7 A;  3U93 A;  2HAV A;  2UXA A;  1USY E;  2B4L A;  3PUX E;  1I69 A;  4EDP A;  3KGC A;  4MLV A;  5DYH A;  1YCJ A;  4IO6 A;  1HSJ A;  4MBP A;  3RYD A;  2I4C A;  1NV1 A;  3MPL A;  3VDF A;  1DPE A;  3QK6 A;  1M5D A;  2FVZ A;  4C1U A;  2NVU B;  4GRK A;  1NKX A;  5KCJ B;  3TTL A;  3VLW A;  4XKR A;  1P1Q A;  4UA8 A;  4QSD A;  1NNK A;  1AIV A;  3OO6 A;  2JJK A;  4G8M A;  1IZ1 A;  3MQ9 A;  4G77 A;  3S2V A;  3SEX A;  4FBP A;  1LBV A;  1LFH A;  5H8S A;  3PPR A;  1I6B A;  2XX9 A;  2XXQ A;  1UTB A;  1ZBM A;  4ND9 A;  1Z7N E;  5H8Q A;  4PAF A;  1QUJ A;  1UTH B;  1G0H A;  5AE4 A;  5IAI A;  2PFY A;  4RJZ A;  2XWK A;  1FBD A;  3RTF B;  3M3F A;  4ZED A;  2KQZ A;  2OCU A;  5ELV A;  2WYP A;  4PBQ A;  2ZYM A;  2OZZ A;  4WED A;  2VT5 A;  1B46 A;  4JWX A;  5KZT A;  4XKP A;  5I56 A;  5L9S A;  4XXU A;  4NE4 A;  4R73 A;  5I2N A;  1QUI A;  3T66 A;  3TKD A;  1SQY A;  3MW0 A;  3BIH A;  1XHY A;  3LBS A;  1DTZ A;  2DVZ A;  4LZ8 A;  2RKM A;  3TYH A;  2HAU A;  1QUK A;  2X7Q A;  4JSO A;  4JVC A;  3C35 A;  1FPJ A;  4NF0 A;  3MZB A;  4H6D A;  1XVY A;  4GFR A;  1B1X A;  2ZZX A;  2XXI A;  3KOS A;  3RN8 A;  3W9W A;  1LAF E;  4FEB A;  4YAH X;  1OQG A;  3OO9 A;  4ZS9 A;  2FHY A;  1QGX A;  1SW2 A;  1TFD A;  5ET6 A;  1YPN A;  2A5S A;  1T0K A;  4PFT A;  1IMB A;  3V5A A;  2B4M A;  3C36 A;  1MG1 A;  3O29 A;  4H1X A;  5ITO A;  2ZNS A;  2B3F A;  1I6A A;  1POY 1;  2DS9 A;  2QS4 A;  5FHN A;  4QRZ A;  3H6U A;  2V84 A;  3T96 B;  4LA9 A;  4AS4 A;  2XXP A;  2DXR A;  2HPG A;  2XXX A;  4NTL A;  2I0B A;  1I6Q A;  4X04 A;  4PP0 A;  4F3P A;  4QXD A;  4IO2 A;  1HSL A;  4KYE A;  4PGP A;  1II5 A;  3MUQ A;  2GFE A;  2CZH A;  3SES A;  3TQW A;  1CNQ A;  5HPQ A;  2Q2C A;  5CBS A;  5DEX B;  1B0H A;  3T93 B;  3VV5 A;  1H76 A;  1JET A;  3Q29 A;  4YKK A;  3EPE A;  2G29 A;  3HO7 A;  3HHG A;  2DQV A;  2Z22 A;  1A55 A;  3PGF A;  2VHA A;  1URS A;  2RCB A;  4IB2 A;  4RNS A;  5TP9 B;  3VLV A;  4H5F A;  1N3W A;  2WX9 A;  4PF6 A;  4FJP A;  4LAT A;  2OBG A;  4GX6 A;  1EU8 A;  1LBC A;  3MVW A;  1RDY A;  1NV0 A;  4R2B A;  3M8U A;  1ZJL A;  1Q35 A;  3K01 A;  3JZJ A;  1DTG A;  2F5X A;  1H44 A;  4OFL A;  3U92 A;  2E0S A;  2PMS A;  4P1L A;  3M3K A;  4N6P A;  4R72 A;  4F31 B;  4RXL A;  1JW4 A;  2ZNT A;  3H6W A;  1VFD A;  3G3J A;  2P3V A;  3ZKK A;  5AA1 A;  1SI0 A;  2WKY A;  2Y7W A;  4YMA A;  2QS1 A;  3R7X A;  4IY6 A;  2UVH A;  3OEM A;  1A54 A;  4EQ9 A;  1SYI A;  3MVY A;  1B2H A;  3OEL A;  2ZMB A;  4F1U A;  1B1H A;  1FPI A;  4OTE A;  3O6G A;  4DI4 B;  1FQE A;  1XC1 A;  3L6G A;  1BP5 A;  4JVD A;  1B9J A;  5KDT B;  4EXL A;  5EHS A;  3RUM A;  4XF5 A;  5FHM A;  3QUJ A;  4P47 A;  1PDA A;  3RPL A;  2V25 A;  3C33 A;  4GX3 A;  3H6V A;  3BBR A;  1MY3 A;  5IZ1 A;  5ET8 A;  4KCD A;  5H8H A;  3TTN A;  4XKN A;  4QFK A;  5H8F A;  2GHA A;  1IXH A;  2LAO A;  3HV1 A;  2ZYO A;  4YU0 A;  1YAE A;  3KG2 A;  2UYE A;  1BKA A;  3G3H A;  4R6H A;  2XD3 A;  3PMV A;  4JWY A;  4OER A;  4M1V A;  5IZZ A;  3O66 A;  2Y5L A;  4E0X A;  4YKI A;  3FXQ A;  3TTM A;  1LAG E;  4ELP A;  2DE3 A;  2HXW A;  2O69 A;  2XHD A;  3MJN A;  2UVG A;  1EZ9 A;  1DK4 A;  2WBD A;  1BK4 A;  3TTK A;  4QFN A;  4LQ2 A;  4U1O A;  2I0C A;  4IR8 A;  5IZ3 B;  1SI1 A;  3LV0 A;  3E79 A;  4GWW A;  1LBZ A;  3TTR A;  1EH3 A;  5AA2 A;  1P1N A;  3KBZ A;  2F34 A;  4R2F A;  1B4Z A;  1O64 A;  2VGQ A;  3C4M A;  3CR9 A;  4LON B;  4RK9 A;  5DVJ A;  1FPK A;  2CZL A;  2WYK A;  1O63 A;  2ZZW A;  4F3G A;  1NMU A;  4H67 A;  1AH5 A;  3CSG A;  1JP4 A;  1MQG A;  4PF8 A;  1PBP A;  3O28 A;  3EKI A;  5TU0 A;  2XXU A;  4M4G A;  4FOR A;  2Y7R A;  5AA4 A;  1OMP A;  4MHF A;  4BDQ A;  3E4R A;  4GOT A;  4H8J A;  2NUV A;  2Z8F A;  3JV9 A;  1MS7 A;  5FBP A;  3GBA A;  2REG A;  3S4U A;  5ET7 A;  1MQD A;  1B4H A;  2BJJ X;  1JQF A;  4KHZ E;  4LN5 A;  4L17 A;  3F11 A;  1N0T A;  2RCA A;  1S7Y A;  4G68 A;  5I2K A;  1MY2 A;  4IO4 A;  2F8D A;  4H65 A;  5TPA A;  4BDM A;  1FPF A;  1NV4 A;  1URG A;  2DDK A;  2DE2 A;  1NUW A;  3IR1 A;  2DXY A;  1OVB A;  3TCG A;  4OZ9 A;  3MZ1 A;  3N5L A;  1ATG A;  5I57 B;  3KZG A;  3MZ9 A;  4HXV A;  4N6K A;  4GD5 A;  4FEC A;  4HTG A;  3IOW A;  5I7I A;  2CEY A;  4YB7 A;  1Y1Z A;  1O7T A;  1CB6 A;  4GWX A;  5I58 B;  3FAS A;  1IXC A;  4HW8 A;  5DVF A;  1YZ0 A;  4I40 A;  3MVZ A;  2DYX A;  2ESN A;  3G7W A;  4N4U A;  1B05 A;  3IJX B;  1UIV A;  4GQO A;  1XVX A;  1VFE A;  1QUL A;  3G3K A;  1FTM A;  4ONY A;  5ICQ A;  4Q30 B;  1D3K A;  1PC3 A;  1MH3 A;  4I62 A;  4N91 A;  3QMF A;  2XXH A;  3U8Q A;  1JVY A;  1TFA A;  3RPW A;  1Y1M A;  4PFU A;  3C32 A;  4NWD A;  4Q5T A;  3TDJ A;  3PUZ E;  1NV2 A;  1OLC A;  2IA4 A;  1AL3 A;  3PPP A;  1JEU A;  1JVX A;  3KFM A;  4G8N A;  1NNT A;  3ILU B;  3RPL B;  1FPD A;  3G3I A;  3IB2 A;  5EYG A;  1B3F A;  2Q74 A;  5J16 A;  1B7H A;  1FTL A;  1EZO A;  1M5F A;  4ELR A;  1QJM A;  1MY1 A;  3SEY A;  1A40 A;  3D4G A;  1B51 A;  4H46 A;  3DEL B;  1FJ6 A;  4IO5 A;  4MF3 A;  5CMC A;  2PX1 A;  4X48 A;  1MPD A;  2F3D A;  2RC9 A;  2ONS A;  5LDZ A;  3THI A;  1ZU0 A;  4KFQ A;  2NWJ A;  1MXZ A;  5AA2 D;  4R75 A;  4PAK A;  3EQ1 A;  3C34 A;  4F18 A;  3VVD A;  4Q0C A;  2DOJ A;  1B3G A;  3UGW A;  2XXK A;  3FVG A;  1KA1 A;  1S9T A;  4NF8 A;  2RF1 A;  1FBF A;  3HFU A;  2BJI A;  5A5X A;  2ZYK A;  1INP A;  2H4I A;  2Z23 A;  1IME A;  5I59 A;  2ONK E;  4MMP A;  3C9H A;  4ELO A;  1SBP A;  1SW4 A;  1R9Q A;  3TQL A;  3EHS A;  3FD3 A;  4F1V A;  2CMO A;  2F36 A;  1B40 A;  3DP6 A;  2E1S A;  3W9V A;  4GWS A;  2CEX A;  1FTA A;  2PFZ A;  3KN8 A;  4U23 A;  4NF5 B;  1F9B A;  5EQ7 A;  4O3C A;  3BFT A;  5BWJ A;  3IK6 B;  1M5C A;  3O2A A;  5CC2 A;  1IEJ A;  3PMX A;  2HZK A;  2D5W A;  2M8C A;  5CM6 A;  3D1R A;  1MH4 A;  2XXW A;  4ECF A;  2O6A A;  1JW5 A;  2PVU A;  3KEI A;  3LC8 A;  3FV1 A;  4FIM A;  5EYH A;  5ITP A;  4RPO A;  2I58 A;  4FAJ A;  3K1N A;  1EYK A;  3FV2 A;  4PGN A;  3K6V A;  2Q8J A;  4HS7 A;  3V83 A;  3FUZ A;  2I48 A;  4QFL A;  3MC2 A;  1NUX A;  4G68 B;  2F7A A;  4JB7 A;  1JEV A;  4Q8R A;  4I9D A;  2OLB A;  4IO3 A;  3EN3 A;  3QXM A;  2O1L A;  4R6K A;  2QVU A;  1NV3 A;  5I84 A;  1ZLQ A;  3USD A;  4YIC A;  4NF6 A;  3T9V A;  2YJP A;  1IIW A;  3VLU A;  5LTC A;  4HE0 A;  2HZL A;  4OVP A;  3MYU A;  4K3F A;  2OWS A;  2XX7 A;  3ISP A;  4DCX A;  4P1E A;  4GXS B;  1IMD A;  1LB9 A;  4NGU A;  3KN3 A;  2FYI A;  4LQ5 A;  3WAF A;  3CRB A;  1B5J A;  3PPO A;  2H25 A;  2ZNU A;  3LR1 A;  4YKJ A;  4P56 A;  3IAZ A;  5DTB A;  5BUU A;  2HEU A;  3CFZ A;  4QBA A;  1EYJ A;  3OMB A;  4MEV A;  5HBC A;  3LUY A;  3TEP A;  2RC7 A;  3LUZ A;  1NNP A;  3P7I A;  2UVI A;  2QS3 A;  1P1W A;  2I49 A;  4YKP A;  2B65 A;  4GIZ A;  1ZKB A;  3PUW E;  3IOT A;  2O68 A;  3H3G A;  4LVQ A;  4PE5 B;  1FPL A;  3RY3 A;  1RDZ A;  3KC1 A;  3A3C A;  1FBC A;  5L8D A;  1HSE A;  4I3Y A;  4Z7E A;  2PT1 A;  1FQA A;  1S50 A;  2P3N A;  3IO6 A;  4DDD A;  4OFO A;  4EUO A;  4X8R A;  5FTI A;  2OWZ A;  3SET A;  2Y5K A;  3ZSF A;  3IJO B;  3IB0 A;  4ZEK A;  5IGA A;  1Q9D A;  2VOZ A;  3GLB A;  4ZDM A;  2CZK A;  3KJ7 A;  1SPI A;  2WEF A;  1DOT A;  1MPC A;  1N84 A;  3MAM A;  2ZZV A;  2H9B A;  1B58 A;  4TQU Q;  4PFW A;  3EF7 A;  1FPE A;  3FVK A;  1US4 A;  4JSD A;  1TWY A;  4N15 A;  1URD A;  4H45 A;  2XWO A;  4G68 C;  3GZG A;  4QSE A;  1H3D A;  1B3L A;  3Q28 A;  1NL5 A;  1R9L A;  3IO4 A;  3T0J A;  5J1D A;  2XXY A;  3S9N C;  4POW A;  1NI9 A;  3D4C A;  2ZXT A;  1NNF A;  2F3B A;  2HHM A;  2I3W A;  1GVC A;  4PAI A;  5L9M A;  3E9X A;  4YMB A;  2L5V A;  2R6G E;  4N13 A;  3UN6 A;  2O51 A;  3VVE A;  3JYR A;  1M5B A;  5H8N A;  1JNF A;  1VR5 A;  1RDX A;  2AL4 A;  3MBP A;  3QAX A;  2Y7P A;  2QRY A;  4OEU A;  3T1B A;  1FW0 A;  5AA3 A;  4EQB A;  2UVJ A;  1R1N A;  3V8X B;  3IOR A;  3MP8 A;  1MQJ A;  2R8T A;  4NMY A;  5B70 A;  2ABH A;  5DW8 A;  2H5Y A;  1OQH A;  3ODB A;  1Y20 A;  1UTB B;  4MNI A;  5H8Q B;  4UAB A;  3R6U A;  4PFR A;  1N7W A;  2P1S A;  2THI A;  4PFI A;  2X7P A;  1PB8 A;  3TPA A;  4NN3 A;  3OOA A;  4NG7 A;  3TFL A;  1AWB A;  4DI3 D;  2Q88 A;  4EQ7 A;  2XWI A;  5I56 B;  1OLA A;  3E13 X;  4O7M A;  1N3X A;  2Q2A A;  1GR2 A;  5I2N B;  2HCA A;  4YB5 A;  1MXU A;  3LSL A;  3SZP A;  4NF6 B;  3H4Z A;  4ZEC A;  4KI0 E;  4E0W A;  1LCF A;  1LFG A;  2NOO A;  3KN7 A;  3TZA A;  2DWA A;  4OXV A;  1B5H A;  1ANF A;  3B6T A;  1LBX A;  4O7I A;  5A5L A;  3FBP A;  3SEU A;  2I4B A;  3DP8 A;  1XOC A;  4GL8 A;  2R71 A;  2B3B A;  2VP1 A;  5I3S A;  4LZ5 A;  4QF9 A;  4XKQ A;  1AOV A;  2XD2 A;  3OEN A;  4OFJ A;  1P1O A;  2QMX A;  4JDF A;  5EYF A;  2XXT A;  3SKP A;  3SEW A;  4OEN A;  5KCJ A;  3VXB A;  1B52 A;  3QUF A;  2HQ0 A;  1POT A;  1MY0 A;  3PPN A;  4OVQ A;  3TOD A;  1PB9 A;  4DZ1 A;  3FVO A;  4POX A;  1IMA A;  1H43 A;  3SDF A;  5CMB A;  4NF4 A;  1VE4 A;  3MWB A;  1FCK A;  3TEL A;  1MRP A;  5FTH A;  4PFY A;  2OJT A;  3MVX A;  1UTH A;  4FE8 A;  1L5T A;  2QVV A;  4NED A;  5DT6 A;  3UP9 A;  1FQC A;  4AB5 A;  1PB7 A;  4JXI A;  1ELJ A;  4DXC A;  1XT8 A;  4MNP A;  2FBP A;  4WEP A;  4H0W A;  4G8H A;  4MIJ A;  3O6I A;  4ZE8 A;  5HM4 B;  2VD2 A;  3RT8 A;  1SVX B;  1SYH A;  2OK2 A;  5F24 A;  3OSR A;  4LZ7 A;  4GF8 A;  1FRP A;  1LST A;  3W15 C;  2XWV A;  1Q1K A;  3ZS6 A;  4F2Q A;  4NHB A;  4THI A;  1QKB A;  3CG1 A;  3PD8 A;  3U1O A;  4DIG A;  2W7Y A;  1D4N A;  1A99 A;  2PYY A;  2VPN A;  1RKM A;  3K6X A;  4OET A;  5EHM A;  3VVF A;  3ZKL A;  3FJ7 A;  4OMB A;  3CG3 A;  4IGR A;  4OWD A;  1B5I A;  3DLN A;  3U72 A;  4OAN A;  4XFE A;  1MY4 A;  4NQ8 A;  1A7L A;  2AYS A;  2NXO A;  4MAG A;  3B6Q A;  3IFC A;  3S9L C;  3KBR A;  2V4C A;  4NAP A;  4ELQ A;  2AIX A;  3A3U A;  1NV5 A;  2Z8E A;  5H8H B;  2I3V A;  1KA0 A;  5H8F B;  2XX8 A;  2OX3 A;  4ZZE A;  3IFA A; 
#chains in the Genus database with same CATH homology
 5ISU A;  4KR5 A;  4F22 A;  3H03 A;  4Z0I A;  5K2X A;  3K2D A;  3S9M C;  4BDR A;  4QFO A;  4HCY A;  3TMG A;  3SEV A;  1TT1 A;  1MPB A;  4QFP A;  1Y3Q A;  3AXF A;  2QS2 A;  1B32 A;  2V93 A;  4ZZA A;  1R6Z A;  2GHB A;  2Q89 A;  3I6V A;  1D9Y A;  4C0R A;  1P99 A;  4EF2 A;  3ECR A;  5F7V A;  1XS5 A;  3FAT A;  1AMF A;  3UK4 A;  3CFX A;  3PU5 A;  2FNC A;  3HCQ A;  4FED A;  4ZEB A;  2DWH A;  4G4P A;  3K0V A;  5AA2 B;  4ZE9 A;  4OVJ A;  1IXI A;  2KLF A;  3RQT A;  3FJG A;  3KOT A;  4IY5 A;  4OEV A;  3KJT A;  1WDN A;  3LSX A;  1LCT A;  4ZEF A;  5KDT A;  5AA4 B;  1LAH E;  3RNN A;  1P1U A;  4NF4 B;  4BDL A;  1UIU A;  2Y7K A;  1B7U A;  3I5O A;  1VSO A;  3V89 B;  1BIY A;  1DSN A;  3ILT B;  5I2K B;  5TPA B;  3R26 A;  2ZYN A;  4ISU A;  3MPK A;  2XXV A;  4XIG Q;  4OHN A;  3HST A;  2P0S A;  1JW1 A;  3FXR A;  1B0L A;  4TOZ A;  3RLF E;  1B6H A;  1IUD A;  1OVT A;  3N94 A;  2RIN A;  1ZIU A;  3GXA A;  1A8F A;  5CMK A;  1Y4T A;  4RPN A;  3IOV A;  1ZTY A;  3RGY A;  2G93 A;  3A09 A;  1IIT A;  3VE1 B;  5CMM A;  4U4X A;  4F2O A;  2RC8 A;  3CIJ A;  4F29 A;  3DP4 A;  3HPI A;  1A8E A;  4MH5 A;  4BDN A;  1ZMG A;  2X26 A;  1LFI A;  1EZP A;  1NH7 A;  2O1M A;  2F7C A;  2GRV A;  1MXY A;  4GLI A;  4O3A A;  3LSW A;  1OIB A;  2H98 A;  5JTY A;  3G3G A;  5M2V A;  4GWO A;  3GBB A;  1N7X A;  4U2R A;  3K02 A;  2Y7I A;  2AL5 A;  4R9G A;  3S9E A;  2P2A A;  4I8C A;  3OD7 A;  1J1N A;  3FGS A;  3UOR A;  4YB6 A;  2ALU A;  3O9P A;  3DM0 A;  3OSQ A;  2ANJ A;  1MM6 A;  4U4S A;  4G2Z A;  2Q9T A;  1FTO A;  3WAE A;  3K1P A;  2D3I A;  2QPQ A;  4JBZ A;  1WVJ A;  4YZZ A;  4X1D A;  2HFB A;  2F6G A;  1MXW A;  2UYF A;  2DSF A;  3T9U A;  5CI5 A;  4F39 A;  3BFU A;  2QSX A;  1H45 A;  3K6U A;  1LGB C;  4R9F A;  1IQ7 A;  5I57 A;  4I1D A;  1KWH A;  3FVN A;  1B3E A;  1YTV A;  4NF8 B;  1RYO A;  4F3S A;  5A5X B;  3TAJ A;  4X9T A;  3PUV E;  5I59 B;  3QYT A;  3RT6 B;  3PMW A;  3CI8 A;  5I58 A;  1LAX A;  1BLF A;  1QKA A;  1US5 A;  4LUB A;  2O84 X;  3CVG A;  4QSC A;  4WKM A;  4NWC A;  3K00 A;  1DPP A;  3O6H A;  3IX1 A;  1MXV A;  2FA7 A;  2V3U A;  5DVI A;  4ESX A;  5ICT A;  4O3B A;  4H8I A;  2ONR A;  4KYD A;  4FAT A;  4GVO A;  2A5T A;  2Z8D A;  4KD5 A;  4P0I A;  3I3V A;  3FXU A;  2D21 A;  2DWJ A;  2YLN A;  3HHF A;  1TXF A;  1LBB A;  3T22 A;  3IOU A;  3RTW B;  4F1Y A;  5JEI A;  1LLS A;  1Z7M E;  3K1M A;  1SW1 A;  4AB6 A;  5L9O A;  4R6Y A;  1QW0 A;  1SDX A;  3C31 A;  3H7M A;  4GL0 A;  4H5G A;  3MP6 A;  4RY1 A;  3FJM A;  2F97 A;  3LSF B;  4TLL B;  4DXB A;  4GXA A;  3E3K A;  1D9V A;  1PBQ A;  3H6T A;  3U94 A;  4MFI A;  5JK4 A;  4DCY A;  2VD3 A;  1N04 A;  2GH9 A;  1Y3N A;  1GTK A;  2QL3 A;  3EHT A;  4JWO A;  4R74 A;  4HCW A;  1MDP 1;  3PV0 E;  3Q25 A;  4KCC A;  1FTK A;  2DWI A;  3BKI B;  3OO8 A;  2DP8 A;  4IGT A;  2V3T A;  5K2Y A;  5FHO A;  3VFJ A;  2IEE A;  1M5E A;  1MDQ A;  4KPT A;  4U21 A;  5F1Q A;  5JTY B;  4P0G A;  1UQW A;  3FZV A;  1SD3 A;  1USY H;  1NH8 A;  4NF5 A;  3L6H A;  4U1Z A;  4AQ4 A;  2QJE A;  1B7Z A;  2XXR A;  3PUY E;  4DE8 A;  1FQB A;  4N07 A;  2YPN A;  4F3B A;  1FQD A;  4PET A;  4DLD A;  1MQH A;  3B7D A;  3B6W A;  3KSX A;  4BLA A;  3OXN A;  4F19 A;  1FTJ A;  1RYX A;  3KSJ A;  3TCH A;  3G3F A;  4RYA A;  3UIF A;  3PPQ A;  3ONM A;  1GGG A;  2F6P A;  2O7I A;  2DE4 A;  3HN0 A;  5B7D A;  2REJ A;  4IO7 A;  4XTC Q;  3CFL A;  4OQO A;  3Q26 A;  3IB1 A;  5IKB A;  3N26 A;  4RA1 A;  3TUS A;  3T9X B;  4OES A;  2QMW A;  2OWT A;  1FQF A;  2DVC A;  2F35 A;  3QSL A;  2O7U A;  4EF1 A;  3EHU A;  1B3H A;  2R9J A;  5H8N B;  1DMB A;  4RK2 A;  1LB8 A;  3K6W A;  5CRY A;  4KYS A;  3VXC A;  3UA8 A;  1Y9U A;  1WOD A;  3N6U A;  4OYV A;  1NFT A;  4ESW A;  3MP1 A;  3TCF A;  4WXJ A;  3O97 A;  2F78 A;  2Y84 A;  1MXX A;  5LOM A;  1Y3P A;  2A5T B;  3Q27 A;  1MQI A;  3PD9 A;  5DEX A;  4DXU A;  1MM7 A;  3CSB A;  4P11 A;  3IL1 B;  1Y4C A;  2I6E A;  1PEB A;  5TP9 A;  4MLQ A;  2PBW A;  3H06 B;  1SW5 A;  2H99 A;  4TLM B;  1BTJ A;  3M3L A;  4U22 A;  4UAC A;  4KQP A;  4PQJ A;  4EXK A;  1CE2 A;  4LP2 B;  1GV8 A;  1IXG A;  4C1T A;  4ZEI A;  3QIM A;  2PT2 A;  3T9H B;  2V3Q A;  4QHQ A;  2F7B A;  3N6T A;  1N76 A;  3SER A;  4X1B A;  5CBR A;  3FIR A;  3K4U A;  4BDO A;  3OEK A;  1QVS A;  3OO7 A;  3U93 A;  2HAV A;  2UXA A;  1USY E;  3PUX E;  1I69 A;  4EDP A;  3KGC A;  4MLV A;  5DYH A;  1YCJ A;  4IO6 A;  1HSJ A;  4MBP A;  2I4C A;  3VDF A;  3MPL A;  1DPE A;  3QK6 A;  1M5D A;  4C1U A;  2NVU B;  4GRK A;  1NKX A;  5KCJ B;  3TTL A;  3VLW A;  4XKR A;  1P1Q A;  4UA8 A;  4QSD A;  1NNK A;  1AIV A;  3OO6 A;  4G8M A;  1IZ1 A;  3MQ9 A;  4G77 A;  3S2V A;  3SEX A;  1LFH A;  5H8S A;  3PPR A;  1I6B A;  2XX9 A;  2XXQ A;  1UTB A;  1ZBM A;  4ND9 A;  1Z7N E;  5H8Q A;  1QUJ A;  1UTH B;  5AE4 A;  5IAI A;  4RJZ A;  3RTF B;  3M3F A;  4ZED A;  2OCU A;  5ELV A;  2ZYM A;  2OZZ A;  4WED A;  1B46 A;  4JWX A;  5KZT A;  4XKP A;  5I56 A;  5L9S A;  4XXU A;  4NE4 A;  4R73 A;  5I2N A;  1QUI A;  3T66 A;  3TKD A;  1SQY A;  3MW0 A;  1XHY A;  3LBS A;  1DTZ A;  2DVZ A;  4LZ8 A;  2RKM A;  3TYH A;  2HAU A;  1QUK A;  2X7Q A;  4JSO A;  3C35 A;  3MZB A;  4H6D A;  1XVY A;  4GFR A;  1B1X A;  2XXI A;  3KOS A;  3RN8 A;  3W9W A;  1LAF E;  4FEB A;  4YAH X;  1OQG A;  3OO9 A;  4ZS9 A;  1SW2 A;  1TFD A;  2A5S A;  1YPN A;  1T0K A;  4PFT A;  3V5A A;  3C36 A;  3O29 A;  1MG1 A;  4H1X A;  5ITO A;  2ZNS A;  2B3F A;  1I6A A;  1POY 1;  2DS9 A;  2QS4 A;  5FHN A;  4QRZ A;  3H6U A;  2V84 A;  3T96 B;  4LA9 A;  2XXP A;  2DXR A;  2XXX A;  4NTL A;  2I0B A;  1I6Q A;  4PP0 A;  4F3P A;  4IO2 A;  1HSL A;  4KYE A;  1II5 A;  3MUQ A;  2GFE A;  3SES A;  3TQW A;  5HPQ A;  2Q2C A;  5CBS A;  5DEX B;  1B0H A;  3T93 B;  3VV5 A;  1H76 A;  1JET A;  3Q29 A;  4YKK A;  3EPE A;  2G29 A;  3HO7 A;  3HHG A;  2DQV A;  2Z22 A;  1A55 A;  3PGF A;  2VHA A;  1URS A;  2RCB A;  4IB2 A;  4RNS A;  5TP9 B;  3VLV A;  4H5F A;  1N3W A;  4FJP A;  4LAT A;  2OBG A;  1EU8 A;  1LBC A;  3MVW A;  4R2B A;  3M8U A;  1ZJL A;  1Q35 A;  3K01 A;  3JZJ A;  1DTG A;  2F5X A;  1H44 A;  4OFL A;  3U92 A;  2E0S A;  2PMS A;  3M3K A;  4N6P A;  4R72 A;  4F31 B;  4RXL A;  1JW4 A;  2ZNT A;  3H6W A;  1VFD A;  3G3J A;  3ZKK A;  5AA1 A;  1SI0 A;  2WKY A;  2Y7W A;  4YMA A;  2QS1 A;  3R7X A;  4IY6 A;  2UVH A;  3OEM A;  1A54 A;  4EQ9 A;  1SYI A;  3MVY A;  1B2H A;  3OEL A;  2ZMB A;  4F1U A;  1B1H A;  4OTE A;  3O6G A;  1FQE A;  1XC1 A;  3L6G A;  1BP5 A;  1B9J A;  5KDT B;  4EXL A;  5EHS A;  3RUM A;  5FHM A;  3QUJ A;  1PDA A;  2V25 A;  3C33 A;  3H6V A;  3BBR A;  1MY3 A;  4KCD A;  5H8H A;  3TTN A;  4XKN A;  4QFK A;  5H8F A;  2GHA A;  1IXH A;  2LAO A;  3HV1 A;  2ZYO A;  4YU0 A;  1YAE A;  3KG2 A;  2UYE A;  1BKA A;  3G3H A;  4R6H A;  2XD3 A;  3PMV A;  4JWY A;  4OER A;  4M1V A;  3O66 A;  4E0X A;  4YKI A;  3FXQ A;  3TTM A;  1LAG E;  4ELP A;  2DE3 A;  2HXW A;  2O69 A;  2XHD A;  3MJN A;  2UVG A;  1EZ9 A;  3TTK A;  4QFN A;  4LQ2 A;  4U1O A;  2I0C A;  1SI1 A;  3TTR A;  1EH3 A;  5AA2 A;  1P1N A;  2F34 A;  4R2F A;  1B4Z A;  1O64 A;  2VGQ A;  3C4M A;  3CR9 A;  4LON B;  4RK9 A;  5DVJ A;  2CZL A;  1O63 A;  4F3G A;  1NMU A;  4H67 A;  1AH5 A;  3CSG A;  1MQG A;  1PBP A;  3O28 A;  5TU0 A;  2XXU A;  4M4G A;  4FOR A;  5AA4 A;  2Y7R A;  1OMP A;  4BDQ A;  3E4R A;  4GOT A;  4H8J A;  2NUV A;  2Z8F A;  3JV9 A;  1MS7 A;  3GBA A;  2REG A;  3S4U A;  1MQD A;  1B4H A;  2BJJ X;  1JQF A;  4KHZ E;  4L17 A;  3F11 A;  1N0T A;  2RCA A;  1S7Y A;  4G68 A;  5I2K A;  1MY2 A;  4IO4 A;  2F8D A;  4H65 A;  5TPA A;  4BDM A;  1URG A;  2DE2 A;  3IR1 A;  2DXY A;  3TCG A;  1OVB A;  4OZ9 A;  3MZ1 A;  3N5L A;  1ATG A;  5I57 B;  3KZG A;  3MZ9 A;  4GD5 A;  4FEC A;  4HTG A;  3IOW A;  4YB7 A;  1Y1Z A;  1O7T A;  1CB6 A;  5I58 B;  3FAS A;  1IXC A;  4HW8 A;  5DVF A;  3MVZ A;  2DYX A;  2ESN A;  3G7W A;  1B05 A;  3IJX B;  1UIV A;  4GQO A;  1XVX A;  1VFE A;  1QUL A;  3G3K A;  1FTM A;  4ONY A;  5ICQ A;  4Q30 B;  1D3K A;  1PC3 A;  1MH3 A;  4I62 A;  2XXH A;  3U8Q A;  1JVY A;  1TFA A;  3RPW A;  1Y1M A;  4PFU A;  3C32 A;  4NWD A;  4Q5T A;  3TDJ A;  3PUZ E;  1OLC A;  2IA4 A;  1AL3 A;  3PPP A;  1JEU A;  1JVX A;  3KFM A;  4G8N A;  1NNT A;  3ILU B;  3G3I A;  3IB2 A;  1B3F A;  1B7H A;  1FTL A;  1EZO A;  1M5F A;  4ELR A;  1QJM A;  1MY1 A;  3SEY A;  1A40 A;  3D4G A;  1B51 A;  3DEL B;  4IO5 A;  4MF3 A;  5CMC A;  2PX1 A;  4X48 A;  1MPD A;  2RC9 A;  2ONS A;  3THI A;  1ZU0 A;  4KFQ A;  2NWJ A;  1MXZ A;  5AA2 D;  4R75 A;  3EQ1 A;  3C34 A;  4F18 A;  3VVD A;  4Q0C A;  2DOJ A;  1B3G A;  3UGW A;  3FVG A;  1S9T A;  4NF8 A;  2RF1 A;  5A5X A;  2ZYK A;  2H4I A;  2Z23 A;  5I59 A;  2ONK E;  3C9H A;  4ELO A;  1SBP A;  1SW4 A;  1R9Q A;  3TQL A;  3EHS A;  3FD3 A;  4F1V A;  2CMO A;  2F36 A;  1B40 A;  3DP6 A;  2E1S A;  3W9V A;  3KN8 A;  4U23 A;  4NF5 B;  1F9B A;  4O3C A;  3BFT A;  5BWJ A;  3IK6 B;  1M5C A;  3O2A A;  5CC2 A;  1IEJ A;  3PMX A;  2HZK A;  2D5W A;  2M8C A;  5CM6 A;  1MH4 A;  2XXW A;  4ECF A;  2O6A A;  1JW5 A;  2PVU A;  3KEI A;  3LC8 A;  3FV1 A;  4FIM A;  5ITP A;  4RPO A;  2I58 A;  4FAJ A;  3K1N A;  3FV2 A;  3K6V A;  2Q8J A;  4HS7 A;  3V83 A;  3FUZ A;  2I48 A;  4QFL A;  3MC2 A;  4G68 B;  2F7A A;  4JB7 A;  1JEV A;  4Q8R A;  4I9D A;  2OLB A;  4IO3 A;  3EN3 A;  3QXM A;  2O1L A;  4R6K A;  5I84 A;  1ZLQ A;  3USD A;  4YIC A;  4NF6 A;  3T9V A;  2YJP A;  1IIW A;  3VLU A;  2HZL A;  4K3F A;  2OWS A;  2XX7 A;  4DCX A;  4GXS B;  1LB9 A;  3KN3 A;  2FYI A;  4LQ5 A;  3WAF A;  3CRB A;  1B5J A;  3PPO A;  2H25 A;  2ZNU A;  3LR1 A;  4YKJ A;  3IAZ A;  5DTB A;  5BUU A;  2HEU A;  3CFZ A;  3OMB A;  5HBC A;  3LUY A;  3TEP A;  2RC7 A;  1NNP A;  3P7I A;  2UVI A;  2QS3 A;  1P1W A;  2I49 A;  4YKP A;  2B65 A;  4GIZ A;  1ZKB A;  3PUW E;  3IOT A;  2O68 A;  3H3G A;  4LVQ A;  4PE5 B;  3RY3 A;  3A3C A;  5L8D A;  1HSE A;  4Z7E A;  2PT1 A;  1FQA A;  1S50 A;  3IO6 A;  4DDD A;  4OFO A;  4EUO A;  5FTI A;  3SET A;  3ZSF A;  3IJO B;  3IB0 A;  4ZEK A;  2VOZ A;  3GLB A;  4ZDM A;  3KJ7 A;  1DOT A;  1MPC A;  1N84 A;  3MAM A;  2H9B A;  1B58 A;  4TQU Q;  4PFW A;  3EF7 A;  3FVK A;  1US4 A;  4JSD A;  1TWY A;  1URD A;  4G68 C;  3GZG A;  4QSE A;  1H3D A;  1B3L A;  3Q28 A;  1NL5 A;  1R9L A;  3IO4 A;  5J1D A;  2XXY A;  3S9N C;  4POW A;  3D4C A;  2ZXT A;  1NNF A;  2I3W A;  1GVC A;  5L9M A;  3E9X A;  4YMB A;  2R6G E;  4N13 A;  3UN6 A;  2O51 A;  3VVE A;  3JYR A;  1M5B A;  5H8N A;  1JNF A;  1VR5 A;  2AL4 A;  3MBP A;  3QAX A;  2Y7P A;  2QRY A;  4OEU A;  1FW0 A;  5AA3 A;  4EQB A;  2UVJ A;  1R1N A;  3V8X B;  3IOR A;  3MP8 A;  1MQJ A;  4NMY A;  5B70 A;  2ABH A;  2H5Y A;  1OQH A;  3ODB A;  1Y20 A;  1UTB B;  5H8Q B;  3R6U A;  1N7W A;  2P1S A;  2THI A;  3TPA A;  2X7P A;  1PB8 A;  3OOA A;  3TFL A;  2Q88 A;  4EQ7 A;  5I56 B;  1OLA A;  3E13 X;  1N3X A;  2Q2A A;  1GR2 A;  5I2N B;  2HCA A;  4YB5 A;  1MXU A;  3LSL A;  4NF6 B;  3H4Z A;  4ZEC A;  4KI0 E;  4E0W A;  1LCF A;  1LFG A;  2NOO A;  3KN7 A;  3TZA A;  2DWA A;  4OXV A;  1B5H A;  1ANF A;  3B6T A;  3SEU A;  2I4B A;  3DP8 A;  1XOC A;  4GL8 A;  2R71 A;  2B3B A;  2VP1 A;  4LZ5 A;  4QF9 A;  4XKQ A;  1AOV A;  2XD2 A;  3OEN A;  4OFJ A;  1P1O A;  2QMX A;  4JDF A;  5EYF A;  2XXT A;  3SKP A;  3SEW A;  4OEN A;  5KCJ A;  3VXB A;  1B52 A;  3QUF A;  2HQ0 A;  1POT A;  1MY0 A;  3PPN A;  3TOD A;  1PB9 A;  4DZ1 A;  3FVO A;  4POX A;  1H43 A;  3SDF A;  5CMB A;  4NF4 A;  1VE4 A;  3MWB A;  1FCK A;  3TEL A;  1MRP A;  5FTH A;  4PFY A;  2OJT A;  3MVX A;  1UTH A;  4FE8 A;  1L5T A;  4NED A;  5DT6 A;  3UP9 A;  1FQC A;  4AB5 A;  1PB7 A;  4JXI A;  1ELJ A;  4DXC A;  1XT8 A;  4WEP A;  4H0W A;  4G8H A;  3O6I A;  4ZE8 A;  5HM4 B;  2VD2 A;  3RT8 A;  1SVX B;  1SYH A;  2OK2 A;  3OSR A;  4LZ7 A;  4GF8 A;  1LST A;  3W15 C;  1Q1K A;  3ZS6 A;  4F2Q A;  4THI A;  1QKB A;  3CG1 A;  3PD8 A;  3U1O A;  4DIG A;  2W7Y A;  1D4N A;  1A99 A;  2PYY A;  1RKM A;  3K6X A;  4OET A;  5EHM A;  3VVF A;  3ZKL A;  3FJ7 A;  4OMB A;  3CG3 A;  4IGR A;  4OWD A;  1B5I A;  3DLN A;  3U72 A;  1MY4 A;  1A7L A;  2AYS A;  2NXO A;  3B6Q A;  3S9L C;  3KBR A;  4ELQ A;  2AIX A;  3A3U A;  5H8H B;  2Z8E A;  2I3V A;  5H8F B;  2XX8 A;  4ZZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...