4XXUA

Moda - chromate bound
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
231
structure length
231
Chain Sequence
GKITVFAAASLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTLLGNSLVVVAPKASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPVAVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Molybdate-binding periplasmic protein
publication title Structure of chromate bound ModA from E.coli at 1.43 Angstroms resolution.
rcsb
source organism Escherichia coli (strain k12)
total genus 78
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4xxuA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4xxuA02
4F29A 1B7HA 2XHDA 3CVGA 3M3FA 4LP2B 3KSXA 1OQHA 1URGA 2I58A 4F18A 3WAEA 3VLVA 2GFEA 4PFTA 5H8QA 3O9PA 1N3XA 1POY1 3ZSFA 1NH7A 4ISUA 4ONYA 1R6ZA 3DELB 3OO6A 1EH3A 3MC2A 3FV2A 2OCUA 1I6QA 3V89B 1B1XA 5CBSA 5KCJB 4R6HA 3EF7A 3PPRA 5H8NA 3VVDA 5CMCA 4C1TA 4PP0A 3QAXA 1MY3A 4XKRA 1Y3NA 2F7CA 5TU0A 2H4IA 2A5TB 3CRBA 3FVGA 1JVXA 3V83A 3KJTA 2XXYA 3M8UA 2ESNA 1BLFA 3WAFA 3OO9A 4H8IA 5M2VA 1MXVA 3IO6A 5ICTA 1P1WA 2GHBA 4NEDA 4OYVA 3MVWA 1N3WA 3LUYA 2V25A 4F2OA 4KD5A 5JK4A 2NUVA 3PD9A 1N7XA 3KEIA 3T93B 4GD5A 4IB2A 5KZTA 4P0IA 1AH5A 3PUZE 1M5EA 2ZNTA 1JW1A 3UA8A 2OK2A 4C1UA 3R6UA 3AXFA 2V3UA 5DVFA 1PB8A 2XXPA 3THIA 1EZPA 1DOTA 5I57B 1S7YA 4F3PA 2P2AA 1MY1A 1IQ7A 3EHTA 3IB0A 4IO6A 4GWOA 2AL5A 4NF8B 1LFGA 5DEXB 3OEMA 3Q29A 3S9LC 4DIGA 4LA9A 2KLFA 2Y7RA 5I56B 3CSGA 4YKPA 1NNTA 1RYOA 2ZXTA 3EHSA 2BJJX 4YAHX 3GBBA 3VVEA 2DWHA 5K2YA 1XHYA 3IOUA 4MFIA 5FTIA 4U4SA 1MQIA 1BTJA 4F3SA 3T22A 3HSTA 1LBBA 3A09A 5KDTA 4G68A 2REJA 4RY1A 4QSDA 1HSLA 1MY2A 2Q2AA 2O1LA 2O68A 4NMYA 5TPAA 4LVQA 1SW4A 5K2XA 4Q0CA 4NF6A 3H6VA 4YB5A 3E13X 2YLNA 1NKXA 1JVYA 5B7DA 3MP8A 5L9OA 1B4HA 4R2FA 3Q26A 3E3KA 1XS5A 4HTGA 1I69A 3I6VA 3S4UA 4H0WA 3U8QA 3TMGA 3LC8A 1LFHA 1Y9UA 4N13A 1B0HA 3LSWA 4N07A 3K2DA 1LAHE 1ZJLA 2O7UA 2DOJA 2I3WA 3IK6B 3TELA 1OLCA 2VP1A 4NF4A 1YAEA 1DSNA 4IY5A 3K01A 1SW5A 4UACA 3OENA 3H03A 2H25A 3HHFA 1PB7A 3HCQA 3MPKA 4RA1A 5H8NB 1AOVA 4KYDA 3C36A 4LQ2A 3FXUA 4FJPA 2DXYA 3OELA 4ZEDA 2XD2A 3RLFE 4KYSA 4ELRA 3L6HA 5KCJA 4I62A 3VXCA 2HAUA 4GXAA 2O84X 4EF1A 2ONRA 4IO5A 3C32A 1Z7NE 5I59A 1SW2A 1FCKA 1IXHA 4F1VA 3PV0E 1SBPA 3OXNA 2DWJA 1HSEA 3D4GA 3H6TA 4X1BA 1B6HA 1B3GA 3ILUB 2R9JA 4ZS9A 3IX1A 4KQPA 3C34A 2THIA 5I84A 1A8EA 4LONB 1MXZA 3ODBA 1URSA 1M5BA 1IEJA 4X48A 1MXUA 2XXTA 3T66A 4EXLA 1M5DA 1JEUA 4H1XA 4R75A 2AIXA 2XXUA 4P0GA 3ONMA 2F6GA 1VE4A 4BDLA 1TFDA 3HN0A 3EQ1A 5EHMA 2R6GE 2DVCA 2Y7IA 3T9XB 2AYSA 2I6EA 3G3GA 3FJGA 4G2ZA 1IZ1A 2OWSA 4DCYA 3SEWA 4U1ZA 1PC3A 4IO3A 4NF8A 2QS1A 2O1MA 5FHNA 1SYHA 1B40A 1R9QA 1IIWA 1IXIA 3IORA 3FVKA 1S9TA 5FHMA 4Q30B 5KDTB 3SERA 1IXCA 1Y4TA 4JWOA 1N76A 3MVZA 1UTHB 5AA1A 5ISUA 1UTBA 4NF5A 2ALUA 3G3KA 2UXAA 5ELVA 2B3BA 5ITOA 2V93A 1SI0A 4I9DA 1B05A 3KN3A 3EN3A 3E9XA 5L8DA 1ZMGA 1VSOA 2I3VA 3KJ7A 1D3KA 2XX7A 2F78A 4NE4A 3OO7A 1ZTYA 4XIGQ 2Q8JA 4F2QA 2D3IA 3FUZA 4JB7A 1B52A 1ZLQA 4X9TA 3G3HA 2DQVA 2E0SA 1CB6A 2XXXA 4OQOA 4DCXA 1IUDA 2VOZA 2D5WA 2F6PA 4PFWA 4PQJA 4EXKA 4NF4B 4LATA 4M4GA 3V8XB 3RN8A 3RY3A 4R2BA 3IOWA 1QUKA 3FZVA 3O6HA 2O51A 2PT1A 3Q25A 4QFOA 3B7DA 3W9WA 3PPNA 3K1NA 3T9HB 1KWHA 4UA8A 2GHAA 2ZNUA 2DYXA 2Q88A 3QSLA 5HPQA 1LB9A 1PB9A 1SQYA 3N94A 4QSCA 5HM4B 4K3FA 1OLAA 1MY4A 1MDQA 2XX8A 3DP4A 2Q89A 2RKMA 1A54A 2O7IA 3MPLA 2V84A 4E0WA 3CSBA 4OFOA 2DE2A 3TZAA 4X1DA 1B32A 3HHGA 3FVOA 1O63A 2FYIA 3H4ZA 1UIVA 1D4NA 4YKIA 3SESA 2V3TA 2I4CA 3U93A 4R72A 1M5FA 4N6PA 2ZYNA 4AQ4A 5I59B 3U94A 1JNFA 5F1QA 3VFJA 1D9VA 3IJOB 4ZZEA 4QHQA 3UORA 3CR9A 2F8DA 2I4BA 4F1UA 1Y3PA 2F97A 2Z23A 3VVFA 3PUWE 2OLBA 4ZEKA 3TPAA 3V5AA 4I8CA 4RK2A 4THIA 3KG2A 3B6QA 4JSOA 1USYH 3O29A 3K6XA 3UGWA 2UYFA 2QL3A 3H7MA 1GVCA 1YCJA 1US5A 1VFDA 5I2NB 2XXRA 1POTA 2VD3A 4U23A 1QJMA 3O6IA 2CMOA 2Y7WA 3G3IA 2DWAA 4PFYA 1H45A 3LR1A 1PEBA 3KFMA 5CRYA 1GR2A 3M3LA 1B3LA 3Q27A 3E4RA 1MXXA 4G4PA 3BFUA 4AB6A 2OWTA 2OJTA 1FQBA 4OXVA 5CM6A 2GRVA 4OESA 3O2AA 2I0BA 3W15C 4DE8A 3PUXE 3QIMA 3IOTA 3FVNA 1Y4CA 1B9JA 5L9MA 3OOAA 4E0XA 3CG1A 1JETA 1UIUA 4GFRA 4YB7A 1ATGA 1P1QA 3N26A 4MBPA 4O3CA 4NTLA 2O69A 3U1OA 3UP9A 4Q5TA 1A40A 4XTCQ 3KN8A 3FXRA 1LCFA 1UTBB 4NF5B 3HO7A 4YKKA 4POWA 4HCYA 1AMFA 5I58A 2ANJA 3R7XA 3SETA 3VV5A 3MP6A 5DVJA 1FQCA 2GH9A 1MXWA 4JSDA 4GVOA 4H65A 3H06B 4ECFA 5AA4A 1UTHA 3UK4A 2W7YA 4KPTA 3SKPA 3S9NC 5DTBA 4OZ9A 1B1HA 3TTRA 3RT6B 1TFAA 1B3HA 1SW1A 4ND9A 3HV1A 5JEIA 4OTEA 3S9EA 2PBWA 4OHNA 3FATA 3QUJA 4OMBA 4EDPA 1QKAA 4IY6A 1WDNA 3USDA 5H8HA 1OIBA 2PYYA 3MZBA 3MVYA 1UQWA 2LAOA 1B3EA 2HZKA 4F39A 3MZ1A 1Y3QA 1RKMA 1IITA 3ZKLA 1ELJA 3TTKA 4OEVA 2PVUA 1FW0A 3OEKA 2QS3A 4ESXA 2H98A 4TLLB 3EPEA 2I0CA 1B7UA 3RTFB 2QPQA 5EYFA 1M5CA 1ZBMA 4R73A 3BBRA 5AA2A 2I48A 3S9MC 1MDP1 2RCAA 5EHSA 1OMPA 3OD7A 2VHAA 1CE2A 3S2VA 1DMBA 3TDJA 3TODA 4KHZE 2UYEA 2X7PA 3TYHA 1B4ZA 3BKIB 3N6TA 1N7WA 2V3QA 2QS4A 4F3GA 3PPPA 4ZZAA 2QSXA 3H6WA 4FEDA 2XX9A 4QFKA 4G68C 5DT6A 3A3UA 2O6AA 1RYXA 3VLUA 4U1OA 1MXYA 4IGTA 2D21A 5ITPA 3KGCA 4OENA 3G3JA 1XOCA 1US4A 1XC1A 3FGSA 3KOSA 5DYHA 3N5LA 3IOVA 2XXVA 3IR1A 4GL0A 1XVXA 3C4MA 3TAJA 3TFLA 1FTOA 4R74A 3SEUA 2G29A 2H99A 5I2KA 4H5GA 1O64A 4FE8A 4U2RA 1MRPA 2XXQA 4XKQA 3F11A 5AA3A 1QKBA 5I2NA 1MPBA 3BFTA 4RPNA 1OVBA 1VR5A 2F35A 3IJXB 4RJZA 3KZGA 1DTZA 2PT2A 2HQ0A 2Y84A 1SD3A 1PDAA 2QS2A 2ZYOA 4F22A 4XKPA 3MWBA 2ZNSA 2X26A 1Y20A 4G8NA 4YZZA 4JXIA 4OETA 4U22A 5I58B 2CZLA 1IXGA 3FJ7A 2Y7PA 1XT8A 1LLSA 4BDOA 3G3FA 2F36A 3GZGA 5BWJA 3FV1A 2XD3A 4ZEBA 1A8FA 1ZKBA 3FASA 1LFIA 2RC8A 1WODA 5AA4B 5AE4A 1JEVA 1D9YA 3IL1B 2WKYA 1DTGA 2RC7A 1II5A 1YTVA 2OBGA 1B3FA 5IKBA 3GBAA 4G8HA 5FHOA 3PUVE 4FIMA 1NFTA 1JQFA 5A5XB 3VLWA 2NOOA 2RINA 5CMKA 3T96B 4ZECA 1T0KA 3FD3A 4ZEIA 1URDA 3KSJA 2DWIA 3IB1A 4OVJA 1LAXA 4C0RA 5H8FB 4BDNA 3CFLA 3TTLA 3LSFB 4IO2A 4F1YA 5H8HB 1ANFA 1MQHA 1SVXB 2YJPA 1BIYA 1P99A 2OZZA 3U72A 4GLIA 4JWYA 4ZDMA 1N0TA 1BP5A 2F7BA 2A5SA 2VD2A 3OSRA 2DS9A 5ICQA 2FA7A 2QJEA 1QUIA 4OEUA 1MY0A 1ZU0A 2I49A 4LQ5A 1JW5A 5JTYA 4TOZA 4ZE8A 4Z7EA 1H44A 1ZIUA 3MUQA 2DXRA 2RCBA 1VFEA 1B5JA 4RXLA 5AA2B 4H5FA 2R71A 3HPIA 2ABHA 2HEUA 3MW0A 1MPDA 3PMXA 2QMWA 1B0LA 1JW4A 1N04A 3PUYE 1NNKA 1LAGE 4MLQA 2IA4A 3QK6A 1OVTA 5B70A 2F7AA 4RK9A 4I1DA 3K4UA 3ZS6A 2XXWA 3TCGA 1NNPA 3CG3A 3RUMA 2ONSA 3MBPA 3RTWB 3C35A 1B2HA 1I6BA 2DVZA 4YB6A 4ZE9A 3GLBA 3JZJA 2DP8A 2PMSA 3MVXA 1MS7A 1MM7A 3MQ9A 2AL4A 4YICA 2RF1A 2UVHA 1Y1ZA 5CMBA 4RNSA 2HZLA 3SEVA 4F31B 3TQWA 1MQDA 1LBCA 3M3KA 3TEPA 4R6YA 2UVGA 1MM6A 4MH5A 4PFUA 3ZKKA 5I2KB 5HBCA 1P1UA 1TXFA 1R1NA 1MPCA 3OSQA 3K02A 1LSTA 4FEBA 1MG1A 3KN7A 4LZ5A 4OFJA 3VE1B 1EZOA 3K6VA 1Z7ME 3DLNA 4WEPA 1A7LA 2ZMBA 4HCWA 2UVIA 3MJNA 2VGQA 1B46A 4YU0A 3C31A 1QW0A 3JYRA 1QUJA 4DZ1A 2Q9TA 4QFNA 1SYIA 4IO7A 4H6DA 4LZ8A 3A3CA 5TP9A 1AIVA 4GXSB 4GRKA 4FAJA 3PMWA 1MQGA 1DPPA 2B3FA 3O97A 1SI1A 4JBZA 3PPOA 3I3VA 4ESWA 1GV8A 3UN6A 2ZYKA 1FQFA 5CC2A 4PE5B 2P1SA 5CBRA 3TKDA 2Q2CA 3KBRA 4OFLA 2PX1A 1B5IA 4ELQA 2HAVA 3H3GA 4JWXA 1J1NA 1O7TA 4Q8RA 3H6UA 2DSFA 2NVUB 1F9BA 3RT8A 1R9LA 4G77A 3O6GA 2RC9A 5A5XA 3I5OA 5CMMA 3QUFA 4FECA 1TWYA 3SDFA 4EQ9A 3GXAA 4DXCA 1FTKA 2DE3A 3LSXA 3MZ9A 1PBPA 5H8FA 3TTMA 3G7WA 3OMBA 4KR5A 3K1MA 5JTYB 2HXWA 4JDFA 3IB2A 1EU8A 4O3AA 2H9BA 2QRYA 3K0VA 2UVJA 2Z8FA 3DM0A 3O28A 3FIRA 4NWDA 5AA2D 1H43A 2H5YA 5F7VA 4QFPA 4POXA 2P0SA 3C9HA 3RQTA 2HFBA 3K00A 2B65A 3LSLA 1S50A 3PPQA 5L9SA 3W9VA 4ELOA 3K6UA 4QFLA 1L5TA 5J1DA 3Q28A 4WEDA 5H8QB 2M8CA 3K6WA 4HS7A 1I6AA 3P7IA 3CFZA 3OO8A 2Z8EA 1H3DA 4QRZA 1B58A 4P11A 3MAMA 5IAIA 3VDFA 4MLVA 4HW8A 2XXHA 4BDQA 4H67A 4OERA 1TT1A 2Z22A 2ZYMA 1AL3A 2F34A 1MQJA 3O66A 1LCTA 1HSJA 1Q35A 4ELPA 1NNFA 3RNNA 1Q1KA 4EUOA 4BLAA 2QMXA 3K1PA 1NMUA 1LB8A 1QVSA 4Z0IA 2YPNA 1QULA 4LUBA 1P1NA 4DLDA 3R26A 4NWCA 1WVJA 3RPWA 4KI0E 4DXBA 3TQLA 3U92A 3FJMA 3SEXA 2X7QA 1B5HA 1A99A 4EF2A 4R6KA 4TQUQ 3CFXA 1H76A 2A5TA 3IAZA 2Z8DA 4FORA 4WKMA 4QSEA 5CI5A 4O3BA 3SEYA 3TCHA 4H8JA 2E1SA 1FTMA 1EZ9A 4MF3A 5LOMA 4G8MA 2DE4A 4GL8A 4EQ7A 5BUUA 5TP9B 3VXBA 1XVYA 4IO4A 1FTLA 2REGA 3D4CA 3T9UA 1SDXA 1LAFE 2ONKE 3MP1A 4LZ7A 4ZEFA 1GTKA 4GF8A 2FNCA 4F3BA 1A55A 3DP6A 1NH8A 4R9GA 3RGYA 2Y7KA 5I57A 3UIFA 3TTNA 1B7ZA 2F5XA 2NXOA 4IGRA 4YMBA 4XKNA 5DEXA 1BKAA 4L17A 1GGGA 3QYTA 3C33A 4WXJA 4RPOA 4GOTA 4F19A 4AB5A 5I56A 4G68B 3DP8A 4RYAA 1DPEA 3LBSA 1B51A 3FXQA 3CI8A 4DDDA 4KCDA 4XXUA 4BDRA 1OQGA 3N6UA 4R9FA 1NL5A 4QF9A 4OWDA 5TPAB 4M1VA 1FTJA 4KYEA 4NF6B 1FQEA 1USYE 3L6GA 3JV9A 2NWJA 3PU5A 2IEEA 1MH3A 3IO4A 5FTHA 1FQAA 3TCFA 1MH4A 4PETA 3TUSA 1YPNA 3PMVA 1PBQA 4EQBA 4KCCA 4DXUA 3QXMA 3PD8A 4U21A 5DVIA 4BDMA 1N84A 4YMAA 3B6TA 2XXIA 1FQDA 3KOTA 4U4XA 5H8SA 2G93A 4FATA 1Y1MA 3PGFA 1LGBC 2HCAA 3ILTB 3CIJA 4GIZA 3B6WA 3ECRA 4GQOA 4KFQA 4YKJA 4TLMB 3EHUA 3T9VA 1P1OA
chains in the Genus database with same CATH superfamily
4F29A 1B7HA 2XHDA 3CVGA 3M3FA 4LP2B 3KSXA 1OQHA 1URGA 2I58A 4F18A 3WAEA 3VLVA 2GFEA 4PFTA 5IZ1A 5H8QA 3O9PA 1N3XA 4GX6A 1POY1 3ZSFA 1NH7A 4ISUA 2CZHA 4ONYA 1R6ZA 3DELB 3OO6A 1EH3A 3MC2A 4PAFA 3FV2A 3LV0A 2OCUA 1I6QA 2CZIA 3V89B 1B1XA 5CBSA 4GBVA 4I40A 5KCJB 4MNIA 4R6HA 3EF7A 3PPRA 5H8NA 3VVDA 5CMCA 4C1TA 4PP0A 3QAXA 1MY3A 4XKRA 1Y3NA 2F7CA 4AS4A 5TU0A 2H4IA 2A5TB 5ET8A 3CRBA 3FVGA 1JVXA 2Q74A 3V83A 3KJTA 2WBBA 1FTAA 2XXYA 3M8UA 2ESNA 1BLFA 1DK4A 3WAFA 3OO9A 4H8IA 5M2VA 1MXVA 3IO6A 1FPJA 5ICTA 1P1WA 2GHBA 4NEDA 4OYVA 3MVWA 1N3WA 2BJIA 3LUYA 2V25A 4F2OA 4KD5A 1K9ZA 5JK4A 2NUVA 3PD9A 1N7XA 4GWUA 3KEIA 3T93B 4GD5A 4IB2A 5KZTA 4P0IA 1AH5A 3PUZE 4PFIA 2PFYA 1M5EA 2ZNTA 1JW1A 3UA8A 4N8YA 2OK2A 4C1UA 3R6UA 3AXFA 2V3UA 5DVFA 1PB8A 2XXPA 3THIA 1EZPA 3ROJA 1DOTA 1FBHA 5I57B 1S7YA 2P3NA 2P2AA 4F3PA 1MY1A 1IQ7A 3EHTA 3IB0A 1IMDA 4IO6A 4GWOA 2AL5A 3RPLB 4PAIA 4PGNA 3LUZA 1LFGA 4NF8B 5DEXB 3OEMA 4GWZA 3Q29A 3KC0A 4DIGA 3S9LC 4LA9A 3ISPA 3D1RA 2KLFA 2Y7RA 5I56B 3CSGA 5F24A 4MNPA 4YKPA 4JVCA 1NNTA 1RYOA 1K9YA 2ZXTA 2BJJX 3EHSA 4YAHX 3GBBA 3VVEA 2DWHA 5K2YA 1XHYA 3IOUA 4MFIA 5FTIA 4U4SA 1MQIA 1BTJA 4F3SA 3T22A 4NAPA 3HSTA 1LBBA 3A09A 5KDTA 4G68A 4P9KA 2VT5A 2REJA 4RY1A 4QSDA 1FPKA 1HSLA 1MY2A 2Q2AA 2O1LA 4P47A 2O68A 1LEVA 4NMYA 5DW8A 5TPAA 2P3VA 4LVQA 1SW4A 5K2XA 2QVUA 4Q0CA 4NF6A 3H6VA 4YB5A 3E13X 2YLNA 4H45A 1NKXA 1JVYA 4QBAA 5B7DA 3MP8A 5L9OA 1B4HA 4QXDA 5IGAA 4R2FA 3Q26A 3E3KA 4PBHA 1XS5A 4X04A 4HTGA 1I69A 3I6VA 3S4UA 4H0WA 3U8QA 3TMGA 3LC8A 1LFHA 4OVRA 1Y9UA 4N13A 4OA4A 1B0HA 3LSWA 4N07A 3K2DA 1NV4A 1LAHE 1ZJLA 4P1LA 2O7UA 2DOJA 2I3WA 3IK6B 3TELA 1OLCA 2VP1A 4NF4A 4O8MA 1YAEA 1DSNA 4IY5A 2XXKA 3K01A 2XWOA 1SW5A 4UACA 3OENA 3H03A 2VPNA 2H25A 3HHFA 1PB7A 2PFZA 3HCQA 3MPKA 5ET6A 1AWBA 5IZ3A 4RA1A 5H8NB 4GWSA 1QGXA 1AOVA 4KYDA 3C36A 4XFEA 4LQ2A 1FPIA 1XI6A 3FXUA 4FJPA 2DXYA 5EQ9A 3OELA 4ZEDA 2XD2A 3RLFE 4KYSA 4ELRA 3L6HA 4NN3A 5KCJA 4I62A 3VXCA 2HAUA 4GXAA 2O84X 4MMPA 4EF1A 4IR8A 2ONRA 4IO5A 3C32A 4PCDA 4FBPA 2F3BA 4GX4A 1Z7NE 5I59A 1SW2A 1LBYA 1FCKA 1IXHA 4F1VA 3PV0E 1SBPA 3OXNA 2DWJA 1HSEA 3D4GA 3H6TA 4X1BA 1B6HA 1B3GA 3ILUB 2R9JA 4ZS9A 3IX1A 4KQPA 3C34A 2THIA 5I84A 1A8EA 4LONB 1MXZA 3ODBA 1URSA 1M5BA 1IEJA 1NV2A 4X48A 1MXUA 2XXTA 3T66A 4EXLA 1M5DA 5EQ7A 1JEUA 4H1XA 4R75A 2AIXA 2XXUA 4P0GA 3ONMA 2F6GA 1VE4A 4BDLA 1TFDA 1CNQA 3HN0A 3EQ1A 4PDHA 1FSAA 2FIXA 5EHMA 2R6GE 1KA1A 2DVCA 2Y7IA 3T9XB 2AYSA 2WX9A 4XEQA 1G0HA 2I6EA 3G3GA 3FJGA 4G2ZA 4MNCA 1IZ1A 2OWSA 4I3EA 4DCYA 3E79A 3SEWA 4U1ZA 1PC3A 3RPLA 4NX1A 4IO3A 1FBDA 1KA0A 4NF8A 2QS1A 2O1MA 1KZ8A 5FHNA 1SYHA 2WYPA 2Y5LA 1B40A 1R9QA 1IIWA 1IXIA 3IORA 3FVKA 1S9TA 1RDXA 5FHMA 4Q30B 5KDTB 3SERA 1IXCA 1Y4TA 1FBCA 2VPOA 4JWOA 2OX3A 1N76A 3MVZA 4PF6A 1FBEA 1UTHB 5AA1A 5ISUA 1UTBA 4NF5A 2ALUA 3G3KA 2UXAA 5ELVA 2B3BA 5ITOA 2V93A 1SI0A 2HPGA 2PCRA 4I9DA 1B05A 4PFBA 1RDYA 3KN3A 3EN3A 3E9XA 5L8DA 1ZMGA 1VSOA 1YXIA 2I3VA 3KJ7A 1D3KA 4PGPA 2XX7A 1LBWA 2F78A 4NE4A 3OO7A 3SZPA 1ZTYA 1NV1A 4XIGQ 2Q8JA 1NI9A 4F2QA 3A29A 4NHBA 2D3IA 3FUZA 4JB7A 1B52A 1ZLQA 4X9TA 4P3LA 3G3HA 2DQVA 2E0SA 1CB6A 2XXXA 4GWXA 4OQOA 1IUDA 4DCXA 2VOZA 2D5WA 2F6PA 4PFWA 2CEXA 4PQJA 4EXKA 4NF4B 4LATA 4M4GA 3V8XB 3RN8A 3RY3A 4R2BA 3IOWA 1QUKA 3FZVA 3O6HA 2O51A 2PT1A 3Q25A 4QFOA 2GQ1A 3B7DA 3W9WA 3PPNA 4PDDA 4MHFA 3K1NA 3T9HB 1KWHA 4UA8A 2GHAA 2ZNUA 5IZ3B 3MYUA 2DYXA 2Q88A 3QSLA 5HPQA 1LB9A 1PB9A 1SQYA 3N94A 4QSCA 5HM4B 4K3FA 5A5LA 1OLAA 1MY4A 2ZZWA 1MDQA 2XX8A 3DP4A 2Q89A 2RKMA 4JVDA 1A54A 2O7IA 3MPLA 2V84A 4E0WA 3CSBA 4OFOA 2DE2A 3TZAA 4X1DA 1B32A 3HHGA 3FVOA 1O63A 2FYIA 3H4ZA 1UIVA 1D4NA 4YKIA 3SESA 2V3TA 2I4CA 3U93A 5T3JA 3EKIA 4PC9A 4R72A 1M5FA 4N6PA 2ZYNA 4AQ4A 5I59B 3U94A 1JNFA 5F1QA 3VFJA 2QVVA 1D9VA 3IJOB 4ZZEA 4QHQA 3UORA 3CR9A 2F8DA 4N6DA 2I4BA 4F1UA 4GX3A 1Y3PA 2F97A 2Z23A 5EQAA 3VVFA 2Y5KA 3PUWE 2OLBA 4ZEKA 3TPAA 4O7IA 3V5AA 4I8CA 4RK2A 1FBPA 4THIA 3KG2A 4N91A 3B6QA 4JSOA 1USYH 3O29A 3K6XA 3UGWA 2UYFA 2QL3A 3H7MA 1GVCA 1YCJA 1US5A 1VFDA 5I2NB 2XXRA 1POTA 2VD3A 4U23A 1QJMA 3O6IA 1VDWA 4OVTA 2CMOA 2Y7WA 3G3IA 2DWAA 4HE1A 4PFYA 3RYDA 1H45A 4X8RA 3LR1A 1PEBA 3KFMA 5CRYA 1GR2A 3M3LA 1B3LA 3Q27A 3E4RA 1MXXA 4G4PA 3BFUA 4AB6A 2XWKA 2OWTA 2OJTA 1FQBA 2FIEA 4OXVA 5CM6A 2GRVA 4OESA 3O2AA 1FBFA 2I0BA 3W15C 4DE8A 3PUXE 3QIMA 3IOTA 3FVNA 1B9JA 1Y4CA 5L9MA 1YZ0A 3OOAA 4UABA 4E0XA 3CG1A 1JETA 1UIUA 4GFRA 4YB7A 1ATGA 1P1QA 3N26A 4MBPA 4O3CA 4NTLA 2O69A 3U1OA 3UP9A 4Q5TA 1A40A 4XTCQ 2CEYA 3KN8A 3FXRA 1LCFA 3MSTA 1UTBB 4NF5B 3HO7A 4YKKA 4POWA 4HCYA 1AMFA 5I58A 2ANJA 3R7XA 3SETA 3VV5A 3MP6A 5DVJA 1FQCA 1LBZA 2GH9A 1MXWA 4JSDA 4GVOA 1RDZA 3H06B 4H65A 4ECFA 5AA4A 1FPBA 1NUZA 1UTHA 3UK4A 2W7YA 4KPTA 3SKPA 3S9NC 3KBZA 5DTBA 4OZ9A 1IMCA 1B1HA 3TTRA 4GBWA 3RT6B 1TFAA 2QVRA 5LTCA 4NG7A 5IZZA 5LDZA 1B3HA 1SW1A 4ND9A 3HV1A 5JEIA 4OTEA 3S9EA 3BIHA 1EYJA 2PBWA 4P1EA 4OHNA 3FATA 3QUJA 4OMBA 4EDPA 1QKAA 4IY6A 1WDNA 3USDA 2FHYA 5H8HA 1OIBA 2PYYA 3MZBA 3MVYA 4N17A 1UQWA 2LAOA 1B3EA 2HZKA 4F39A 3MZ1A 2QFLA 1Y3QA 1RKMA 1IITA 3ZKLA 4PFRA 1ELJA 3TTKA 1Q9DA 4O94A 3QMFA 4OEVA 2PVUA 4MEVA 1FW0A 3OEKA 2QS3A 4ESXA 2H98A 2XA5A 4P8BA 4I3YA 4TLLB 3EPEA 2I0CA 1B7UA 3RTFB 2QPQA 5EYFA 1M5CA 1ZBMA 4R73A 4PBQA 3BBRA 5AA2A 2I48A 3S9MC 1MDP1 2RCAA 5IM2A 5EHSA 1OMPA 5EYGA 3OD7A 2VHAA 3B8BA 1CE2A 3S2VA 1DMBA 1YYZA 3TDJA 3TODA 4KHZE 2UYEA 4GWYA 2X7PA 2XWVA 3TYHA 1DBZA 1B4ZA 2ZZVA 3BKIB 3N6TA 2Q8MA 1N7WA 2V3QA 2QS4A 4F3GA 3PPPA 4ZZAA 4AS5A 2QSXA 3H6WA 4FEDA 4LN5A 2XX9A 4QFKA 4G68C 5DT6A 3A3UA 2O6AA 1RYXA 3VLUA 4U1OA 1MXYA 4IGTA 2D21A 5ITPA 3KGCA 4OENA 3G3JA 4NQ8A 1XOCA 2KR0A 1US4A 1XC1A 3FGSA 3KOSA 5DYHA 3N5LA 3IOVA 2XXVA 3IR1A 4GL0A 1XVXA 3C4MA 3TAJA 3TFLA 1FTOA 4R74A 3SEUA 2G29A 2H99A 5I2KA 4H5GA 1O64A 1NV7A 4FE8A 4U2RA 1MRPA 2XXQA 4XKQA 3F11A 5AA3A 1NV6A 1QKBA 5I2NA 1NV0A 2DDKA 1MPBA 3BFTA 4H46A 4RPNA 3GYYA 1OVBA 1VR5A 2F35A 3IJXB 4RJZA 3KZGA 1DTZA 2PT2A 2HQ0A 4GWWA 2Y84A 1SD3A 1PDAA 1BK4A 2QS2A 2ZYOA 4F22A 4XKPA 3MWBA 2ZNSA 2X26A 1Y20A 3PTYA 4G8NA 2R8TA 4YZZA 4HE0A 4JXIA 4OETA 4U22A 5I58B 2CZLA 1FBGA 1IXGA 3FJ7A 2Y7PA 1XT8A 1LLSA 4BDOA 4HXVA 3G3FA 2F36A 4PAKA 3GZGA 5BWJA 1IMBA 3FV1A 2XD3A 4ZEBA 1A8FA 1ZKBA 3FASA 1LFIA 2RC8A 1WODA 5AA4B 1SPIA 5AE4A 1JEVA 1D9YA 3IL1B 2WKYA 1DTGA 4PE3A 2RC7A 1II5A 1YTVA 2OBGA 1B3FA 5IKBA 3GBAA 4G8HA 5FHOA 3PUVE 2ZZXA 4FIMA 1NFTA 1JQFA 1LBVA 5A5XB 3VLWA 2NOOA 2RINA 5CMKA 3T96B 4ZECA 1T0KA 3FD3A 1IMAA 4ZEIA 1URDA 1FPGA 3KSJA 4PF8A 2DWIA 3IB1A 4OVJA 1LAXA 4C0RA 5H8FB 4BDNA 3CFLA 3TTLA 3LSFB 4IO2A 4F1YA 5H8HB 2V4CA 1ANFA 1MQHA 1SVXB 2YJPA 1BIYA 1P99A 2OZZA 3U72A 5ESYA 4N8GA 3FBPA 4GLIA 4JWYA 4ZDMA 1N0TA 4OANA 1BP5A 3CHGA 2F7BA 2A5SA 2VD2A 3OSRA 2DS9A 4MX6A 5ICQA 2FA7A 2QJEA 1QUIA 2B4LA 4OEUA 1MY0A 1ZU0A 2I49A 4LQ5A 4DI3D 1JW5A 5JTYA 2FVZA 5I5PA 4TOZA 4ZE8A 4Z7EA 1H44A 1NUXA 1ZIUA 3MUQA 2DXRA 2RCBA 3BIGA 1VFEA 1B5JA 4RXLA 5AA2B 1D9QA 1IMEA 4H5FA 2R71A 3HPIA 2ABHA 2HEUA 3MW0A 1DCUA 1EYKA 1MPDA 3PMXA 5I7IA 2QMWA 1B0LA 3IFAA 1JW4A 1N04A 3PUYE 1NNKA 1LAGE 2CZKA 4MLQA 2IA4A 3QK6A 3T0JA 1OVTA 5B70A 2F7AA 4RK9A 4I1DA 3K4UA 3ZS6A 2XXWA 3TCGA 1NNPA 2HHMA 3CG3A 2B4MA 3RUMA 2ONSA 3MBPA 3RTWB 3C35A 1B2HA 2XWIA 1I6BA 2DVZA 4N6KA 4PTKA 4YB6A 4ZE9A 3GLBA 4XF5A 3JZJA 2DP8A 2PMSA 3MVXA 1MS7A 1MM7A 3MQ9A 2AL4A 4YICA 2RF1A 2UVHA 1Y1ZA 5CMBA 4RNSA 2HZLA 3SEVA 4F31B 3TQWA 1MQDA 1LBCA 4JVIA 3M3KA 3TEPA 4R6YA 2UVGA 1MM6A 4MH5A 4PFUA 3ZKKA 5I2KB 5HBCA 1P1UA 1TXFA 1R1NA 1MPCA 3OSQA 3K02A 1LSTA 4FEBA 1MG1A 3KN7A 4LZ5A 4OFJA 3VE1B 1EZOA 3K6VA 4G61A 1Z7ME 3DLNA 4WEPA 1A7LA 2ZMBA 4HCWA 2UVIA 3MJNA 3T1BA 2HXRA 2VGQA 1B46A 4OVPA 4YU0A 3C31A 1QW0A 3JYRA 1QUJA 4DZ1A 3IFCA 2Q9TA 4QFNA 4OVQA 1SYIA 4IO7A 4H6DA 4LZ8A 3A3CA 5TP9A 1AIVA 4GXSB 4GRKA 4FAJA 1FJ9A 3PMWA 1MQGA 1DPPA 2B3FA 3O97A 4NF0A 1SI1A 4JBZA 3PPOA 3I3VA 4ESWA 1GV8A 3UN6A 2ZYKA 1FQFA 4O7MA 2MKZA 5CC2A 4MAGA 4PE5B 2P1SA 4OVSA 5CBRA 3TKDA 2Q2CA 3KBRA 4OFLA 2PX1A 1B5IA 4ELQA 2HAVA 4NGUA 3H3GA 4JWXA 1J1NA 1O7TA 5I3SA 4Q8RA 3H6UA 2DSFA 2NVUB 5FBPA 1F9BA 3RT8A 1FPEA 1R9LA 5J16A 4G77A 5EQ8A 3O6GA 1INPA 2RC9A 5A5XA 3I5OA 5CMMA 3QUFA 4N81A 4FECA 1TWYA 3SDFA 4EQ9A 3GXAA 4DXCA 3U65A 1FTKA 2DE3A 3LSXA 1G0IA 3MZ9A 1PBPA 5H8FA 3TTMA 3G7WA 3OMBA 4KR5A 3K1MA 5JTYB 2HXWA 4JDFA 3IB2A 1EU8A 4O3AA 2H9BA 2QRYA 3K0VA 2UVJA 2Z8FA 2WYKA 3DM0A 3O28A 3FIRA 4NWDA 5AA2D 1H43A 2H5YA 2KQZA 5F7VA 4QFPA 4POXA 2P0SA 3C9HA 3RQTA 2HFBA 3K00A 2B65A 3LSLA 1S50A 3PPQA 5L9SA 3W9VA 4ELOA 3K6UA 4QFLA 1L5TA 5J1DA 3Q28A 4WEDA 5H8QB 2M8CA 3K6WA 4HS7A 1I6AA 3P7IA 3CFZA 3OO8A 4N15A 2Z8EA 1H3DA 4QRZA 1B58A 4P11A 3MAMA 1FPFA 5IAIA 3VDFA 4MCOA 4MLVA 4HW8A 2XXHA 4BDQA 4H67A 4OERA 1TT1A 2FBPA 2Z22A 2ZYMA 1AL3A 2F34A 2WEFA 1MQJA 3O66A 1LCTA 1HSJA 4HE2A 1Q35A 3HFUA 4ELPA 1NNFA 3RNNA 1Q1KA 4EUOA 4BLAA 4P56A 2QMXA 3K1PA 1NMUA 1LB8A 1QVSA 4Z0IA 2YPNA 1QULA 5EYHA 4LUBA 1P1NA 4DLDA 3R26A 4NWCA 1WVJA 5ET5A 1EYIA 3RPWA 3FXBA 4KI0E 4DXBA 3TQLA 3U92A 2OWZA 3FJMA 3SEXA 2X7QA 1B5HA 1A99A 4EF2A 4MJOA 4R6KA 4TQUQ 3CFXA 1H76A 2A5TA 3IAZA 2Z8DA 4FORA 4WKMA 4QSEA 5CI5A 4O3BA 3SEYA 3TCHA 4H8JA 2E1SA 1FTMA 1EZ9A 4MF3A 5LOMA 4G8MA 2DE4A 4GL8A 4EQ7A 5BUUA 5TP9B 2L5VA 3VXBA 1XVYA 4IO4A 1FTLA 2REGA 3D4CA 3T9UA 1SDXA 1LAFE 2ONKE 3MP1A 4LZ7A 4ZEFA 1GTKA 4GF8A 2FNCA 4F3BA 1A55A 3DP6A 1NH8A 4R9GA 1FPDA 3RGYA 1IMFA 2Y7KA 5I57A 1JP4A 3UIFA 3TTNA 1B7ZA 2F5XA 2NXOA 4IGRA 4YMBA 4XKNA 5DEXA 1BKAA 4L17A 1GGGA 1FJ6A 3QYTA 3C33A 4WXJA 4RPOA 4GOTA 4F19A 1NV5A 4AB5A 5I56A 1FRPA 4G68B 4KXPA 3DP8A 4RYAA 1DPEA 3LBSA 1B51A 3FXQA 3CI8A 2F3DA 1NUYA 4DDDA 4KCDA 4XXUA 4BDRA 1OQGA 3N6UA 4R9FA 1NL5A 4QF9A 4MIJA 4OWDA 5TPAB 4M1VA 1FTJA 4KYEA 4NF6B 1FQEA 1USYE 3L6GA 1FPLA 3JV9A 3NOHA 2WBDA 2NWJA 3PU5A 2IEEA 1MH3A 1NUWA 3IO4A 5FTHA 1FQAA 3TCFA 1MH4A 4PETA 3TUSA 5ET7A 2JJKA 1YPNA 3PMVA 1PBQA 4EQBA 1NV3A 4KCCA 4DXUA 1LBXA 3QXMA 3PD8A 4U21A 5DVIA 4BDMA 1N84A 4N4UA 4YMAA 3B6TA 2XXIA 1FQDA 3KOTA 3E78A 4U4XA 5H8SA 2G93A 4FATA 1Y1MA 4DI4B 3PGFA 1LGBC 2HCAA 3ILTB 3CIJA 4GIZA 3B6WA 3ECRA 3KC1A 4GQOA 4KFQA 4YKJA 4TLMB 3B50A 3EHUA 3T9VA 1P1OA
chains in the Genus database with same CATH topology
4F29A 1B7HA 2XHDA 3CVGA 3M3FA 4LP2B 3KSXA 1OQHA 1URGA 2I58A 4F18A 3WAEA 3VLVA 2GFEA 4PFTA 5H8QA 3O9PA 1N3XA 1POY1 3ZSFA 1NH7A 4ISUA 4ONYA 1R6ZA 3DELB 3OO6A 1EH3A 3MC2A 3FV2A 2OCUA 1I6QA 3V89B 1B1XA 5CBSA 5KCJB 4R6HA 3EF7A 3PPRA 5H8NA 3VVDA 5CMCA 4C1TA 4PP0A 3QAXA 1MY3A 4XKRA 1Y3NA 2F7CA 5TU0A 2H4IA 2A5TB 3CRBA 3FVGA 1JVXA 3V83A 3KJTA 2XXYA 3M8UA 2ESNA 1BLFA 3WAFA 3OO9A 4H8IA 5M2VA 1MXVA 3IO6A 5ICTA 1P1WA 2GHBA 4NEDA 4OYVA 3MVWA 1N3WA 3LUYA 2V25A 4F2OA 4KD5A 5JK4A 2NUVA 3PD9A 1N7XA 3KEIA 3T93B 4GD5A 4IB2A 5KZTA 4P0IA 1AH5A 3PUZE 1M5EA 2ZNTA 1JW1A 3UA8A 2OK2A 4C1UA 3R6UA 3AXFA 2V3UA 5DVFA 1PB8A 2XXPA 3THIA 1EZPA 1DOTA 5I57B 1S7YA 4F3PA 2P2AA 1MY1A 1IQ7A 3EHTA 3IB0A 4IO6A 4GWOA 2AL5A 4NF8B 1LFGA 5DEXB 3OEMA 3Q29A 3S9LC 4DIGA 4LA9A 2KLFA 2Y7RA 5I56B 3CSGA 4YKPA 1NNTA 1RYOA 2ZXTA 3EHSA 2BJJX 4YAHX 3GBBA 3VVEA 2DWHA 5K2YA 1XHYA 3IOUA 4MFIA 5FTIA 4U4SA 1MQIA 1BTJA 4F3SA 3T22A 3HSTA 1LBBA 3A09A 5KDTA 4G68A 2REJA 4RY1A 4QSDA 1HSLA 1MY2A 2Q2AA 2O1LA 2O68A 4NMYA 5TPAA 4LVQA 1SW4A 5K2XA 4Q0CA 4NF6A 3H6VA 4YB5A 3E13X 2YLNA 1NKXA 1JVYA 5B7DA 3MP8A 5L9OA 1B4HA 4R2FA 3Q26A 3E3KA 1XS5A 4HTGA 1I69A 3I6VA 3S4UA 4H0WA 3U8QA 3TMGA 3LC8A 1LFHA 1Y9UA 4N13A 1B0HA 3LSWA 4N07A 3K2DA 1LAHE 1ZJLA 2O7UA 2DOJA 2I3WA 3IK6B 3TELA 1OLCA 2VP1A 4NF4A 1YAEA 1DSNA 4IY5A 3K01A 1SW5A 4UACA 3OENA 3H03A 2H25A 3HHFA 1PB7A 3HCQA 3MPKA 4RA1A 5H8NB 1AOVA 4KYDA 3C36A 4LQ2A 3FXUA 4FJPA 2DXYA 3OELA 4ZEDA 2XD2A 3RLFE 4KYSA 4ELRA 3L6HA 5KCJA 4I62A 3VXCA 2HAUA 4GXAA 2O84X 4EF1A 2ONRA 4IO5A 3C32A 1Z7NE 5I59A 1SW2A 1FCKA 1IXHA 4F1VA 3PV0E 1SBPA 3OXNA 2DWJA 1HSEA 3D4GA 3H6TA 4X1BA 1B6HA 1B3GA 3ILUB 2R9JA 4ZS9A 3IX1A 4KQPA 3C34A 2THIA 5I84A 1A8EA 4LONB 1MXZA 3ODBA 1URSA 1M5BA 1IEJA 4X48A 1MXUA 2XXTA 3T66A 4EXLA 1M5DA 1JEUA 4H1XA 4R75A 2AIXA 2XXUA 4P0GA 3ONMA 2F6GA 1VE4A 4BDLA 1TFDA 3HN0A 3EQ1A 5EHMA 2R6GE 2DVCA 2Y7IA 3T9XB 2AYSA 2I6EA 3G3GA 3FJGA 4G2ZA 1IZ1A 2OWSA 4DCYA 3SEWA 4U1ZA 1PC3A 4IO3A 4NF8A 2QS1A 2O1MA 5FHNA 1SYHA 1B40A 1R9QA 1IIWA 1IXIA 3IORA 3FVKA 1S9TA 5FHMA 4Q30B 5KDTB 3SERA 1IXCA 1Y4TA 4JWOA 1N76A 3MVZA 1UTHB 5AA1A 5ISUA 1UTBA 4NF5A 2ALUA 3G3KA 2UXAA 5ELVA 2B3BA 5ITOA 2V93A 1SI0A 4I9DA 1B05A 3KN3A 3EN3A 3E9XA 5L8DA 1ZMGA 1VSOA 2I3VA 3KJ7A 1D3KA 2XX7A 2F78A 4NE4A 3OO7A 1ZTYA 4XIGQ 2Q8JA 4F2QA 2D3IA 3FUZA 4JB7A 1B52A 1ZLQA 4X9TA 3G3HA 2DQVA 2E0SA 1CB6A 2XXXA 4OQOA 4DCXA 1IUDA 2VOZA 2D5WA 2F6PA 4PFWA 4PQJA 4EXKA 4NF4B 4LATA 4M4GA 3V8XB 3RN8A 3RY3A 4R2BA 3IOWA 1QUKA 3FZVA 3O6HA 2O51A 2PT1A 3Q25A 4QFOA 3B7DA 3W9WA 3PPNA 3K1NA 3T9HB 1KWHA 4UA8A 2GHAA 2ZNUA 2DYXA 2Q88A 3QSLA 5HPQA 1LB9A 1PB9A 1SQYA 3N94A 4QSCA 5HM4B 4K3FA 1OLAA 1MY4A 1MDQA 2XX8A 3DP4A 2Q89A 2RKMA 1A54A 2O7IA 3MPLA 2V84A 4E0WA 3CSBA 4OFOA 2DE2A 3TZAA 4X1DA 1B32A 3HHGA 3FVOA 1O63A 2FYIA 3H4ZA 1UIVA 1D4NA 4YKIA 3SESA 2V3TA 2I4CA 3U93A 4R72A 1M5FA 4N6PA 2ZYNA 4AQ4A 5I59B 3U94A 1JNFA 5F1QA 3VFJA 1D9VA 3IJOB 4ZZEA 4QHQA 3UORA 3CR9A 2F8DA 2I4BA 4F1UA 1Y3PA 2F97A 2Z23A 3VVFA 3PUWE 2OLBA 4ZEKA 3TPAA 3V5AA 4I8CA 4RK2A 4THIA 3KG2A 3B6QA 4JSOA 1USYH 3O29A 3K6XA 3UGWA 2UYFA 2QL3A 3H7MA 1GVCA 1YCJA 1US5A 1VFDA 5I2NB 2XXRA 1POTA 2VD3A 4U23A 1QJMA 3O6IA 2CMOA 2Y7WA 3G3IA 2DWAA 4PFYA 1H45A 3LR1A 1PEBA 3KFMA 5CRYA 1GR2A 3M3LA 1B3LA 3Q27A 3E4RA 1MXXA 4G4PA 3BFUA 4AB6A 2OWTA 2OJTA 1FQBA 4OXVA 5CM6A 2GRVA 4OESA 3O2AA 2I0BA 3W15C 4DE8A 3PUXE 3QIMA 3IOTA 3FVNA 1Y4CA 1B9JA 5L9MA 3OOAA 4E0XA 3CG1A 1JETA 1UIUA 4GFRA 4YB7A 1ATGA 1P1QA 3N26A 4MBPA 4O3CA 4NTLA 2O69A 3U1OA 3UP9A 4Q5TA 1A40A 4XTCQ 3KN8A 3FXRA 1LCFA 1UTBB 4NF5B 3HO7A 4YKKA 4POWA 4HCYA 1AMFA 5I58A 2ANJA 3R7XA 3SETA 3VV5A 3MP6A 5DVJA 1FQCA 2GH9A 1MXWA 4JSDA 4GVOA 4H65A 3H06B 4ECFA 5AA4A 1UTHA 3UK4A 2W7YA 4KPTA 3SKPA 3S9NC 5DTBA 4OZ9A 1B1HA 3TTRA 3RT6B 1TFAA 1B3HA 1SW1A 4ND9A 3HV1A 5JEIA 4OTEA 3S9EA 2PBWA 4OHNA 3FATA 3QUJA 4OMBA 4EDPA 1QKAA 4IY6A 1WDNA 3USDA 5H8HA 1OIBA 2PYYA 3MZBA 3MVYA 1UQWA 2LAOA 1B3EA 2HZKA 4F39A 3MZ1A 1Y3QA 1RKMA 1IITA 3ZKLA 1ELJA 3TTKA 4OEVA 2PVUA 1FW0A 3OEKA 2QS3A 4ESXA 2H98A 4TLLB 3EPEA 2I0CA 1B7UA 3RTFB 2QPQA 5EYFA 1M5CA 1ZBMA 4R73A 3BBRA 5AA2A 2I48A 3S9MC 1MDP1 2RCAA 5EHSA 1OMPA 3OD7A 2VHAA 1CE2A 3S2VA 1DMBA 3TDJA 3TODA 4KHZE 2UYEA 2X7PA 3TYHA 1B4ZA 3BKIB 3N6TA 1N7WA 2V3QA 2QS4A 4F3GA 3PPPA 4ZZAA 2QSXA 3H6WA 4FEDA 2XX9A 4QFKA 4G68C 5DT6A 3A3UA 2O6AA 1RYXA 3VLUA 4U1OA 1MXYA 4IGTA 2D21A 5ITPA 3KGCA 4OENA 3G3JA 1XOCA 1US4A 1XC1A 3FGSA 3KOSA 5DYHA 3N5LA 3IOVA 2XXVA 3IR1A 4GL0A 1XVXA 3C4MA 3TAJA 3TFLA 1FTOA 4R74A 3SEUA 2G29A 2H99A 5I2KA 4H5GA 1O64A 4FE8A 4U2RA 1MRPA 2XXQA 4XKQA 3F11A 5AA3A 1QKBA 5I2NA 1MPBA 3BFTA 4RPNA 1OVBA 1VR5A 2F35A 3IJXB 4RJZA 3KZGA 1DTZA 2PT2A 2HQ0A 2Y84A 1SD3A 1PDAA 2QS2A 2ZYOA 4F22A 4XKPA 3MWBA 2ZNSA 2X26A 1Y20A 4G8NA 4YZZA 4JXIA 4OETA 4U22A 5I58B 2CZLA 1IXGA 3FJ7A 2Y7PA 1XT8A 1LLSA 4BDOA 3G3FA 2F36A 3GZGA 5BWJA 3FV1A 2XD3A 4ZEBA 1A8FA 1ZKBA 3FASA 1LFIA 2RC8A 1WODA 5AA4B 5AE4A 1JEVA 1D9YA 3IL1B 2WKYA 1DTGA 2RC7A 1II5A 1YTVA 2OBGA 1B3FA 5IKBA 3GBAA 4G8HA 5FHOA 3PUVE 4FIMA 1NFTA 1JQFA 5A5XB 3VLWA 2NOOA 2RINA 5CMKA 3T96B 4ZECA 1T0KA 3FD3A 4ZEIA 1URDA 3KSJA 2DWIA 3IB1A 4OVJA 1LAXA 4C0RA 5H8FB 4BDNA 3CFLA 3TTLA 3LSFB 4IO2A 4F1YA 5H8HB 1ANFA 1MQHA 1SVXB 2YJPA 1BIYA 1P99A 2OZZA 3U72A 4GLIA 4JWYA 4ZDMA 1N0TA 1BP5A 2F7BA 2A5SA 2VD2A 3OSRA 2DS9A 5ICQA 2FA7A 2QJEA 1QUIA 4OEUA 1MY0A 1ZU0A 2I49A 4LQ5A 1JW5A 5JTYA 4TOZA 4ZE8A 4Z7EA 1H44A 1ZIUA 3MUQA 2DXRA 2RCBA 1VFEA 1B5JA 4RXLA 5AA2B 4H5FA 2R71A 3HPIA 2ABHA 2HEUA 3MW0A 1MPDA 3PMXA 2QMWA 1B0LA 1JW4A 1N04A 3PUYE 1NNKA 1LAGE 4MLQA 2IA4A 3QK6A 1OVTA 5B70A 2F7AA 4RK9A 4I1DA 3K4UA 3ZS6A 2XXWA 3TCGA 1NNPA 3CG3A 3RUMA 2ONSA 3MBPA 3RTWB 3C35A 1B2HA 1I6BA 2DVZA 4YB6A 4ZE9A 3GLBA 3JZJA 2DP8A 2PMSA 3MVXA 1MS7A 1MM7A 3MQ9A 2AL4A 4YICA 2RF1A 2UVHA 1Y1ZA 5CMBA 4RNSA 2HZLA 3SEVA 4F31B 3TQWA 1MQDA 1LBCA 3M3KA 3TEPA 4R6YA 2UVGA 1MM6A 4MH5A 4PFUA 3ZKKA 5I2KB 5HBCA 1P1UA 1TXFA 1R1NA 1MPCA 3OSQA 3K02A 1LSTA 4FEBA 1MG1A 3KN7A 4LZ5A 4OFJA 3VE1B 1EZOA 3K6VA 1Z7ME 3DLNA 4WEPA 1A7LA 2ZMBA 4HCWA 2UVIA 3MJNA 2VGQA 1B46A 4YU0A 3C31A 1QW0A 3JYRA 1QUJA 4DZ1A 2Q9TA 4QFNA 1SYIA 4IO7A 4H6DA 4LZ8A 3A3CA 5TP9A 1AIVA 4GXSB 4GRKA 4FAJA 3PMWA 1MQGA 1DPPA 2B3FA 3O97A 1SI1A 4JBZA 3PPOA 3I3VA 4ESWA 1GV8A 3UN6A 2ZYKA 1FQFA 5CC2A 4PE5B 2P1SA 5CBRA 3TKDA 2Q2CA 3KBRA 4OFLA 2PX1A 1B5IA 4ELQA 2HAVA 3H3GA 4JWXA 1J1NA 1O7TA 4Q8RA 3H6UA 2DSFA 2NVUB 1F9BA 3RT8A 1R9LA 4G77A 3O6GA 2RC9A 5A5XA 3I5OA 5CMMA 3QUFA 4FECA 1TWYA 3SDFA 4EQ9A 3GXAA 4DXCA 1FTKA 2DE3A 3LSXA 3MZ9A 1PBPA 5H8FA 3TTMA 3G7WA 3OMBA 4KR5A 3K1MA 5JTYB 2HXWA 4JDFA 3IB2A 1EU8A 4O3AA 2H9BA 2QRYA 3K0VA 2UVJA 2Z8FA 3DM0A 3O28A 3FIRA 4NWDA 5AA2D 1H43A 2H5YA 5F7VA 4QFPA 4POXA 2P0SA 3C9HA 3RQTA 2HFBA 3K00A 2B65A 3LSLA 1S50A 3PPQA 5L9SA 3W9VA 4ELOA 3K6UA 4QFLA 1L5TA 5J1DA 3Q28A 4WEDA 5H8QB 2M8CA 3K6WA 4HS7A 1I6AA 3P7IA 3CFZA 3OO8A 2Z8EA 1H3DA 4QRZA 1B58A 4P11A 3MAMA 5IAIA 3VDFA 4MLVA 4HW8A 2XXHA 4BDQA 4H67A 4OERA 1TT1A 2Z22A 2ZYMA 1AL3A 2F34A 1MQJA 3O66A 1LCTA 1HSJA 1Q35A 4ELPA 1NNFA 3RNNA 1Q1KA 4EUOA 4BLAA 2QMXA 3K1PA 1NMUA 1LB8A 1QVSA 4Z0IA 2YPNA 1QULA 4LUBA 1P1NA 4DLDA 3R26A 4NWCA 1WVJA 3RPWA 4KI0E 4DXBA 3TQLA 3U92A 3FJMA 3SEXA 2X7QA 1B5HA 1A99A 4EF2A 4R6KA 4TQUQ 3CFXA 1H76A 2A5TA 3IAZA 2Z8DA 4FORA 4WKMA 4QSEA 5CI5A 4O3BA 3SEYA 3TCHA 4H8JA 2E1SA 1FTMA 1EZ9A 4MF3A 5LOMA 4G8MA 2DE4A 4GL8A 4EQ7A 5BUUA 5TP9B 3VXBA 1XVYA 4IO4A 1FTLA 2REGA 3D4CA 3T9UA 1SDXA 1LAFE 2ONKE 3MP1A 4LZ7A 4ZEFA 1GTKA 4GF8A 2FNCA 4F3BA 1A55A 3DP6A 1NH8A 4R9GA 3RGYA 2Y7KA 5I57A 3UIFA 3TTNA 1B7ZA 2F5XA 2NXOA 4IGRA 4YMBA 4XKNA 5DEXA 1BKAA 4L17A 1GGGA 3QYTA 3C33A 4WXJA 4RPOA 4GOTA 4F19A 4AB5A 5I56A 4G68B 3DP8A 4RYAA 1DPEA 3LBSA 1B51A 3FXQA 3CI8A 4DDDA 4KCDA 4XXUA 4BDRA 1OQGA 3N6UA 4R9FA 1NL5A 4QF9A 4OWDA 5TPAB 4M1VA 1FTJA 4KYEA 4NF6B 1FQEA 1USYE 3L6GA 3JV9A 2NWJA 3PU5A 2IEEA 1MH3A 3IO4A 5FTHA 1FQAA 3TCFA 1MH4A 4PETA 3TUSA 1YPNA 3PMVA 1PBQA 4EQBA 4KCCA 4DXUA 3QXMA 3PD8A 4U21A 5DVIA 4BDMA 1N84A 4YMAA 3B6TA 2XXIA 1FQDA 3KOTA 4U4XA 5H8SA 2G93A 4FATA 1Y1MA 3PGFA 1LGBC 2HCAA 3ILTB 3CIJA 4GIZA 3B6WA 3ECRA 4GQOA 4KFQA 4YKJA 4TLMB 3EHUA 3T9VA 1P1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F29 A;  1B7H A;  2XHD A;  3CVG A;  3M3F A;  4LP2 B;  3KSX A;  1OQH A;  1URG A;  2I58 A;  4F18 A;  3WAE A;  3VLV A;  2GFE A;  4PFT A;  5H8Q A;  3O9P A;  1N3X A;  1POY 1;  3ZSF A;  1NH7 A;  4ISU A;  4ONY A;  1R6Z A;  3DEL B;  3OO6 A;  1EH3 A;  3MC2 A;  3FV2 A;  2OCU A;  1I6Q A;  3V89 B;  1B1X A;  5CBS A;  5KCJ B;  4R6H A;  3EF7 A;  3PPR A;  5H8N A;  3VVD A;  5CMC A;  4C1T A;  4PP0 A;  3QAX A;  1MY3 A;  4XKR A;  1Y3N A;  2F7C A;  5TU0 A;  2H4I A;  2A5T B;  3CRB A;  3FVG A;  1JVX A;  3V83 A;  3KJT A;  2XXY A;  3M8U A;  2ESN A;  1BLF A;  3WAF A;  3OO9 A;  4H8I A;  5M2V A;  1MXV A;  3IO6 A;  5ICT A;  1P1W A;  2GHB A;  4NED A;  4OYV A;  3MVW A;  1N3W A;  3LUY A;  2V25 A;  4F2O A;  4KD5 A;  5JK4 A;  2NUV A;  3PD9 A;  1N7X A;  3KEI A;  3T93 B;  4GD5 A;  4IB2 A;  5KZT A;  4P0I A;  1AH5 A;  3PUZ E;  1M5E A;  2ZNT A;  1JW1 A;  3UA8 A;  2OK2 A;  4C1U A;  3R6U A;  3AXF A;  2V3U A;  5DVF A;  1PB8 A;  2XXP A;  3THI A;  1EZP A;  1DOT A;  5I57 B;  1S7Y A;  4F3P A;  2P2A A;  1MY1 A;  1IQ7 A;  3EHT A;  3IB0 A;  4IO6 A;  4GWO A;  2AL5 A;  4NF8 B;  1LFG A;  5DEX B;  3OEM A;  3Q29 A;  3S9L C;  4DIG A;  4LA9 A;  2KLF A;  2Y7R A;  5I56 B;  3CSG A;  4YKP A;  1NNT A;  1RYO A;  2ZXT A;  3EHS A;  2BJJ X;  4YAH X;  3GBB A;  3VVE A;  2DWH A;  5K2Y A;  1XHY A;  3IOU A;  4MFI A;  5FTI A;  4U4S A;  1MQI A;  1BTJ A;  4F3S A;  3T22 A;  3HST A;  1LBB A;  3A09 A;  5KDT A;  4G68 A;  2REJ A;  4RY1 A;  4QSD A;  1HSL A;  1MY2 A;  2Q2A A;  2O1L A;  2O68 A;  4NMY A;  5TPA A;  4LVQ A;  1SW4 A;  5K2X A;  4Q0C A;  4NF6 A;  3H6V A;  4YB5 A;  3E13 X;  2YLN A;  1NKX A;  1JVY A;  5B7D A;  3MP8 A;  5L9O A;  1B4H A;  4R2F A;  3Q26 A;  3E3K A;  1XS5 A;  4HTG A;  1I69 A;  3I6V A;  3S4U A;  4H0W A;  3U8Q A;  3TMG A;  3LC8 A;  1LFH A;  1Y9U A;  4N13 A;  1B0H A;  3LSW A;  4N07 A;  3K2D A;  1LAH E;  1ZJL A;  2O7U A;  2DOJ A;  2I3W A;  3IK6 B;  3TEL A;  1OLC A;  2VP1 A;  4NF4 A;  1YAE A;  1DSN A;  4IY5 A;  3K01 A;  1SW5 A;  4UAC A;  3OEN A;  3H03 A;  2H25 A;  3HHF A;  1PB7 A;  3HCQ A;  3MPK A;  4RA1 A;  5H8N B;  1AOV A;  4KYD A;  3C36 A;  4LQ2 A;  3FXU A;  4FJP A;  2DXY A;  3OEL A;  4ZED A;  2XD2 A;  3RLF E;  4KYS A;  4ELR A;  3L6H A;  5KCJ A;  4I62 A;  3VXC A;  2HAU A;  4GXA A;  2O84 X;  4EF1 A;  2ONR A;  4IO5 A;  3C32 A;  1Z7N E;  5I59 A;  1SW2 A;  1FCK A;  1IXH A;  4F1V A;  3PV0 E;  1SBP A;  3OXN A;  2DWJ A;  1HSE A;  3D4G A;  3H6T A;  4X1B A;  1B6H A;  1B3G A;  3ILU B;  2R9J A;  4ZS9 A;  3IX1 A;  4KQP A;  3C34 A;  2THI A;  5I84 A;  1A8E A;  4LON B;  1MXZ A;  3ODB A;  1URS A;  1M5B A;  1IEJ A;  4X48 A;  1MXU A;  2XXT A;  3T66 A;  4EXL A;  1M5D A;  1JEU A;  4H1X A;  4R75 A;  2AIX A;  2XXU A;  4P0G A;  3ONM A;  2F6G A;  1VE4 A;  4BDL A;  1TFD A;  3HN0 A;  3EQ1 A;  5EHM A;  2R6G E;  2DVC A;  2Y7I A;  3T9X B;  2AYS A;  2I6E A;  3G3G A;  3FJG A;  4G2Z A;  1IZ1 A;  2OWS A;  4DCY A;  3SEW A;  4U1Z A;  1PC3 A;  4IO3 A;  4NF8 A;  2QS1 A;  2O1M A;  5FHN A;  1SYH A;  1B40 A;  1R9Q A;  1IIW A;  1IXI A;  3IOR A;  3FVK A;  1S9T A;  5FHM A;  4Q30 B;  5KDT B;  3SER A;  1IXC A;  1Y4T A;  4JWO A;  1N76 A;  3MVZ A;  1UTH B;  5AA1 A;  5ISU A;  1UTB A;  4NF5 A;  2ALU A;  3G3K A;  2UXA A;  5ELV A;  2B3B A;  5ITO A;  2V93 A;  1SI0 A;  4I9D A;  1B05 A;  3KN3 A;  3EN3 A;  3E9X A;  5L8D A;  1ZMG A;  1VSO A;  2I3V A;  3KJ7 A;  1D3K A;  2XX7 A;  2F78 A;  4NE4 A;  3OO7 A;  1ZTY A;  4XIG Q;  2Q8J A;  4F2Q A;  2D3I A;  3FUZ A;  4JB7 A;  1B52 A;  1ZLQ A;  4X9T A;  3G3H A;  2DQV A;  2E0S A;  1CB6 A;  2XXX A;  4OQO A;  4DCX A;  1IUD A;  2VOZ A;  2D5W A;  2F6P A;  4PFW A;  4PQJ A;  4EXK A;  4NF4 B;  4LAT A;  4M4G A;  3V8X B;  3RN8 A;  3RY3 A;  4R2B A;  3IOW A;  1QUK A;  3FZV A;  3O6H A;  2O51 A;  2PT1 A;  3Q25 A;  4QFO A;  3B7D A;  3W9W A;  3PPN A;  3K1N A;  3T9H B;  1KWH A;  4UA8 A;  2GHA A;  2ZNU A;  2DYX A;  2Q88 A;  3QSL A;  5HPQ A;  1LB9 A;  1PB9 A;  1SQY A;  3N94 A;  4QSC A;  5HM4 B;  4K3F A;  1OLA A;  1MY4 A;  1MDQ A;  2XX8 A;  3DP4 A;  2Q89 A;  2RKM A;  1A54 A;  2O7I A;  3MPL A;  2V84 A;  4E0W A;  3CSB A;  4OFO A;  2DE2 A;  3TZA A;  4X1D A;  1B32 A;  3HHG A;  3FVO A;  1O63 A;  2FYI A;  3H4Z A;  1UIV A;  1D4N A;  4YKI A;  3SES A;  2V3T A;  2I4C A;  3U93 A;  4R72 A;  1M5F A;  4N6P A;  2ZYN A;  4AQ4 A;  5I59 B;  3U94 A;  1JNF A;  5F1Q A;  3VFJ A;  1D9V A;  3IJO B;  4ZZE A;  4QHQ A;  3UOR A;  3CR9 A;  2F8D A;  2I4B A;  4F1U A;  1Y3P A;  2F97 A;  2Z23 A;  3VVF A;  3PUW E;  2OLB A;  4ZEK A;  3TPA A;  3V5A A;  4I8C A;  4RK2 A;  4THI A;  3KG2 A;  3B6Q A;  4JSO A;  1USY H;  3O29 A;  3K6X A;  3UGW A;  2UYF A;  2QL3 A;  3H7M A;  1GVC A;  1YCJ A;  1US5 A;  1VFD A;  5I2N B;  2XXR A;  1POT A;  2VD3 A;  4U23 A;  1QJM A;  3O6I A;  2CMO A;  2Y7W A;  3G3I A;  2DWA A;  4PFY A;  1H45 A;  3LR1 A;  1PEB A;  3KFM A;  5CRY A;  1GR2 A;  3M3L A;  1B3L A;  3Q27 A;  3E4R A;  1MXX A;  4G4P A;  3BFU A;  4AB6 A;  2OWT A;  2OJT A;  1FQB A;  4OXV A;  5CM6 A;  2GRV A;  4OES A;  3O2A A;  2I0B A;  3W15 C;  4DE8 A;  3PUX E;  3QIM A;  3IOT A;  3FVN A;  1Y4C A;  1B9J A;  5L9M A;  3OOA A;  4E0X A;  3CG1 A;  1JET A;  1UIU A;  4GFR A;  4YB7 A;  1ATG A;  1P1Q A;  3N26 A;  4MBP A;  4O3C A;  4NTL A;  2O69 A;  3U1O A;  3UP9 A;  4Q5T A;  1A40 A;  4XTC Q;  3KN8 A;  3FXR A;  1LCF A;  1UTB B;  4NF5 B;  3HO7 A;  4YKK A;  4POW A;  4HCY A;  1AMF A;  5I58 A;  2ANJ A;  3R7X A;  3SET A;  3VV5 A;  3MP6 A;  5DVJ A;  1FQC A;  2GH9 A;  1MXW A;  4JSD A;  4GVO A;  4H65 A;  3H06 B;  4ECF A;  5AA4 A;  1UTH A;  3UK4 A;  2W7Y A;  4KPT A;  3SKP A;  3S9N C;  5DTB A;  4OZ9 A;  1B1H A;  3TTR A;  3RT6 B;  1TFA A;  1B3H A;  1SW1 A;  4ND9 A;  3HV1 A;  5JEI A;  4OTE A;  3S9E A;  2PBW A;  4OHN A;  3FAT A;  3QUJ A;  4OMB A;  4EDP A;  1QKA A;  4IY6 A;  1WDN A;  3USD A;  5H8H A;  1OIB A;  2PYY A;  3MZB A;  3MVY A;  1UQW A;  2LAO A;  1B3E A;  2HZK A;  4F39 A;  3MZ1 A;  1Y3Q A;  1RKM A;  1IIT A;  3ZKL A;  1ELJ A;  3TTK A;  4OEV A;  2PVU A;  1FW0 A;  3OEK A;  2QS3 A;  4ESX A;  2H98 A;  4TLL B;  3EPE A;  2I0C A;  1B7U A;  3RTF B;  2QPQ A;  5EYF A;  1M5C A;  1ZBM A;  4R73 A;  3BBR A;  5AA2 A;  2I48 A;  3S9M C;  1MDP 1;  2RCA A;  5EHS A;  1OMP A;  3OD7 A;  2VHA A;  1CE2 A;  3S2V A;  1DMB A;  3TDJ A;  3TOD A;  4KHZ E;  2UYE A;  2X7P A;  3TYH A;  1B4Z A;  3BKI B;  3N6T A;  1N7W A;  2V3Q A;  2QS4 A;  4F3G A;  3PPP A;  4ZZA A;  2QSX A;  3H6W A;  4FED A;  2XX9 A;  4QFK A;  4G68 C;  5DT6 A;  3A3U A;  2O6A A;  1RYX A;  3VLU A;  4U1O A;  1MXY A;  4IGT A;  2D21 A;  5ITP A;  3KGC A;  4OEN A;  3G3J A;  1XOC A;  1US4 A;  1XC1 A;  3FGS A;  3KOS A;  5DYH A;  3N5L A;  3IOV A;  2XXV A;  3IR1 A;  4GL0 A;  1XVX A;  3C4M A;  3TAJ A;  3TFL A;  1FTO A;  4R74 A;  3SEU A;  2G29 A;  2H99 A;  5I2K A;  4H5G A;  1O64 A;  4FE8 A;  4U2R A;  1MRP A;  2XXQ A;  4XKQ A;  3F11 A;  5AA3 A;  1QKB A;  5I2N A;  1MPB A;  3BFT A;  4RPN A;  1OVB A;  1VR5 A;  2F35 A;  3IJX B;  4RJZ A;  3KZG A;  1DTZ A;  2PT2 A;  2HQ0 A;  2Y84 A;  1SD3 A;  1PDA A;  2QS2 A;  2ZYO A;  4F22 A;  4XKP A;  3MWB A;  2ZNS A;  2X26 A;  1Y20 A;  4G8N A;  4YZZ A;  4JXI A;  4OET A;  4U22 A;  5I58 B;  2CZL A;  1IXG A;  3FJ7 A;  2Y7P A;  1XT8 A;  1LLS A;  4BDO A;  3G3F A;  2F36 A;  3GZG A;  5BWJ A;  3FV1 A;  2XD3 A;  4ZEB A;  1A8F A;  1ZKB A;  3FAS A;  1LFI A;  2RC8 A;  1WOD A;  5AA4 B;  5AE4 A;  1JEV A;  1D9Y A;  3IL1 B;  2WKY A;  1DTG A;  2RC7 A;  1II5 A;  1YTV A;  2OBG A;  1B3F A;  5IKB A;  3GBA A;  4G8H A;  5FHO A;  3PUV E;  4FIM A;  1NFT A;  1JQF A;  5A5X B;  3VLW A;  2NOO A;  2RIN A;  5CMK A;  3T96 B;  4ZEC A;  1T0K A;  3FD3 A;  4ZEI A;  1URD A;  3KSJ A;  2DWI A;  3IB1 A;  4OVJ A;  1LAX A;  4C0R A;  5H8F B;  4BDN A;  3CFL A;  3TTL A;  3LSF B;  4IO2 A;  4F1Y A;  5H8H B;  1ANF A;  1MQH A;  1SVX B;  2YJP A;  1BIY A;  1P99 A;  2OZZ A;  3U72 A;  4GLI A;  4JWY A;  4ZDM A;  1N0T A;  1BP5 A;  2F7B A;  2A5S A;  2VD2 A;  3OSR A;  2DS9 A;  5ICQ A;  2FA7 A;  2QJE A;  1QUI A;  4OEU A;  1MY0 A;  1ZU0 A;  2I49 A;  4LQ5 A;  1JW5 A;  5JTY A;  4TOZ A;  4ZE8 A;  4Z7E A;  1H44 A;  1ZIU A;  3MUQ A;  2DXR A;  2RCB A;  1VFE A;  1B5J A;  4RXL A;  5AA2 B;  4H5F A;  2R71 A;  3HPI A;  2ABH A;  2HEU A;  3MW0 A;  1MPD A;  3PMX A;  2QMW A;  1B0L A;  1JW4 A;  1N04 A;  3PUY E;  1NNK A;  1LAG E;  4MLQ A;  2IA4 A;  3QK6 A;  1OVT A;  5B70 A;  2F7A A;  4RK9 A;  4I1D A;  3K4U A;  3ZS6 A;  2XXW A;  3TCG A;  1NNP A;  3CG3 A;  3RUM A;  2ONS A;  3MBP A;  3RTW B;  3C35 A;  1B2H A;  1I6B A;  2DVZ A;  4YB6 A;  4ZE9 A;  3GLB A;  3JZJ A;  2DP8 A;  2PMS A;  3MVX A;  1MS7 A;  1MM7 A;  3MQ9 A;  2AL4 A;  4YIC A;  2RF1 A;  2UVH A;  1Y1Z A;  5CMB A;  4RNS A;  2HZL A;  3SEV A;  4F31 B;  3TQW A;  1MQD A;  1LBC A;  3M3K A;  3TEP A;  4R6Y A;  2UVG A;  1MM6 A;  4MH5 A;  4PFU A;  3ZKK A;  5I2K B;  5HBC A;  1P1U A;  1TXF A;  1R1N A;  1MPC A;  3OSQ A;  3K02 A;  1LST A;  4FEB A;  1MG1 A;  3KN7 A;  4LZ5 A;  4OFJ A;  3VE1 B;  1EZO A;  3K6V A;  1Z7M E;  3DLN A;  4WEP A;  1A7L A;  2ZMB A;  4HCW A;  2UVI A;  3MJN A;  2VGQ A;  1B46 A;  4YU0 A;  3C31 A;  1QW0 A;  3JYR A;  1QUJ A;  4DZ1 A;  2Q9T A;  4QFN A;  1SYI A;  4IO7 A;  4H6D A;  4LZ8 A;  3A3C A;  5TP9 A;  1AIV A;  4GXS B;  4GRK A;  4FAJ A;  3PMW A;  1MQG A;  1DPP A;  2B3F A;  3O97 A;  1SI1 A;  4JBZ A;  3PPO A;  3I3V A;  4ESW A;  1GV8 A;  3UN6 A;  2ZYK A;  1FQF A;  5CC2 A;  4PE5 B;  2P1S A;  5CBR A;  3TKD A;  2Q2C A;  3KBR A;  4OFL A;  2PX1 A;  1B5I A;  4ELQ A;  2HAV A;  3H3G A;  4JWX A;  1J1N A;  1O7T A;  4Q8R A;  3H6U A;  2DSF A;  2NVU B;  1F9B A;  3RT8 A;  1R9L A;  4G77 A;  3O6G A;  2RC9 A;  5A5X A;  3I5O A;  5CMM A;  3QUF A;  4FEC A;  1TWY A;  3SDF A;  4EQ9 A;  3GXA A;  4DXC A;  1FTK A;  2DE3 A;  3LSX A;  3MZ9 A;  1PBP A;  5H8F A;  3TTM A;  3G7W A;  3OMB A;  4KR5 A;  3K1M A;  5JTY B;  2HXW A;  4JDF A;  3IB2 A;  1EU8 A;  4O3A A;  2H9B A;  2QRY A;  3K0V A;  2UVJ A;  2Z8F A;  3DM0 A;  3O28 A;  3FIR A;  4NWD A;  5AA2 D;  1H43 A;  2H5Y A;  5F7V A;  4QFP A;  4POX A;  2P0S A;  3C9H A;  3RQT A;  2HFB A;  3K00 A;  2B65 A;  3LSL A;  1S50 A;  3PPQ A;  5L9S A;  3W9V A;  4ELO A;  3K6U A;  4QFL A;  1L5T A;  5J1D A;  3Q28 A;  4WED A;  5H8Q B;  2M8C A;  3K6W A;  4HS7 A;  1I6A A;  3P7I A;  3CFZ A;  3OO8 A;  2Z8E A;  1H3D A;  4QRZ A;  1B58 A;  4P11 A;  3MAM A;  5IAI A;  3VDF A;  4MLV A;  4HW8 A;  2XXH A;  4BDQ A;  4H67 A;  4OER A;  1TT1 A;  2Z22 A;  2ZYM A;  1AL3 A;  2F34 A;  1MQJ A;  3O66 A;  1LCT A;  1HSJ A;  1Q35 A;  4ELP A;  1NNF A;  3RNN A;  1Q1K A;  4EUO A;  4BLA A;  2QMX A;  3K1P A;  1NMU A;  1LB8 A;  1QVS A;  4Z0I A;  2YPN A;  1QUL A;  4LUB A;  1P1N A;  4DLD A;  3R26 A;  4NWC A;  1WVJ A;  3RPW A;  4KI0 E;  4DXB A;  3TQL A;  3U92 A;  3FJM A;  3SEX A;  2X7Q A;  1B5H A;  1A99 A;  4EF2 A;  4R6K A;  4TQU Q;  3CFX A;  1H76 A;  2A5T A;  3IAZ A;  2Z8D A;  4FOR A;  4WKM A;  4QSE A;  5CI5 A;  4O3B A;  3SEY A;  3TCH A;  4H8J A;  2E1S A;  1FTM A;  1EZ9 A;  4MF3 A;  5LOM A;  4G8M A;  2DE4 A;  4GL8 A;  4EQ7 A;  5BUU A;  5TP9 B;  3VXB A;  1XVY A;  4IO4 A;  1FTL A;  2REG A;  3D4C A;  3T9U A;  1SDX A;  1LAF E;  2ONK E;  3MP1 A;  4LZ7 A;  4ZEF A;  1GTK A;  4GF8 A;  2FNC A;  4F3B A;  1A55 A;  3DP6 A;  1NH8 A;  4R9G A;  3RGY A;  2Y7K A;  5I57 A;  3UIF A;  3TTN A;  1B7Z A;  2F5X A;  2NXO A;  4IGR A;  4YMB A;  4XKN A;  5DEX A;  1BKA A;  4L17 A;  1GGG A;  3QYT A;  3C33 A;  4WXJ A;  4RPO A;  4GOT A;  4F19 A;  4AB5 A;  5I56 A;  4G68 B;  3DP8 A;  4RYA A;  1DPE A;  3LBS A;  1B51 A;  3FXQ A;  3CI8 A;  4DDD A;  4KCD A;  4XXU A;  4BDR A;  1OQG A;  3N6U A;  4R9F A;  1NL5 A;  4QF9 A;  4OWD A;  5TPA B;  4M1V A;  1FTJ A;  4KYE A;  4NF6 B;  1FQE A;  1USY E;  3L6G A;  3JV9 A;  2NWJ A;  3PU5 A;  2IEE A;  1MH3 A;  3IO4 A;  5FTH A;  1FQA A;  3TCF A;  1MH4 A;  4PET A;  3TUS A;  1YPN A;  3PMV A;  1PBQ A;  4EQB A;  4KCC A;  4DXU A;  3QXM A;  3PD8 A;  4U21 A;  5DVI A;  4BDM A;  1N84 A;  4YMA A;  3B6T A;  2XXI A;  1FQD A;  3KOT A;  4U4X A;  5H8S A;  2G93 A;  4FAT A;  1Y1M A;  3PGF A;  1LGB C;  2HCA A;  3ILT B;  3CIJ A;  4GIZ A;  3B6W A;  3ECR A;  4GQO A;  4KFQ A;  4YKJ A;  4TLM B;  3EHU A;  3T9V A;  1P1O A; 
#chains in the Genus database with same CATH topology
 4F29 A;  1B7H A;  2XHD A;  3CVG A;  3M3F A;  4LP2 B;  3KSX A;  1OQH A;  1URG A;  2I58 A;  4F18 A;  3WAE A;  3VLV A;  2GFE A;  4PFT A;  5IZ1 A;  5H8Q A;  3O9P A;  1N3X A;  4GX6 A;  1POY 1;  3ZSF A;  1NH7 A;  4ISU A;  2CZH A;  4ONY A;  1R6Z A;  3DEL B;  3OO6 A;  1EH3 A;  3MC2 A;  4PAF A;  3FV2 A;  3LV0 A;  2OCU A;  1I6Q A;  2CZI A;  3V89 B;  1B1X A;  5CBS A;  4GBV A;  4I40 A;  5KCJ B;  4MNI A;  4R6H A;  3EF7 A;  3PPR A;  5H8N A;  3VVD A;  5CMC A;  4C1T A;  4PP0 A;  3QAX A;  1MY3 A;  4XKR A;  1Y3N A;  2F7C A;  4AS4 A;  5TU0 A;  2H4I A;  2A5T B;  5ET8 A;  3CRB A;  3FVG A;  1JVX A;  2Q74 A;  3V83 A;  3KJT A;  2WBB A;  1FTA A;  2XXY A;  3M8U A;  2ESN A;  1BLF A;  1DK4 A;  3WAF A;  3OO9 A;  4H8I A;  5M2V A;  1MXV A;  3IO6 A;  1FPJ A;  5ICT A;  1P1W A;  2GHB A;  4NED A;  4OYV A;  3MVW A;  1N3W A;  2BJI A;  3LUY A;  2V25 A;  4F2O A;  4KD5 A;  1K9Z A;  5JK4 A;  2NUV A;  3PD9 A;  1N7X A;  4GWU A;  3KEI A;  3T93 B;  4GD5 A;  4IB2 A;  5KZT A;  4P0I A;  1AH5 A;  3PUZ E;  4PFI A;  2PFY A;  1M5E A;  2ZNT A;  1JW1 A;  3UA8 A;  4N8Y A;  2OK2 A;  4C1U A;  3R6U A;  3AXF A;  2V3U A;  5DVF A;  1PB8 A;  2XXP A;  3THI A;  1EZP A;  3ROJ A;  1DOT A;  1FBH A;  5I57 B;  1S7Y A;  2P3N A;  2P2A A;  4F3P A;  1MY1 A;  1IQ7 A;  3EHT A;  3IB0 A;  1IMD A;  4IO6 A;  4GWO A;  2AL5 A;  3RPL B;  4PAI A;  4PGN A;  3LUZ A;  1LFG A;  4NF8 B;  5DEX B;  3OEM A;  4GWZ A;  3Q29 A;  3KC0 A;  4DIG A;  3S9L C;  4LA9 A;  3ISP A;  3D1R A;  2KLF A;  2Y7R A;  5I56 B;  3CSG A;  5F24 A;  4MNP A;  4YKP A;  4JVC A;  1NNT A;  1RYO A;  1K9Y A;  2ZXT A;  2BJJ X;  3EHS A;  4YAH X;  3GBB A;  3VVE A;  2DWH A;  5K2Y A;  1XHY A;  3IOU A;  4MFI A;  5FTI A;  4U4S A;  1MQI A;  1BTJ A;  4F3S A;  3T22 A;  4NAP A;  3HST A;  1LBB A;  3A09 A;  5KDT A;  4G68 A;  4P9K A;  2VT5 A;  2REJ A;  4RY1 A;  4QSD A;  1FPK A;  1HSL A;  1MY2 A;  2Q2A A;  2O1L A;  4P47 A;  2O68 A;  1LEV A;  4NMY A;  5DW8 A;  5TPA A;  2P3V A;  4LVQ A;  1SW4 A;  5K2X A;  2QVU A;  4Q0C A;  4NF6 A;  3H6V A;  4YB5 A;  3E13 X;  2YLN A;  4H45 A;  1NKX A;  1JVY A;  4QBA A;  5B7D A;  3MP8 A;  5L9O A;  1B4H A;  4QXD A;  5IGA A;  4R2F A;  3Q26 A;  3E3K A;  4PBH A;  1XS5 A;  4X04 A;  4HTG A;  1I69 A;  3I6V A;  3S4U A;  4H0W A;  3U8Q A;  3TMG A;  3LC8 A;  1LFH A;  4OVR A;  1Y9U A;  4N13 A;  4OA4 A;  1B0H A;  3LSW A;  4N07 A;  3K2D A;  1NV4 A;  1LAH E;  1ZJL A;  4P1L A;  2O7U A;  2DOJ A;  2I3W A;  3IK6 B;  3TEL A;  1OLC A;  2VP1 A;  4NF4 A;  4O8M A;  1YAE A;  1DSN A;  4IY5 A;  2XXK A;  3K01 A;  2XWO A;  1SW5 A;  4UAC A;  3OEN A;  3H03 A;  2VPN A;  2H25 A;  3HHF A;  1PB7 A;  2PFZ A;  3HCQ A;  3MPK A;  5ET6 A;  1AWB A;  5IZ3 A;  4RA1 A;  5H8N B;  4GWS A;  1QGX A;  1AOV A;  4KYD A;  3C36 A;  4XFE A;  4LQ2 A;  1FPI A;  1XI6 A;  3FXU A;  4FJP A;  2DXY A;  5EQ9 A;  3OEL A;  4ZED A;  2XD2 A;  3RLF E;  4KYS A;  4ELR A;  3L6H A;  4NN3 A;  5KCJ A;  4I62 A;  3VXC A;  2HAU A;  4GXA A;  2O84 X;  4MMP A;  4EF1 A;  4IR8 A;  2ONR A;  4IO5 A;  3C32 A;  4PCD A;  4FBP A;  2F3B A;  4GX4 A;  1Z7N E;  5I59 A;  1SW2 A;  1LBY A;  1FCK A;  1IXH A;  4F1V A;  3PV0 E;  1SBP A;  3OXN A;  2DWJ A;  1HSE A;  3D4G A;  3H6T A;  4X1B A;  1B6H A;  1B3G A;  3ILU B;  2R9J A;  4ZS9 A;  3IX1 A;  4KQP A;  3C34 A;  2THI A;  5I84 A;  1A8E A;  4LON B;  1MXZ A;  3ODB A;  1URS A;  1M5B A;  1IEJ A;  1NV2 A;  4X48 A;  1MXU A;  2XXT A;  3T66 A;  4EXL A;  1M5D A;  5EQ7 A;  1JEU A;  4H1X A;  4R75 A;  2AIX A;  2XXU A;  4P0G A;  3ONM A;  2F6G A;  1VE4 A;  4BDL A;  1TFD A;  1CNQ A;  3HN0 A;  3EQ1 A;  4PDH A;  1FSA A;  2FIX A;  5EHM A;  2R6G E;  1KA1 A;  2DVC A;  2Y7I A;  3T9X B;  2AYS A;  2WX9 A;  4XEQ A;  1G0H A;  2I6E A;  3G3G A;  3FJG A;  4G2Z A;  4MNC A;  1IZ1 A;  2OWS A;  4I3E A;  4DCY A;  3E79 A;  3SEW A;  4U1Z A;  1PC3 A;  3RPL A;  4NX1 A;  4IO3 A;  1FBD A;  1KA0 A;  4NF8 A;  2QS1 A;  2O1M A;  1KZ8 A;  5FHN A;  1SYH A;  2WYP A;  2Y5L A;  1B40 A;  1R9Q A;  1IIW A;  1IXI A;  3IOR A;  3FVK A;  1S9T A;  1RDX A;  5FHM A;  4Q30 B;  5KDT B;  3SER A;  1IXC A;  1Y4T A;  1FBC A;  2VPO A;  4JWO A;  2OX3 A;  1N76 A;  3MVZ A;  4PF6 A;  1FBE A;  1UTH B;  5AA1 A;  5ISU A;  1UTB A;  4NF5 A;  2ALU A;  3G3K A;  2UXA A;  5ELV A;  2B3B A;  5ITO A;  2V93 A;  1SI0 A;  2HPG A;  2PCR A;  4I9D A;  1B05 A;  4PFB A;  1RDY A;  3KN3 A;  3EN3 A;  3E9X A;  5L8D A;  1ZMG A;  1VSO A;  1YXI A;  2I3V A;  3KJ7 A;  1D3K A;  4PGP A;  2XX7 A;  1LBW A;  2F78 A;  4NE4 A;  3OO7 A;  3SZP A;  1ZTY A;  1NV1 A;  4XIG Q;  2Q8J A;  1NI9 A;  4F2Q A;  3A29 A;  4NHB A;  2D3I A;  3FUZ A;  4JB7 A;  1B52 A;  1ZLQ A;  4X9T A;  4P3L A;  3G3H A;  2DQV A;  2E0S A;  1CB6 A;  2XXX A;  4GWX A;  4OQO A;  1IUD A;  4DCX A;  2VOZ A;  2D5W A;  2F6P A;  4PFW A;  2CEX A;  4PQJ A;  4EXK A;  4NF4 B;  4LAT A;  4M4G A;  3V8X B;  3RN8 A;  3RY3 A;  4R2B A;  3IOW A;  1QUK A;  3FZV A;  3O6H A;  2O51 A;  2PT1 A;  3Q25 A;  4QFO A;  2GQ1 A;  3B7D A;  3W9W A;  3PPN A;  4PDD A;  4MHF A;  3K1N A;  3T9H B;  1KWH A;  4UA8 A;  2GHA A;  2ZNU A;  5IZ3 B;  3MYU A;  2DYX A;  2Q88 A;  3QSL A;  5HPQ A;  1LB9 A;  1PB9 A;  1SQY A;  3N94 A;  4QSC A;  5HM4 B;  4K3F A;  5A5L A;  1OLA A;  1MY4 A;  2ZZW A;  1MDQ A;  2XX8 A;  3DP4 A;  2Q89 A;  2RKM A;  4JVD A;  1A54 A;  2O7I A;  3MPL A;  2V84 A;  4E0W A;  3CSB A;  4OFO A;  2DE2 A;  3TZA A;  4X1D A;  1B32 A;  3HHG A;  3FVO A;  1O63 A;  2FYI A;  3H4Z A;  1UIV A;  1D4N A;  4YKI A;  3SES A;  2V3T A;  2I4C A;  3U93 A;  5T3J A;  3EKI A;  4PC9 A;  4R72 A;  1M5F A;  4N6P A;  2ZYN A;  4AQ4 A;  5I59 B;  3U94 A;  1JNF A;  5F1Q A;  3VFJ A;  2QVV A;  1D9V A;  3IJO B;  4ZZE A;  4QHQ A;  3UOR A;  3CR9 A;  2F8D A;  4N6D A;  2I4B A;  4F1U A;  4GX3 A;  1Y3P A;  2F97 A;  2Z23 A;  5EQA A;  3VVF A;  2Y5K A;  3PUW E;  2OLB A;  4ZEK A;  3TPA A;  4O7I A;  3V5A A;  4I8C A;  4RK2 A;  1FBP A;  4THI A;  3KG2 A;  4N91 A;  3B6Q A;  4JSO A;  1USY H;  3O29 A;  3K6X A;  3UGW A;  2UYF A;  2QL3 A;  3H7M A;  1GVC A;  1YCJ A;  1US5 A;  1VFD A;  5I2N B;  2XXR A;  1POT A;  2VD3 A;  4U23 A;  1QJM A;  3O6I A;  1VDW A;  4OVT A;  2CMO A;  2Y7W A;  3G3I A;  2DWA A;  4HE1 A;  4PFY A;  3RYD A;  1H45 A;  4X8R A;  3LR1 A;  1PEB A;  3KFM A;  5CRY A;  1GR2 A;  3M3L A;  1B3L A;  3Q27 A;  3E4R A;  1MXX A;  4G4P A;  3BFU A;  4AB6 A;  2XWK A;  2OWT A;  2OJT A;  1FQB A;  2FIE A;  4OXV A;  5CM6 A;  2GRV A;  4OES A;  3O2A A;  1FBF A;  2I0B A;  3W15 C;  4DE8 A;  3PUX E;  3QIM A;  3IOT A;  3FVN A;  1B9J A;  1Y4C A;  5L9M A;  1YZ0 A;  3OOA A;  4UAB A;  4E0X A;  3CG1 A;  1JET A;  1UIU A;  4GFR A;  4YB7 A;  1ATG A;  1P1Q A;  3N26 A;  4MBP A;  4O3C A;  4NTL A;  2O69 A;  3U1O A;  3UP9 A;  4Q5T A;  1A40 A;  4XTC Q;  2CEY A;  3KN8 A;  3FXR A;  1LCF A;  3MST A;  1UTB B;  4NF5 B;  3HO7 A;  4YKK A;  4POW A;  4HCY A;  1AMF A;  5I58 A;  2ANJ A;  3R7X A;  3SET A;  3VV5 A;  3MP6 A;  5DVJ A;  1FQC A;  1LBZ A;  2GH9 A;  1MXW A;  4JSD A;  4GVO A;  1RDZ A;  3H06 B;  4H65 A;  4ECF A;  5AA4 A;  1FPB A;  1NUZ A;  1UTH A;  3UK4 A;  2W7Y A;  4KPT A;  3SKP A;  3S9N C;  3KBZ A;  5DTB A;  4OZ9 A;  1IMC A;  1B1H A;  3TTR A;  4GBW A;  3RT6 B;  1TFA A;  2QVR A;  5LTC A;  4NG7 A;  5IZZ A;  5LDZ A;  1B3H A;  1SW1 A;  4ND9 A;  3HV1 A;  5JEI A;  4OTE A;  3S9E A;  3BIH A;  1EYJ A;  2PBW A;  4P1E A;  4OHN A;  3FAT A;  3QUJ A;  4OMB A;  4EDP A;  1QKA A;  4IY6 A;  1WDN A;  3USD A;  2FHY A;  5H8H A;  1OIB A;  2PYY A;  3MZB A;  3MVY A;  4N17 A;  1UQW A;  2LAO A;  1B3E A;  2HZK A;  4F39 A;  3MZ1 A;  2QFL A;  1Y3Q A;  1RKM A;  1IIT A;  3ZKL A;  4PFR A;  1ELJ A;  3TTK A;  1Q9D A;  4O94 A;  3QMF A;  4OEV A;  2PVU A;  4MEV A;  1FW0 A;  3OEK A;  2QS3 A;  4ESX A;  2H98 A;  2XA5 A;  4P8B A;  4I3Y A;  4TLL B;  3EPE A;  2I0C A;  1B7U A;  3RTF B;  2QPQ A;  5EYF A;  1M5C A;  1ZBM A;  4R73 A;  4PBQ A;  3BBR A;  5AA2 A;  2I48 A;  3S9M C;  1MDP 1;  2RCA A;  5IM2 A;  5EHS A;  1OMP A;  5EYG A;  3OD7 A;  2VHA A;  3B8B A;  1CE2 A;  3S2V A;  1DMB A;  1YYZ A;  3TDJ A;  3TOD A;  4KHZ E;  2UYE A;  4GWY A;  2X7P A;  2XWV A;  3TYH A;  1DBZ A;  1B4Z A;  2ZZV A;  3BKI B;  3N6T A;  2Q8M A;  1N7W A;  2V3Q A;  2QS4 A;  4F3G A;  3PPP A;  4ZZA A;  4AS5 A;  2QSX A;  3H6W A;  4FED A;  4LN5 A;  2XX9 A;  4QFK A;  4G68 C;  5DT6 A;  3A3U A;  2O6A A;  1RYX A;  3VLU A;  4U1O A;  1MXY A;  4IGT A;  2D21 A;  5ITP A;  3KGC A;  4OEN A;  3G3J A;  4NQ8 A;  1XOC A;  2KR0 A;  1US4 A;  1XC1 A;  3FGS A;  3KOS A;  5DYH A;  3N5L A;  3IOV A;  2XXV A;  3IR1 A;  4GL0 A;  1XVX A;  3C4M A;  3TAJ A;  3TFL A;  1FTO A;  4R74 A;  3SEU A;  2G29 A;  2H99 A;  5I2K A;  4H5G A;  1O64 A;  1NV7 A;  4FE8 A;  4U2R A;  1MRP A;  2XXQ A;  4XKQ A;  3F11 A;  5AA3 A;  1NV6 A;  1QKB A;  5I2N A;  1NV0 A;  2DDK A;  1MPB A;  3BFT A;  4H46 A;  4RPN A;  3GYY A;  1OVB A;  1VR5 A;  2F35 A;  3IJX B;  4RJZ A;  3KZG A;  1DTZ A;  2PT2 A;  2HQ0 A;  4GWW A;  2Y84 A;  1SD3 A;  1PDA A;  1BK4 A;  2QS2 A;  2ZYO A;  4F22 A;  4XKP A;  3MWB A;  2ZNS A;  2X26 A;  1Y20 A;  3PTY A;  4G8N A;  2R8T A;  4YZZ A;  4HE0 A;  4JXI A;  4OET A;  4U22 A;  5I58 B;  2CZL A;  1FBG A;  1IXG A;  3FJ7 A;  2Y7P A;  1XT8 A;  1LLS A;  4BDO A;  4HXV A;  3G3F A;  2F36 A;  4PAK A;  3GZG A;  5BWJ A;  1IMB A;  3FV1 A;  2XD3 A;  4ZEB A;  1A8F A;  1ZKB A;  3FAS A;  1LFI A;  2RC8 A;  1WOD A;  5AA4 B;  1SPI A;  5AE4 A;  1JEV A;  1D9Y A;  3IL1 B;  2WKY A;  1DTG A;  4PE3 A;  2RC7 A;  1II5 A;  1YTV A;  2OBG A;  1B3F A;  5IKB A;  3GBA A;  4G8H A;  5FHO A;  3PUV E;  2ZZX A;  4FIM A;  1NFT A;  1JQF A;  1LBV A;  5A5X B;  3VLW A;  2NOO A;  2RIN A;  5CMK A;  3T96 B;  4ZEC A;  1T0K A;  3FD3 A;  1IMA A;  4ZEI A;  1URD A;  1FPG A;  3KSJ A;  4PF8 A;  2DWI A;  3IB1 A;  4OVJ A;  1LAX A;  4C0R A;  5H8F B;  4BDN A;  3CFL A;  3TTL A;  3LSF B;  4IO2 A;  4F1Y A;  5H8H B;  2V4C A;  1ANF A;  1MQH A;  1SVX B;  2YJP A;  1BIY A;  1P99 A;  2OZZ A;  3U72 A;  5ESY A;  4N8G A;  3FBP A;  4GLI A;  4JWY A;  4ZDM A;  1N0T A;  4OAN A;  1BP5 A;  3CHG A;  2F7B A;  2A5S A;  2VD2 A;  3OSR A;  2DS9 A;  4MX6 A;  5ICQ A;  2FA7 A;  2QJE A;  1QUI A;  2B4L A;  4OEU A;  1MY0 A;  1ZU0 A;  2I49 A;  4LQ5 A;  4DI3 D;  1JW5 A;  5JTY A;  2FVZ A;  5I5P A;  4TOZ A;  4ZE8 A;  4Z7E A;  1H44 A;  1NUX A;  1ZIU A;  3MUQ A;  2DXR A;  2RCB A;  3BIG A;  1VFE A;  1B5J A;  4RXL A;  5AA2 B;  1D9Q A;  1IME A;  4H5F A;  2R71 A;  3HPI A;  2ABH A;  2HEU A;  3MW0 A;  1DCU A;  1EYK A;  1MPD A;  3PMX A;  5I7I A;  2QMW A;  1B0L A;  3IFA A;  1JW4 A;  1N04 A;  3PUY E;  1NNK A;  1LAG E;  2CZK A;  4MLQ A;  2IA4 A;  3QK6 A;  3T0J A;  1OVT A;  5B70 A;  2F7A A;  4RK9 A;  4I1D A;  3K4U A;  3ZS6 A;  2XXW A;  3TCG A;  1NNP A;  2HHM A;  3CG3 A;  2B4M A;  3RUM A;  2ONS A;  3MBP A;  3RTW B;  3C35 A;  1B2H A;  2XWI A;  1I6B A;  2DVZ A;  4N6K A;  4PTK A;  4YB6 A;  4ZE9 A;  3GLB A;  4XF5 A;  3JZJ A;  2DP8 A;  2PMS A;  3MVX A;  1MS7 A;  1MM7 A;  3MQ9 A;  2AL4 A;  4YIC A;  2RF1 A;  2UVH A;  1Y1Z A;  5CMB A;  4RNS A;  2HZL A;  3SEV A;  4F31 B;  3TQW A;  1MQD A;  1LBC A;  4JVI A;  3M3K A;  3TEP A;  4R6Y A;  2UVG A;  1MM6 A;  4MH5 A;  4PFU A;  3ZKK A;  5I2K B;  5HBC A;  1P1U A;  1TXF A;  1R1N A;  1MPC A;  3OSQ A;  3K02 A;  1LST A;  4FEB A;  1MG1 A;  3KN7 A;  4LZ5 A;  4OFJ A;  3VE1 B;  1EZO A;  3K6V A;  4G61 A;  1Z7M E;  3DLN A;  4WEP A;  1A7L A;  2ZMB A;  4HCW A;  2UVI A;  3MJN A;  3T1B A;  2HXR A;  2VGQ A;  1B46 A;  4OVP A;  4YU0 A;  3C31 A;  1QW0 A;  3JYR A;  1QUJ A;  4DZ1 A;  3IFC A;  2Q9T A;  4QFN A;  4OVQ A;  1SYI A;  4IO7 A;  4H6D A;  4LZ8 A;  3A3C A;  5TP9 A;  1AIV A;  4GXS B;  4GRK A;  4FAJ A;  1FJ9 A;  3PMW A;  1MQG A;  1DPP A;  2B3F A;  3O97 A;  4NF0 A;  1SI1 A;  4JBZ A;  3PPO A;  3I3V A;  4ESW A;  1GV8 A;  3UN6 A;  2ZYK A;  1FQF A;  4O7M A;  2MKZ A;  5CC2 A;  4MAG A;  4PE5 B;  2P1S A;  4OVS A;  5CBR A;  3TKD A;  2Q2C A;  3KBR A;  4OFL A;  2PX1 A;  1B5I A;  4ELQ A;  2HAV A;  4NGU A;  3H3G A;  4JWX A;  1J1N A;  1O7T A;  5I3S A;  4Q8R A;  3H6U A;  2DSF A;  2NVU B;  5FBP A;  1F9B A;  3RT8 A;  1FPE A;  1R9L A;  5J16 A;  4G77 A;  5EQ8 A;  3O6G A;  1INP A;  2RC9 A;  5A5X A;  3I5O A;  5CMM A;  3QUF A;  4N81 A;  4FEC A;  1TWY A;  3SDF A;  4EQ9 A;  3GXA A;  4DXC A;  3U65 A;  1FTK A;  2DE3 A;  3LSX A;  1G0I A;  3MZ9 A;  1PBP A;  5H8F A;  3TTM A;  3G7W A;  3OMB A;  4KR5 A;  3K1M A;  5JTY B;  2HXW A;  4JDF A;  3IB2 A;  1EU8 A;  4O3A A;  2H9B A;  2QRY A;  3K0V A;  2UVJ A;  2Z8F A;  2WYK A;  3DM0 A;  3O28 A;  3FIR A;  4NWD A;  5AA2 D;  1H43 A;  2H5Y A;  2KQZ A;  5F7V A;  4QFP A;  4POX A;  2P0S A;  3C9H A;  3RQT A;  2HFB A;  3K00 A;  2B65 A;  3LSL A;  1S50 A;  3PPQ A;  5L9S A;  3W9V A;  4ELO A;  3K6U A;  4QFL A;  1L5T A;  5J1D A;  3Q28 A;  4WED A;  5H8Q B;  2M8C A;  3K6W A;  4HS7 A;  1I6A A;  3P7I A;  3CFZ A;  3OO8 A;  4N15 A;  2Z8E A;  1H3D A;  4QRZ A;  1B58 A;  4P11 A;  3MAM A;  1FPF A;  5IAI A;  3VDF A;  4MCO A;  4MLV A;  4HW8 A;  2XXH A;  4BDQ A;  4H67 A;  4OER A;  1TT1 A;  2FBP A;  2Z22 A;  2ZYM A;  1AL3 A;  2F34 A;  2WEF A;  1MQJ A;  3O66 A;  1LCT A;  1HSJ A;  4HE2 A;  1Q35 A;  3HFU A;  4ELP A;  1NNF A;  3RNN A;  1Q1K A;  4EUO A;  4BLA A;  4P56 A;  2QMX A;  3K1P A;  1NMU A;  1LB8 A;  1QVS A;  4Z0I A;  2YPN A;  1QUL A;  5EYH A;  4LUB A;  1P1N A;  4DLD A;  3R26 A;  4NWC A;  1WVJ A;  5ET5 A;  1EYI A;  3RPW A;  3FXB A;  4KI0 E;  4DXB A;  3TQL A;  3U92 A;  2OWZ A;  3FJM A;  3SEX A;  2X7Q A;  1B5H A;  1A99 A;  4EF2 A;  4MJO A;  4R6K A;  4TQU Q;  3CFX A;  1H76 A;  2A5T A;  3IAZ A;  2Z8D A;  4FOR A;  4WKM A;  4QSE A;  5CI5 A;  4O3B A;  3SEY A;  3TCH A;  4H8J A;  2E1S A;  1FTM A;  1EZ9 A;  4MF3 A;  5LOM A;  4G8M A;  2DE4 A;  4GL8 A;  4EQ7 A;  5BUU A;  5TP9 B;  2L5V A;  3VXB A;  1XVY A;  4IO4 A;  1FTL A;  2REG A;  3D4C A;  3T9U A;  1SDX A;  1LAF E;  2ONK E;  3MP1 A;  4LZ7 A;  4ZEF A;  1GTK A;  4GF8 A;  2FNC A;  4F3B A;  1A55 A;  3DP6 A;  1NH8 A;  4R9G A;  1FPD A;  3RGY A;  1IMF A;  2Y7K A;  5I57 A;  1JP4 A;  3UIF A;  3TTN A;  1B7Z A;  2F5X A;  2NXO A;  4IGR A;  4YMB A;  4XKN A;  5DEX A;  1BKA A;  4L17 A;  1GGG A;  1FJ6 A;  3QYT A;  3C33 A;  4WXJ A;  4RPO A;  4GOT A;  4F19 A;  1NV5 A;  4AB5 A;  5I56 A;  1FRP A;  4G68 B;  4KXP A;  3DP8 A;  4RYA A;  1DPE A;  3LBS A;  1B51 A;  3FXQ A;  3CI8 A;  2F3D A;  1NUY A;  4DDD A;  4KCD A;  4XXU A;  4BDR A;  1OQG A;  3N6U A;  4R9F A;  1NL5 A;  4QF9 A;  4MIJ A;  4OWD A;  5TPA B;  4M1V A;  1FTJ A;  4KYE A;  4NF6 B;  1FQE A;  1USY E;  3L6G A;  1FPL A;  3JV9 A;  3NOH A;  2WBD A;  2NWJ A;  3PU5 A;  2IEE A;  1MH3 A;  1NUW A;  3IO4 A;  5FTH A;  1FQA A;  3TCF A;  1MH4 A;  4PET A;  3TUS A;  5ET7 A;  2JJK A;  1YPN A;  3PMV A;  1PBQ A;  4EQB A;  1NV3 A;  4KCC A;  4DXU A;  1LBX A;  3QXM A;  3PD8 A;  4U21 A;  5DVI A;  4BDM A;  1N84 A;  4N4U A;  4YMA A;  3B6T A;  2XXI A;  1FQD A;  3KOT A;  3E78 A;  4U4X A;  5H8S A;  2G93 A;  4FAT A;  1Y1M A;  4DI4 B;  3PGF A;  1LGB C;  2HCA A;  3ILT B;  3CIJ A;  4GIZ A;  3B6W A;  3ECR A;  3KC1 A;  4GQO A;  4KFQ A;  4YKJ A;  4TLM B;  3B50 A;  3EHU A;  3T9V A;  1P1O A; 
#chains in the Genus database with same CATH homology
 4F29 A;  1B7H A;  2XHD A;  3CVG A;  3M3F A;  4LP2 B;  3KSX A;  1OQH A;  1URG A;  2I58 A;  4F18 A;  3WAE A;  3VLV A;  2GFE A;  4PFT A;  5H8Q A;  3O9P A;  1N3X A;  1POY 1;  3ZSF A;  1NH7 A;  4ISU A;  4ONY A;  1R6Z A;  3DEL B;  3OO6 A;  1EH3 A;  3MC2 A;  3FV2 A;  2OCU A;  1I6Q A;  3V89 B;  1B1X A;  5CBS A;  5KCJ B;  4R6H A;  3EF7 A;  3PPR A;  5H8N A;  3VVD A;  5CMC A;  4C1T A;  4PP0 A;  3QAX A;  1MY3 A;  4XKR A;  1Y3N A;  2F7C A;  5TU0 A;  2H4I A;  2A5T B;  3CRB A;  3FVG A;  1JVX A;  3V83 A;  3KJT A;  2XXY A;  3M8U A;  2ESN A;  1BLF A;  3WAF A;  3OO9 A;  4H8I A;  5M2V A;  1MXV A;  3IO6 A;  5ICT A;  1P1W A;  2GHB A;  4NED A;  4OYV A;  3MVW A;  1N3W A;  3LUY A;  2V25 A;  4F2O A;  4KD5 A;  5JK4 A;  2NUV A;  3PD9 A;  1N7X A;  3KEI A;  3T93 B;  4GD5 A;  4IB2 A;  5KZT A;  4P0I A;  1AH5 A;  3PUZ E;  1M5E A;  2ZNT A;  1JW1 A;  3UA8 A;  2OK2 A;  4C1U A;  3R6U A;  3AXF A;  2V3U A;  5DVF A;  1PB8 A;  2XXP A;  3THI A;  1EZP A;  1DOT A;  5I57 B;  1S7Y A;  4F3P A;  2P2A A;  1MY1 A;  1IQ7 A;  3EHT A;  3IB0 A;  4IO6 A;  4GWO A;  2AL5 A;  4NF8 B;  1LFG A;  5DEX B;  3OEM A;  3Q29 A;  3S9L C;  4DIG A;  4LA9 A;  2KLF A;  2Y7R A;  5I56 B;  3CSG A;  4YKP A;  1NNT A;  1RYO A;  2ZXT A;  3EHS A;  2BJJ X;  4YAH X;  3GBB A;  3VVE A;  2DWH A;  5K2Y A;  1XHY A;  3IOU A;  4MFI A;  5FTI A;  4U4S A;  1MQI A;  1BTJ A;  4F3S A;  3T22 A;  3HST A;  1LBB A;  3A09 A;  5KDT A;  4G68 A;  2REJ A;  4RY1 A;  4QSD A;  1HSL A;  1MY2 A;  2Q2A A;  2O1L A;  2O68 A;  4NMY A;  5TPA A;  4LVQ A;  1SW4 A;  5K2X A;  4Q0C A;  4NF6 A;  3H6V A;  4YB5 A;  3E13 X;  2YLN A;  1NKX A;  1JVY A;  5B7D A;  3MP8 A;  5L9O A;  1B4H A;  4R2F A;  3Q26 A;  3E3K A;  1XS5 A;  4HTG A;  1I69 A;  3I6V A;  3S4U A;  4H0W A;  3U8Q A;  3TMG A;  3LC8 A;  1LFH A;  1Y9U A;  4N13 A;  1B0H A;  3LSW A;  4N07 A;  3K2D A;  1LAH E;  1ZJL A;  2O7U A;  2DOJ A;  2I3W A;  3IK6 B;  3TEL A;  1OLC A;  2VP1 A;  4NF4 A;  1YAE A;  1DSN A;  4IY5 A;  3K01 A;  1SW5 A;  4UAC A;  3OEN A;  3H03 A;  2H25 A;  3HHF A;  1PB7 A;  3HCQ A;  3MPK A;  4RA1 A;  5H8N B;  1AOV A;  4KYD A;  3C36 A;  4LQ2 A;  3FXU A;  4FJP A;  2DXY A;  3OEL A;  4ZED A;  2XD2 A;  3RLF E;  4KYS A;  4ELR A;  3L6H A;  5KCJ A;  4I62 A;  3VXC A;  2HAU A;  4GXA A;  2O84 X;  4EF1 A;  2ONR A;  4IO5 A;  3C32 A;  1Z7N E;  5I59 A;  1SW2 A;  1FCK A;  1IXH A;  4F1V A;  3PV0 E;  1SBP A;  3OXN A;  2DWJ A;  1HSE A;  3D4G A;  3H6T A;  4X1B A;  1B6H A;  1B3G A;  3ILU B;  2R9J A;  4ZS9 A;  3IX1 A;  4KQP A;  3C34 A;  2THI A;  5I84 A;  1A8E A;  4LON B;  1MXZ A;  3ODB A;  1URS A;  1M5B A;  1IEJ A;  4X48 A;  1MXU A;  2XXT A;  3T66 A;  4EXL A;  1M5D A;  1JEU A;  4H1X A;  4R75 A;  2AIX A;  2XXU A;  4P0G A;  3ONM A;  2F6G A;  1VE4 A;  4BDL A;  1TFD A;  3HN0 A;  3EQ1 A;  5EHM A;  2R6G E;  2DVC A;  2Y7I A;  3T9X B;  2AYS A;  2I6E A;  3G3G A;  3FJG A;  4G2Z A;  1IZ1 A;  2OWS A;  4DCY A;  3SEW A;  4U1Z A;  1PC3 A;  4IO3 A;  4NF8 A;  2QS1 A;  2O1M A;  5FHN A;  1SYH A;  1B40 A;  1R9Q A;  1IIW A;  1IXI A;  3IOR A;  3FVK A;  1S9T A;  5FHM A;  4Q30 B;  5KDT B;  3SER A;  1IXC A;  1Y4T A;  4JWO A;  1N76 A;  3MVZ A;  1UTH B;  5AA1 A;  5ISU A;  1UTB A;  4NF5 A;  2ALU A;  3G3K A;  2UXA A;  5ELV A;  2B3B A;  5ITO A;  2V93 A;  1SI0 A;  4I9D A;  1B05 A;  3KN3 A;  3EN3 A;  3E9X A;  5L8D A;  1ZMG A;  1VSO A;  2I3V A;  3KJ7 A;  1D3K A;  2XX7 A;  2F78 A;  4NE4 A;  3OO7 A;  1ZTY A;  4XIG Q;  2Q8J A;  4F2Q A;  2D3I A;  3FUZ A;  4JB7 A;  1B52 A;  1ZLQ A;  4X9T A;  3G3H A;  2DQV A;  2E0S A;  1CB6 A;  2XXX A;  4OQO A;  4DCX A;  1IUD A;  2VOZ A;  2D5W A;  2F6P A;  4PFW A;  4PQJ A;  4EXK A;  4NF4 B;  4LAT A;  4M4G A;  3V8X B;  3RN8 A;  3RY3 A;  4R2B A;  3IOW A;  1QUK A;  3FZV A;  3O6H A;  2O51 A;  2PT1 A;  3Q25 A;  4QFO A;  3B7D A;  3W9W A;  3PPN A;  3K1N A;  3T9H B;  1KWH A;  4UA8 A;  2GHA A;  2ZNU A;  2DYX A;  2Q88 A;  3QSL A;  5HPQ A;  1LB9 A;  1PB9 A;  1SQY A;  3N94 A;  4QSC A;  5HM4 B;  4K3F A;  1OLA A;  1MY4 A;  1MDQ A;  2XX8 A;  3DP4 A;  2Q89 A;  2RKM A;  1A54 A;  2O7I A;  3MPL A;  2V84 A;  4E0W A;  3CSB A;  4OFO A;  2DE2 A;  3TZA A;  4X1D A;  1B32 A;  3HHG A;  3FVO A;  1O63 A;  2FYI A;  3H4Z A;  1UIV A;  1D4N A;  4YKI A;  3SES A;  2V3T A;  2I4C A;  3U93 A;  4R72 A;  1M5F A;  4N6P A;  2ZYN A;  4AQ4 A;  5I59 B;  3U94 A;  1JNF A;  5F1Q A;  3VFJ A;  1D9V A;  3IJO B;  4ZZE A;  4QHQ A;  3UOR A;  3CR9 A;  2F8D A;  2I4B A;  4F1U A;  1Y3P A;  2F97 A;  2Z23 A;  3VVF A;  3PUW E;  2OLB A;  4ZEK A;  3TPA A;  3V5A A;  4I8C A;  4RK2 A;  4THI A;  3KG2 A;  3B6Q A;  4JSO A;  1USY H;  3O29 A;  3K6X A;  3UGW A;  2UYF A;  2QL3 A;  3H7M A;  1GVC A;  1YCJ A;  1US5 A;  1VFD A;  5I2N B;  2XXR A;  1POT A;  2VD3 A;  4U23 A;  1QJM A;  3O6I A;  2CMO A;  2Y7W A;  3G3I A;  2DWA A;  4PFY A;  1H45 A;  3LR1 A;  1PEB A;  3KFM A;  5CRY A;  1GR2 A;  3M3L A;  1B3L A;  3Q27 A;  3E4R A;  1MXX A;  4G4P A;  3BFU A;  4AB6 A;  2OWT A;  2OJT A;  1FQB A;  4OXV A;  5CM6 A;  2GRV A;  4OES A;  3O2A A;  2I0B A;  3W15 C;  4DE8 A;  3PUX E;  3QIM A;  3IOT A;  3FVN A;  1Y4C A;  1B9J A;  5L9M A;  3OOA A;  4E0X A;  3CG1 A;  1JET A;  1UIU A;  4GFR A;  4YB7 A;  1ATG A;  1P1Q A;  3N26 A;  4MBP A;  4O3C A;  4NTL A;  2O69 A;  3U1O A;  3UP9 A;  4Q5T A;  1A40 A;  4XTC Q;  3KN8 A;  3FXR A;  1LCF A;  1UTB B;  4NF5 B;  3HO7 A;  4YKK A;  4POW A;  4HCY A;  1AMF A;  5I58 A;  2ANJ A;  3R7X A;  3SET A;  3VV5 A;  3MP6 A;  5DVJ A;  1FQC A;  2GH9 A;  1MXW A;  4JSD A;  4GVO A;  4H65 A;  3H06 B;  4ECF A;  5AA4 A;  1UTH A;  3UK4 A;  2W7Y A;  4KPT A;  3SKP A;  3S9N C;  5DTB A;  4OZ9 A;  1B1H A;  3TTR A;  3RT6 B;  1TFA A;  1B3H A;  1SW1 A;  4ND9 A;  3HV1 A;  5JEI A;  4OTE A;  3S9E A;  2PBW A;  4OHN A;  3FAT A;  3QUJ A;  4OMB A;  4EDP A;  1QKA A;  4IY6 A;  1WDN A;  3USD A;  5H8H A;  1OIB A;  2PYY A;  3MZB A;  3MVY A;  1UQW A;  2LAO A;  1B3E A;  2HZK A;  4F39 A;  3MZ1 A;  1Y3Q A;  1RKM A;  1IIT A;  3ZKL A;  1ELJ A;  3TTK A;  4OEV A;  2PVU A;  1FW0 A;  3OEK A;  2QS3 A;  4ESX A;  2H98 A;  4TLL B;  3EPE A;  2I0C A;  1B7U A;  3RTF B;  2QPQ A;  5EYF A;  1M5C A;  1ZBM A;  4R73 A;  3BBR A;  5AA2 A;  2I48 A;  3S9M C;  1MDP 1;  2RCA A;  5EHS A;  1OMP A;  3OD7 A;  2VHA A;  1CE2 A;  3S2V A;  1DMB A;  3TDJ A;  3TOD A;  4KHZ E;  2UYE A;  2X7P A;  3TYH A;  1B4Z A;  3BKI B;  3N6T A;  1N7W A;  2V3Q A;  2QS4 A;  4F3G A;  3PPP A;  4ZZA A;  2QSX A;  3H6W A;  4FED A;  2XX9 A;  4QFK A;  4G68 C;  5DT6 A;  3A3U A;  2O6A A;  1RYX A;  3VLU A;  4U1O A;  1MXY A;  4IGT A;  2D21 A;  5ITP A;  3KGC A;  4OEN A;  3G3J A;  1XOC A;  1US4 A;  1XC1 A;  3FGS A;  3KOS A;  5DYH A;  3N5L A;  3IOV A;  2XXV A;  3IR1 A;  4GL0 A;  1XVX A;  3C4M A;  3TAJ A;  3TFL A;  1FTO A;  4R74 A;  3SEU A;  2G29 A;  2H99 A;  5I2K A;  4H5G A;  1O64 A;  4FE8 A;  4U2R A;  1MRP A;  2XXQ A;  4XKQ A;  3F11 A;  5AA3 A;  1QKB A;  5I2N A;  1MPB A;  3BFT A;  4RPN A;  1OVB A;  1VR5 A;  2F35 A;  3IJX B;  4RJZ A;  3KZG A;  1DTZ A;  2PT2 A;  2HQ0 A;  2Y84 A;  1SD3 A;  1PDA A;  2QS2 A;  2ZYO A;  4F22 A;  4XKP A;  3MWB A;  2ZNS A;  2X26 A;  1Y20 A;  4G8N A;  4YZZ A;  4JXI A;  4OET A;  4U22 A;  5I58 B;  2CZL A;  1IXG A;  3FJ7 A;  2Y7P A;  1XT8 A;  1LLS A;  4BDO A;  3G3F A;  2F36 A;  3GZG A;  5BWJ A;  3FV1 A;  2XD3 A;  4ZEB A;  1A8F A;  1ZKB A;  3FAS A;  1LFI A;  2RC8 A;  1WOD A;  5AA4 B;  5AE4 A;  1JEV A;  1D9Y A;  3IL1 B;  2WKY A;  1DTG A;  2RC7 A;  1II5 A;  1YTV A;  2OBG A;  1B3F A;  5IKB A;  3GBA A;  4G8H A;  5FHO A;  3PUV E;  4FIM A;  1NFT A;  1JQF A;  5A5X B;  3VLW A;  2NOO A;  2RIN A;  5CMK A;  3T96 B;  4ZEC A;  1T0K A;  3FD3 A;  4ZEI A;  1URD A;  3KSJ A;  2DWI A;  3IB1 A;  4OVJ A;  1LAX A;  4C0R A;  5H8F B;  4BDN A;  3CFL A;  3TTL A;  3LSF B;  4IO2 A;  4F1Y A;  5H8H B;  1ANF A;  1MQH A;  1SVX B;  2YJP A;  1BIY A;  1P99 A;  2OZZ A;  3U72 A;  4GLI A;  4JWY A;  4ZDM A;  1N0T A;  1BP5 A;  2F7B A;  2A5S A;  2VD2 A;  3OSR A;  2DS9 A;  5ICQ A;  2FA7 A;  2QJE A;  1QUI A;  4OEU A;  1MY0 A;  1ZU0 A;  2I49 A;  4LQ5 A;  1JW5 A;  5JTY A;  4TOZ A;  4ZE8 A;  4Z7E A;  1H44 A;  1ZIU A;  3MUQ A;  2DXR A;  2RCB A;  1VFE A;  1B5J A;  4RXL A;  5AA2 B;  4H5F A;  2R71 A;  3HPI A;  2ABH A;  2HEU A;  3MW0 A;  1MPD A;  3PMX A;  2QMW A;  1B0L A;  1JW4 A;  1N04 A;  3PUY E;  1NNK A;  1LAG E;  4MLQ A;  2IA4 A;  3QK6 A;  1OVT A;  5B70 A;  2F7A A;  4RK9 A;  4I1D A;  3K4U A;  3ZS6 A;  2XXW A;  3TCG A;  1NNP A;  3CG3 A;  3RUM A;  2ONS A;  3MBP A;  3RTW B;  3C35 A;  1B2H A;  1I6B A;  2DVZ A;  4YB6 A;  4ZE9 A;  3GLB A;  3JZJ A;  2DP8 A;  2PMS A;  3MVX A;  1MS7 A;  1MM7 A;  3MQ9 A;  2AL4 A;  4YIC A;  2RF1 A;  2UVH A;  1Y1Z A;  5CMB A;  4RNS A;  2HZL A;  3SEV A;  4F31 B;  3TQW A;  1MQD A;  1LBC A;  3M3K A;  3TEP A;  4R6Y A;  2UVG A;  1MM6 A;  4MH5 A;  4PFU A;  3ZKK A;  5I2K B;  5HBC A;  1P1U A;  1TXF A;  1R1N A;  1MPC A;  3OSQ A;  3K02 A;  1LST A;  4FEB A;  1MG1 A;  3KN7 A;  4LZ5 A;  4OFJ A;  3VE1 B;  1EZO A;  3K6V A;  1Z7M E;  3DLN A;  4WEP A;  1A7L A;  2ZMB A;  4HCW A;  2UVI A;  3MJN A;  2VGQ A;  1B46 A;  4YU0 A;  3C31 A;  1QW0 A;  3JYR A;  1QUJ A;  4DZ1 A;  2Q9T A;  4QFN A;  1SYI A;  4IO7 A;  4H6D A;  4LZ8 A;  3A3C A;  5TP9 A;  1AIV A;  4GXS B;  4GRK A;  4FAJ A;  3PMW A;  1MQG A;  1DPP A;  2B3F A;  3O97 A;  1SI1 A;  4JBZ A;  3PPO A;  3I3V A;  4ESW A;  1GV8 A;  3UN6 A;  2ZYK A;  1FQF A;  5CC2 A;  4PE5 B;  2P1S A;  5CBR A;  3TKD A;  2Q2C A;  3KBR A;  4OFL A;  2PX1 A;  1B5I A;  4ELQ A;  2HAV A;  3H3G A;  4JWX A;  1J1N A;  1O7T A;  4Q8R A;  3H6U A;  2DSF A;  2NVU B;  1F9B A;  3RT8 A;  1R9L A;  4G77 A;  3O6G A;  2RC9 A;  5A5X A;  3I5O A;  5CMM A;  3QUF A;  4FEC A;  1TWY A;  3SDF A;  4EQ9 A;  3GXA A;  4DXC A;  1FTK A;  2DE3 A;  3LSX A;  3MZ9 A;  1PBP A;  5H8F A;  3TTM A;  3G7W A;  3OMB A;  4KR5 A;  3K1M A;  5JTY B;  2HXW A;  4JDF A;  3IB2 A;  1EU8 A;  4O3A A;  2H9B A;  2QRY A;  3K0V A;  2UVJ A;  2Z8F A;  3DM0 A;  3O28 A;  3FIR A;  4NWD A;  5AA2 D;  1H43 A;  2H5Y A;  5F7V A;  4QFP A;  4POX A;  2P0S A;  3C9H A;  3RQT A;  2HFB A;  3K00 A;  2B65 A;  3LSL A;  1S50 A;  3PPQ A;  5L9S A;  3W9V A;  4ELO A;  3K6U A;  4QFL A;  1L5T A;  5J1D A;  3Q28 A;  4WED A;  5H8Q B;  2M8C A;  3K6W A;  4HS7 A;  1I6A A;  3P7I A;  3CFZ A;  3OO8 A;  2Z8E A;  1H3D A;  4QRZ A;  1B58 A;  4P11 A;  3MAM A;  5IAI A;  3VDF A;  4MLV A;  4HW8 A;  2XXH A;  4BDQ A;  4H67 A;  4OER A;  1TT1 A;  2Z22 A;  2ZYM A;  1AL3 A;  2F34 A;  1MQJ A;  3O66 A;  1LCT A;  1HSJ A;  1Q35 A;  4ELP A;  1NNF A;  3RNN A;  1Q1K A;  4EUO A;  4BLA A;  2QMX A;  3K1P A;  1NMU A;  1LB8 A;  1QVS A;  4Z0I A;  2YPN A;  1QUL A;  4LUB A;  1P1N A;  4DLD A;  3R26 A;  4NWC A;  1WVJ A;  3RPW A;  4KI0 E;  4DXB A;  3TQL A;  3U92 A;  3FJM A;  3SEX A;  2X7Q A;  1B5H A;  1A99 A;  4EF2 A;  4R6K A;  4TQU Q;  3CFX A;  1H76 A;  2A5T A;  3IAZ A;  2Z8D A;  4FOR A;  4WKM A;  4QSE A;  5CI5 A;  4O3B A;  3SEY A;  3TCH A;  4H8J A;  2E1S A;  1FTM A;  1EZ9 A;  4MF3 A;  5LOM A;  4G8M A;  2DE4 A;  4GL8 A;  4EQ7 A;  5BUU A;  5TP9 B;  3VXB A;  1XVY A;  4IO4 A;  1FTL A;  2REG A;  3D4C A;  3T9U A;  1SDX A;  1LAF E;  2ONK E;  3MP1 A;  4LZ7 A;  4ZEF A;  1GTK A;  4GF8 A;  2FNC A;  4F3B A;  1A55 A;  3DP6 A;  1NH8 A;  4R9G A;  3RGY A;  2Y7K A;  5I57 A;  3UIF A;  3TTN A;  1B7Z A;  2F5X A;  2NXO A;  4IGR A;  4YMB A;  4XKN A;  5DEX A;  1BKA A;  4L17 A;  1GGG A;  3QYT A;  3C33 A;  4WXJ A;  4RPO A;  4GOT A;  4F19 A;  4AB5 A;  5I56 A;  4G68 B;  3DP8 A;  4RYA A;  1DPE A;  3LBS A;  1B51 A;  3FXQ A;  3CI8 A;  4DDD A;  4KCD A;  4XXU A;  4BDR A;  1OQG A;  3N6U A;  4R9F A;  1NL5 A;  4QF9 A;  4OWD A;  5TPA B;  4M1V A;  1FTJ A;  4KYE A;  4NF6 B;  1FQE A;  1USY E;  3L6G A;  3JV9 A;  2NWJ A;  3PU5 A;  2IEE A;  1MH3 A;  3IO4 A;  5FTH A;  1FQA A;  3TCF A;  1MH4 A;  4PET A;  3TUS A;  1YPN A;  3PMV A;  1PBQ A;  4EQB A;  4KCC A;  4DXU A;  3QXM A;  3PD8 A;  4U21 A;  5DVI A;  4BDM A;  1N84 A;  4YMA A;  3B6T A;  2XXI A;  1FQD A;  3KOT A;  4U4X A;  5H8S A;  2G93 A;  4FAT A;  1Y1M A;  3PGF A;  1LGB C;  2HCA A;  3ILT B;  3CIJ A;  4GIZ A;  3B6W A;  3ECR A;  4GQO A;  4KFQ A;  4YKJ A;  4TLM B;  3EHU A;  3T9V A;  1P1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...