4XXUA

Moda - chromate bound
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
231
structure length
231
Chain Sequence
GKITVFAAASLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTLLGNSLVVVAPKASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPVAVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of chromate bound ModA from E.coli at 1.43 Angstroms resolution.
rcsb
source organism Escherichia coli (strain k12)
molecule tags Metal binding protein
molecule keywords Molybdate-binding periplasmic protein
total genus 78
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4xxuA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4xxuA02
1FTLA 1CB6A 1ATGA 3TQLA 3VVFA 4HCYA 1B7UA 3KJTA 4OYVA 3MP6A 3FD3A 4WEDA 2Y7KA 3PV0E 3SEYA 1MDP1 4E0WA 3IB2A 3G7WA 2O84X 2ONRA 4AQ4A 4F19A 4Q8RA 4M1VA 2ZYOA 5FHMA 3WAFA 2REGA 3ZSFA 3CIJA 1N84A 2D3IA 1B6HA 1QKAA 1SW5A 3EHUA 1FQAA 3MVXA 4EQ7A 2THIA 3PMVA 4C1TA 1OMPA 3H3GA 1CE2A 1Y1MA 4GIZA 4ND9A 4X1DA 1N0TA 3TMGA 4GFRA 2I3VA 1MXUA 1GGGA 3R26A 3PU5A 4UA8A 1B0HA 3TTMA 2O51A 3O6GA 3TYHA 4GXAA 4LA9A 4EXLA 1O7TA 4ESWA 4ZECA 5I57B 3RUMA 3R7XA 5ITPA 3QUFA 1TWYA 4ZEKA 3LC8A 4N6PA 1LB9A 4KQPA 4OENA 1A99A 3TUSA 4PETA 3TEPA 2NVUB 2UVHA 2P2AA 2ZNUA 3FXRA 3K2DA 3N94A 5I84A 4HCWA 3KJ7A 4F2OA 4F18A 3VE1B 4BDNA 1FQCA 1FQEA 3IOTA 4JXIA 2XXUA 4F3BA 3UK4A 1P1UA 5I58A 1ZBMA 3MJNA 5DEXA 1BP5A 3FVOA 3UP9A 2DS9A 1R1NA 3ECRA 4O3AA 4NWDA 3RTFB 3DP4A 2QSXA 3KN8A 2R9JA 1A55A 1MY0A 2OBGA 3M3FA 4IGTA 2NWJA 2DSFA 3B6QA 2F6PA 5DEXB 1IUDA 1B46A 4OQOA 5DVIA 2QS2A 3C34A 3EPEA 3H06B 5H8HB 5KDTB 2YJPA 1IXHA 1N04A 2O1MA 2Z22A 1AL3A 5K2XA 1LAHE 2YLNA 1URGA 3MQ9A 4GLIA 3TPAA 3BKIB 1SYHA 3CR9A 3BBRA 1T0KA 3Q29A 4LVQA 1DTZA 1EZ9A 2A5TA 1JEVA 1LAXA 1B4HA 4H67A 4IB2A 3R6UA 4QFKA 4FECA 3USDA 2KLFA 3C31A 4OESA 4G8MA 5FTHA 2I0CA 4YKKA 4H1XA 5AA4B 5L9MA 1AOVA 3H4ZA 1B5JA 3T9VA 1NFTA 4KR5A 2XXHA 2V3TA 4H8JA 2Y7WA 3IOUA 1Y3PA 4ZEFA 3K02A 4KHZE 2XX8A 1II5A 2HXWA 3V89B 1A8EA 2UYEA 4YMAA 2DP8A 2PT2A 5I56B 3MC2A 3C36A 2Z23A 2PVUA 4JWOA 5ICQA 5HBCA 4C1UA 4DXUA 4RY1A 4ZE9A 4X48A 4EF1A 3IJXB 2HFBA 4IGRA 1B3GA 2ANJA 3TODA 4ELOA 3KEIA 3RTWB 1WDNA 3SETA 4U4SA 5F7VA 1B1XA 3G3KA 1B52A 4NE4A 2I49A 1B3HA 2M8CA 2V25A 4KPTA 1Y4TA 1WVJA 3OEKA 2DXRA 2ZYMA 2I6EA 1LB8A 1LCTA 4BDMA 4DCYA 3OSRA 2H99A 1MXXA 1MQGA 4I1DA 3ZKKA 4GL8A 3CFXA 4ISUA 4NF4B 3OO8A 2QRYA 3SEVA 4F3GA 4ONYA 5I2KA 1A8FA 2CZLA 3MVZA 2F78A 4JSDA 3SKPA 3U92A 1EH3A 3U72A 2DE3A 4YKJA 4DXCA 1MH4A 4IY6A 1NL5A 2BJJX 3M3KA 2GFEA 1P99A 1QJMA 2QPQA 5ITOA 4YMBA 5TPAA 1S7YA 3UN6A 2B65A 2DVCA 2FNCA 2OLBA 1Z7NE 3RY3A 2O68A 1Q35A 3K1NA 1QUIA 3OD7A 3DM0A 3LSLA 3KOTA 1R6ZA 4KD5A 5TU0A 4ZZAA 1MQHA 3MUQA 2XXQA 2RKMA 4R72A 4U2RA 5H8QA 3D4CA 1B9JA 4PE5B 4F1UA 1OQHA 1Q1KA 2B3BA 2XD3A 4H0WA 4Q30B 4MBPA 1ZTYA 4JB7A 3T22A 3V83A 1OLAA 4EDPA 1MRPA 3RT6B 2H9BA 2UYFA 3GXAA 2VD3A 1Y20A 1RKMA 4TLMB 2VOZA 1DPPA 2Y7IA 4NF6A 3TZAA 1DMBA 1FQBA 1P1QA 3Q26A 4OEUA 4ZDMA 2PX1A 3S4UA 2ZYNA 4PFUA 4QSEA 3OMBA 4RK9A 3FV1A 4G77A 4ELPA 4RPOA 1B1HA 1NH7A 1MQJA 3HHGA 3MP8A 3O28A 3U1OA 4Q0CA 5I58B 2A5SA 3W15C 3DP8A 4WXJA 3KN3A 3IR1A 3KBRA 3RPWA 1AIVA 2QS4A 3FVNA 1MG1A 4KCCA 3OOAA 1SI0A 2Q8JA 3ZKLA 3TFLA 2DOJA 3PMWA 2I3WA 1MS7A 3QAXA 1YCJA 4KCDA 1EZPA 4OERA 5CRYA 4EUOA 3MVWA 4QHQA 3CSBA 5DVFA 3QUJA 3LSWA 1YTVA 4R75A 1XVXA 2LAOA 1FQFA 3K6UA 2F5XA 2P0SA 1SW2A 1NKXA 1IEJA 1DOTA 4YB6A 3S9NC 1MY3A 2W7YA 2QL3A 2A5TB 4R2FA 1LFGA 4H6DA 2V84A 2XD2A 1SBPA 4GL0A 4JSOA 1TXFA 3K6XA 1GVCA 3RT8A 1SW4A 1B0LA 2O7UA 4MLQA 4NF8A 3I6VA 1Y9UA 1ZJLA 2ABHA 3Q27A 2R71A 1A7LA 2X7PA 1VFDA 1J1NA 5TP9B 3N26A 4PFYA 3HCQA 3MZBA 4U22A 3O9PA 3TTKA 4MF3A 1ELJA 4QSCA 3EHSA 1HSEA 3H6VA 3PD8A 4R2BA 1DSNA 5H8NB 2RF1A 5ICTA 1QW0A 4G68C 4YICA 3TKDA 2PT1A 4AB6A 2REJA 5KZTA 2DXYA 4NTLA 4QFNA 4MH5A 4ELQA 4C0RA 4OETA 1FTKA 2UVGA 1ZIUA 2UVIA 3JV9A 3N6UA 1UTBA 1PDAA 4F3PA 2HZLA 3RGYA 4E0XA 5AE4A 1Y3NA 1GR2A 3S9EA 2RC9A 3FUZA 4GVOA 1IXIA 3EF7A 1M5FA 2ALUA 1B3LA 3H6TA 3LSXA 1OVBA 4QFOA 1YPNA 4U4XA 2PMSA 1MXZA 3H6UA 3IO6A 1JETA 1B3EA 1UTBB 1N76A 1MPBA 1NNPA 3ILTB 1FW0A 4YKPA 4R73A 5FTIA 3FXQA 3G3IA 4GD5A 4YKIA 2AL4A 1D3KA 1N7WA 3O6HA 3PPPA 1I6BA 5H8SA 2HAVA 2HAUA 4JWYA 2ZYKA 4M4GA 3QK6A 2ZNTA 3FXUA 1ZU0A 2PYYA 2OWTA 4FAJA 4NF4A 5ISUA 1IITA 1B7ZA 4DZ1A 1QKBA 3CRBA 4JBZA 4DIGA 4IO2A 4G2ZA 3N5LA 5F1QA 4G8HA 3S9LC 3OSQA 4U21A 4OTEA 2RCBA 3ILUB 3FZVA 3RLFE 4F31B 5I2NA 3PPQA 5CMBA 3CSGA 4TLLB 4FATA 5I56A 1QUKA 3HSTA 5DTBA 4OFOA 2H98A 1MY1A 2ESNA 1VSOA 1QULA 3AXFA 3U93A 2Y7PA 3G3FA 1FCKA 1UIVA 2UVJA 3SESA 5H8QB 5BUUA 4K3FA 3HO7A 2E0SA 4R9GA 5CC2A 2FA7A 4YB7A 1H3DA 1PBPA 5IKBA 3MW0A 4LZ8A 1UQWA 3HN0A 1BLFA 2DE4A 3LSFB 3VLVA 5L9SA 4BLAA 2XX9A 3Q25A 5JTYA 4FORA 1L5TA 1LCFA 5JK4A 1EU8A 3P7IA 3DP6A 4YAHX 1XVYA 1MPCA 1DPEA 4DE8A 1IXGA 1M5DA 3CFLA 4JWXA 3E3KA 1O63A 4RA1A 4ZEIA 5AA1A 5I2KB 1LGBC 4OFLA 4WKMA 2G29A 1Y3QA 3MZ9A 3ZS6A 1MH3A 1VFEA 3VXCA 2I48A 3SEXA 3IB0A 3MPLA 4I9DA 3T96B 1O64A 2DVZA 1N7XA 2HCAA 3OO6A 3PUVE 1BTJA 3PPRA 1MXYA 4HS7A 1FTMA 3V8XB 5L8DA 1PC3A 3TAJA 5BWJA 5I57A 1R9QA 3VLUA 2Z8EA 5L9OA 4QF9A 3PD9A 4RK2A 3VLWA 2D5WA 1RYXA 4ECFA 4LATA 4LZ7A 3PPNA 4ZEDA 2Q89A 4R6KA 3V5AA 5LOMA 4ZEBA 2ZNSA 4U1OA 2DQVA 5JEIA 1H43A 1US4A 4RNSA 3Q28A 1TFAA 4F29A 2XX7A 1B32A 1B7HA 1URSA 2NXOA 3B7DA 3BFTA 4PP0A 1B3FA 3EHTA 3OELA 4R6HA 3TCHA 3UGWA 4DLDA 3S2VA 4G68B 2I0BA 3K6WA 1NNKA 1ZLQA 4DXBA 3E9XA 2H4IA 3GBBA 4BDOA 1OLCA 2YPNA 4ZS9A 5EYFA 3DLNA 3CG1A 4THIA 1US5A 3PUWE 3TCFA 3FJGA 5FHOA 1DTGA 2O1LA 5HPQA 2F8DA 1A54A 4L17A 2NUVA 4R6YA 4OMBA 4G4PA 3G3JA 3W9VA 1QUJA 3TCGA 3K01A 1MXVA 1MPDA 2F7CA 2P1SA 5CBRA 5I59B 2IA4A 3HV1A 1EZOA 4RYAA 5KCJB 4F2QA 1B58A 3CVGA 3T9HB 3PMXA 5KDTA 5AA4A 2QJEA 1SW1A 3IAZA 3T9XB 2HZKA 1SQYA 1KWHA 2AYSA 2B3FA 2XXYA 1MQIA 1OVTA 2RCAA 4NF5A 4PFTA 3IOVA 4MFIA 3UORA 4NF8B 5KCJA 1XT8A 2FYIA 1UIUA 3FVKA 4O3BA 4FE8A 4H8IA 4KYEA 4X1BA 4I8CA 2G93A 4NF5B 2XXIA 4QSDA 4BDQA 2F7BA 3K1MA 3U8QA 2V3UA 2H25A 3G3GA 4F22A 3A09A 1LAGE 2RC8A 2VGQA 1P1WA 3S9MC 1JVXA 2Q2AA 2QS1A 1USYE 3B6TA 2HEUA 3B6WA 2GH9A 3MZ1A 4GWOA 2XHDA 3IORA 1XC1A 2RINA 2Y84A 4FEDA 2Q2CA 1QVSA 1Y1ZA 3IJOB 2GRVA 3MVYA 4LP2B 4XIGQ 3VDFA 4TQUQ 5CMCA 4BDLA 1PBQA 2IEEA 2OCUA 3ODBA 5B7DA 1LLSA 2F34A 4EQ9A 4IO3A 3IB1A 4X9TA 5DYHA 3PGFA 3TTNA 2XXPA 1P1OA 1VR5A 1IIWA 1B2HA 1H76A 1B5HA 2DE2A 1SDXA 3H7MA 3OXNA 4N07A 3M3LA 4HTGA 3TTLA 4FIMA 2QMWA 4EF2A 3E13X 1FTJA 2WKYA 4MLVA 3C32A 3VVEA 3LR1A 5AA2A 3K00A 4H65A 4GOTA 4R9FA 4IO7A 3IL1B 1PEBA 2V93A 1IQ7A 1ZKBA 2H5YA 3UIFA 1SD3A 2Z8DA 4GF8A 1I69A 1D4NA 2OWSA 3F11A 3L6GA 5TPAB 3WAEA 1F9BA 2AIXA 3LBSA 2F6GA 4OWDA 2HQ0A 1JVYA 2ZMBA 4WEPA 1FTOA 3A3UA 4FEBA 3KGCA 5EHMA 1BKAA 3ONMA 4LONB 1IZ1A 2DWIA 1R9LA 2O7IA 2ZXTA 4XKQA 3T93B 1M5CA 1N3WA 2NOOA 5CM6A 2Y7RA 1POY1 3BFUA 3H6WA 3KZGA 3SEWA 4ELRA 1LFIA 1B4ZA 2XXTA 4POXA 4H5GA 1JQFA 4LQ2A 2GHAA 4OXVA 5M2VA 1NNFA 2V3QA 2Z8FA 3TQWA 1YAEA 1MQDA 2RC7A 3VXBA 3GZGA 3O29A 3CG3A 5CBSA 4P0IA 4LQ5A 4PFWA 1ZMGA 4OEVA 3FASA 3TDJA 5JTYB 1RYOA 3VVDA 1LAFE 4G68A 1LBBA 5I2NB 2O6AA 2PBWA 2QS3A 1LBCA 3FGSA 3M8UA 3L6HA 2XXWA 3O97A 4XKPA 3OO9A 3K4UA 4IY5A 4P0GA 1FQDA 2I58A 4QFLA 3T66A 1PB9A 3KN7A 2QMXA 4XKRA 4Z7EA 4I62A 3C4MA 1WODA 2OK2A 3KSJA 3SERA 3FATA 4AB5A 1LFHA 4XKNA 1AH5A 5DT6A 1P1NA 2DWHA 4NMYA 3VFJA 3O6IA 1PB7A 5CMMA 4G8NA 3VV5A 3OEMA 1URDA 3OO7A 4RJZA 5H8HA 4JDFA 1MM7A 5B70A 4OVJA 1S9TA 3GBAA 5FHNA 1GV8A 3E4RA 4U23A 5I59A 1M5EA 1B51A 2VP1A 4QFPA 3RNNA 3O66A 3C35A 3CI8A 1LSTA 2F35A 1D9YA 1S50A 2I4BA 3QYTA 2Q9TA 3KG2A 5DVJA 3A3CA 3IK6B 3C33A 1MDQA 3W9WA 2OZZA 4P11A 5CI5A 3TELA 4KYSA 5H8NA 1BIYA 4NEDA 4BDRA 2XXVA 2XXRA 3UA8A 3FV2A 4OFJA 1NNTA 2F97A 1XOCA 3MWBA 3N6TA 1NH8A 4IO4A 1POTA 3LUYA 4N13A 3D4GA 2GHBA 3OENA 3EN3A 4F39A 2ONKE 3FIRA 3H03A 4PQJA 4LZ5A 3IO4A 4FJPA 1I6AA 1PB8A 5TP9A 3DELB 3RN8A 5IAIA 2X7QA 4H5FA 1USYH 4QRZA 2O69A 2F7AA 2DWJA 2OJTA 3JYRA 4DDDA 5J1DA 1XS5A 1JNFA 1Z7ME 2AL5A 3K0VA 4YU0A 5H8FA 4OZ9A 2Q88A 1MY4A 3MP1A 4LUBA 5AA2D 4UACA 1MY2A 1H45A 4F1VA 3KOSA 4IO6A 3G3HA 4IO5A 4O3CA 4RXLA 5H8FB 1HSJA 4ZZEA 4ZE8A 1OQGA 1Y4CA 5AA2B 2I4CA 1UTHA 2ONSA 3KSXA 4KI0E 2UXAA 4KYDA 4XXUA 4YB5A 1TT1A 3KFMA 1JW4A 4POWA 3IX1A 2VHAA 1I6QA 4TOZA 3SDFA 2R6GE 1B40A 3C9HA 3QSLA 5K2YA 1VE4A 1SVXB 1GTKA 1UTHB 1SYIA 3K1PA 4Q5TA 3HPIA 3JZJA 3THIA 3SEUA 3TTRA 1ANFA 1JW1A 3I5OA 4DCXA 3QIMA 3K6VA 4EQBA 3MPKA 3RQTA 2E1SA 2DWAA 3T9UA 1OIBA 3O2AA 3QXMA 5CMKA 1NMUA 1XHYA 1A40A 3PUXE 2F36A 1HSLA 4GRKA 4RPNA 4U1ZA 5A5XA 4EXKA 3U94A 3PPOA 1MM6A 1D9VA 1M5BA 2XXXA 3PUYE 4NWCA 5HM4B 1H44A 3IOWA 4YZZA 2D21A 3PUZE 5ELVA 3CFZA 4ESXA 1SI1A 3I3VA 5A5XB 3MBPA 1B05A 3FJMA 1IXCA 1B5IA 1JW5A 5AA3A 1MXWA 3FVGA 3MAMA 4GXSB 4F3SA 4Z0IA 4F1YA 4OHNA 4NF6B 1TFDA 2VD2A 3HHFA 3FJ7A 5EHSA 3EQ1A 4HW8A 4XTCQ 1N3XA 1JEUA 2X26A 1AMFA 4GQOA 4KFQA 2CMOA 3GLBA 2DYXA 4R74A
chains in the Genus database with same CATH superfamily
2Y7KA 4E0WA 4AQ4A 4M1VA 1DK4A 3EHUA 3PMVA 4GBVA 4C1TA 4GIZA 5EQ8A 4X1DA 3PU5A 1B0HA 4EXLA 4LA9A 3ROJA 1FBFA 3R7XA 3QUFA 1LB9A 3KC1A 4PETA 3TEPA 1FQEA 3IOTA 5I58A 3MJNA 5IGAA 2DS9A 4GBWA 2KQZA 3B6QA 4OVQA 1AL3A 5EQ7A 1LAHE 2YLNA 1URGA 4MIJA 3R6UA 4G8MA 4YKKA 1AOVA 1RDXA 4KHZE 3V89B 4YMAA 2DP8A 5J16A 2Z23A 5HBCA 3IJXB 2HFBA 4IGRA 1WDNA 3SETA 1B1XA 3G3KA 1B52A 3ISPA 4NE4A 1B3HA 4PTKA 1JP4A 3ZKKA 4ISUA 4NF4B 3SEVA 4N8YA 5I2KA 1EH3A 3M3KA 2P3VA 2GFEA 1Z7NE 1QUIA 3OD7A 4I40A 3KOTA 2JJKA 4ZZAA 1FTAA 4P8BA 4F1UA 1B9JA 1Q1KA 4JB7A 1OLAA 2UYFA 2VD3A 4TLMB 2VOZA 3Q26A 4PFUA 4RK9A 4G77A 1B1HA 4WXJA 3KN3A 4PC9A 3KBRA 1LEVA 2QS4A 4AS4A 2DOJA 2I3WA 4KCDA 5CRYA 4QHQA 4I3YA 1YTVA 1DOTA 1MY3A 4GL0A 2O7UA 3I6VA 2R71A 5TP9B 3H6VA 1QW0A 4G68C 4AB6A 2REJA 4NTLA 4QFNA 1ZIUA 3S9EA 2RC9A 4PAKA 2ALUA 1B3LA 4HE2A 2PMSA 4HXVA 3TDJA 4YKPA 1B3EA 1K9ZA 1N76A 3VFJA 4GD5A 3TFLA 1D3KA 1N7WA 4GWXA 2ZNTA 1ZU0A 1IITA 1B7ZA 1QKBA 4F31B 2H98A 2QVUA 3AXFA 3U93A 2Y7PA 3G3FA 1UIVA 3SESA 5CC2A 5IKBA 3MW0A 1NUXA 2XX9A 3PTYA 5JK4A 1EU8A 3DP6A 1MPCA 1DPEA 1IXGA 3CFLA 4RA1A 5AA1A 3T66A 4WKMA 5ET7A 1MH3A 3SEXA 4I9DA 3T96B 1O64A 2B4LA 1R9QA 5L9OA 3PD9A 1RYXA 3PPNA 1LBXA 2ZNSA 5JEIA 3Q28A 3BFTA 4DLDA 3OELA 1FBCA 2H4IA 1OLCA 4ZS9A 3CG1A 2XWVA 3TCFA 5FHOA 1DTGA 2F8DA 4L17A 4OMBA 3TCGA 4N4UA 1IMCA 3HV1A 1EZOA 5KCJB 3T9HB 5KDTA 5AA4A 1SQYA 2XXYA 4MFIA 2FYIA 1UIUA 4KYEA 4QSDA 5IZ1A 1USYE 3B6TA 1Q9DA 4LP2B 4XIGQ 1LLSA 4IO3A 4X9TA 1P1OA 1VR5A 1B2HA 4N07A 4HTGA 3C32A 3VVEA 3LR1A 4H65A 1PEBA 2V93A 3A29A 1ZKBA 2H5YA 1I69A 5TPAB 4N6DA 2AIXA 2Y5KA 4GX6A 3LBSA 1JVYA 4WEPA 3A3UA 4UABA 4FEBA 1FJ6A 4LONB 2DWIA 2O7IA 2Y7RA 1POY1 3H6WA 3SEWA 4ELRA 4POXA 3VXBA 3O29A 2GQ1A 4OEVA 1LBBA 2O6AA 3OO9A 4P0GA 4QFLA 2I58A 4I62A 2OK2A 1AH5A 5DT6A 3RPLB 2FVZA 3VV5A 3OEMA 1URDA 1G0HA 3OO7A 4JDFA 3KBZA 5FHNA 5I59A 4U23A 1M5EA 1FPEA 3LUZA 5EYGA 1LSTA 2I4BA 5DVJA 4P11A 5H8NA 4OFJA 1XOCA 3N6TA 2WEFA 3D4GA 4PFIA 2ONKE 4P1EA 1PB8A 3RN8A 1USYH 4QRZA 3JYRA 2F7AA 4JVIA 2Q88A 2WBDA 1MY2A 4ZZEA 1Y4CA 5AA2B 3KSXA 4KI0E 4XXUA 3KFMA 1JW4A 3IX1A 1I6QA 1NUWA 2R6GE 5I2NB 5K2YA 1VE4A 3K1PA 4N81A 3QMFA 3THIA 4DCXA 3MPKA 2E1SA 4X04A 3O2AA 3PUXE 2F36A 4U1ZA 3PUYE 1H44A 3GYYA 4GXSB 4F1YA 3FJ7A 4XTCQ 1N3XA 2X26A 2DYXA 2WYKA 2R8TA 1B7UA 4OYVA 3MP6A 3FD3A 3SEYA 1MDP1 2O84X 3CIJA 4EQ7A 1FQAA 1OMPA 1Y1MA 3R26A 4UA8A 3O6GA 4ESWA 3LC8A 4N6PA 1NV4A 3TUSA 1A99A 1YXIA 1FBEA 2ZNUA 4F2OA 4BDNA 1FQCA 4DI3D 3UK4A 1ZBMA 3FVOA 3ECRA 4O3AA 3RTFB 3DP4A 3M3FA 4IGTA 2F6PA 1IUDA 5H8HB 5DVIA 2QS2A 3EPEA 3H06B 3MQ9A 2BJIA 1LBZA 1SYHA 1T0KA 3Q29A 4LVQA 1DTZA 1EZ9A 4MNIA 4H67A 4IB2A 3B8BA 3USDA 3C31A 5FTHA 1FPDA 5L9MA 2XXHA 2V3TA 1KA0A 2HXWA 5I56B 2PT2A 4O7MA 4RY1A 4ELOA 1B3GA 3KEIA 2V25A 1Y4TA 2CZKA 2ZYMA 2I6EA 1LB8A 5ET5A 4OA4A 2H99A 2F78A 4MJOA 2XWKA 2QPQA 5ITOA 1QJMA 5TPAA 3UN6A 2DVCA 2FNCA 1Q35A 3K1NA 2PFYA 3LSLA 4KD5A 3MUQA 2XXQA 2RKMA 2WYPA 1OQHA 2XD3A 4Q30B 3ZSFA 4H0WA 4EDPA 1MRPA 1FPFA 4NF0A 1DPPA 2Y7IA 1FQBA 2QVRA 4ZDMA 1YYZA 4RPOA 3MYUA 5ET6A 4Q0CA 2FHYA 1YCJA 3MVWA 1NV5A 3QUJA 4H45A 3K6UA 2F5XA 1NKXA 1IEJA 2W7YA 2QL3A 1LFGA 4H6DA 5CBRA 2B4MA 1SBPA 4JSOA 3K6XA 3RT8A 1SW4A 1Y9UA 2VT5A 3TTKA 4MF3A 4QSCA 4R2BA 3PD8A 5H8NB 5ICTA 5IM2A 2DXYA 1FTKA 2UVIA 3JV9A 3N6UA 4F3PA 2DDKA 3RGYA 4E0XA 5FBPA 5AE4A 4XEQA 4GWYA 3FUZA 3E79A 3EF7A 3VLUA 3LSXA 4QFOA 1OVBA 1YPNA 3H6UA 3IO6A 1UTBB 3ILTB 3TTNA 1FW0A 3FXQA 3G3IA 4YKIA 5H8SA 3PPPA 1I6BA 4P9KA 2ZYKA 3QK6A 2PYYA 4DI4B 4FAJA 1NUYA 3OSQA 4OTEA 2Q74A 3FZVA 4AS5A 4H46A 3PPQA 4G61A 4FATA 1QUKA 5DTBA 2ESNA 1VSOA 3U65A 4JVDA 2FA7A 4YB7A 1UQWA 2DE4A 5L9SA 5JTYA 4FORA 1L5TA 1LCFA 1QGXA 1XVYA 3E3KA 1O63A 4OFLA 1Y3QA 3MZ9A 3ZS6A 1VFEA 2PCRA 2HCAA 3PPRA 4HS7A 5L8DA 3TAJA 2Z8EA 4O94A 2D5WA 3V5AA 2Y5LA 5LOMA 4ZEBA 4U1OA 2DQVA 4NHBA 4RNSA 2XX7A 1B32A 2NXOA 3TCHA 4R6HA 3GBBA 4BDOA 1US5A 3PUWE 3CHGA 4R6YA 5I59B 3MSTA 3CVGA 2FIEA 2QJEA 4NF5A 1MQIA 1OVTA 2RCAA 3IOVA 3FVKA 4H8IA 2XXIA 3U8QA 3K1MA 2RC8A 2VGQA 1P1WA 1FJ9A 1JVXA 2Q2AA 2QS1A 3MZ1A 3B6WA 2GH9A 2XHDA 3IORA 2Q2CA 3VDFA 4TQUQ 1PBQA 2OCUA 3ODBA 5B7DA 4EQ9A 2XXPA 1H76A 3H7MA 2QFLA 2VPNA 3M3LA 2QMWA 5AA2A 1FTJA 2WKYA 4GOTA 3IL1B 3F11A 3L6GA 2OWSA 5EQ9A 1F9BA 5EQAA 1BKAA 3ONMA 1IZ1A 4P56A 3T93B 2NOOA 3KZGA 4QBAA 4H5GA 1JQFA 4LQ2A 4OXVA 5M2VA 1NNFA 2V3QA 3GZGA 5CBSA 1LBYA 4LQ5A 4P0IA 2PBWA 4XKPA 4IY5A 2QMXA 4GWUA 4Z7EA 1WODA 3KSJA 3SERA 2DWHA 4NMYA 5A5LA 3O6IA 4G8NA 3IFCA 1GV8A 4QFPA 3RNNA 3O66A 1NUZA 2F35A 2Q9TA 2XWIA 2OZZA 5CI5A 3E78A 3TELA 2XXVA 2XXRA 2F97A 3MWBA 1NH8A 2GHBA 3FIRA 4PQJA 4LZ5A 3IO4A 4FJPA 4HE1A 3DELB 5IAIA 1XS5A 2L5VA 1Z7ME 5H8FA 4OZ9A 5LTCA 3MP1A 5AA2D 1IMDA 4IO6A 2HXRA 4PFBA 2UXAA 4POWA 3C9HA 3QSLA 4EUOA 4Q5TA 1SYIA 3JZJA 1ANFA 1JW1A 3I5OA 3QIMA 3T9UA 1NMUA 2XA5A 1HSLA 4RPNA 3PPOA 1D9VA 5HM4B 3PUZE 3CFZA 3I3VA 4PGNA 1B5IA 1JW5A 5AA3A 3MAMA 4Z0IA 4OHNA 2MKZA 3EQ1A 4GQOA 1AMFA 4R74A 1FTLA 1CB6A 1ATGA 3VVFA 3KJTA 3PV0E 1AWBA 4F19A 3G7WA 2ONRA 2ZYOA 1B6HA 3MVXA 1IMFA 2THIA 3H3GA 1CE2A 4ND9A 4GFRA 2I3VA 1GGGA 1NV3A 2O51A 4GXAA 4GWSA 1O7TA 3RUMA 5ITPA 1TWYA 4ZEKA 4KQPA 4OENA 2NVUB 2UVHA 2P2AA 5I84A 3K2DA 4F18A 3VE1B 4JXIA 1P1UA 1BP5A 1R1NA 4MX6A 4NWDA 3KN8A 2QSXA 2R9JA 1A55A 2OBGA 2DSFA 5DEXB 1FSAA 1B46A 3C34A 3IFAA 5KDTB 2YJPA 1IXHA 1N04A 2Z22A 5K2XA 3B50A 3TPAA 3BKIB 2A5TA 4QFKA 4FECA 2KLFA 4H1XA 3H4ZA 2Y7WA 4ZEFA 1Y3PA 3RYDA 1II5A 2UYEA 3MC2A 3C36A 4JWOA 5ICQA 4C1UA 4X48A 4EF1A 2ANJA 3TODA 3RTWB 2CEXA 2M8CA 4KPTA 1WVJA 3OEKA 4N8GA 3T0JA 1LCTA 4BDMA 1FPIA 1IMAA 3OO8A 4JSDA 3U92A 4DXCA 3U72A 2DE3A 4YKJA 4YMBA 1P99A 2OLBA 4PAFA 3RY3A 4X8RA 2O68A 5TU0A 4U2RA 3D4CA 4PE5B 2CZHA 2B3BA 3V83A 2VPOA 1DMBA 1P1QA 2PX1A 3S4UA 2ZYNA 4I3EA 3FV1A 3T1BA 4ELPA 1NH7A 1MQJA 5I58B 3MP8A 4HE0A 4KXPA 3IR1A 1AIVA 4KCCA 3OOAA 2Q8JA 4N6KA 3ZKLA 1MS7A 4OERA 3CSBA 4MCOA 3LSWA 4R75A 1XVXA 1FQFA 2P0SA 4R2FA 2V84A 4NF8A 4MLQA 1ZJLA 3Q27A 1VFDA 1J1NA 3N26A 4PFYA 3HCQA 3MZBA 3O9PA 1ELJA 3EHSA 1HSEA 3S9MC 1DSNA 2RF1A 4YICA 4NN3A 4ELQA 4MH5A 2UVGA 4PF8A 1UTBA 2HZLA 4GVOA 1IXIA 4NG7A 4U4XA 5DVFA 1JETA 3WAEA 5FTIA 4R73A 3HFUA 1KA1A 4JWYA 4M4GA 3FXUA 1LBVA 2OWTA 5LDZA 4NF4A 4DIGA 4G2ZA 3N5LA 5F1QA 4G8HA 4U21A 3RLFE 5I2NA 1LBWA 5CMBA 4TLLB 5I56A 3HSTA 4OFOA 1MY1A 1FCKA 5H8QB 5IZ3A 4K3FA 3HO7A 2E0SA 4R9GA 1H3DA 2QVVA 3FBPA 4GWWA 4LZ8A 3VLVA 4BLAA 3Q25A 2WX9A 4YAHX 4OVTA 5F24A 1M5DA 3SZPA 5I2KB 2CZIA 2G29A 3VXCA 3MPLA 3OO6A 2ZZXA 3PUVE 1BTJA 1FTMA 1PC3A 5I57A 2CEYA 4RK2A 3VLWA 4ZEDA 4R6KA 1FPJA 1US4A 1B7HA 1URSA 3UGWA 4PP0A 3V8XB 4PBHA 3S2VA 4MNPA 2I0BA 1NNKA 1ZLQA 2YPNA 4OVRA 5HPQA 2NUVA 5I5PA 4G4PA 1QUJA 3K01A 1MPDA 2F7CA 4RYAA 4F2QA 1B58A 3PMXA 2B3FA 4PFTA 1XT8A 4O3BA 4FE8A 4X1BA 4NF5B 5EYHA 1LAGE 4PAIA 1FPKA 2HEUA 4FEDA 1XC1A 2RINA 2Y84A 3MVYA 2GRVA 1VDWA 1KZ8A 5CMCA 2IEEA 2F34A 3PGFA 4GX3A 1IIWA 2ZZWA 2DE2A 3OXNA 5ISUA 4XFEA 1SPIA 4MLVA 2PFZA 4R9FA 1IQ7A 2Z8DA 1D4NA 4PGPA 2HQ0A 3KGCA 2ZXTA 4XKQA 1M5CA 1N3WA 5CM6A 2HPGA 2XXTA 2GHAA 1YAEA 1MQDA 3CG3A 1ZMGA 5JTYB 3VVDA 4G68A 3M8UA 1LBCA 5IZZA 2XXWA 3K4UA 1FQDA 1PB9A 1P1NA 2V4CA 5B70A 4OVJA 1FBPA 4NAPA 1RDZA 1D9YA 1S50A 3QYTA 3KG2A 1IMEA 4JVCA 4P47A 3IK6B 1MDQA 1BIYA 4BDRA 3FV2A 1NNTA 3FXBA 5ET8A 3OENA 4F39A 3EN3A 1INPA 3H03A 1I6AA 5TP9A 1FBDA 4QXDA 2DWJA 4DDDA 1JNFA 2AL5A 4NQ8A 4NX1A 4UACA 4F1VA 3LV0A 4RXLA 3G3HA 4O3CA 1HSJA 1OQGA 2I4CA 1UTHA 2ONSA 4MHFA 1TT1A 4TOZA 3SDFA 1EYIA 1B40A 1UTHB 1K9YA 3TTRA 3HPIA 3KC0A 3K6VA 5CMKA 2DWAA 1A40A 3D1RA 5DW8A 4EXKA 1MM6A 3IOWA 2D21A 4PE3A 5ELVA 1B05A 3FJMA 5EHSA 4HW8A 3HHFA 1JEUA 3GLBA 3TQLA 4HCYA 4WEDA 4Q8RA 3IB2A 1FPLA 5FHMA 3WAFA 2REGA 1N84A 2D3IA 1QKAA 1SW5A 4OVSA 2OX3A 1N0TA 4MMPA 3TMGA 1MXUA 1EYJA 2FIXA 3TYHA 3TTMA 5I57B 4ZECA 1NV0A 2WBBA 4GWZA 4PCDA 2Q8MA 3BIHA 3N94A 3FXRA 4HCWA 3KJ7A 2XXUA 4F3BA 3UP9A 5DEXA 3RPLA 1MY0A 2NWJA 4OQOA 4PBQA 2O1MA 4GLIA 1NV1A 3CR9A 3BBRA 1JEVA 1LAXA 1B4HA 4OESA 2I0CA 5AA4B 4OANA 1B5JA 3T9VA 1NFTA 4KR5A 4H8JA 3IOUA 3K02A 2XX8A 1A8EA 2PVUA 4FBPA 4DXUA 4ZE9A 4U4SA 5F7VA 2I49A 2DXRA 4DCYA 3OSRA 1FBHA 5I3SA 1MXXA 1MQGA 4I1DA 4GL8A 3CFXA 2QRYA 4F3GA 4ONYA 1A8FA 2CZLA 2HHMA 3MVZA 3SKPA 1MH4A 4IY6A 1NL5A 2BJJX 1S7YA 2B65A 5T3JA 4PF6A 3DM0A 1R6ZA 1MQHA 4R72A 5H8QA 5IZ3B 3T22A 4MBPA 1ZTYA 3RT6B 2H9BA 3GXAA 1Y20A 1RKMA 5ESYA 4NF6A 3TZAA 4OEUA 4QSEA 3OMBA 4P3LA 3HHGA 3U1OA 3O28A 2A5SA 3W15C 3DP8A 3RPWA 4N17A 3FVNA 1MG1A 1SI0A 4MAGA 3PMWA 3QAXA 1EZPA 2LAOA 1SW2A 4YB6A 3S9NC 2A5TB 4YB5A 2XD2A 1TXFA 1GVCA 1B0LA 4PDHA 2ABHA 1A7LA 2X7PA 1XI6A 4U22A 1G0IA 2PT1A 5KZTA 4OETA 4GX4A 1PDAA 1Y3NA 1GR2A 1FRPA 3H6TA 1M5FA 1MXZA 3TKDA 1MPBA 1NNPA 4N15A 2AL4A 3O6HA 2HAVA 2HAUA 4DZ1A 3CRBA 4JBZA 4IO2A 2KR0A 3S9LC 1CNQA 2RCBA 3ILUB 3CSGA 1QULA 1YZ0A 2UVJA 5BUUA 1PBPA 3HN0A 1BLFA 3LSFB 3P7IA 4DE8A 4JWXA 4ZEIA 1LGBC 2I48A 3IB0A 2DVZA 1N7XA 1MXYA 5BWJA 4QF9A 4ECFA 4LATA 4LZ7A 2Q89A 1H43A 1TFAA 4F29A 4PFRA 3B7DA 1B3FA 3EHTA 4G68B 4DXBA 3K6WA 3E9XA 5EYFA 3DLNA 4THIA 1FPBA 3FJGA 2O1LA 1A54A 3G3JA 3W9VA 1RDYA 1MXVA 3BIGA 2P1SA 2IA4A 2FBPA 1SW1A 3IAZA 3T9XB 2HZKA 1KWHA 2AYSA 3UORA 5KCJA 4NF8B 4O8MA 1EYKA 4I8CA 2G93A 4BDQA 2F7BA 2V3UA 2H25A 3G3GA 4F22A 3A09A 2F3DA 4NGUA 4GWOA 1QVSA 1Y1ZA 2F3BA 3IJOB 3IB1A 5DYHA 1B5HA 3TTLA 1SDXA 4FIMA 4EF2A 3E13X 3K00A 4IO7A 3UIFA 1SD3A 4GF8A 4O7IA 2F6GA 4OWDA 2ZMBA 1FTOA 5EHMA 1IMBA 1R9LA 4OVPA 3BFUA 1LFIA 1B4ZA 4MEVA 2Z8FA 2XXKA 3TQWA 2RC7A 1NV6A 4PFWA 3FASA 1RYOA 1LAFE 2QS3A 3FGSA 4XF5A 3L6HA 3O97A 3KN7A 4XKRA 3C4MA 2P3NA 3FATA 4AB5A 1LFHA 4XKNA 1NV2A 1NI9A 1PB7A 5CMMA 4BDLA 5H8HA 1BK4A 4RJZA 1MM7A 1S9TA 3GBAA 3E4RA 2VP1A 1B51A 4PDDA 2XWOA 3C35A 3CI8A 3A3CA 5I7IA 3C33A 3W9WA 4KYSA 4NEDA 4P1LA 3UA8A 4IO4A 1POTA 3LUYA 4N13A 4LN5A 2OWZA 2X7QA 4H5FA 2ZZVA 1FBGA 2O69A 5J1DA 2OJTA 4IR8A 3K0VA 4YU0A 1MY4A 4LUBA 1H45A 3KOSA 4IO5A 5H8FB 4ZE8A 4KYDA 2VHAA 1FPGA 4C0RA 1SVXB 1GTKA 1DBZA 3SEUA 4EQBA 3RQTA 1OIBA 4MNCA 3QXMA 1XHYA 4GRKA 5A5XA 3U94A 1M5BA 2XXXA 4NWCA 4YZZA 1NV7A 3NOHA 4ESXA 1SI1A 5A5XB 4N91A 3MBPA 1IXCA 1MXWA 3FVGA 4F3SA 4NF6B 1TFDA 2VD2A 1D9QA 3EKIA 4KFQA 1DCUA 2CMOA
chains in the Genus database with same CATH topology
1FTLA 1CB6A 1ATGA 3TQLA 3VVFA 4HCYA 1B7UA 3KJTA 4OYVA 3MP6A 3FD3A 4WEDA 2Y7KA 3PV0E 3SEYA 1MDP1 4E0WA 3IB2A 3G7WA 2O84X 2ONRA 4AQ4A 4F19A 4Q8RA 4M1VA 2ZYOA 5FHMA 3WAFA 2REGA 3ZSFA 3CIJA 1N84A 2D3IA 1B6HA 1QKAA 1SW5A 3EHUA 1FQAA 3MVXA 4EQ7A 2THIA 3PMVA 4C1TA 1OMPA 3H3GA 1CE2A 1Y1MA 4GIZA 4ND9A 4X1DA 1N0TA 3TMGA 4GFRA 2I3VA 1MXUA 1GGGA 3R26A 3PU5A 4UA8A 1B0HA 3TTMA 2O51A 3O6GA 3TYHA 4GXAA 4LA9A 4EXLA 1O7TA 4ESWA 4ZECA 5I57B 3RUMA 3R7XA 5ITPA 3QUFA 1TWYA 4ZEKA 3LC8A 4N6PA 1LB9A 4KQPA 4OENA 1A99A 3TUSA 4PETA 3TEPA 2NVUB 2UVHA 2P2AA 2ZNUA 3FXRA 3K2DA 3N94A 5I84A 4HCWA 3KJ7A 4F2OA 4F18A 3VE1B 4BDNA 1FQCA 1FQEA 3IOTA 4JXIA 2XXUA 4F3BA 3UK4A 1P1UA 5I58A 1ZBMA 3MJNA 5DEXA 1BP5A 3FVOA 3UP9A 2DS9A 1R1NA 3ECRA 4O3AA 4NWDA 3RTFB 3DP4A 2QSXA 3KN8A 2R9JA 1A55A 1MY0A 2OBGA 3M3FA 4IGTA 2NWJA 2DSFA 3B6QA 2F6PA 5DEXB 1IUDA 1B46A 4OQOA 5DVIA 2QS2A 3C34A 3EPEA 3H06B 5H8HB 5KDTB 2YJPA 1IXHA 1N04A 2O1MA 2Z22A 1AL3A 5K2XA 1LAHE 2YLNA 1URGA 3MQ9A 4GLIA 3TPAA 3BKIB 1SYHA 3CR9A 3BBRA 1T0KA 3Q29A 4LVQA 1DTZA 1EZ9A 2A5TA 1JEVA 1LAXA 1B4HA 4H67A 4IB2A 3R6UA 4QFKA 4FECA 3USDA 2KLFA 3C31A 4OESA 4G8MA 5FTHA 2I0CA 4YKKA 4H1XA 5AA4B 5L9MA 1AOVA 3H4ZA 1B5JA 3T9VA 1NFTA 4KR5A 2XXHA 2V3TA 4H8JA 2Y7WA 3IOUA 1Y3PA 4ZEFA 3K02A 4KHZE 2XX8A 1II5A 2HXWA 3V89B 1A8EA 2UYEA 4YMAA 2DP8A 2PT2A 5I56B 3MC2A 3C36A 2Z23A 2PVUA 4JWOA 5ICQA 5HBCA 4C1UA 4DXUA 4RY1A 4ZE9A 4X48A 4EF1A 3IJXB 2HFBA 4IGRA 1B3GA 2ANJA 3TODA 4ELOA 3KEIA 3RTWB 1WDNA 3SETA 4U4SA 5F7VA 1B1XA 3G3KA 1B52A 4NE4A 2I49A 1B3HA 2M8CA 2V25A 4KPTA 1Y4TA 1WVJA 3OEKA 2DXRA 2ZYMA 2I6EA 1LB8A 1LCTA 4BDMA 4DCYA 3OSRA 2H99A 1MXXA 1MQGA 4I1DA 3ZKKA 4GL8A 3CFXA 4ISUA 4NF4B 3OO8A 2QRYA 3SEVA 4F3GA 4ONYA 5I2KA 1A8FA 2CZLA 3MVZA 2F78A 4JSDA 3SKPA 3U92A 1EH3A 3U72A 2DE3A 4YKJA 4DXCA 1MH4A 4IY6A 1NL5A 2BJJX 3M3KA 2GFEA 1P99A 1QJMA 2QPQA 5ITOA 4YMBA 5TPAA 1S7YA 3UN6A 2B65A 2DVCA 2FNCA 2OLBA 1Z7NE 3RY3A 2O68A 1Q35A 3K1NA 1QUIA 3OD7A 3DM0A 3LSLA 3KOTA 1R6ZA 4KD5A 5TU0A 4ZZAA 1MQHA 3MUQA 2XXQA 2RKMA 4R72A 4U2RA 5H8QA 3D4CA 1B9JA 4PE5B 4F1UA 1OQHA 1Q1KA 2B3BA 2XD3A 4H0WA 4Q30B 4MBPA 1ZTYA 4JB7A 3T22A 3V83A 1OLAA 4EDPA 1MRPA 3RT6B 2H9BA 2UYFA 3GXAA 2VD3A 1Y20A 1RKMA 4TLMB 2VOZA 1DPPA 2Y7IA 4NF6A 3TZAA 1DMBA 1FQBA 1P1QA 3Q26A 4OEUA 4ZDMA 2PX1A 3S4UA 2ZYNA 4PFUA 4QSEA 3OMBA 4RK9A 3FV1A 4G77A 4ELPA 4RPOA 1B1HA 1NH7A 1MQJA 3HHGA 3MP8A 3O28A 3U1OA 4Q0CA 5I58B 2A5SA 3W15C 3DP8A 4WXJA 3KN3A 3IR1A 3KBRA 3RPWA 1AIVA 2QS4A 3FVNA 1MG1A 4KCCA 3OOAA 1SI0A 2Q8JA 3ZKLA 3TFLA 2DOJA 3PMWA 2I3WA 1MS7A 3QAXA 1YCJA 4KCDA 1EZPA 4OERA 5CRYA 4EUOA 3MVWA 4QHQA 3CSBA 5DVFA 3QUJA 3LSWA 1YTVA 4R75A 1XVXA 2LAOA 1FQFA 3K6UA 2F5XA 2P0SA 1SW2A 1NKXA 1IEJA 1DOTA 4YB6A 3S9NC 1MY3A 2W7YA 2QL3A 2A5TB 4R2FA 1LFGA 4H6DA 2V84A 2XD2A 1SBPA 4GL0A 4JSOA 1TXFA 3K6XA 1GVCA 3RT8A 1SW4A 1B0LA 2O7UA 4MLQA 4NF8A 3I6VA 1Y9UA 1ZJLA 2ABHA 3Q27A 2R71A 1A7LA 2X7PA 1VFDA 1J1NA 5TP9B 3N26A 4PFYA 3HCQA 3MZBA 4U22A 3O9PA 3TTKA 4MF3A 1ELJA 4QSCA 3EHSA 1HSEA 3H6VA 3PD8A 4R2BA 1DSNA 5H8NB 2RF1A 5ICTA 1QW0A 4G68C 4YICA 3TKDA 2PT1A 4AB6A 2REJA 5KZTA 2DXYA 4NTLA 4QFNA 4MH5A 4ELQA 4C0RA 4OETA 1FTKA 2UVGA 1ZIUA 2UVIA 3JV9A 3N6UA 1UTBA 1PDAA 4F3PA 2HZLA 3RGYA 4E0XA 5AE4A 1Y3NA 1GR2A 3S9EA 2RC9A 3FUZA 4GVOA 1IXIA 3EF7A 1M5FA 2ALUA 1B3LA 3H6TA 3LSXA 1OVBA 4QFOA 1YPNA 4U4XA 2PMSA 1MXZA 3H6UA 3IO6A 1JETA 1B3EA 1UTBB 1N76A 1MPBA 1NNPA 3ILTB 1FW0A 4YKPA 4R73A 5FTIA 3FXQA 3G3IA 4GD5A 4YKIA 2AL4A 1D3KA 1N7WA 3O6HA 3PPPA 1I6BA 5H8SA 2HAVA 2HAUA 4JWYA 2ZYKA 4M4GA 3QK6A 2ZNTA 3FXUA 1ZU0A 2PYYA 2OWTA 4FAJA 4NF4A 5ISUA 1IITA 1B7ZA 4DZ1A 1QKBA 3CRBA 4JBZA 4DIGA 4IO2A 4G2ZA 3N5LA 5F1QA 4G8HA 3S9LC 3OSQA 4U21A 4OTEA 2RCBA 3ILUB 3FZVA 3RLFE 4F31B 5I2NA 3PPQA 5CMBA 3CSGA 4TLLB 4FATA 5I56A 1QUKA 3HSTA 5DTBA 4OFOA 2H98A 1MY1A 2ESNA 1VSOA 1QULA 3AXFA 3U93A 2Y7PA 3G3FA 1FCKA 1UIVA 2UVJA 3SESA 5H8QB 5BUUA 4K3FA 3HO7A 2E0SA 4R9GA 5CC2A 2FA7A 4YB7A 1H3DA 1PBPA 5IKBA 3MW0A 4LZ8A 1UQWA 3HN0A 1BLFA 2DE4A 3LSFB 3VLVA 5L9SA 4BLAA 2XX9A 3Q25A 5JTYA 4FORA 1L5TA 1LCFA 5JK4A 1EU8A 3P7IA 3DP6A 4YAHX 1XVYA 1MPCA 1DPEA 4DE8A 1IXGA 1M5DA 3CFLA 4JWXA 3E3KA 1O63A 4RA1A 4ZEIA 5AA1A 5I2KB 1LGBC 4OFLA 4WKMA 2G29A 1Y3QA 3MZ9A 3ZS6A 1MH3A 1VFEA 3VXCA 2I48A 3SEXA 3IB0A 3MPLA 4I9DA 3T96B 1O64A 2DVZA 1N7XA 2HCAA 3OO6A 3PUVE 1BTJA 3PPRA 1MXYA 4HS7A 1FTMA 3V8XB 5L8DA 1PC3A 3TAJA 5BWJA 5I57A 1R9QA 3VLUA 2Z8EA 5L9OA 4QF9A 3PD9A 4RK2A 3VLWA 2D5WA 1RYXA 4ECFA 4LATA 4LZ7A 3PPNA 4ZEDA 2Q89A 4R6KA 3V5AA 5LOMA 4ZEBA 2ZNSA 4U1OA 2DQVA 5JEIA 1H43A 1US4A 4RNSA 3Q28A 1TFAA 4F29A 2XX7A 1B32A 1B7HA 1URSA 2NXOA 3B7DA 3BFTA 4PP0A 1B3FA 3EHTA 3OELA 4R6HA 3TCHA 3UGWA 4DLDA 3S2VA 4G68B 2I0BA 3K6WA 1NNKA 1ZLQA 4DXBA 3E9XA 2H4IA 3GBBA 4BDOA 1OLCA 2YPNA 4ZS9A 5EYFA 3DLNA 3CG1A 4THIA 1US5A 3PUWE 3TCFA 3FJGA 5FHOA 1DTGA 2O1LA 5HPQA 2F8DA 1A54A 4L17A 2NUVA 4R6YA 4OMBA 4G4PA 3G3JA 3W9VA 1QUJA 3TCGA 3K01A 1MXVA 1MPDA 2F7CA 2P1SA 5CBRA 5I59B 2IA4A 3HV1A 1EZOA 4RYAA 5KCJB 4F2QA 1B58A 3CVGA 3T9HB 3PMXA 5KDTA 5AA4A 2QJEA 1SW1A 3IAZA 3T9XB 2HZKA 1SQYA 1KWHA 2AYSA 2B3FA 2XXYA 1MQIA 1OVTA 2RCAA 4NF5A 4PFTA 3IOVA 4MFIA 3UORA 4NF8B 5KCJA 1XT8A 2FYIA 1UIUA 3FVKA 4O3BA 4FE8A 4H8IA 4KYEA 4X1BA 4I8CA 2G93A 4NF5B 2XXIA 4QSDA 4BDQA 2F7BA 3K1MA 3U8QA 2V3UA 2H25A 3G3GA 4F22A 3A09A 1LAGE 2RC8A 2VGQA 1P1WA 3S9MC 1JVXA 2Q2AA 2QS1A 1USYE 3B6TA 2HEUA 3B6WA 2GH9A 3MZ1A 4GWOA 2XHDA 3IORA 1XC1A 2RINA 2Y84A 4FEDA 2Q2CA 1QVSA 1Y1ZA 3IJOB 2GRVA 3MVYA 4LP2B 4XIGQ 3VDFA 4TQUQ 5CMCA 4BDLA 1PBQA 2IEEA 2OCUA 3ODBA 5B7DA 1LLSA 2F34A 4EQ9A 4IO3A 3IB1A 4X9TA 5DYHA 3PGFA 3TTNA 2XXPA 1P1OA 1VR5A 1IIWA 1B2HA 1H76A 1B5HA 2DE2A 1SDXA 3H7MA 3OXNA 4N07A 3M3LA 4HTGA 3TTLA 4FIMA 2QMWA 4EF2A 3E13X 1FTJA 2WKYA 4MLVA 3C32A 3VVEA 3LR1A 5AA2A 3K00A 4H65A 4GOTA 4R9FA 4IO7A 3IL1B 1PEBA 2V93A 1IQ7A 1ZKBA 2H5YA 3UIFA 1SD3A 2Z8DA 4GF8A 1I69A 1D4NA 2OWSA 3F11A 3L6GA 5TPAB 3WAEA 1F9BA 2AIXA 3LBSA 2F6GA 4OWDA 2HQ0A 1JVYA 2ZMBA 4WEPA 1FTOA 3A3UA 4FEBA 3KGCA 5EHMA 1BKAA 3ONMA 4LONB 1IZ1A 2DWIA 1R9LA 2O7IA 2ZXTA 4XKQA 3T93B 1M5CA 1N3WA 2NOOA 5CM6A 2Y7RA 1POY1 3BFUA 3H6WA 3KZGA 3SEWA 4ELRA 1LFIA 1B4ZA 2XXTA 4POXA 4H5GA 1JQFA 4LQ2A 2GHAA 4OXVA 5M2VA 1NNFA 2V3QA 2Z8FA 3TQWA 1YAEA 1MQDA 2RC7A 3VXBA 3GZGA 3O29A 3CG3A 5CBSA 4P0IA 4LQ5A 4PFWA 1ZMGA 4OEVA 3FASA 3TDJA 5JTYB 1RYOA 3VVDA 1LAFE 4G68A 1LBBA 5I2NB 2O6AA 2PBWA 2QS3A 1LBCA 3FGSA 3M8UA 3L6HA 2XXWA 3O97A 4XKPA 3OO9A 3K4UA 4IY5A 4P0GA 1FQDA 2I58A 4QFLA 3T66A 1PB9A 3KN7A 2QMXA 4XKRA 4Z7EA 4I62A 3C4MA 1WODA 2OK2A 3KSJA 3SERA 3FATA 4AB5A 1LFHA 4XKNA 1AH5A 5DT6A 1P1NA 2DWHA 4NMYA 3VFJA 3O6IA 1PB7A 5CMMA 4G8NA 3VV5A 3OEMA 1URDA 3OO7A 4RJZA 5H8HA 4JDFA 1MM7A 5B70A 4OVJA 1S9TA 3GBAA 5FHNA 1GV8A 3E4RA 4U23A 5I59A 1M5EA 1B51A 2VP1A 4QFPA 3RNNA 3O66A 3C35A 3CI8A 1LSTA 2F35A 1D9YA 1S50A 2I4BA 3QYTA 2Q9TA 3KG2A 5DVJA 3A3CA 3IK6B 3C33A 1MDQA 3W9WA 2OZZA 4P11A 5CI5A 3TELA 4KYSA 5H8NA 1BIYA 4NEDA 4BDRA 2XXVA 2XXRA 3UA8A 3FV2A 4OFJA 1NNTA 2F97A 1XOCA 3MWBA 3N6TA 1NH8A 4IO4A 1POTA 3LUYA 4N13A 3D4GA 2GHBA 3OENA 3EN3A 4F39A 2ONKE 3FIRA 3H03A 4PQJA 4LZ5A 3IO4A 4FJPA 1I6AA 1PB8A 5TP9A 3DELB 3RN8A 5IAIA 2X7QA 4H5FA 1USYH 4QRZA 2O69A 2F7AA 2DWJA 2OJTA 3JYRA 4DDDA 5J1DA 1XS5A 1JNFA 1Z7ME 2AL5A 3K0VA 4YU0A 5H8FA 4OZ9A 2Q88A 1MY4A 3MP1A 4LUBA 5AA2D 4UACA 1MY2A 1H45A 4F1VA 3KOSA 4IO6A 3G3HA 4IO5A 4O3CA 4RXLA 5H8FB 1HSJA 4ZZEA 4ZE8A 1OQGA 1Y4CA 5AA2B 2I4CA 1UTHA 2ONSA 3KSXA 4KI0E 2UXAA 4KYDA 4XXUA 4YB5A 1TT1A 3KFMA 1JW4A 4POWA 3IX1A 2VHAA 1I6QA 4TOZA 3SDFA 2R6GE 1B40A 3C9HA 3QSLA 5K2YA 1VE4A 1SVXB 1GTKA 1UTHB 1SYIA 3K1PA 4Q5TA 3HPIA 3JZJA 3THIA 3SEUA 3TTRA 1ANFA 1JW1A 3I5OA 4DCXA 3QIMA 3K6VA 4EQBA 3MPKA 3RQTA 2E1SA 2DWAA 3T9UA 1OIBA 3O2AA 3QXMA 5CMKA 1NMUA 1XHYA 1A40A 3PUXE 2F36A 1HSLA 4GRKA 4RPNA 4U1ZA 5A5XA 4EXKA 3U94A 3PPOA 1MM6A 1D9VA 1M5BA 2XXXA 3PUYE 4NWCA 5HM4B 1H44A 3IOWA 4YZZA 2D21A 3PUZE 5ELVA 3CFZA 4ESXA 1SI1A 3I3VA 5A5XB 3MBPA 1B05A 3FJMA 1IXCA 1B5IA 1JW5A 5AA3A 1MXWA 3FVGA 3MAMA 4GXSB 4F3SA 4Z0IA 4F1YA 4OHNA 4NF6B 1TFDA 2VD2A 3HHFA 3FJ7A 5EHSA 3EQ1A 4HW8A 4XTCQ 1N3XA 1JEUA 2X26A 1AMFA 4GQOA 4KFQA 2CMOA 3GLBA 2DYXA 4R74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FTL A;  1CB6 A;  1ATG A;  3TQL A;  3VVF A;  4HCY A;  1B7U A;  3KJT A;  4OYV A;  3MP6 A;  3FD3 A;  4WED A;  2Y7K A;  3PV0 E;  3SEY A;  1MDP 1;  4E0W A;  3IB2 A;  3G7W A;  2O84 X;  2ONR A;  4AQ4 A;  4F19 A;  4Q8R A;  4M1V A;  2ZYO A;  5FHM A;  3WAF A;  2REG A;  3ZSF A;  3CIJ A;  1N84 A;  2D3I A;  1B6H A;  1QKA A;  1SW5 A;  3EHU A;  1FQA A;  3MVX A;  4EQ7 A;  2THI A;  3PMV A;  4C1T A;  1OMP A;  3H3G A;  1CE2 A;  1Y1M A;  4GIZ A;  4ND9 A;  4X1D A;  1N0T A;  3TMG A;  4GFR A;  2I3V A;  1MXU A;  1GGG A;  3R26 A;  3PU5 A;  4UA8 A;  1B0H A;  3TTM A;  2O51 A;  3O6G A;  3TYH A;  4GXA A;  4LA9 A;  4EXL A;  1O7T A;  4ESW A;  4ZEC A;  5I57 B;  3RUM A;  3R7X A;  5ITP A;  3QUF A;  1TWY A;  4ZEK A;  3LC8 A;  4N6P A;  1LB9 A;  4KQP A;  4OEN A;  1A99 A;  3TUS A;  4PET A;  3TEP A;  2NVU B;  2UVH A;  2P2A A;  2ZNU A;  3FXR A;  3K2D A;  3N94 A;  5I84 A;  4HCW A;  3KJ7 A;  4F2O A;  4F18 A;  3VE1 B;  4BDN A;  1FQC A;  1FQE A;  3IOT A;  4JXI A;  2XXU A;  4F3B A;  3UK4 A;  1P1U A;  5I58 A;  1ZBM A;  3MJN A;  5DEX A;  1BP5 A;  3FVO A;  3UP9 A;  2DS9 A;  1R1N A;  3ECR A;  4O3A A;  4NWD A;  3RTF B;  3DP4 A;  2QSX A;  3KN8 A;  2R9J A;  1A55 A;  1MY0 A;  2OBG A;  3M3F A;  4IGT A;  2NWJ A;  2DSF A;  3B6Q A;  2F6P A;  5DEX B;  1IUD A;  1B46 A;  4OQO A;  5DVI A;  2QS2 A;  3C34 A;  3EPE A;  3H06 B;  5H8H B;  5KDT B;  2YJP A;  1IXH A;  1N04 A;  2O1M A;  2Z22 A;  1AL3 A;  5K2X A;  1LAH E;  2YLN A;  1URG A;  3MQ9 A;  4GLI A;  3TPA A;  3BKI B;  1SYH A;  3CR9 A;  3BBR A;  1T0K A;  3Q29 A;  4LVQ A;  1DTZ A;  1EZ9 A;  2A5T A;  1JEV A;  1LAX A;  1B4H A;  4H67 A;  4IB2 A;  3R6U A;  4QFK A;  4FEC A;  3USD A;  2KLF A;  3C31 A;  4OES A;  4G8M A;  5FTH A;  2I0C A;  4YKK A;  4H1X A;  5AA4 B;  5L9M A;  1AOV A;  3H4Z A;  1B5J A;  3T9V A;  1NFT A;  4KR5 A;  2XXH A;  2V3T A;  4H8J A;  2Y7W A;  3IOU A;  1Y3P A;  4ZEF A;  3K02 A;  4KHZ E;  2XX8 A;  1II5 A;  2HXW A;  3V89 B;  1A8E A;  2UYE A;  4YMA A;  2DP8 A;  2PT2 A;  5I56 B;  3MC2 A;  3C36 A;  2Z23 A;  2PVU A;  4JWO A;  5ICQ A;  5HBC A;  4C1U A;  4DXU A;  4RY1 A;  4ZE9 A;  4X48 A;  4EF1 A;  3IJX B;  2HFB A;  4IGR A;  1B3G A;  2ANJ A;  3TOD A;  4ELO A;  3KEI A;  3RTW B;  1WDN A;  3SET A;  4U4S A;  5F7V A;  1B1X A;  3G3K A;  1B52 A;  4NE4 A;  2I49 A;  1B3H A;  2M8C A;  2V25 A;  4KPT A;  1Y4T A;  1WVJ A;  3OEK A;  2DXR A;  2ZYM A;  2I6E A;  1LB8 A;  1LCT A;  4BDM A;  4DCY A;  3OSR A;  2H99 A;  1MXX A;  1MQG A;  4I1D A;  3ZKK A;  4GL8 A;  3CFX A;  4ISU A;  4NF4 B;  3OO8 A;  2QRY A;  3SEV A;  4F3G A;  4ONY A;  5I2K A;  1A8F A;  2CZL A;  3MVZ A;  2F78 A;  4JSD A;  3SKP A;  3U92 A;  1EH3 A;  3U72 A;  2DE3 A;  4YKJ A;  4DXC A;  1MH4 A;  4IY6 A;  1NL5 A;  2BJJ X;  3M3K A;  2GFE A;  1P99 A;  1QJM A;  2QPQ A;  5ITO A;  4YMB A;  5TPA A;  1S7Y A;  3UN6 A;  2B65 A;  2DVC A;  2FNC A;  2OLB A;  1Z7N E;  3RY3 A;  2O68 A;  1Q35 A;  3K1N A;  1QUI A;  3OD7 A;  3DM0 A;  3LSL A;  3KOT A;  1R6Z A;  4KD5 A;  5TU0 A;  4ZZA A;  1MQH A;  3MUQ A;  2XXQ A;  2RKM A;  4R72 A;  4U2R A;  5H8Q A;  3D4C A;  1B9J A;  4PE5 B;  4F1U A;  1OQH A;  1Q1K A;  2B3B A;  2XD3 A;  4H0W A;  4Q30 B;  4MBP A;  1ZTY A;  4JB7 A;  3T22 A;  3V83 A;  1OLA A;  4EDP A;  1MRP A;  3RT6 B;  2H9B A;  2UYF A;  3GXA A;  2VD3 A;  1Y20 A;  1RKM A;  4TLM B;  2VOZ A;  1DPP A;  2Y7I A;  4NF6 A;  3TZA A;  1DMB A;  1FQB A;  1P1Q A;  3Q26 A;  4OEU A;  4ZDM A;  2PX1 A;  3S4U A;  2ZYN A;  4PFU A;  4QSE A;  3OMB A;  4RK9 A;  3FV1 A;  4G77 A;  4ELP A;  4RPO A;  1B1H A;  1NH7 A;  1MQJ A;  3HHG A;  3MP8 A;  3O28 A;  3U1O A;  4Q0C A;  5I58 B;  2A5S A;  3W15 C;  3DP8 A;  4WXJ A;  3KN3 A;  3IR1 A;  3KBR A;  3RPW A;  1AIV A;  2QS4 A;  3FVN A;  1MG1 A;  4KCC A;  3OOA A;  1SI0 A;  2Q8J A;  3ZKL A;  3TFL A;  2DOJ A;  3PMW A;  2I3W A;  1MS7 A;  3QAX A;  1YCJ A;  4KCD A;  1EZP A;  4OER A;  5CRY A;  4EUO A;  3MVW A;  4QHQ A;  3CSB A;  5DVF A;  3QUJ A;  3LSW A;  1YTV A;  4R75 A;  1XVX A;  2LAO A;  1FQF A;  3K6U A;  2F5X A;  2P0S A;  1SW2 A;  1NKX A;  1IEJ A;  1DOT A;  4YB6 A;  3S9N C;  1MY3 A;  2W7Y A;  2QL3 A;  2A5T B;  4R2F A;  1LFG A;  4H6D A;  2V84 A;  2XD2 A;  1SBP A;  4GL0 A;  4JSO A;  1TXF A;  3K6X A;  1GVC A;  3RT8 A;  1SW4 A;  1B0L A;  2O7U A;  4MLQ A;  4NF8 A;  3I6V A;  1Y9U A;  1ZJL A;  2ABH A;  3Q27 A;  2R71 A;  1A7L A;  2X7P A;  1VFD A;  1J1N A;  5TP9 B;  3N26 A;  4PFY A;  3HCQ A;  3MZB A;  4U22 A;  3O9P A;  3TTK A;  4MF3 A;  1ELJ A;  4QSC A;  3EHS A;  1HSE A;  3H6V A;  3PD8 A;  4R2B A;  1DSN A;  5H8N B;  2RF1 A;  5ICT A;  1QW0 A;  4G68 C;  4YIC A;  3TKD A;  2PT1 A;  4AB6 A;  2REJ A;  5KZT A;  2DXY A;  4NTL A;  4QFN A;  4MH5 A;  4ELQ A;  4C0R A;  4OET A;  1FTK A;  2UVG A;  1ZIU A;  2UVI A;  3JV9 A;  3N6U A;  1UTB A;  1PDA A;  4F3P A;  2HZL A;  3RGY A;  4E0X A;  5AE4 A;  1Y3N A;  1GR2 A;  3S9E A;  2RC9 A;  3FUZ A;  4GVO A;  1IXI A;  3EF7 A;  1M5F A;  2ALU A;  1B3L A;  3H6T A;  3LSX A;  1OVB A;  4QFO A;  1YPN A;  4U4X A;  2PMS A;  1MXZ A;  3H6U A;  3IO6 A;  1JET A;  1B3E A;  1UTB B;  1N76 A;  1MPB A;  1NNP A;  3ILT B;  1FW0 A;  4YKP A;  4R73 A;  5FTI A;  3FXQ A;  3G3I A;  4GD5 A;  4YKI A;  2AL4 A;  1D3K A;  1N7W A;  3O6H A;  3PPP A;  1I6B A;  5H8S A;  2HAV A;  2HAU A;  4JWY A;  2ZYK A;  4M4G A;  3QK6 A;  2ZNT A;  3FXU A;  1ZU0 A;  2PYY A;  2OWT A;  4FAJ A;  4NF4 A;  5ISU A;  1IIT A;  1B7Z A;  4DZ1 A;  1QKB A;  3CRB A;  4JBZ A;  4DIG A;  4IO2 A;  4G2Z A;  3N5L A;  5F1Q A;  4G8H A;  3S9L C;  3OSQ A;  4U21 A;  4OTE A;  2RCB A;  3ILU B;  3FZV A;  3RLF E;  4F31 B;  5I2N A;  3PPQ A;  5CMB A;  3CSG A;  4TLL B;  4FAT A;  5I56 A;  1QUK A;  3HST A;  5DTB A;  4OFO A;  2H98 A;  1MY1 A;  2ESN A;  1VSO A;  1QUL A;  3AXF A;  3U93 A;  2Y7P A;  3G3F A;  1FCK A;  1UIV A;  2UVJ A;  3SES A;  5H8Q B;  5BUU A;  4K3F A;  3HO7 A;  2E0S A;  4R9G A;  5CC2 A;  2FA7 A;  4YB7 A;  1H3D A;  1PBP A;  5IKB A;  3MW0 A;  4LZ8 A;  1UQW A;  3HN0 A;  1BLF A;  2DE4 A;  3LSF B;  3VLV A;  5L9S A;  4BLA A;  2XX9 A;  3Q25 A;  5JTY A;  4FOR A;  1L5T A;  1LCF A;  5JK4 A;  1EU8 A;  3P7I A;  3DP6 A;  4YAH X;  1XVY A;  1MPC A;  1DPE A;  4DE8 A;  1IXG A;  1M5D A;  3CFL A;  4JWX A;  3E3K A;  1O63 A;  4RA1 A;  4ZEI A;  5AA1 A;  5I2K B;  1LGB C;  4OFL A;  4WKM A;  2G29 A;  1Y3Q A;  3MZ9 A;  3ZS6 A;  1MH3 A;  1VFE A;  3VXC A;  2I48 A;  3SEX A;  3IB0 A;  3MPL A;  4I9D A;  3T96 B;  1O64 A;  2DVZ A;  1N7X A;  2HCA A;  3OO6 A;  3PUV E;  1BTJ A;  3PPR A;  1MXY A;  4HS7 A;  1FTM A;  3V8X B;  5L8D A;  1PC3 A;  3TAJ A;  5BWJ A;  5I57 A;  1R9Q A;  3VLU A;  2Z8E A;  5L9O A;  4QF9 A;  3PD9 A;  4RK2 A;  3VLW A;  2D5W A;  1RYX A;  4ECF A;  4LAT A;  4LZ7 A;  3PPN A;  4ZED A;  2Q89 A;  4R6K A;  3V5A A;  5LOM A;  4ZEB A;  2ZNS A;  4U1O A;  2DQV A;  5JEI A;  1H43 A;  1US4 A;  4RNS A;  3Q28 A;  1TFA A;  4F29 A;  2XX7 A;  1B32 A;  1B7H A;  1URS A;  2NXO A;  3B7D A;  3BFT A;  4PP0 A;  1B3F A;  3EHT A;  3OEL A;  4R6H A;  3TCH A;  3UGW A;  4DLD A;  3S2V A;  4G68 B;  2I0B A;  3K6W A;  1NNK A;  1ZLQ A;  4DXB A;  3E9X A;  2H4I A;  3GBB A;  4BDO A;  1OLC A;  2YPN A;  4ZS9 A;  5EYF A;  3DLN A;  3CG1 A;  4THI A;  1US5 A;  3PUW E;  3TCF A;  3FJG A;  5FHO A;  1DTG A;  2O1L A;  5HPQ A;  2F8D A;  1A54 A;  4L17 A;  2NUV A;  4R6Y A;  4OMB A;  4G4P A;  3G3J A;  3W9V A;  1QUJ A;  3TCG A;  3K01 A;  1MXV A;  1MPD A;  2F7C A;  2P1S A;  5CBR A;  5I59 B;  2IA4 A;  3HV1 A;  1EZO A;  4RYA A;  5KCJ B;  4F2Q A;  1B58 A;  3CVG A;  3T9H B;  3PMX A;  5KDT A;  5AA4 A;  2QJE A;  1SW1 A;  3IAZ A;  3T9X B;  2HZK A;  1SQY A;  1KWH A;  2AYS A;  2B3F A;  2XXY A;  1MQI A;  1OVT A;  2RCA A;  4NF5 A;  4PFT A;  3IOV A;  4MFI A;  3UOR A;  4NF8 B;  5KCJ A;  1XT8 A;  2FYI A;  1UIU A;  3FVK A;  4O3B A;  4FE8 A;  4H8I A;  4KYE A;  4X1B A;  4I8C A;  2G93 A;  4NF5 B;  2XXI A;  4QSD A;  4BDQ A;  2F7B A;  3K1M A;  3U8Q A;  2V3U A;  2H25 A;  3G3G A;  4F22 A;  3A09 A;  1LAG E;  2RC8 A;  2VGQ A;  1P1W A;  3S9M C;  1JVX A;  2Q2A A;  2QS1 A;  1USY E;  3B6T A;  2HEU A;  3B6W A;  2GH9 A;  3MZ1 A;  4GWO A;  2XHD A;  3IOR A;  1XC1 A;  2RIN A;  2Y84 A;  4FED A;  2Q2C A;  1QVS A;  1Y1Z A;  3IJO B;  2GRV A;  3MVY A;  4LP2 B;  4XIG Q;  3VDF A;  4TQU Q;  5CMC A;  4BDL A;  1PBQ A;  2IEE A;  2OCU A;  3ODB A;  5B7D A;  1LLS A;  2F34 A;  4EQ9 A;  4IO3 A;  3IB1 A;  4X9T A;  5DYH A;  3PGF A;  3TTN A;  2XXP A;  1P1O A;  1VR5 A;  1IIW A;  1B2H A;  1H76 A;  1B5H A;  2DE2 A;  1SDX A;  3H7M A;  3OXN A;  4N07 A;  3M3L A;  4HTG A;  3TTL A;  4FIM A;  2QMW A;  4EF2 A;  3E13 X;  1FTJ A;  2WKY A;  4MLV A;  3C32 A;  3VVE A;  3LR1 A;  5AA2 A;  3K00 A;  4H65 A;  4GOT A;  4R9F A;  4IO7 A;  3IL1 B;  1PEB A;  2V93 A;  1IQ7 A;  1ZKB A;  2H5Y A;  3UIF A;  1SD3 A;  2Z8D A;  4GF8 A;  1I69 A;  1D4N A;  2OWS A;  3F11 A;  3L6G A;  5TPA B;  3WAE A;  1F9B A;  2AIX A;  3LBS A;  2F6G A;  4OWD A;  2HQ0 A;  1JVY A;  2ZMB A;  4WEP A;  1FTO A;  3A3U A;  4FEB A;  3KGC A;  5EHM A;  1BKA A;  3ONM A;  4LON B;  1IZ1 A;  2DWI A;  1R9L A;  2O7I A;  2ZXT A;  4XKQ A;  3T93 B;  1M5C A;  1N3W A;  2NOO A;  5CM6 A;  2Y7R A;  1POY 1;  3BFU A;  3H6W A;  3KZG A;  3SEW A;  4ELR A;  1LFI A;  1B4Z A;  2XXT A;  4POX A;  4H5G A;  1JQF A;  4LQ2 A;  2GHA A;  4OXV A;  5M2V A;  1NNF A;  2V3Q A;  2Z8F A;  3TQW A;  1YAE A;  1MQD A;  2RC7 A;  3VXB A;  3GZG A;  3O29 A;  3CG3 A;  5CBS A;  4P0I A;  4LQ5 A;  4PFW A;  1ZMG A;  4OEV A;  3FAS A;  3TDJ A;  5JTY B;  1RYO A;  3VVD A;  1LAF E;  4G68 A;  1LBB A;  5I2N B;  2O6A A;  2PBW A;  2QS3 A;  1LBC A;  3FGS A;  3M8U A;  3L6H A;  2XXW A;  3O97 A;  4XKP A;  3OO9 A;  3K4U A;  4IY5 A;  4P0G A;  1FQD A;  2I58 A;  4QFL A;  3T66 A;  1PB9 A;  3KN7 A;  2QMX A;  4XKR A;  4Z7E A;  4I62 A;  3C4M A;  1WOD A;  2OK2 A;  3KSJ A;  3SER A;  3FAT A;  4AB5 A;  1LFH A;  4XKN A;  1AH5 A;  5DT6 A;  1P1N A;  2DWH A;  4NMY A;  3VFJ A;  3O6I A;  1PB7 A;  5CMM A;  4G8N A;  3VV5 A;  3OEM A;  1URD A;  3OO7 A;  4RJZ A;  5H8H A;  4JDF A;  1MM7 A;  5B70 A;  4OVJ A;  1S9T A;  3GBA A;  5FHN A;  1GV8 A;  3E4R A;  4U23 A;  5I59 A;  1M5E A;  1B51 A;  2VP1 A;  4QFP A;  3RNN A;  3O66 A;  3C35 A;  3CI8 A;  1LST A;  2F35 A;  1D9Y A;  1S50 A;  2I4B A;  3QYT A;  2Q9T A;  3KG2 A;  5DVJ A;  3A3C A;  3IK6 B;  3C33 A;  1MDQ A;  3W9W A;  2OZZ A;  4P11 A;  5CI5 A;  3TEL A;  4KYS A;  5H8N A;  1BIY A;  4NED A;  4BDR A;  2XXV A;  2XXR A;  3UA8 A;  3FV2 A;  4OFJ A;  1NNT A;  2F97 A;  1XOC A;  3MWB A;  3N6T A;  1NH8 A;  4IO4 A;  1POT A;  3LUY A;  4N13 A;  3D4G A;  2GHB A;  3OEN A;  3EN3 A;  4F39 A;  2ONK E;  3FIR A;  3H03 A;  4PQJ A;  4LZ5 A;  3IO4 A;  4FJP A;  1I6A A;  1PB8 A;  5TP9 A;  3DEL B;  3RN8 A;  5IAI A;  2X7Q A;  4H5F A;  1USY H;  4QRZ A;  2O69 A;  2F7A A;  2DWJ A;  2OJT A;  3JYR A;  4DDD A;  5J1D A;  1XS5 A;  1JNF A;  1Z7M E;  2AL5 A;  3K0V A;  4YU0 A;  5H8F A;  4OZ9 A;  2Q88 A;  1MY4 A;  3MP1 A;  4LUB A;  5AA2 D;  4UAC A;  1MY2 A;  1H45 A;  4F1V A;  3KOS A;  4IO6 A;  3G3H A;  4IO5 A;  4O3C A;  4RXL A;  5H8F B;  1HSJ A;  4ZZE A;  4ZE8 A;  1OQG A;  1Y4C A;  5AA2 B;  2I4C A;  1UTH A;  2ONS A;  3KSX A;  4KI0 E;  2UXA A;  4KYD A;  4XXU A;  4YB5 A;  1TT1 A;  3KFM A;  1JW4 A;  4POW A;  3IX1 A;  2VHA A;  1I6Q A;  4TOZ A;  3SDF A;  2R6G E;  1B40 A;  3C9H A;  3QSL A;  5K2Y A;  1VE4 A;  1SVX B;  1GTK A;  1UTH B;  1SYI A;  3K1P A;  4Q5T A;  3HPI A;  3JZJ A;  3THI A;  3SEU A;  3TTR A;  1ANF A;  1JW1 A;  3I5O A;  4DCX A;  3QIM A;  3K6V A;  4EQB A;  3MPK A;  3RQT A;  2E1S A;  2DWA A;  3T9U A;  1OIB A;  3O2A A;  3QXM A;  5CMK A;  1NMU A;  1XHY A;  1A40 A;  3PUX E;  2F36 A;  1HSL A;  4GRK A;  4RPN A;  4U1Z A;  5A5X A;  4EXK A;  3U94 A;  3PPO A;  1MM6 A;  1D9V A;  1M5B A;  2XXX A;  3PUY E;  4NWC A;  5HM4 B;  1H44 A;  3IOW A;  4YZZ A;  2D21 A;  3PUZ E;  5ELV A;  3CFZ A;  4ESX A;  1SI1 A;  3I3V A;  5A5X B;  3MBP A;  1B05 A;  3FJM A;  1IXC A;  1B5I A;  1JW5 A;  5AA3 A;  1MXW A;  3FVG A;  3MAM A;  4GXS B;  4F3S A;  4Z0I A;  4F1Y A;  4OHN A;  4NF6 B;  1TFD A;  2VD2 A;  3HHF A;  3FJ7 A;  5EHS A;  3EQ1 A;  4HW8 A;  4XTC Q;  1N3X A;  1JEU A;  2X26 A;  1AMF A;  4GQO A;  4KFQ A;  2CMO A;  3GLB A;  2DYX A;  4R74 A; 
#chains in the Genus database with same CATH topology
 2Y7K A;  4E0W A;  4AQ4 A;  4M1V A;  1DK4 A;  3EHU A;  3PMV A;  4GBV A;  4C1T A;  4GIZ A;  5EQ8 A;  4X1D A;  3PU5 A;  1B0H A;  4EXL A;  4LA9 A;  3ROJ A;  1FBF A;  3R7X A;  3QUF A;  1LB9 A;  3KC1 A;  4PET A;  3TEP A;  1FQE A;  3IOT A;  5I58 A;  3MJN A;  5IGA A;  2DS9 A;  4GBW A;  2KQZ A;  3B6Q A;  4OVQ A;  1AL3 A;  5EQ7 A;  1LAH E;  2YLN A;  1URG A;  4MIJ A;  3R6U A;  4G8M A;  4YKK A;  1AOV A;  1RDX A;  4KHZ E;  3V89 B;  4YMA A;  2DP8 A;  5J16 A;  2Z23 A;  5HBC A;  3IJX B;  2HFB A;  4IGR A;  1WDN A;  3SET A;  1B1X A;  3G3K A;  1B52 A;  3ISP A;  4NE4 A;  1B3H A;  4PTK A;  1JP4 A;  3ZKK A;  4ISU A;  4NF4 B;  3SEV A;  4N8Y A;  5I2K A;  1EH3 A;  3M3K A;  2P3V A;  2GFE A;  1Z7N E;  1QUI A;  3OD7 A;  4I40 A;  3KOT A;  2JJK A;  4ZZA A;  1FTA A;  4P8B A;  4F1U A;  1B9J A;  1Q1K A;  4JB7 A;  1OLA A;  2UYF A;  2VD3 A;  4TLM B;  2VOZ A;  3Q26 A;  4PFU A;  4RK9 A;  4G77 A;  1B1H A;  4WXJ A;  3KN3 A;  4PC9 A;  3KBR A;  1LEV A;  2QS4 A;  4AS4 A;  2DOJ A;  2I3W A;  4KCD A;  5CRY A;  4QHQ A;  4I3Y A;  1YTV A;  1DOT A;  1MY3 A;  4GL0 A;  2O7U A;  3I6V A;  2R71 A;  5TP9 B;  3H6V A;  1QW0 A;  4G68 C;  4AB6 A;  2REJ A;  4NTL A;  4QFN A;  1ZIU A;  3S9E A;  2RC9 A;  4PAK A;  2ALU A;  1B3L A;  4HE2 A;  2PMS A;  4HXV A;  3TDJ A;  4YKP A;  1B3E A;  1K9Z A;  1N76 A;  3VFJ A;  4GD5 A;  3TFL A;  1D3K A;  1N7W A;  4GWX A;  2ZNT A;  1ZU0 A;  1IIT A;  1B7Z A;  1QKB A;  4F31 B;  2H98 A;  2QVU A;  3AXF A;  3U93 A;  2Y7P A;  3G3F A;  1UIV A;  3SES A;  5CC2 A;  5IKB A;  3MW0 A;  1NUX A;  2XX9 A;  3PTY A;  5JK4 A;  1EU8 A;  3DP6 A;  1MPC A;  1DPE A;  1IXG A;  3CFL A;  4RA1 A;  5AA1 A;  3T66 A;  4WKM A;  5ET7 A;  1MH3 A;  3SEX A;  4I9D A;  3T96 B;  1O64 A;  2B4L A;  1R9Q A;  5L9O A;  3PD9 A;  1RYX A;  3PPN A;  1LBX A;  2ZNS A;  5JEI A;  3Q28 A;  3BFT A;  4DLD A;  3OEL A;  1FBC A;  2H4I A;  1OLC A;  4ZS9 A;  3CG1 A;  2XWV A;  3TCF A;  5FHO A;  1DTG A;  2F8D A;  4L17 A;  4OMB A;  3TCG A;  4N4U A;  1IMC A;  3HV1 A;  1EZO A;  5KCJ B;  3T9H B;  5KDT A;  5AA4 A;  1SQY A;  2XXY A;  4MFI A;  2FYI A;  1UIU A;  4KYE A;  4QSD A;  5IZ1 A;  1USY E;  3B6T A;  1Q9D A;  4LP2 B;  4XIG Q;  1LLS A;  4IO3 A;  4X9T A;  1P1O A;  1VR5 A;  1B2H A;  4N07 A;  4HTG A;  3C32 A;  3VVE A;  3LR1 A;  4H65 A;  1PEB A;  2V93 A;  3A29 A;  1ZKB A;  2H5Y A;  1I69 A;  5TPA B;  4N6D A;  2AIX A;  2Y5K A;  4GX6 A;  3LBS A;  1JVY A;  4WEP A;  3A3U A;  4UAB A;  4FEB A;  1FJ6 A;  4LON B;  2DWI A;  2O7I A;  2Y7R A;  1POY 1;  3H6W A;  3SEW A;  4ELR A;  4POX A;  3VXB A;  3O29 A;  2GQ1 A;  4OEV A;  1LBB A;  2O6A A;  3OO9 A;  4P0G A;  4QFL A;  2I58 A;  4I62 A;  2OK2 A;  1AH5 A;  5DT6 A;  3RPL B;  2FVZ A;  3VV5 A;  3OEM A;  1URD A;  1G0H A;  3OO7 A;  4JDF A;  3KBZ A;  5FHN A;  5I59 A;  4U23 A;  1M5E A;  1FPE A;  3LUZ A;  5EYG A;  1LST A;  2I4B A;  5DVJ A;  4P11 A;  5H8N A;  4OFJ A;  1XOC A;  3N6T A;  2WEF A;  3D4G A;  4PFI A;  2ONK E;  4P1E A;  1PB8 A;  3RN8 A;  1USY H;  4QRZ A;  3JYR A;  2F7A A;  4JVI A;  2Q88 A;  2WBD A;  1MY2 A;  4ZZE A;  1Y4C A;  5AA2 B;  3KSX A;  4KI0 E;  4XXU A;  3KFM A;  1JW4 A;  3IX1 A;  1I6Q A;  1NUW A;  2R6G E;  5I2N B;  5K2Y A;  1VE4 A;  3K1P A;  4N81 A;  3QMF A;  3THI A;  4DCX A;  3MPK A;  2E1S A;  4X04 A;  3O2A A;  3PUX E;  2F36 A;  4U1Z A;  3PUY E;  1H44 A;  3GYY A;  4GXS B;  4F1Y A;  3FJ7 A;  4XTC Q;  1N3X A;  2X26 A;  2DYX A;  2WYK A;  2R8T A;  1B7U A;  4OYV A;  3MP6 A;  3FD3 A;  3SEY A;  1MDP 1;  2O84 X;  3CIJ A;  4EQ7 A;  1FQA A;  1OMP A;  1Y1M A;  3R26 A;  4UA8 A;  3O6G A;  4ESW A;  3LC8 A;  4N6P A;  1NV4 A;  3TUS A;  1A99 A;  1YXI A;  1FBE A;  2ZNU A;  4F2O A;  4BDN A;  1FQC A;  4DI3 D;  3UK4 A;  1ZBM A;  3FVO A;  3ECR A;  4O3A A;  3RTF B;  3DP4 A;  3M3F A;  4IGT A;  2F6P A;  1IUD A;  5H8H B;  5DVI A;  2QS2 A;  3EPE A;  3H06 B;  3MQ9 A;  2BJI A;  1LBZ A;  1SYH A;  1T0K A;  3Q29 A;  4LVQ A;  1DTZ A;  1EZ9 A;  4MNI A;  4H67 A;  4IB2 A;  3B8B A;  3USD A;  3C31 A;  5FTH A;  1FPD A;  5L9M A;  2XXH A;  2V3T A;  1KA0 A;  2HXW A;  5I56 B;  2PT2 A;  4O7M A;  4RY1 A;  4ELO A;  1B3G A;  3KEI A;  2V25 A;  1Y4T A;  2CZK A;  2ZYM A;  2I6E A;  1LB8 A;  5ET5 A;  4OA4 A;  2H99 A;  2F78 A;  4MJO A;  2XWK A;  2QPQ A;  5ITO A;  1QJM A;  5TPA A;  3UN6 A;  2DVC A;  2FNC A;  1Q35 A;  3K1N A;  2PFY A;  3LSL A;  4KD5 A;  3MUQ A;  2XXQ A;  2RKM A;  2WYP A;  1OQH A;  2XD3 A;  4Q30 B;  3ZSF A;  4H0W A;  4EDP A;  1MRP A;  1FPF A;  4NF0 A;  1DPP A;  2Y7I A;  1FQB A;  2QVR A;  4ZDM A;  1YYZ A;  4RPO A;  3MYU A;  5ET6 A;  4Q0C A;  2FHY A;  1YCJ A;  3MVW A;  1NV5 A;  3QUJ A;  4H45 A;  3K6U A;  2F5X A;  1NKX A;  1IEJ A;  2W7Y A;  2QL3 A;  1LFG A;  4H6D A;  5CBR A;  2B4M A;  1SBP A;  4JSO A;  3K6X A;  3RT8 A;  1SW4 A;  1Y9U A;  2VT5 A;  3TTK A;  4MF3 A;  4QSC A;  4R2B A;  3PD8 A;  5H8N B;  5ICT A;  5IM2 A;  2DXY A;  1FTK A;  2UVI A;  3JV9 A;  3N6U A;  4F3P A;  2DDK A;  3RGY A;  4E0X A;  5FBP A;  5AE4 A;  4XEQ A;  4GWY A;  3FUZ A;  3E79 A;  3EF7 A;  3VLU A;  3LSX A;  4QFO A;  1OVB A;  1YPN A;  3H6U A;  3IO6 A;  1UTB B;  3ILT B;  3TTN A;  1FW0 A;  3FXQ A;  3G3I A;  4YKI A;  5H8S A;  3PPP A;  1I6B A;  4P9K A;  2ZYK A;  3QK6 A;  2PYY A;  4DI4 B;  4FAJ A;  1NUY A;  3OSQ A;  4OTE A;  2Q74 A;  3FZV A;  4AS5 A;  4H46 A;  3PPQ A;  4G61 A;  4FAT A;  1QUK A;  5DTB A;  2ESN A;  1VSO A;  3U65 A;  4JVD A;  2FA7 A;  4YB7 A;  1UQW A;  2DE4 A;  5L9S A;  5JTY A;  4FOR A;  1L5T A;  1LCF A;  1QGX A;  1XVY A;  3E3K A;  1O63 A;  4OFL A;  1Y3Q A;  3MZ9 A;  3ZS6 A;  1VFE A;  2PCR A;  2HCA A;  3PPR A;  4HS7 A;  5L8D A;  3TAJ A;  2Z8E A;  4O94 A;  2D5W A;  3V5A A;  2Y5L A;  5LOM A;  4ZEB A;  4U1O A;  2DQV A;  4NHB A;  4RNS A;  2XX7 A;  1B32 A;  2NXO A;  3TCH A;  4R6H A;  3GBB A;  4BDO A;  1US5 A;  3PUW E;  3CHG A;  4R6Y A;  5I59 B;  3MST A;  3CVG A;  2FIE A;  2QJE A;  4NF5 A;  1MQI A;  1OVT A;  2RCA A;  3IOV A;  3FVK A;  4H8I A;  2XXI A;  3U8Q A;  3K1M A;  2RC8 A;  2VGQ A;  1P1W A;  1FJ9 A;  1JVX A;  2Q2A A;  2QS1 A;  3MZ1 A;  3B6W A;  2GH9 A;  2XHD A;  3IOR A;  2Q2C A;  3VDF A;  4TQU Q;  1PBQ A;  2OCU A;  3ODB A;  5B7D A;  4EQ9 A;  2XXP A;  1H76 A;  3H7M A;  2QFL A;  2VPN A;  3M3L A;  2QMW A;  5AA2 A;  1FTJ A;  2WKY A;  4GOT A;  3IL1 B;  3F11 A;  3L6G A;  2OWS A;  5EQ9 A;  1F9B A;  5EQA A;  1BKA A;  3ONM A;  1IZ1 A;  4P56 A;  3T93 B;  2NOO A;  3KZG A;  4QBA A;  4H5G A;  1JQF A;  4LQ2 A;  4OXV A;  5M2V A;  1NNF A;  2V3Q A;  3GZG A;  5CBS A;  1LBY A;  4LQ5 A;  4P0I A;  2PBW A;  4XKP A;  4IY5 A;  2QMX A;  4GWU A;  4Z7E A;  1WOD A;  3KSJ A;  3SER A;  2DWH A;  4NMY A;  5A5L A;  3O6I A;  4G8N A;  3IFC A;  1GV8 A;  4QFP A;  3RNN A;  3O66 A;  1NUZ A;  2F35 A;  2Q9T A;  2XWI A;  2OZZ A;  5CI5 A;  3E78 A;  3TEL A;  2XXV A;  2XXR A;  2F97 A;  3MWB A;  1NH8 A;  2GHB A;  3FIR A;  4PQJ A;  4LZ5 A;  3IO4 A;  4FJP A;  4HE1 A;  3DEL B;  5IAI A;  1XS5 A;  2L5V A;  1Z7M E;  5H8F A;  4OZ9 A;  5LTC A;  3MP1 A;  5AA2 D;  1IMD A;  4IO6 A;  2HXR A;  4PFB A;  2UXA A;  4POW A;  3C9H A;  3QSL A;  4EUO A;  4Q5T A;  1SYI A;  3JZJ A;  1ANF A;  1JW1 A;  3I5O A;  3QIM A;  3T9U A;  1NMU A;  2XA5 A;  1HSL A;  4RPN A;  3PPO A;  1D9V A;  5HM4 B;  3PUZ E;  3CFZ A;  3I3V A;  4PGN A;  1B5I A;  1JW5 A;  5AA3 A;  3MAM A;  4Z0I A;  4OHN A;  2MKZ A;  3EQ1 A;  4GQO A;  1AMF A;  4R74 A;  1FTL A;  1CB6 A;  1ATG A;  3VVF A;  3KJT A;  3PV0 E;  1AWB A;  4F19 A;  3G7W A;  2ONR A;  2ZYO A;  1B6H A;  3MVX A;  1IMF A;  2THI A;  3H3G A;  1CE2 A;  4ND9 A;  4GFR A;  2I3V A;  1GGG A;  1NV3 A;  2O51 A;  4GXA A;  4GWS A;  1O7T A;  3RUM A;  5ITP A;  1TWY A;  4ZEK A;  4KQP A;  4OEN A;  2NVU B;  2UVH A;  2P2A A;  5I84 A;  3K2D A;  4F18 A;  3VE1 B;  4JXI A;  1P1U A;  1BP5 A;  1R1N A;  4MX6 A;  4NWD A;  3KN8 A;  2QSX A;  2R9J A;  1A55 A;  2OBG A;  2DSF A;  5DEX B;  1FSA A;  1B46 A;  3C34 A;  3IFA A;  5KDT B;  2YJP A;  1IXH A;  1N04 A;  2Z22 A;  5K2X A;  3B50 A;  3TPA A;  3BKI B;  2A5T A;  4QFK A;  4FEC A;  2KLF A;  4H1X A;  3H4Z A;  2Y7W A;  4ZEF A;  1Y3P A;  3RYD A;  1II5 A;  2UYE A;  3MC2 A;  3C36 A;  4JWO A;  5ICQ A;  4C1U A;  4X48 A;  4EF1 A;  2ANJ A;  3TOD A;  3RTW B;  2CEX A;  2M8C A;  4KPT A;  1WVJ A;  3OEK A;  4N8G A;  3T0J A;  1LCT A;  4BDM A;  1FPI A;  1IMA A;  3OO8 A;  4JSD A;  3U92 A;  4DXC A;  3U72 A;  2DE3 A;  4YKJ A;  4YMB A;  1P99 A;  2OLB A;  4PAF A;  3RY3 A;  4X8R A;  2O68 A;  5TU0 A;  4U2R A;  3D4C A;  4PE5 B;  2CZH A;  2B3B A;  3V83 A;  2VPO A;  1DMB A;  1P1Q A;  2PX1 A;  3S4U A;  2ZYN A;  4I3E A;  3FV1 A;  3T1B A;  4ELP A;  1NH7 A;  1MQJ A;  5I58 B;  3MP8 A;  4HE0 A;  4KXP A;  3IR1 A;  1AIV A;  4KCC A;  3OOA A;  2Q8J A;  4N6K A;  3ZKL A;  1MS7 A;  4OER A;  3CSB A;  4MCO A;  3LSW A;  4R75 A;  1XVX A;  1FQF A;  2P0S A;  4R2F A;  2V84 A;  4NF8 A;  4MLQ A;  1ZJL A;  3Q27 A;  1VFD A;  1J1N A;  3N26 A;  4PFY A;  3HCQ A;  3MZB A;  3O9P A;  1ELJ A;  3EHS A;  1HSE A;  3S9M C;  1DSN A;  2RF1 A;  4YIC A;  4NN3 A;  4ELQ A;  4MH5 A;  2UVG A;  4PF8 A;  1UTB A;  2HZL A;  4GVO A;  1IXI A;  4NG7 A;  4U4X A;  5DVF A;  1JET A;  3WAE A;  5FTI A;  4R73 A;  3HFU A;  1KA1 A;  4JWY A;  4M4G A;  3FXU A;  1LBV A;  2OWT A;  5LDZ A;  4NF4 A;  4DIG A;  4G2Z A;  3N5L A;  5F1Q A;  4G8H A;  4U21 A;  3RLF E;  5I2N A;  1LBW A;  5CMB A;  4TLL B;  5I56 A;  3HST A;  4OFO A;  1MY1 A;  1FCK A;  5H8Q B;  5IZ3 A;  4K3F A;  3HO7 A;  2E0S A;  4R9G A;  1H3D A;  2QVV A;  3FBP A;  4GWW A;  4LZ8 A;  3VLV A;  4BLA A;  3Q25 A;  2WX9 A;  4YAH X;  4OVT A;  5F24 A;  1M5D A;  3SZP A;  5I2K B;  2CZI A;  2G29 A;  3VXC A;  3MPL A;  3OO6 A;  2ZZX A;  3PUV E;  1BTJ A;  1FTM A;  1PC3 A;  5I57 A;  2CEY A;  4RK2 A;  3VLW A;  4ZED A;  4R6K A;  1FPJ A;  1US4 A;  1B7H A;  1URS A;  3UGW A;  4PP0 A;  3V8X B;  4PBH A;  3S2V A;  4MNP A;  2I0B A;  1NNK A;  1ZLQ A;  2YPN A;  4OVR A;  5HPQ A;  2NUV A;  5I5P A;  4G4P A;  1QUJ A;  3K01 A;  1MPD A;  2F7C A;  4RYA A;  4F2Q A;  1B58 A;  3PMX A;  2B3F A;  4PFT A;  1XT8 A;  4O3B A;  4FE8 A;  4X1B A;  4NF5 B;  5EYH A;  1LAG E;  4PAI A;  1FPK A;  2HEU A;  4FED A;  1XC1 A;  2RIN A;  2Y84 A;  3MVY A;  2GRV A;  1VDW A;  1KZ8 A;  5CMC A;  2IEE A;  2F34 A;  3PGF A;  4GX3 A;  1IIW A;  2ZZW A;  2DE2 A;  3OXN A;  5ISU A;  4XFE A;  1SPI A;  4MLV A;  2PFZ A;  4R9F A;  1IQ7 A;  2Z8D A;  1D4N A;  4PGP A;  2HQ0 A;  3KGC A;  2ZXT A;  4XKQ A;  1M5C A;  1N3W A;  5CM6 A;  2HPG A;  2XXT A;  2GHA A;  1YAE A;  1MQD A;  3CG3 A;  1ZMG A;  5JTY B;  3VVD A;  4G68 A;  3M8U A;  1LBC A;  5IZZ A;  2XXW A;  3K4U A;  1FQD A;  1PB9 A;  1P1N A;  2V4C A;  5B70 A;  4OVJ A;  1FBP A;  4NAP A;  1RDZ A;  1D9Y A;  1S50 A;  3QYT A;  3KG2 A;  1IME A;  4JVC A;  4P47 A;  3IK6 B;  1MDQ A;  1BIY A;  4BDR A;  3FV2 A;  1NNT A;  3FXB A;  5ET8 A;  3OEN A;  4F39 A;  3EN3 A;  1INP A;  3H03 A;  1I6A A;  5TP9 A;  1FBD A;  4QXD A;  2DWJ A;  4DDD A;  1JNF A;  2AL5 A;  4NQ8 A;  4NX1 A;  4UAC A;  4F1V A;  3LV0 A;  4RXL A;  3G3H A;  4O3C A;  1HSJ A;  1OQG A;  2I4C A;  1UTH A;  2ONS A;  4MHF A;  1TT1 A;  4TOZ A;  3SDF A;  1EYI A;  1B40 A;  1UTH B;  1K9Y A;  3TTR A;  3HPI A;  3KC0 A;  3K6V A;  5CMK A;  2DWA A;  1A40 A;  3D1R A;  5DW8 A;  4EXK A;  1MM6 A;  3IOW A;  2D21 A;  4PE3 A;  5ELV A;  1B05 A;  3FJM A;  5EHS A;  4HW8 A;  3HHF A;  1JEU A;  3GLB A;  3TQL A;  4HCY A;  4WED A;  4Q8R A;  3IB2 A;  1FPL A;  5FHM A;  3WAF A;  2REG A;  1N84 A;  2D3I A;  1QKA A;  1SW5 A;  4OVS A;  2OX3 A;  1N0T A;  4MMP A;  3TMG A;  1MXU A;  1EYJ A;  2FIX A;  3TYH A;  3TTM A;  5I57 B;  4ZEC A;  1NV0 A;  2WBB A;  4GWZ A;  4PCD A;  2Q8M A;  3BIH A;  3N94 A;  3FXR A;  4HCW A;  3KJ7 A;  2XXU A;  4F3B A;  3UP9 A;  5DEX A;  3RPL A;  1MY0 A;  2NWJ A;  4OQO A;  4PBQ A;  2O1M A;  4GLI A;  1NV1 A;  3CR9 A;  3BBR A;  1JEV A;  1LAX A;  1B4H A;  4OES A;  2I0C A;  5AA4 B;  4OAN A;  1B5J A;  3T9V A;  1NFT A;  4KR5 A;  4H8J A;  3IOU A;  3K02 A;  2XX8 A;  1A8E A;  2PVU A;  4FBP A;  4DXU A;  4ZE9 A;  4U4S A;  5F7V A;  2I49 A;  2DXR A;  4DCY A;  3OSR A;  1FBH A;  5I3S A;  1MXX A;  1MQG A;  4I1D A;  4GL8 A;  3CFX A;  2QRY A;  4F3G A;  4ONY A;  1A8F A;  2CZL A;  2HHM A;  3MVZ A;  3SKP A;  1MH4 A;  4IY6 A;  1NL5 A;  2BJJ X;  1S7Y A;  2B65 A;  5T3J A;  4PF6 A;  3DM0 A;  1R6Z A;  1MQH A;  4R72 A;  5H8Q A;  5IZ3 B;  3T22 A;  4MBP A;  1ZTY A;  3RT6 B;  2H9B A;  3GXA A;  1Y20 A;  1RKM A;  5ESY A;  4NF6 A;  3TZA A;  4OEU A;  4QSE A;  3OMB A;  4P3L A;  3HHG A;  3U1O A;  3O28 A;  2A5S A;  3W15 C;  3DP8 A;  3RPW A;  4N17 A;  3FVN A;  1MG1 A;  1SI0 A;  4MAG A;  3PMW A;  3QAX A;  1EZP A;  2LAO A;  1SW2 A;  4YB6 A;  3S9N C;  2A5T B;  4YB5 A;  2XD2 A;  1TXF A;  1GVC A;  1B0L A;  4PDH A;  2ABH A;  1A7L A;  2X7P A;  1XI6 A;  4U22 A;  1G0I A;  2PT1 A;  5KZT A;  4OET A;  4GX4 A;  1PDA A;  1Y3N A;  1GR2 A;  1FRP A;  3H6T A;  1M5F A;  1MXZ A;  3TKD A;  1MPB A;  1NNP A;  4N15 A;  2AL4 A;  3O6H A;  2HAV A;  2HAU A;  4DZ1 A;  3CRB A;  4JBZ A;  4IO2 A;  2KR0 A;  3S9L C;  1CNQ A;  2RCB A;  3ILU B;  3CSG A;  1QUL A;  1YZ0 A;  2UVJ A;  5BUU A;  1PBP A;  3HN0 A;  1BLF A;  3LSF B;  3P7I A;  4DE8 A;  4JWX A;  4ZEI A;  1LGB C;  2I48 A;  3IB0 A;  2DVZ A;  1N7X A;  1MXY A;  5BWJ A;  4QF9 A;  4ECF A;  4LAT A;  4LZ7 A;  2Q89 A;  1H43 A;  1TFA A;  4F29 A;  4PFR A;  3B7D A;  1B3F A;  3EHT A;  4G68 B;  4DXB A;  3K6W A;  3E9X A;  5EYF A;  3DLN A;  4THI A;  1FPB A;  3FJG A;  2O1L A;  1A54 A;  3G3J A;  3W9V A;  1RDY A;  1MXV A;  3BIG A;  2P1S A;  2IA4 A;  2FBP A;  1SW1 A;  3IAZ A;  3T9X B;  2HZK A;  1KWH A;  2AYS A;  3UOR A;  5KCJ A;  4NF8 B;  4O8M A;  1EYK A;  4I8C A;  2G93 A;  4BDQ A;  2F7B A;  2V3U A;  2H25 A;  3G3G A;  4F22 A;  3A09 A;  2F3D A;  4NGU A;  4GWO A;  1QVS A;  1Y1Z A;  2F3B A;  3IJO B;  3IB1 A;  5DYH A;  1B5H A;  3TTL A;  1SDX A;  4FIM A;  4EF2 A;  3E13 X;  3K00 A;  4IO7 A;  3UIF A;  1SD3 A;  4GF8 A;  4O7I A;  2F6G A;  4OWD A;  2ZMB A;  1FTO A;  5EHM A;  1IMB A;  1R9L A;  4OVP A;  3BFU A;  1LFI A;  1B4Z A;  4MEV A;  2Z8F A;  2XXK A;  3TQW A;  2RC7 A;  1NV6 A;  4PFW A;  3FAS A;  1RYO A;  1LAF E;  2QS3 A;  3FGS A;  4XF5 A;  3L6H A;  3O97 A;  3KN7 A;  4XKR A;  3C4M A;  2P3N A;  3FAT A;  4AB5 A;  1LFH A;  4XKN A;  1NV2 A;  1NI9 A;  1PB7 A;  5CMM A;  4BDL A;  5H8H A;  1BK4 A;  4RJZ A;  1MM7 A;  1S9T A;  3GBA A;  3E4R A;  2VP1 A;  1B51 A;  4PDD A;  2XWO A;  3C35 A;  3CI8 A;  3A3C A;  5I7I A;  3C33 A;  3W9W A;  4KYS A;  4NED A;  4P1L A;  3UA8 A;  4IO4 A;  1POT A;  3LUY A;  4N13 A;  4LN5 A;  2OWZ A;  2X7Q A;  4H5F A;  2ZZV A;  1FBG A;  2O69 A;  5J1D A;  2OJT A;  4IR8 A;  3K0V A;  4YU0 A;  1MY4 A;  4LUB A;  1H45 A;  3KOS A;  4IO5 A;  5H8F B;  4ZE8 A;  4KYD A;  2VHA A;  1FPG A;  4C0R A;  1SVX B;  1GTK A;  1DBZ A;  3SEU A;  4EQB A;  3RQT A;  1OIB A;  4MNC A;  3QXM A;  1XHY A;  4GRK A;  5A5X A;  3U94 A;  1M5B A;  2XXX A;  4NWC A;  4YZZ A;  1NV7 A;  3NOH A;  4ESX A;  1SI1 A;  5A5X B;  4N91 A;  3MBP A;  1IXC A;  1MXW A;  3FVG A;  4F3S A;  4NF6 B;  1TFD A;  2VD2 A;  1D9Q A;  3EKI A;  4KFQ A;  1DCU A;  2CMO A; 
#chains in the Genus database with same CATH homology
 1FTL A;  1CB6 A;  1ATG A;  3TQL A;  3VVF A;  4HCY A;  1B7U A;  3KJT A;  4OYV A;  3MP6 A;  3FD3 A;  4WED A;  2Y7K A;  3PV0 E;  3SEY A;  1MDP 1;  4E0W A;  3IB2 A;  3G7W A;  2O84 X;  2ONR A;  4AQ4 A;  4F19 A;  4Q8R A;  4M1V A;  2ZYO A;  5FHM A;  3WAF A;  2REG A;  3ZSF A;  3CIJ A;  1N84 A;  2D3I A;  1B6H A;  1QKA A;  1SW5 A;  3EHU A;  1FQA A;  3MVX A;  4EQ7 A;  2THI A;  3PMV A;  4C1T A;  1OMP A;  3H3G A;  1CE2 A;  1Y1M A;  4GIZ A;  4ND9 A;  4X1D A;  1N0T A;  3TMG A;  4GFR A;  2I3V A;  1MXU A;  1GGG A;  3R26 A;  3PU5 A;  4UA8 A;  1B0H A;  3TTM A;  2O51 A;  3O6G A;  3TYH A;  4GXA A;  4LA9 A;  4EXL A;  1O7T A;  4ESW A;  4ZEC A;  5I57 B;  3RUM A;  3R7X A;  5ITP A;  3QUF A;  1TWY A;  4ZEK A;  3LC8 A;  4N6P A;  1LB9 A;  4KQP A;  4OEN A;  1A99 A;  3TUS A;  4PET A;  3TEP A;  2NVU B;  2UVH A;  2P2A A;  2ZNU A;  3FXR A;  3K2D A;  3N94 A;  5I84 A;  4HCW A;  3KJ7 A;  4F2O A;  4F18 A;  3VE1 B;  4BDN A;  1FQC A;  1FQE A;  3IOT A;  4JXI A;  2XXU A;  4F3B A;  3UK4 A;  1P1U A;  5I58 A;  1ZBM A;  3MJN A;  5DEX A;  1BP5 A;  3FVO A;  3UP9 A;  2DS9 A;  1R1N A;  3ECR A;  4O3A A;  4NWD A;  3RTF B;  3DP4 A;  2QSX A;  3KN8 A;  2R9J A;  1A55 A;  1MY0 A;  2OBG A;  3M3F A;  4IGT A;  2NWJ A;  2DSF A;  3B6Q A;  2F6P A;  5DEX B;  1IUD A;  1B46 A;  4OQO A;  5DVI A;  2QS2 A;  3C34 A;  3EPE A;  3H06 B;  5H8H B;  5KDT B;  2YJP A;  1IXH A;  1N04 A;  2O1M A;  2Z22 A;  1AL3 A;  5K2X A;  1LAH E;  2YLN A;  1URG A;  3MQ9 A;  4GLI A;  3TPA A;  3BKI B;  1SYH A;  3CR9 A;  3BBR A;  1T0K A;  3Q29 A;  4LVQ A;  1DTZ A;  1EZ9 A;  2A5T A;  1JEV A;  1LAX A;  1B4H A;  4H67 A;  4IB2 A;  3R6U A;  4QFK A;  4FEC A;  3USD A;  2KLF A;  3C31 A;  4OES A;  4G8M A;  5FTH A;  2I0C A;  4YKK A;  4H1X A;  5AA4 B;  5L9M A;  1AOV A;  3H4Z A;  1B5J A;  3T9V A;  1NFT A;  4KR5 A;  2XXH A;  2V3T A;  4H8J A;  2Y7W A;  3IOU A;  1Y3P A;  4ZEF A;  3K02 A;  4KHZ E;  2XX8 A;  1II5 A;  2HXW A;  3V89 B;  1A8E A;  2UYE A;  4YMA A;  2DP8 A;  2PT2 A;  5I56 B;  3MC2 A;  3C36 A;  2Z23 A;  2PVU A;  4JWO A;  5ICQ A;  5HBC A;  4C1U A;  4DXU A;  4RY1 A;  4ZE9 A;  4X48 A;  4EF1 A;  3IJX B;  2HFB A;  4IGR A;  1B3G A;  2ANJ A;  3TOD A;  4ELO A;  3KEI A;  3RTW B;  1WDN A;  3SET A;  4U4S A;  5F7V A;  1B1X A;  3G3K A;  1B52 A;  4NE4 A;  2I49 A;  1B3H A;  2M8C A;  2V25 A;  4KPT A;  1Y4T A;  1WVJ A;  3OEK A;  2DXR A;  2ZYM A;  2I6E A;  1LB8 A;  1LCT A;  4BDM A;  4DCY A;  3OSR A;  2H99 A;  1MXX A;  1MQG A;  4I1D A;  3ZKK A;  4GL8 A;  3CFX A;  4ISU A;  4NF4 B;  3OO8 A;  2QRY A;  3SEV A;  4F3G A;  4ONY A;  5I2K A;  1A8F A;  2CZL A;  3MVZ A;  2F78 A;  4JSD A;  3SKP A;  3U92 A;  1EH3 A;  3U72 A;  2DE3 A;  4YKJ A;  4DXC A;  1MH4 A;  4IY6 A;  1NL5 A;  2BJJ X;  3M3K A;  2GFE A;  1P99 A;  1QJM A;  2QPQ A;  5ITO A;  4YMB A;  5TPA A;  1S7Y A;  3UN6 A;  2B65 A;  2DVC A;  2FNC A;  2OLB A;  1Z7N E;  3RY3 A;  2O68 A;  1Q35 A;  3K1N A;  1QUI A;  3OD7 A;  3DM0 A;  3LSL A;  3KOT A;  1R6Z A;  4KD5 A;  5TU0 A;  4ZZA A;  1MQH A;  3MUQ A;  2XXQ A;  2RKM A;  4R72 A;  4U2R A;  5H8Q A;  3D4C A;  1B9J A;  4PE5 B;  4F1U A;  1OQH A;  1Q1K A;  2B3B A;  2XD3 A;  4H0W A;  4Q30 B;  4MBP A;  1ZTY A;  4JB7 A;  3T22 A;  3V83 A;  1OLA A;  4EDP A;  1MRP A;  3RT6 B;  2H9B A;  2UYF A;  3GXA A;  2VD3 A;  1Y20 A;  1RKM A;  4TLM B;  2VOZ A;  1DPP A;  2Y7I A;  4NF6 A;  3TZA A;  1DMB A;  1FQB A;  1P1Q A;  3Q26 A;  4OEU A;  4ZDM A;  2PX1 A;  3S4U A;  2ZYN A;  4PFU A;  4QSE A;  3OMB A;  4RK9 A;  3FV1 A;  4G77 A;  4ELP A;  4RPO A;  1B1H A;  1NH7 A;  1MQJ A;  3HHG A;  3MP8 A;  3O28 A;  3U1O A;  4Q0C A;  5I58 B;  2A5S A;  3W15 C;  3DP8 A;  4WXJ A;  3KN3 A;  3IR1 A;  3KBR A;  3RPW A;  1AIV A;  2QS4 A;  3FVN A;  1MG1 A;  4KCC A;  3OOA A;  1SI0 A;  2Q8J A;  3ZKL A;  3TFL A;  2DOJ A;  3PMW A;  2I3W A;  1MS7 A;  3QAX A;  1YCJ A;  4KCD A;  1EZP A;  4OER A;  5CRY A;  4EUO A;  3MVW A;  4QHQ A;  3CSB A;  5DVF A;  3QUJ A;  3LSW A;  1YTV A;  4R75 A;  1XVX A;  2LAO A;  1FQF A;  3K6U A;  2F5X A;  2P0S A;  1SW2 A;  1NKX A;  1IEJ A;  1DOT A;  4YB6 A;  3S9N C;  1MY3 A;  2W7Y A;  2QL3 A;  2A5T B;  4R2F A;  1LFG A;  4H6D A;  2V84 A;  2XD2 A;  1SBP A;  4GL0 A;  4JSO A;  1TXF A;  3K6X A;  1GVC A;  3RT8 A;  1SW4 A;  1B0L A;  2O7U A;  4MLQ A;  4NF8 A;  3I6V A;  1Y9U A;  1ZJL A;  2ABH A;  3Q27 A;  2R71 A;  1A7L A;  2X7P A;  1VFD A;  1J1N A;  5TP9 B;  3N26 A;  4PFY A;  3HCQ A;  3MZB A;  4U22 A;  3O9P A;  3TTK A;  4MF3 A;  1ELJ A;  4QSC A;  3EHS A;  1HSE A;  3H6V A;  3PD8 A;  4R2B A;  1DSN A;  5H8N B;  2RF1 A;  5ICT A;  1QW0 A;  4G68 C;  4YIC A;  3TKD A;  2PT1 A;  4AB6 A;  2REJ A;  5KZT A;  2DXY A;  4NTL A;  4QFN A;  4MH5 A;  4ELQ A;  4C0R A;  4OET A;  1FTK A;  2UVG A;  1ZIU A;  2UVI A;  3JV9 A;  3N6U A;  1UTB A;  1PDA A;  4F3P A;  2HZL A;  3RGY A;  4E0X A;  5AE4 A;  1Y3N A;  1GR2 A;  3S9E A;  2RC9 A;  3FUZ A;  4GVO A;  1IXI A;  3EF7 A;  1M5F A;  2ALU A;  1B3L A;  3H6T A;  3LSX A;  1OVB A;  4QFO A;  1YPN A;  4U4X A;  2PMS A;  1MXZ A;  3H6U A;  3IO6 A;  1JET A;  1B3E A;  1UTB B;  1N76 A;  1MPB A;  1NNP A;  3ILT B;  1FW0 A;  4YKP A;  4R73 A;  5FTI A;  3FXQ A;  3G3I A;  4GD5 A;  4YKI A;  2AL4 A;  1D3K A;  1N7W A;  3O6H A;  3PPP A;  1I6B A;  5H8S A;  2HAV A;  2HAU A;  4JWY A;  2ZYK A;  4M4G A;  3QK6 A;  2ZNT A;  3FXU A;  1ZU0 A;  2PYY A;  2OWT A;  4FAJ A;  4NF4 A;  5ISU A;  1IIT A;  1B7Z A;  4DZ1 A;  1QKB A;  3CRB A;  4JBZ A;  4DIG A;  4IO2 A;  4G2Z A;  3N5L A;  5F1Q A;  4G8H A;  3S9L C;  3OSQ A;  4U21 A;  4OTE A;  2RCB A;  3ILU B;  3FZV A;  3RLF E;  4F31 B;  5I2N A;  3PPQ A;  5CMB A;  3CSG A;  4TLL B;  4FAT A;  5I56 A;  1QUK A;  3HST A;  5DTB A;  4OFO A;  2H98 A;  1MY1 A;  2ESN A;  1VSO A;  1QUL A;  3AXF A;  3U93 A;  2Y7P A;  3G3F A;  1FCK A;  1UIV A;  2UVJ A;  3SES A;  5H8Q B;  5BUU A;  4K3F A;  3HO7 A;  2E0S A;  4R9G A;  5CC2 A;  2FA7 A;  4YB7 A;  1H3D A;  1PBP A;  5IKB A;  3MW0 A;  4LZ8 A;  1UQW A;  3HN0 A;  1BLF A;  2DE4 A;  3LSF B;  3VLV A;  5L9S A;  4BLA A;  2XX9 A;  3Q25 A;  5JTY A;  4FOR A;  1L5T A;  1LCF A;  5JK4 A;  1EU8 A;  3P7I A;  3DP6 A;  4YAH X;  1XVY A;  1MPC A;  1DPE A;  4DE8 A;  1IXG A;  1M5D A;  3CFL A;  4JWX A;  3E3K A;  1O63 A;  4RA1 A;  4ZEI A;  5AA1 A;  5I2K B;  1LGB C;  4OFL A;  4WKM A;  2G29 A;  1Y3Q A;  3MZ9 A;  3ZS6 A;  1MH3 A;  1VFE A;  3VXC A;  2I48 A;  3SEX A;  3IB0 A;  3MPL A;  4I9D A;  3T96 B;  1O64 A;  2DVZ A;  1N7X A;  2HCA A;  3OO6 A;  3PUV E;  1BTJ A;  3PPR A;  1MXY A;  4HS7 A;  1FTM A;  3V8X B;  5L8D A;  1PC3 A;  3TAJ A;  5BWJ A;  5I57 A;  1R9Q A;  3VLU A;  2Z8E A;  5L9O A;  4QF9 A;  3PD9 A;  4RK2 A;  3VLW A;  2D5W A;  1RYX A;  4ECF A;  4LAT A;  4LZ7 A;  3PPN A;  4ZED A;  2Q89 A;  4R6K A;  3V5A A;  5LOM A;  4ZEB A;  2ZNS A;  4U1O A;  2DQV A;  5JEI A;  1H43 A;  1US4 A;  4RNS A;  3Q28 A;  1TFA A;  4F29 A;  2XX7 A;  1B32 A;  1B7H A;  1URS A;  2NXO A;  3B7D A;  3BFT A;  4PP0 A;  1B3F A;  3EHT A;  3OEL A;  4R6H A;  3TCH A;  3UGW A;  4DLD A;  3S2V A;  4G68 B;  2I0B A;  3K6W A;  1NNK A;  1ZLQ A;  4DXB A;  3E9X A;  2H4I A;  3GBB A;  4BDO A;  1OLC A;  2YPN A;  4ZS9 A;  5EYF A;  3DLN A;  3CG1 A;  4THI A;  1US5 A;  3PUW E;  3TCF A;  3FJG A;  5FHO A;  1DTG A;  2O1L A;  5HPQ A;  2F8D A;  1A54 A;  4L17 A;  2NUV A;  4R6Y A;  4OMB A;  4G4P A;  3G3J A;  3W9V A;  1QUJ A;  3TCG A;  3K01 A;  1MXV A;  1MPD A;  2F7C A;  2P1S A;  5CBR A;  5I59 B;  2IA4 A;  3HV1 A;  1EZO A;  4RYA A;  5KCJ B;  4F2Q A;  1B58 A;  3CVG A;  3T9H B;  3PMX A;  5KDT A;  5AA4 A;  2QJE A;  1SW1 A;  3IAZ A;  3T9X B;  2HZK A;  1SQY A;  1KWH A;  2AYS A;  2B3F A;  2XXY A;  1MQI A;  1OVT A;  2RCA A;  4NF5 A;  4PFT A;  3IOV A;  4MFI A;  3UOR A;  4NF8 B;  5KCJ A;  1XT8 A;  2FYI A;  1UIU A;  3FVK A;  4O3B A;  4FE8 A;  4H8I A;  4KYE A;  4X1B A;  4I8C A;  2G93 A;  4NF5 B;  2XXI A;  4QSD A;  4BDQ A;  2F7B A;  3K1M A;  3U8Q A;  2V3U A;  2H25 A;  3G3G A;  4F22 A;  3A09 A;  1LAG E;  2RC8 A;  2VGQ A;  1P1W A;  3S9M C;  1JVX A;  2Q2A A;  2QS1 A;  1USY E;  3B6T A;  2HEU A;  3B6W A;  2GH9 A;  3MZ1 A;  4GWO A;  2XHD A;  3IOR A;  1XC1 A;  2RIN A;  2Y84 A;  4FED A;  2Q2C A;  1QVS A;  1Y1Z A;  3IJO B;  2GRV A;  3MVY A;  4LP2 B;  4XIG Q;  3VDF A;  4TQU Q;  5CMC A;  4BDL A;  1PBQ A;  2IEE A;  2OCU A;  3ODB A;  5B7D A;  1LLS A;  2F34 A;  4EQ9 A;  4IO3 A;  3IB1 A;  4X9T A;  5DYH A;  3PGF A;  3TTN A;  2XXP A;  1P1O A;  1VR5 A;  1IIW A;  1B2H A;  1H76 A;  1B5H A;  2DE2 A;  1SDX A;  3H7M A;  3OXN A;  4N07 A;  3M3L A;  4HTG A;  3TTL A;  4FIM A;  2QMW A;  4EF2 A;  3E13 X;  1FTJ A;  2WKY A;  4MLV A;  3C32 A;  3VVE A;  3LR1 A;  5AA2 A;  3K00 A;  4H65 A;  4GOT A;  4R9F A;  4IO7 A;  3IL1 B;  1PEB A;  2V93 A;  1IQ7 A;  1ZKB A;  2H5Y A;  3UIF A;  1SD3 A;  2Z8D A;  4GF8 A;  1I69 A;  1D4N A;  2OWS A;  3F11 A;  3L6G A;  5TPA B;  3WAE A;  1F9B A;  2AIX A;  3LBS A;  2F6G A;  4OWD A;  2HQ0 A;  1JVY A;  2ZMB A;  4WEP A;  1FTO A;  3A3U A;  4FEB A;  3KGC A;  5EHM A;  1BKA A;  3ONM A;  4LON B;  1IZ1 A;  2DWI A;  1R9L A;  2O7I A;  2ZXT A;  4XKQ A;  3T93 B;  1M5C A;  1N3W A;  2NOO A;  5CM6 A;  2Y7R A;  1POY 1;  3BFU A;  3H6W A;  3KZG A;  3SEW A;  4ELR A;  1LFI A;  1B4Z A;  2XXT A;  4POX A;  4H5G A;  1JQF A;  4LQ2 A;  2GHA A;  4OXV A;  5M2V A;  1NNF A;  2V3Q A;  2Z8F A;  3TQW A;  1YAE A;  1MQD A;  2RC7 A;  3VXB A;  3GZG A;  3O29 A;  3CG3 A;  5CBS A;  4P0I A;  4LQ5 A;  4PFW A;  1ZMG A;  4OEV A;  3FAS A;  3TDJ A;  5JTY B;  1RYO A;  3VVD A;  1LAF E;  4G68 A;  1LBB A;  5I2N B;  2O6A A;  2PBW A;  2QS3 A;  1LBC A;  3FGS A;  3M8U A;  3L6H A;  2XXW A;  3O97 A;  4XKP A;  3OO9 A;  3K4U A;  4IY5 A;  4P0G A;  1FQD A;  2I58 A;  4QFL A;  3T66 A;  1PB9 A;  3KN7 A;  2QMX A;  4XKR A;  4Z7E A;  4I62 A;  3C4M A;  1WOD A;  2OK2 A;  3KSJ A;  3SER A;  3FAT A;  4AB5 A;  1LFH A;  4XKN A;  1AH5 A;  5DT6 A;  1P1N A;  2DWH A;  4NMY A;  3VFJ A;  3O6I A;  1PB7 A;  5CMM A;  4G8N A;  3VV5 A;  3OEM A;  1URD A;  3OO7 A;  4RJZ A;  5H8H A;  4JDF A;  1MM7 A;  5B70 A;  4OVJ A;  1S9T A;  3GBA A;  5FHN A;  1GV8 A;  3E4R A;  4U23 A;  5I59 A;  1M5E A;  1B51 A;  2VP1 A;  4QFP A;  3RNN A;  3O66 A;  3C35 A;  3CI8 A;  1LST A;  2F35 A;  1D9Y A;  1S50 A;  2I4B A;  3QYT A;  2Q9T A;  3KG2 A;  5DVJ A;  3A3C A;  3IK6 B;  3C33 A;  1MDQ A;  3W9W A;  2OZZ A;  4P11 A;  5CI5 A;  3TEL A;  4KYS A;  5H8N A;  1BIY A;  4NED A;  4BDR A;  2XXV A;  2XXR A;  3UA8 A;  3FV2 A;  4OFJ A;  1NNT A;  2F97 A;  1XOC A;  3MWB A;  3N6T A;  1NH8 A;  4IO4 A;  1POT A;  3LUY A;  4N13 A;  3D4G A;  2GHB A;  3OEN A;  3EN3 A;  4F39 A;  2ONK E;  3FIR A;  3H03 A;  4PQJ A;  4LZ5 A;  3IO4 A;  4FJP A;  1I6A A;  1PB8 A;  5TP9 A;  3DEL B;  3RN8 A;  5IAI A;  2X7Q A;  4H5F A;  1USY H;  4QRZ A;  2O69 A;  2F7A A;  2DWJ A;  2OJT A;  3JYR A;  4DDD A;  5J1D A;  1XS5 A;  1JNF A;  1Z7M E;  2AL5 A;  3K0V A;  4YU0 A;  5H8F A;  4OZ9 A;  2Q88 A;  1MY4 A;  3MP1 A;  4LUB A;  5AA2 D;  4UAC A;  1MY2 A;  1H45 A;  4F1V A;  3KOS A;  4IO6 A;  3G3H A;  4IO5 A;  4O3C A;  4RXL A;  5H8F B;  1HSJ A;  4ZZE A;  4ZE8 A;  1OQG A;  1Y4C A;  5AA2 B;  2I4C A;  1UTH A;  2ONS A;  3KSX A;  4KI0 E;  2UXA A;  4KYD A;  4XXU A;  4YB5 A;  1TT1 A;  3KFM A;  1JW4 A;  4POW A;  3IX1 A;  2VHA A;  1I6Q A;  4TOZ A;  3SDF A;  2R6G E;  1B40 A;  3C9H A;  3QSL A;  5K2Y A;  1VE4 A;  1SVX B;  1GTK A;  1UTH B;  1SYI A;  3K1P A;  4Q5T A;  3HPI A;  3JZJ A;  3THI A;  3SEU A;  3TTR A;  1ANF A;  1JW1 A;  3I5O A;  4DCX A;  3QIM A;  3K6V A;  4EQB A;  3MPK A;  3RQT A;  2E1S A;  2DWA A;  3T9U A;  1OIB A;  3O2A A;  3QXM A;  5CMK A;  1NMU A;  1XHY A;  1A40 A;  3PUX E;  2F36 A;  1HSL A;  4GRK A;  4RPN A;  4U1Z A;  5A5X A;  4EXK A;  3U94 A;  3PPO A;  1MM6 A;  1D9V A;  1M5B A;  2XXX A;  3PUY E;  4NWC A;  5HM4 B;  1H44 A;  3IOW A;  4YZZ A;  2D21 A;  3PUZ E;  5ELV A;  3CFZ A;  4ESX A;  1SI1 A;  3I3V A;  5A5X B;  3MBP A;  1B05 A;  3FJM A;  1IXC A;  1B5I A;  1JW5 A;  5AA3 A;  1MXW A;  3FVG A;  3MAM A;  4GXS B;  4F3S A;  4Z0I A;  4F1Y A;  4OHN A;  4NF6 B;  1TFD A;  2VD2 A;  3HHF A;  3FJ7 A;  5EHS A;  3EQ1 A;  4HW8 A;  4XTC Q;  1N3X A;  1JEU A;  2X26 A;  1AMF A;  4GQO A;  4KFQ A;  2CMO A;  3GLB A;  2DYX A;  4R74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...