2X7QA

The conserved candida albicans ca3427 gene product defines a new family of proteins exhibiting the generic periplasmic binding protein structural fold
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
306
structure length
306
Chain Sequence
LPTLKVAYIPEHFSTPLFFAQQQGYYKAHDLSIEFVKVPEGSGRLINLLNSNEVDIAIGLTEAFIADIAKGNENIHVLDTYVKSPLLWAVSTGSNRDDVTDAKQLKRIGVSRIGSGSYVMSFVLAHQLGVPSFDQFQVLSNFKNLRDSVNLKDGVEGSDAFMWEYFTSKKYYDNHEIKQIDQIYTPWSSWVVATSSDSLQAKSDVIKNFIDAVNQGIQYYNEHVDEAIEYISSNLDYSAEDAKEWTKTVEFNSRIGKTPLDWDTIVVKTKDTLKLAGVLAESDDVILKRLNSNVKKTNLQLDGDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords POSSIBLE THIAMINE BIOSYNTHESIS ENZYME
publication title The Conserved Candida Albicans Ca3427 Gene Product Defines a New Family of Proteins Exhibiting the Generic Periplasmic Binding Protein Structural Fold
pubmed doi rcsb
source organism Candida albicans
total genus 104
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2x7qA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2x7qA01
3PUXE 1MPBA 2PVUA 1Y3PA 5I58B 4YU0A 2F7AA 4E0WA 2XD3A 5FHNA 5I2NB 3A3UA 1NKXA 3CI8A 4XXUA 3RNNA 3PPRA 3D4CA 1MH4A 4LZ8A 1TXFA 3FATA 1AOVA 4OHNA 3H6VA 2GFEA 2AYSA 3D4GA 1JEUA 2BJJX 3DP8A 3O29A 4DCXA 3B6TA 4EDPA 4ISUA 1EH3A 2R9JA 3OSQA 2VD3A 3UP9A 3K1PA 1I6BA 5HBCA 3HHGA 2HEUA 4HS7A 1H45A 4XTCQ 4NF4B 4F3PA 3T96B 2OWSA 3RY3A 4JB7A 4R75A 1Q1KA 3MPKA 2OZZA 1FQDA 1B3HA 1JVXA 3ZKLA 1KWHA 3C34A 2QMXA 4MBPA 1UTBB 4EQBA 3H7MA 2I3VA 4XKRA 2PT1A 2I49A 4FIMA 1OVBA 1BP5A 2Y7PA 4DE8A 4IGTA 4KYEA 3O6IA 4G4PA 4H0WA 2XD2A 3IB0A 4LVQA 1LCFA 3KSJA 3H6UA 4OETA 2O84X 3RT6B 1VR5A 3S4UA 3PPPA 1IQ7A 3MBPA 1M5BA 1I6QA 2DWJA 1NMUA 1IXHA 3WAEA 1XVXA 5KCJB 3VDFA 1B0HA 2WKYA 1H44A 2ZNSA 2VD2A 1F9BA 3UGWA 3RN8A 1EZ9A 1MQHA 3FZVA 4ZDMA 2OWTA 2GHBA 3SEUA 4IO3A 3SEVA 4QHQA 2UXAA 1EZPA 2VGQA 4NF8B 3N6UA 4JWYA 3IL1B 4EXLA 1FQAA 1Z7NE 3G3KA 4ZZEA 1ATGA 2RC7A 2ZYNA 4IO2A 1LAHE 3SEWA 2DE3A 4YMBA 4H65A 1MH3A 1QVSA 4ZEKA 4I62A 4QSEA 3O6GA 4IO7A 1TFAA 4YAHX 2DWHA 3QK6A 5CMCA 4RY1A 3QAXA 3Q27A 4PFTA 4ND9A 1SQYA 3EHUA 1SYHA 2LAOA 2XXWA 4GL0A 4ZEDA 4PP0A 4TQUQ 3FASA 4H8JA 5ICTA 2NWJA 1B5IA 2Y7WA 3TAJA 5ISUA 3T22A 5CRYA 3QXMA 1QW0A 1PEBA 2REGA 1N7XA 2DVCA 1ZIUA 2M8CA 2QRYA 4ZE9A 3FIRA 1MXVA 3K2DA 1LB8A 3C35A 4OXVA 2DXYA 4DDDA 4F39A 2Z22A 1OIBA 1DPPA 2Y7KA 3TEPA 2ONSA 1Z7ME 1N84A 3KJTA 4AB6A 3HN0A 1OLAA 1N04A 3ODBA 3PMWA 3S9EA 2Z8FA 5I2KB 1MY2A 1YCJA 4P11A 3U92A 3TCFA 4WEPA 5TP9A 2VP1A 3MVWA 1VSOA 5H8NB 4RPOA 2NUVA 4M1VA 3FUZA 4LUBA 4FATA 2DWAA 4R6KA 3O2AA 1MQGA 1XC1A 2XXHA 4RPNA 4ESXA 1URSA 4KFQA 3DELB 3B6WA 3VV5A 3ILUB 5A5XA 4P0GA 2PT2A 1I6AA 1LFIA 2DVZA 3FXQA 4NTLA 1WDNA 1B7HA 2ONRA 2O7IA 1LFHA 5AA4A 1XHYA 1BKAA 1BTJA 4R2BA 1LLSA 1SW2A 1AH5A 1XVYA 1MG1A 3TKDA 1NH8A 3LC8A 4N13A 2I4CA 5TPAA 3CSBA 4NEDA 1JNFA 1OVTA 2E1SA 4HW8A 1P99A 3MVXA 3U93A 5L9SA 3MAMA 5H8HB 1US4A 3IX1A 1B1HA 4ZEIA 3OENA 2V3UA 3FVGA 3KZGA 1PC3A 2UYFA 3OXNA 1USYH 4G68C 3F11A 2VOZA 1N3WA 1XS5A 1J1NA 4OWDA 4Z7EA 4U4SA 2RCBA 3O66A 4POXA 4ZZAA 4U21A 3G3IA 2I3WA 3M3KA 5JK4A 3FJGA 4FEBA 4MFIA 2HFBA 1YTVA 4UACA 3KOTA 1NL5A 5KDTA 4OFLA 4LQ2A 4NF5B 1OQHA 3BBRA 1II5A 1Q35A 4OFJA 2DWIA 4TOZA 5DEXB 1QULA 1LAXA 5H8FB 4R9FA 5I56B 2D21A 4N6PA 3QUFA 3UK4A 4X48A 3TDJA 1B4ZA 1Y4CA 4NF6A 1QUKA 2P2AA 1BIYA 3FV1A 4BDQA 1IXIA 5FTHA 5H8SA 2UVJA 4X1BA 4OEUA 3CFXA 5AA3A 4FJPA 5F1QA 2ZNTA 3C36A 3OO7A 1Y1MA 3G3HA 3THIA 3I5OA 5FHMA 4F3BA 2Q8JA 1MXXA 3FXUA 3HO7A 2RCAA 2FNCA 3HCQA 3S9NC 1DMBA 4X9TA 3Q26A 1HSEA 3QYTA 3VLWA 2IA4A 1P1WA 3JYRA 4UA8A 3MPLA 2HZKA 2H25A 2AL4A 4KI0E 1ANFA 5L9OA 1B7ZA 1R1NA 3O9PA 1LSTA 1US5A 2V93A 3RT8A 3N94A 4KHZE 3KBRA 1CE2A 1DPEA 3OOAA 4XKNA 1SYIA 1MM7A 3H4ZA 4YB6A 2RF1A 2QPQA 3TTNA 3CG3A 3VVFA 1PB9A 3A3CA 3OMBA 2O69A 2A5TA 5CM6A 3PV0E 1S50A 4TLMB 3U94A 3PU5A 3SKPA 4Q0CA 4FE8A 2NVUB 1MQJA 1B0LA 1L5TA 1XT8A 3PUWE 1RYXA 2F6GA 4LQ5A 4RA1A 2FA7A 2HAVA 2IEEA 2HCAA 4ZE8A 5I58A 4GWOA 4N07A 4QFOA 3CSGA 1M5DA 4BDNA 5I2NA 3CG1A 2QL3A 4JSOA 5FTIA 4GF8A 3K01A 1MRPA 3USDA 1UTHA 1IIWA 2G93A 4C0RA 2O1LA 1GGGA 4QFLA 4JDFA 5B70A 3OEKA 3V89B 1JQFA 4XIGQ 3K02A 1A54A 3P7IA 3KEIA 3VLVA 2I6EA 2UYEA 1B58A 2NOOA 2DXRA 3N5LA 1HSLA 5DYHA 1YPNA 3OSRA 4Q30B 4QF9A 4YKJA 4ELQA 3R7XA 4F3SA 1JW1A 4NF4A 4OYVA 2B65A 2OK2A 2I0BA 3V5AA 4ELPA 4OVJA 2RINA 5I57A 3ONMA 1LFGA 1JW5A 4XKPA 4YZZA 3EHSA 4U23A 3O28A 4YKIA 4BDLA 3MP6A 4IY5A 4OENA 3RUMA 5ITOA 3VXCA 3TELA 4MLQA 1MQIA 3ECRA 1FW0A 3KFMA 5I84A 1POY1 1R6ZA 3T9XB 1GTKA 3MZBA 4HCYA 3IB1A 5DTBA 4QFNA 1FTKA 3R26A 2XXQA 3GZGA 4YB7A 1LBBA 4OEVA 3MZ9A 2DP8A 1UQWA 2G29A 3LSLA 2F7BA 2Y7RA 2H4IA 4IO6A 2H98A 5M2VA 1MQDA 2XXIA 1SW1A 1ZMGA 2DE2A 5I59A 1Y20A 2Z8DA 4F1YA 3V83A 3IOUA 4AQ4A 3FVOA 2V3QA 2XX9A 4U4XA 4HCWA 4F1VA 4QRZA 3U1OA 3N26A 1JVYA 4DZ1A 1JEVA 2B3FA 3C4MA 3ZKKA 2H5YA 1D4NA 3M3LA 3MWBA 1P1UA 1SW4A 2E0SA 1B1XA 4U2RA 1I69A 2W7YA 4GXSB 2D5WA 3VFJA 3EPEA 4RXLA 4NWDA 4GXAA 4ZEBA 3EN3A 1ZKBA 4H1XA 4H5GA 2DOJA 3PMXA 4I1DA 1DTGA 5AA2A 3TMGA 4PE5B 3SDFA 5K2XA 1MDP1 2R6GE 4LP2B 3M8UA 3IAZA 1XOCA 2D3IA 1B6HA 2XX7A 3C32A 3MP8A 4DIGA 1A40A 2O51A 1OLCA 5K2YA 4QFPA 3FGSA 3MQ9A 5TP9B 3GLBA 1SD3A 3TCGA 2QS4A 3TQLA 1O64A 2HAUA 4GL8A 3SEYA 1B32A 2XXTA 1WVJA 5I2KA 4OTEA 3KJ7A 1EZOA 5AA2D 4KYSA 4LZ7A 5A5XB 3GBBA 4DCYA 3HHFA 1M5EA 3K6VA 2XXYA 3JV9A 2ZYKA 3RPWA 3ZSFA 5AA4B 1O63A 2I48A 3TYHA 3K6WA 4THIA 1PB8A 3G3FA 4U22A 3C31A 2F78A 4KPTA 3MVZA 4ELOA 5TPAB 1FQBA 1MDQA 3OO6A 2YLNA 4U1OA 4ZS9A 4KD5A 2I0CA 2PX1A 3K6XA 4H67A 3SESA 2QJEA 4C1UA 4PFUA 3PUYE 4DXBA 1HSJA 2P0SA 3LBSA 4Q5TA 3E13X 1O7TA 4NWCA 3AXFA 5H8QA 1YAEA 1MS7A 1ZLQA 2UVGA 2XXPA 3IOTA 4GVOA 4M4GA 4EQ9A 3MUQA 3PUVE 2ZXTA 3UN6A 1QJMA 5L8DA 1SI0A 2F35A 1RKMA 1QKBA 3KOSA 5JTYA 2F97A 4R72A 1B3EA 2XXUA 3SERA 3OO8A 4KR5A 2QSXA 2YJPA 3MZ1A 1B2HA 2HXWA 2QMWA 1FQCA 4H5FA 3W9VA 3A09A 2O68A 1Y4TA 3Q25A 1MPDA 5KDTB 3OEMA 1B3GA 1OMPA 4IGRA 4EF2A 3TTKA 1S9TA 1A99A 4GQOA 4EXKA 5CMKA 1LAGE 3GBAA 1MPCA 5CI5A 5KZTA 1PBPA 1NNTA 3PPNA 4NF6B 3T9VA 1B05A 4JWOA 3T9HB 2DS9A 2O6AA 3TQWA 4ZECA 2DSFA 2F36A 5HM4B 4WEDA 2VHAA 5DEXA 3K1MA 2X7PA 2ZNUA 2ZMBA 3FVNA 4GIZA 3TODA 5I56A 4YICA 3E9XA 1TWYA 3S9LC 5F7VA 4G68A 3ZS6A 1B4HA 5IAIA 3OO9A 4FORA 4HTGA 4F3GA 4R9GA 4YMAA 3KGCA 3PPQA 2QS3A 1B52A 3W9WA 1UIUA 3IJOB 3PPOA 2ONKE 4RYAA 3SETA 4H8IA 5DVJA 4O3AA 1SW5A 4ELRA 3RGYA 5LOMA 1IXCA 2HZLA 2V25A 1B51A 1JETA 2I58A 4DXUA 3Q28A 4F22A 4GD5A 1GVCA 2F34A 1IUDA 4P0IA 3M3FA 1B5HA 3H03A 2ESNA 5HPQA 2A5TB 3IJXB 2PYYA 2H9BA 1MXUA 1NNKA 1PDAA 1OQGA 3O6HA 2V84A 3CFZA 2DYXA 3DLNA 1MY4A 4FEDA 1NH7A 2Y84A 4PFYA 3TPAA 1IITA 4FAJA 2ABHA 3S2VA 2DE4A 3CR9A 4I9DA 1PBQA 2OJTA 2YPNA 5J1DA 3H3GA 1UTHB 1Y9UA 3VVEA 3CFLA 3PMVA 1VFDA 1AL3A 3KSXA 4JSDA 3VVDA 4JWXA 1N3XA 3DM0A 4PFWA 3VE1B 5DVFA 2X26A 4R6HA 4YKPA 4G8NA 2ANJA 4EF1A 2CMOA 1A8EA 2F5XA 3T9UA 4GFRA 3E4RA 3H6WA 3EF7A 3HV1A 4G8MA 5I57B 3OELA 5L9MA 1N7WA 1DOTA 5DVIA 3TCHA 3TUSA 1FQFA 1NNPA 1FTMA 2NXOA 3IOWA 1S7YA 3S9MC 3G3GA 1UTBA 4BDOA 2XXVA 4YB5A 1H43A 3RTWB 4TLLB 3N6TA 1VE4A 5IKBA 2R71A 1JW4A 4MLVA 4PQJA 4X1DA 2QS2A 5FHOA 5JEIA 4F2OA 1GV8A 3UA8A 2H99A 4OERA 3FXRA 3E3KA 2PMSA 4JBZA 2PBWA 1ELJA 5KCJA 2F7CA 2F8DA 1SBPA 4QSDA 1EU8A 1MXZA 4MH5A 1N0TA 3MC2A 3IORA 2OCUA 1H76A 2XHDA 5I59B 4O3CA 1URGA 2UVIA 3V8XB 2B3BA 1NFTA 2OLBA 1A8FA 2RC8A 4YKKA 3UORA 5BUUA 4NF8A 1PB7A 2P1SA 3QUJA 3FJ7A 5DT6A 1IXGA 1M5FA 4NMYA 3CRBA 1D9VA 1TFDA 4XKQA 1MXYA 3LSFB 4WXJA 4IY6A 3KN3A 2Q88A 3LR1A 3VLUA 4BDRA 4QFKA 2GHAA 1B9JA 4GLIA 3ILTB 3EQ1A 3Q29A 2Z8EA 1LGBC 2Q2CA 4RJZA 5ELVA 4RNSA 5B7DA 4EQ7A 1MY0A 4G2ZA 4R73A 3C9HA 2REJA 5CC2A 3VXBA 5AA2B 3QIMA 3K00A 3OD7A 4RK9A 3H06B 3BFTA 2GH9A 4POWA 4F18A 4BDMA 5CBRA 4KQPA 1Y3QA 5ICQA 4LONB 1RYOA 3TTMA 3T93B 1LBCA 5CMBA 5AA1A 3LUYA 1POTA 3U8QA 3FD3A 4DLDA 4F1UA 3G3JA 3IOVA 1P1NA 2HQ0A 3C33A 4GOTA 2FYIA 2ALUA 1ZTYA 3I6VA 1LB9A 2XXRA 1FTLA 1ZU0A 3MJNA 4F19A 3EHTA 3L6GA 4AB5A 4H6DA 2OBGA 4R2FA 3IO6A 1R9QA 1ZBMA 1A55A 4R74A 1AIVA 3R6UA 4OQOA 4I8CA 5H8NA 1FTOA 2Y7IA 1M5CA 4K3FA 4IO5A 4NE4A 3FJMA 4KYDA 2I4BA 1SVXB 3K1NA 3PUZE 4IB2A 2QS1A 3W15C 3FVKA 3TFLA 1A7LA 1P1QA 4KCCA 4FECA 2KLFA 2XXXA 3K4UA 3T66A 3U72A 2CZLA 1B5JA 4F31B 1MM6A 3LSWA 3RTFB 3LSXA 1FQEA 2DQVA 3FV2A 5H8QB 4OESA 1B7UA 4OZ9A 1MY3A 3IO4A 4MF3A 3K0VA 1URDA 1CB6A 3IK6B 5JTYB 1D3KA 5H8HA 3PD8A 2AL5A 1T0KA 4ESWA 2RKMA 4C1TA 4ONYA 3TTLA 2ZYOA 4QSCA 5EHMA 3G7WA 3DP6A 4DXCA 2X7QA 3HPIA 2Q9TA 2F6PA 4U1ZA 5CBSA 1H3DA 4KCDA 3GXAA 3KG2A 1USYE 4ZEFA 3K6UA 1GR2A 3JZJA 3RQTA 4E0XA 2O7UA 4JXIA 1LAFE 1N76A 3I3VA 1R9LA 1UIVA 3H6TA 3IR1A 4PETA 4G8HA 4NF5A 3PD9A 1D9YA 4L17A 3MVYA 3UIFA 1WODA 4OFOA 4F29A 1DSNA 1LCTA 3IB2A 1B3LA 1DTZA 2AIXA 3TZAA 4RK2A 5H8FA 2V3TA 1FTJA 2ZYMA 4G68B 1Y1ZA 1FCKA 3CVGA 4F2QA 4Q8RA 5AE4A 4OMBA 3SEXA 5BWJA 1QUJA 1IEJA 5EYFA 1P1OA 1BLFA 3BFUA 3QSLA 4G77A 2THIA 4R6YA 1IZ1A 4LATA 5CMMA 1VFEA 2UVHA 4IO4A 3MP1A 4EUOA 2Q89A 4LA9A 3PGFA 1QKAA 3KN8A 5TU0A 4GRKA 1MXWA 5ITPA 3CIJA 1NNFA 2A5SA 4BLAA 1B40A 4O3BA 4WKMA 1Y3NA 2O1MA 2Q2AA 3L6HA 1SI1A 5EHSA 2Z23A 2RC9A 3O97A 3BKIB 3B6QA 3KN7A 3WAFA 1ZJLA 1AMFA 3MW0A 3RLFE 3B7DA 1QUIA 4ECFA 4Z0IA 1TT1A 2GRVA 1SDXA 3HSTA 4LZ5A 1B46A 2XX8A 1MY1A 1B3FA 3TTRA 3DP4A
chains in the Genus database with same CATH superfamily
3PUXE 1MPBA 2PVUA 1Y3PA 5I58B 4YU0A 2F7AA 4E0WA 2XD3A 5FHNA 5I2NB 4PGPA 3A3UA 1NKXA 3CI8A 4H45A 4XXUA 3RNNA 3PPRA 3D4CA 1MH4A 4LZ8A 1TXFA 3FATA 1AOVA 4O94A 4OHNA 4IR8A 3H6VA 2GFEA 2AYSA 3D4GA 1JEUA 1NUXA 2BJJX 3DP8A 3O29A 3IFCA 4DCXA 3B6TA 4OANA 4EDPA 4ISUA 1EH3A 1NUWA 2OWZA 2R9JA 3OSQA 2VD3A 3UP9A 3K1PA 1I6BA 5HBCA 1NUZA 3HHGA 2HEUA 3RPLB 4HS7A 1H45A 4XTCQ 4NF4B 4F3PA 3T96B 2OWSA 3RY3A 4JB7A 4R75A 1Q1KA 2L5VA 3MPKA 2OZZA 1FQDA 1B3HA 1JVXA 1FPLA 3ZKLA 1KWHA 3C34A 2QMXA 4MBPA 1UTBB 4EQBA 3H7MA 2I3VA 4XKRA 2PT1A 2I49A 4FIMA 1OVBA 1BP5A 2Y7PA 4DE8A 4IGTA 4KYEA 5LTCA 3O6IA 4G4PA 4H0WA 2XD2A 3IB0A 4LVQA 1LCFA 3KSJA 3H6UA 4OETA 4AS5A 2O84X 3RT6B 1VR5A 3S4UA 3PPPA 1IQ7A 3MBPA 1M5BA 1I6QA 2DWJA 1NMUA 1IXHA 4LN5A 3WAEA 4NX1A 1XVXA 5KCJB 1IMCA 4PAFA 4PF6A 3VDFA 1B0HA 1FPIA 4N6KA 2WKYA 1H44A 2ZNSA 5ET7A 2VD2A 4GWUA 1F9BA 2B4LA 3UGWA 3RN8A 3NOHA 1EZ9A 1MQHA 3FZVA 4ZDMA 2OWTA 2GHBA 4XEQA 3SEUA 4IO3A 3SEVA 4QHQA 2UXAA 1IMBA 1EZPA 2VGQA 4NF8B 3N6UA 4JWYA 3IL1B 4EXLA 1FQAA 1Z7NE 3G3KA 4ZZEA 1ATGA 2RC7A 2ZYNA 4IO2A 1LAHE 3SEWA 4PBHA 2DE3A 4YMBA 4GBWA 4H65A 3HFUA 1MH3A 1QVSA 5ET5A 4ZEKA 4I62A 4GX3A 4QSEA 3O6GA 4OVQA 4IO7A 1TFAA 4YAHX 2DWHA 3QK6A 5CMCA 4RY1A 3QAXA 3Q27A 4PFTA 4ND9A 2Q74A 1SQYA 3EHUA 4NN3A 1SYHA 2LAOA 2XXWA 4GL0A 4ZEDA 4PP0A 5EQAA 4TQUQ 1RDYA 3FASA 4H8JA 5ICTA 2NWJA 1B5IA 2Y7WA 3TAJA 5ISUA 3T22A 5CRYA 3QXMA 1QW0A 1PEBA 2REGA 1N7XA 2DVCA 2ZZVA 1ZIUA 4XF5A 2M8CA 2QRYA 4ZE9A 4OVRA 3FIRA 1MXVA 3K2DA 1LB8A 4GWYA 3C35A 4OXVA 2DXYA 2XXKA 4DDDA 5I5PA 4F39A 2Z22A 1Q9DA 1OIBA 1DPPA 2Y7KA 4N81A 3TEPA 1RDZA 2ONSA 1Z7ME 1N84A 1G0IA 4OVPA 3KJTA 4AB6A 3HN0A 1OLAA 1N04A 3ODBA 3PMWA 5EQ7A 3S9EA 2Z8FA 5I2KB 1MY2A 1YCJA 4P11A 3U92A 4P3LA 3TCFA 4WEPA 1YXIA 4JVCA 5TP9A 2VP1A 3MVWA 1JP4A 1VSOA 5H8NB 4RPOA 2NUVA 4M1VA 3FUZA 4LUBA 4FATA 2DWAA 2DDKA 4R6KA 3O2AA 1MQGA 4GX6A 1XC1A 2XXHA 4RPNA 2WBBA 4ESXA 1URSA 4KFQA 4MX6A 3DELB 3B6WA 3VV5A 3ILUB 5A5XA 1CNQA 4P0GA 2PT2A 1I6AA 1LFIA 2DVZA 3FXQA 4NTLA 1WDNA 1B7HA 3BIGA 2CZIA 2ONRA 2O7IA 1LFHA 5AA4A 1XHYA 1BKAA 1BTJA 4R2BA 1LLSA 1SW2A 1AH5A 1NV2A 1XVYA 4XFEA 1MG1A 3TKDA 1NH8A 3LC8A 4N13A 2I4CA 2ZZWA 5TPAA 3CSBA 4NEDA 1JNFA 1OVTA 2BJIA 1D9QA 3FXBA 2E1SA 4HW8A 1P99A 3MVXA 2WX9A 1NV6A 3U93A 5L9SA 3MAMA 5H8HB 1US4A 3IX1A 1B1HA 4MEVA 4ZEIA 3OENA 2V3UA 3FVGA 3KZGA 1PC3A 2UYFA 3OXNA 1USYH 4G68C 3F11A 2VOZA 1N3WA 4PC9A 1XS5A 1J1NA 3B50A 4OWDA 4Z7EA 4U4SA 2RCBA 3O66A 4POXA 2QVRA 4ZZAA 4U21A 3G3IA 2I3WA 3M3KA 5JK4A 3FJGA 4NAPA 4FEBA 4MFIA 2HFBA 1YTVA 4UACA 5EYHA 2KR0A 3KOTA 4H46A 1NL5A 5KDTA 4OFLA 4LQ2A 1LBZA 4NF5B 1OQHA 2HHMA 3BBRA 1II5A 1Q35A 4OFJA 4UABA 2DWIA 4TOZA 1LBVA 5DEXB 2Y5KA 1QULA 1LAXA 5H8FB 4R9FA 5I56B 2D21A 4N6PA 3QUFA 3UK4A 4X48A 4G61A 3TDJA 1B4ZA 1Y4CA 4NF6A 1QUKA 2P2AA 4MMPA 2QVUA 1BIYA 3FV1A 4BDQA 1IXIA 5FTHA 5H8SA 2UVJA 1EYKA 4X1BA 4OEUA 3CFXA 5AA3A 4FJPA 5F1QA 4PFRA 2ZNTA 2XWVA 3C36A 3OO7A 1Y1MA 3G3HA 3THIA 4OA4A 3I5OA 5FHMA 4F3BA 2Q8JA 1MXXA 3FXUA 3HO7A 2RCAA 2FNCA 3HCQA 5EYGA 3S9NC 1DMBA 4X9TA 3Q26A 1HSEA 3QYTA 3VLWA 2IA4A 1P1WA 4NG7A 3JYRA 4UA8A 3MPLA 2HZKA 2H25A 2AL4A 4KI0E 1ANFA 1LEVA 5L9OA 1B7ZA 2CEXA 1R1NA 3O9PA 1LSTA 1US5A 2OX3A 2V93A 4N4UA 3RT8A 3N94A 4KHZE 3KBRA 4O7IA 1CE2A 1DPEA 3OOAA 4XKNA 1SYIA 1MM7A 3H4ZA 4YB6A 2RF1A 2QPQA 1DCUA 3E79A 3TTNA 3CG3A 3VVFA 2FBPA 1PB9A 3A3CA 5J16A 3OMBA 2O69A 2A5TA 5CM6A 4PFIA 3PV0E 1S50A 4TLMB 2VPOA 3U94A 3PU5A 3SKPA 4Q0CA 2JJKA 4FE8A 4HE2A 2NVUB 1MQJA 1B0LA 1L5TA 1XT8A 3PUWE 1RYXA 2F6GA 4LQ5A 4RA1A 2FA7A 2HAVA 2IEEA 2HCAA 4ZE8A 5I58A 4GWOA 4QFOA 4N07A 3CSGA 1M5DA 4BDNA 5I2NA 1AWBA 3CG1A 1YZ0A 2QL3A 4JSOA 5FTIA 4GF8A 3K01A 1MRPA 3USDA 1NI9A 1KA0A 1UTHA 1IIWA 2G93A 4C0RA 2O1LA 1GGGA 1LBXA 4QFLA 4JDFA 1G0HA 5B70A 3OEKA 3V89B 1JQFA 4XIGQ 3K02A 1A54A 3P7IA 4N8YA 5ET6A 3KEIA 3VLVA 5IZ1A 2I6EA 2UYEA 1B58A 1FBHA 2NOOA 3KC0A 2DXRA 1FBDA 3N5LA 1HSLA 5DYHA 2Q8MA 1FJ6A 1YPNA 3OSRA 4Q30B 4QF9A 4YKJA 2WEFA 4ELQA 3R7XA 4F3SA 1JW1A 4NF4A 4OYVA 2B65A 2OK2A 2I0BA 3V5AA 4ELPA 5EQ8A 1NV7A 4OVJA 2RINA 5I57A 3ONMA 1LFGA 1JW5A 4XKPA 4YZZA 3EHSA 4U23A 4N8GA 3O28A 4YKIA 4BDLA 3MP6A 4GBVA 4IY5A 4OENA 3RUMA 2B4MA 5ITOA 3VXCA 3TELA 4MLQA 1MQIA 4PDDA 3ECRA 1FW0A 3KFMA 2R8TA 5I84A 1POY1 4N15A 1R6ZA 3T9XB 1GTKA 3MZBA 4HCYA 3IB1A 5DTBA 4QFNA 2F3DA 1FPKA 1FTKA 3R26A 2FIEA 2XXQA 3GZGA 5T3JA 4YB7A 1LBBA 2CEYA 4OEVA 3MZ9A 2DP8A 1UQWA 3BIHA 2G29A 3LSLA 2F7BA 3MYUA 2Y7RA 2H4IA 4IO6A 2H98A 2PFYA 5M2VA 1MQDA 2XXIA 1SW1A 1ZMGA 1DBZA 2DE2A 5I59A 1Y20A 2Z8DA 4F1YA 3V83A 3IOUA 4AQ4A 1NV5A 3FVOA 2V3QA 2XX9A 4U4XA 4HCWA 4F1VA 4QRZA 3U1OA 1NV3A 3N26A 1JVYA 4DZ1A 3LUZA 1JEVA 2B3FA 3C4MA 3ZKKA 2H5YA 1K9YA 1D4NA 3M3LA 3MWBA 1BK4A 1P1UA 1SW4A 2E0SA 1B1XA 4U2RA 1I69A 2W7YA 1YYZA 4GXSB 2D5WA 4P8BA 3VFJA 2WYKA 3EPEA 4RXLA 4NWDA 4GXAA 3U65A 4ZEBA 3EN3A 1ZKBA 4H1XA 4PAIA 4H5GA 2DOJA 3PMXA 4I1DA 4OVSA 1DTGA 5AA2A 3TMGA 4PE5B 3SDFA 5K2XA 4MNPA 1MDP1 2R6GE 4LP2B 3M8UA 3IAZA 1XOCA 4I3EA 2D3IA 1B6HA 2XX7A 4KXPA 3C32A 4N91A 3MP8A 4DIGA 1A40A 2O51A 1OLCA 5K2YA 4QFPA 3FGSA 3MQ9A 5TP9B 3GLBA 1SD3A 3TCGA 4MIJA 2PFZA 2QS4A 3FBPA 3TQLA 1O64A 2HAUA 4I40A 4GL8A 3SEYA 1B32A 2FVZA 2XXTA 4PGNA 1WVJA 5I2KA 4OTEA 3KJ7A 1EZOA 5AA2D 4KYSA 1FBCA 4LZ7A 5A5XB 3GBBA 4DCYA 3ISPA 4GWXA 3HHFA 1M5EA 3K6VA 1FBEA 2XXYA 3JV9A 2ZYKA 3RPWA 3ZSFA 2WYPA 5AA4B 4O7MA 4PCDA 4O8MA 4GWZA 1O63A 2I48A 3TYHA 3K6WA 4THIA 1PB8A 3G3FA 4U22A 3C31A 2F78A 4MNIA 4KPTA 3MVZA 4ELOA 5TPAB 1FQBA 1MDQA 2QVVA 3OO6A 2QFLA 2YLNA 4U1OA 4ZS9A 4KD5A 2CZKA 2I0CA 1KA1A 2PX1A 3K6XA 4H67A 3SESA 2QJEA 4C1UA 4PFUA 3PUYE 4DXBA 1HSJA 2P0SA 3LBSA 4Q5TA 3E13X 1O7TA 2XWIA 4NWCA 3AXFA 4HE0A 5H8QA 1YAEA 1MS7A 1ZLQA 2UVGA 2XXPA 3IOTA 4GVOA 2HPGA 4M4GA 4N17A 4EQ9A 3MUQA 3PUVE 2ZXTA 3UN6A 1QJMA 5L8DA 1SI0A 2F35A 1RKMA 1QKBA 4MHFA 3KOSA 5JTYA 1NV0A 5ESYA 2F97A 4R72A 1B3EA 2XXUA 3SERA 3OO8A 4KR5A 2QSXA 2YJPA 3MZ1A 1B2HA 2HXWA 4MNCA 2V4CA 2QMWA 1FQCA 4H5FA 3W9VA 3A09A 4MJOA 2O68A 1Y4TA 3KC1A 3Q25A 1MPDA 5KDTB 3OEMA 1B3GA 1OMPA 4IGRA 4EF2A 4P1EA 3TTKA 1S9TA 1QGXA 1A99A 4GQOA 1FPFA 4EXKA 5CMKA 1LAGE 3GBAA 1MPCA 5CI5A 5KZTA 1PBPA 1NNTA 3PPNA 4NF6B 3T9VA 1B05A 4JWOA 3T9HB 2DS9A 2O6AA 3TQWA 4ZECA 2DSFA 2F36A 5HM4B 4WEDA 2VHAA 5DEXA 3K1MA 2X7PA 2ZNUA 2ZMBA 3FVNA 4GIZA 3TODA 3IFAA 5I56A 4YICA 3E9XA 1TWYA 3S9LC 5F7VA 5IM2A 4G68A 3ZS6A 1B4HA 5IGAA 5IAIA 3OO9A 1FJ9A 4FORA 4HTGA 4F3GA 4R9GA 4YMAA 3KGCA 3PPQA 2QS3A 1FTAA 1B52A 3W9WA 1UIUA 3IJOB 3PPOA 2ONKE 4RYAA 3SETA 4H8IA 2WBDA 2Y5LA 2HXRA 5DVJA 4O3AA 4PBQA 1SW5A 4ELRA 3RGYA 5LOMA 3A29A 1IXCA 2HZLA 2V25A 5A5LA 1B51A 1JETA 2I58A 4DXUA 5IZZA 3Q28A 4F22A 4GD5A 1GVCA 2F34A 1IUDA 4P0IA 3M3FA 1B5HA 3H03A 2ESNA 4N6DA 5HPQA 2A5TB 3IJXB 2PYYA 2H9BA 1MXUA 1NNKA 1FPJA 1PDAA 1OQGA 3O6HA 2V84A 5IZ3A 3CFZA 2DYXA 3DLNA 3D1RA 1MY4A 4FEDA 4P56A 1NH7A 2Y84A 4PFYA 4GX4A 3TPAA 1IITA 4FAJA 3T0JA 2ABHA 3S2VA 2DE4A 3CR9A 4I9DA 1FPBA 1PBQA 2OJTA 1EYIA 2YPNA 5J1DA 3H3GA 1UTHB 1NUYA 1Y9UA 3VVEA 3CFLA 3PMVA 1VFDA 1AL3A 3KSXA 4P1LA 3T1BA 4JSDA 3VVDA 4JWXA 1N3XA 3DM0A 4PFWA 3VE1B 5DVFA 2X26A 1IMEA 4GWSA 4R6HA 4YKPA 4MCOA 4G8NA 2ANJA 4PFBA 4EF1A 2CMOA 1FPEA 1A8EA 3LV0A 2F5XA 3T9UA 1FPGA 4GFRA 4NF0A 3RPLA 3E4RA 2GQ1A 2P3VA 3H6WA 3EF7A 3HV1A 4G8MA 5I57B 3OELA 5L9MA 1N7WA 1DOTA 5DVIA 3TCHA 3TUSA 1FQFA 1NNPA 4OVTA 1FTMA 2NXOA 3IOWA 1S7YA 2FHYA 3S9MC 2XA5A 3G3GA 1UTBA 4BDOA 2XXVA 4YB5A 1H43A 3RTWB 4TLLB 3N6TA 4X8RA 2CZHA 1VE4A 5IKBA 2R71A 1JW4A 4MLVA 4PQJA 4X1DA 2QS2A 5FHOA 4JVDA 5JEIA 4F2OA 1GV8A 3UA8A 2H99A 4PTKA 1FBFA 4OERA 3FXRA 3E3KA 2PMSA 4JBZA 2PBWA 4AS4A 1ELJA 3PTYA 5KCJA 1FBPA 2F7CA 2F8DA 1SBPA 4QSDA 1EU8A 1MXZA 4MH5A 1N0TA 3MC2A 3IORA 2OCUA 1H76A 2XHDA 5I59B 4O3CA 5I7IA 1NV4A 5DW8A 1FSAA 1URGA 2UVIA 3V8XB 2B3BA 1NFTA 1DK4A 2OLBA 4JVIA 1A8FA 4MAGA 2RC8A 4YKKA 3UORA 5BUUA 4NF8A 1PB7A 2P1SA 3QUJA 3FJ7A 5DT6A 1IMDA 1IXGA 1M5FA 4NMYA 3CRBA 1D9VA 1TFDA 4XKQA 1MXYA 3LSFB 4WXJA 4IY6A 3KN3A 2Q88A 3LR1A 3VLUA 4BDRA 4QFKA 2GHAA 1B9JA 4GLIA 3ILTB 5F24A 4NQ8A 5EQ9A 3EQ1A 3Q29A 2Z8EA 1LGBC 2Q2CA 1NV1A 4RJZA 1XI6A 5ELVA 4RNSA 5B7DA 4EQ7A 1MY0A 1INPA 4G2ZA 4R73A 3C9HA 2REJA 5CC2A 3VXBA 5AA2B 3QIMA 3K00A 3OD7A 4RK9A 3H06B 2ZZXA 2PCRA 3BFTA 2GH9A 4POWA 4F18A 4BDMA 5CBRA 4KQPA 1Y3QA 5ICQA 4LONB 2MKZA 1RYOA 3TTMA 3KBZA 3T93B 1LBCA 5CMBA 5AA1A 3LUYA 1POTA 3U8QA 3FD3A 4DLDA 4F1UA 2XWKA 3GYYA 1FBGA 1FPDA 3G3JA 3IOVA 1P1NA 2HQ0A 3C33A 4GOTA 2FYIA 2ALUA 1ZTYA 3I6VA 1LB9A 2XXRA 1FTLA 1ZU0A 3MJNA 3E78A 4F19A 3EHTA 1K9ZA 3L6GA 4AB5A 4PAKA 4H6DA 2OBGA 4R2FA 3IO6A 1R9QA 1ZBMA 1IMFA 1A55A 4R74A 1AIVA 3R6UA 3RYDA 1SPIA 4OQOA 4I8CA 4GWWA 5H8NA 1RDXA 5ET8A 1FTOA 2Y7IA 1M5CA 4K3FA 4IO5A 4NE4A 3FJMA 4KYDA 2I4BA 1SVXB 3K1NA 3PUZE 4QBAA 4IB2A 2QS1A 3W15C 3FVKA 3B8BA 1IMAA 3TFLA 3ROJA 1A7LA 1P1QA 4KCCA 4FECA 2KLFA 2XXXA 3K4UA 2XWOA 3T66A 3U72A 2CZLA 2VT5A 1B5JA 4F31B 3MSTA 1MM6A 2F3BA 3LSWA 3RTFB 3LSXA 1FQEA 2DQVA 3FV2A 5H8QB 1VDWA 4OESA 1B7UA 3CHGA 4OZ9A 3EKIA 4DI4B 1MY3A 3IO4A 4MF3A 3K0VA 4FBPA 1URDA 1CB6A 3IK6B 5I3SA 2VPNA 3SZPA 5JTYB 5FBPA 1D3KA 5H8HA 3PD8A 2AL5A 1EYJA 5LDZA 1T0KA 4ESWA 2FIXA 2RKMA 4C1TA 4ONYA 3TTLA 2ZYOA 4QSCA 5EHMA 3G7WA 3DP6A 4DXCA 2X7QA 3HPIA 4X04A 2Q9TA 2F6PA 4HXVA 4U1ZA 5CBSA 1H3DA 4KCDA 3GXAA 3KG2A 1USYE 4ZEFA 3K6UA 1GR2A 3JZJA 4I3YA 3RQTA 4E0XA 2O7UA 4JXIA 1LAFE 1N76A 3I3VA 1R9LA 1UIVA 3H6TA 3IR1A 4PETA 4G8HA 4NF5A 3PD9A 1D9YA 4L17A 3MVYA 4HE1A 3UIFA 4P47A 1WODA 4OFOA 4F29A 1DSNA 1LCTA 3IB2A 1B3LA 1DTZA 2AIXA 3TZAA 4RK2A 5H8FA 2V3TA 1FTJA 2ZYMA 4G68B 1Y1ZA 1FCKA 3CVGA 4F2QA 4Q8RA 5AE4A 4OMBA 3SEXA 5BWJA 1QUJA 1IEJA 5EYFA 1P1OA 1BLFA 3BFUA 1FRPA 3QSLA 4G77A 2THIA 3QMFA 4R6YA 1IZ1A 4LATA 5CMMA 1VFEA 4QXDA 4PDHA 2UVHA 4IO4A 3MP1A 4EUOA 4NGUA 2Q89A 4LA9A 2KQZA 3PGFA 1LBYA 1QKAA 4P9KA 3KN8A 5TU0A 4GRKA 1MXWA 4NHBA 4PE3A 5ITPA 1KZ8A 3CIJA 1NNFA 2A5SA 4BLAA 1B40A 4O3BA 4WKMA 1Y3NA 2O1MA 1LBWA 2Q2AA 3L6HA 1SI1A 5EHSA 2P3NA 2Z23A 4PF8A 2RC9A 3O97A 3BKIB 5IZ3B 3B6QA 3KN7A 3WAFA 1ZJLA 1AMFA 3MW0A 3RLFE 3B7DA 1QUIA 4ECFA 4Z0IA 1TT1A 2GRVA 1SDXA 3HSTA 4LZ5A 1B46A 2XX8A 1MY1A 1B3FA 4DI3D 3TTRA 3DP4A
chains in the Genus database with same CATH topology
3PUXE 1MPBA 2PVUA 1Y3PA 5I58B 4YU0A 2F7AA 4E0WA 2XD3A 5FHNA 5I2NB 3A3UA 1NKXA 3CI8A 4XXUA 3RNNA 3PPRA 3D4CA 1MH4A 4LZ8A 1TXFA 3FATA 1AOVA 4OHNA 3H6VA 2GFEA 2AYSA 3D4GA 1JEUA 2BJJX 3DP8A 3O29A 4DCXA 3B6TA 4EDPA 4ISUA 1EH3A 2R9JA 3OSQA 2VD3A 3UP9A 3K1PA 1I6BA 5HBCA 3HHGA 2HEUA 4HS7A 1H45A 4XTCQ 4NF4B 4F3PA 3T96B 2OWSA 3RY3A 4JB7A 4R75A 1Q1KA 3MPKA 2OZZA 1FQDA 1B3HA 1JVXA 3ZKLA 1KWHA 3C34A 2QMXA 4MBPA 1UTBB 4EQBA 3H7MA 2I3VA 4XKRA 2PT1A 2I49A 4FIMA 1OVBA 1BP5A 2Y7PA 4DE8A 4IGTA 4KYEA 3O6IA 4G4PA 4H0WA 2XD2A 3IB0A 4LVQA 1LCFA 3KSJA 3H6UA 4OETA 2O84X 3RT6B 1VR5A 3S4UA 3PPPA 1IQ7A 3MBPA 1M5BA 1I6QA 2DWJA 1NMUA 1IXHA 3WAEA 1XVXA 5KCJB 3VDFA 1B0HA 2WKYA 1H44A 2ZNSA 2VD2A 1F9BA 3UGWA 3RN8A 1EZ9A 1MQHA 3FZVA 4ZDMA 2OWTA 2GHBA 3SEUA 4IO3A 3SEVA 4QHQA 2UXAA 1EZPA 2VGQA 4NF8B 3N6UA 4JWYA 3IL1B 4EXLA 1FQAA 1Z7NE 3G3KA 4ZZEA 1ATGA 2RC7A 2ZYNA 4IO2A 1LAHE 3SEWA 2DE3A 4YMBA 4H65A 1MH3A 1QVSA 4ZEKA 4I62A 4QSEA 3O6GA 4IO7A 1TFAA 4YAHX 2DWHA 3QK6A 5CMCA 4RY1A 3QAXA 3Q27A 4PFTA 4ND9A 1SQYA 3EHUA 1SYHA 2LAOA 2XXWA 4GL0A 4ZEDA 4PP0A 4TQUQ 3FASA 4H8JA 5ICTA 2NWJA 1B5IA 2Y7WA 3TAJA 5ISUA 3T22A 5CRYA 3QXMA 1QW0A 1PEBA 2REGA 1N7XA 2DVCA 1ZIUA 2M8CA 2QRYA 4ZE9A 3FIRA 1MXVA 3K2DA 1LB8A 3C35A 4OXVA 2DXYA 4DDDA 4F39A 2Z22A 1OIBA 1DPPA 2Y7KA 3TEPA 2ONSA 1Z7ME 1N84A 3KJTA 4AB6A 3HN0A 1OLAA 1N04A 3ODBA 3PMWA 3S9EA 2Z8FA 5I2KB 1MY2A 1YCJA 4P11A 3U92A 3TCFA 4WEPA 5TP9A 2VP1A 3MVWA 1VSOA 5H8NB 4RPOA 2NUVA 4M1VA 3FUZA 4LUBA 4FATA 2DWAA 4R6KA 3O2AA 1MQGA 1XC1A 2XXHA 4RPNA 4ESXA 1URSA 4KFQA 3DELB 3B6WA 3VV5A 3ILUB 5A5XA 4P0GA 2PT2A 1I6AA 1LFIA 2DVZA 3FXQA 4NTLA 1WDNA 1B7HA 2ONRA 2O7IA 1LFHA 5AA4A 1XHYA 1BKAA 1BTJA 4R2BA 1LLSA 1SW2A 1AH5A 1XVYA 1MG1A 3TKDA 1NH8A 3LC8A 4N13A 2I4CA 5TPAA 3CSBA 4NEDA 1JNFA 1OVTA 2E1SA 4HW8A 1P99A 3MVXA 3U93A 5L9SA 3MAMA 5H8HB 1US4A 3IX1A 1B1HA 4ZEIA 3OENA 2V3UA 3FVGA 3KZGA 1PC3A 2UYFA 3OXNA 1USYH 4G68C 3F11A 2VOZA 1N3WA 1XS5A 1J1NA 4OWDA 4Z7EA 4U4SA 2RCBA 3O66A 4POXA 4ZZAA 4U21A 3G3IA 2I3WA 3M3KA 5JK4A 3FJGA 4FEBA 4MFIA 2HFBA 1YTVA 4UACA 3KOTA 1NL5A 5KDTA 4OFLA 4LQ2A 4NF5B 1OQHA 3BBRA 1II5A 1Q35A 4OFJA 2DWIA 4TOZA 5DEXB 1QULA 1LAXA 5H8FB 4R9FA 5I56B 2D21A 4N6PA 3QUFA 3UK4A 4X48A 3TDJA 1B4ZA 1Y4CA 4NF6A 1QUKA 2P2AA 1BIYA 3FV1A 4BDQA 1IXIA 5FTHA 5H8SA 2UVJA 4X1BA 4OEUA 3CFXA 5AA3A 4FJPA 5F1QA 2ZNTA 3C36A 3OO7A 1Y1MA 3G3HA 3THIA 3I5OA 5FHMA 4F3BA 2Q8JA 1MXXA 3FXUA 3HO7A 2RCAA 2FNCA 3HCQA 3S9NC 1DMBA 4X9TA 3Q26A 1HSEA 3QYTA 3VLWA 2IA4A 1P1WA 3JYRA 4UA8A 3MPLA 2HZKA 2H25A 2AL4A 4KI0E 1ANFA 5L9OA 1B7ZA 1R1NA 3O9PA 1LSTA 1US5A 2V93A 3RT8A 3N94A 4KHZE 3KBRA 1CE2A 1DPEA 3OOAA 4XKNA 1SYIA 1MM7A 3H4ZA 4YB6A 2RF1A 2QPQA 3TTNA 3CG3A 3VVFA 1PB9A 3A3CA 3OMBA 2O69A 2A5TA 5CM6A 3PV0E 1S50A 4TLMB 3U94A 3PU5A 3SKPA 4Q0CA 4FE8A 2NVUB 1MQJA 1B0LA 1L5TA 1XT8A 3PUWE 1RYXA 2F6GA 4LQ5A 4RA1A 2FA7A 2HAVA 2IEEA 2HCAA 4ZE8A 5I58A 4GWOA 4N07A 4QFOA 3CSGA 1M5DA 4BDNA 5I2NA 3CG1A 2QL3A 4JSOA 5FTIA 4GF8A 3K01A 1MRPA 3USDA 1UTHA 1IIWA 2G93A 4C0RA 2O1LA 1GGGA 4QFLA 4JDFA 5B70A 3OEKA 3V89B 1JQFA 4XIGQ 3K02A 1A54A 3P7IA 3KEIA 3VLVA 2I6EA 2UYEA 1B58A 2NOOA 2DXRA 3N5LA 1HSLA 5DYHA 1YPNA 3OSRA 4Q30B 4QF9A 4YKJA 4ELQA 3R7XA 4F3SA 1JW1A 4NF4A 4OYVA 2B65A 2OK2A 2I0BA 3V5AA 4ELPA 4OVJA 2RINA 5I57A 3ONMA 1LFGA 1JW5A 4XKPA 4YZZA 3EHSA 4U23A 3O28A 4YKIA 4BDLA 3MP6A 4IY5A 4OENA 3RUMA 5ITOA 3VXCA 3TELA 4MLQA 1MQIA 3ECRA 1FW0A 3KFMA 5I84A 1POY1 1R6ZA 3T9XB 1GTKA 3MZBA 4HCYA 3IB1A 5DTBA 4QFNA 1FTKA 3R26A 2XXQA 3GZGA 4YB7A 1LBBA 4OEVA 3MZ9A 2DP8A 1UQWA 2G29A 3LSLA 2F7BA 2Y7RA 2H4IA 4IO6A 2H98A 5M2VA 1MQDA 2XXIA 1SW1A 1ZMGA 2DE2A 5I59A 1Y20A 2Z8DA 4F1YA 3V83A 3IOUA 4AQ4A 3FVOA 2V3QA 2XX9A 4U4XA 4HCWA 4F1VA 4QRZA 3U1OA 3N26A 1JVYA 4DZ1A 1JEVA 2B3FA 3C4MA 3ZKKA 2H5YA 1D4NA 3M3LA 3MWBA 1P1UA 1SW4A 2E0SA 1B1XA 4U2RA 1I69A 2W7YA 4GXSB 2D5WA 3VFJA 3EPEA 4RXLA 4NWDA 4GXAA 4ZEBA 3EN3A 1ZKBA 4H1XA 4H5GA 2DOJA 3PMXA 4I1DA 1DTGA 5AA2A 3TMGA 4PE5B 3SDFA 5K2XA 1MDP1 2R6GE 4LP2B 3M8UA 3IAZA 1XOCA 2D3IA 1B6HA 2XX7A 3C32A 3MP8A 4DIGA 1A40A 2O51A 1OLCA 5K2YA 4QFPA 3FGSA 3MQ9A 5TP9B 3GLBA 1SD3A 3TCGA 2QS4A 3TQLA 1O64A 2HAUA 4GL8A 3SEYA 1B32A 2XXTA 1WVJA 5I2KA 4OTEA 3KJ7A 1EZOA 5AA2D 4KYSA 4LZ7A 5A5XB 3GBBA 4DCYA 3HHFA 1M5EA 3K6VA 2XXYA 3JV9A 2ZYKA 3RPWA 3ZSFA 5AA4B 1O63A 2I48A 3TYHA 3K6WA 4THIA 1PB8A 3G3FA 4U22A 3C31A 2F78A 4KPTA 3MVZA 4ELOA 5TPAB 1FQBA 1MDQA 3OO6A 2YLNA 4U1OA 4ZS9A 4KD5A 2I0CA 2PX1A 3K6XA 4H67A 3SESA 2QJEA 4C1UA 4PFUA 3PUYE 4DXBA 1HSJA 2P0SA 3LBSA 4Q5TA 3E13X 1O7TA 4NWCA 3AXFA 5H8QA 1YAEA 1MS7A 1ZLQA 2UVGA 2XXPA 3IOTA 4GVOA 4M4GA 4EQ9A 3MUQA 3PUVE 2ZXTA 3UN6A 1QJMA 5L8DA 1SI0A 2F35A 1RKMA 1QKBA 3KOSA 5JTYA 2F97A 4R72A 1B3EA 2XXUA 3SERA 3OO8A 4KR5A 2QSXA 2YJPA 3MZ1A 1B2HA 2HXWA 2QMWA 1FQCA 4H5FA 3W9VA 3A09A 2O68A 1Y4TA 3Q25A 1MPDA 5KDTB 3OEMA 1B3GA 1OMPA 4IGRA 4EF2A 3TTKA 1S9TA 1A99A 4GQOA 4EXKA 5CMKA 1LAGE 3GBAA 1MPCA 5CI5A 5KZTA 1PBPA 1NNTA 3PPNA 4NF6B 3T9VA 1B05A 4JWOA 3T9HB 2DS9A 2O6AA 3TQWA 4ZECA 2DSFA 2F36A 5HM4B 4WEDA 2VHAA 5DEXA 3K1MA 2X7PA 2ZNUA 2ZMBA 3FVNA 4GIZA 3TODA 5I56A 4YICA 3E9XA 1TWYA 3S9LC 5F7VA 4G68A 3ZS6A 1B4HA 5IAIA 3OO9A 4FORA 4HTGA 4F3GA 4R9GA 4YMAA 3KGCA 3PPQA 2QS3A 1B52A 3W9WA 1UIUA 3IJOB 3PPOA 2ONKE 4RYAA 3SETA 4H8IA 5DVJA 4O3AA 1SW5A 4ELRA 3RGYA 5LOMA 1IXCA 2HZLA 2V25A 1B51A 1JETA 2I58A 4DXUA 3Q28A 4F22A 4GD5A 1GVCA 2F34A 1IUDA 4P0IA 3M3FA 1B5HA 3H03A 2ESNA 5HPQA 2A5TB 3IJXB 2PYYA 2H9BA 1MXUA 1NNKA 1PDAA 1OQGA 3O6HA 2V84A 3CFZA 2DYXA 3DLNA 1MY4A 4FEDA 1NH7A 2Y84A 4PFYA 3TPAA 1IITA 4FAJA 2ABHA 3S2VA 2DE4A 3CR9A 4I9DA 1PBQA 2OJTA 2YPNA 5J1DA 3H3GA 1UTHB 1Y9UA 3VVEA 3CFLA 3PMVA 1VFDA 1AL3A 3KSXA 4JSDA 3VVDA 4JWXA 1N3XA 3DM0A 4PFWA 3VE1B 5DVFA 2X26A 4R6HA 4YKPA 4G8NA 2ANJA 4EF1A 2CMOA 1A8EA 2F5XA 3T9UA 4GFRA 3E4RA 3H6WA 3EF7A 3HV1A 4G8MA 5I57B 3OELA 5L9MA 1N7WA 1DOTA 5DVIA 3TCHA 3TUSA 1FQFA 1NNPA 1FTMA 2NXOA 3IOWA 1S7YA 3S9MC 3G3GA 1UTBA 4BDOA 2XXVA 4YB5A 1H43A 3RTWB 4TLLB 3N6TA 1VE4A 5IKBA 2R71A 1JW4A 4MLVA 4PQJA 4X1DA 2QS2A 5FHOA 5JEIA 4F2OA 1GV8A 3UA8A 2H99A 4OERA 3FXRA 3E3KA 2PMSA 4JBZA 2PBWA 1ELJA 5KCJA 2F7CA 2F8DA 1SBPA 4QSDA 1EU8A 1MXZA 4MH5A 1N0TA 3MC2A 3IORA 2OCUA 1H76A 2XHDA 5I59B 4O3CA 1URGA 2UVIA 3V8XB 2B3BA 1NFTA 2OLBA 1A8FA 2RC8A 4YKKA 3UORA 5BUUA 4NF8A 1PB7A 2P1SA 3QUJA 3FJ7A 5DT6A 1IXGA 1M5FA 4NMYA 3CRBA 1D9VA 1TFDA 4XKQA 1MXYA 3LSFB 4WXJA 4IY6A 3KN3A 2Q88A 3LR1A 3VLUA 4BDRA 4QFKA 2GHAA 1B9JA 4GLIA 3ILTB 3EQ1A 3Q29A 2Z8EA 1LGBC 2Q2CA 4RJZA 5ELVA 4RNSA 5B7DA 4EQ7A 1MY0A 4G2ZA 4R73A 3C9HA 2REJA 5CC2A 3VXBA 5AA2B 3QIMA 3K00A 3OD7A 4RK9A 3H06B 3BFTA 2GH9A 4POWA 4F18A 4BDMA 5CBRA 4KQPA 1Y3QA 5ICQA 4LONB 1RYOA 3TTMA 3T93B 1LBCA 5CMBA 5AA1A 3LUYA 1POTA 3U8QA 3FD3A 4DLDA 4F1UA 3G3JA 3IOVA 1P1NA 2HQ0A 3C33A 4GOTA 2FYIA 2ALUA 1ZTYA 3I6VA 1LB9A 2XXRA 1FTLA 1ZU0A 3MJNA 4F19A 3EHTA 3L6GA 4AB5A 4H6DA 2OBGA 4R2FA 3IO6A 1R9QA 1ZBMA 1A55A 4R74A 1AIVA 3R6UA 4OQOA 4I8CA 5H8NA 1FTOA 2Y7IA 1M5CA 4K3FA 4IO5A 4NE4A 3FJMA 4KYDA 2I4BA 1SVXB 3K1NA 3PUZE 4IB2A 2QS1A 3W15C 3FVKA 3TFLA 1A7LA 1P1QA 4KCCA 4FECA 2KLFA 2XXXA 3K4UA 3T66A 3U72A 2CZLA 1B5JA 4F31B 1MM6A 3LSWA 3RTFB 3LSXA 1FQEA 2DQVA 3FV2A 5H8QB 4OESA 1B7UA 4OZ9A 1MY3A 3IO4A 4MF3A 3K0VA 1URDA 1CB6A 3IK6B 5JTYB 1D3KA 5H8HA 3PD8A 2AL5A 1T0KA 4ESWA 2RKMA 4C1TA 4ONYA 3TTLA 2ZYOA 4QSCA 5EHMA 3G7WA 3DP6A 4DXCA 2X7QA 3HPIA 2Q9TA 2F6PA 4U1ZA 5CBSA 1H3DA 4KCDA 3GXAA 3KG2A 1USYE 4ZEFA 3K6UA 1GR2A 3JZJA 3RQTA 4E0XA 2O7UA 4JXIA 1LAFE 1N76A 3I3VA 1R9LA 1UIVA 3H6TA 3IR1A 4PETA 4G8HA 4NF5A 3PD9A 1D9YA 4L17A 3MVYA 3UIFA 1WODA 4OFOA 4F29A 1DSNA 1LCTA 3IB2A 1B3LA 1DTZA 2AIXA 3TZAA 4RK2A 5H8FA 2V3TA 1FTJA 2ZYMA 4G68B 1Y1ZA 1FCKA 3CVGA 4F2QA 4Q8RA 5AE4A 4OMBA 3SEXA 5BWJA 1QUJA 1IEJA 5EYFA 1P1OA 1BLFA 3BFUA 3QSLA 4G77A 2THIA 4R6YA 1IZ1A 4LATA 5CMMA 1VFEA 2UVHA 4IO4A 3MP1A 4EUOA 2Q89A 4LA9A 3PGFA 1QKAA 3KN8A 5TU0A 4GRKA 1MXWA 5ITPA 3CIJA 1NNFA 2A5SA 4BLAA 1B40A 4O3BA 4WKMA 1Y3NA 2O1MA 2Q2AA 3L6HA 1SI1A 5EHSA 2Z23A 2RC9A 3O97A 3BKIB 3B6QA 3KN7A 3WAFA 1ZJLA 1AMFA 3MW0A 3RLFE 3B7DA 1QUIA 4ECFA 4Z0IA 1TT1A 2GRVA 1SDXA 3HSTA 4LZ5A 1B46A 2XX8A 1MY1A 1B3FA 3TTRA 3DP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUX E;  1MPB A;  2PVU A;  1Y3P A;  5I58 B;  4YU0 A;  2F7A A;  4E0W A;  2XD3 A;  5FHN A;  5I2N B;  3A3U A;  1NKX A;  3CI8 A;  4XXU A;  3RNN A;  3PPR A;  3D4C A;  1MH4 A;  4LZ8 A;  1TXF A;  3FAT A;  1AOV A;  4OHN A;  3H6V A;  2GFE A;  2AYS A;  3D4G A;  1JEU A;  2BJJ X;  3DP8 A;  3O29 A;  4DCX A;  3B6T A;  4EDP A;  4ISU A;  1EH3 A;  2R9J A;  3OSQ A;  2VD3 A;  3UP9 A;  3K1P A;  1I6B A;  5HBC A;  3HHG A;  2HEU A;  4HS7 A;  1H45 A;  4XTC Q;  4NF4 B;  4F3P A;  3T96 B;  2OWS A;  3RY3 A;  4JB7 A;  4R75 A;  1Q1K A;  3MPK A;  2OZZ A;  1FQD A;  1B3H A;  1JVX A;  3ZKL A;  1KWH A;  3C34 A;  2QMX A;  4MBP A;  1UTB B;  4EQB A;  3H7M A;  2I3V A;  4XKR A;  2PT1 A;  2I49 A;  4FIM A;  1OVB A;  1BP5 A;  2Y7P A;  4DE8 A;  4IGT A;  4KYE A;  3O6I A;  4G4P A;  4H0W A;  2XD2 A;  3IB0 A;  4LVQ A;  1LCF A;  3KSJ A;  3H6U A;  4OET A;  2O84 X;  3RT6 B;  1VR5 A;  3S4U A;  3PPP A;  1IQ7 A;  3MBP A;  1M5B A;  1I6Q A;  2DWJ A;  1NMU A;  1IXH A;  3WAE A;  1XVX A;  5KCJ B;  3VDF A;  1B0H A;  2WKY A;  1H44 A;  2ZNS A;  2VD2 A;  1F9B A;  3UGW A;  3RN8 A;  1EZ9 A;  1MQH A;  3FZV A;  4ZDM A;  2OWT A;  2GHB A;  3SEU A;  4IO3 A;  3SEV A;  4QHQ A;  2UXA A;  1EZP A;  2VGQ A;  4NF8 B;  3N6U A;  4JWY A;  3IL1 B;  4EXL A;  1FQA A;  1Z7N E;  3G3K A;  4ZZE A;  1ATG A;  2RC7 A;  2ZYN A;  4IO2 A;  1LAH E;  3SEW A;  2DE3 A;  4YMB A;  4H65 A;  1MH3 A;  1QVS A;  4ZEK A;  4I62 A;  4QSE A;  3O6G A;  4IO7 A;  1TFA A;  4YAH X;  2DWH A;  3QK6 A;  5CMC A;  4RY1 A;  3QAX A;  3Q27 A;  4PFT A;  4ND9 A;  1SQY A;  3EHU A;  1SYH A;  2LAO A;  2XXW A;  4GL0 A;  4ZED A;  4PP0 A;  4TQU Q;  3FAS A;  4H8J A;  5ICT A;  2NWJ A;  1B5I A;  2Y7W A;  3TAJ A;  5ISU A;  3T22 A;  5CRY A;  3QXM A;  1QW0 A;  1PEB A;  2REG A;  1N7X A;  2DVC A;  1ZIU A;  2M8C A;  2QRY A;  4ZE9 A;  3FIR A;  1MXV A;  3K2D A;  1LB8 A;  3C35 A;  4OXV A;  2DXY A;  4DDD A;  4F39 A;  2Z22 A;  1OIB A;  1DPP A;  2Y7K A;  3TEP A;  2ONS A;  1Z7M E;  1N84 A;  3KJT A;  4AB6 A;  3HN0 A;  1OLA A;  1N04 A;  3ODB A;  3PMW A;  3S9E A;  2Z8F A;  5I2K B;  1MY2 A;  1YCJ A;  4P11 A;  3U92 A;  3TCF A;  4WEP A;  5TP9 A;  2VP1 A;  3MVW A;  1VSO A;  5H8N B;  4RPO A;  2NUV A;  4M1V A;  3FUZ A;  4LUB A;  4FAT A;  2DWA A;  4R6K A;  3O2A A;  1MQG A;  1XC1 A;  2XXH A;  4RPN A;  4ESX A;  1URS A;  4KFQ A;  3DEL B;  3B6W A;  3VV5 A;  3ILU B;  5A5X A;  4P0G A;  2PT2 A;  1I6A A;  1LFI A;  2DVZ A;  3FXQ A;  4NTL A;  1WDN A;  1B7H A;  2ONR A;  2O7I A;  1LFH A;  5AA4 A;  1XHY A;  1BKA A;  1BTJ A;  4R2B A;  1LLS A;  1SW2 A;  1AH5 A;  1XVY A;  1MG1 A;  3TKD A;  1NH8 A;  3LC8 A;  4N13 A;  2I4C A;  5TPA A;  3CSB A;  4NED A;  1JNF A;  1OVT A;  2E1S A;  4HW8 A;  1P99 A;  3MVX A;  3U93 A;  5L9S A;  3MAM A;  5H8H B;  1US4 A;  3IX1 A;  1B1H A;  4ZEI A;  3OEN A;  2V3U A;  3FVG A;  3KZG A;  1PC3 A;  2UYF A;  3OXN A;  1USY H;  4G68 C;  3F11 A;  2VOZ A;  1N3W A;  1XS5 A;  1J1N A;  4OWD A;  4Z7E A;  4U4S A;  2RCB A;  3O66 A;  4POX A;  4ZZA A;  4U21 A;  3G3I A;  2I3W A;  3M3K A;  5JK4 A;  3FJG A;  4FEB A;  4MFI A;  2HFB A;  1YTV A;  4UAC A;  3KOT A;  1NL5 A;  5KDT A;  4OFL A;  4LQ2 A;  4NF5 B;  1OQH A;  3BBR A;  1II5 A;  1Q35 A;  4OFJ A;  2DWI A;  4TOZ A;  5DEX B;  1QUL A;  1LAX A;  5H8F B;  4R9F A;  5I56 B;  2D21 A;  4N6P A;  3QUF A;  3UK4 A;  4X48 A;  3TDJ A;  1B4Z A;  1Y4C A;  4NF6 A;  1QUK A;  2P2A A;  1BIY A;  3FV1 A;  4BDQ A;  1IXI A;  5FTH A;  5H8S A;  2UVJ A;  4X1B A;  4OEU A;  3CFX A;  5AA3 A;  4FJP A;  5F1Q A;  2ZNT A;  3C36 A;  3OO7 A;  1Y1M A;  3G3H A;  3THI A;  3I5O A;  5FHM A;  4F3B A;  2Q8J A;  1MXX A;  3FXU A;  3HO7 A;  2RCA A;  2FNC A;  3HCQ A;  3S9N C;  1DMB A;  4X9T A;  3Q26 A;  1HSE A;  3QYT A;  3VLW A;  2IA4 A;  1P1W A;  3JYR A;  4UA8 A;  3MPL A;  2HZK A;  2H25 A;  2AL4 A;  4KI0 E;  1ANF A;  5L9O A;  1B7Z A;  1R1N A;  3O9P A;  1LST A;  1US5 A;  2V93 A;  3RT8 A;  3N94 A;  4KHZ E;  3KBR A;  1CE2 A;  1DPE A;  3OOA A;  4XKN A;  1SYI A;  1MM7 A;  3H4Z A;  4YB6 A;  2RF1 A;  2QPQ A;  3TTN A;  3CG3 A;  3VVF A;  1PB9 A;  3A3C A;  3OMB A;  2O69 A;  2A5T A;  5CM6 A;  3PV0 E;  1S50 A;  4TLM B;  3U94 A;  3PU5 A;  3SKP A;  4Q0C A;  4FE8 A;  2NVU B;  1MQJ A;  1B0L A;  1L5T A;  1XT8 A;  3PUW E;  1RYX A;  2F6G A;  4LQ5 A;  4RA1 A;  2FA7 A;  2HAV A;  2IEE A;  2HCA A;  4ZE8 A;  5I58 A;  4GWO A;  4N07 A;  4QFO A;  3CSG A;  1M5D A;  4BDN A;  5I2N A;  3CG1 A;  2QL3 A;  4JSO A;  5FTI A;  4GF8 A;  3K01 A;  1MRP A;  3USD A;  1UTH A;  1IIW A;  2G93 A;  4C0R A;  2O1L A;  1GGG A;  4QFL A;  4JDF A;  5B70 A;  3OEK A;  3V89 B;  1JQF A;  4XIG Q;  3K02 A;  1A54 A;  3P7I A;  3KEI A;  3VLV A;  2I6E A;  2UYE A;  1B58 A;  2NOO A;  2DXR A;  3N5L A;  1HSL A;  5DYH A;  1YPN A;  3OSR A;  4Q30 B;  4QF9 A;  4YKJ A;  4ELQ A;  3R7X A;  4F3S A;  1JW1 A;  4NF4 A;  4OYV A;  2B65 A;  2OK2 A;  2I0B A;  3V5A A;  4ELP A;  4OVJ A;  2RIN A;  5I57 A;  3ONM A;  1LFG A;  1JW5 A;  4XKP A;  4YZZ A;  3EHS A;  4U23 A;  3O28 A;  4YKI A;  4BDL A;  3MP6 A;  4IY5 A;  4OEN A;  3RUM A;  5ITO A;  3VXC A;  3TEL A;  4MLQ A;  1MQI A;  3ECR A;  1FW0 A;  3KFM A;  5I84 A;  1POY 1;  1R6Z A;  3T9X B;  1GTK A;  3MZB A;  4HCY A;  3IB1 A;  5DTB A;  4QFN A;  1FTK A;  3R26 A;  2XXQ A;  3GZG A;  4YB7 A;  1LBB A;  4OEV A;  3MZ9 A;  2DP8 A;  1UQW A;  2G29 A;  3LSL A;  2F7B A;  2Y7R A;  2H4I A;  4IO6 A;  2H98 A;  5M2V A;  1MQD A;  2XXI A;  1SW1 A;  1ZMG A;  2DE2 A;  5I59 A;  1Y20 A;  2Z8D A;  4F1Y A;  3V83 A;  3IOU A;  4AQ4 A;  3FVO A;  2V3Q A;  2XX9 A;  4U4X A;  4HCW A;  4F1V A;  4QRZ A;  3U1O A;  3N26 A;  1JVY A;  4DZ1 A;  1JEV A;  2B3F A;  3C4M A;  3ZKK A;  2H5Y A;  1D4N A;  3M3L A;  3MWB A;  1P1U A;  1SW4 A;  2E0S A;  1B1X A;  4U2R A;  1I69 A;  2W7Y A;  4GXS B;  2D5W A;  3VFJ A;  3EPE A;  4RXL A;  4NWD A;  4GXA A;  4ZEB A;  3EN3 A;  1ZKB A;  4H1X A;  4H5G A;  2DOJ A;  3PMX A;  4I1D A;  1DTG A;  5AA2 A;  3TMG A;  4PE5 B;  3SDF A;  5K2X A;  1MDP 1;  2R6G E;  4LP2 B;  3M8U A;  3IAZ A;  1XOC A;  2D3I A;  1B6H A;  2XX7 A;  3C32 A;  3MP8 A;  4DIG A;  1A40 A;  2O51 A;  1OLC A;  5K2Y A;  4QFP A;  3FGS A;  3MQ9 A;  5TP9 B;  3GLB A;  1SD3 A;  3TCG A;  2QS4 A;  3TQL A;  1O64 A;  2HAU A;  4GL8 A;  3SEY A;  1B32 A;  2XXT A;  1WVJ A;  5I2K A;  4OTE A;  3KJ7 A;  1EZO A;  5AA2 D;  4KYS A;  4LZ7 A;  5A5X B;  3GBB A;  4DCY A;  3HHF A;  1M5E A;  3K6V A;  2XXY A;  3JV9 A;  2ZYK A;  3RPW A;  3ZSF A;  5AA4 B;  1O63 A;  2I48 A;  3TYH A;  3K6W A;  4THI A;  1PB8 A;  3G3F A;  4U22 A;  3C31 A;  2F78 A;  4KPT A;  3MVZ A;  4ELO A;  5TPA B;  1FQB A;  1MDQ A;  3OO6 A;  2YLN A;  4U1O A;  4ZS9 A;  4KD5 A;  2I0C A;  2PX1 A;  3K6X A;  4H67 A;  3SES A;  2QJE A;  4C1U A;  4PFU A;  3PUY E;  4DXB A;  1HSJ A;  2P0S A;  3LBS A;  4Q5T A;  3E13 X;  1O7T A;  4NWC A;  3AXF A;  5H8Q A;  1YAE A;  1MS7 A;  1ZLQ A;  2UVG A;  2XXP A;  3IOT A;  4GVO A;  4M4G A;  4EQ9 A;  3MUQ A;  3PUV E;  2ZXT A;  3UN6 A;  1QJM A;  5L8D A;  1SI0 A;  2F35 A;  1RKM A;  1QKB A;  3KOS A;  5JTY A;  2F97 A;  4R72 A;  1B3E A;  2XXU A;  3SER A;  3OO8 A;  4KR5 A;  2QSX A;  2YJP A;  3MZ1 A;  1B2H A;  2HXW A;  2QMW A;  1FQC A;  4H5F A;  3W9V A;  3A09 A;  2O68 A;  1Y4T A;  3Q25 A;  1MPD A;  5KDT B;  3OEM A;  1B3G A;  1OMP A;  4IGR A;  4EF2 A;  3TTK A;  1S9T A;  1A99 A;  4GQO A;  4EXK A;  5CMK A;  1LAG E;  3GBA A;  1MPC A;  5CI5 A;  5KZT A;  1PBP A;  1NNT A;  3PPN A;  4NF6 B;  3T9V A;  1B05 A;  4JWO A;  3T9H B;  2DS9 A;  2O6A A;  3TQW A;  4ZEC A;  2DSF A;  2F36 A;  5HM4 B;  4WED A;  2VHA A;  5DEX A;  3K1M A;  2X7P A;  2ZNU A;  2ZMB A;  3FVN A;  4GIZ A;  3TOD A;  5I56 A;  4YIC A;  3E9X A;  1TWY A;  3S9L C;  5F7V A;  4G68 A;  3ZS6 A;  1B4H A;  5IAI A;  3OO9 A;  4FOR A;  4HTG A;  4F3G A;  4R9G A;  4YMA A;  3KGC A;  3PPQ A;  2QS3 A;  1B52 A;  3W9W A;  1UIU A;  3IJO B;  3PPO A;  2ONK E;  4RYA A;  3SET A;  4H8I A;  5DVJ A;  4O3A A;  1SW5 A;  4ELR A;  3RGY A;  5LOM A;  1IXC A;  2HZL A;  2V25 A;  1B51 A;  1JET A;  2I58 A;  4DXU A;  3Q28 A;  4F22 A;  4GD5 A;  1GVC A;  2F34 A;  1IUD A;  4P0I A;  3M3F A;  1B5H A;  3H03 A;  2ESN A;  5HPQ A;  2A5T B;  3IJX B;  2PYY A;  2H9B A;  1MXU A;  1NNK A;  1PDA A;  1OQG A;  3O6H A;  2V84 A;  3CFZ A;  2DYX A;  3DLN A;  1MY4 A;  4FED A;  1NH7 A;  2Y84 A;  4PFY A;  3TPA A;  1IIT A;  4FAJ A;  2ABH A;  3S2V A;  2DE4 A;  3CR9 A;  4I9D A;  1PBQ A;  2OJT A;  2YPN A;  5J1D A;  3H3G A;  1UTH B;  1Y9U A;  3VVE A;  3CFL A;  3PMV A;  1VFD A;  1AL3 A;  3KSX A;  4JSD A;  3VVD A;  4JWX A;  1N3X A;  3DM0 A;  4PFW A;  3VE1 B;  5DVF A;  2X26 A;  4R6H A;  4YKP A;  4G8N A;  2ANJ A;  4EF1 A;  2CMO A;  1A8E A;  2F5X A;  3T9U A;  4GFR A;  3E4R A;  3H6W A;  3EF7 A;  3HV1 A;  4G8M A;  5I57 B;  3OEL A;  5L9M A;  1N7W A;  1DOT A;  5DVI A;  3TCH A;  3TUS A;  1FQF A;  1NNP A;  1FTM A;  2NXO A;  3IOW A;  1S7Y A;  3S9M C;  3G3G A;  1UTB A;  4BDO A;  2XXV A;  4YB5 A;  1H43 A;  3RTW B;  4TLL B;  3N6T A;  1VE4 A;  5IKB A;  2R71 A;  1JW4 A;  4MLV A;  4PQJ A;  4X1D A;  2QS2 A;  5FHO A;  5JEI A;  4F2O A;  1GV8 A;  3UA8 A;  2H99 A;  4OER A;  3FXR A;  3E3K A;  2PMS A;  4JBZ A;  2PBW A;  1ELJ A;  5KCJ A;  2F7C A;  2F8D A;  1SBP A;  4QSD A;  1EU8 A;  1MXZ A;  4MH5 A;  1N0T A;  3MC2 A;  3IOR A;  2OCU A;  1H76 A;  2XHD A;  5I59 B;  4O3C A;  1URG A;  2UVI A;  3V8X B;  2B3B A;  1NFT A;  2OLB A;  1A8F A;  2RC8 A;  4YKK A;  3UOR A;  5BUU A;  4NF8 A;  1PB7 A;  2P1S A;  3QUJ A;  3FJ7 A;  5DT6 A;  1IXG A;  1M5F A;  4NMY A;  3CRB A;  1D9V A;  1TFD A;  4XKQ A;  1MXY A;  3LSF B;  4WXJ A;  4IY6 A;  3KN3 A;  2Q88 A;  3LR1 A;  3VLU A;  4BDR A;  4QFK A;  2GHA A;  1B9J A;  4GLI A;  3ILT B;  3EQ1 A;  3Q29 A;  2Z8E A;  1LGB C;  2Q2C A;  4RJZ A;  5ELV A;  4RNS A;  5B7D A;  4EQ7 A;  1MY0 A;  4G2Z A;  4R73 A;  3C9H A;  2REJ A;  5CC2 A;  3VXB A;  5AA2 B;  3QIM A;  3K00 A;  3OD7 A;  4RK9 A;  3H06 B;  3BFT A;  2GH9 A;  4POW A;  4F18 A;  4BDM A;  5CBR A;  4KQP A;  1Y3Q A;  5ICQ A;  4LON B;  1RYO A;  3TTM A;  3T93 B;  1LBC A;  5CMB A;  5AA1 A;  3LUY A;  1POT A;  3U8Q A;  3FD3 A;  4DLD A;  4F1U A;  3G3J A;  3IOV A;  1P1N A;  2HQ0 A;  3C33 A;  4GOT A;  2FYI A;  2ALU A;  1ZTY A;  3I6V A;  1LB9 A;  2XXR A;  1FTL A;  1ZU0 A;  3MJN A;  4F19 A;  3EHT A;  3L6G A;  4AB5 A;  4H6D A;  2OBG A;  4R2F A;  3IO6 A;  1R9Q A;  1ZBM A;  1A55 A;  4R74 A;  1AIV A;  3R6U A;  4OQO A;  4I8C A;  5H8N A;  1FTO A;  2Y7I A;  1M5C A;  4K3F A;  4IO5 A;  4NE4 A;  3FJM A;  4KYD A;  2I4B A;  1SVX B;  3K1N A;  3PUZ E;  4IB2 A;  2QS1 A;  3W15 C;  3FVK A;  3TFL A;  1A7L A;  1P1Q A;  4KCC A;  4FEC A;  2KLF A;  2XXX A;  3K4U A;  3T66 A;  3U72 A;  2CZL A;  1B5J A;  4F31 B;  1MM6 A;  3LSW A;  3RTF B;  3LSX A;  1FQE A;  2DQV A;  3FV2 A;  5H8Q B;  4OES A;  1B7U A;  4OZ9 A;  1MY3 A;  3IO4 A;  4MF3 A;  3K0V A;  1URD A;  1CB6 A;  3IK6 B;  5JTY B;  1D3K A;  5H8H A;  3PD8 A;  2AL5 A;  1T0K A;  4ESW A;  2RKM A;  4C1T A;  4ONY A;  3TTL A;  2ZYO A;  4QSC A;  5EHM A;  3G7W A;  3DP6 A;  4DXC A;  2X7Q A;  3HPI A;  2Q9T A;  2F6P A;  4U1Z A;  5CBS A;  1H3D A;  4KCD A;  3GXA A;  3KG2 A;  1USY E;  4ZEF A;  3K6U A;  1GR2 A;  3JZJ A;  3RQT A;  4E0X A;  2O7U A;  4JXI A;  1LAF E;  1N76 A;  3I3V A;  1R9L A;  1UIV A;  3H6T A;  3IR1 A;  4PET A;  4G8H A;  4NF5 A;  3PD9 A;  1D9Y A;  4L17 A;  3MVY A;  3UIF A;  1WOD A;  4OFO A;  4F29 A;  1DSN A;  1LCT A;  3IB2 A;  1B3L A;  1DTZ A;  2AIX A;  3TZA A;  4RK2 A;  5H8F A;  2V3T A;  1FTJ A;  2ZYM A;  4G68 B;  1Y1Z A;  1FCK A;  3CVG A;  4F2Q A;  4Q8R A;  5AE4 A;  4OMB A;  3SEX A;  5BWJ A;  1QUJ A;  1IEJ A;  5EYF A;  1P1O A;  1BLF A;  3BFU A;  3QSL A;  4G77 A;  2THI A;  4R6Y A;  1IZ1 A;  4LAT A;  5CMM A;  1VFE A;  2UVH A;  4IO4 A;  3MP1 A;  4EUO A;  2Q89 A;  4LA9 A;  3PGF A;  1QKA A;  3KN8 A;  5TU0 A;  4GRK A;  1MXW A;  5ITP A;  3CIJ A;  1NNF A;  2A5S A;  4BLA A;  1B40 A;  4O3B A;  4WKM A;  1Y3N A;  2O1M A;  2Q2A A;  3L6H A;  1SI1 A;  5EHS A;  2Z23 A;  2RC9 A;  3O97 A;  3BKI B;  3B6Q A;  3KN7 A;  3WAF A;  1ZJL A;  1AMF A;  3MW0 A;  3RLF E;  3B7D A;  1QUI A;  4ECF A;  4Z0I A;  1TT1 A;  2GRV A;  1SDX A;  3HST A;  4LZ5 A;  1B46 A;  2XX8 A;  1MY1 A;  1B3F A;  3TTR A;  3DP4 A; 
#chains in the Genus database with same CATH topology
 3PUX E;  1MPB A;  2PVU A;  1Y3P A;  5I58 B;  4YU0 A;  2F7A A;  4E0W A;  2XD3 A;  5FHN A;  5I2N B;  4PGP A;  3A3U A;  1NKX A;  3CI8 A;  4H45 A;  4XXU A;  3RNN A;  3PPR A;  3D4C A;  1MH4 A;  4LZ8 A;  1TXF A;  3FAT A;  1AOV A;  4O94 A;  4OHN A;  4IR8 A;  3H6V A;  2GFE A;  2AYS A;  3D4G A;  1JEU A;  1NUX A;  2BJJ X;  3DP8 A;  3O29 A;  3IFC A;  4DCX A;  3B6T A;  4OAN A;  4EDP A;  4ISU A;  1EH3 A;  1NUW A;  2OWZ A;  2R9J A;  3OSQ A;  2VD3 A;  3UP9 A;  3K1P A;  1I6B A;  5HBC A;  1NUZ A;  3HHG A;  2HEU A;  3RPL B;  4HS7 A;  1H45 A;  4XTC Q;  4NF4 B;  4F3P A;  3T96 B;  2OWS A;  3RY3 A;  4JB7 A;  4R75 A;  1Q1K A;  2L5V A;  3MPK A;  2OZZ A;  1FQD A;  1B3H A;  1JVX A;  1FPL A;  3ZKL A;  1KWH A;  3C34 A;  2QMX A;  4MBP A;  1UTB B;  4EQB A;  3H7M A;  2I3V A;  4XKR A;  2PT1 A;  2I49 A;  4FIM A;  1OVB A;  1BP5 A;  2Y7P A;  4DE8 A;  4IGT A;  4KYE A;  5LTC A;  3O6I A;  4G4P A;  4H0W A;  2XD2 A;  3IB0 A;  4LVQ A;  1LCF A;  3KSJ A;  3H6U A;  4OET A;  4AS5 A;  2O84 X;  3RT6 B;  1VR5 A;  3S4U A;  3PPP A;  1IQ7 A;  3MBP A;  1M5B A;  1I6Q A;  2DWJ A;  1NMU A;  1IXH A;  4LN5 A;  3WAE A;  4NX1 A;  1XVX A;  5KCJ B;  1IMC A;  4PAF A;  4PF6 A;  3VDF A;  1B0H A;  1FPI A;  4N6K A;  2WKY A;  1H44 A;  2ZNS A;  5ET7 A;  2VD2 A;  4GWU A;  1F9B A;  2B4L A;  3UGW A;  3RN8 A;  3NOH A;  1EZ9 A;  1MQH A;  3FZV A;  4ZDM A;  2OWT A;  2GHB A;  4XEQ A;  3SEU A;  4IO3 A;  3SEV A;  4QHQ A;  2UXA A;  1IMB A;  1EZP A;  2VGQ A;  4NF8 B;  3N6U A;  4JWY A;  3IL1 B;  4EXL A;  1FQA A;  1Z7N E;  3G3K A;  4ZZE A;  1ATG A;  2RC7 A;  2ZYN A;  4IO2 A;  1LAH E;  3SEW A;  4PBH A;  2DE3 A;  4YMB A;  4GBW A;  4H65 A;  3HFU A;  1MH3 A;  1QVS A;  5ET5 A;  4ZEK A;  4I62 A;  4GX3 A;  4QSE A;  3O6G A;  4OVQ A;  4IO7 A;  1TFA A;  4YAH X;  2DWH A;  3QK6 A;  5CMC A;  4RY1 A;  3QAX A;  3Q27 A;  4PFT A;  4ND9 A;  2Q74 A;  1SQY A;  3EHU A;  4NN3 A;  1SYH A;  2LAO A;  2XXW A;  4GL0 A;  4ZED A;  4PP0 A;  5EQA A;  4TQU Q;  1RDY A;  3FAS A;  4H8J A;  5ICT A;  2NWJ A;  1B5I A;  2Y7W A;  3TAJ A;  5ISU A;  3T22 A;  5CRY A;  3QXM A;  1QW0 A;  1PEB A;  2REG A;  1N7X A;  2DVC A;  2ZZV A;  1ZIU A;  4XF5 A;  2M8C A;  2QRY A;  4ZE9 A;  4OVR A;  3FIR A;  1MXV A;  3K2D A;  1LB8 A;  4GWY A;  3C35 A;  4OXV A;  2DXY A;  2XXK A;  4DDD A;  5I5P A;  4F39 A;  2Z22 A;  1Q9D A;  1OIB A;  1DPP A;  2Y7K A;  4N81 A;  3TEP A;  1RDZ A;  2ONS A;  1Z7M E;  1N84 A;  1G0I A;  4OVP A;  3KJT A;  4AB6 A;  3HN0 A;  1OLA A;  1N04 A;  3ODB A;  3PMW A;  5EQ7 A;  3S9E A;  2Z8F A;  5I2K B;  1MY2 A;  1YCJ A;  4P11 A;  3U92 A;  4P3L A;  3TCF A;  4WEP A;  1YXI A;  4JVC A;  5TP9 A;  2VP1 A;  3MVW A;  1JP4 A;  1VSO A;  5H8N B;  4RPO A;  2NUV A;  4M1V A;  3FUZ A;  4LUB A;  4FAT A;  2DWA A;  2DDK A;  4R6K A;  3O2A A;  1MQG A;  4GX6 A;  1XC1 A;  2XXH A;  4RPN A;  2WBB A;  4ESX A;  1URS A;  4KFQ A;  4MX6 A;  3DEL B;  3B6W A;  3VV5 A;  3ILU B;  5A5X A;  1CNQ A;  4P0G A;  2PT2 A;  1I6A A;  1LFI A;  2DVZ A;  3FXQ A;  4NTL A;  1WDN A;  1B7H A;  3BIG A;  2CZI A;  2ONR A;  2O7I A;  1LFH A;  5AA4 A;  1XHY A;  1BKA A;  1BTJ A;  4R2B A;  1LLS A;  1SW2 A;  1AH5 A;  1NV2 A;  1XVY A;  4XFE A;  1MG1 A;  3TKD A;  1NH8 A;  3LC8 A;  4N13 A;  2I4C A;  2ZZW A;  5TPA A;  3CSB A;  4NED A;  1JNF A;  1OVT A;  2BJI A;  1D9Q A;  3FXB A;  2E1S A;  4HW8 A;  1P99 A;  3MVX A;  2WX9 A;  1NV6 A;  3U93 A;  5L9S A;  3MAM A;  5H8H B;  1US4 A;  3IX1 A;  1B1H A;  4MEV A;  4ZEI A;  3OEN A;  2V3U A;  3FVG A;  3KZG A;  1PC3 A;  2UYF A;  3OXN A;  1USY H;  4G68 C;  3F11 A;  2VOZ A;  1N3W A;  4PC9 A;  1XS5 A;  1J1N A;  3B50 A;  4OWD A;  4Z7E A;  4U4S A;  2RCB A;  3O66 A;  4POX A;  2QVR A;  4ZZA A;  4U21 A;  3G3I A;  2I3W A;  3M3K A;  5JK4 A;  3FJG A;  4NAP A;  4FEB A;  4MFI A;  2HFB A;  1YTV A;  4UAC A;  5EYH A;  2KR0 A;  3KOT A;  4H46 A;  1NL5 A;  5KDT A;  4OFL A;  4LQ2 A;  1LBZ A;  4NF5 B;  1OQH A;  2HHM A;  3BBR A;  1II5 A;  1Q35 A;  4OFJ A;  4UAB A;  2DWI A;  4TOZ A;  1LBV A;  5DEX B;  2Y5K A;  1QUL A;  1LAX A;  5H8F B;  4R9F A;  5I56 B;  2D21 A;  4N6P A;  3QUF A;  3UK4 A;  4X48 A;  4G61 A;  3TDJ A;  1B4Z A;  1Y4C A;  4NF6 A;  1QUK A;  2P2A A;  4MMP A;  2QVU A;  1BIY A;  3FV1 A;  4BDQ A;  1IXI A;  5FTH A;  5H8S A;  2UVJ A;  1EYK A;  4X1B A;  4OEU A;  3CFX A;  5AA3 A;  4FJP A;  5F1Q A;  4PFR A;  2ZNT A;  2XWV A;  3C36 A;  3OO7 A;  1Y1M A;  3G3H A;  3THI A;  4OA4 A;  3I5O A;  5FHM A;  4F3B A;  2Q8J A;  1MXX A;  3FXU A;  3HO7 A;  2RCA A;  2FNC A;  3HCQ A;  5EYG A;  3S9N C;  1DMB A;  4X9T A;  3Q26 A;  1HSE A;  3QYT A;  3VLW A;  2IA4 A;  1P1W A;  4NG7 A;  3JYR A;  4UA8 A;  3MPL A;  2HZK A;  2H25 A;  2AL4 A;  4KI0 E;  1ANF A;  1LEV A;  5L9O A;  1B7Z A;  2CEX A;  1R1N A;  3O9P A;  1LST A;  1US5 A;  2OX3 A;  2V93 A;  4N4U A;  3RT8 A;  3N94 A;  4KHZ E;  3KBR A;  4O7I A;  1CE2 A;  1DPE A;  3OOA A;  4XKN A;  1SYI A;  1MM7 A;  3H4Z A;  4YB6 A;  2RF1 A;  2QPQ A;  1DCU A;  3E79 A;  3TTN A;  3CG3 A;  3VVF A;  2FBP A;  1PB9 A;  3A3C A;  5J16 A;  3OMB A;  2O69 A;  2A5T A;  5CM6 A;  4PFI A;  3PV0 E;  1S50 A;  4TLM B;  2VPO A;  3U94 A;  3PU5 A;  3SKP A;  4Q0C A;  2JJK A;  4FE8 A;  4HE2 A;  2NVU B;  1MQJ A;  1B0L A;  1L5T A;  1XT8 A;  3PUW E;  1RYX A;  2F6G A;  4LQ5 A;  4RA1 A;  2FA7 A;  2HAV A;  2IEE A;  2HCA A;  4ZE8 A;  5I58 A;  4GWO A;  4QFO A;  4N07 A;  3CSG A;  1M5D A;  4BDN A;  5I2N A;  1AWB A;  3CG1 A;  1YZ0 A;  2QL3 A;  4JSO A;  5FTI A;  4GF8 A;  3K01 A;  1MRP A;  3USD A;  1NI9 A;  1KA0 A;  1UTH A;  1IIW A;  2G93 A;  4C0R A;  2O1L A;  1GGG A;  1LBX A;  4QFL A;  4JDF A;  1G0H A;  5B70 A;  3OEK A;  3V89 B;  1JQF A;  4XIG Q;  3K02 A;  1A54 A;  3P7I A;  4N8Y A;  5ET6 A;  3KEI A;  3VLV A;  5IZ1 A;  2I6E A;  2UYE A;  1B58 A;  1FBH A;  2NOO A;  3KC0 A;  2DXR A;  1FBD A;  3N5L A;  1HSL A;  5DYH A;  2Q8M A;  1FJ6 A;  1YPN A;  3OSR A;  4Q30 B;  4QF9 A;  4YKJ A;  2WEF A;  4ELQ A;  3R7X A;  4F3S A;  1JW1 A;  4NF4 A;  4OYV A;  2B65 A;  2OK2 A;  2I0B A;  3V5A A;  4ELP A;  5EQ8 A;  1NV7 A;  4OVJ A;  2RIN A;  5I57 A;  3ONM A;  1LFG A;  1JW5 A;  4XKP A;  4YZZ A;  3EHS A;  4U23 A;  4N8G A;  3O28 A;  4YKI A;  4BDL A;  3MP6 A;  4GBV A;  4IY5 A;  4OEN A;  3RUM A;  2B4M A;  5ITO A;  3VXC A;  3TEL A;  4MLQ A;  1MQI A;  4PDD A;  3ECR A;  1FW0 A;  3KFM A;  2R8T A;  5I84 A;  1POY 1;  4N15 A;  1R6Z A;  3T9X B;  1GTK A;  3MZB A;  4HCY A;  3IB1 A;  5DTB A;  4QFN A;  2F3D A;  1FPK A;  1FTK A;  3R26 A;  2FIE A;  2XXQ A;  3GZG A;  5T3J A;  4YB7 A;  1LBB A;  2CEY A;  4OEV A;  3MZ9 A;  2DP8 A;  1UQW A;  3BIH A;  2G29 A;  3LSL A;  2F7B A;  3MYU A;  2Y7R A;  2H4I A;  4IO6 A;  2H98 A;  2PFY A;  5M2V A;  1MQD A;  2XXI A;  1SW1 A;  1ZMG A;  1DBZ A;  2DE2 A;  5I59 A;  1Y20 A;  2Z8D A;  4F1Y A;  3V83 A;  3IOU A;  4AQ4 A;  1NV5 A;  3FVO A;  2V3Q A;  2XX9 A;  4U4X A;  4HCW A;  4F1V A;  4QRZ A;  3U1O A;  1NV3 A;  3N26 A;  1JVY A;  4DZ1 A;  3LUZ A;  1JEV A;  2B3F A;  3C4M A;  3ZKK A;  2H5Y A;  1K9Y A;  1D4N A;  3M3L A;  3MWB A;  1BK4 A;  1P1U A;  1SW4 A;  2E0S A;  1B1X A;  4U2R A;  1I69 A;  2W7Y A;  1YYZ A;  4GXS B;  2D5W A;  4P8B A;  3VFJ A;  2WYK A;  3EPE A;  4RXL A;  4NWD A;  4GXA A;  3U65 A;  4ZEB A;  3EN3 A;  1ZKB A;  4H1X A;  4PAI A;  4H5G A;  2DOJ A;  3PMX A;  4I1D A;  4OVS A;  1DTG A;  5AA2 A;  3TMG A;  4PE5 B;  3SDF A;  5K2X A;  4MNP A;  1MDP 1;  2R6G E;  4LP2 B;  3M8U A;  3IAZ A;  1XOC A;  4I3E A;  2D3I A;  1B6H A;  2XX7 A;  4KXP A;  3C32 A;  4N91 A;  3MP8 A;  4DIG A;  1A40 A;  2O51 A;  1OLC A;  5K2Y A;  4QFP A;  3FGS A;  3MQ9 A;  5TP9 B;  3GLB A;  1SD3 A;  3TCG A;  4MIJ A;  2PFZ A;  2QS4 A;  3FBP A;  3TQL A;  1O64 A;  2HAU A;  4I40 A;  4GL8 A;  3SEY A;  1B32 A;  2FVZ A;  2XXT A;  4PGN A;  1WVJ A;  5I2K A;  4OTE A;  3KJ7 A;  1EZO A;  5AA2 D;  4KYS A;  1FBC A;  4LZ7 A;  5A5X B;  3GBB A;  4DCY A;  3ISP A;  4GWX A;  3HHF A;  1M5E A;  3K6V A;  1FBE A;  2XXY A;  3JV9 A;  2ZYK A;  3RPW A;  3ZSF A;  2WYP A;  5AA4 B;  4O7M A;  4PCD A;  4O8M A;  4GWZ A;  1O63 A;  2I48 A;  3TYH A;  3K6W A;  4THI A;  1PB8 A;  3G3F A;  4U22 A;  3C31 A;  2F78 A;  4MNI A;  4KPT A;  3MVZ A;  4ELO A;  5TPA B;  1FQB A;  1MDQ A;  2QVV A;  3OO6 A;  2QFL A;  2YLN A;  4U1O A;  4ZS9 A;  4KD5 A;  2CZK A;  2I0C A;  1KA1 A;  2PX1 A;  3K6X A;  4H67 A;  3SES A;  2QJE A;  4C1U A;  4PFU A;  3PUY E;  4DXB A;  1HSJ A;  2P0S A;  3LBS A;  4Q5T A;  3E13 X;  1O7T A;  2XWI A;  4NWC A;  3AXF A;  4HE0 A;  5H8Q A;  1YAE A;  1MS7 A;  1ZLQ A;  2UVG A;  2XXP A;  3IOT A;  4GVO A;  2HPG A;  4M4G A;  4N17 A;  4EQ9 A;  3MUQ A;  3PUV E;  2ZXT A;  3UN6 A;  1QJM A;  5L8D A;  1SI0 A;  2F35 A;  1RKM A;  1QKB A;  4MHF A;  3KOS A;  5JTY A;  1NV0 A;  5ESY A;  2F97 A;  4R72 A;  1B3E A;  2XXU A;  3SER A;  3OO8 A;  4KR5 A;  2QSX A;  2YJP A;  3MZ1 A;  1B2H A;  2HXW A;  4MNC A;  2V4C A;  2QMW A;  1FQC A;  4H5F A;  3W9V A;  3A09 A;  4MJO A;  2O68 A;  1Y4T A;  3KC1 A;  3Q25 A;  1MPD A;  5KDT B;  3OEM A;  1B3G A;  1OMP A;  4IGR A;  4EF2 A;  4P1E A;  3TTK A;  1S9T A;  1QGX A;  1A99 A;  4GQO A;  1FPF A;  4EXK A;  5CMK A;  1LAG E;  3GBA A;  1MPC A;  5CI5 A;  5KZT A;  1PBP A;  1NNT A;  3PPN A;  4NF6 B;  3T9V A;  1B05 A;  4JWO A;  3T9H B;  2DS9 A;  2O6A A;  3TQW A;  4ZEC A;  2DSF A;  2F36 A;  5HM4 B;  4WED A;  2VHA A;  5DEX A;  3K1M A;  2X7P A;  2ZNU A;  2ZMB A;  3FVN A;  4GIZ A;  3TOD A;  3IFA A;  5I56 A;  4YIC A;  3E9X A;  1TWY A;  3S9L C;  5F7V A;  5IM2 A;  4G68 A;  3ZS6 A;  1B4H A;  5IGA A;  5IAI A;  3OO9 A;  1FJ9 A;  4FOR A;  4HTG A;  4F3G A;  4R9G A;  4YMA A;  3KGC A;  3PPQ A;  2QS3 A;  1FTA A;  1B52 A;  3W9W A;  1UIU A;  3IJO B;  3PPO A;  2ONK E;  4RYA A;  3SET A;  4H8I A;  2WBD A;  2Y5L A;  2HXR A;  5DVJ A;  4O3A A;  4PBQ A;  1SW5 A;  4ELR A;  3RGY A;  5LOM A;  3A29 A;  1IXC A;  2HZL A;  2V25 A;  5A5L A;  1B51 A;  1JET A;  2I58 A;  4DXU A;  5IZZ A;  3Q28 A;  4F22 A;  4GD5 A;  1GVC A;  2F34 A;  1IUD A;  4P0I A;  3M3F A;  1B5H A;  3H03 A;  2ESN A;  4N6D A;  5HPQ A;  2A5T B;  3IJX B;  2PYY A;  2H9B A;  1MXU A;  1NNK A;  1FPJ A;  1PDA A;  1OQG A;  3O6H A;  2V84 A;  5IZ3 A;  3CFZ A;  2DYX A;  3DLN A;  3D1R A;  1MY4 A;  4FED A;  4P56 A;  1NH7 A;  2Y84 A;  4PFY A;  4GX4 A;  3TPA A;  1IIT A;  4FAJ A;  3T0J A;  2ABH A;  3S2V A;  2DE4 A;  3CR9 A;  4I9D A;  1FPB A;  1PBQ A;  2OJT A;  1EYI A;  2YPN A;  5J1D A;  3H3G A;  1UTH B;  1NUY A;  1Y9U A;  3VVE A;  3CFL A;  3PMV A;  1VFD A;  1AL3 A;  3KSX A;  4P1L A;  3T1B A;  4JSD A;  3VVD A;  4JWX A;  1N3X A;  3DM0 A;  4PFW A;  3VE1 B;  5DVF A;  2X26 A;  1IME A;  4GWS A;  4R6H A;  4YKP A;  4MCO A;  4G8N A;  2ANJ A;  4PFB A;  4EF1 A;  2CMO A;  1FPE A;  1A8E A;  3LV0 A;  2F5X A;  3T9U A;  1FPG A;  4GFR A;  4NF0 A;  3RPL A;  3E4R A;  2GQ1 A;  2P3V A;  3H6W A;  3EF7 A;  3HV1 A;  4G8M A;  5I57 B;  3OEL A;  5L9M A;  1N7W A;  1DOT A;  5DVI A;  3TCH A;  3TUS A;  1FQF A;  1NNP A;  4OVT A;  1FTM A;  2NXO A;  3IOW A;  1S7Y A;  2FHY A;  3S9M C;  2XA5 A;  3G3G A;  1UTB A;  4BDO A;  2XXV A;  4YB5 A;  1H43 A;  3RTW B;  4TLL B;  3N6T A;  4X8R A;  2CZH A;  1VE4 A;  5IKB A;  2R71 A;  1JW4 A;  4MLV A;  4PQJ A;  4X1D A;  2QS2 A;  5FHO A;  4JVD A;  5JEI A;  4F2O A;  1GV8 A;  3UA8 A;  2H99 A;  4PTK A;  1FBF A;  4OER A;  3FXR A;  3E3K A;  2PMS A;  4JBZ A;  2PBW A;  4AS4 A;  1ELJ A;  3PTY A;  5KCJ A;  1FBP A;  2F7C A;  2F8D A;  1SBP A;  4QSD A;  1EU8 A;  1MXZ A;  4MH5 A;  1N0T A;  3MC2 A;  3IOR A;  2OCU A;  1H76 A;  2XHD A;  5I59 B;  4O3C A;  5I7I A;  1NV4 A;  5DW8 A;  1FSA A;  1URG A;  2UVI A;  3V8X B;  2B3B A;  1NFT A;  1DK4 A;  2OLB A;  4JVI A;  1A8F A;  4MAG A;  2RC8 A;  4YKK A;  3UOR A;  5BUU A;  4NF8 A;  1PB7 A;  2P1S A;  3QUJ A;  3FJ7 A;  5DT6 A;  1IMD A;  1IXG A;  1M5F A;  4NMY A;  3CRB A;  1D9V A;  1TFD A;  4XKQ A;  1MXY A;  3LSF B;  4WXJ A;  4IY6 A;  3KN3 A;  2Q88 A;  3LR1 A;  3VLU A;  4BDR A;  4QFK A;  2GHA A;  1B9J A;  4GLI A;  3ILT B;  5F24 A;  4NQ8 A;  5EQ9 A;  3EQ1 A;  3Q29 A;  2Z8E A;  1LGB C;  2Q2C A;  1NV1 A;  4RJZ A;  1XI6 A;  5ELV A;  4RNS A;  5B7D A;  4EQ7 A;  1MY0 A;  1INP A;  4G2Z A;  4R73 A;  3C9H A;  2REJ A;  5CC2 A;  3VXB A;  5AA2 B;  3QIM A;  3K00 A;  3OD7 A;  4RK9 A;  3H06 B;  2ZZX A;  2PCR A;  3BFT A;  2GH9 A;  4POW A;  4F18 A;  4BDM A;  5CBR A;  4KQP A;  1Y3Q A;  5ICQ A;  4LON B;  2MKZ A;  1RYO A;  3TTM A;  3KBZ A;  3T93 B;  1LBC A;  5CMB A;  5AA1 A;  3LUY A;  1POT A;  3U8Q A;  3FD3 A;  4DLD A;  4F1U A;  2XWK A;  3GYY A;  1FBG A;  1FPD A;  3G3J A;  3IOV A;  1P1N A;  2HQ0 A;  3C33 A;  4GOT A;  2FYI A;  2ALU A;  1ZTY A;  3I6V A;  1LB9 A;  2XXR A;  1FTL A;  1ZU0 A;  3MJN A;  3E78 A;  4F19 A;  3EHT A;  1K9Z A;  3L6G A;  4AB5 A;  4PAK A;  4H6D A;  2OBG A;  4R2F A;  3IO6 A;  1R9Q A;  1ZBM A;  1IMF A;  1A55 A;  4R74 A;  1AIV A;  3R6U A;  3RYD A;  1SPI A;  4OQO A;  4I8C A;  4GWW A;  5H8N A;  1RDX A;  5ET8 A;  1FTO A;  2Y7I A;  1M5C A;  4K3F A;  4IO5 A;  4NE4 A;  3FJM A;  4KYD A;  2I4B A;  1SVX B;  3K1N A;  3PUZ E;  4QBA A;  4IB2 A;  2QS1 A;  3W15 C;  3FVK A;  3B8B A;  1IMA A;  3TFL A;  3ROJ A;  1A7L A;  1P1Q A;  4KCC A;  4FEC A;  2KLF A;  2XXX A;  3K4U A;  2XWO A;  3T66 A;  3U72 A;  2CZL A;  2VT5 A;  1B5J A;  4F31 B;  3MST A;  1MM6 A;  2F3B A;  3LSW A;  3RTF B;  3LSX A;  1FQE A;  2DQV A;  3FV2 A;  5H8Q B;  1VDW A;  4OES A;  1B7U A;  3CHG A;  4OZ9 A;  3EKI A;  4DI4 B;  1MY3 A;  3IO4 A;  4MF3 A;  3K0V A;  4FBP A;  1URD A;  1CB6 A;  3IK6 B;  5I3S A;  2VPN A;  3SZP A;  5JTY B;  5FBP A;  1D3K A;  5H8H A;  3PD8 A;  2AL5 A;  1EYJ A;  5LDZ A;  1T0K A;  4ESW A;  2FIX A;  2RKM A;  4C1T A;  4ONY A;  3TTL A;  2ZYO A;  4QSC A;  5EHM A;  3G7W A;  3DP6 A;  4DXC A;  2X7Q A;  3HPI A;  4X04 A;  2Q9T A;  2F6P A;  4HXV A;  4U1Z A;  5CBS A;  1H3D A;  4KCD A;  3GXA A;  3KG2 A;  1USY E;  4ZEF A;  3K6U A;  1GR2 A;  3JZJ A;  4I3Y A;  3RQT A;  4E0X A;  2O7U A;  4JXI A;  1LAF E;  1N76 A;  3I3V A;  1R9L A;  1UIV A;  3H6T A;  3IR1 A;  4PET A;  4G8H A;  4NF5 A;  3PD9 A;  1D9Y A;  4L17 A;  3MVY A;  4HE1 A;  3UIF A;  4P47 A;  1WOD A;  4OFO A;  4F29 A;  1DSN A;  1LCT A;  3IB2 A;  1B3L A;  1DTZ A;  2AIX A;  3TZA A;  4RK2 A;  5H8F A;  2V3T A;  1FTJ A;  2ZYM A;  4G68 B;  1Y1Z A;  1FCK A;  3CVG A;  4F2Q A;  4Q8R A;  5AE4 A;  4OMB A;  3SEX A;  5BWJ A;  1QUJ A;  1IEJ A;  5EYF A;  1P1O A;  1BLF A;  3BFU A;  1FRP A;  3QSL A;  4G77 A;  2THI A;  3QMF A;  4R6Y A;  1IZ1 A;  4LAT A;  5CMM A;  1VFE A;  4QXD A;  4PDH A;  2UVH A;  4IO4 A;  3MP1 A;  4EUO A;  4NGU A;  2Q89 A;  4LA9 A;  2KQZ A;  3PGF A;  1LBY A;  1QKA A;  4P9K A;  3KN8 A;  5TU0 A;  4GRK A;  1MXW A;  4NHB A;  4PE3 A;  5ITP A;  1KZ8 A;  3CIJ A;  1NNF A;  2A5S A;  4BLA A;  1B40 A;  4O3B A;  4WKM A;  1Y3N A;  2O1M A;  1LBW A;  2Q2A A;  3L6H A;  1SI1 A;  5EHS A;  2P3N A;  2Z23 A;  4PF8 A;  2RC9 A;  3O97 A;  3BKI B;  5IZ3 B;  3B6Q A;  3KN7 A;  3WAF A;  1ZJL A;  1AMF A;  3MW0 A;  3RLF E;  3B7D A;  1QUI A;  4ECF A;  4Z0I A;  1TT1 A;  2GRV A;  1SDX A;  3HST A;  4LZ5 A;  1B46 A;  2XX8 A;  1MY1 A;  1B3F A;  4DI3 D;  3TTR A;  3DP4 A; 
#chains in the Genus database with same CATH homology
 3PUX E;  1MPB A;  2PVU A;  1Y3P A;  5I58 B;  4YU0 A;  2F7A A;  4E0W A;  2XD3 A;  5FHN A;  5I2N B;  3A3U A;  1NKX A;  3CI8 A;  4XXU A;  3RNN A;  3PPR A;  3D4C A;  1MH4 A;  4LZ8 A;  1TXF A;  3FAT A;  1AOV A;  4OHN A;  3H6V A;  2GFE A;  2AYS A;  3D4G A;  1JEU A;  2BJJ X;  3DP8 A;  3O29 A;  4DCX A;  3B6T A;  4EDP A;  4ISU A;  1EH3 A;  2R9J A;  3OSQ A;  2VD3 A;  3UP9 A;  3K1P A;  1I6B A;  5HBC A;  3HHG A;  2HEU A;  4HS7 A;  1H45 A;  4XTC Q;  4NF4 B;  4F3P A;  3T96 B;  2OWS A;  3RY3 A;  4JB7 A;  4R75 A;  1Q1K A;  3MPK A;  2OZZ A;  1FQD A;  1B3H A;  1JVX A;  3ZKL A;  1KWH A;  3C34 A;  2QMX A;  4MBP A;  1UTB B;  4EQB A;  3H7M A;  2I3V A;  4XKR A;  2PT1 A;  2I49 A;  4FIM A;  1OVB A;  1BP5 A;  2Y7P A;  4DE8 A;  4IGT A;  4KYE A;  3O6I A;  4G4P A;  4H0W A;  2XD2 A;  3IB0 A;  4LVQ A;  1LCF A;  3KSJ A;  3H6U A;  4OET A;  2O84 X;  3RT6 B;  1VR5 A;  3S4U A;  3PPP A;  1IQ7 A;  3MBP A;  1M5B A;  1I6Q A;  2DWJ A;  1NMU A;  1IXH A;  3WAE A;  1XVX A;  5KCJ B;  3VDF A;  1B0H A;  2WKY A;  1H44 A;  2ZNS A;  2VD2 A;  1F9B A;  3UGW A;  3RN8 A;  1EZ9 A;  1MQH A;  3FZV A;  4ZDM A;  2OWT A;  2GHB A;  3SEU A;  4IO3 A;  3SEV A;  4QHQ A;  2UXA A;  1EZP A;  2VGQ A;  4NF8 B;  3N6U A;  4JWY A;  3IL1 B;  4EXL A;  1FQA A;  1Z7N E;  3G3K A;  4ZZE A;  1ATG A;  2RC7 A;  2ZYN A;  4IO2 A;  1LAH E;  3SEW A;  2DE3 A;  4YMB A;  4H65 A;  1MH3 A;  1QVS A;  4ZEK A;  4I62 A;  4QSE A;  3O6G A;  4IO7 A;  1TFA A;  4YAH X;  2DWH A;  3QK6 A;  5CMC A;  4RY1 A;  3QAX A;  3Q27 A;  4PFT A;  4ND9 A;  1SQY A;  3EHU A;  1SYH A;  2LAO A;  2XXW A;  4GL0 A;  4ZED A;  4PP0 A;  4TQU Q;  3FAS A;  4H8J A;  5ICT A;  2NWJ A;  1B5I A;  2Y7W A;  3TAJ A;  5ISU A;  3T22 A;  5CRY A;  3QXM A;  1QW0 A;  1PEB A;  2REG A;  1N7X A;  2DVC A;  1ZIU A;  2M8C A;  2QRY A;  4ZE9 A;  3FIR A;  1MXV A;  3K2D A;  1LB8 A;  3C35 A;  4OXV A;  2DXY A;  4DDD A;  4F39 A;  2Z22 A;  1OIB A;  1DPP A;  2Y7K A;  3TEP A;  2ONS A;  1Z7M E;  1N84 A;  3KJT A;  4AB6 A;  3HN0 A;  1OLA A;  1N04 A;  3ODB A;  3PMW A;  3S9E A;  2Z8F A;  5I2K B;  1MY2 A;  1YCJ A;  4P11 A;  3U92 A;  3TCF A;  4WEP A;  5TP9 A;  2VP1 A;  3MVW A;  1VSO A;  5H8N B;  4RPO A;  2NUV A;  4M1V A;  3FUZ A;  4LUB A;  4FAT A;  2DWA A;  4R6K A;  3O2A A;  1MQG A;  1XC1 A;  2XXH A;  4RPN A;  4ESX A;  1URS A;  4KFQ A;  3DEL B;  3B6W A;  3VV5 A;  3ILU B;  5A5X A;  4P0G A;  2PT2 A;  1I6A A;  1LFI A;  2DVZ A;  3FXQ A;  4NTL A;  1WDN A;  1B7H A;  2ONR A;  2O7I A;  1LFH A;  5AA4 A;  1XHY A;  1BKA A;  1BTJ A;  4R2B A;  1LLS A;  1SW2 A;  1AH5 A;  1XVY A;  1MG1 A;  3TKD A;  1NH8 A;  3LC8 A;  4N13 A;  2I4C A;  5TPA A;  3CSB A;  4NED A;  1JNF A;  1OVT A;  2E1S A;  4HW8 A;  1P99 A;  3MVX A;  3U93 A;  5L9S A;  3MAM A;  5H8H B;  1US4 A;  3IX1 A;  1B1H A;  4ZEI A;  3OEN A;  2V3U A;  3FVG A;  3KZG A;  1PC3 A;  2UYF A;  3OXN A;  1USY H;  4G68 C;  3F11 A;  2VOZ A;  1N3W A;  1XS5 A;  1J1N A;  4OWD A;  4Z7E A;  4U4S A;  2RCB A;  3O66 A;  4POX A;  4ZZA A;  4U21 A;  3G3I A;  2I3W A;  3M3K A;  5JK4 A;  3FJG A;  4FEB A;  4MFI A;  2HFB A;  1YTV A;  4UAC A;  3KOT A;  1NL5 A;  5KDT A;  4OFL A;  4LQ2 A;  4NF5 B;  1OQH A;  3BBR A;  1II5 A;  1Q35 A;  4OFJ A;  2DWI A;  4TOZ A;  5DEX B;  1QUL A;  1LAX A;  5H8F B;  4R9F A;  5I56 B;  2D21 A;  4N6P A;  3QUF A;  3UK4 A;  4X48 A;  3TDJ A;  1B4Z A;  1Y4C A;  4NF6 A;  1QUK A;  2P2A A;  1BIY A;  3FV1 A;  4BDQ A;  1IXI A;  5FTH A;  5H8S A;  2UVJ A;  4X1B A;  4OEU A;  3CFX A;  5AA3 A;  4FJP A;  5F1Q A;  2ZNT A;  3C36 A;  3OO7 A;  1Y1M A;  3G3H A;  3THI A;  3I5O A;  5FHM A;  4F3B A;  2Q8J A;  1MXX A;  3FXU A;  3HO7 A;  2RCA A;  2FNC A;  3HCQ A;  3S9N C;  1DMB A;  4X9T A;  3Q26 A;  1HSE A;  3QYT A;  3VLW A;  2IA4 A;  1P1W A;  3JYR A;  4UA8 A;  3MPL A;  2HZK A;  2H25 A;  2AL4 A;  4KI0 E;  1ANF A;  5L9O A;  1B7Z A;  1R1N A;  3O9P A;  1LST A;  1US5 A;  2V93 A;  3RT8 A;  3N94 A;  4KHZ E;  3KBR A;  1CE2 A;  1DPE A;  3OOA A;  4XKN A;  1SYI A;  1MM7 A;  3H4Z A;  4YB6 A;  2RF1 A;  2QPQ A;  3TTN A;  3CG3 A;  3VVF A;  1PB9 A;  3A3C A;  3OMB A;  2O69 A;  2A5T A;  5CM6 A;  3PV0 E;  1S50 A;  4TLM B;  3U94 A;  3PU5 A;  3SKP A;  4Q0C A;  4FE8 A;  2NVU B;  1MQJ A;  1B0L A;  1L5T A;  1XT8 A;  3PUW E;  1RYX A;  2F6G A;  4LQ5 A;  4RA1 A;  2FA7 A;  2HAV A;  2IEE A;  2HCA A;  4ZE8 A;  5I58 A;  4GWO A;  4N07 A;  4QFO A;  3CSG A;  1M5D A;  4BDN A;  5I2N A;  3CG1 A;  2QL3 A;  4JSO A;  5FTI A;  4GF8 A;  3K01 A;  1MRP A;  3USD A;  1UTH A;  1IIW A;  2G93 A;  4C0R A;  2O1L A;  1GGG A;  4QFL A;  4JDF A;  5B70 A;  3OEK A;  3V89 B;  1JQF A;  4XIG Q;  3K02 A;  1A54 A;  3P7I A;  3KEI A;  3VLV A;  2I6E A;  2UYE A;  1B58 A;  2NOO A;  2DXR A;  3N5L A;  1HSL A;  5DYH A;  1YPN A;  3OSR A;  4Q30 B;  4QF9 A;  4YKJ A;  4ELQ A;  3R7X A;  4F3S A;  1JW1 A;  4NF4 A;  4OYV A;  2B65 A;  2OK2 A;  2I0B A;  3V5A A;  4ELP A;  4OVJ A;  2RIN A;  5I57 A;  3ONM A;  1LFG A;  1JW5 A;  4XKP A;  4YZZ A;  3EHS A;  4U23 A;  3O28 A;  4YKI A;  4BDL A;  3MP6 A;  4IY5 A;  4OEN A;  3RUM A;  5ITO A;  3VXC A;  3TEL A;  4MLQ A;  1MQI A;  3ECR A;  1FW0 A;  3KFM A;  5I84 A;  1POY 1;  1R6Z A;  3T9X B;  1GTK A;  3MZB A;  4HCY A;  3IB1 A;  5DTB A;  4QFN A;  1FTK A;  3R26 A;  2XXQ A;  3GZG A;  4YB7 A;  1LBB A;  4OEV A;  3MZ9 A;  2DP8 A;  1UQW A;  2G29 A;  3LSL A;  2F7B A;  2Y7R A;  2H4I A;  4IO6 A;  2H98 A;  5M2V A;  1MQD A;  2XXI A;  1SW1 A;  1ZMG A;  2DE2 A;  5I59 A;  1Y20 A;  2Z8D A;  4F1Y A;  3V83 A;  3IOU A;  4AQ4 A;  3FVO A;  2V3Q A;  2XX9 A;  4U4X A;  4HCW A;  4F1V A;  4QRZ A;  3U1O A;  3N26 A;  1JVY A;  4DZ1 A;  1JEV A;  2B3F A;  3C4M A;  3ZKK A;  2H5Y A;  1D4N A;  3M3L A;  3MWB A;  1P1U A;  1SW4 A;  2E0S A;  1B1X A;  4U2R A;  1I69 A;  2W7Y A;  4GXS B;  2D5W A;  3VFJ A;  3EPE A;  4RXL A;  4NWD A;  4GXA A;  4ZEB A;  3EN3 A;  1ZKB A;  4H1X A;  4H5G A;  2DOJ A;  3PMX A;  4I1D A;  1DTG A;  5AA2 A;  3TMG A;  4PE5 B;  3SDF A;  5K2X A;  1MDP 1;  2R6G E;  4LP2 B;  3M8U A;  3IAZ A;  1XOC A;  2D3I A;  1B6H A;  2XX7 A;  3C32 A;  3MP8 A;  4DIG A;  1A40 A;  2O51 A;  1OLC A;  5K2Y A;  4QFP A;  3FGS A;  3MQ9 A;  5TP9 B;  3GLB A;  1SD3 A;  3TCG A;  2QS4 A;  3TQL A;  1O64 A;  2HAU A;  4GL8 A;  3SEY A;  1B32 A;  2XXT A;  1WVJ A;  5I2K A;  4OTE A;  3KJ7 A;  1EZO A;  5AA2 D;  4KYS A;  4LZ7 A;  5A5X B;  3GBB A;  4DCY A;  3HHF A;  1M5E A;  3K6V A;  2XXY A;  3JV9 A;  2ZYK A;  3RPW A;  3ZSF A;  5AA4 B;  1O63 A;  2I48 A;  3TYH A;  3K6W A;  4THI A;  1PB8 A;  3G3F A;  4U22 A;  3C31 A;  2F78 A;  4KPT A;  3MVZ A;  4ELO A;  5TPA B;  1FQB A;  1MDQ A;  3OO6 A;  2YLN A;  4U1O A;  4ZS9 A;  4KD5 A;  2I0C A;  2PX1 A;  3K6X A;  4H67 A;  3SES A;  2QJE A;  4C1U A;  4PFU A;  3PUY E;  4DXB A;  1HSJ A;  2P0S A;  3LBS A;  4Q5T A;  3E13 X;  1O7T A;  4NWC A;  3AXF A;  5H8Q A;  1YAE A;  1MS7 A;  1ZLQ A;  2UVG A;  2XXP A;  3IOT A;  4GVO A;  4M4G A;  4EQ9 A;  3MUQ A;  3PUV E;  2ZXT A;  3UN6 A;  1QJM A;  5L8D A;  1SI0 A;  2F35 A;  1RKM A;  1QKB A;  3KOS A;  5JTY A;  2F97 A;  4R72 A;  1B3E A;  2XXU A;  3SER A;  3OO8 A;  4KR5 A;  2QSX A;  2YJP A;  3MZ1 A;  1B2H A;  2HXW A;  2QMW A;  1FQC A;  4H5F A;  3W9V A;  3A09 A;  2O68 A;  1Y4T A;  3Q25 A;  1MPD A;  5KDT B;  3OEM A;  1B3G A;  1OMP A;  4IGR A;  4EF2 A;  3TTK A;  1S9T A;  1A99 A;  4GQO A;  4EXK A;  5CMK A;  1LAG E;  3GBA A;  1MPC A;  5CI5 A;  5KZT A;  1PBP A;  1NNT A;  3PPN A;  4NF6 B;  3T9V A;  1B05 A;  4JWO A;  3T9H B;  2DS9 A;  2O6A A;  3TQW A;  4ZEC A;  2DSF A;  2F36 A;  5HM4 B;  4WED A;  2VHA A;  5DEX A;  3K1M A;  2X7P A;  2ZNU A;  2ZMB A;  3FVN A;  4GIZ A;  3TOD A;  5I56 A;  4YIC A;  3E9X A;  1TWY A;  3S9L C;  5F7V A;  4G68 A;  3ZS6 A;  1B4H A;  5IAI A;  3OO9 A;  4FOR A;  4HTG A;  4F3G A;  4R9G A;  4YMA A;  3KGC A;  3PPQ A;  2QS3 A;  1B52 A;  3W9W A;  1UIU A;  3IJO B;  3PPO A;  2ONK E;  4RYA A;  3SET A;  4H8I A;  5DVJ A;  4O3A A;  1SW5 A;  4ELR A;  3RGY A;  5LOM A;  1IXC A;  2HZL A;  2V25 A;  1B51 A;  1JET A;  2I58 A;  4DXU A;  3Q28 A;  4F22 A;  4GD5 A;  1GVC A;  2F34 A;  1IUD A;  4P0I A;  3M3F A;  1B5H A;  3H03 A;  2ESN A;  5HPQ A;  2A5T B;  3IJX B;  2PYY A;  2H9B A;  1MXU A;  1NNK A;  1PDA A;  1OQG A;  3O6H A;  2V84 A;  3CFZ A;  2DYX A;  3DLN A;  1MY4 A;  4FED A;  1NH7 A;  2Y84 A;  4PFY A;  3TPA A;  1IIT A;  4FAJ A;  2ABH A;  3S2V A;  2DE4 A;  3CR9 A;  4I9D A;  1PBQ A;  2OJT A;  2YPN A;  5J1D A;  3H3G A;  1UTH B;  1Y9U A;  3VVE A;  3CFL A;  3PMV A;  1VFD A;  1AL3 A;  3KSX A;  4JSD A;  3VVD A;  4JWX A;  1N3X A;  3DM0 A;  4PFW A;  3VE1 B;  5DVF A;  2X26 A;  4R6H A;  4YKP A;  4G8N A;  2ANJ A;  4EF1 A;  2CMO A;  1A8E A;  2F5X A;  3T9U A;  4GFR A;  3E4R A;  3H6W A;  3EF7 A;  3HV1 A;  4G8M A;  5I57 B;  3OEL A;  5L9M A;  1N7W A;  1DOT A;  5DVI A;  3TCH A;  3TUS A;  1FQF A;  1NNP A;  1FTM A;  2NXO A;  3IOW A;  1S7Y A;  3S9M C;  3G3G A;  1UTB A;  4BDO A;  2XXV A;  4YB5 A;  1H43 A;  3RTW B;  4TLL B;  3N6T A;  1VE4 A;  5IKB A;  2R71 A;  1JW4 A;  4MLV A;  4PQJ A;  4X1D A;  2QS2 A;  5FHO A;  5JEI A;  4F2O A;  1GV8 A;  3UA8 A;  2H99 A;  4OER A;  3FXR A;  3E3K A;  2PMS A;  4JBZ A;  2PBW A;  1ELJ A;  5KCJ A;  2F7C A;  2F8D A;  1SBP A;  4QSD A;  1EU8 A;  1MXZ A;  4MH5 A;  1N0T A;  3MC2 A;  3IOR A;  2OCU A;  1H76 A;  2XHD A;  5I59 B;  4O3C A;  1URG A;  2UVI A;  3V8X B;  2B3B A;  1NFT A;  2OLB A;  1A8F A;  2RC8 A;  4YKK A;  3UOR A;  5BUU A;  4NF8 A;  1PB7 A;  2P1S A;  3QUJ A;  3FJ7 A;  5DT6 A;  1IXG A;  1M5F A;  4NMY A;  3CRB A;  1D9V A;  1TFD A;  4XKQ A;  1MXY A;  3LSF B;  4WXJ A;  4IY6 A;  3KN3 A;  2Q88 A;  3LR1 A;  3VLU A;  4BDR A;  4QFK A;  2GHA A;  1B9J A;  4GLI A;  3ILT B;  3EQ1 A;  3Q29 A;  2Z8E A;  1LGB C;  2Q2C A;  4RJZ A;  5ELV A;  4RNS A;  5B7D A;  4EQ7 A;  1MY0 A;  4G2Z A;  4R73 A;  3C9H A;  2REJ A;  5CC2 A;  3VXB A;  5AA2 B;  3QIM A;  3K00 A;  3OD7 A;  4RK9 A;  3H06 B;  3BFT A;  2GH9 A;  4POW A;  4F18 A;  4BDM A;  5CBR A;  4KQP A;  1Y3Q A;  5ICQ A;  4LON B;  1RYO A;  3TTM A;  3T93 B;  1LBC A;  5CMB A;  5AA1 A;  3LUY A;  1POT A;  3U8Q A;  3FD3 A;  4DLD A;  4F1U A;  3G3J A;  3IOV A;  1P1N A;  2HQ0 A;  3C33 A;  4GOT A;  2FYI A;  2ALU A;  1ZTY A;  3I6V A;  1LB9 A;  2XXR A;  1FTL A;  1ZU0 A;  3MJN A;  4F19 A;  3EHT A;  3L6G A;  4AB5 A;  4H6D A;  2OBG A;  4R2F A;  3IO6 A;  1R9Q A;  1ZBM A;  1A55 A;  4R74 A;  1AIV A;  3R6U A;  4OQO A;  4I8C A;  5H8N A;  1FTO A;  2Y7I A;  1M5C A;  4K3F A;  4IO5 A;  4NE4 A;  3FJM A;  4KYD A;  2I4B A;  1SVX B;  3K1N A;  3PUZ E;  4IB2 A;  2QS1 A;  3W15 C;  3FVK A;  3TFL A;  1A7L A;  1P1Q A;  4KCC A;  4FEC A;  2KLF A;  2XXX A;  3K4U A;  3T66 A;  3U72 A;  2CZL A;  1B5J A;  4F31 B;  1MM6 A;  3LSW A;  3RTF B;  3LSX A;  1FQE A;  2DQV A;  3FV2 A;  5H8Q B;  4OES A;  1B7U A;  4OZ9 A;  1MY3 A;  3IO4 A;  4MF3 A;  3K0V A;  1URD A;  1CB6 A;  3IK6 B;  5JTY B;  1D3K A;  5H8H A;  3PD8 A;  2AL5 A;  1T0K A;  4ESW A;  2RKM A;  4C1T A;  4ONY A;  3TTL A;  2ZYO A;  4QSC A;  5EHM A;  3G7W A;  3DP6 A;  4DXC A;  2X7Q A;  3HPI A;  2Q9T A;  2F6P A;  4U1Z A;  5CBS A;  1H3D A;  4KCD A;  3GXA A;  3KG2 A;  1USY E;  4ZEF A;  3K6U A;  1GR2 A;  3JZJ A;  3RQT A;  4E0X A;  2O7U A;  4JXI A;  1LAF E;  1N76 A;  3I3V A;  1R9L A;  1UIV A;  3H6T A;  3IR1 A;  4PET A;  4G8H A;  4NF5 A;  3PD9 A;  1D9Y A;  4L17 A;  3MVY A;  3UIF A;  1WOD A;  4OFO A;  4F29 A;  1DSN A;  1LCT A;  3IB2 A;  1B3L A;  1DTZ A;  2AIX A;  3TZA A;  4RK2 A;  5H8F A;  2V3T A;  1FTJ A;  2ZYM A;  4G68 B;  1Y1Z A;  1FCK A;  3CVG A;  4F2Q A;  4Q8R A;  5AE4 A;  4OMB A;  3SEX A;  5BWJ A;  1QUJ A;  1IEJ A;  5EYF A;  1P1O A;  1BLF A;  3BFU A;  3QSL A;  4G77 A;  2THI A;  4R6Y A;  1IZ1 A;  4LAT A;  5CMM A;  1VFE A;  2UVH A;  4IO4 A;  3MP1 A;  4EUO A;  2Q89 A;  4LA9 A;  3PGF A;  1QKA A;  3KN8 A;  5TU0 A;  4GRK A;  1MXW A;  5ITP A;  3CIJ A;  1NNF A;  2A5S A;  4BLA A;  1B40 A;  4O3B A;  4WKM A;  1Y3N A;  2O1M A;  2Q2A A;  3L6H A;  1SI1 A;  5EHS A;  2Z23 A;  2RC9 A;  3O97 A;  3BKI B;  3B6Q A;  3KN7 A;  3WAF A;  1ZJL A;  1AMF A;  3MW0 A;  3RLF E;  3B7D A;  1QUI A;  4ECF A;  4Z0I A;  1TT1 A;  2GRV A;  1SDX A;  3HST A;  4LZ5 A;  1B46 A;  2XX8 A;  1MY1 A;  1B3F A;  3TTR A;  3DP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...