1OQGA

Crystal structure of the d63e mutant of the n-lobe human transferrin
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLEAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Serotransferrin
publication title Structural and functional consequences of binding site mutations in transferrin: crystal structures of the Asp63Glu and Arg124Ala mutants of the N-lobe of human transferrin
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2003-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1oqgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1oqgA02
3DP8A 3QYTA 2ZXTA 3TKDA 5CBSA 3K4UA 4N13A 3PPOA 1Q1KA 1Q35A 4LVQA 1BLFA 4GXSB 4RYAA 4KFQA 1GTKA 2ZNSA 4ZE8A 4L17A 3VXCA 2UVGA 1UTHA 3GLBA 1P1OA 4K3FA 5I56B 3E9XA 3BFTA 1B3LA 1HSEA 3ZKKA 5CMMA 2NWJA 1LB9A 3VDFA 5ITPA 3CRBA 1UTHB 4KCDA 4ELOA 5DVFA 4R6YA 4PFWA 1B2HA 3T93B 4YB5A 1B4HA 3MVXA 5KZTA 1B1XA 2ONRA 2RF1A 3IJOB 5ISUA 1ZLQA 3GZGA 5AA1A 3HCQA 4R9FA 4FIMA 1IXCA 3C33A 4HW8A 4NWDA 4EDPA 4EQ7A 3K02A 3E3KA 3KOTA 4NE4A 3C34A 4U1OA 2I4CA 4OWDA 3TPAA 2QL3A 3SEYA 4GXAA 1B0LA 2PX1A 4C0RA 3BKIB 1MXVA 4ELPA 1B58A 1B7HA 2H4IA 4F2OA 3IB0A 2XXTA 5H8QB 4H1XA 4OHNA 2Y7WA 3C35A 2XHDA 3H6TA 4H5GA 1MXZA 2OWSA 3D4CA 4ZEFA 5KCJB 3GBBA 4ELQA 2PBWA 4POXA 2Y7PA 3OXNA 3WAFA 5CBRA 1FQDA 3LC8A 2Z8FA 1MPBA 1A54A 1SW2A 3MP1A 1URGA 4NF5B 1IUDA 1SW1A 4BDQA 1I69A 2ZYNA 1MQDA 3FV2A 1HSJA 2Y7RA 4C1UA 4M4GA 3PPNA 4N6PA 3EHSA 4ND9A 3TYHA 1IXGA 4NF6A 2DS9A 4ZZEA 4OXVA 1SYHA 5J1DA 1D9YA 1A40A 1R9LA 4YB6A 5AA3A 2Z8DA 1USYE 2OCUA 3UGWA 4GL8A 3TFLA 1FW0A 4IGTA 2XXPA 3GBAA 5HM4B 3QUFA 3LBSA 5FHOA 1QKAA 1URSA 1II5A 1S9TA 2VHAA 4QSCA 3IB2A 4TLLB 2HXWA 4KYEA 1A7LA 3K6WA 3LSXA 4ZDMA 1NFTA 3CR9A 1KWHA 3RUMA 3VLVA 3ZSFA 3TQLA 2AIXA 4HTGA 3M3LA 1Y4TA 4OTEA 3T9HB 3LSWA 2XXWA 3OO8A 5I57A 1YAEA 3VFJA 1S7YA 3M8UA 2QJEA 3P7IA 4OEVA 1OLAA 1JVXA 3CSBA 3K00A 4YZZA 3K6UA 4EUOA 1SBPA 1Y1ZA 5DTBA 4AB6A 1MG1A 1MY1A 4XKRA 1PDAA 3OSQA 5AA4A 3U92A 3TUSA 1I6BA 4MFIA 4QFOA 1I6AA 1MS7A 3N5LA 3SESA 4QFPA 4P0IA 3FVNA 4WEPA 3OO9A 5ICTA 1VR5A 4F3PA 2RC8A 3T9VA 2F8DA 1US4A 2GFEA 3O6IA 1TWYA 5TU0A 1MPDA 4BDNA 5I59A 4KQPA 1N84A 4E0XA 3K0VA 3C4MA 3TTKA 3MAMA 3PPQA 2D3IA 1MY0A 3EHTA 4PFUA 2QMWA 2Q9TA 1MXUA 4TLMB 1AOVA 4YICA 5M2VA 3QXMA 3H06B 1UTBA 1B05A 3KN3A 1LCFA 1DPEA 4GRKA 1MY4A 3C9HA 5H8FB 3U1OA 4G8MA 4YMAA 4AB5A 4ECFA 4LZ8A 3WAEA 3C36A 3CG3A 4WXJA 4QHQA 4X48A 3OELA 1FTLA 5JTYB 3S9EA 3PPPA 3FUZA 4LP2B 2O51A 1LB8A 3RT8A 4NTLA 2I0BA 1Z7NE 4E0WA 2NVUB 3ILTB 3OEKA 3RQTA 2FA7A 2G93A 3H3GA 4WEDA 4MH5A 3SETA 2AL4A 3CIJA 1FTMA 2DWHA 3RLFE 2DXYA 4G2ZA 1JW4A 1NNKA 2V3UA 5I2NA 2HFBA 3BFUA 1O63A 4F3GA 2IEEA 2UYEA 4GWOA 2ZNUA 3VVEA 2ESNA 4ZS9A 2XD3A 5I2NB 1ZU0A 2ZYMA 4I8CA 3SDFA 3IOUA 2Q8JA 2HAVA 5LOMA 4U2RA 1B46A 2DP8A 1DMBA 2F35A 1EZ9A 4H8IA 4FAJA 3S9LC 3SERA 2YJPA 4DE8A 1VFEA 3MPLA 1JW5A 1MRPA 3FXQA 3IORA 2F5XA 1AIVA 1WVJA 1OMPA 3VE1B 5FTIA 1XC1A 1LSTA 1M5DA 4FEDA 4JWYA 2GRVA 4GD5A 1OQGA 3THIA 3UORA 1B3HA 1A8FA 2I3VA 5JEIA 2P2AA 5F7VA 4YKKA 4P0GA 3O9PA 3IO4A 1R1NA 1H45A 2THIA 2H25A 2O69A 2BJJX 3TTNA 1CB6A 3DP4A 1P1UA 2B65A 2V3QA 1XS5A 1BTJA 1GR2A 3VLWA 4NF4B 2E1SA 4F29A 3VLUA 5L8DA 2V93A 3FASA 3VXBA 3C32A 5I56A 2RC7A 4IO7A 4R6HA 2F78A 5CMBA 2XX8A 3CFLA 1HSLA 4IY5A 1MDP1 4UACA 2VGQA 3IO6A 3HO7A 4AQ4A 2HZKA 1J1NA 3F11A 4R72A 3PD8A 4OMBA 2DWAA 1NH8A 1M5FA 3V83A 5TP9A 4ESXA 1SQYA 2DE2A 4U4SA 1OLCA 1RKMA 4BDLA 4F39A 5KDTB 2ABHA 2OBGA 3TEPA 4ONYA 3R7XA 5IKBA 3FZVA 4FE8A 3KEIA 2DYXA 4FECA 5TP9B 1OVTA 4LA9A 1SD3A 4Q30B 3S4UA 3H4ZA 3A09A 4R74A 3E13X 4F18A 4JXIA 1FTKA 1ZMGA 2YLNA 3U72A 2ONKE 3ZS6A 5H8QA 4ELRA 1LBCA 4Z7EA 2Y84A 4JSOA 4KD5A 1JVYA 4ZEKA 4IGRA 4RJZA 3FGSA 3N6UA 3PUVE 3DLNA 2R71A 4X1DA 1EZOA 2Q2CA 3UA8A 5KCJA 1D4NA 4OEUA 2PT2A 2XXRA 1MM6A 1IZ1A 2F6GA 3B6TA 3A3UA 3MVYA 1NNTA 4PP0A 4R75A 1NKXA 1TXFA 2RCBA 1D9VA 2XXYA 4NF5A 1DTZA 2HAUA 3KFMA 2QSXA 3AXFA 4FATA 4LQ5A 3G3IA 4KPTA 4OFOA 1H76A 3RGYA 3T9XB 2DSFA 2QRYA 3HV1A 4LQ2A 1Y3NA 3LR1A 1EZPA 2OLBA 3IB1A 4FJPA 4R2FA 1ATGA 2Q2AA 4EXKA 1L5TA 1B9JA 3K2DA 2F34A 4WKMA 3ILUB 3M3FA 3HHGA 3Q27A 4XKQA 1NL5A 3KJTA 3IOTA 3PD9A 3MQ9A 5HBCA 3M3KA 3RTWB 4PETA 1ZKBA 4G8NA 2F6PA 4QFNA 1LLSA 2DE3A 2DWIA 1B52A 4RY1A 3R26A 3IK6B 5I2KB 2AYSA 4G8HA 2D21A 1QJMA 5ITOA 3QUJA 5ELVA 3TTLA 4KYSA 3TMGA 4KYDA 2DWJA 4G68A 5K2XA 4N07A 4U22A 1SVXB 2X7QA 3EF7A 1B7UA 3RNNA 3OO6A 3FVKA 1Y20A 4ISUA 2RC9A 3B6QA 4G68B 2B3BA 3S2VA 4GLIA 1MQHA 1QW0A 4IO2A 4EF2A 1JEVA 2UVHA 1H43A 1XHYA 4RK9A 3KSXA 4YMBA 3H03A 4F1VA 4FEBA 4C1TA 4DXCA 2CMOA 5H8SA 1JQFA 1A55A 1WDNA 2XD2A 1NNPA 3FVOA 1IXIA 1M5BA 5DEXA 1PBQA 3SEWA 3B6WA 1IQ7A 4JBZA 1P99A 2AL5A 3ONMA 5H8NB 3ODBA 3S9MC 2ZYOA 1M5CA 1B3FA 2DXRA 4R2BA 3OMBA 3KZGA 5DEXB 3PU5A 1FQCA 1GV8A 2RCAA 4FORA 1MH4A 3HPIA 3EPEA 4I9DA 5TPAB 2NOOA 2ONSA 3OSRA 2QS4A 2PMSA 4KI0E 1B0HA 1XVYA 1LFHA 4Q0CA 4OFLA 1PBPA 2GHAA 3CSGA 4YU0A 2CZLA 2R6GE 1MH3A 1BIYA 4MLQA 5FHNA 4PE5B 4JWXA 3I3VA 2XXHA 3IL1B 3PV0E 1TT1A 1N3XA 1Y3QA 4ZEBA 5H8FA 1DPPA 4IO4A 2REGA 3PUXE 3T22A 1N76A 1WODA 3KGCA 3OD7A 3N94A 1PEBA 3OOAA 1SDXA 1B5IA 4POWA 4QSEA 5JTYA 4XKPA 1R9QA 4F3SA 5I58B 1Y9UA 3KN8A 4R73A 4OFJA 3W15C 3K1NA 1YCJA 1ZBMA 4OZ9A 3MBPA 4GIZA 3MPKA 4XIGQ 1QVSA 4Q8RA 3FIRA 4F1UA 4F22A 2O1MA 2QS1A 3K6VA 1NNFA 3K6XA 1XOCA 3V8XB 4HCWA 2X26A 3DP6A 3IOWA 4H67A 3FJMA 3HN0A 4GL0A 1LAHE 2V84A 2Z23A 3PPRA 1MXYA 3FXRA 1QUKA 5ICQA 5BWJA 3FJ7A 1BP5A 1MQJA 2HCAA 5FHMA 2O7IA 2PYYA 3H6VA 4H5FA 3G3GA 3H7MA 3USDA 1QUIA 3L6HA 4LONB 3MVZA 4YKJA 4QRZA 3L6GA 4ZEDA 5H8HB 1Y3PA 1PB7A 3N26A 1RYXA 4GF8A 3T66A 1Z7ME 3C31A 5AA2D 2KLFA 1O7TA 1FQAA 2I3WA 2E0SA 3CFZA 1LAGE 4THIA 4PFTA 2I4BA 4EF1A 1SW5A 3U8QA 3TELA 1H3DA 5HPQA 3I5OA 1PB8A 1EH3A 3FV1A 1LGBC 3IX1A 4GQOA 3IOVA 4U4XA 4DIGA 4NMYA 4H8JA 2ZYKA 5IAIA 2A5SA 4LZ5A 2P0SA 4YAHX 2OJTA 3JZJA 2XXUA 1FQEA 2UYFA 4ESWA 3T9UA 4YB7A 4NWCA 1B3GA 4OQOA 3KSJA 1QUJA 4NF4A 2O1LA 5F1QA 3PMWA 3W9WA 2QMXA 2UVJA 3HSTA 3DELB 4DCXA 1DTGA 1QKBA 3IJXB 2NUVA 3RN8A 4EXLA 1B5HA 1UQWA 1US5A 1SW4A 4ZZAA 5AA2B 3MP8A 3QK6A 4I1DA 4F3BA 4JWOA 4MF3A 1P1WA 1POY1 3OO7A 2XXIA 5L9SA 5CI5A 2QPQA 1FQBA 1B32A 1B7ZA 5BUUA 3MZ1A 1XT8A 3CG1A 3H6UA 5KDTA 2ANJA 1Y4CA 4ZE9A 3OENA 4U23A 3V5AA 4O3AA 5EHMA 3O66A 3Q29A 4F2QA 4RPOA 3FVGA 1GGGA 2UVIA 2PT1A 1UIVA 3U93A 4PQJA 3MZ9A 3K1PA 4IO3A 5DVJA 3KG2A 3O2AA 3EN3A 4X9TA 3SEVA 4RPNA 1MQGA 1N3WA 1AH5A 2GHBA 1XVXA 4LATA 2XXQA 5DYHA 3PMXA 2FYIA 5AE4A 3V89B 2WKYA 2Z8EA 3Q28A 3GXAA 1YTVA 4QFLA 4QF9A 3JV9A 4G68C 1S50A 3MWBA 1MY3A 3TQWA 2Q89A 2REJA 4TOZA 1JETA 2NXOA 1I6QA 1CE2A 4H0WA 1ZIUA 3G3KA 1FCKA 4R6KA 1URDA 4NF8A 1ZTYA 4X1BA 1POTA 1USYH 3MW0A 1N7XA 4IO6A 4JSDA 2VP1A 2IA4A 1AL3A 2F97A 4OESA 1N04A 3MVWA 4NF8B 2D5WA 3PGFA 4R9GA 3ZKLA 4ZECA 2RINA 3TZAA 3MUQA 3HHFA 1D3KA 2VD2A 5DVIA 4OERA 1JW1A 3O97A 2A5TA 1A8EA 3IAZA 1BKAA 4PFYA 1N7WA 3TDJA 4BDRA 4UA8A 1SI1A 1MPCA 2A5TB 3Q26A 3EQ1A 5I2KA 3BBRA 3QIMA 4KR5A 4U21A 4QFKA 2H99A 1EU8A 3EHUA 2RKMA 1MY2A 2ZNTA 4P11A 3SEUA 4IO5A 2R9JA 3U94A 1LFIA 1P1QA 4NF6B 2GH9A 1JEUA 5CC2A 3RT6B 2V3TA 1YPNA 5CMCA 4TQUQ 1PB9A 3DM0A 3JYRA 4F19A 3SKPA 1MQIA 3K01A 3T96B 2I0CA 4XXUA 5L9MA 2XX9A 3FJGA 4O3BA 4QSDA 5L9OA 1MDQA 4GVOA 3TCHA 3RPWA 4EQ9A 2I6EA 1LAFE 3O29A 4DZ1A 4XKNA 1QULA 4U1ZA 3VV5A 3LUYA 4KHZE 1A99A 1ELJA 5B70A 5B7DA 1IIWA 1IEJA 2V25A 3D4GA 1LAXA 2DE4A 2F36A 1IXHA 5H8NA 3KOSA 4F31B 4EQBA 1B3EA 3RY3A 5CRYA 1PC3A 3N6TA 4KCCA 5I57B 3PUYE 4HS7A 2B3FA 2H9BA 2DOJA 3O6HA 5TPAA 1B5JA 1N0TA 2DQVA 4OYVA 4Z0IA 3SEXA 2HEUA 4OENA 1H44A 1VFDA 2ALUA 3PMVA 2XXXA 3W9VA 3PUZE 3MP6A 3FATA 4IB2A 3VVDA 3OEMA 4BDMA 3FXUA 5AA4B 3R6UA 4DCYA 1FQFA 3LSFB 3MZBA 4IY6A 4DLDA 3LSLA 5EHSA 1OVBA 3G3FA 5I58A 1T0KA 2F7BA 2H5YA 3O28A 1B51A 1VE4A 2W7YA 1SI0A 3VVFA 1OIBA 1B4ZA 2OZZA 3RTFB 3MC2A 1R6ZA 5I59B 2YPNA 3KN7A 2Z22A 3KJ7A 3FD3A 3S9NC 4I62A 1ZJLA 4NEDA 3TODA 3O6GA 2FNCA 4OETA 1FTJA 2ZMBA 5I84A 1Y1MA 2G29A 3TCGA 1UTBB 1AMFA 4M1VA 5A5XA 5EYFA 1F9BA 2M8CA 2O68A 1LBBA 2H98A 2QS2A 2VD3A 5A5XB 3TTRA 2OK2A 3K1MA 4DDDA 2UXAA 3CVGA 5DT6A 4LZ7A 2F7AA 2DVZA 3UK4A 5H8HA 5JK4A 2XX7A 4RK2A 2XXVA 1TFAA 1LFGA 2O6AA 3QAXA 3TCFA 1IITA 2F7CA 1RYOA 3UP9A 3G3JA 2I49A 3Q25A 1GVCA 1MM7A 1UIUA 4BDOA 2I48A 4JB7A 4HCYA 2O84X 1SYIA 4MBPA 4XTCQ 1B40A 4RNSA 4H65A 2Y7KA 2LAOA 4H6DA 5K2YA 1B1HA 1MXWA 2OWTA 1TFDA 2O7UA 4YKIA 2Q88A 4F1YA 4JDFA 4OVJA 3H6WA 1P1NA 1B6HA 5CM6A 4G4PA 2I58A 3TAJA 1DSNA 1MXXA 4DXBA 4YKPA 4GFRA 5CMKA 1O64A 3G7WA 3MJNA 2HQ0A 2Y7IA 3UIFA 4RXLA 3G3HA 4BLAA 3IR1A 2P1SA 3I6VA 3KBRA 3TTMA 1NMUA 2VOZA 4MLVA 4RA1A 4G77A 1VSOA 2DVCA 3B7DA 1M5EA 3E4RA 1DOTA 3PUWE 3QSLA 4GOTA 5FTHA 3UN6A 4ZEIA 1JNFA 4Q5TA 3CI8A 4O3CA 5AA2A 3ECRA 1OQHA 4LUBA 3A3CA 3CFXA 1NH7A 4DXUA 1ANFA 1LCTA 2X7PA 2HZLA 2PVUA 1FTOA 2QS3A
chains in the Genus database with same CATH superfamily
3DP8A 4PF6A 3QYTA 4NN3A 2ZXTA 3TKDA 5CBSA 3MYUA 3K4UA 4N13A 3PPOA 1Q1KA 1Q35A 4GBVA 4LVQA 1IMFA 1BLFA 4GXSB 4RYAA 4P56A 4KFQA 1GTKA 3B50A 2ZNSA 4ZE8A 4L17A 3VXCA 2UVGA 1UTHA 1FBGA 3GLBA 1P1OA 4K3FA 5I56B 3E9XA 3BFTA 1B3LA 1HSEA 2HHMA 3ZKKA 5CMMA 2NWJA 1LB9A 3VDFA 2HPGA 5ITPA 3CRBA 1UTHB 4OA4A 4KCDA 4ELOA 5DVFA 1RDZA 4R6YA 4PFWA 3LUZA 1B2HA 3T93B 4YB5A 1B4HA 3MVXA 5KZTA 1B1XA 2ONRA 2RF1A 3IJOB 5ISUA 1ZLQA 2XA5A 3GZGA 5AA1A 3B8BA 3HCQA 4R9FA 4FIMA 1IXCA 3C33A 4HW8A 4NWDA 4EDPA 1LEVA 4EQ7A 3K02A 3E3KA 1AWBA 3KOTA 4NE4A 3C34A 4U1OA 4P9KA 2I4CA 4OWDA 3TPAA 2QL3A 3SEYA 4GXAA 1B0LA 2PX1A 3QMFA 4C0RA 1Q9DA 3BKIB 1MXVA 4ELPA 1B58A 1B7HA 2H4IA 4F2OA 3IB0A 2XXTA 5H8QB 4H1XA 1G0HA 4XEQA 4OHNA 2Y7WA 3C35A 4P47A 4PE3A 2XHDA 4PFIA 3H6TA 4H5GA 1MXZA 2OWSA 3D4CA 4ZEFA 5KCJB 3GBBA 4ELQA 2PBWA 4POXA 2Y7PA 3OXNA 3WAFA 5CBRA 4PBQA 1FPIA 1FQDA 3LC8A 2Z8FA 1MPBA 1A54A 1SW2A 2R8TA 3MP1A 1URGA 4NF5B 1IUDA 3KC0A 1SW1A 3T1BA 4BDQA 1G0IA 1I69A 2ZYNA 1MQDA 3FV2A 1HSJA 2Y7RA 4C1UA 4M4GA 5IZ1A 3PPNA 4H46A 4N6PA 4HE0A 3EHSA 4ND9A 3TYHA 1IXGA 4NF6A 2DS9A 4ZZEA 4OXVA 1SYHA 4MJOA 5J1DA 1D9YA 1A40A 5I7IA 1R9LA 4YB6A 5AA3A 2Z8DA 1USYE 2OCUA 3UGWA 1FSAA 4GL8A 4MX6A 3TFLA 4O94A 1FW0A 2P3NA 4IGTA 2XXPA 3GBAA 5HM4B 3QUFA 3LBSA 5FHOA 1QKAA 4P1LA 2FIEA 1YZ0A 1URSA 1II5A 1S9TA 2VHAA 4QSCA 3IB2A 5DW8A 4TLLB 2HXWA 4KYEA 1A7LA 2PCRA 3K6WA 3LSXA 4ZDMA 1NFTA 3CR9A 2ZZXA 1KWHA 3RUMA 3VLVA 3ZSFA 3TQLA 2AIXA 4HTGA 3M3LA 1Y4TA 4OTEA 4AS4A 4XFEA 3T9HB 3LSWA 2XXWA 3OO8A 1LBWA 5I57A 2KR0A 1YAEA 3VFJA 1S7YA 3M8UA 2QJEA 3P7IA 4OEVA 5I5PA 1OLAA 1JVXA 3CSBA 2V4CA 3K00A 3LV0A 4YZZA 3K6UA 4EUOA 1EYKA 1SBPA 2PFZA 4MNPA 5ET5A 2Q74A 1NV5A 2WBBA 1Y1ZA 5DTBA 4AB6A 5LTCA 1MG1A 4I3YA 4XF5A 1MY1A 4XKRA 1PDAA 3OSQA 5AA4A 1FRPA 3U92A 3TUSA 1I6BA 4MFIA 4QFOA 1I6AA 1MS7A 3N5LA 3SESA 4QFPA 4P0IA 3FVNA 4WEPA 3OO9A 5ICTA 1VR5A 2KQZA 4F3PA 4G61A 2RC8A 3T9VA 2F8DA 1US4A 2GFEA 3O6IA 1TWYA 2CZKA 5TU0A 1MPDA 4BDNA 4N6KA 5I59A 4KQPA 1N84A 4PGPA 4E0XA 3K0VA 3C4MA 2VPNA 3TTKA 3MAMA 4GWXA 3PPQA 2D3IA 1MY0A 3EHTA 4PFUA 2QMWA 2Q9TA 1MXUA 4NHBA 4TLMB 1SPIA 1AOVA 4YICA 5M2VA 3QXMA 1FPJA 3H06B 1UTBA 1B05A 3MSTA 3KN3A 4PTKA 1LCFA 2XWOA 1DPEA 4HE2A 4GRKA 1NV1A 1IMCA 5LDZA 1MY4A 3C9HA 5H8FB 3U1OA 1FBFA 1VDWA 4G8MA 4YMAA 4AB5A 4ECFA 4LZ8A 3WAEA 3C36A 3CG3A 4WXJA 4QHQA 4X48A 3OELA 1FTLA 5JTYB 3S9EA 3PPPA 3FUZA 4LP2B 3BIHA 2O51A 1LB8A 3RT8A 4NTLA 2I0BA 1Z7NE 4E0WA 2NVUB 3ILTB 3OEKA 3RQTA 2FA7A 2G93A 1LBVA 4GWZA 3H3GA 5IZ3A 4WEDA 4MH5A 3SETA 2AL4A 3CIJA 1FTMA 2DWHA 3RLFE 2DXYA 4G2ZA 1JW4A 1NNKA 2V3UA 5I2NA 2HFBA 3BFUA 1O63A 4F3GA 2IEEA 2UYEA 2CEXA 4GWOA 2Q8MA 4KXPA 2ZNUA 3VVEA 2ESNA 4ZS9A 2XD3A 5I2NB 1IMBA 1ZU0A 2ZYMA 3FXBA 4I8CA 2OWZA 3FBPA 3IFCA 4PBHA 3SDFA 3IOUA 2Q8JA 2HAVA 5LOMA 1NV2A 4U2RA 1B46A 2DP8A 1DMBA 2F35A 1EZ9A 4H8IA 4FAJA 3S9LC 4NQ8A 3SERA 2YJPA 4DE8A 1VFEA 3MPLA 1JW5A 1MRPA 3FXQA 3IORA 2F5XA 4N17A 4OVRA 1AIVA 1WVJA 1OMPA 3VE1B 5FTIA 4NX1A 1XC1A 4NAPA 1LSTA 5EYHA 1M5DA 4FEDA 2F3BA 4JWYA 2GRVA 4HE1A 4GD5A 1OQGA 3THIA 3UORA 1B3HA 1A8FA 2I3VA 5JEIA 2P2AA 5F7VA 4YKKA 4P0GA 4MCOA 3O9PA 3IO4A 1R1NA 3IFAA 1H45A 2THIA 1KA1A 2H25A 1RDYA 2O69A 2BJJX 3TTNA 1CB6A 2FVZA 2OX3A 3DP4A 1P1UA 2B65A 2V3QA 1XS5A 1BTJA 1GR2A 3VLWA 4NF4B 1NV0A 2E1SA 4GBWA 4DI4B 4F29A 3VLUA 5L8DA 2V93A 3FASA 3VXBA 3C32A 4UABA 5IM2A 5I56A 2RC7A 1XI6A 4IO7A 4R6HA 2F78A 5CMBA 2XX8A 3CFLA 1HSLA 4MIJA 4FBPA 4IY5A 1MDP1 4UACA 4H45A 2VGQA 3IO6A 3HO7A 4AQ4A 2HZKA 1J1NA 3F11A 4R72A 3PD8A 4OMBA 2DWAA 3ROJA 1NH8A 4N15A 1M5FA 3V83A 5TP9A 4ESXA 1SQYA 2JJKA 2DE2A 4U4SA 1OLCA 1NUXA 1RKMA 4BDLA 4F39A 5KDTB 2ABHA 2OBGA 3TEPA 4ONYA 3R7XA 1INPA 5IKBA 3FZVA 4FE8A 4GX6A 3KEIA 2DYXA 4FECA 5TP9B 3BIGA 1OVTA 4LA9A 1SD3A 4Q30B 1NUYA 3S4UA 3H4ZA 3A09A 4R74A 3E13X 4F18A 5A5LA 4JXIA 1FTKA 1ZMGA 4P3LA 2YLNA 3U72A 2ONKE 3ZS6A 5H8QA 4ELRA 1LBCA 4Z7EA 2Y84A 4JSOA 4KD5A 1JVYA 4ZEKA 1FBHA 4IGRA 4RJZA 3FGSA 3N6UA 3PUVE 3DLNA 2R71A 4NGUA 4PAIA 4X1DA 1EZOA 2Q2CA 3UA8A 5KCJA 1D4NA 4OEUA 2PT2A 2XXRA 1MM6A 1IZ1A 2F6GA 3B6TA 3A3UA 3MVYA 1NNTA 4PP0A 4R75A 1NKXA 1TXFA 2RCBA 1D9VA 2XXYA 4NF5A 4QBAA 2DDKA 1DTZA 2HAUA 3KFMA 2QSXA 3AXFA 4FATA 4LQ5A 1KA0A 3G3IA 4KPTA 4OFOA 1H76A 4JVCA 3RGYA 3T9XB 2DSFA 2QRYA 4MEVA 3HV1A 4LQ2A 1Y3NA 3LR1A 1EZPA 2OLBA 3IB1A 1FBDA 4FJPA 4R2FA 1ATGA 2Q2AA 1BK4A 4EXKA 1L5TA 1YYZA 1B9JA 1K9YA 3K2DA 2F34A 4WKMA 3ILUB 3M3FA 3HHGA 3Q27A 4XKQA 1NL5A 4GWUA 3KJTA 1FPBA 3IOTA 3PD9A 3MQ9A 5HBCA 1DCUA 3M3KA 3RTWB 4PETA 1ZKBA 4G8NA 2F6PA 4QFNA 4N6DA 1LLSA 2DE3A 2L5VA 2DWIA 1D9QA 1B52A 4RY1A 3R26A 3IK6B 5I2KB 2AYSA 4G8HA 3RYDA 2D21A 1QJMA 5ITOA 3QUJA 5ELVA 3TTLA 1NV4A 2XXKA 4KYSA 3TMGA 4KYDA 2DWJA 4G68A 5K2XA 4N07A 4U22A 1SVXB 1EYJA 2X7QA 3EF7A 1B7UA 3RNNA 3OO6A 3FVKA 1Y20A 4ISUA 2RC9A 3B6QA 4G68B 2B3BA 4GLIA 1MQHA 3S2VA 1QW0A 4IO2A 4QXDA 4EF2A 1JEVA 2UVHA 1H43A 1XHYA 4RK9A 3KSXA 4YMBA 3H03A 4F1VA 4FEBA 1NUZA 4C1TA 4DXCA 2CMOA 5H8SA 1JQFA 4N8GA 1A55A 2WX9A 1WDNA 2XD2A 1NNPA 3FVOA 1IXIA 1FPKA 1M5BA 4OVPA 1LBZA 3KBZA 5DEXA 1PBQA 3SEWA 3B6WA 1IQ7A 4JBZA 1P99A 2AL5A 3ONMA 4OANA 5H8NB 4GX4A 3ODBA 3S9MC 2ZYOA 1M5CA 1B3FA 4OVSA 2DXRA 5IZZA 4R2BA 3OMBA 3KZGA 5DEXB 2QVRA 3PU5A 1FQCA 4JVDA 1GV8A 2RCAA 4FORA 1MH4A 3HPIA 3EPEA 4I9DA 5TPAB 2NOOA 2ONSA 3OSRA 2QS4A 2PMSA 4KI0E 1B0HA 1NI9A 1XVYA 5ESYA 1LFHA 4Q0CA 4OFLA 1PBPA 2GHAA 3CSGA 4YU0A 2CZLA 2R6GE 4NG7A 1MH3A 1BIYA 1FPDA 4MLQA 5FHNA 4PE5B 4JWXA 3I3VA 2XXHA 3IL1B 3PV0E 1TT1A 1N3XA 1FBPA 1Y3QA 4ZEBA 5H8FA 1DPPA 4IO4A 2REGA 3PUXE 3T22A 2PFYA 1N76A 1WODA 3KGCA 3OD7A 3N94A 1PEBA 3OOAA 1SDXA 4N4UA 2F3DA 1B5IA 4POWA 4QSEA 2CZHA 5JTYA 4XKPA 1R9QA 4F3SA 5I58B 1Y9UA 3KN8A 4R73A 4OFJA 3W15C 3K1NA 1YCJA 1ZBMA 4OZ9A 2QVVA 3MBPA 4GIZA 3MPKA 4XIGQ 1QVSA 4Q8RA 3FIRA 1DBZA 4F1UA 4F22A 2O1MA 2QS1A 2BJIA 3K6VA 1NNFA 3K6XA 1XOCA 3V8XB 4HCWA 2X26A 3DP6A 3IOWA 4H67A 3FJMA 4PFRA 3HN0A 4GL0A 5ET7A 1FBCA 1LAHE 2V84A 2Z23A 3PPRA 1MXYA 3FXRA 1QUKA 5ICQA 1FPFA 5BWJA 2QFLA 3FJ7A 1BP5A 1MQJA 2HCAA 5FHMA 2O7IA 2PYYA 3H6VA 4H5FA 3G3GA 3H7MA 3USDA 1QUIA 3L6HA 4LONB 3MVZA 4YKJA 4QRZA 3L6GA 4ZEDA 5H8HB 1Y3PA 1PB7A 3N26A 1LBXA 1RYXA 4GF8A 3T66A 1Z7ME 3C31A 5AA2D 2KLFA 1O7TA 1FQAA 2I3WA 2E0SA 3CFZA 1LAGE 4JVIA 4THIA 4PFTA 2I4BA 3RPLA 4EF1A 1SW5A 2FHYA 3U8QA 3TELA 1H3DA 5HPQA 3I5OA 4PAFA 1PB8A 1EH3A 3FV1A 1LGBC 4PAKA 3IX1A 2WYKA 4GQOA 3IOVA 3RPLB 4U4XA 4DIGA 4NMYA 4H8JA 2ZYKA 5IAIA 2A5SA 4PDDA 4LZ5A 2P0SA 4YAHX 2OJTA 3JZJA 2XXUA 1FQEA 1CNQA 2VPOA 2UYFA 4ESWA 3T9UA 4YB7A 4NWCA 1B3GA 4OQOA 3KSJA 1QUJA 4NF4A 2O1LA 4PDHA 5F1QA 3PMWA 4GWSA 3HFUA 3W9WA 2QMXA 2UVJA 3HSTA 4GWWA 3DELB 4DCXA 1DTGA 1QKBA 5EYGA 3IJXB 2NUVA 3RN8A 4DI3D 4EXLA 5FBPA 1B5HA 1UQWA 1US5A 3EKIA 1SW4A 4ZZAA 5AA2B 3MP8A 3QK6A 4I1DA 4F3BA 4JWOA 5IGAA 4OVTA 4MF3A 1P1WA 1POY1 3T0JA 3OO7A 2XXIA 2FBPA 5L9SA 5CI5A 2QPQA 1FQBA 4P1EA 1B32A 1B7ZA 5BUUA 3MZ1A 1XT8A 3CG1A 3H6UA 5KDTA 2ANJA 1Y4CA 4ZE9A 3OENA 4U23A 3V5AA 4O3AA 4P8BA 5EHMA 3O66A 3Q29A 4F2QA 4RPOA 4MNIA 3ISPA 4MMPA 3FVGA 1GGGA 2QVUA 1DK4A 4N81A 2UVIA 3E78A 2PT1A 1UIVA 3U93A 4PQJA 2CEYA 3MZ9A 2XWIA 3GYYA 3K1PA 4IO3A 5DVJA 3KG2A 3O2AA 3EN3A 4X9TA 3SEVA 4RPNA 1MQGA 1FPLA 1N3WA 1AH5A 2GQ1A 2GHBA 1XVXA 1IMAA 4LATA 2XXQA 5DYHA 3PMXA 2FYIA 5AE4A 3V89B 2WKYA 2Z8EA 3Q28A 1RDXA 3GXAA 2WYPA 1YTVA 4GWYA 4QFLA 4QF9A 1FBEA 3JV9A 4G68C 1S50A 3MWBA 4PC9A 1MY3A 2REJA 2Q89A 3TQWA 4TOZA 1JETA 2NXOA 1I6QA 1CE2A 4H0WA 1ZIUA 3G3KA 1FCKA 4R6KA 5EQ8A 1URDA 4NF8A 1ZTYA 4X1BA 1POTA 1USYH 3MW0A 1N7XA 4IO6A 4JSDA 2VP1A 2IA4A 1AL3A 2F97A 4OESA 1N04A 2VT5A 3MVWA 4NF8B 4N91A 2D5WA 3PGFA 4R9GA 3ZKLA 4ZECA 2RINA 3TZAA 3MUQA 3HHFA 4HXVA 1D3KA 2VD2A 5DVIA 4OERA 1JW1A 3O97A 2A5TA 2XWKA 1A8EA 4MNCA 3IAZA 3KC1A 1BKAA 4PFYA 1N7WA 3TDJA 4AS5A 4BDRA 4O7IA 5I3SA 4UA8A 1SI1A 1MPCA 4MHFA 2WEFA 2A5TB 3Q26A 3EQ1A 5I2KA 3BBRA 5ET6A 3QIMA 4KR5A 4U21A 4QFKA 2H99A 1KZ8A 1EU8A 3EHUA 2RKMA 1MY2A 2ZNTA 4P11A 3SEUA 4IO5A 3E79A 2R9JA 3U94A 1LFIA 1P1QA 4NF6B 2GH9A 1JEUA 5CC2A 3RT6B 2V3TA 1YPNA 3U65A 5CMCA 4TQUQ 4PCDA 1PB9A 3DM0A 3JYRA 4F19A 1IMDA 3SKPA 1MQIA 3K01A 3PTYA 3T96B 2I0CA 4XXUA 5L9MA 2XX9A 3FJGA 4O3BA 2ZZWA 4QSDA 5L9OA 1MDQA 4GVOA 3TCHA 3RPWA 5ET8A 4PGNA 4EQ9A 2I6EA 2FIXA 1LAFE 3O29A 4DZ1A 4XKNA 1QULA 4GX3A 4U1ZA 3VV5A 3LUYA 1FPGA 1IMEA 1A99A 4KHZE 1FJ9A 1ELJA 5B70A 5B7DA 1IIWA 1IEJA 2V25A 3D4GA 1LAXA 2DE4A 2F36A 1IXHA 5H8NA 3KOSA 4F31B 4EQBA 1B3EA 3RY3A 5CRYA 1PC3A 3N6TA 4KCCA 5I57B 3PUYE 4HS7A 1NUWA 2B3FA 2H9BA 2DOJA 3O6HA 5TPAA 1FPEA 1B5JA 1N0TA 2DQVA 1K9ZA 4OYVA 5EQ9A 4Z0IA 3SEXA 2HEUA 4OENA 1H44A 1VFDA 2ALUA 3PMVA 1NV6A 2XXXA 3W9VA 2WBDA 3PUZE 3MP6A 3FATA 4IB2A 3VVDA 3OEMA 4BDMA 2P3VA 3FXUA 2B4LA 5AA4B 3NOHA 3R6UA 4DCYA 1FTAA 1FQFA 4I40A 3LSFB 3MZBA 4IY6A 4DLDA 5EQ7A 3LSLA 4OVQA 5EHSA 1OVBA 3G3FA 5I58A 1T0KA 2F7BA 2H5YA 3O28A 1B51A 1VE4A 4O8MA 2W7YA 1SI0A 4PF8A 3VVFA 1OIBA 1B4ZA 2CZIA 2OZZA 3RTFB 3MC2A 1R6ZA 5I59B 2YPNA 3KN7A 2Z22A 3KJ7A 3FD3A 3S9NC 4I62A 1ZJLA 4NEDA 3TODA 3O6GA 2FNCA 4OETA 1FTJA 2ZMBA 5I84A 1Y1MA 2G29A 3TCGA 1UTBB 1FJ6A 1AMFA 4M1VA 4MAGA 5A5XA 1EYIA 5EYFA 1F9BA 1NV7A 2M8CA 2O68A 1LBBA 2H98A 4IR8A 2Y5LA 2QS2A 4X8RA 2VD3A 5A5XB 4O7MA 3TTRA 2OK2A 4X04A 3A29A 3K1MA 4DDDA 2UXAA 3CVGA 5DT6A 4LZ7A 2F7AA 2DVZA 3UK4A 5H8HA 5JK4A 2XX7A 4RK2A 2XXVA 1TFAA 1LFGA 2O6AA 3QAXA 5F24A 3TCFA 1IITA 2F7CA 1RYOA 3UP9A 3G3JA 2I49A 3Q25A 1GVCA 5IZ3B 1MM7A 1UIUA 4BDOA 2I48A 4JB7A 4HCYA 2O84X 1SYIA 4MBPA 3CHGA 4XTCQ 5J16A 4LN5A 2Y5KA 1B40A 4RNSA 4H65A 2Y7KA 2LAOA 4H6DA 5K2YA 1B1HA 1MXWA 2OWTA 1TFDA 2O7UA 4YKIA 2Q88A 4F1YA 4JDFA 4OVJA 3H6WA 1NV3A 4N8YA 1P1NA 1B6HA 5CM6A 4G4PA 2I58A 3TAJA 1DSNA 1MXXA 3D1RA 4DXBA 3SZPA 4YKPA 4GFRA 5CMKA 2XWVA 1O64A 3G7WA 2ZZVA 3MJNA 2HQ0A 2Y7IA 2B4MA 3UIFA 4RXLA 3G3HA 4BLAA 3IR1A 2P1SA 3I6VA 3KBRA 5EQAA 3TTMA 1NMUA 2VOZA 4MLVA 4RA1A 5T3JA 4G77A 1VSOA 2DVCA 3B7DA 1M5EA 3E4RA 1QGXA 1DOTA 3PUWE 3QSLA 4GOTA 5FTHA 1YXIA 2MKZA 3UN6A 4ZEIA 1JNFA 4Q5TA 3CI8A 4O3CA 4I3EA 5AA2A 3ECRA 4PFBA 1OQHA 4LUBA 1JP4A 3A3CA 3CFXA 1NH7A 4DXUA 1ANFA 1LCTA 2X7PA 2HZLA 4NF0A 1LBYA 2PVUA 2HXRA 1FTOA 2QS3A
chains in the Genus database with same CATH topology
3DP8A 3QYTA 2ZXTA 3TKDA 5CBSA 3K4UA 4N13A 3PPOA 1Q1KA 1Q35A 4LVQA 1BLFA 4GXSB 4RYAA 4KFQA 1GTKA 2ZNSA 4ZE8A 4L17A 3VXCA 2UVGA 1UTHA 3GLBA 1P1OA 4K3FA 5I56B 3E9XA 3BFTA 1B3LA 1HSEA 3ZKKA 5CMMA 2NWJA 1LB9A 3VDFA 5ITPA 3CRBA 1UTHB 4KCDA 4ELOA 5DVFA 4R6YA 4PFWA 1B2HA 3T93B 4YB5A 1B4HA 3MVXA 5KZTA 1B1XA 2ONRA 2RF1A 3IJOB 5ISUA 1ZLQA 3GZGA 5AA1A 3HCQA 4R9FA 4FIMA 1IXCA 3C33A 4HW8A 4NWDA 4EDPA 4EQ7A 3K02A 3E3KA 3KOTA 4NE4A 3C34A 4U1OA 2I4CA 4OWDA 3TPAA 2QL3A 3SEYA 4GXAA 1B0LA 2PX1A 4C0RA 3BKIB 1MXVA 4ELPA 1B58A 1B7HA 2H4IA 4F2OA 3IB0A 2XXTA 5H8QB 4H1XA 4OHNA 2Y7WA 3C35A 2XHDA 3H6TA 4H5GA 1MXZA 2OWSA 3D4CA 4ZEFA 5KCJB 3GBBA 4ELQA 2PBWA 4POXA 2Y7PA 3OXNA 3WAFA 5CBRA 1FQDA 3LC8A 2Z8FA 1MPBA 1A54A 1SW2A 3MP1A 1URGA 4NF5B 1IUDA 1SW1A 4BDQA 1I69A 2ZYNA 1MQDA 3FV2A 1HSJA 2Y7RA 4C1UA 4M4GA 3PPNA 4N6PA 3EHSA 4ND9A 3TYHA 1IXGA 4NF6A 2DS9A 4ZZEA 4OXVA 1SYHA 5J1DA 1D9YA 1A40A 1R9LA 4YB6A 5AA3A 2Z8DA 1USYE 2OCUA 3UGWA 4GL8A 3TFLA 1FW0A 4IGTA 2XXPA 3GBAA 5HM4B 3QUFA 3LBSA 5FHOA 1QKAA 1URSA 1II5A 1S9TA 2VHAA 4QSCA 3IB2A 4TLLB 2HXWA 4KYEA 1A7LA 3K6WA 3LSXA 4ZDMA 1NFTA 3CR9A 1KWHA 3RUMA 3VLVA 3ZSFA 3TQLA 2AIXA 4HTGA 3M3LA 1Y4TA 4OTEA 3T9HB 3LSWA 2XXWA 3OO8A 5I57A 1YAEA 3VFJA 1S7YA 3M8UA 2QJEA 3P7IA 4OEVA 1OLAA 1JVXA 3CSBA 3K00A 4YZZA 3K6UA 4EUOA 1SBPA 1Y1ZA 5DTBA 4AB6A 1MG1A 1MY1A 4XKRA 1PDAA 3OSQA 5AA4A 3U92A 3TUSA 1I6BA 4MFIA 4QFOA 1I6AA 1MS7A 3N5LA 3SESA 4QFPA 4P0IA 3FVNA 4WEPA 3OO9A 5ICTA 1VR5A 4F3PA 2RC8A 3T9VA 2F8DA 1US4A 2GFEA 3O6IA 1TWYA 5TU0A 1MPDA 4BDNA 5I59A 4KQPA 1N84A 4E0XA 3K0VA 3C4MA 3TTKA 3MAMA 3PPQA 2D3IA 1MY0A 3EHTA 4PFUA 2QMWA 2Q9TA 1MXUA 4TLMB 1AOVA 4YICA 5M2VA 3QXMA 3H06B 1UTBA 1B05A 3KN3A 1LCFA 1DPEA 4GRKA 1MY4A 3C9HA 5H8FB 3U1OA 4G8MA 4YMAA 4AB5A 4ECFA 4LZ8A 3WAEA 3C36A 3CG3A 4WXJA 4QHQA 4X48A 3OELA 1FTLA 5JTYB 3S9EA 3PPPA 3FUZA 4LP2B 2O51A 1LB8A 3RT8A 4NTLA 2I0BA 1Z7NE 4E0WA 2NVUB 3ILTB 3OEKA 3RQTA 2FA7A 2G93A 3H3GA 4WEDA 4MH5A 3SETA 2AL4A 3CIJA 1FTMA 2DWHA 3RLFE 2DXYA 4G2ZA 1JW4A 1NNKA 2V3UA 5I2NA 2HFBA 3BFUA 1O63A 4F3GA 2IEEA 2UYEA 4GWOA 2ZNUA 3VVEA 2ESNA 4ZS9A 2XD3A 5I2NB 1ZU0A 2ZYMA 4I8CA 3SDFA 3IOUA 2Q8JA 2HAVA 5LOMA 4U2RA 1B46A 2DP8A 1DMBA 2F35A 1EZ9A 4H8IA 4FAJA 3S9LC 3SERA 2YJPA 4DE8A 1VFEA 3MPLA 1JW5A 1MRPA 3FXQA 3IORA 2F5XA 1AIVA 1WVJA 1OMPA 3VE1B 5FTIA 1XC1A 1LSTA 1M5DA 4FEDA 4JWYA 2GRVA 4GD5A 1OQGA 3THIA 3UORA 1B3HA 1A8FA 2I3VA 5JEIA 2P2AA 5F7VA 4YKKA 4P0GA 3O9PA 3IO4A 1R1NA 1H45A 2THIA 2H25A 2O69A 2BJJX 3TTNA 1CB6A 3DP4A 1P1UA 2B65A 2V3QA 1XS5A 1BTJA 1GR2A 3VLWA 4NF4B 2E1SA 4F29A 3VLUA 5L8DA 2V93A 3FASA 3VXBA 3C32A 5I56A 2RC7A 4IO7A 4R6HA 2F78A 5CMBA 2XX8A 3CFLA 1HSLA 4IY5A 1MDP1 4UACA 2VGQA 3IO6A 3HO7A 4AQ4A 2HZKA 1J1NA 3F11A 4R72A 3PD8A 4OMBA 2DWAA 1NH8A 1M5FA 3V83A 5TP9A 4ESXA 1SQYA 2DE2A 4U4SA 1OLCA 1RKMA 4BDLA 4F39A 5KDTB 2ABHA 2OBGA 3TEPA 4ONYA 3R7XA 5IKBA 3FZVA 4FE8A 3KEIA 2DYXA 4FECA 5TP9B 1OVTA 4LA9A 1SD3A 4Q30B 3S4UA 3H4ZA 3A09A 4R74A 3E13X 4F18A 4JXIA 1FTKA 1ZMGA 2YLNA 3U72A 2ONKE 3ZS6A 5H8QA 4ELRA 1LBCA 4Z7EA 2Y84A 4JSOA 4KD5A 1JVYA 4ZEKA 4IGRA 4RJZA 3FGSA 3N6UA 3PUVE 3DLNA 2R71A 4X1DA 1EZOA 2Q2CA 3UA8A 5KCJA 1D4NA 4OEUA 2PT2A 2XXRA 1MM6A 1IZ1A 2F6GA 3B6TA 3A3UA 3MVYA 1NNTA 4PP0A 4R75A 1NKXA 1TXFA 2RCBA 1D9VA 2XXYA 4NF5A 1DTZA 2HAUA 3KFMA 2QSXA 3AXFA 4FATA 4LQ5A 3G3IA 4KPTA 4OFOA 1H76A 3RGYA 3T9XB 2DSFA 2QRYA 3HV1A 4LQ2A 1Y3NA 3LR1A 1EZPA 2OLBA 3IB1A 4FJPA 4R2FA 1ATGA 2Q2AA 4EXKA 1L5TA 1B9JA 3K2DA 2F34A 4WKMA 3ILUB 3M3FA 3HHGA 3Q27A 4XKQA 1NL5A 3KJTA 3IOTA 3PD9A 3MQ9A 5HBCA 3M3KA 3RTWB 4PETA 1ZKBA 4G8NA 2F6PA 4QFNA 1LLSA 2DE3A 2DWIA 1B52A 4RY1A 3R26A 3IK6B 5I2KB 2AYSA 4G8HA 2D21A 1QJMA 5ITOA 3QUJA 5ELVA 3TTLA 4KYSA 3TMGA 4KYDA 2DWJA 4G68A 5K2XA 4N07A 4U22A 1SVXB 2X7QA 3EF7A 1B7UA 3RNNA 3OO6A 3FVKA 1Y20A 4ISUA 2RC9A 3B6QA 4G68B 2B3BA 3S2VA 4GLIA 1MQHA 1QW0A 4IO2A 4EF2A 1JEVA 2UVHA 1H43A 1XHYA 4RK9A 3KSXA 4YMBA 3H03A 4F1VA 4FEBA 4C1TA 4DXCA 2CMOA 5H8SA 1JQFA 1A55A 1WDNA 2XD2A 1NNPA 3FVOA 1IXIA 1M5BA 5DEXA 1PBQA 3SEWA 3B6WA 1IQ7A 4JBZA 1P99A 2AL5A 3ONMA 5H8NB 3ODBA 3S9MC 2ZYOA 1M5CA 1B3FA 2DXRA 4R2BA 3OMBA 3KZGA 5DEXB 3PU5A 1FQCA 1GV8A 2RCAA 4FORA 1MH4A 3HPIA 3EPEA 4I9DA 5TPAB 2NOOA 2ONSA 3OSRA 2QS4A 2PMSA 4KI0E 1B0HA 1XVYA 1LFHA 4Q0CA 4OFLA 1PBPA 2GHAA 3CSGA 4YU0A 2CZLA 2R6GE 1MH3A 1BIYA 4MLQA 5FHNA 4PE5B 4JWXA 3I3VA 2XXHA 3IL1B 3PV0E 1TT1A 1N3XA 1Y3QA 4ZEBA 5H8FA 1DPPA 4IO4A 2REGA 3PUXE 3T22A 1N76A 1WODA 3KGCA 3OD7A 3N94A 1PEBA 3OOAA 1SDXA 1B5IA 4POWA 4QSEA 5JTYA 4XKPA 1R9QA 4F3SA 5I58B 1Y9UA 3KN8A 4R73A 4OFJA 3W15C 3K1NA 1YCJA 1ZBMA 4OZ9A 3MBPA 4GIZA 3MPKA 4XIGQ 1QVSA 4Q8RA 3FIRA 4F1UA 4F22A 2O1MA 2QS1A 3K6VA 1NNFA 3K6XA 1XOCA 3V8XB 4HCWA 2X26A 3DP6A 3IOWA 4H67A 3FJMA 3HN0A 4GL0A 1LAHE 2V84A 2Z23A 3PPRA 1MXYA 3FXRA 1QUKA 5ICQA 5BWJA 3FJ7A 1BP5A 1MQJA 2HCAA 5FHMA 2O7IA 2PYYA 3H6VA 4H5FA 3G3GA 3H7MA 3USDA 1QUIA 3L6HA 4LONB 3MVZA 4YKJA 4QRZA 3L6GA 4ZEDA 5H8HB 1Y3PA 1PB7A 3N26A 1RYXA 4GF8A 3T66A 1Z7ME 3C31A 5AA2D 2KLFA 1O7TA 1FQAA 2I3WA 2E0SA 3CFZA 1LAGE 4THIA 4PFTA 2I4BA 4EF1A 1SW5A 3U8QA 3TELA 1H3DA 5HPQA 3I5OA 1PB8A 1EH3A 3FV1A 1LGBC 3IX1A 4GQOA 3IOVA 4U4XA 4DIGA 4NMYA 4H8JA 2ZYKA 5IAIA 2A5SA 4LZ5A 2P0SA 4YAHX 2OJTA 3JZJA 2XXUA 1FQEA 2UYFA 4ESWA 3T9UA 4YB7A 4NWCA 1B3GA 4OQOA 3KSJA 1QUJA 4NF4A 2O1LA 5F1QA 3PMWA 3W9WA 2QMXA 2UVJA 3HSTA 3DELB 4DCXA 1DTGA 1QKBA 3IJXB 2NUVA 3RN8A 4EXLA 1B5HA 1UQWA 1US5A 1SW4A 4ZZAA 5AA2B 3MP8A 3QK6A 4I1DA 4F3BA 4JWOA 4MF3A 1P1WA 1POY1 3OO7A 2XXIA 5L9SA 5CI5A 2QPQA 1FQBA 1B32A 1B7ZA 5BUUA 3MZ1A 1XT8A 3CG1A 3H6UA 5KDTA 2ANJA 1Y4CA 4ZE9A 3OENA 4U23A 3V5AA 4O3AA 5EHMA 3O66A 3Q29A 4F2QA 4RPOA 3FVGA 1GGGA 2UVIA 2PT1A 1UIVA 3U93A 4PQJA 3MZ9A 3K1PA 4IO3A 5DVJA 3KG2A 3O2AA 3EN3A 4X9TA 3SEVA 4RPNA 1MQGA 1N3WA 1AH5A 2GHBA 1XVXA 4LATA 2XXQA 5DYHA 3PMXA 2FYIA 5AE4A 3V89B 2WKYA 2Z8EA 3Q28A 3GXAA 1YTVA 4QFLA 4QF9A 3JV9A 4G68C 1S50A 3MWBA 1MY3A 3TQWA 2Q89A 2REJA 4TOZA 1JETA 2NXOA 1I6QA 1CE2A 4H0WA 1ZIUA 3G3KA 1FCKA 4R6KA 1URDA 4NF8A 1ZTYA 4X1BA 1POTA 1USYH 3MW0A 1N7XA 4IO6A 4JSDA 2VP1A 2IA4A 1AL3A 2F97A 4OESA 1N04A 3MVWA 4NF8B 2D5WA 3PGFA 4R9GA 3ZKLA 4ZECA 2RINA 3TZAA 3MUQA 3HHFA 1D3KA 2VD2A 5DVIA 4OERA 1JW1A 3O97A 2A5TA 1A8EA 3IAZA 1BKAA 4PFYA 1N7WA 3TDJA 4BDRA 4UA8A 1SI1A 1MPCA 2A5TB 3Q26A 3EQ1A 5I2KA 3BBRA 3QIMA 4KR5A 4U21A 4QFKA 2H99A 1EU8A 3EHUA 2RKMA 1MY2A 2ZNTA 4P11A 3SEUA 4IO5A 2R9JA 3U94A 1LFIA 1P1QA 4NF6B 2GH9A 1JEUA 5CC2A 3RT6B 2V3TA 1YPNA 5CMCA 4TQUQ 1PB9A 3DM0A 3JYRA 4F19A 3SKPA 1MQIA 3K01A 3T96B 2I0CA 4XXUA 5L9MA 2XX9A 3FJGA 4O3BA 4QSDA 5L9OA 1MDQA 4GVOA 3TCHA 3RPWA 4EQ9A 2I6EA 1LAFE 3O29A 4DZ1A 4XKNA 1QULA 4U1ZA 3VV5A 3LUYA 4KHZE 1A99A 1ELJA 5B70A 5B7DA 1IIWA 1IEJA 2V25A 3D4GA 1LAXA 2DE4A 2F36A 1IXHA 5H8NA 3KOSA 4F31B 4EQBA 1B3EA 3RY3A 5CRYA 1PC3A 3N6TA 4KCCA 5I57B 3PUYE 4HS7A 2B3FA 2H9BA 2DOJA 3O6HA 5TPAA 1B5JA 1N0TA 2DQVA 4OYVA 4Z0IA 3SEXA 2HEUA 4OENA 1H44A 1VFDA 2ALUA 3PMVA 2XXXA 3W9VA 3PUZE 3MP6A 3FATA 4IB2A 3VVDA 3OEMA 4BDMA 3FXUA 5AA4B 3R6UA 4DCYA 1FQFA 3LSFB 3MZBA 4IY6A 4DLDA 3LSLA 5EHSA 1OVBA 3G3FA 5I58A 1T0KA 2F7BA 2H5YA 3O28A 1B51A 1VE4A 2W7YA 1SI0A 3VVFA 1OIBA 1B4ZA 2OZZA 3RTFB 3MC2A 1R6ZA 5I59B 2YPNA 3KN7A 2Z22A 3KJ7A 3FD3A 3S9NC 4I62A 1ZJLA 4NEDA 3TODA 3O6GA 2FNCA 4OETA 1FTJA 2ZMBA 5I84A 1Y1MA 2G29A 3TCGA 1UTBB 1AMFA 4M1VA 5A5XA 5EYFA 1F9BA 2M8CA 2O68A 1LBBA 2H98A 2QS2A 2VD3A 5A5XB 3TTRA 2OK2A 3K1MA 4DDDA 2UXAA 3CVGA 5DT6A 4LZ7A 2F7AA 2DVZA 3UK4A 5H8HA 5JK4A 2XX7A 4RK2A 2XXVA 1TFAA 1LFGA 2O6AA 3QAXA 3TCFA 1IITA 2F7CA 1RYOA 3UP9A 3G3JA 2I49A 3Q25A 1GVCA 1MM7A 1UIUA 4BDOA 2I48A 4JB7A 4HCYA 2O84X 1SYIA 4MBPA 4XTCQ 1B40A 4RNSA 4H65A 2Y7KA 2LAOA 4H6DA 5K2YA 1B1HA 1MXWA 2OWTA 1TFDA 2O7UA 4YKIA 2Q88A 4F1YA 4JDFA 4OVJA 3H6WA 1P1NA 1B6HA 5CM6A 4G4PA 2I58A 3TAJA 1DSNA 1MXXA 4DXBA 4YKPA 4GFRA 5CMKA 1O64A 3G7WA 3MJNA 2HQ0A 2Y7IA 3UIFA 4RXLA 3G3HA 4BLAA 3IR1A 2P1SA 3I6VA 3KBRA 3TTMA 1NMUA 2VOZA 4MLVA 4RA1A 4G77A 1VSOA 2DVCA 3B7DA 1M5EA 3E4RA 1DOTA 3PUWE 3QSLA 4GOTA 5FTHA 3UN6A 4ZEIA 1JNFA 4Q5TA 3CI8A 4O3CA 5AA2A 3ECRA 1OQHA 4LUBA 3A3CA 3CFXA 1NH7A 4DXUA 1ANFA 1LCTA 2X7PA 2HZLA 2PVUA 1FTOA 2QS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DP8 A;  3QYT A;  2ZXT A;  3TKD A;  5CBS A;  3K4U A;  4N13 A;  3PPO A;  1Q1K A;  1Q35 A;  4LVQ A;  1BLF A;  4GXS B;  4RYA A;  4KFQ A;  1GTK A;  2ZNS A;  4ZE8 A;  4L17 A;  3VXC A;  2UVG A;  1UTH A;  3GLB A;  1P1O A;  4K3F A;  5I56 B;  3E9X A;  3BFT A;  1B3L A;  1HSE A;  3ZKK A;  5CMM A;  2NWJ A;  1LB9 A;  3VDF A;  5ITP A;  3CRB A;  1UTH B;  4KCD A;  4ELO A;  5DVF A;  4R6Y A;  4PFW A;  1B2H A;  3T93 B;  4YB5 A;  1B4H A;  3MVX A;  5KZT A;  1B1X A;  2ONR A;  2RF1 A;  3IJO B;  5ISU A;  1ZLQ A;  3GZG A;  5AA1 A;  3HCQ A;  4R9F A;  4FIM A;  1IXC A;  3C33 A;  4HW8 A;  4NWD A;  4EDP A;  4EQ7 A;  3K02 A;  3E3K A;  3KOT A;  4NE4 A;  3C34 A;  4U1O A;  2I4C A;  4OWD A;  3TPA A;  2QL3 A;  3SEY A;  4GXA A;  1B0L A;  2PX1 A;  4C0R A;  3BKI B;  1MXV A;  4ELP A;  1B58 A;  1B7H A;  2H4I A;  4F2O A;  3IB0 A;  2XXT A;  5H8Q B;  4H1X A;  4OHN A;  2Y7W A;  3C35 A;  2XHD A;  3H6T A;  4H5G A;  1MXZ A;  2OWS A;  3D4C A;  4ZEF A;  5KCJ B;  3GBB A;  4ELQ A;  2PBW A;  4POX A;  2Y7P A;  3OXN A;  3WAF A;  5CBR A;  1FQD A;  3LC8 A;  2Z8F A;  1MPB A;  1A54 A;  1SW2 A;  3MP1 A;  1URG A;  4NF5 B;  1IUD A;  1SW1 A;  4BDQ A;  1I69 A;  2ZYN A;  1MQD A;  3FV2 A;  1HSJ A;  2Y7R A;  4C1U A;  4M4G A;  3PPN A;  4N6P A;  3EHS A;  4ND9 A;  3TYH A;  1IXG A;  4NF6 A;  2DS9 A;  4ZZE A;  4OXV A;  1SYH A;  5J1D A;  1D9Y A;  1A40 A;  1R9L A;  4YB6 A;  5AA3 A;  2Z8D A;  1USY E;  2OCU A;  3UGW A;  4GL8 A;  3TFL A;  1FW0 A;  4IGT A;  2XXP A;  3GBA A;  5HM4 B;  3QUF A;  3LBS A;  5FHO A;  1QKA A;  1URS A;  1II5 A;  1S9T A;  2VHA A;  4QSC A;  3IB2 A;  4TLL B;  2HXW A;  4KYE A;  1A7L A;  3K6W A;  3LSX A;  4ZDM A;  1NFT A;  3CR9 A;  1KWH A;  3RUM A;  3VLV A;  3ZSF A;  3TQL A;  2AIX A;  4HTG A;  3M3L A;  1Y4T A;  4OTE A;  3T9H B;  3LSW A;  2XXW A;  3OO8 A;  5I57 A;  1YAE A;  3VFJ A;  1S7Y A;  3M8U A;  2QJE A;  3P7I A;  4OEV A;  1OLA A;  1JVX A;  3CSB A;  3K00 A;  4YZZ A;  3K6U A;  4EUO A;  1SBP A;  1Y1Z A;  5DTB A;  4AB6 A;  1MG1 A;  1MY1 A;  4XKR A;  1PDA A;  3OSQ A;  5AA4 A;  3U92 A;  3TUS A;  1I6B A;  4MFI A;  4QFO A;  1I6A A;  1MS7 A;  3N5L A;  3SES A;  4QFP A;  4P0I A;  3FVN A;  4WEP A;  3OO9 A;  5ICT A;  1VR5 A;  4F3P A;  2RC8 A;  3T9V A;  2F8D A;  1US4 A;  2GFE A;  3O6I A;  1TWY A;  5TU0 A;  1MPD A;  4BDN A;  5I59 A;  4KQP A;  1N84 A;  4E0X A;  3K0V A;  3C4M A;  3TTK A;  3MAM A;  3PPQ A;  2D3I A;  1MY0 A;  3EHT A;  4PFU A;  2QMW A;  2Q9T A;  1MXU A;  4TLM B;  1AOV A;  4YIC A;  5M2V A;  3QXM A;  3H06 B;  1UTB A;  1B05 A;  3KN3 A;  1LCF A;  1DPE A;  4GRK A;  1MY4 A;  3C9H A;  5H8F B;  3U1O A;  4G8M A;  4YMA A;  4AB5 A;  4ECF A;  4LZ8 A;  3WAE A;  3C36 A;  3CG3 A;  4WXJ A;  4QHQ A;  4X48 A;  3OEL A;  1FTL A;  5JTY B;  3S9E A;  3PPP A;  3FUZ A;  4LP2 B;  2O51 A;  1LB8 A;  3RT8 A;  4NTL A;  2I0B A;  1Z7N E;  4E0W A;  2NVU B;  3ILT B;  3OEK A;  3RQT A;  2FA7 A;  2G93 A;  3H3G A;  4WED A;  4MH5 A;  3SET A;  2AL4 A;  3CIJ A;  1FTM A;  2DWH A;  3RLF E;  2DXY A;  4G2Z A;  1JW4 A;  1NNK A;  2V3U A;  5I2N A;  2HFB A;  3BFU A;  1O63 A;  4F3G A;  2IEE A;  2UYE A;  4GWO A;  2ZNU A;  3VVE A;  2ESN A;  4ZS9 A;  2XD3 A;  5I2N B;  1ZU0 A;  2ZYM A;  4I8C A;  3SDF A;  3IOU A;  2Q8J A;  2HAV A;  5LOM A;  4U2R A;  1B46 A;  2DP8 A;  1DMB A;  2F35 A;  1EZ9 A;  4H8I A;  4FAJ A;  3S9L C;  3SER A;  2YJP A;  4DE8 A;  1VFE A;  3MPL A;  1JW5 A;  1MRP A;  3FXQ A;  3IOR A;  2F5X A;  1AIV A;  1WVJ A;  1OMP A;  3VE1 B;  5FTI A;  1XC1 A;  1LST A;  1M5D A;  4FED A;  4JWY A;  2GRV A;  4GD5 A;  1OQG A;  3THI A;  3UOR A;  1B3H A;  1A8F A;  2I3V A;  5JEI A;  2P2A A;  5F7V A;  4YKK A;  4P0G A;  3O9P A;  3IO4 A;  1R1N A;  1H45 A;  2THI A;  2H25 A;  2O69 A;  2BJJ X;  3TTN A;  1CB6 A;  3DP4 A;  1P1U A;  2B65 A;  2V3Q A;  1XS5 A;  1BTJ A;  1GR2 A;  3VLW A;  4NF4 B;  2E1S A;  4F29 A;  3VLU A;  5L8D A;  2V93 A;  3FAS A;  3VXB A;  3C32 A;  5I56 A;  2RC7 A;  4IO7 A;  4R6H A;  2F78 A;  5CMB A;  2XX8 A;  3CFL A;  1HSL A;  4IY5 A;  1MDP 1;  4UAC A;  2VGQ A;  3IO6 A;  3HO7 A;  4AQ4 A;  2HZK A;  1J1N A;  3F11 A;  4R72 A;  3PD8 A;  4OMB A;  2DWA A;  1NH8 A;  1M5F A;  3V83 A;  5TP9 A;  4ESX A;  1SQY A;  2DE2 A;  4U4S A;  1OLC A;  1RKM A;  4BDL A;  4F39 A;  5KDT B;  2ABH A;  2OBG A;  3TEP A;  4ONY A;  3R7X A;  5IKB A;  3FZV A;  4FE8 A;  3KEI A;  2DYX A;  4FEC A;  5TP9 B;  1OVT A;  4LA9 A;  1SD3 A;  4Q30 B;  3S4U A;  3H4Z A;  3A09 A;  4R74 A;  3E13 X;  4F18 A;  4JXI A;  1FTK A;  1ZMG A;  2YLN A;  3U72 A;  2ONK E;  3ZS6 A;  5H8Q A;  4ELR A;  1LBC A;  4Z7E A;  2Y84 A;  4JSO A;  4KD5 A;  1JVY A;  4ZEK A;  4IGR A;  4RJZ A;  3FGS A;  3N6U A;  3PUV E;  3DLN A;  2R71 A;  4X1D A;  1EZO A;  2Q2C A;  3UA8 A;  5KCJ A;  1D4N A;  4OEU A;  2PT2 A;  2XXR A;  1MM6 A;  1IZ1 A;  2F6G A;  3B6T A;  3A3U A;  3MVY A;  1NNT A;  4PP0 A;  4R75 A;  1NKX A;  1TXF A;  2RCB A;  1D9V A;  2XXY A;  4NF5 A;  1DTZ A;  2HAU A;  3KFM A;  2QSX A;  3AXF A;  4FAT A;  4LQ5 A;  3G3I A;  4KPT A;  4OFO A;  1H76 A;  3RGY A;  3T9X B;  2DSF A;  2QRY A;  3HV1 A;  4LQ2 A;  1Y3N A;  3LR1 A;  1EZP A;  2OLB A;  3IB1 A;  4FJP A;  4R2F A;  1ATG A;  2Q2A A;  4EXK A;  1L5T A;  1B9J A;  3K2D A;  2F34 A;  4WKM A;  3ILU B;  3M3F A;  3HHG A;  3Q27 A;  4XKQ A;  1NL5 A;  3KJT A;  3IOT A;  3PD9 A;  3MQ9 A;  5HBC A;  3M3K A;  3RTW B;  4PET A;  1ZKB A;  4G8N A;  2F6P A;  4QFN A;  1LLS A;  2DE3 A;  2DWI A;  1B52 A;  4RY1 A;  3R26 A;  3IK6 B;  5I2K B;  2AYS A;  4G8H A;  2D21 A;  1QJM A;  5ITO A;  3QUJ A;  5ELV A;  3TTL A;  4KYS A;  3TMG A;  4KYD A;  2DWJ A;  4G68 A;  5K2X A;  4N07 A;  4U22 A;  1SVX B;  2X7Q A;  3EF7 A;  1B7U A;  3RNN A;  3OO6 A;  3FVK A;  1Y20 A;  4ISU A;  2RC9 A;  3B6Q A;  4G68 B;  2B3B A;  3S2V A;  4GLI A;  1MQH A;  1QW0 A;  4IO2 A;  4EF2 A;  1JEV A;  2UVH A;  1H43 A;  1XHY A;  4RK9 A;  3KSX A;  4YMB A;  3H03 A;  4F1V A;  4FEB A;  4C1T A;  4DXC A;  2CMO A;  5H8S A;  1JQF A;  1A55 A;  1WDN A;  2XD2 A;  1NNP A;  3FVO A;  1IXI A;  1M5B A;  5DEX A;  1PBQ A;  3SEW A;  3B6W A;  1IQ7 A;  4JBZ A;  1P99 A;  2AL5 A;  3ONM A;  5H8N B;  3ODB A;  3S9M C;  2ZYO A;  1M5C A;  1B3F A;  2DXR A;  4R2B A;  3OMB A;  3KZG A;  5DEX B;  3PU5 A;  1FQC A;  1GV8 A;  2RCA A;  4FOR A;  1MH4 A;  3HPI A;  3EPE A;  4I9D A;  5TPA B;  2NOO A;  2ONS A;  3OSR A;  2QS4 A;  2PMS A;  4KI0 E;  1B0H A;  1XVY A;  1LFH A;  4Q0C A;  4OFL A;  1PBP A;  2GHA A;  3CSG A;  4YU0 A;  2CZL A;  2R6G E;  1MH3 A;  1BIY A;  4MLQ A;  5FHN A;  4PE5 B;  4JWX A;  3I3V A;  2XXH A;  3IL1 B;  3PV0 E;  1TT1 A;  1N3X A;  1Y3Q A;  4ZEB A;  5H8F A;  1DPP A;  4IO4 A;  2REG A;  3PUX E;  3T22 A;  1N76 A;  1WOD A;  3KGC A;  3OD7 A;  3N94 A;  1PEB A;  3OOA A;  1SDX A;  1B5I A;  4POW A;  4QSE A;  5JTY A;  4XKP A;  1R9Q A;  4F3S A;  5I58 B;  1Y9U A;  3KN8 A;  4R73 A;  4OFJ A;  3W15 C;  3K1N A;  1YCJ A;  1ZBM A;  4OZ9 A;  3MBP A;  4GIZ A;  3MPK A;  4XIG Q;  1QVS A;  4Q8R A;  3FIR A;  4F1U A;  4F22 A;  2O1M A;  2QS1 A;  3K6V A;  1NNF A;  3K6X A;  1XOC A;  3V8X B;  4HCW A;  2X26 A;  3DP6 A;  3IOW A;  4H67 A;  3FJM A;  3HN0 A;  4GL0 A;  1LAH E;  2V84 A;  2Z23 A;  3PPR A;  1MXY A;  3FXR A;  1QUK A;  5ICQ A;  5BWJ A;  3FJ7 A;  1BP5 A;  1MQJ A;  2HCA A;  5FHM A;  2O7I A;  2PYY A;  3H6V A;  4H5F A;  3G3G A;  3H7M A;  3USD A;  1QUI A;  3L6H A;  4LON B;  3MVZ A;  4YKJ A;  4QRZ A;  3L6G A;  4ZED A;  5H8H B;  1Y3P A;  1PB7 A;  3N26 A;  1RYX A;  4GF8 A;  3T66 A;  1Z7M E;  3C31 A;  5AA2 D;  2KLF A;  1O7T A;  1FQA A;  2I3W A;  2E0S A;  3CFZ A;  1LAG E;  4THI A;  4PFT A;  2I4B A;  4EF1 A;  1SW5 A;  3U8Q A;  3TEL A;  1H3D A;  5HPQ A;  3I5O A;  1PB8 A;  1EH3 A;  3FV1 A;  1LGB C;  3IX1 A;  4GQO A;  3IOV A;  4U4X A;  4DIG A;  4NMY A;  4H8J A;  2ZYK A;  5IAI A;  2A5S A;  4LZ5 A;  2P0S A;  4YAH X;  2OJT A;  3JZJ A;  2XXU A;  1FQE A;  2UYF A;  4ESW A;  3T9U A;  4YB7 A;  4NWC A;  1B3G A;  4OQO A;  3KSJ A;  1QUJ A;  4NF4 A;  2O1L A;  5F1Q A;  3PMW A;  3W9W A;  2QMX A;  2UVJ A;  3HST A;  3DEL B;  4DCX A;  1DTG A;  1QKB A;  3IJX B;  2NUV A;  3RN8 A;  4EXL A;  1B5H A;  1UQW A;  1US5 A;  1SW4 A;  4ZZA A;  5AA2 B;  3MP8 A;  3QK6 A;  4I1D A;  4F3B A;  4JWO A;  4MF3 A;  1P1W A;  1POY 1;  3OO7 A;  2XXI A;  5L9S A;  5CI5 A;  2QPQ A;  1FQB A;  1B32 A;  1B7Z A;  5BUU A;  3MZ1 A;  1XT8 A;  3CG1 A;  3H6U A;  5KDT A;  2ANJ A;  1Y4C A;  4ZE9 A;  3OEN A;  4U23 A;  3V5A A;  4O3A A;  5EHM A;  3O66 A;  3Q29 A;  4F2Q A;  4RPO A;  3FVG A;  1GGG A;  2UVI A;  2PT1 A;  1UIV A;  3U93 A;  4PQJ A;  3MZ9 A;  3K1P A;  4IO3 A;  5DVJ A;  3KG2 A;  3O2A A;  3EN3 A;  4X9T A;  3SEV A;  4RPN A;  1MQG A;  1N3W A;  1AH5 A;  2GHB A;  1XVX A;  4LAT A;  2XXQ A;  5DYH A;  3PMX A;  2FYI A;  5AE4 A;  3V89 B;  2WKY A;  2Z8E A;  3Q28 A;  3GXA A;  1YTV A;  4QFL A;  4QF9 A;  3JV9 A;  4G68 C;  1S50 A;  3MWB A;  1MY3 A;  3TQW A;  2Q89 A;  2REJ A;  4TOZ A;  1JET A;  2NXO A;  1I6Q A;  1CE2 A;  4H0W A;  1ZIU A;  3G3K A;  1FCK A;  4R6K A;  1URD A;  4NF8 A;  1ZTY A;  4X1B A;  1POT A;  1USY H;  3MW0 A;  1N7X A;  4IO6 A;  4JSD A;  2VP1 A;  2IA4 A;  1AL3 A;  2F97 A;  4OES A;  1N04 A;  3MVW A;  4NF8 B;  2D5W A;  3PGF A;  4R9G A;  3ZKL A;  4ZEC A;  2RIN A;  3TZA A;  3MUQ A;  3HHF A;  1D3K A;  2VD2 A;  5DVI A;  4OER A;  1JW1 A;  3O97 A;  2A5T A;  1A8E A;  3IAZ A;  1BKA A;  4PFY A;  1N7W A;  3TDJ A;  4BDR A;  4UA8 A;  1SI1 A;  1MPC A;  2A5T B;  3Q26 A;  3EQ1 A;  5I2K A;  3BBR A;  3QIM A;  4KR5 A;  4U21 A;  4QFK A;  2H99 A;  1EU8 A;  3EHU A;  2RKM A;  1MY2 A;  2ZNT A;  4P11 A;  3SEU A;  4IO5 A;  2R9J A;  3U94 A;  1LFI A;  1P1Q A;  4NF6 B;  2GH9 A;  1JEU A;  5CC2 A;  3RT6 B;  2V3T A;  1YPN A;  5CMC A;  4TQU Q;  1PB9 A;  3DM0 A;  3JYR A;  4F19 A;  3SKP A;  1MQI A;  3K01 A;  3T96 B;  2I0C A;  4XXU A;  5L9M A;  2XX9 A;  3FJG A;  4O3B A;  4QSD A;  5L9O A;  1MDQ A;  4GVO A;  3TCH A;  3RPW A;  4EQ9 A;  2I6E A;  1LAF E;  3O29 A;  4DZ1 A;  4XKN A;  1QUL A;  4U1Z A;  3VV5 A;  3LUY A;  4KHZ E;  1A99 A;  1ELJ A;  5B70 A;  5B7D A;  1IIW A;  1IEJ A;  2V25 A;  3D4G A;  1LAX A;  2DE4 A;  2F36 A;  1IXH A;  5H8N A;  3KOS A;  4F31 B;  4EQB A;  1B3E A;  3RY3 A;  5CRY A;  1PC3 A;  3N6T A;  4KCC A;  5I57 B;  3PUY E;  4HS7 A;  2B3F A;  2H9B A;  2DOJ A;  3O6H A;  5TPA A;  1B5J A;  1N0T A;  2DQV A;  4OYV A;  4Z0I A;  3SEX A;  2HEU A;  4OEN A;  1H44 A;  1VFD A;  2ALU A;  3PMV A;  2XXX A;  3W9V A;  3PUZ E;  3MP6 A;  3FAT A;  4IB2 A;  3VVD A;  3OEM A;  4BDM A;  3FXU A;  5AA4 B;  3R6U A;  4DCY A;  1FQF A;  3LSF B;  3MZB A;  4IY6 A;  4DLD A;  3LSL A;  5EHS A;  1OVB A;  3G3F A;  5I58 A;  1T0K A;  2F7B A;  2H5Y A;  3O28 A;  1B51 A;  1VE4 A;  2W7Y A;  1SI0 A;  3VVF A;  1OIB A;  1B4Z A;  2OZZ A;  3RTF B;  3MC2 A;  1R6Z A;  5I59 B;  2YPN A;  3KN7 A;  2Z22 A;  3KJ7 A;  3FD3 A;  3S9N C;  4I62 A;  1ZJL A;  4NED A;  3TOD A;  3O6G A;  2FNC A;  4OET A;  1FTJ A;  2ZMB A;  5I84 A;  1Y1M A;  2G29 A;  3TCG A;  1UTB B;  1AMF A;  4M1V A;  5A5X A;  5EYF A;  1F9B A;  2M8C A;  2O68 A;  1LBB A;  2H98 A;  2QS2 A;  2VD3 A;  5A5X B;  3TTR A;  2OK2 A;  3K1M A;  4DDD A;  2UXA A;  3CVG A;  5DT6 A;  4LZ7 A;  2F7A A;  2DVZ A;  3UK4 A;  5H8H A;  5JK4 A;  2XX7 A;  4RK2 A;  2XXV A;  1TFA A;  1LFG A;  2O6A A;  3QAX A;  3TCF A;  1IIT A;  2F7C A;  1RYO A;  3UP9 A;  3G3J A;  2I49 A;  3Q25 A;  1GVC A;  1MM7 A;  1UIU A;  4BDO A;  2I48 A;  4JB7 A;  4HCY A;  2O84 X;  1SYI A;  4MBP A;  4XTC Q;  1B40 A;  4RNS A;  4H65 A;  2Y7K A;  2LAO A;  4H6D A;  5K2Y A;  1B1H A;  1MXW A;  2OWT A;  1TFD A;  2O7U A;  4YKI A;  2Q88 A;  4F1Y A;  4JDF A;  4OVJ A;  3H6W A;  1P1N A;  1B6H A;  5CM6 A;  4G4P A;  2I58 A;  3TAJ A;  1DSN A;  1MXX A;  4DXB A;  4YKP A;  4GFR A;  5CMK A;  1O64 A;  3G7W A;  3MJN A;  2HQ0 A;  2Y7I A;  3UIF A;  4RXL A;  3G3H A;  4BLA A;  3IR1 A;  2P1S A;  3I6V A;  3KBR A;  3TTM A;  1NMU A;  2VOZ A;  4MLV A;  4RA1 A;  4G77 A;  1VSO A;  2DVC A;  3B7D A;  1M5E A;  3E4R A;  1DOT A;  3PUW E;  3QSL A;  4GOT A;  5FTH A;  3UN6 A;  4ZEI A;  1JNF A;  4Q5T A;  3CI8 A;  4O3C A;  5AA2 A;  3ECR A;  1OQH A;  4LUB A;  3A3C A;  3CFX A;  1NH7 A;  4DXU A;  1ANF A;  1LCT A;  2X7P A;  2HZL A;  2PVU A;  1FTO A;  2QS3 A; 
#chains in the Genus database with same CATH topology
 3DP8 A;  4PF6 A;  3QYT A;  4NN3 A;  2ZXT A;  3TKD A;  5CBS A;  3MYU A;  3K4U A;  4N13 A;  3PPO A;  1Q1K A;  1Q35 A;  4GBV A;  4LVQ A;  1IMF A;  1BLF A;  4GXS B;  4RYA A;  4P56 A;  4KFQ A;  1GTK A;  3B50 A;  2ZNS A;  4ZE8 A;  4L17 A;  3VXC A;  2UVG A;  1UTH A;  1FBG A;  3GLB A;  1P1O A;  4K3F A;  5I56 B;  3E9X A;  3BFT A;  1B3L A;  1HSE A;  2HHM A;  3ZKK A;  5CMM A;  2NWJ A;  1LB9 A;  3VDF A;  2HPG A;  5ITP A;  3CRB A;  1UTH B;  4OA4 A;  4KCD A;  4ELO A;  5DVF A;  1RDZ A;  4R6Y A;  4PFW A;  3LUZ A;  1B2H A;  3T93 B;  4YB5 A;  1B4H A;  3MVX A;  5KZT A;  1B1X A;  2ONR A;  2RF1 A;  3IJO B;  5ISU A;  1ZLQ A;  2XA5 A;  3GZG A;  5AA1 A;  3B8B A;  3HCQ A;  4R9F A;  4FIM A;  1IXC A;  3C33 A;  4HW8 A;  4NWD A;  4EDP A;  1LEV A;  4EQ7 A;  3K02 A;  3E3K A;  1AWB A;  3KOT A;  4NE4 A;  3C34 A;  4U1O A;  4P9K A;  2I4C A;  4OWD A;  3TPA A;  2QL3 A;  3SEY A;  4GXA A;  1B0L A;  2PX1 A;  3QMF A;  4C0R A;  1Q9D A;  3BKI B;  1MXV A;  4ELP A;  1B58 A;  1B7H A;  2H4I A;  4F2O A;  3IB0 A;  2XXT A;  5H8Q B;  4H1X A;  1G0H A;  4XEQ A;  4OHN A;  2Y7W A;  3C35 A;  4P47 A;  4PE3 A;  2XHD A;  4PFI A;  3H6T A;  4H5G A;  1MXZ A;  2OWS A;  3D4C A;  4ZEF A;  5KCJ B;  3GBB A;  4ELQ A;  2PBW A;  4POX A;  2Y7P A;  3OXN A;  3WAF A;  5CBR A;  4PBQ A;  1FPI A;  1FQD A;  3LC8 A;  2Z8F A;  1MPB A;  1A54 A;  1SW2 A;  2R8T A;  3MP1 A;  1URG A;  4NF5 B;  1IUD A;  3KC0 A;  1SW1 A;  3T1B A;  4BDQ A;  1G0I A;  1I69 A;  2ZYN A;  1MQD A;  3FV2 A;  1HSJ A;  2Y7R A;  4C1U A;  4M4G A;  5IZ1 A;  3PPN A;  4H46 A;  4N6P A;  4HE0 A;  3EHS A;  4ND9 A;  3TYH A;  1IXG A;  4NF6 A;  2DS9 A;  4ZZE A;  4OXV A;  1SYH A;  4MJO A;  5J1D A;  1D9Y A;  1A40 A;  5I7I A;  1R9L A;  4YB6 A;  5AA3 A;  2Z8D A;  1USY E;  2OCU A;  3UGW A;  1FSA A;  4GL8 A;  4MX6 A;  3TFL A;  4O94 A;  1FW0 A;  2P3N A;  4IGT A;  2XXP A;  3GBA A;  5HM4 B;  3QUF A;  3LBS A;  5FHO A;  1QKA A;  4P1L A;  2FIE A;  1YZ0 A;  1URS A;  1II5 A;  1S9T A;  2VHA A;  4QSC A;  3IB2 A;  5DW8 A;  4TLL B;  2HXW A;  4KYE A;  1A7L A;  2PCR A;  3K6W A;  3LSX A;  4ZDM A;  1NFT A;  3CR9 A;  2ZZX A;  1KWH A;  3RUM A;  3VLV A;  3ZSF A;  3TQL A;  2AIX A;  4HTG A;  3M3L A;  1Y4T A;  4OTE A;  4AS4 A;  4XFE A;  3T9H B;  3LSW A;  2XXW A;  3OO8 A;  1LBW A;  5I57 A;  2KR0 A;  1YAE A;  3VFJ A;  1S7Y A;  3M8U A;  2QJE A;  3P7I A;  4OEV A;  5I5P A;  1OLA A;  1JVX A;  3CSB A;  2V4C A;  3K00 A;  3LV0 A;  4YZZ A;  3K6U A;  4EUO A;  1EYK A;  1SBP A;  2PFZ A;  4MNP A;  5ET5 A;  2Q74 A;  1NV5 A;  2WBB A;  1Y1Z A;  5DTB A;  4AB6 A;  5LTC A;  1MG1 A;  4I3Y A;  4XF5 A;  1MY1 A;  4XKR A;  1PDA A;  3OSQ A;  5AA4 A;  1FRP A;  3U92 A;  3TUS A;  1I6B A;  4MFI A;  4QFO A;  1I6A A;  1MS7 A;  3N5L A;  3SES A;  4QFP A;  4P0I A;  3FVN A;  4WEP A;  3OO9 A;  5ICT A;  1VR5 A;  2KQZ A;  4F3P A;  4G61 A;  2RC8 A;  3T9V A;  2F8D A;  1US4 A;  2GFE A;  3O6I A;  1TWY A;  2CZK A;  5TU0 A;  1MPD A;  4BDN A;  4N6K A;  5I59 A;  4KQP A;  1N84 A;  4PGP A;  4E0X A;  3K0V A;  3C4M A;  2VPN A;  3TTK A;  3MAM A;  4GWX A;  3PPQ A;  2D3I A;  1MY0 A;  3EHT A;  4PFU A;  2QMW A;  2Q9T A;  1MXU A;  4NHB A;  4TLM B;  1SPI A;  1AOV A;  4YIC A;  5M2V A;  3QXM A;  1FPJ A;  3H06 B;  1UTB A;  1B05 A;  3MST A;  3KN3 A;  4PTK A;  1LCF A;  2XWO A;  1DPE A;  4HE2 A;  4GRK A;  1NV1 A;  1IMC A;  5LDZ A;  1MY4 A;  3C9H A;  5H8F B;  3U1O A;  1FBF A;  1VDW A;  4G8M A;  4YMA A;  4AB5 A;  4ECF A;  4LZ8 A;  3WAE A;  3C36 A;  3CG3 A;  4WXJ A;  4QHQ A;  4X48 A;  3OEL A;  1FTL A;  5JTY B;  3S9E A;  3PPP A;  3FUZ A;  4LP2 B;  3BIH A;  2O51 A;  1LB8 A;  3RT8 A;  4NTL A;  2I0B A;  1Z7N E;  4E0W A;  2NVU B;  3ILT B;  3OEK A;  3RQT A;  2FA7 A;  2G93 A;  1LBV A;  4GWZ A;  3H3G A;  5IZ3 A;  4WED A;  4MH5 A;  3SET A;  2AL4 A;  3CIJ A;  1FTM A;  2DWH A;  3RLF E;  2DXY A;  4G2Z A;  1JW4 A;  1NNK A;  2V3U A;  5I2N A;  2HFB A;  3BFU A;  1O63 A;  4F3G A;  2IEE A;  2UYE A;  2CEX A;  4GWO A;  2Q8M A;  4KXP A;  2ZNU A;  3VVE A;  2ESN A;  4ZS9 A;  2XD3 A;  5I2N B;  1IMB A;  1ZU0 A;  2ZYM A;  3FXB A;  4I8C A;  2OWZ A;  3FBP A;  3IFC A;  4PBH A;  3SDF A;  3IOU A;  2Q8J A;  2HAV A;  5LOM A;  1NV2 A;  4U2R A;  1B46 A;  2DP8 A;  1DMB A;  2F35 A;  1EZ9 A;  4H8I A;  4FAJ A;  3S9L C;  4NQ8 A;  3SER A;  2YJP A;  4DE8 A;  1VFE A;  3MPL A;  1JW5 A;  1MRP A;  3FXQ A;  3IOR A;  2F5X A;  4N17 A;  4OVR A;  1AIV A;  1WVJ A;  1OMP A;  3VE1 B;  5FTI A;  4NX1 A;  1XC1 A;  4NAP A;  1LST A;  5EYH A;  1M5D A;  4FED A;  2F3B A;  4JWY A;  2GRV A;  4HE1 A;  4GD5 A;  1OQG A;  3THI A;  3UOR A;  1B3H A;  1A8F A;  2I3V A;  5JEI A;  2P2A A;  5F7V A;  4YKK A;  4P0G A;  4MCO A;  3O9P A;  3IO4 A;  1R1N A;  3IFA A;  1H45 A;  2THI A;  1KA1 A;  2H25 A;  1RDY A;  2O69 A;  2BJJ X;  3TTN A;  1CB6 A;  2FVZ A;  2OX3 A;  3DP4 A;  1P1U A;  2B65 A;  2V3Q A;  1XS5 A;  1BTJ A;  1GR2 A;  3VLW A;  4NF4 B;  1NV0 A;  2E1S A;  4GBW A;  4DI4 B;  4F29 A;  3VLU A;  5L8D A;  2V93 A;  3FAS A;  3VXB A;  3C32 A;  4UAB A;  5IM2 A;  5I56 A;  2RC7 A;  1XI6 A;  4IO7 A;  4R6H A;  2F78 A;  5CMB A;  2XX8 A;  3CFL A;  1HSL A;  4MIJ A;  4FBP A;  4IY5 A;  1MDP 1;  4UAC A;  4H45 A;  2VGQ A;  3IO6 A;  3HO7 A;  4AQ4 A;  2HZK A;  1J1N A;  3F11 A;  4R72 A;  3PD8 A;  4OMB A;  2DWA A;  3ROJ A;  1NH8 A;  4N15 A;  1M5F A;  3V83 A;  5TP9 A;  4ESX A;  1SQY A;  2JJK A;  2DE2 A;  4U4S A;  1OLC A;  1NUX A;  1RKM A;  4BDL A;  4F39 A;  5KDT B;  2ABH A;  2OBG A;  3TEP A;  4ONY A;  3R7X A;  1INP A;  5IKB A;  3FZV A;  4FE8 A;  4GX6 A;  3KEI A;  2DYX A;  4FEC A;  5TP9 B;  3BIG A;  1OVT A;  4LA9 A;  1SD3 A;  4Q30 B;  1NUY A;  3S4U A;  3H4Z A;  3A09 A;  4R74 A;  3E13 X;  4F18 A;  5A5L A;  4JXI A;  1FTK A;  1ZMG A;  4P3L A;  2YLN A;  3U72 A;  2ONK E;  3ZS6 A;  5H8Q A;  4ELR A;  1LBC A;  4Z7E A;  2Y84 A;  4JSO A;  4KD5 A;  1JVY A;  4ZEK A;  1FBH A;  4IGR A;  4RJZ A;  3FGS A;  3N6U A;  3PUV E;  3DLN A;  2R71 A;  4NGU A;  4PAI A;  4X1D A;  1EZO A;  2Q2C A;  3UA8 A;  5KCJ A;  1D4N A;  4OEU A;  2PT2 A;  2XXR A;  1MM6 A;  1IZ1 A;  2F6G A;  3B6T A;  3A3U A;  3MVY A;  1NNT A;  4PP0 A;  4R75 A;  1NKX A;  1TXF A;  2RCB A;  1D9V A;  2XXY A;  4NF5 A;  4QBA A;  2DDK A;  1DTZ A;  2HAU A;  3KFM A;  2QSX A;  3AXF A;  4FAT A;  4LQ5 A;  1KA0 A;  3G3I A;  4KPT A;  4OFO A;  1H76 A;  4JVC A;  3RGY A;  3T9X B;  2DSF A;  2QRY A;  4MEV A;  3HV1 A;  4LQ2 A;  1Y3N A;  3LR1 A;  1EZP A;  2OLB A;  3IB1 A;  1FBD A;  4FJP A;  4R2F A;  1ATG A;  2Q2A A;  1BK4 A;  4EXK A;  1L5T A;  1YYZ A;  1B9J A;  1K9Y A;  3K2D A;  2F34 A;  4WKM A;  3ILU B;  3M3F A;  3HHG A;  3Q27 A;  4XKQ A;  1NL5 A;  4GWU A;  3KJT A;  1FPB A;  3IOT A;  3PD9 A;  3MQ9 A;  5HBC A;  1DCU A;  3M3K A;  3RTW B;  4PET A;  1ZKB A;  4G8N A;  2F6P A;  4QFN A;  4N6D A;  1LLS A;  2DE3 A;  2L5V A;  2DWI A;  1D9Q A;  1B52 A;  4RY1 A;  3R26 A;  3IK6 B;  5I2K B;  2AYS A;  4G8H A;  3RYD A;  2D21 A;  1QJM A;  5ITO A;  3QUJ A;  5ELV A;  3TTL A;  1NV4 A;  2XXK A;  4KYS A;  3TMG A;  4KYD A;  2DWJ A;  4G68 A;  5K2X A;  4N07 A;  4U22 A;  1SVX B;  1EYJ A;  2X7Q A;  3EF7 A;  1B7U A;  3RNN A;  3OO6 A;  3FVK A;  1Y20 A;  4ISU A;  2RC9 A;  3B6Q A;  4G68 B;  2B3B A;  4GLI A;  1MQH A;  3S2V A;  1QW0 A;  4IO2 A;  4QXD A;  4EF2 A;  1JEV A;  2UVH A;  1H43 A;  1XHY A;  4RK9 A;  3KSX A;  4YMB A;  3H03 A;  4F1V A;  4FEB A;  1NUZ A;  4C1T A;  4DXC A;  2CMO A;  5H8S A;  1JQF A;  4N8G A;  1A55 A;  2WX9 A;  1WDN A;  2XD2 A;  1NNP A;  3FVO A;  1IXI A;  1FPK A;  1M5B A;  4OVP A;  1LBZ A;  3KBZ A;  5DEX A;  1PBQ A;  3SEW A;  3B6W A;  1IQ7 A;  4JBZ A;  1P99 A;  2AL5 A;  3ONM A;  4OAN A;  5H8N B;  4GX4 A;  3ODB A;  3S9M C;  2ZYO A;  1M5C A;  1B3F A;  4OVS A;  2DXR A;  5IZZ A;  4R2B A;  3OMB A;  3KZG A;  5DEX B;  2QVR A;  3PU5 A;  1FQC A;  4JVD A;  1GV8 A;  2RCA A;  4FOR A;  1MH4 A;  3HPI A;  3EPE A;  4I9D A;  5TPA B;  2NOO A;  2ONS A;  3OSR A;  2QS4 A;  2PMS A;  4KI0 E;  1B0H A;  1NI9 A;  1XVY A;  5ESY A;  1LFH A;  4Q0C A;  4OFL A;  1PBP A;  2GHA A;  3CSG A;  4YU0 A;  2CZL A;  2R6G E;  4NG7 A;  1MH3 A;  1BIY A;  1FPD A;  4MLQ A;  5FHN A;  4PE5 B;  4JWX A;  3I3V A;  2XXH A;  3IL1 B;  3PV0 E;  1TT1 A;  1N3X A;  1FBP A;  1Y3Q A;  4ZEB A;  5H8F A;  1DPP A;  4IO4 A;  2REG A;  3PUX E;  3T22 A;  2PFY A;  1N76 A;  1WOD A;  3KGC A;  3OD7 A;  3N94 A;  1PEB A;  3OOA A;  1SDX A;  4N4U A;  2F3D A;  1B5I A;  4POW A;  4QSE A;  2CZH A;  5JTY A;  4XKP A;  1R9Q A;  4F3S A;  5I58 B;  1Y9U A;  3KN8 A;  4R73 A;  4OFJ A;  3W15 C;  3K1N A;  1YCJ A;  1ZBM A;  4OZ9 A;  2QVV A;  3MBP A;  4GIZ A;  3MPK A;  4XIG Q;  1QVS A;  4Q8R A;  3FIR A;  1DBZ A;  4F1U A;  4F22 A;  2O1M A;  2QS1 A;  2BJI A;  3K6V A;  1NNF A;  3K6X A;  1XOC A;  3V8X B;  4HCW A;  2X26 A;  3DP6 A;  3IOW A;  4H67 A;  3FJM A;  4PFR A;  3HN0 A;  4GL0 A;  5ET7 A;  1FBC A;  1LAH E;  2V84 A;  2Z23 A;  3PPR A;  1MXY A;  3FXR A;  1QUK A;  5ICQ A;  1FPF A;  5BWJ A;  2QFL A;  3FJ7 A;  1BP5 A;  1MQJ A;  2HCA A;  5FHM A;  2O7I A;  2PYY A;  3H6V A;  4H5F A;  3G3G A;  3H7M A;  3USD A;  1QUI A;  3L6H A;  4LON B;  3MVZ A;  4YKJ A;  4QRZ A;  3L6G A;  4ZED A;  5H8H B;  1Y3P A;  1PB7 A;  3N26 A;  1LBX A;  1RYX A;  4GF8 A;  3T66 A;  1Z7M E;  3C31 A;  5AA2 D;  2KLF A;  1O7T A;  1FQA A;  2I3W A;  2E0S A;  3CFZ A;  1LAG E;  4JVI A;  4THI A;  4PFT A;  2I4B A;  3RPL A;  4EF1 A;  1SW5 A;  2FHY A;  3U8Q A;  3TEL A;  1H3D A;  5HPQ A;  3I5O A;  4PAF A;  1PB8 A;  1EH3 A;  3FV1 A;  1LGB C;  4PAK A;  3IX1 A;  2WYK A;  4GQO A;  3IOV A;  3RPL B;  4U4X A;  4DIG A;  4NMY A;  4H8J A;  2ZYK A;  5IAI A;  2A5S A;  4PDD A;  4LZ5 A;  2P0S A;  4YAH X;  2OJT A;  3JZJ A;  2XXU A;  1FQE A;  1CNQ A;  2VPO A;  2UYF A;  4ESW A;  3T9U A;  4YB7 A;  4NWC A;  1B3G A;  4OQO A;  3KSJ A;  1QUJ A;  4NF4 A;  2O1L A;  4PDH A;  5F1Q A;  3PMW A;  4GWS A;  3HFU A;  3W9W A;  2QMX A;  2UVJ A;  3HST A;  4GWW A;  3DEL B;  4DCX A;  1DTG A;  1QKB A;  5EYG A;  3IJX B;  2NUV A;  3RN8 A;  4DI3 D;  4EXL A;  5FBP A;  1B5H A;  1UQW A;  1US5 A;  3EKI A;  1SW4 A;  4ZZA A;  5AA2 B;  3MP8 A;  3QK6 A;  4I1D A;  4F3B A;  4JWO A;  5IGA A;  4OVT A;  4MF3 A;  1P1W A;  1POY 1;  3T0J A;  3OO7 A;  2XXI A;  2FBP A;  5L9S A;  5CI5 A;  2QPQ A;  1FQB A;  4P1E A;  1B32 A;  1B7Z A;  5BUU A;  3MZ1 A;  1XT8 A;  3CG1 A;  3H6U A;  5KDT A;  2ANJ A;  1Y4C A;  4ZE9 A;  3OEN A;  4U23 A;  3V5A A;  4O3A A;  4P8B A;  5EHM A;  3O66 A;  3Q29 A;  4F2Q A;  4RPO A;  4MNI A;  3ISP A;  4MMP A;  3FVG A;  1GGG A;  2QVU A;  1DK4 A;  4N81 A;  2UVI A;  3E78 A;  2PT1 A;  1UIV A;  3U93 A;  4PQJ A;  2CEY A;  3MZ9 A;  2XWI A;  3GYY A;  3K1P A;  4IO3 A;  5DVJ A;  3KG2 A;  3O2A A;  3EN3 A;  4X9T A;  3SEV A;  4RPN A;  1MQG A;  1FPL A;  1N3W A;  1AH5 A;  2GQ1 A;  2GHB A;  1XVX A;  1IMA A;  4LAT A;  2XXQ A;  5DYH A;  3PMX A;  2FYI A;  5AE4 A;  3V89 B;  2WKY A;  2Z8E A;  3Q28 A;  1RDX A;  3GXA A;  2WYP A;  1YTV A;  4GWY A;  4QFL A;  4QF9 A;  1FBE A;  3JV9 A;  4G68 C;  1S50 A;  3MWB A;  4PC9 A;  1MY3 A;  2REJ A;  2Q89 A;  3TQW A;  4TOZ A;  1JET A;  2NXO A;  1I6Q A;  1CE2 A;  4H0W A;  1ZIU A;  3G3K A;  1FCK A;  4R6K A;  5EQ8 A;  1URD A;  4NF8 A;  1ZTY A;  4X1B A;  1POT A;  1USY H;  3MW0 A;  1N7X A;  4IO6 A;  4JSD A;  2VP1 A;  2IA4 A;  1AL3 A;  2F97 A;  4OES A;  1N04 A;  2VT5 A;  3MVW A;  4NF8 B;  4N91 A;  2D5W A;  3PGF A;  4R9G A;  3ZKL A;  4ZEC A;  2RIN A;  3TZA A;  3MUQ A;  3HHF A;  4HXV A;  1D3K A;  2VD2 A;  5DVI A;  4OER A;  1JW1 A;  3O97 A;  2A5T A;  2XWK A;  1A8E A;  4MNC A;  3IAZ A;  3KC1 A;  1BKA A;  4PFY A;  1N7W A;  3TDJ A;  4AS5 A;  4BDR A;  4O7I A;  5I3S A;  4UA8 A;  1SI1 A;  1MPC A;  4MHF A;  2WEF A;  2A5T B;  3Q26 A;  3EQ1 A;  5I2K A;  3BBR A;  5ET6 A;  3QIM A;  4KR5 A;  4U21 A;  4QFK A;  2H99 A;  1KZ8 A;  1EU8 A;  3EHU A;  2RKM A;  1MY2 A;  2ZNT A;  4P11 A;  3SEU A;  4IO5 A;  3E79 A;  2R9J A;  3U94 A;  1LFI A;  1P1Q A;  4NF6 B;  2GH9 A;  1JEU A;  5CC2 A;  3RT6 B;  2V3T A;  1YPN A;  3U65 A;  5CMC A;  4TQU Q;  4PCD A;  1PB9 A;  3DM0 A;  3JYR A;  4F19 A;  1IMD A;  3SKP A;  1MQI A;  3K01 A;  3PTY A;  3T96 B;  2I0C A;  4XXU A;  5L9M A;  2XX9 A;  3FJG A;  4O3B A;  2ZZW A;  4QSD A;  5L9O A;  1MDQ A;  4GVO A;  3TCH A;  3RPW A;  5ET8 A;  4PGN A;  4EQ9 A;  2I6E A;  2FIX A;  1LAF E;  3O29 A;  4DZ1 A;  4XKN A;  1QUL A;  4GX3 A;  4U1Z A;  3VV5 A;  3LUY A;  1FPG A;  1IME A;  1A99 A;  4KHZ E;  1FJ9 A;  1ELJ A;  5B70 A;  5B7D A;  1IIW A;  1IEJ A;  2V25 A;  3D4G A;  1LAX A;  2DE4 A;  2F36 A;  1IXH A;  5H8N A;  3KOS A;  4F31 B;  4EQB A;  1B3E A;  3RY3 A;  5CRY A;  1PC3 A;  3N6T A;  4KCC A;  5I57 B;  3PUY E;  4HS7 A;  1NUW A;  2B3F A;  2H9B A;  2DOJ A;  3O6H A;  5TPA A;  1FPE A;  1B5J A;  1N0T A;  2DQV A;  1K9Z A;  4OYV A;  5EQ9 A;  4Z0I A;  3SEX A;  2HEU A;  4OEN A;  1H44 A;  1VFD A;  2ALU A;  3PMV A;  1NV6 A;  2XXX A;  3W9V A;  2WBD A;  3PUZ E;  3MP6 A;  3FAT A;  4IB2 A;  3VVD A;  3OEM A;  4BDM A;  2P3V A;  3FXU A;  2B4L A;  5AA4 B;  3NOH A;  3R6U A;  4DCY A;  1FTA A;  1FQF A;  4I40 A;  3LSF B;  3MZB A;  4IY6 A;  4DLD A;  5EQ7 A;  3LSL A;  4OVQ A;  5EHS A;  1OVB A;  3G3F A;  5I58 A;  1T0K A;  2F7B A;  2H5Y A;  3O28 A;  1B51 A;  1VE4 A;  4O8M A;  2W7Y A;  1SI0 A;  4PF8 A;  3VVF A;  1OIB A;  1B4Z A;  2CZI A;  2OZZ A;  3RTF B;  3MC2 A;  1R6Z A;  5I59 B;  2YPN A;  3KN7 A;  2Z22 A;  3KJ7 A;  3FD3 A;  3S9N C;  4I62 A;  1ZJL A;  4NED A;  3TOD A;  3O6G A;  2FNC A;  4OET A;  1FTJ A;  2ZMB A;  5I84 A;  1Y1M A;  2G29 A;  3TCG A;  1UTB B;  1FJ6 A;  1AMF A;  4M1V A;  4MAG A;  5A5X A;  1EYI A;  5EYF A;  1F9B A;  1NV7 A;  2M8C A;  2O68 A;  1LBB A;  2H98 A;  4IR8 A;  2Y5L A;  2QS2 A;  4X8R A;  2VD3 A;  5A5X B;  4O7M A;  3TTR A;  2OK2 A;  4X04 A;  3A29 A;  3K1M A;  4DDD A;  2UXA A;  3CVG A;  5DT6 A;  4LZ7 A;  2F7A A;  2DVZ A;  3UK4 A;  5H8H A;  5JK4 A;  2XX7 A;  4RK2 A;  2XXV A;  1TFA A;  1LFG A;  2O6A A;  3QAX A;  5F24 A;  3TCF A;  1IIT A;  2F7C A;  1RYO A;  3UP9 A;  3G3J A;  2I49 A;  3Q25 A;  1GVC A;  5IZ3 B;  1MM7 A;  1UIU A;  4BDO A;  2I48 A;  4JB7 A;  4HCY A;  2O84 X;  1SYI A;  4MBP A;  3CHG A;  4XTC Q;  5J16 A;  4LN5 A;  2Y5K A;  1B40 A;  4RNS A;  4H65 A;  2Y7K A;  2LAO A;  4H6D A;  5K2Y A;  1B1H A;  1MXW A;  2OWT A;  1TFD A;  2O7U A;  4YKI A;  2Q88 A;  4F1Y A;  4JDF A;  4OVJ A;  3H6W A;  1NV3 A;  4N8Y A;  1P1N A;  1B6H A;  5CM6 A;  4G4P A;  2I58 A;  3TAJ A;  1DSN A;  1MXX A;  3D1R A;  4DXB A;  3SZP A;  4YKP A;  4GFR A;  5CMK A;  2XWV A;  1O64 A;  3G7W A;  2ZZV A;  3MJN A;  2HQ0 A;  2Y7I A;  2B4M A;  3UIF A;  4RXL A;  3G3H A;  4BLA A;  3IR1 A;  2P1S A;  3I6V A;  3KBR A;  5EQA A;  3TTM A;  1NMU A;  2VOZ A;  4MLV A;  4RA1 A;  5T3J A;  4G77 A;  1VSO A;  2DVC A;  3B7D A;  1M5E A;  3E4R A;  1QGX A;  1DOT A;  3PUW E;  3QSL A;  4GOT A;  5FTH A;  1YXI A;  2MKZ A;  3UN6 A;  4ZEI A;  1JNF A;  4Q5T A;  3CI8 A;  4O3C A;  4I3E A;  5AA2 A;  3ECR A;  4PFB A;  1OQH A;  4LUB A;  1JP4 A;  3A3C A;  3CFX A;  1NH7 A;  4DXU A;  1ANF A;  1LCT A;  2X7P A;  2HZL A;  4NF0 A;  1LBY A;  2PVU A;  2HXR A;  1FTO A;  2QS3 A; 
#chains in the Genus database with same CATH homology
 3DP8 A;  3QYT A;  2ZXT A;  3TKD A;  5CBS A;  3K4U A;  4N13 A;  3PPO A;  1Q1K A;  1Q35 A;  4LVQ A;  1BLF A;  4GXS B;  4RYA A;  4KFQ A;  1GTK A;  2ZNS A;  4ZE8 A;  4L17 A;  3VXC A;  2UVG A;  1UTH A;  3GLB A;  1P1O A;  4K3F A;  5I56 B;  3E9X A;  3BFT A;  1B3L A;  1HSE A;  3ZKK A;  5CMM A;  2NWJ A;  1LB9 A;  3VDF A;  5ITP A;  3CRB A;  1UTH B;  4KCD A;  4ELO A;  5DVF A;  4R6Y A;  4PFW A;  1B2H A;  3T93 B;  4YB5 A;  1B4H A;  3MVX A;  5KZT A;  1B1X A;  2ONR A;  2RF1 A;  3IJO B;  5ISU A;  1ZLQ A;  3GZG A;  5AA1 A;  3HCQ A;  4R9F A;  4FIM A;  1IXC A;  3C33 A;  4HW8 A;  4NWD A;  4EDP A;  4EQ7 A;  3K02 A;  3E3K A;  3KOT A;  4NE4 A;  3C34 A;  4U1O A;  2I4C A;  4OWD A;  3TPA A;  2QL3 A;  3SEY A;  4GXA A;  1B0L A;  2PX1 A;  4C0R A;  3BKI B;  1MXV A;  4ELP A;  1B58 A;  1B7H A;  2H4I A;  4F2O A;  3IB0 A;  2XXT A;  5H8Q B;  4H1X A;  4OHN A;  2Y7W A;  3C35 A;  2XHD A;  3H6T A;  4H5G A;  1MXZ A;  2OWS A;  3D4C A;  4ZEF A;  5KCJ B;  3GBB A;  4ELQ A;  2PBW A;  4POX A;  2Y7P A;  3OXN A;  3WAF A;  5CBR A;  1FQD A;  3LC8 A;  2Z8F A;  1MPB A;  1A54 A;  1SW2 A;  3MP1 A;  1URG A;  4NF5 B;  1IUD A;  1SW1 A;  4BDQ A;  1I69 A;  2ZYN A;  1MQD A;  3FV2 A;  1HSJ A;  2Y7R A;  4C1U A;  4M4G A;  3PPN A;  4N6P A;  3EHS A;  4ND9 A;  3TYH A;  1IXG A;  4NF6 A;  2DS9 A;  4ZZE A;  4OXV A;  1SYH A;  5J1D A;  1D9Y A;  1A40 A;  1R9L A;  4YB6 A;  5AA3 A;  2Z8D A;  1USY E;  2OCU A;  3UGW A;  4GL8 A;  3TFL A;  1FW0 A;  4IGT A;  2XXP A;  3GBA A;  5HM4 B;  3QUF A;  3LBS A;  5FHO A;  1QKA A;  1URS A;  1II5 A;  1S9T A;  2VHA A;  4QSC A;  3IB2 A;  4TLL B;  2HXW A;  4KYE A;  1A7L A;  3K6W A;  3LSX A;  4ZDM A;  1NFT A;  3CR9 A;  1KWH A;  3RUM A;  3VLV A;  3ZSF A;  3TQL A;  2AIX A;  4HTG A;  3M3L A;  1Y4T A;  4OTE A;  3T9H B;  3LSW A;  2XXW A;  3OO8 A;  5I57 A;  1YAE A;  3VFJ A;  1S7Y A;  3M8U A;  2QJE A;  3P7I A;  4OEV A;  1OLA A;  1JVX A;  3CSB A;  3K00 A;  4YZZ A;  3K6U A;  4EUO A;  1SBP A;  1Y1Z A;  5DTB A;  4AB6 A;  1MG1 A;  1MY1 A;  4XKR A;  1PDA A;  3OSQ A;  5AA4 A;  3U92 A;  3TUS A;  1I6B A;  4MFI A;  4QFO A;  1I6A A;  1MS7 A;  3N5L A;  3SES A;  4QFP A;  4P0I A;  3FVN A;  4WEP A;  3OO9 A;  5ICT A;  1VR5 A;  4F3P A;  2RC8 A;  3T9V A;  2F8D A;  1US4 A;  2GFE A;  3O6I A;  1TWY A;  5TU0 A;  1MPD A;  4BDN A;  5I59 A;  4KQP A;  1N84 A;  4E0X A;  3K0V A;  3C4M A;  3TTK A;  3MAM A;  3PPQ A;  2D3I A;  1MY0 A;  3EHT A;  4PFU A;  2QMW A;  2Q9T A;  1MXU A;  4TLM B;  1AOV A;  4YIC A;  5M2V A;  3QXM A;  3H06 B;  1UTB A;  1B05 A;  3KN3 A;  1LCF A;  1DPE A;  4GRK A;  1MY4 A;  3C9H A;  5H8F B;  3U1O A;  4G8M A;  4YMA A;  4AB5 A;  4ECF A;  4LZ8 A;  3WAE A;  3C36 A;  3CG3 A;  4WXJ A;  4QHQ A;  4X48 A;  3OEL A;  1FTL A;  5JTY B;  3S9E A;  3PPP A;  3FUZ A;  4LP2 B;  2O51 A;  1LB8 A;  3RT8 A;  4NTL A;  2I0B A;  1Z7N E;  4E0W A;  2NVU B;  3ILT B;  3OEK A;  3RQT A;  2FA7 A;  2G93 A;  3H3G A;  4WED A;  4MH5 A;  3SET A;  2AL4 A;  3CIJ A;  1FTM A;  2DWH A;  3RLF E;  2DXY A;  4G2Z A;  1JW4 A;  1NNK A;  2V3U A;  5I2N A;  2HFB A;  3BFU A;  1O63 A;  4F3G A;  2IEE A;  2UYE A;  4GWO A;  2ZNU A;  3VVE A;  2ESN A;  4ZS9 A;  2XD3 A;  5I2N B;  1ZU0 A;  2ZYM A;  4I8C A;  3SDF A;  3IOU A;  2Q8J A;  2HAV A;  5LOM A;  4U2R A;  1B46 A;  2DP8 A;  1DMB A;  2F35 A;  1EZ9 A;  4H8I A;  4FAJ A;  3S9L C;  3SER A;  2YJP A;  4DE8 A;  1VFE A;  3MPL A;  1JW5 A;  1MRP A;  3FXQ A;  3IOR A;  2F5X A;  1AIV A;  1WVJ A;  1OMP A;  3VE1 B;  5FTI A;  1XC1 A;  1LST A;  1M5D A;  4FED A;  4JWY A;  2GRV A;  4GD5 A;  1OQG A;  3THI A;  3UOR A;  1B3H A;  1A8F A;  2I3V A;  5JEI A;  2P2A A;  5F7V A;  4YKK A;  4P0G A;  3O9P A;  3IO4 A;  1R1N A;  1H45 A;  2THI A;  2H25 A;  2O69 A;  2BJJ X;  3TTN A;  1CB6 A;  3DP4 A;  1P1U A;  2B65 A;  2V3Q A;  1XS5 A;  1BTJ A;  1GR2 A;  3VLW A;  4NF4 B;  2E1S A;  4F29 A;  3VLU A;  5L8D A;  2V93 A;  3FAS A;  3VXB A;  3C32 A;  5I56 A;  2RC7 A;  4IO7 A;  4R6H A;  2F78 A;  5CMB A;  2XX8 A;  3CFL A;  1HSL A;  4IY5 A;  1MDP 1;  4UAC A;  2VGQ A;  3IO6 A;  3HO7 A;  4AQ4 A;  2HZK A;  1J1N A;  3F11 A;  4R72 A;  3PD8 A;  4OMB A;  2DWA A;  1NH8 A;  1M5F A;  3V83 A;  5TP9 A;  4ESX A;  1SQY A;  2DE2 A;  4U4S A;  1OLC A;  1RKM A;  4BDL A;  4F39 A;  5KDT B;  2ABH A;  2OBG A;  3TEP A;  4ONY A;  3R7X A;  5IKB A;  3FZV A;  4FE8 A;  3KEI A;  2DYX A;  4FEC A;  5TP9 B;  1OVT A;  4LA9 A;  1SD3 A;  4Q30 B;  3S4U A;  3H4Z A;  3A09 A;  4R74 A;  3E13 X;  4F18 A;  4JXI A;  1FTK A;  1ZMG A;  2YLN A;  3U72 A;  2ONK E;  3ZS6 A;  5H8Q A;  4ELR A;  1LBC A;  4Z7E A;  2Y84 A;  4JSO A;  4KD5 A;  1JVY A;  4ZEK A;  4IGR A;  4RJZ A;  3FGS A;  3N6U A;  3PUV E;  3DLN A;  2R71 A;  4X1D A;  1EZO A;  2Q2C A;  3UA8 A;  5KCJ A;  1D4N A;  4OEU A;  2PT2 A;  2XXR A;  1MM6 A;  1IZ1 A;  2F6G A;  3B6T A;  3A3U A;  3MVY A;  1NNT A;  4PP0 A;  4R75 A;  1NKX A;  1TXF A;  2RCB A;  1D9V A;  2XXY A;  4NF5 A;  1DTZ A;  2HAU A;  3KFM A;  2QSX A;  3AXF A;  4FAT A;  4LQ5 A;  3G3I A;  4KPT A;  4OFO A;  1H76 A;  3RGY A;  3T9X B;  2DSF A;  2QRY A;  3HV1 A;  4LQ2 A;  1Y3N A;  3LR1 A;  1EZP A;  2OLB A;  3IB1 A;  4FJP A;  4R2F A;  1ATG A;  2Q2A A;  4EXK A;  1L5T A;  1B9J A;  3K2D A;  2F34 A;  4WKM A;  3ILU B;  3M3F A;  3HHG A;  3Q27 A;  4XKQ A;  1NL5 A;  3KJT A;  3IOT A;  3PD9 A;  3MQ9 A;  5HBC A;  3M3K A;  3RTW B;  4PET A;  1ZKB A;  4G8N A;  2F6P A;  4QFN A;  1LLS A;  2DE3 A;  2DWI A;  1B52 A;  4RY1 A;  3R26 A;  3IK6 B;  5I2K B;  2AYS A;  4G8H A;  2D21 A;  1QJM A;  5ITO A;  3QUJ A;  5ELV A;  3TTL A;  4KYS A;  3TMG A;  4KYD A;  2DWJ A;  4G68 A;  5K2X A;  4N07 A;  4U22 A;  1SVX B;  2X7Q A;  3EF7 A;  1B7U A;  3RNN A;  3OO6 A;  3FVK A;  1Y20 A;  4ISU A;  2RC9 A;  3B6Q A;  4G68 B;  2B3B A;  3S2V A;  4GLI A;  1MQH A;  1QW0 A;  4IO2 A;  4EF2 A;  1JEV A;  2UVH A;  1H43 A;  1XHY A;  4RK9 A;  3KSX A;  4YMB A;  3H03 A;  4F1V A;  4FEB A;  4C1T A;  4DXC A;  2CMO A;  5H8S A;  1JQF A;  1A55 A;  1WDN A;  2XD2 A;  1NNP A;  3FVO A;  1IXI A;  1M5B A;  5DEX A;  1PBQ A;  3SEW A;  3B6W A;  1IQ7 A;  4JBZ A;  1P99 A;  2AL5 A;  3ONM A;  5H8N B;  3ODB A;  3S9M C;  2ZYO A;  1M5C A;  1B3F A;  2DXR A;  4R2B A;  3OMB A;  3KZG A;  5DEX B;  3PU5 A;  1FQC A;  1GV8 A;  2RCA A;  4FOR A;  1MH4 A;  3HPI A;  3EPE A;  4I9D A;  5TPA B;  2NOO A;  2ONS A;  3OSR A;  2QS4 A;  2PMS A;  4KI0 E;  1B0H A;  1XVY A;  1LFH A;  4Q0C A;  4OFL A;  1PBP A;  2GHA A;  3CSG A;  4YU0 A;  2CZL A;  2R6G E;  1MH3 A;  1BIY A;  4MLQ A;  5FHN A;  4PE5 B;  4JWX A;  3I3V A;  2XXH A;  3IL1 B;  3PV0 E;  1TT1 A;  1N3X A;  1Y3Q A;  4ZEB A;  5H8F A;  1DPP A;  4IO4 A;  2REG A;  3PUX E;  3T22 A;  1N76 A;  1WOD A;  3KGC A;  3OD7 A;  3N94 A;  1PEB A;  3OOA A;  1SDX A;  1B5I A;  4POW A;  4QSE A;  5JTY A;  4XKP A;  1R9Q A;  4F3S A;  5I58 B;  1Y9U A;  3KN8 A;  4R73 A;  4OFJ A;  3W15 C;  3K1N A;  1YCJ A;  1ZBM A;  4OZ9 A;  3MBP A;  4GIZ A;  3MPK A;  4XIG Q;  1QVS A;  4Q8R A;  3FIR A;  4F1U A;  4F22 A;  2O1M A;  2QS1 A;  3K6V A;  1NNF A;  3K6X A;  1XOC A;  3V8X B;  4HCW A;  2X26 A;  3DP6 A;  3IOW A;  4H67 A;  3FJM A;  3HN0 A;  4GL0 A;  1LAH E;  2V84 A;  2Z23 A;  3PPR A;  1MXY A;  3FXR A;  1QUK A;  5ICQ A;  5BWJ A;  3FJ7 A;  1BP5 A;  1MQJ A;  2HCA A;  5FHM A;  2O7I A;  2PYY A;  3H6V A;  4H5F A;  3G3G A;  3H7M A;  3USD A;  1QUI A;  3L6H A;  4LON B;  3MVZ A;  4YKJ A;  4QRZ A;  3L6G A;  4ZED A;  5H8H B;  1Y3P A;  1PB7 A;  3N26 A;  1RYX A;  4GF8 A;  3T66 A;  1Z7M E;  3C31 A;  5AA2 D;  2KLF A;  1O7T A;  1FQA A;  2I3W A;  2E0S A;  3CFZ A;  1LAG E;  4THI A;  4PFT A;  2I4B A;  4EF1 A;  1SW5 A;  3U8Q A;  3TEL A;  1H3D A;  5HPQ A;  3I5O A;  1PB8 A;  1EH3 A;  3FV1 A;  1LGB C;  3IX1 A;  4GQO A;  3IOV A;  4U4X A;  4DIG A;  4NMY A;  4H8J A;  2ZYK A;  5IAI A;  2A5S A;  4LZ5 A;  2P0S A;  4YAH X;  2OJT A;  3JZJ A;  2XXU A;  1FQE A;  2UYF A;  4ESW A;  3T9U A;  4YB7 A;  4NWC A;  1B3G A;  4OQO A;  3KSJ A;  1QUJ A;  4NF4 A;  2O1L A;  5F1Q A;  3PMW A;  3W9W A;  2QMX A;  2UVJ A;  3HST A;  3DEL B;  4DCX A;  1DTG A;  1QKB A;  3IJX B;  2NUV A;  3RN8 A;  4EXL A;  1B5H A;  1UQW A;  1US5 A;  1SW4 A;  4ZZA A;  5AA2 B;  3MP8 A;  3QK6 A;  4I1D A;  4F3B A;  4JWO A;  4MF3 A;  1P1W A;  1POY 1;  3OO7 A;  2XXI A;  5L9S A;  5CI5 A;  2QPQ A;  1FQB A;  1B32 A;  1B7Z A;  5BUU A;  3MZ1 A;  1XT8 A;  3CG1 A;  3H6U A;  5KDT A;  2ANJ A;  1Y4C A;  4ZE9 A;  3OEN A;  4U23 A;  3V5A A;  4O3A A;  5EHM A;  3O66 A;  3Q29 A;  4F2Q A;  4RPO A;  3FVG A;  1GGG A;  2UVI A;  2PT1 A;  1UIV A;  3U93 A;  4PQJ A;  3MZ9 A;  3K1P A;  4IO3 A;  5DVJ A;  3KG2 A;  3O2A A;  3EN3 A;  4X9T A;  3SEV A;  4RPN A;  1MQG A;  1N3W A;  1AH5 A;  2GHB A;  1XVX A;  4LAT A;  2XXQ A;  5DYH A;  3PMX A;  2FYI A;  5AE4 A;  3V89 B;  2WKY A;  2Z8E A;  3Q28 A;  3GXA A;  1YTV A;  4QFL A;  4QF9 A;  3JV9 A;  4G68 C;  1S50 A;  3MWB A;  1MY3 A;  3TQW A;  2Q89 A;  2REJ A;  4TOZ A;  1JET A;  2NXO A;  1I6Q A;  1CE2 A;  4H0W A;  1ZIU A;  3G3K A;  1FCK A;  4R6K A;  1URD A;  4NF8 A;  1ZTY A;  4X1B A;  1POT A;  1USY H;  3MW0 A;  1N7X A;  4IO6 A;  4JSD A;  2VP1 A;  2IA4 A;  1AL3 A;  2F97 A;  4OES A;  1N04 A;  3MVW A;  4NF8 B;  2D5W A;  3PGF A;  4R9G A;  3ZKL A;  4ZEC A;  2RIN A;  3TZA A;  3MUQ A;  3HHF A;  1D3K A;  2VD2 A;  5DVI A;  4OER A;  1JW1 A;  3O97 A;  2A5T A;  1A8E A;  3IAZ A;  1BKA A;  4PFY A;  1N7W A;  3TDJ A;  4BDR A;  4UA8 A;  1SI1 A;  1MPC A;  2A5T B;  3Q26 A;  3EQ1 A;  5I2K A;  3BBR A;  3QIM A;  4KR5 A;  4U21 A;  4QFK A;  2H99 A;  1EU8 A;  3EHU A;  2RKM A;  1MY2 A;  2ZNT A;  4P11 A;  3SEU A;  4IO5 A;  2R9J A;  3U94 A;  1LFI A;  1P1Q A;  4NF6 B;  2GH9 A;  1JEU A;  5CC2 A;  3RT6 B;  2V3T A;  1YPN A;  5CMC A;  4TQU Q;  1PB9 A;  3DM0 A;  3JYR A;  4F19 A;  3SKP A;  1MQI A;  3K01 A;  3T96 B;  2I0C A;  4XXU A;  5L9M A;  2XX9 A;  3FJG A;  4O3B A;  4QSD A;  5L9O A;  1MDQ A;  4GVO A;  3TCH A;  3RPW A;  4EQ9 A;  2I6E A;  1LAF E;  3O29 A;  4DZ1 A;  4XKN A;  1QUL A;  4U1Z A;  3VV5 A;  3LUY A;  4KHZ E;  1A99 A;  1ELJ A;  5B70 A;  5B7D A;  1IIW A;  1IEJ A;  2V25 A;  3D4G A;  1LAX A;  2DE4 A;  2F36 A;  1IXH A;  5H8N A;  3KOS A;  4F31 B;  4EQB A;  1B3E A;  3RY3 A;  5CRY A;  1PC3 A;  3N6T A;  4KCC A;  5I57 B;  3PUY E;  4HS7 A;  2B3F A;  2H9B A;  2DOJ A;  3O6H A;  5TPA A;  1B5J A;  1N0T A;  2DQV A;  4OYV A;  4Z0I A;  3SEX A;  2HEU A;  4OEN A;  1H44 A;  1VFD A;  2ALU A;  3PMV A;  2XXX A;  3W9V A;  3PUZ E;  3MP6 A;  3FAT A;  4IB2 A;  3VVD A;  3OEM A;  4BDM A;  3FXU A;  5AA4 B;  3R6U A;  4DCY A;  1FQF A;  3LSF B;  3MZB A;  4IY6 A;  4DLD A;  3LSL A;  5EHS A;  1OVB A;  3G3F A;  5I58 A;  1T0K A;  2F7B A;  2H5Y A;  3O28 A;  1B51 A;  1VE4 A;  2W7Y A;  1SI0 A;  3VVF A;  1OIB A;  1B4Z A;  2OZZ A;  3RTF B;  3MC2 A;  1R6Z A;  5I59 B;  2YPN A;  3KN7 A;  2Z22 A;  3KJ7 A;  3FD3 A;  3S9N C;  4I62 A;  1ZJL A;  4NED A;  3TOD A;  3O6G A;  2FNC A;  4OET A;  1FTJ A;  2ZMB A;  5I84 A;  1Y1M A;  2G29 A;  3TCG A;  1UTB B;  1AMF A;  4M1V A;  5A5X A;  5EYF A;  1F9B A;  2M8C A;  2O68 A;  1LBB A;  2H98 A;  2QS2 A;  2VD3 A;  5A5X B;  3TTR A;  2OK2 A;  3K1M A;  4DDD A;  2UXA A;  3CVG A;  5DT6 A;  4LZ7 A;  2F7A A;  2DVZ A;  3UK4 A;  5H8H A;  5JK4 A;  2XX7 A;  4RK2 A;  2XXV A;  1TFA A;  1LFG A;  2O6A A;  3QAX A;  3TCF A;  1IIT A;  2F7C A;  1RYO A;  3UP9 A;  3G3J A;  2I49 A;  3Q25 A;  1GVC A;  1MM7 A;  1UIU A;  4BDO A;  2I48 A;  4JB7 A;  4HCY A;  2O84 X;  1SYI A;  4MBP A;  4XTC Q;  1B40 A;  4RNS A;  4H65 A;  2Y7K A;  2LAO A;  4H6D A;  5K2Y A;  1B1H A;  1MXW A;  2OWT A;  1TFD A;  2O7U A;  4YKI A;  2Q88 A;  4F1Y A;  4JDF A;  4OVJ A;  3H6W A;  1P1N A;  1B6H A;  5CM6 A;  4G4P A;  2I58 A;  3TAJ A;  1DSN A;  1MXX A;  4DXB A;  4YKP A;  4GFR A;  5CMK A;  1O64 A;  3G7W A;  3MJN A;  2HQ0 A;  2Y7I A;  3UIF A;  4RXL A;  3G3H A;  4BLA A;  3IR1 A;  2P1S A;  3I6V A;  3KBR A;  3TTM A;  1NMU A;  2VOZ A;  4MLV A;  4RA1 A;  4G77 A;  1VSO A;  2DVC A;  3B7D A;  1M5E A;  3E4R A;  1DOT A;  3PUW E;  3QSL A;  4GOT A;  5FTH A;  3UN6 A;  4ZEI A;  1JNF A;  4Q5T A;  3CI8 A;  4O3C A;  5AA2 A;  3ECR A;  1OQH A;  4LUB A;  3A3C A;  3CFX A;  1NH7 A;  4DXU A;  1ANF A;  1LCT A;  2X7P A;  2HZL A;  2PVU A;  1FTO A;  2QS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...