5DVFA

Crystal structure of unliganded periplasmic glucose binding protein (ppgbp) from p. putida csv86
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
389
Chain Sequence
NPGTVDVLHWWTSGGEAKAVETLKQQIQKDGFIWKDNAAAMTVLKTRAISGNPPSAAQIKGPDIQEWGALGLLTELDDVAAANKWDDLLPRQVADIMKYDGHYVAVPVNIHRVNWLWINPQVFDKAGAKVPTTLDELFAAADKLKAAGFIPLAHGGQPWQDSTVFEDLVLSILGPKGYHAAFVDLDEKTLTGPQMTEAFATLKRLGTYMDPNRAGRDWNIAAAEVINGKAGMQIMGDWAKSEWSAAGKVAGKDYQCVAFPGTQGSFAYNIDSLAMFKLKDANDIKAQNDLAKVALEPEFQTVFNQNKGSLPVRQDMDMSKFDACTQKSAADFKEAAKGDGLQPSMAHNMATTLAVQGAIFDVVTNFLNDPQAEPATAVKQLNAAIKAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Binding protein component of ABC sugar transporter
publication title High Resolution Structures of Periplasmic Glucose-binding Protein of Pseudomonas putida CSV86 Reveal Structural Basis of Its Substrate Specificity
pubmed doi rcsb
source organism Pseudomonas putida csv86
total genus 140
structure length 389
sequence length 396
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5dvfA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5dvfA02
3H7MA 3LSFB 1MS7A 3JYRA 4BDRA 2Z22A 3IOTA 2OK2A 3N5LA 3UORA 4I9DA 1MY2A 1POTA 2VOZA 4PETA 2I3WA 4U22A 3ODBA 4YB7A 3W9VA 5I2NA 1XS5A 1B5HA 1P1WA 4EXLA 2HAUA 4X1DA 3T96B 3LSXA 1NFTA 1LSTA 1ELJA 4YB6A 3KJTA 1AL3A 5H8QA 3FZVA 3ILTB 2HZKA 3BFUA 2NWJA 1VFDA 4FEDA 2HQ0A 3PPRA 3S9LC 2F7AA 1LFGA 2UYFA 4YKJA 1MPDA 3OO6A 1Y3QA 1IUDA 1LLSA 1GGGA 1Q35A 2RF1A 3IB2A 3TDJA 3FV2A 4F1VA 3VLUA 1B05A 3RUMA 2AL4A 4OENA 5HBCA 4NF6B 1N3XA 4U4XA 3O29A 5I2NB 2NXOA 4LQ5A 3TFLA 1P1OA 1O7TA 3UN6A 3TODA 2M8CA 3U93A 5H8QB 5L9SA 1MXVA 2X26A 1IXHA 2OJTA 4PFYA 3QK6A 2UXAA 1XOCA 1JW5A 5ELVA 3SEWA 3IX1A 1BP5A 1FQEA 1B7HA 1ZTYA 2ZYMA 3K1MA 1R9QA 3EHUA 1MH3A 5FHOA 4X9TA 3K0VA 1SI0A 3CG3A 3VV5A 2XXYA 2BJJX 1IXCA 3E13X 1JEVA 3TTLA 3TTRA 3LBSA 2PVUA 2DWAA 3D4GA 1NKXA 1PBQA 4EDPA 5JEIA 3IO4A 1VFEA 2OWSA 4FATA 5KCJB 1A7LA 2YPNA 2I6EA 5DT6A 3FD3A 4ESXA 1S9TA 2GHAA 2QMWA 2I49A 5IAIA 4TLLB 2LAOA 3U92A 4KYSA 2OWTA 2UVJA 3ILUB 3U94A 1ZJLA 1MQHA 4H67A 3VFJA 1AMFA 4R2FA 1KWHA 4F3SA 4X48A 3KEIA 5TP9A 2QS2A 3K6UA 1GR2A 3IOUA 2O84X 4U4SA 4GIZA 5B70A 2ZNUA 1IXGA 4P0IA 5AA4A 3N26A 3RGYA 2QMXA 2VHAA 3TPAA 3UIFA 1D3KA 3ZSFA 4NF8B 3H03A 3U8QA 5B7DA 1PDAA 4OZ9A 4G4PA 4JWXA 4NE4A 3RLFE 5TPAA 1A54A 2XXIA 3PU5A 4OERA 2OBGA 4MH5A 4KYDA 4ND9A 3MAMA 4R6YA 2Y7IA 4DXCA 2V25A 1MPCA 4PQJA 3A09A 1MXZA 1I69A 4ZE8A 3M3LA 5H8HA 4IO5A 1ZLQA 4U1ZA 1XVYA 3TQWA 4GLIA 4OTEA 3MVXA 4AB6A 1B3LA 2Z8FA 1I6BA 5ISUA 2VP1A 1N04A 4U23A 4LVQA 3QUFA 5AA4B 1UTBB 1DPPA 4OFJA 1D4NA 4R9FA 4ZEFA 3TKDA 3R26A 4ZDMA 2O7IA 3PUXE 3OO9A 1N3WA 2F97A 2OCUA 1LFIA 5TPAB 4JB7A 3S2VA 3KJ7A 2O6AA 4GL0A 3CFXA 2UYEA 4ONYA 1D9VA 4OEVA 2O1LA 4JXIA 1DTZA 1LAXA 1DSNA 1URGA 2RC8A 3O2AA 2X7PA 5DVIA 2DE3A 3EQ1A 5AA2B 3MP6A 2F5XA 1S7YA 4UA8A 2ZYKA 1FQFA 1FTLA 1JEUA 2ZXTA 3MPLA 1CB6A 4OFLA 3JZJA 1TFDA 3MW0A 4NF5B 4RA1A 2F6GA 2H99A 4ZEKA 4FECA 2R71A 3CVGA 3Q27A 1FTJA 1AH5A 2WKYA 2B3FA 4NF4A 4H65A 4GOTA 3RQTA 3UGWA 3PUWE 3GBBA 4QSCA 3G3FA 3UA8A 1HSJA 3O6IA 1BLFA 1RKMA 2QRYA 3I6VA 3HO7A 3KN3A 1MXXA 2GRVA 3HPIA 3T9XB 5I58B 1XT8A 2F78A 1FQCA 3CG1A 3R7XA 3QYTA 2DS9A 3N94A 4F3GA 4KPTA 2ALUA 5A5XA 3Q28A 5AE4A 4WXJA 2XXTA 4ZZAA 4LA9A 3Q26A 4GWOA 2P2AA 2XX7A 5CC2A 4Q30B 3TUSA 2DOJA 4KI0E 1MXYA 5H8NB 1A40A 1USYE 2ANJA 1B2HA 3K01A 4RPOA 3FV1A 1MQIA 5H8FB 3SEXA 4WEDA 2R9JA 5KDTB 4U2RA 2F6PA 3MVWA 3MZBA 4OQOA 5I59A 1MM7A 3THIA 2ABHA 3SKPA 3B6WA 3OEKA 2XD3A 5CMKA 3FJMA 1B3EA 3C36A 1Z7NE 1SI1A 3UP9A 3MP1A 5A5XB 3VLWA 1YCJA 2IEEA 2XXQA 4EXKA 3AXFA 4PE5B 3IOWA 5CMMA 2REGA 5DEXA 5K2XA 2ONKE 1A55A 1DTGA 2DWHA 1D9YA 1VE4A 2REJA 1NNPA 2DVZA 5DTBA 4R6HA 4H5FA 1R1NA 1VR5A 2HCAA 4LUBA 1UIUA 4N07A 1UIVA 5DYHA 3VDFA 1YAEA 1EZ9A 5I59B 4E0WA 2PT2A 2AL5A 3C34A 4YKIA 2NOOA 3OSRA 4HCWA 4GL8A 4IO4A 4XKPA 2AIXA 4U21A 4MLVA 1SYHA 1US5A 2XHDA 3SEYA 3B6QA 1N76A 3MJNA 3M3FA 2B3BA 4GD5A 3EN3A 4Q5TA 2D21A 2IA4A 2Q88A 3PMWA 1US4A 3Q25A 3K00A 3TCGA 1QKAA 2Q89A 3PUZE 1N84A 4YU0A 2PT1A 4RK9A 3FGSA 4OETA 1LBBA 1SVXB 3MWBA 3ZKKA 1QUKA 3O28A 1ZBMA 2DE2A 3CFZA 1AOVA 1Y4CA 4M1VA 5HPQA 5FTHA 1B5IA 2O69A 3S9NC 2XXPA 1SBPA 1Y1MA 4YAHX 4R9GA 4KHZE 2F34A 4X1BA 3FJ7A 3H6WA 2HEUA 3C4MA 3JV9A 2KLFA 2RKMA 2UVHA 3EHTA 4QFNA 3RNNA 4U1OA 4F29A 2ONSA 1B6HA 5I84A 4XKNA 2Z23A 1OIBA 4GVOA 1JW4A 4R2BA 4DE8A 4TLMB 4ELOA 3M3KA 3DLNA 1FW0A 1XC1A 2Z8EA 3C33A 4DCXA 4KCDA 1LAHE 4NWDA 1O64A 1A8FA 3LR1A 1II5A 4IY6A 5I56A 5JTYA 3HSTA 3GXAA 1PB7A 2I0CA 3G7WA 1WVJA 3H6UA 3O9PA 3I3VA 4MFIA 1P99A 4BLAA 1ANFA 1B9JA 3DELB 4EQ9A 3E3KA 1B32A 3CSGA 4FEBA 5EHMA 4ZEDA 3O6GA 4OWDA 4QSEA 5L9MA 2VGQA 1JVYA 3DP6A 4HCYA 3RT6B 5L8DA 1N7XA 3T9VA 2ESNA 4QHQA 4ZS9A 3MUQA 1MY4A 4G8MA 4AQ4A 1B5JA 4G8HA 3UK4A 4XXUA 4EF1A 4ZZEA 1T0KA 2THIA 1B7UA 4YKKA 4PFUA 1O63A 3G3IA 3FVGA 4ELQA 2I0BA 3VVFA 3EF7A 3IL1B 2P1SA 1H44A 2Z8DA 4LQ2A 2H4IA 3CIJA 1LAFE 1FTKA 1F9BA 4K3FA 1B7ZA 5EHSA 1SW5A 3USDA 3OELA 3BFTA 3PV0E 4L17A 2G93A 4BDOA 2V3QA 2Q9TA 1SW1A 1B51A 1B1HA 4OESA 5I57A 5CI5A 3KG2A 5H8SA 4F2OA 4ELPA 2PBWA 4NMYA 5FHNA 2Q2AA 2I3VA 1TWYA 1WDNA 2F7CA 1OMPA 3KOSA 4YB5A 5BWJA 5TP9B 3G3JA 1MH4A 3KN7A 2QS3A 5CMBA 3D4CA 4F31B 1B3FA 4PFTA 1FQAA 4H6DA 4I1DA 3TTNA 5K2YA 3C9HA 3H6VA 3MZ1A 2PYYA 4ZECA 4RY1A 3W15C 5CMCA 5F1QA 3H4ZA 1BIYA 4OYVA 1MRPA 1Y3NA 2D3IA 2FNCA 1M5DA 2XXRA 5BUUA 2RCAA 3TEPA 2HAVA 4HTGA 4IB2A 1GVCA 5I57B 3OSQA 1H3DA 3OOAA 4QRZA 5H8HB 3RPWA 1H43A 2CZLA 1FTMA 4EQ7A 1PC3A 1MM6A 4UACA 2H98A 1EU8A 2YLNA 4OHNA 2O1MA 4XKRA 1IIWA 2I48A 4LP2B 1TXFA 2G29A 2P0SA 4R75A 1UQWA 3ECRA 2XXWA 4JBZA 3OENA 1YTVA 2OLBA 1B4ZA 1LCTA 4LZ8A 3FIRA 5M2VA 3OD7A 3S9EA 1LAGE 1USYH 1MQGA 1FQBA 3QSLA 1SD3A 4O3BA 4RPNA 3VXCA 2RC9A 3KFMA 4O3CA 2E1SA 2YJPA 4Q0CA 3U72A 4H8IA 1IQ7A 4JWOA 2Q2CA 3GZGA 3EHSA 1RYXA 2XXUA 2XXHA 3ZKLA 1IZ1A 3H3GA 3IR1A 1LFHA 3V89B 1Y4TA 3IK6B 1UTHA 4IO3A 3MPKA 3A3CA 2O68A 2Y7PA 2DWIA 1JQFA 3MQ9A 3IB0A 4G2ZA 3DP8A 3ONMA 4POWA 3PUYE 4G77A 2A5TA 4TQUQ 1L5TA 1IEJA 4XIGQ 2E0SA 3MVYA 3OO7A 1P1NA 1JNFA 3K1NA 4PP0A 3KZGA 1JW1A 2Y7RA 3OMBA 4LZ7A 4NF4B 2NVUB 2R6GE 1SYIA 3K2DA 4I8CA 3VVDA 4H1XA 5CBRA 1PEBA 1Z7ME 3L6HA 3K02A 3W9WA 1UTHB 2V3TA 1MY1A 2ZMBA 1EZPA 2QSXA 2DQVA 5ITOA 1ZU0A 4RNSA 1SDXA 1Y20A 4LATA 3TTKA 3TYHA 3VVEA 4LONB 2RCBA 2ZNTA 3PPPA 3LSLA 4FAJA 4HS7A 1JVXA 5J1DA 3CFLA 3SESA 1S50A 2XXVA 3LUYA 3OEMA 1M5FA 3K6WA 1QJMA 3DP4A 4H0WA 4Z0IA 4ESWA 1EZOA 3KBRA 4G68A 1ZMGA 1B1XA 3I5OA 1Y3PA 2X7QA 4FJPA 4IO7A 2QPQA 3RT8A 3TCHA 1TFAA 3E9XA 1OQHA 3HHFA 4RK2A 5IKBA 3K4UA 2V93A 4EQBA 5LOMA 2UVGA 3C31A 5ICTA 3C35A 2ZYNA 4KYEA 3V8XB 4NF6A 4KCCA 1YPNA 5CRYA 1QKBA 3V83A 3EPEA 3KN8A 3SEVA 4AB5A 2I58A 1B52A 4IO6A 3E4RA 1JETA 2HZLA 3BBRA 3C32A 4G68B 5DEXB 4JSDA 2DP8A 1PB9A 4Q8RA 5CM6A 2VD3A 5DVJA 4BDLA 1GTKA 1XVXA 2QL3A 4DDDA 4QF9A 3QXMA 2Q8JA 1N0TA 1QUJA 4OXVA 3T9HB 3T66A 1MDQA 2F35A 4F1YA 1J1NA 2O7UA 1PBPA 1TT1A 4NWCA 3IJOB 2AYSA 3ZS6A 1R6ZA 3TQLA 4WKMA 4OFOA 4R74A 3MBPA 3R6UA 4YMAA 3S9MC 4DXBA 3G3HA 1LCFA 3O97A 3MP8A 3G3KA 4EUOA 4DZ1A 2RC7A 2XD2A 3B6TA 1OVBA 1B46A 3FVOA 1B58A 3HN0A 3H6TA 5KCJA 2QS4A 1GV8A 5FTIA 4QFKA 3LSWA 4QFPA 3PMVA 5EYFA 3TCFA 2V84A 3WAFA 2D5WA 4YKPA 4GRKA 2GHBA 4MLQA 3K1PA 1ZKBA 4C0RA 1MQDA 3FXRA 2Y84A 3CSBA 2ONRA 3PD8A 5DVFA 1QVSA 2FYIA 3F11A 1LGBC 1M5BA 2F7BA 1LB9A 2PMSA 1MPBA 4QFOA 3IAZA 4NTLA 4F18A 4C1TA 2ZYOA 4I62A 1SW2A 4GXSB 3KGCA 4O3AA 1Q1KA 4KD5A 3CRBA 3TZAA 4E0XA 1HSLA 3WAEA 2DWJA 4NF8A 4BDMA 1R9LA 1DMBA 5ICQA 2A5SA 3LC8A 1B3GA 3RTWB 3PGFA 3FVNA 4DLDA 1B40A 4WEPA 2XX8A 4ZEIA 4F3PA 3VLVA 1OQGA 2DSFA 5I56B 4YZZA 3A3UA 3TMGA 2FA7A 2UVIA 1MXUA 3N6TA 2OZZA 5JTYB 3K6XA 2QJEA 3IJXB 5KZTA 2XXXA 5F7VA 2NUVA 1P1UA 4F22A 3FXQA 3N6UA 4MBPA 4Z7EA 1UTBA 4C1UA 2W7YA 4DCYA 3TELA 3VE1B 2I4CA 4KFQA 2PX1A 1SQYA 1NL5A 1FTOA 1DPEA 3MC2A 1FQDA 1P1QA 4N13A 3TTMA 1IITA 3RN8A 3OO8A 3QIMA 3KOTA 1MQJA 4TOZA 1BTJA 3HHGA 4THIA 1QUIA 4RJZA 3VXBA 4ZE9A 5AA2D 4GFRA 1M5CA 4ISUA 5CBSA 5TU0A 4DIGA 4R73A 4ZEBA 3U1OA 3S4UA 3QUJA 4HW8A 1MY0A 2F36A 3FXUA 3L6GA 4FE8A 1Y1ZA 4QSDA 4F19A 3O6HA 5AA3A 4JWYA 1NH8A 4EF2A 3SEUA 5AA2A 5HM4B 1SW4A 4IGRA 2XX9A 4XTCQ 4OEUA 4H8JA 5L9OA 3BKIB 4ECFA 1A8EA 1B3HA 1NNFA 4G68C 2O51A 4FORA 3RY3A 4OMBA 3KSXA 1XHYA 2GFEA 4F39A 2H25A 3V5AA 3GBAA 4NF5A 4XKQA 2DXRA 1I6AA 4F3BA 1LB8A 4PFWA 2ZNSA 1DOTA 3T22A 2B65A 4M4GA 1B0HA 4ELRA 3OXNA 1NMUA 4MF3A 2CMOA 2HXWA 2Y7WA 1NNTA 1QW0A 1N7WA 4JDFA 1IXIA 2DYXA 3G3GA 3DM0A 1MY3A 3IORA 5I58A 4P0GA 3T93B 1OVTA 3IB1A 3HCQA 3PUVE 3FUZA 4QFLA 3SETA 1PB8A 2V3UA 1ZIUA 4KQPA 2Y7KA 3GLBA 3Q29A 4FIMA 2DXYA 3RTFB 1OLCA 2I4BA 4KR5A 2H5YA 3M8UA 2QS1A 3FJGA 1QULA 4JSOA 1MXWA 2F8DA 4GQOA 4OVJA 3IO6A 4DXUA 4G8NA 1CE2A 5H8NA 1BKAA 1I6QA 2VD2A 5H8FA 1NNKA 1M5EA 4IY5A 3T9UA 5KDTA 4YICA 5AA1A 1URDA 1NH7A 4GXAA 2HFBA 1Y9UA 4YMBA 4H5GA 4R6KA 3FASA 3SERA 2DE4A 1AIVA 4IO2A 1URSA 3P7IA 1POY1 2RINA 1B0LA 4NEDA 4F1UA 5I2KA 1ATGA 1EH3A 1FCKA 4N6PA 1OLAA 3HV1A 1RYOA 3MVZA 4LZ5A 3SDFA 4BDQA 3PPOA 1MDP1 3KSJA 4R72A 1LBCA 4IGTA 1VSOA 1HSEA 4BDNA 3TAJA 4RYAA 4RXLA 1WODA 5ITPA 2H9BA 3B7DA 3PMXA 1MG1A 3FATA 3PPQA 4P11A 1H76A 3IOVA 5FHMA 3H06B 1H45A 1B4HA 5JK4A 2A5TB 4POXA 4GF8A 3FVKA 3O66A 3QAXA 3PD9A 3K6VA 3CI8A 4F2QA 1A99A 5I2KB 3MZ9A 3CR9A 2DVCA 3PPNA 2GH9A
chains in the Genus database with same CATH superfamily
3H7MA 3LSFB 1MS7A 3JYRA 4BDRA 2Z22A 4PDHA 3IOTA 2OK2A 3N5LA 2Q74A 3UORA 4I9DA 1MY2A 1POTA 2VOZA 4PETA 2I3WA 4U22A 3ODBA 4YB7A 1NUXA 3W9VA 5I2NA 4GBVA 1XS5A 1B5HA 1P1WA 4EXLA 2HAUA 4X1DA 3T96B 3LSXA 1NFTA 3ISPA 1LSTA 1ELJA 2Q8MA 4YB6A 3KJTA 1AL3A 5H8QA 3FZVA 2CEXA 3ILTB 2HZKA 3BFUA 2NWJA 1VFDA 4FEDA 2HQ0A 3PPRA 2GQ1A 3S9LC 2F7AA 1LFGA 2UYFA 4HE2A 4YKJA 1MPDA 3OO6A 1FBCA 4JVCA 1Y3QA 1IUDA 1LLSA 1GGGA 1Q35A 2RF1A 1NV6A 3IB2A 3TDJA 2WBBA 3FV2A 4F1VA 3VLUA 1B05A 1IMAA 1D9QA 3RUMA 2AL4A 4OENA 5HBCA 4NF6B 1RDZA 1N3XA 4U4XA 3O29A 5I2NB 2NXOA 4LQ5A 3TFLA 1P1OA 4LN5A 4FBPA 1O7TA 3UN6A 3TODA 2M8CA 3U93A 3FXBA 5H8QB 5L9SA 1MXVA 2X26A 2WX9A 1IXHA 4NQ8A 2OJTA 4PFYA 3QK6A 4N8GA 2UXAA 1XOCA 1JW5A 5ELVA 3SEWA 3IX1A 4MHFA 1BP5A 3D1RA 1FQEA 1B7HA 1ZTYA 2ZYMA 3K1MA 1R9QA 3EHUA 1MH3A 2ZZXA 5FHOA 4X9TA 3K0VA 1SI0A 3CG3A 3VV5A 5EQ8A 2XXYA 2BJJX 1IXCA 3E13X 1JEVA 3TTLA 3TTRA 2QVVA 3LBSA 2PVUA 2DWAA 3D4GA 1NKXA 1PBQA 4EDPA 5JEIA 3IO4A 1VFEA 2OWSA 4FATA 5KCJB 1A7LA 2YPNA 4O8MA 2I6EA 1NV1A 5DT6A 3FD3A 4ESXA 5IZ3B 1S9TA 2GHAA 5EQ7A 2QMWA 2I49A 5IAIA 4TLLB 2FIEA 2LAOA 3U92A 4KYSA 2OWTA 3PTYA 2UVJA 3ILUB 2PCRA 3U94A 1ZJLA 1MQHA 4H67A 3VFJA 1NI9A 1AMFA 4R2FA 1KWHA 4N6KA 4F3SA 4X48A 3KEIA 5TP9A 1NUYA 2QS2A 3K6UA 1GR2A 3IOUA 2O84X 4U4SA 2CEYA 4GIZA 5B70A 4KXPA 2ZNUA 1IXGA 4P0IA 5AA4A 1FPLA 3N26A 3RGYA 4OVSA 2QMXA 5ET8A 2VHAA 1FJ9A 3TPAA 3UIFA 1D3KA 3ZSFA 4NF8B 3H03A 3U8QA 5B7DA 1PDAA 4OZ9A 4G4PA 1YZ0A 4JWXA 4NE4A 3RLFE 5TPAA 1A54A 4MX6A 2XXIA 3PU5A 4OERA 2XXKA 2OBGA 4X04A 4MH5A 4KYDA 4ND9A 3MAMA 4R6YA 2Y7IA 4DXCA 2V25A 1MPCA 4PQJA 2PFZA 3A09A 4HE1A 1MXZA 1I69A 4ZE8A 3M3LA 5H8HA 4O7MA 4IO5A 1ZLQA 5EYGA 4U1ZA 1XVYA 3TQWA 4GLIA 4OTEA 4XFEA 2WEFA 3MVXA 4AB6A 1B3LA 2Z8FA 1I6BA 5ISUA 2VP1A 1N04A 4U23A 4LVQA 3QUFA 2KQZA 5AA4B 1UTBB 1DPPA 4OFJA 1G0HA 1D4NA 2HHMA 4R9FA 4ZEFA 3TKDA 3R26A 4ZDMA 2O7IA 3PUXE 3OO9A 1N3WA 2F97A 2OCUA 1LFIA 5TPAB 4JB7A 3S2VA 4PFIA 3KJ7A 2VT5A 2O6AA 4GL0A 3CFXA 2UYEA 4ONYA 3HFUA 1D9VA 4OEVA 2O1LA 4JXIA 4OVPA 1DTZA 1LAXA 3RPLB 1DSNA 1URGA 2RC8A 3O2AA 2X7PA 2XA5A 5DVIA 1EYIA 2DE3A 3EQ1A 3ROJA 5AA2B 3MP6A 2F5XA 1S7YA 4UA8A 2ZYKA 1FQFA 1FTLA 1JEUA 2ZXTA 4MAGA 1NV2A 3MPLA 1CB6A 1LBZA 5EQAA 4OFLA 2BJIA 3JZJA 1TFDA 4N91A 3MW0A 4NF5B 4RA1A 4MNIA 2F6GA 2H99A 1FBHA 4ZEKA 4FECA 2R71A 3CVGA 3Q27A 1FTJA 1AH5A 4GWWA 2WKYA 2B3FA 4PBQA 5ET7A 4NF4A 4H65A 1LBXA 2OWZA 4GOTA 3RQTA 3UGWA 3PUWE 3GBBA 4QSCA 3G3FA 1FSAA 3UA8A 1HSJA 3O6IA 4O94A 1BLFA 1RKMA 2QRYA 3I6VA 3HO7A 3KN3A 1FBGA 1MXXA 2GRVA 3HPIA 3T9XB 5I58B 1XT8A 2F78A 1FQCA 3CG1A 3R7XA 3QYTA 2DS9A 3N94A 4F3GA 4KPTA 2ALUA 5A5XA 3Q28A 5AE4A 4P8BA 4WXJA 2XXTA 4ZZAA 4GWZA 4LA9A 3Q26A 4GWOA 2P2AA 2XX7A 1NV7A 5CC2A 4Q30B 3TUSA 2DOJA 4KI0E 1DCUA 4MNPA 1MXYA 5H8NB 1A40A 1USYE 2ANJA 1B2HA 3K01A 4NX1A 4RPOA 3FV1A 4PCDA 1MQIA 5H8FB 3SEXA 4WEDA 2R9JA 5KDTB 3KC0A 4U2RA 2F6PA 3MVWA 3MZBA 4OQOA 5I59A 1MM7A 3THIA 4GX6A 2ABHA 3SKPA 3B6WA 3OEKA 2XD3A 5CMKA 3FJMA 1B3EA 3C36A 1K9ZA 1Z7NE 1SI1A 3UP9A 3MP1A 5A5XB 3VLWA 1YCJA 2IEEA 5ET6A 2XXQA 4EXKA 3AXFA 4PE5B 3IOWA 5CMMA 2REGA 2WYPA 5DEXA 5K2XA 2ONKE 1A55A 1DTGA 2DWHA 1D9YA 1VE4A 2REJA 1NNPA 2DVZA 5DTBA 4R6HA 4H5FA 1R1NA 1VR5A 2HCAA 4LUBA 1DBZA 1UIUA 4N07A 1UIVA 5DYHA 3VDFA 1YAEA 1EZ9A 5I59B 3B50A 4MIJA 4E0WA 2PT2A 2AL5A 3C34A 4YKIA 2NOOA 3OSRA 4HCWA 4GL8A 4IO4A 4XKPA 2AIXA 4U21A 4MLVA 5I7IA 2OX3A 1SYHA 1US5A 2XHDA 3BIGA 3SEYA 3B6QA 1N76A 3MJNA 3M3FA 2B3BA 4GD5A 3EN3A 4Q5TA 1NUZA 2D21A 4OVQA 2IA4A 2Q88A 3PMWA 3KBZA 2XWIA 1US4A 3Q25A 5EQ9A 3K00A 3TCGA 1QKAA 2Q89A 4PF8A 3PUZE 1N84A 4YU0A 1FPEA 2PT1A 4RK9A 3FGSA 4OETA 1LBBA 1SVXB 3MWBA 1IMFA 5LDZA 3ZKKA 1FPKA 1QUKA 3O28A 1ZBMA 2DE2A 3CFZA 1AOVA 1Y4CA 4M1VA 5HPQA 5FTHA 1B5IA 2O69A 3S9NC 2XXPA 1SBPA 1Y1MA 4YAHX 4R9GA 1FPDA 4KHZE 1FBFA 2F34A 4X1BA 3FJ7A 3H6WA 2HEUA 3C4MA 4MNCA 5ET5A 4MJOA 3JV9A 2KLFA 2RKMA 2UVHA 3EHTA 4QFNA 3U65A 3RNNA 4U1OA 4F29A 2ONSA 1B6HA 5I84A 4XKNA 2Z23A 1OIBA 4GVOA 1JW4A 4R2BA 4DE8A 4TLMB 4ELOA 4OVTA 3M3KA 3DLNA 1FW0A 1XC1A 2Z8EA 1IMEA 3C33A 4DCXA 4KCDA 1LAHE 4NWDA 1O64A 2P3NA 1A8FA 3LR1A 1II5A 4IY6A 5I56A 5JTYA 3HSTA 3GXAA 4MCOA 1PB7A 2I0CA 5IGAA 3G7WA 1WVJA 3H6UA 1IMCA 3O9PA 3I3VA 4MFIA 1P99A 1ANFA 4BLAA 1B9JA 3DELB 4OANA 4EQ9A 3E3KA 4PAFA 1B32A 1QGXA 4P9KA 3CSGA 4MMPA 4FEBA 5EHMA 4ZEDA 3O6GA 4OWDA 4QSEA 5L9MA 5LTCA 3GYYA 1RDYA 2VGQA 1JVYA 3DP6A 4HCYA 3RT6B 5L8DA 1N7XA 3T9VA 4PC9A 3MYUA 2ESNA 3E79A 2QVUA 4QHQA 4ZS9A 3MUQA 1IMDA 1MY4A 1AWBA 4G8MA 4AQ4A 1B5JA 4G8HA 3UK4A 4XXUA 4EF1A 4ZZEA 1T0KA 1NV3A 2FIXA 2THIA 1B7UA 2Y5KA 4YKKA 4PFUA 1O63A 3G3IA 3FVGA 4ELQA 2I0BA 4N8YA 3VVFA 1CNQA 3EF7A 3IL1B 2P1SA 1H44A 2Z8DA 4LQ2A 2H4IA 3CIJA 1LAFE 2V4CA 1FTKA 1INPA 1F9BA 4K3FA 1B7ZA 5EHSA 1SW5A 3USDA 3OELA 4NGUA 3BFTA 3PV0E 4L17A 2G93A 4BDOA 2V3QA 2Q9TA 1SW1A 1B51A 2FHYA 1NV5A 1B1HA 4OESA 5I57A 5CI5A 3KG2A 4I3EA 5H8SA 4F2OA 3FBPA 4ELPA 2PBWA 4NMYA 5FHNA 2Q2AA 2I3VA 1TWYA 1WDNA 2F7CA 1OMPA 3KOSA 4YB5A 5BWJA 5TP9B 3G3JA 2Y5LA 1MH4A 3KN7A 2QS3A 1NV4A 5CMBA 3D4CA 4F31B 1B3FA 2CZKA 4PFRA 4PFTA 1FQAA 4H6DA 4I1DA 3TTNA 1RDXA 5K2YA 3C9HA 3H6VA 3MZ1A 2PYYA 4ZECA 4XF5A 4RY1A 3W15C 5CMCA 5F1QA 3H4ZA 1BIYA 5IZ1A 4OYVA 1MRPA 1KZ8A 5IM2A 2P3VA 1Y3NA 2D3IA 2FNCA 1M5DA 2XXRA 5BUUA 2RCAA 3TEPA 2HAVA 4HTGA 4I3YA 4IB2A 1GVCA 5I57B 3OSQA 1H3DA 3OOAA 4QRZA 4AS5A 1FJ6A 5H8HB 3RPWA 4QBAA 1H43A 2CZLA 1FTMA 4EQ7A 1PC3A 1MM6A 4UACA 2H98A 1EU8A 2YLNA 4OHNA 4N17A 2O1MA 4XKRA 1IIWA 2R8TA 4PGNA 2I48A 4LP2B 4X8RA 1TXFA 2G29A 2P0SA 1Q9DA 4R75A 1UQWA 3ECRA 2XXWA 4JBZA 3OENA 1YTVA 2OLBA 1B4ZA 1LCTA 4LZ8A 3FIRA 5M2VA 3OD7A 2QVRA 3S9EA 1LAGE 1USYH 1MQGA 4PDDA 1FQBA 3QSLA 1SD3A 4O3BA 4RPNA 3VXCA 2RC9A 3KFMA 4O3CA 2E1SA 2YJPA 3NOHA 4Q0CA 3U72A 4H8IA 1IQ7A 3LV0A 1FPFA 4JWOA 4AS4A 2Q2CA 3GZGA 3EHSA 1LBVA 1RYXA 2XXUA 2XXHA 5ESYA 3ZKLA 1IZ1A 3H3GA 3KC1A 3IR1A 3QMFA 1LFHA 3V89B 1Y4TA 3IK6B 1UTHA 4OA4A 4IO3A 3MPKA 3A3CA 2O68A 4DI4B 2Y7PA 2DWIA 1JQFA 3MQ9A 3IB0A 4G2ZA 1EYKA 3DP8A 3ONMA 4POWA 3PUYE 4G77A 2A5TA 4TQUQ 1L5TA 1IEJA 4XIGQ 2E0SA 3MVYA 2DDKA 3OO7A 1FPIA 1P1NA 1JNFA 1LBWA 3IFAA 3K1NA 3RYDA 4PP0A 4P3LA 3KZGA 1JW1A 2Y7RA 3OMBA 4LZ7A 4NF4B 2NVUB 4P47A 2R6GE 3B8BA 1SYIA 3K2DA 4I8CA 3VVDA 4H1XA 5CBRA 2WYKA 1PEBA 1Z7ME 3L6HA 3K02A 3W9WA 1UTHB 2V3TA 4HE0A 1MY1A 2ZMBA 1EZPA 2HXRA 2QSXA 2DQVA 5ITOA 1YXIA 1ZU0A 4RNSA 1SDXA 1Y20A 5A5LA 4LATA 3TTKA 3TYHA 3VVEA 4LONB 2RCBA 2ZNTA 3PPPA 3LSLA 4FAJA 4HS7A 5I5PA 2JJKA 1JVXA 2CZHA 2MKZA 5J1DA 4GWYA 3CFLA 3SESA 1S50A 2XXVA 3LUYA 3OEMA 1M5FA 3K6WA 1QJMA 3DP4A 4H0WA 4Z0IA 4ESWA 1EZOA 3KBRA 4G68A 1ZMGA 1B1XA 3I5OA 1BK4A 1Y3PA 2X7QA 4FJPA 4IO7A 2QPQA 3RT8A 3TCHA 4DI3D 1TFAA 3E9XA 1OQHA 4MEVA 4XEQA 3HHFA 4RK2A 5IKBA 3K4UA 2V93A 4EQBA 4GX3A 5LOMA 5I3SA 2UVGA 3C31A 5ICTA 4I40A 3C35A 2ZYNA 4KYEA 3V8XB 4NF6A 4PF6A 4KCCA 1EYJA 1YPNA 1FPGA 5CRYA 1QKBA 3V83A 3EPEA 3KN8A 3SEVA 3LUZA 3CHGA 4AB5A 2I58A 1B52A 4IO6A 3E4RA 1JETA 2HZLA 4N15A 3BBRA 3C32A 4G68B 5DEXB 4JSDA 2DP8A 1PB9A 4Q8RA 5CM6A 2VD3A 3T0JA 4JVIA 5DVJA 4BDLA 1GTKA 1XVXA 2QL3A 4DDDA 4QF9A 3QXMA 2Q8JA 1N0TA 1FTAA 3A29A 1QUJA 4OXVA 3T9HB 3T66A 1MDQA 2F35A 4F1YA 1J1NA 2O7UA 4PE3A 1PBPA 1TT1A 4NWCA 1YYZA 3IJOB 2AYSA 3ZS6A 1R6ZA 1FBDA 3TQLA 4WKMA 4OFOA 4R74A 4PGPA 3MBPA 3R6UA 4YMAA 3S9MC 4DXBA 3G3HA 2CZIA 1LCFA 3O97A 3MP8A 3G3KA 4EUOA 4H46A 4DZ1A 4H45A 2RC7A 2XD2A 3B6TA 1OVBA 1B46A 3FVOA 1B58A 3HN0A 2KR0A 3H6TA 4QXDA 1DK4A 5KCJA 2QS4A 5IZ3A 5F24A 1GV8A 5FTIA 4QFKA 3LSWA 4QFPA 3PMVA 5EYFA 1FBPA 3TCFA 2V84A 3WAFA 1NUWA 2D5WA 4YKPA 4GRKA 2GHBA 4MLQA 3K1PA 1ZKBA 4C0RA 1MQDA 3FXRA 2Y84A 3CSBA 2ONRA 4PFBA 3PD8A 5DVFA 1QVSA 2FYIA 3F11A 1LGBC 1M5BA 2F7BA 4NAPA 2FVZA 1LB9A 2PMSA 1MPBA 4QFOA 3IAZA 4JVDA 1SPIA 4NTLA 4HXVA 4F18A 4C1TA 4OVRA 2ZYOA 4I62A 4GWUA 1SW2A 4GXSB 4GWSA 3KGCA 4O3AA 1Q1KA 2XWVA 4KD5A 2B4LA 3CRBA 2F3DA 3TZAA 4E0XA 2PFYA 1HSLA 3WAEA 1FPJA 2DWJA 4NF8A 4N6DA 4BDMA 1R9LA 1DMBA 5ICQA 2A5SA 3LC8A 1B3GA 3RTWB 3PGFA 3FVNA 4DLDA 4UABA 1B40A 4WEPA 2XX8A 4ZEIA 4F3PA 3VLVA 1OQGA 1K9YA 2DSFA 5I56B 4YZZA 1KA0A 1IMBA 3A3UA 3TMGA 2FA7A 2UVIA 1MXUA 3N6TA 2OZZA 5EYHA 5JTYB 4NF0A 1FPBA 3K6XA 2B4MA 2QJEA 3IJXB 5KZTA 2XXXA 2XWKA 5F7VA 2NUVA 1P1UA 4F22A 3FXQA 3N6UA 1LEVA 1LBYA 4MBPA 4Z7EA 1UTBA 3E78A 4C1UA 2W7YA 4DCYA 3TELA 3VE1B 2I4CA 4KFQA 2PX1A 1SQYA 1NL5A 1FTOA 1DPEA 5T3JA 3MC2A 1FQDA 1P1QA 4N13A 3TTMA 1IITA 3RN8A 3OO8A 3QIMA 5DW8A 3KOTA 1MQJA 4TOZA 2VPNA 1BTJA 2L5VA 3HHGA 4THIA 4PAKA 1QUIA 4RJZA 4P1EA 3VXBA 4ZE9A 3T1BA 4GFRA 5AA2D 1M5CA 4ISUA 1JP4A 5CBSA 5TU0A 4DIGA 4R73A 4ZEBA 4NN3A 3RPLA 3U1OA 3S4UA 3QUJA 2VPOA 4HW8A 1MY0A 2F36A 3FXUA 3L6GA 4FE8A 1Y1ZA 4QSDA 4F19A 3O6HA 5AA3A 4JWYA 1NH8A 4EF2A 3SEUA 5AA2A 5HM4B 1FBEA 1SW4A 4IGRA 4P1LA 2XX9A 4XTCQ 4OEUA 4H8JA 5L9OA 3BKIB 4ECFA 4GX4A 1A8EA 1B3HA 1NNFA 4G68C 4NG7A 2WBDA 2O51A 3SZPA 4FORA 3RY3A 4OMBA 3KSXA 1XHYA 2GFEA 4F39A 2H25A 3V5AA 3GBAA 4NF5A 4XKQA 2DXRA 1I6AA 4NHBA 4PAIA 4F3BA 1LB8A 4PFWA 2ZNSA 1DOTA 3T22A 2B65A 4M4GA 1B0HA 4ELRA 1FRPA 3OXNA 1NMUA 4MF3A 2CMOA 2HXWA 2Y7WA 1NNTA 1QW0A 1N7WA 4JDFA 1IXIA 2DYXA 3G3GA 1G0IA 4N81A 3DM0A 1MY3A 3IORA 5I58A 4P0GA 3T93B 1OVTA 3IB1A 3HCQA 2F3BA 3PUVE 2HPGA 4QFLA 3FUZA 1VDWA 3SETA 1PB8A 2V3UA 1ZIUA 4KQPA 2Y7KA 3GLBA 3Q29A 4FIMA 2DXYA 4IR8A 3RTFB 1OLCA 2I4BA 4KR5A 2H5YA 3M8UA 2QS1A 3FJGA 1QULA 4JSOA 1MXWA 2F8DA 4GQOA 4OVJA 3IO6A 4DXUA 4G8NA 1CE2A 2ZZVA 5H8NA 1KA1A 1BKAA 1I6QA 2VD2A 5H8FA 1NNKA 1M5EA 4IY5A 3T9UA 5J16A 5KDTA 3BIHA 4YICA 5AA1A 1URDA 1NH7A 3EKIA 4GXAA 2HFBA 4PTKA 1Y9UA 4YMBA 4H5GA 4R6KA 3FASA 3MSTA 3SERA 2DE4A 1AIVA 4IO2A 1URSA 3P7IA 1POY1 2RINA 4O7IA 1B0LA 5FBPA 5IZZA 4GBWA 4NEDA 4F1UA 1NV0A 5I2KA 1ATGA 1EH3A 1FCKA 4N6PA 1OLAA 3HV1A 2QFLA 2ZZWA 1RYOA 3MVZA 4LZ5A 3SDFA 4BDQA 3PPOA 1MDP1 3KSJA 2FBPA 4R72A 1LBCA 4IGTA 1VSOA 1HSEA 4BDNA 4N4UA 3TAJA 4RYAA 4RXLA 1WODA 5ITPA 2H9BA 3B7DA 3PMXA 4GWXA 1MG1A 3FATA 3PPQA 4P11A 1H76A 3IOVA 4G61A 1XI6A 5FHMA 3H06B 1H45A 1B4HA 5JK4A 2A5TB 4POXA 4GF8A 3FVKA 3O66A 3QAXA 3PD9A 3K6VA 4P56A 3CI8A 4F2QA 4PBHA 1A99A 5I2KB 3MZ9A 3IFCA 3CR9A 2DVCA 2XWOA 3PPNA 2GH9A
chains in the Genus database with same CATH topology
3H7MA 3LSFB 1MS7A 3JYRA 4BDRA 2Z22A 3IOTA 2OK2A 3N5LA 3UORA 4I9DA 1MY2A 1POTA 2VOZA 4PETA 2I3WA 4U22A 3ODBA 4YB7A 3W9VA 5I2NA 1XS5A 1B5HA 1P1WA 4EXLA 2HAUA 4X1DA 3T96B 3LSXA 1NFTA 1LSTA 1ELJA 4YB6A 3KJTA 1AL3A 5H8QA 3FZVA 3ILTB 2HZKA 3BFUA 2NWJA 1VFDA 4FEDA 2HQ0A 3PPRA 3S9LC 2F7AA 1LFGA 2UYFA 4YKJA 1MPDA 3OO6A 1Y3QA 1IUDA 1LLSA 1GGGA 1Q35A 2RF1A 3IB2A 3TDJA 3FV2A 4F1VA 3VLUA 1B05A 3RUMA 2AL4A 4OENA 5HBCA 4NF6B 1N3XA 4U4XA 3O29A 5I2NB 2NXOA 4LQ5A 3TFLA 1P1OA 1O7TA 3UN6A 3TODA 2M8CA 3U93A 5H8QB 5L9SA 1MXVA 2X26A 1IXHA 2OJTA 4PFYA 3QK6A 2UXAA 1XOCA 1JW5A 5ELVA 3SEWA 3IX1A 1BP5A 1FQEA 1B7HA 1ZTYA 2ZYMA 3K1MA 1R9QA 3EHUA 1MH3A 5FHOA 4X9TA 3K0VA 1SI0A 3CG3A 3VV5A 2XXYA 2BJJX 1IXCA 3E13X 1JEVA 3TTLA 3TTRA 3LBSA 2PVUA 2DWAA 3D4GA 1NKXA 1PBQA 4EDPA 5JEIA 3IO4A 1VFEA 2OWSA 4FATA 5KCJB 1A7LA 2YPNA 2I6EA 5DT6A 3FD3A 4ESXA 1S9TA 2GHAA 2QMWA 2I49A 5IAIA 4TLLB 2LAOA 3U92A 4KYSA 2OWTA 2UVJA 3ILUB 3U94A 1ZJLA 1MQHA 4H67A 3VFJA 1AMFA 4R2FA 1KWHA 4F3SA 4X48A 3KEIA 5TP9A 2QS2A 3K6UA 1GR2A 3IOUA 2O84X 4U4SA 4GIZA 5B70A 2ZNUA 1IXGA 4P0IA 5AA4A 3N26A 3RGYA 2QMXA 2VHAA 3TPAA 3UIFA 1D3KA 3ZSFA 4NF8B 3H03A 3U8QA 5B7DA 1PDAA 4OZ9A 4G4PA 4JWXA 4NE4A 3RLFE 5TPAA 1A54A 2XXIA 3PU5A 4OERA 2OBGA 4MH5A 4KYDA 4ND9A 3MAMA 4R6YA 2Y7IA 4DXCA 2V25A 1MPCA 4PQJA 3A09A 1MXZA 1I69A 4ZE8A 3M3LA 5H8HA 4IO5A 1ZLQA 4U1ZA 1XVYA 3TQWA 4GLIA 4OTEA 3MVXA 4AB6A 1B3LA 2Z8FA 1I6BA 5ISUA 2VP1A 1N04A 4U23A 4LVQA 3QUFA 5AA4B 1UTBB 1DPPA 4OFJA 1D4NA 4R9FA 4ZEFA 3TKDA 3R26A 4ZDMA 2O7IA 3PUXE 3OO9A 1N3WA 2F97A 2OCUA 1LFIA 5TPAB 4JB7A 3S2VA 3KJ7A 2O6AA 4GL0A 3CFXA 2UYEA 4ONYA 1D9VA 4OEVA 2O1LA 4JXIA 1DTZA 1LAXA 1DSNA 1URGA 2RC8A 3O2AA 2X7PA 5DVIA 2DE3A 3EQ1A 5AA2B 3MP6A 2F5XA 1S7YA 4UA8A 2ZYKA 1FQFA 1FTLA 1JEUA 2ZXTA 3MPLA 1CB6A 4OFLA 3JZJA 1TFDA 3MW0A 4NF5B 4RA1A 2F6GA 2H99A 4ZEKA 4FECA 2R71A 3CVGA 3Q27A 1FTJA 1AH5A 2WKYA 2B3FA 4NF4A 4H65A 4GOTA 3RQTA 3UGWA 3PUWE 3GBBA 4QSCA 3G3FA 3UA8A 1HSJA 3O6IA 1BLFA 1RKMA 2QRYA 3I6VA 3HO7A 3KN3A 1MXXA 2GRVA 3HPIA 3T9XB 5I58B 1XT8A 2F78A 1FQCA 3CG1A 3R7XA 3QYTA 2DS9A 3N94A 4F3GA 4KPTA 2ALUA 5A5XA 3Q28A 5AE4A 4WXJA 2XXTA 4ZZAA 4LA9A 3Q26A 4GWOA 2P2AA 2XX7A 5CC2A 4Q30B 3TUSA 2DOJA 4KI0E 1MXYA 5H8NB 1A40A 1USYE 2ANJA 1B2HA 3K01A 4RPOA 3FV1A 1MQIA 5H8FB 3SEXA 4WEDA 2R9JA 5KDTB 4U2RA 2F6PA 3MVWA 3MZBA 4OQOA 5I59A 1MM7A 3THIA 2ABHA 3SKPA 3B6WA 3OEKA 2XD3A 5CMKA 3FJMA 1B3EA 3C36A 1Z7NE 1SI1A 3UP9A 3MP1A 5A5XB 3VLWA 1YCJA 2IEEA 2XXQA 4EXKA 3AXFA 4PE5B 3IOWA 5CMMA 2REGA 5DEXA 5K2XA 2ONKE 1A55A 1DTGA 2DWHA 1D9YA 1VE4A 2REJA 1NNPA 2DVZA 5DTBA 4R6HA 4H5FA 1R1NA 1VR5A 2HCAA 4LUBA 1UIUA 4N07A 1UIVA 5DYHA 3VDFA 1YAEA 1EZ9A 5I59B 4E0WA 2PT2A 2AL5A 3C34A 4YKIA 2NOOA 3OSRA 4HCWA 4GL8A 4IO4A 4XKPA 2AIXA 4U21A 4MLVA 1SYHA 1US5A 2XHDA 3SEYA 3B6QA 1N76A 3MJNA 3M3FA 2B3BA 4GD5A 3EN3A 4Q5TA 2D21A 2IA4A 2Q88A 3PMWA 1US4A 3Q25A 3K00A 3TCGA 1QKAA 2Q89A 3PUZE 1N84A 4YU0A 2PT1A 4RK9A 3FGSA 4OETA 1LBBA 1SVXB 3MWBA 3ZKKA 1QUKA 3O28A 1ZBMA 2DE2A 3CFZA 1AOVA 1Y4CA 4M1VA 5HPQA 5FTHA 1B5IA 2O69A 3S9NC 2XXPA 1SBPA 1Y1MA 4YAHX 4R9GA 4KHZE 2F34A 4X1BA 3FJ7A 3H6WA 2HEUA 3C4MA 3JV9A 2KLFA 2RKMA 2UVHA 3EHTA 4QFNA 3RNNA 4U1OA 4F29A 2ONSA 1B6HA 5I84A 4XKNA 2Z23A 1OIBA 4GVOA 1JW4A 4R2BA 4DE8A 4TLMB 4ELOA 3M3KA 3DLNA 1FW0A 1XC1A 2Z8EA 3C33A 4DCXA 4KCDA 1LAHE 4NWDA 1O64A 1A8FA 3LR1A 1II5A 4IY6A 5I56A 5JTYA 3HSTA 3GXAA 1PB7A 2I0CA 3G7WA 1WVJA 3H6UA 3O9PA 3I3VA 4MFIA 1P99A 4BLAA 1ANFA 1B9JA 3DELB 4EQ9A 3E3KA 1B32A 3CSGA 4FEBA 5EHMA 4ZEDA 3O6GA 4OWDA 4QSEA 5L9MA 2VGQA 1JVYA 3DP6A 4HCYA 3RT6B 5L8DA 1N7XA 3T9VA 2ESNA 4QHQA 4ZS9A 3MUQA 1MY4A 4G8MA 4AQ4A 1B5JA 4G8HA 3UK4A 4XXUA 4EF1A 4ZZEA 1T0KA 2THIA 1B7UA 4YKKA 4PFUA 1O63A 3G3IA 3FVGA 4ELQA 2I0BA 3VVFA 3EF7A 3IL1B 2P1SA 1H44A 2Z8DA 4LQ2A 2H4IA 3CIJA 1LAFE 1FTKA 1F9BA 4K3FA 1B7ZA 5EHSA 1SW5A 3USDA 3OELA 3BFTA 3PV0E 4L17A 2G93A 4BDOA 2V3QA 2Q9TA 1SW1A 1B51A 1B1HA 4OESA 5I57A 5CI5A 3KG2A 5H8SA 4F2OA 4ELPA 2PBWA 4NMYA 5FHNA 2Q2AA 2I3VA 1TWYA 1WDNA 2F7CA 1OMPA 3KOSA 4YB5A 5BWJA 5TP9B 3G3JA 1MH4A 3KN7A 2QS3A 5CMBA 3D4CA 4F31B 1B3FA 4PFTA 1FQAA 4H6DA 4I1DA 3TTNA 5K2YA 3C9HA 3H6VA 3MZ1A 2PYYA 4ZECA 4RY1A 3W15C 5CMCA 5F1QA 3H4ZA 1BIYA 4OYVA 1MRPA 1Y3NA 2D3IA 2FNCA 1M5DA 2XXRA 5BUUA 2RCAA 3TEPA 2HAVA 4HTGA 4IB2A 1GVCA 5I57B 3OSQA 1H3DA 3OOAA 4QRZA 5H8HB 3RPWA 1H43A 2CZLA 1FTMA 4EQ7A 1PC3A 1MM6A 4UACA 2H98A 1EU8A 2YLNA 4OHNA 2O1MA 4XKRA 1IIWA 2I48A 4LP2B 1TXFA 2G29A 2P0SA 4R75A 1UQWA 3ECRA 2XXWA 4JBZA 3OENA 1YTVA 2OLBA 1B4ZA 1LCTA 4LZ8A 3FIRA 5M2VA 3OD7A 3S9EA 1LAGE 1USYH 1MQGA 1FQBA 3QSLA 1SD3A 4O3BA 4RPNA 3VXCA 2RC9A 3KFMA 4O3CA 2E1SA 2YJPA 4Q0CA 3U72A 4H8IA 1IQ7A 4JWOA 2Q2CA 3GZGA 3EHSA 1RYXA 2XXUA 2XXHA 3ZKLA 1IZ1A 3H3GA 3IR1A 1LFHA 3V89B 1Y4TA 3IK6B 1UTHA 4IO3A 3MPKA 3A3CA 2O68A 2Y7PA 2DWIA 1JQFA 3MQ9A 3IB0A 4G2ZA 3DP8A 3ONMA 4POWA 3PUYE 4G77A 2A5TA 4TQUQ 1L5TA 1IEJA 4XIGQ 2E0SA 3MVYA 3OO7A 1P1NA 1JNFA 3K1NA 4PP0A 3KZGA 1JW1A 2Y7RA 3OMBA 4LZ7A 4NF4B 2NVUB 2R6GE 1SYIA 3K2DA 4I8CA 3VVDA 4H1XA 5CBRA 1PEBA 1Z7ME 3L6HA 3K02A 3W9WA 1UTHB 2V3TA 1MY1A 2ZMBA 1EZPA 2QSXA 2DQVA 5ITOA 1ZU0A 4RNSA 1SDXA 1Y20A 4LATA 3TTKA 3TYHA 3VVEA 4LONB 2RCBA 2ZNTA 3PPPA 3LSLA 4FAJA 4HS7A 1JVXA 5J1DA 3CFLA 3SESA 1S50A 2XXVA 3LUYA 3OEMA 1M5FA 3K6WA 1QJMA 3DP4A 4H0WA 4Z0IA 4ESWA 1EZOA 3KBRA 4G68A 1ZMGA 1B1XA 3I5OA 1Y3PA 2X7QA 4FJPA 4IO7A 2QPQA 3RT8A 3TCHA 1TFAA 3E9XA 1OQHA 3HHFA 4RK2A 5IKBA 3K4UA 2V93A 4EQBA 5LOMA 2UVGA 3C31A 5ICTA 3C35A 2ZYNA 4KYEA 3V8XB 4NF6A 4KCCA 1YPNA 5CRYA 1QKBA 3V83A 3EPEA 3KN8A 3SEVA 4AB5A 2I58A 1B52A 4IO6A 3E4RA 1JETA 2HZLA 3BBRA 3C32A 4G68B 5DEXB 4JSDA 2DP8A 1PB9A 4Q8RA 5CM6A 2VD3A 5DVJA 4BDLA 1GTKA 1XVXA 2QL3A 4DDDA 4QF9A 3QXMA 2Q8JA 1N0TA 1QUJA 4OXVA 3T9HB 3T66A 1MDQA 2F35A 4F1YA 1J1NA 2O7UA 1PBPA 1TT1A 4NWCA 3IJOB 2AYSA 3ZS6A 1R6ZA 3TQLA 4WKMA 4OFOA 4R74A 3MBPA 3R6UA 4YMAA 3S9MC 4DXBA 3G3HA 1LCFA 3O97A 3MP8A 3G3KA 4EUOA 4DZ1A 2RC7A 2XD2A 3B6TA 1OVBA 1B46A 3FVOA 1B58A 3HN0A 3H6TA 5KCJA 2QS4A 1GV8A 5FTIA 4QFKA 3LSWA 4QFPA 3PMVA 5EYFA 3TCFA 2V84A 3WAFA 2D5WA 4YKPA 4GRKA 2GHBA 4MLQA 3K1PA 1ZKBA 4C0RA 1MQDA 3FXRA 2Y84A 3CSBA 2ONRA 3PD8A 5DVFA 1QVSA 2FYIA 3F11A 1LGBC 1M5BA 2F7BA 1LB9A 2PMSA 1MPBA 4QFOA 3IAZA 4NTLA 4F18A 4C1TA 2ZYOA 4I62A 1SW2A 4GXSB 3KGCA 4O3AA 1Q1KA 4KD5A 3CRBA 3TZAA 4E0XA 1HSLA 3WAEA 2DWJA 4NF8A 4BDMA 1R9LA 1DMBA 5ICQA 2A5SA 3LC8A 1B3GA 3RTWB 3PGFA 3FVNA 4DLDA 1B40A 4WEPA 2XX8A 4ZEIA 4F3PA 3VLVA 1OQGA 2DSFA 5I56B 4YZZA 3A3UA 3TMGA 2FA7A 2UVIA 1MXUA 3N6TA 2OZZA 5JTYB 3K6XA 2QJEA 3IJXB 5KZTA 2XXXA 5F7VA 2NUVA 1P1UA 4F22A 3FXQA 3N6UA 4MBPA 4Z7EA 1UTBA 4C1UA 2W7YA 4DCYA 3TELA 3VE1B 2I4CA 4KFQA 2PX1A 1SQYA 1NL5A 1FTOA 1DPEA 3MC2A 1FQDA 1P1QA 4N13A 3TTMA 1IITA 3RN8A 3OO8A 3QIMA 3KOTA 1MQJA 4TOZA 1BTJA 3HHGA 4THIA 1QUIA 4RJZA 3VXBA 4ZE9A 5AA2D 4GFRA 1M5CA 4ISUA 5CBSA 5TU0A 4DIGA 4R73A 4ZEBA 3U1OA 3S4UA 3QUJA 4HW8A 1MY0A 2F36A 3FXUA 3L6GA 4FE8A 1Y1ZA 4QSDA 4F19A 3O6HA 5AA3A 4JWYA 1NH8A 4EF2A 3SEUA 5AA2A 5HM4B 1SW4A 4IGRA 2XX9A 4XTCQ 4OEUA 4H8JA 5L9OA 3BKIB 4ECFA 1A8EA 1B3HA 1NNFA 4G68C 2O51A 4FORA 3RY3A 4OMBA 3KSXA 1XHYA 2GFEA 4F39A 2H25A 3V5AA 3GBAA 4NF5A 4XKQA 2DXRA 1I6AA 4F3BA 1LB8A 4PFWA 2ZNSA 1DOTA 3T22A 2B65A 4M4GA 1B0HA 4ELRA 3OXNA 1NMUA 4MF3A 2CMOA 2HXWA 2Y7WA 1NNTA 1QW0A 1N7WA 4JDFA 1IXIA 2DYXA 3G3GA 3DM0A 1MY3A 3IORA 5I58A 4P0GA 3T93B 1OVTA 3IB1A 3HCQA 3PUVE 3FUZA 4QFLA 3SETA 1PB8A 2V3UA 1ZIUA 4KQPA 2Y7KA 3GLBA 3Q29A 4FIMA 2DXYA 3RTFB 1OLCA 2I4BA 4KR5A 2H5YA 3M8UA 2QS1A 3FJGA 1QULA 4JSOA 1MXWA 2F8DA 4GQOA 4OVJA 3IO6A 4DXUA 4G8NA 1CE2A 5H8NA 1BKAA 1I6QA 2VD2A 5H8FA 1NNKA 1M5EA 4IY5A 3T9UA 5KDTA 4YICA 5AA1A 1URDA 1NH7A 4GXAA 2HFBA 1Y9UA 4YMBA 4H5GA 4R6KA 3FASA 3SERA 2DE4A 1AIVA 4IO2A 1URSA 3P7IA 1POY1 2RINA 1B0LA 4NEDA 4F1UA 5I2KA 1ATGA 1EH3A 1FCKA 4N6PA 1OLAA 3HV1A 1RYOA 3MVZA 4LZ5A 3SDFA 4BDQA 3PPOA 1MDP1 3KSJA 4R72A 1LBCA 4IGTA 1VSOA 1HSEA 4BDNA 3TAJA 4RYAA 4RXLA 1WODA 5ITPA 2H9BA 3B7DA 3PMXA 1MG1A 3FATA 3PPQA 4P11A 1H76A 3IOVA 5FHMA 3H06B 1H45A 1B4HA 5JK4A 2A5TB 4POXA 4GF8A 3FVKA 3O66A 3QAXA 3PD9A 3K6VA 3CI8A 4F2QA 1A99A 5I2KB 3MZ9A 3CR9A 2DVCA 3PPNA 2GH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7M A;  3LSF B;  1MS7 A;  3JYR A;  4BDR A;  2Z22 A;  3IOT A;  2OK2 A;  3N5L A;  3UOR A;  4I9D A;  1MY2 A;  1POT A;  2VOZ A;  4PET A;  2I3W A;  4U22 A;  3ODB A;  4YB7 A;  3W9V A;  5I2N A;  1XS5 A;  1B5H A;  1P1W A;  4EXL A;  2HAU A;  4X1D A;  3T96 B;  3LSX A;  1NFT A;  1LST A;  1ELJ A;  4YB6 A;  3KJT A;  1AL3 A;  5H8Q A;  3FZV A;  3ILT B;  2HZK A;  3BFU A;  2NWJ A;  1VFD A;  4FED A;  2HQ0 A;  3PPR A;  3S9L C;  2F7A A;  1LFG A;  2UYF A;  4YKJ A;  1MPD A;  3OO6 A;  1Y3Q A;  1IUD A;  1LLS A;  1GGG A;  1Q35 A;  2RF1 A;  3IB2 A;  3TDJ A;  3FV2 A;  4F1V A;  3VLU A;  1B05 A;  3RUM A;  2AL4 A;  4OEN A;  5HBC A;  4NF6 B;  1N3X A;  4U4X A;  3O29 A;  5I2N B;  2NXO A;  4LQ5 A;  3TFL A;  1P1O A;  1O7T A;  3UN6 A;  3TOD A;  2M8C A;  3U93 A;  5H8Q B;  5L9S A;  1MXV A;  2X26 A;  1IXH A;  2OJT A;  4PFY A;  3QK6 A;  2UXA A;  1XOC A;  1JW5 A;  5ELV A;  3SEW A;  3IX1 A;  1BP5 A;  1FQE A;  1B7H A;  1ZTY A;  2ZYM A;  3K1M A;  1R9Q A;  3EHU A;  1MH3 A;  5FHO A;  4X9T A;  3K0V A;  1SI0 A;  3CG3 A;  3VV5 A;  2XXY A;  2BJJ X;  1IXC A;  3E13 X;  1JEV A;  3TTL A;  3TTR A;  3LBS A;  2PVU A;  2DWA A;  3D4G A;  1NKX A;  1PBQ A;  4EDP A;  5JEI A;  3IO4 A;  1VFE A;  2OWS A;  4FAT A;  5KCJ B;  1A7L A;  2YPN A;  2I6E A;  5DT6 A;  3FD3 A;  4ESX A;  1S9T A;  2GHA A;  2QMW A;  2I49 A;  5IAI A;  4TLL B;  2LAO A;  3U92 A;  4KYS A;  2OWT A;  2UVJ A;  3ILU B;  3U94 A;  1ZJL A;  1MQH A;  4H67 A;  3VFJ A;  1AMF A;  4R2F A;  1KWH A;  4F3S A;  4X48 A;  3KEI A;  5TP9 A;  2QS2 A;  3K6U A;  1GR2 A;  3IOU A;  2O84 X;  4U4S A;  4GIZ A;  5B70 A;  2ZNU A;  1IXG A;  4P0I A;  5AA4 A;  3N26 A;  3RGY A;  2QMX A;  2VHA A;  3TPA A;  3UIF A;  1D3K A;  3ZSF A;  4NF8 B;  3H03 A;  3U8Q A;  5B7D A;  1PDA A;  4OZ9 A;  4G4P A;  4JWX A;  4NE4 A;  3RLF E;  5TPA A;  1A54 A;  2XXI A;  3PU5 A;  4OER A;  2OBG A;  4MH5 A;  4KYD A;  4ND9 A;  3MAM A;  4R6Y A;  2Y7I A;  4DXC A;  2V25 A;  1MPC A;  4PQJ A;  3A09 A;  1MXZ A;  1I69 A;  4ZE8 A;  3M3L A;  5H8H A;  4IO5 A;  1ZLQ A;  4U1Z A;  1XVY A;  3TQW A;  4GLI A;  4OTE A;  3MVX A;  4AB6 A;  1B3L A;  2Z8F A;  1I6B A;  5ISU A;  2VP1 A;  1N04 A;  4U23 A;  4LVQ A;  3QUF A;  5AA4 B;  1UTB B;  1DPP A;  4OFJ A;  1D4N A;  4R9F A;  4ZEF A;  3TKD A;  3R26 A;  4ZDM A;  2O7I A;  3PUX E;  3OO9 A;  1N3W A;  2F97 A;  2OCU A;  1LFI A;  5TPA B;  4JB7 A;  3S2V A;  3KJ7 A;  2O6A A;  4GL0 A;  3CFX A;  2UYE A;  4ONY A;  1D9V A;  4OEV A;  2O1L A;  4JXI A;  1DTZ A;  1LAX A;  1DSN A;  1URG A;  2RC8 A;  3O2A A;  2X7P A;  5DVI A;  2DE3 A;  3EQ1 A;  5AA2 B;  3MP6 A;  2F5X A;  1S7Y A;  4UA8 A;  2ZYK A;  1FQF A;  1FTL A;  1JEU A;  2ZXT A;  3MPL A;  1CB6 A;  4OFL A;  3JZJ A;  1TFD A;  3MW0 A;  4NF5 B;  4RA1 A;  2F6G A;  2H99 A;  4ZEK A;  4FEC A;  2R71 A;  3CVG A;  3Q27 A;  1FTJ A;  1AH5 A;  2WKY A;  2B3F A;  4NF4 A;  4H65 A;  4GOT A;  3RQT A;  3UGW A;  3PUW E;  3GBB A;  4QSC A;  3G3F A;  3UA8 A;  1HSJ A;  3O6I A;  1BLF A;  1RKM A;  2QRY A;  3I6V A;  3HO7 A;  3KN3 A;  1MXX A;  2GRV A;  3HPI A;  3T9X B;  5I58 B;  1XT8 A;  2F78 A;  1FQC A;  3CG1 A;  3R7X A;  3QYT A;  2DS9 A;  3N94 A;  4F3G A;  4KPT A;  2ALU A;  5A5X A;  3Q28 A;  5AE4 A;  4WXJ A;  2XXT A;  4ZZA A;  4LA9 A;  3Q26 A;  4GWO A;  2P2A A;  2XX7 A;  5CC2 A;  4Q30 B;  3TUS A;  2DOJ A;  4KI0 E;  1MXY A;  5H8N B;  1A40 A;  1USY E;  2ANJ A;  1B2H A;  3K01 A;  4RPO A;  3FV1 A;  1MQI A;  5H8F B;  3SEX A;  4WED A;  2R9J A;  5KDT B;  4U2R A;  2F6P A;  3MVW A;  3MZB A;  4OQO A;  5I59 A;  1MM7 A;  3THI A;  2ABH A;  3SKP A;  3B6W A;  3OEK A;  2XD3 A;  5CMK A;  3FJM A;  1B3E A;  3C36 A;  1Z7N E;  1SI1 A;  3UP9 A;  3MP1 A;  5A5X B;  3VLW A;  1YCJ A;  2IEE A;  2XXQ A;  4EXK A;  3AXF A;  4PE5 B;  3IOW A;  5CMM A;  2REG A;  5DEX A;  5K2X A;  2ONK E;  1A55 A;  1DTG A;  2DWH A;  1D9Y A;  1VE4 A;  2REJ A;  1NNP A;  2DVZ A;  5DTB A;  4R6H A;  4H5F A;  1R1N A;  1VR5 A;  2HCA A;  4LUB A;  1UIU A;  4N07 A;  1UIV A;  5DYH A;  3VDF A;  1YAE A;  1EZ9 A;  5I59 B;  4E0W A;  2PT2 A;  2AL5 A;  3C34 A;  4YKI A;  2NOO A;  3OSR A;  4HCW A;  4GL8 A;  4IO4 A;  4XKP A;  2AIX A;  4U21 A;  4MLV A;  1SYH A;  1US5 A;  2XHD A;  3SEY A;  3B6Q A;  1N76 A;  3MJN A;  3M3F A;  2B3B A;  4GD5 A;  3EN3 A;  4Q5T A;  2D21 A;  2IA4 A;  2Q88 A;  3PMW A;  1US4 A;  3Q25 A;  3K00 A;  3TCG A;  1QKA A;  2Q89 A;  3PUZ E;  1N84 A;  4YU0 A;  2PT1 A;  4RK9 A;  3FGS A;  4OET A;  1LBB A;  1SVX B;  3MWB A;  3ZKK A;  1QUK A;  3O28 A;  1ZBM A;  2DE2 A;  3CFZ A;  1AOV A;  1Y4C A;  4M1V A;  5HPQ A;  5FTH A;  1B5I A;  2O69 A;  3S9N C;  2XXP A;  1SBP A;  1Y1M A;  4YAH X;  4R9G A;  4KHZ E;  2F34 A;  4X1B A;  3FJ7 A;  3H6W A;  2HEU A;  3C4M A;  3JV9 A;  2KLF A;  2RKM A;  2UVH A;  3EHT A;  4QFN A;  3RNN A;  4U1O A;  4F29 A;  2ONS A;  1B6H A;  5I84 A;  4XKN A;  2Z23 A;  1OIB A;  4GVO A;  1JW4 A;  4R2B A;  4DE8 A;  4TLM B;  4ELO A;  3M3K A;  3DLN A;  1FW0 A;  1XC1 A;  2Z8E A;  3C33 A;  4DCX A;  4KCD A;  1LAH E;  4NWD A;  1O64 A;  1A8F A;  3LR1 A;  1II5 A;  4IY6 A;  5I56 A;  5JTY A;  3HST A;  3GXA A;  1PB7 A;  2I0C A;  3G7W A;  1WVJ A;  3H6U A;  3O9P A;  3I3V A;  4MFI A;  1P99 A;  4BLA A;  1ANF A;  1B9J A;  3DEL B;  4EQ9 A;  3E3K A;  1B32 A;  3CSG A;  4FEB A;  5EHM A;  4ZED A;  3O6G A;  4OWD A;  4QSE A;  5L9M A;  2VGQ A;  1JVY A;  3DP6 A;  4HCY A;  3RT6 B;  5L8D A;  1N7X A;  3T9V A;  2ESN A;  4QHQ A;  4ZS9 A;  3MUQ A;  1MY4 A;  4G8M A;  4AQ4 A;  1B5J A;  4G8H A;  3UK4 A;  4XXU A;  4EF1 A;  4ZZE A;  1T0K A;  2THI A;  1B7U A;  4YKK A;  4PFU A;  1O63 A;  3G3I A;  3FVG A;  4ELQ A;  2I0B A;  3VVF A;  3EF7 A;  3IL1 B;  2P1S A;  1H44 A;  2Z8D A;  4LQ2 A;  2H4I A;  3CIJ A;  1LAF E;  1FTK A;  1F9B A;  4K3F A;  1B7Z A;  5EHS A;  1SW5 A;  3USD A;  3OEL A;  3BFT A;  3PV0 E;  4L17 A;  2G93 A;  4BDO A;  2V3Q A;  2Q9T A;  1SW1 A;  1B51 A;  1B1H A;  4OES A;  5I57 A;  5CI5 A;  3KG2 A;  5H8S A;  4F2O A;  4ELP A;  2PBW A;  4NMY A;  5FHN A;  2Q2A A;  2I3V A;  1TWY A;  1WDN A;  2F7C A;  1OMP A;  3KOS A;  4YB5 A;  5BWJ A;  5TP9 B;  3G3J A;  1MH4 A;  3KN7 A;  2QS3 A;  5CMB A;  3D4C A;  4F31 B;  1B3F A;  4PFT A;  1FQA A;  4H6D A;  4I1D A;  3TTN A;  5K2Y A;  3C9H A;  3H6V A;  3MZ1 A;  2PYY A;  4ZEC A;  4RY1 A;  3W15 C;  5CMC A;  5F1Q A;  3H4Z A;  1BIY A;  4OYV A;  1MRP A;  1Y3N A;  2D3I A;  2FNC A;  1M5D A;  2XXR A;  5BUU A;  2RCA A;  3TEP A;  2HAV A;  4HTG A;  4IB2 A;  1GVC A;  5I57 B;  3OSQ A;  1H3D A;  3OOA A;  4QRZ A;  5H8H B;  3RPW A;  1H43 A;  2CZL A;  1FTM A;  4EQ7 A;  1PC3 A;  1MM6 A;  4UAC A;  2H98 A;  1EU8 A;  2YLN A;  4OHN A;  2O1M A;  4XKR A;  1IIW A;  2I48 A;  4LP2 B;  1TXF A;  2G29 A;  2P0S A;  4R75 A;  1UQW A;  3ECR A;  2XXW A;  4JBZ A;  3OEN A;  1YTV A;  2OLB A;  1B4Z A;  1LCT A;  4LZ8 A;  3FIR A;  5M2V A;  3OD7 A;  3S9E A;  1LAG E;  1USY H;  1MQG A;  1FQB A;  3QSL A;  1SD3 A;  4O3B A;  4RPN A;  3VXC A;  2RC9 A;  3KFM A;  4O3C A;  2E1S A;  2YJP A;  4Q0C A;  3U72 A;  4H8I A;  1IQ7 A;  4JWO A;  2Q2C A;  3GZG A;  3EHS A;  1RYX A;  2XXU A;  2XXH A;  3ZKL A;  1IZ1 A;  3H3G A;  3IR1 A;  1LFH A;  3V89 B;  1Y4T A;  3IK6 B;  1UTH A;  4IO3 A;  3MPK A;  3A3C A;  2O68 A;  2Y7P A;  2DWI A;  1JQF A;  3MQ9 A;  3IB0 A;  4G2Z A;  3DP8 A;  3ONM A;  4POW A;  3PUY E;  4G77 A;  2A5T A;  4TQU Q;  1L5T A;  1IEJ A;  4XIG Q;  2E0S A;  3MVY A;  3OO7 A;  1P1N A;  1JNF A;  3K1N A;  4PP0 A;  3KZG A;  1JW1 A;  2Y7R A;  3OMB A;  4LZ7 A;  4NF4 B;  2NVU B;  2R6G E;  1SYI A;  3K2D A;  4I8C A;  3VVD A;  4H1X A;  5CBR A;  1PEB A;  1Z7M E;  3L6H A;  3K02 A;  3W9W A;  1UTH B;  2V3T A;  1MY1 A;  2ZMB A;  1EZP A;  2QSX A;  2DQV A;  5ITO A;  1ZU0 A;  4RNS A;  1SDX A;  1Y20 A;  4LAT A;  3TTK A;  3TYH A;  3VVE A;  4LON B;  2RCB A;  2ZNT A;  3PPP A;  3LSL A;  4FAJ A;  4HS7 A;  1JVX A;  5J1D A;  3CFL A;  3SES A;  1S50 A;  2XXV A;  3LUY A;  3OEM A;  1M5F A;  3K6W A;  1QJM A;  3DP4 A;  4H0W A;  4Z0I A;  4ESW A;  1EZO A;  3KBR A;  4G68 A;  1ZMG A;  1B1X A;  3I5O A;  1Y3P A;  2X7Q A;  4FJP A;  4IO7 A;  2QPQ A;  3RT8 A;  3TCH A;  1TFA A;  3E9X A;  1OQH A;  3HHF A;  4RK2 A;  5IKB A;  3K4U A;  2V93 A;  4EQB A;  5LOM A;  2UVG A;  3C31 A;  5ICT A;  3C35 A;  2ZYN A;  4KYE A;  3V8X B;  4NF6 A;  4KCC A;  1YPN A;  5CRY A;  1QKB A;  3V83 A;  3EPE A;  3KN8 A;  3SEV A;  4AB5 A;  2I58 A;  1B52 A;  4IO6 A;  3E4R A;  1JET A;  2HZL A;  3BBR A;  3C32 A;  4G68 B;  5DEX B;  4JSD A;  2DP8 A;  1PB9 A;  4Q8R A;  5CM6 A;  2VD3 A;  5DVJ A;  4BDL A;  1GTK A;  1XVX A;  2QL3 A;  4DDD A;  4QF9 A;  3QXM A;  2Q8J A;  1N0T A;  1QUJ A;  4OXV A;  3T9H B;  3T66 A;  1MDQ A;  2F35 A;  4F1Y A;  1J1N A;  2O7U A;  1PBP A;  1TT1 A;  4NWC A;  3IJO B;  2AYS A;  3ZS6 A;  1R6Z A;  3TQL A;  4WKM A;  4OFO A;  4R74 A;  3MBP A;  3R6U A;  4YMA A;  3S9M C;  4DXB A;  3G3H A;  1LCF A;  3O97 A;  3MP8 A;  3G3K A;  4EUO A;  4DZ1 A;  2RC7 A;  2XD2 A;  3B6T A;  1OVB A;  1B46 A;  3FVO A;  1B58 A;  3HN0 A;  3H6T A;  5KCJ A;  2QS4 A;  1GV8 A;  5FTI A;  4QFK A;  3LSW A;  4QFP A;  3PMV A;  5EYF A;  3TCF A;  2V84 A;  3WAF A;  2D5W A;  4YKP A;  4GRK A;  2GHB A;  4MLQ A;  3K1P A;  1ZKB A;  4C0R A;  1MQD A;  3FXR A;  2Y84 A;  3CSB A;  2ONR A;  3PD8 A;  5DVF A;  1QVS A;  2FYI A;  3F11 A;  1LGB C;  1M5B A;  2F7B A;  1LB9 A;  2PMS A;  1MPB A;  4QFO A;  3IAZ A;  4NTL A;  4F18 A;  4C1T A;  2ZYO A;  4I62 A;  1SW2 A;  4GXS B;  3KGC A;  4O3A A;  1Q1K A;  4KD5 A;  3CRB A;  3TZA A;  4E0X A;  1HSL A;  3WAE A;  2DWJ A;  4NF8 A;  4BDM A;  1R9L A;  1DMB A;  5ICQ A;  2A5S A;  3LC8 A;  1B3G A;  3RTW B;  3PGF A;  3FVN A;  4DLD A;  1B40 A;  4WEP A;  2XX8 A;  4ZEI A;  4F3P A;  3VLV A;  1OQG A;  2DSF A;  5I56 B;  4YZZ A;  3A3U A;  3TMG A;  2FA7 A;  2UVI A;  1MXU A;  3N6T A;  2OZZ A;  5JTY B;  3K6X A;  2QJE A;  3IJX B;  5KZT A;  2XXX A;  5F7V A;  2NUV A;  1P1U A;  4F22 A;  3FXQ A;  3N6U A;  4MBP A;  4Z7E A;  1UTB A;  4C1U A;  2W7Y A;  4DCY A;  3TEL A;  3VE1 B;  2I4C A;  4KFQ A;  2PX1 A;  1SQY A;  1NL5 A;  1FTO A;  1DPE A;  3MC2 A;  1FQD A;  1P1Q A;  4N13 A;  3TTM A;  1IIT A;  3RN8 A;  3OO8 A;  3QIM A;  3KOT A;  1MQJ A;  4TOZ A;  1BTJ A;  3HHG A;  4THI A;  1QUI A;  4RJZ A;  3VXB A;  4ZE9 A;  5AA2 D;  4GFR A;  1M5C A;  4ISU A;  5CBS A;  5TU0 A;  4DIG A;  4R73 A;  4ZEB A;  3U1O A;  3S4U A;  3QUJ A;  4HW8 A;  1MY0 A;  2F36 A;  3FXU A;  3L6G A;  4FE8 A;  1Y1Z A;  4QSD A;  4F19 A;  3O6H A;  5AA3 A;  4JWY A;  1NH8 A;  4EF2 A;  3SEU A;  5AA2 A;  5HM4 B;  1SW4 A;  4IGR A;  2XX9 A;  4XTC Q;  4OEU A;  4H8J A;  5L9O A;  3BKI B;  4ECF A;  1A8E A;  1B3H A;  1NNF A;  4G68 C;  2O51 A;  4FOR A;  3RY3 A;  4OMB A;  3KSX A;  1XHY A;  2GFE A;  4F39 A;  2H25 A;  3V5A A;  3GBA A;  4NF5 A;  4XKQ A;  2DXR A;  1I6A A;  4F3B A;  1LB8 A;  4PFW A;  2ZNS A;  1DOT A;  3T22 A;  2B65 A;  4M4G A;  1B0H A;  4ELR A;  3OXN A;  1NMU A;  4MF3 A;  2CMO A;  2HXW A;  2Y7W A;  1NNT A;  1QW0 A;  1N7W A;  4JDF A;  1IXI A;  2DYX A;  3G3G A;  3DM0 A;  1MY3 A;  3IOR A;  5I58 A;  4P0G A;  3T93 B;  1OVT A;  3IB1 A;  3HCQ A;  3PUV E;  3FUZ A;  4QFL A;  3SET A;  1PB8 A;  2V3U A;  1ZIU A;  4KQP A;  2Y7K A;  3GLB A;  3Q29 A;  4FIM A;  2DXY A;  3RTF B;  1OLC A;  2I4B A;  4KR5 A;  2H5Y A;  3M8U A;  2QS1 A;  3FJG A;  1QUL A;  4JSO A;  1MXW A;  2F8D A;  4GQO A;  4OVJ A;  3IO6 A;  4DXU A;  4G8N A;  1CE2 A;  5H8N A;  1BKA A;  1I6Q A;  2VD2 A;  5H8F A;  1NNK A;  1M5E A;  4IY5 A;  3T9U A;  5KDT A;  4YIC A;  5AA1 A;  1URD A;  1NH7 A;  4GXA A;  2HFB A;  1Y9U A;  4YMB A;  4H5G A;  4R6K A;  3FAS A;  3SER A;  2DE4 A;  1AIV A;  4IO2 A;  1URS A;  3P7I A;  1POY 1;  2RIN A;  1B0L A;  4NED A;  4F1U A;  5I2K A;  1ATG A;  1EH3 A;  1FCK A;  4N6P A;  1OLA A;  3HV1 A;  1RYO A;  3MVZ A;  4LZ5 A;  3SDF A;  4BDQ A;  3PPO A;  1MDP 1;  3KSJ A;  4R72 A;  1LBC A;  4IGT A;  1VSO A;  1HSE A;  4BDN A;  3TAJ A;  4RYA A;  4RXL A;  1WOD A;  5ITP A;  2H9B A;  3B7D A;  3PMX A;  1MG1 A;  3FAT A;  3PPQ A;  4P11 A;  1H76 A;  3IOV A;  5FHM A;  3H06 B;  1H45 A;  1B4H A;  5JK4 A;  2A5T B;  4POX A;  4GF8 A;  3FVK A;  3O66 A;  3QAX A;  3PD9 A;  3K6V A;  3CI8 A;  4F2Q A;  1A99 A;  5I2K B;  3MZ9 A;  3CR9 A;  2DVC A;  3PPN A;  2GH9 A; 
#chains in the Genus database with same CATH topology
 3H7M A;  3LSF B;  1MS7 A;  3JYR A;  4BDR A;  2Z22 A;  4PDH A;  3IOT A;  2OK2 A;  3N5L A;  2Q74 A;  3UOR A;  4I9D A;  1MY2 A;  1POT A;  2VOZ A;  4PET A;  2I3W A;  4U22 A;  3ODB A;  4YB7 A;  1NUX A;  3W9V A;  5I2N A;  4GBV A;  1XS5 A;  1B5H A;  1P1W A;  4EXL A;  2HAU A;  4X1D A;  3T96 B;  3LSX A;  1NFT A;  3ISP A;  1LST A;  1ELJ A;  2Q8M A;  4YB6 A;  3KJT A;  1AL3 A;  5H8Q A;  3FZV A;  2CEX A;  3ILT B;  2HZK A;  3BFU A;  2NWJ A;  1VFD A;  4FED A;  2HQ0 A;  3PPR A;  2GQ1 A;  3S9L C;  2F7A A;  1LFG A;  2UYF A;  4HE2 A;  4YKJ A;  1MPD A;  3OO6 A;  1FBC A;  4JVC A;  1Y3Q A;  1IUD A;  1LLS A;  1GGG A;  1Q35 A;  2RF1 A;  1NV6 A;  3IB2 A;  3TDJ A;  2WBB A;  3FV2 A;  4F1V A;  3VLU A;  1B05 A;  1IMA A;  1D9Q A;  3RUM A;  2AL4 A;  4OEN A;  5HBC A;  4NF6 B;  1RDZ A;  1N3X A;  4U4X A;  3O29 A;  5I2N B;  2NXO A;  4LQ5 A;  3TFL A;  1P1O A;  4LN5 A;  4FBP A;  1O7T A;  3UN6 A;  3TOD A;  2M8C A;  3U93 A;  3FXB A;  5H8Q B;  5L9S A;  1MXV A;  2X26 A;  2WX9 A;  1IXH A;  4NQ8 A;  2OJT A;  4PFY A;  3QK6 A;  4N8G A;  2UXA A;  1XOC A;  1JW5 A;  5ELV A;  3SEW A;  3IX1 A;  4MHF A;  1BP5 A;  3D1R A;  1FQE A;  1B7H A;  1ZTY A;  2ZYM A;  3K1M A;  1R9Q A;  3EHU A;  1MH3 A;  2ZZX A;  5FHO A;  4X9T A;  3K0V A;  1SI0 A;  3CG3 A;  3VV5 A;  5EQ8 A;  2XXY A;  2BJJ X;  1IXC A;  3E13 X;  1JEV A;  3TTL A;  3TTR A;  2QVV A;  3LBS A;  2PVU A;  2DWA A;  3D4G A;  1NKX A;  1PBQ A;  4EDP A;  5JEI A;  3IO4 A;  1VFE A;  2OWS A;  4FAT A;  5KCJ B;  1A7L A;  2YPN A;  4O8M A;  2I6E A;  1NV1 A;  5DT6 A;  3FD3 A;  4ESX A;  5IZ3 B;  1S9T A;  2GHA A;  5EQ7 A;  2QMW A;  2I49 A;  5IAI A;  4TLL B;  2FIE A;  2LAO A;  3U92 A;  4KYS A;  2OWT A;  3PTY A;  2UVJ A;  3ILU B;  2PCR A;  3U94 A;  1ZJL A;  1MQH A;  4H67 A;  3VFJ A;  1NI9 A;  1AMF A;  4R2F A;  1KWH A;  4N6K A;  4F3S A;  4X48 A;  3KEI A;  5TP9 A;  1NUY A;  2QS2 A;  3K6U A;  1GR2 A;  3IOU A;  2O84 X;  4U4S A;  2CEY A;  4GIZ A;  5B70 A;  4KXP A;  2ZNU A;  1IXG A;  4P0I A;  5AA4 A;  1FPL A;  3N26 A;  3RGY A;  4OVS A;  2QMX A;  5ET8 A;  2VHA A;  1FJ9 A;  3TPA A;  3UIF A;  1D3K A;  3ZSF A;  4NF8 B;  3H03 A;  3U8Q A;  5B7D A;  1PDA A;  4OZ9 A;  4G4P A;  1YZ0 A;  4JWX A;  4NE4 A;  3RLF E;  5TPA A;  1A54 A;  4MX6 A;  2XXI A;  3PU5 A;  4OER A;  2XXK A;  2OBG A;  4X04 A;  4MH5 A;  4KYD A;  4ND9 A;  3MAM A;  4R6Y A;  2Y7I A;  4DXC A;  2V25 A;  1MPC A;  4PQJ A;  2PFZ A;  3A09 A;  4HE1 A;  1MXZ A;  1I69 A;  4ZE8 A;  3M3L A;  5H8H A;  4O7M A;  4IO5 A;  1ZLQ A;  5EYG A;  4U1Z A;  1XVY A;  3TQW A;  4GLI A;  4OTE A;  4XFE A;  2WEF A;  3MVX A;  4AB6 A;  1B3L A;  2Z8F A;  1I6B A;  5ISU A;  2VP1 A;  1N04 A;  4U23 A;  4LVQ A;  3QUF A;  2KQZ A;  5AA4 B;  1UTB B;  1DPP A;  4OFJ A;  1G0H A;  1D4N A;  2HHM A;  4R9F A;  4ZEF A;  3TKD A;  3R26 A;  4ZDM A;  2O7I A;  3PUX E;  3OO9 A;  1N3W A;  2F97 A;  2OCU A;  1LFI A;  5TPA B;  4JB7 A;  3S2V A;  4PFI A;  3KJ7 A;  2VT5 A;  2O6A A;  4GL0 A;  3CFX A;  2UYE A;  4ONY A;  3HFU A;  1D9V A;  4OEV A;  2O1L A;  4JXI A;  4OVP A;  1DTZ A;  1LAX A;  3RPL B;  1DSN A;  1URG A;  2RC8 A;  3O2A A;  2X7P A;  2XA5 A;  5DVI A;  1EYI A;  2DE3 A;  3EQ1 A;  3ROJ A;  5AA2 B;  3MP6 A;  2F5X A;  1S7Y A;  4UA8 A;  2ZYK A;  1FQF A;  1FTL A;  1JEU A;  2ZXT A;  4MAG A;  1NV2 A;  3MPL A;  1CB6 A;  1LBZ A;  5EQA A;  4OFL A;  2BJI A;  3JZJ A;  1TFD A;  4N91 A;  3MW0 A;  4NF5 B;  4RA1 A;  4MNI A;  2F6G A;  2H99 A;  1FBH A;  4ZEK A;  4FEC A;  2R71 A;  3CVG A;  3Q27 A;  1FTJ A;  1AH5 A;  4GWW A;  2WKY A;  2B3F A;  4PBQ A;  5ET7 A;  4NF4 A;  4H65 A;  1LBX A;  2OWZ A;  4GOT A;  3RQT A;  3UGW A;  3PUW E;  3GBB A;  4QSC A;  3G3F A;  1FSA A;  3UA8 A;  1HSJ A;  3O6I A;  4O94 A;  1BLF A;  1RKM A;  2QRY A;  3I6V A;  3HO7 A;  3KN3 A;  1FBG A;  1MXX A;  2GRV A;  3HPI A;  3T9X B;  5I58 B;  1XT8 A;  2F78 A;  1FQC A;  3CG1 A;  3R7X A;  3QYT A;  2DS9 A;  3N94 A;  4F3G A;  4KPT A;  2ALU A;  5A5X A;  3Q28 A;  5AE4 A;  4P8B A;  4WXJ A;  2XXT A;  4ZZA A;  4GWZ A;  4LA9 A;  3Q26 A;  4GWO A;  2P2A A;  2XX7 A;  1NV7 A;  5CC2 A;  4Q30 B;  3TUS A;  2DOJ A;  4KI0 E;  1DCU A;  4MNP A;  1MXY A;  5H8N B;  1A40 A;  1USY E;  2ANJ A;  1B2H A;  3K01 A;  4NX1 A;  4RPO A;  3FV1 A;  4PCD A;  1MQI A;  5H8F B;  3SEX A;  4WED A;  2R9J A;  5KDT B;  3KC0 A;  4U2R A;  2F6P A;  3MVW A;  3MZB A;  4OQO A;  5I59 A;  1MM7 A;  3THI A;  4GX6 A;  2ABH A;  3SKP A;  3B6W A;  3OEK A;  2XD3 A;  5CMK A;  3FJM A;  1B3E A;  3C36 A;  1K9Z A;  1Z7N E;  1SI1 A;  3UP9 A;  3MP1 A;  5A5X B;  3VLW A;  1YCJ A;  2IEE A;  5ET6 A;  2XXQ A;  4EXK A;  3AXF A;  4PE5 B;  3IOW A;  5CMM A;  2REG A;  2WYP A;  5DEX A;  5K2X A;  2ONK E;  1A55 A;  1DTG A;  2DWH A;  1D9Y A;  1VE4 A;  2REJ A;  1NNP A;  2DVZ A;  5DTB A;  4R6H A;  4H5F A;  1R1N A;  1VR5 A;  2HCA A;  4LUB A;  1DBZ A;  1UIU A;  4N07 A;  1UIV A;  5DYH A;  3VDF A;  1YAE A;  1EZ9 A;  5I59 B;  3B50 A;  4MIJ A;  4E0W A;  2PT2 A;  2AL5 A;  3C34 A;  4YKI A;  2NOO A;  3OSR A;  4HCW A;  4GL8 A;  4IO4 A;  4XKP A;  2AIX A;  4U21 A;  4MLV A;  5I7I A;  2OX3 A;  1SYH A;  1US5 A;  2XHD A;  3BIG A;  3SEY A;  3B6Q A;  1N76 A;  3MJN A;  3M3F A;  2B3B A;  4GD5 A;  3EN3 A;  4Q5T A;  1NUZ A;  2D21 A;  4OVQ A;  2IA4 A;  2Q88 A;  3PMW A;  3KBZ A;  2XWI A;  1US4 A;  3Q25 A;  5EQ9 A;  3K00 A;  3TCG A;  1QKA A;  2Q89 A;  4PF8 A;  3PUZ E;  1N84 A;  4YU0 A;  1FPE A;  2PT1 A;  4RK9 A;  3FGS A;  4OET A;  1LBB A;  1SVX B;  3MWB A;  1IMF A;  5LDZ A;  3ZKK A;  1FPK A;  1QUK A;  3O28 A;  1ZBM A;  2DE2 A;  3CFZ A;  1AOV A;  1Y4C A;  4M1V A;  5HPQ A;  5FTH A;  1B5I A;  2O69 A;  3S9N C;  2XXP A;  1SBP A;  1Y1M A;  4YAH X;  4R9G A;  1FPD A;  4KHZ E;  1FBF A;  2F34 A;  4X1B A;  3FJ7 A;  3H6W A;  2HEU A;  3C4M A;  4MNC A;  5ET5 A;  4MJO A;  3JV9 A;  2KLF A;  2RKM A;  2UVH A;  3EHT A;  4QFN A;  3U65 A;  3RNN A;  4U1O A;  4F29 A;  2ONS A;  1B6H A;  5I84 A;  4XKN A;  2Z23 A;  1OIB A;  4GVO A;  1JW4 A;  4R2B A;  4DE8 A;  4TLM B;  4ELO A;  4OVT A;  3M3K A;  3DLN A;  1FW0 A;  1XC1 A;  2Z8E A;  1IME A;  3C33 A;  4DCX A;  4KCD A;  1LAH E;  4NWD A;  1O64 A;  2P3N A;  1A8F A;  3LR1 A;  1II5 A;  4IY6 A;  5I56 A;  5JTY A;  3HST A;  3GXA A;  4MCO A;  1PB7 A;  2I0C A;  5IGA A;  3G7W A;  1WVJ A;  3H6U A;  1IMC A;  3O9P A;  3I3V A;  4MFI A;  1P99 A;  1ANF A;  4BLA A;  1B9J A;  3DEL B;  4OAN A;  4EQ9 A;  3E3K A;  4PAF A;  1B32 A;  1QGX A;  4P9K A;  3CSG A;  4MMP A;  4FEB A;  5EHM A;  4ZED A;  3O6G A;  4OWD A;  4QSE A;  5L9M A;  5LTC A;  3GYY A;  1RDY A;  2VGQ A;  1JVY A;  3DP6 A;  4HCY A;  3RT6 B;  5L8D A;  1N7X A;  3T9V A;  4PC9 A;  3MYU A;  2ESN A;  3E79 A;  2QVU A;  4QHQ A;  4ZS9 A;  3MUQ A;  1IMD A;  1MY4 A;  1AWB A;  4G8M A;  4AQ4 A;  1B5J A;  4G8H A;  3UK4 A;  4XXU A;  4EF1 A;  4ZZE A;  1T0K A;  1NV3 A;  2FIX A;  2THI A;  1B7U A;  2Y5K A;  4YKK A;  4PFU A;  1O63 A;  3G3I A;  3FVG A;  4ELQ A;  2I0B A;  4N8Y A;  3VVF A;  1CNQ A;  3EF7 A;  3IL1 B;  2P1S A;  1H44 A;  2Z8D A;  4LQ2 A;  2H4I A;  3CIJ A;  1LAF E;  2V4C A;  1FTK A;  1INP A;  1F9B A;  4K3F A;  1B7Z A;  5EHS A;  1SW5 A;  3USD A;  3OEL A;  4NGU A;  3BFT A;  3PV0 E;  4L17 A;  2G93 A;  4BDO A;  2V3Q A;  2Q9T A;  1SW1 A;  1B51 A;  2FHY A;  1NV5 A;  1B1H A;  4OES A;  5I57 A;  5CI5 A;  3KG2 A;  4I3E A;  5H8S A;  4F2O A;  3FBP A;  4ELP A;  2PBW A;  4NMY A;  5FHN A;  2Q2A A;  2I3V A;  1TWY A;  1WDN A;  2F7C A;  1OMP A;  3KOS A;  4YB5 A;  5BWJ A;  5TP9 B;  3G3J A;  2Y5L A;  1MH4 A;  3KN7 A;  2QS3 A;  1NV4 A;  5CMB A;  3D4C A;  4F31 B;  1B3F A;  2CZK A;  4PFR A;  4PFT A;  1FQA A;  4H6D A;  4I1D A;  3TTN A;  1RDX A;  5K2Y A;  3C9H A;  3H6V A;  3MZ1 A;  2PYY A;  4ZEC A;  4XF5 A;  4RY1 A;  3W15 C;  5CMC A;  5F1Q A;  3H4Z A;  1BIY A;  5IZ1 A;  4OYV A;  1MRP A;  1KZ8 A;  5IM2 A;  2P3V A;  1Y3N A;  2D3I A;  2FNC A;  1M5D A;  2XXR A;  5BUU A;  2RCA A;  3TEP A;  2HAV A;  4HTG A;  4I3Y A;  4IB2 A;  1GVC A;  5I57 B;  3OSQ A;  1H3D A;  3OOA A;  4QRZ A;  4AS5 A;  1FJ6 A;  5H8H B;  3RPW A;  4QBA A;  1H43 A;  2CZL A;  1FTM A;  4EQ7 A;  1PC3 A;  1MM6 A;  4UAC A;  2H98 A;  1EU8 A;  2YLN A;  4OHN A;  4N17 A;  2O1M A;  4XKR A;  1IIW A;  2R8T A;  4PGN A;  2I48 A;  4LP2 B;  4X8R A;  1TXF A;  2G29 A;  2P0S A;  1Q9D A;  4R75 A;  1UQW A;  3ECR A;  2XXW A;  4JBZ A;  3OEN A;  1YTV A;  2OLB A;  1B4Z A;  1LCT A;  4LZ8 A;  3FIR A;  5M2V A;  3OD7 A;  2QVR A;  3S9E A;  1LAG E;  1USY H;  1MQG A;  4PDD A;  1FQB A;  3QSL A;  1SD3 A;  4O3B A;  4RPN A;  3VXC A;  2RC9 A;  3KFM A;  4O3C A;  2E1S A;  2YJP A;  3NOH A;  4Q0C A;  3U72 A;  4H8I A;  1IQ7 A;  3LV0 A;  1FPF A;  4JWO A;  4AS4 A;  2Q2C A;  3GZG A;  3EHS A;  1LBV A;  1RYX A;  2XXU A;  2XXH A;  5ESY A;  3ZKL A;  1IZ1 A;  3H3G A;  3KC1 A;  3IR1 A;  3QMF A;  1LFH A;  3V89 B;  1Y4T A;  3IK6 B;  1UTH A;  4OA4 A;  4IO3 A;  3MPK A;  3A3C A;  2O68 A;  4DI4 B;  2Y7P A;  2DWI A;  1JQF A;  3MQ9 A;  3IB0 A;  4G2Z A;  1EYK A;  3DP8 A;  3ONM A;  4POW A;  3PUY E;  4G77 A;  2A5T A;  4TQU Q;  1L5T A;  1IEJ A;  4XIG Q;  2E0S A;  3MVY A;  2DDK A;  3OO7 A;  1FPI A;  1P1N A;  1JNF A;  1LBW A;  3IFA A;  3K1N A;  3RYD A;  4PP0 A;  4P3L A;  3KZG A;  1JW1 A;  2Y7R A;  3OMB A;  4LZ7 A;  4NF4 B;  2NVU B;  4P47 A;  2R6G E;  3B8B A;  1SYI A;  3K2D A;  4I8C A;  3VVD A;  4H1X A;  5CBR A;  2WYK A;  1PEB A;  1Z7M E;  3L6H A;  3K02 A;  3W9W A;  1UTH B;  2V3T A;  4HE0 A;  1MY1 A;  2ZMB A;  1EZP A;  2HXR A;  2QSX A;  2DQV A;  5ITO A;  1YXI A;  1ZU0 A;  4RNS A;  1SDX A;  1Y20 A;  5A5L A;  4LAT A;  3TTK A;  3TYH A;  3VVE A;  4LON B;  2RCB A;  2ZNT A;  3PPP A;  3LSL A;  4FAJ A;  4HS7 A;  5I5P A;  2JJK A;  1JVX A;  2CZH A;  2MKZ A;  5J1D A;  4GWY A;  3CFL A;  3SES A;  1S50 A;  2XXV A;  3LUY A;  3OEM A;  1M5F A;  3K6W A;  1QJM A;  3DP4 A;  4H0W A;  4Z0I A;  4ESW A;  1EZO A;  3KBR A;  4G68 A;  1ZMG A;  1B1X A;  3I5O A;  1BK4 A;  1Y3P A;  2X7Q A;  4FJP A;  4IO7 A;  2QPQ A;  3RT8 A;  3TCH A;  4DI3 D;  1TFA A;  3E9X A;  1OQH A;  4MEV A;  4XEQ A;  3HHF A;  4RK2 A;  5IKB A;  3K4U A;  2V93 A;  4EQB A;  4GX3 A;  5LOM A;  5I3S A;  2UVG A;  3C31 A;  5ICT A;  4I40 A;  3C35 A;  2ZYN A;  4KYE A;  3V8X B;  4NF6 A;  4PF6 A;  4KCC A;  1EYJ A;  1YPN A;  1FPG A;  5CRY A;  1QKB A;  3V83 A;  3EPE A;  3KN8 A;  3SEV A;  3LUZ A;  3CHG A;  4AB5 A;  2I58 A;  1B52 A;  4IO6 A;  3E4R A;  1JET A;  2HZL A;  4N15 A;  3BBR A;  3C32 A;  4G68 B;  5DEX B;  4JSD A;  2DP8 A;  1PB9 A;  4Q8R A;  5CM6 A;  2VD3 A;  3T0J A;  4JVI A;  5DVJ A;  4BDL A;  1GTK A;  1XVX A;  2QL3 A;  4DDD A;  4QF9 A;  3QXM A;  2Q8J A;  1N0T A;  1FTA A;  3A29 A;  1QUJ A;  4OXV A;  3T9H B;  3T66 A;  1MDQ A;  2F35 A;  4F1Y A;  1J1N A;  2O7U A;  4PE3 A;  1PBP A;  1TT1 A;  4NWC A;  1YYZ A;  3IJO B;  2AYS A;  3ZS6 A;  1R6Z A;  1FBD A;  3TQL A;  4WKM A;  4OFO A;  4R74 A;  4PGP A;  3MBP A;  3R6U A;  4YMA A;  3S9M C;  4DXB A;  3G3H A;  2CZI A;  1LCF A;  3O97 A;  3MP8 A;  3G3K A;  4EUO A;  4H46 A;  4DZ1 A;  4H45 A;  2RC7 A;  2XD2 A;  3B6T A;  1OVB A;  1B46 A;  3FVO A;  1B58 A;  3HN0 A;  2KR0 A;  3H6T A;  4QXD A;  1DK4 A;  5KCJ A;  2QS4 A;  5IZ3 A;  5F24 A;  1GV8 A;  5FTI A;  4QFK A;  3LSW A;  4QFP A;  3PMV A;  5EYF A;  1FBP A;  3TCF A;  2V84 A;  3WAF A;  1NUW A;  2D5W A;  4YKP A;  4GRK A;  2GHB A;  4MLQ A;  3K1P A;  1ZKB A;  4C0R A;  1MQD A;  3FXR A;  2Y84 A;  3CSB A;  2ONR A;  4PFB A;  3PD8 A;  5DVF A;  1QVS A;  2FYI A;  3F11 A;  1LGB C;  1M5B A;  2F7B A;  4NAP A;  2FVZ A;  1LB9 A;  2PMS A;  1MPB A;  4QFO A;  3IAZ A;  4JVD A;  1SPI A;  4NTL A;  4HXV A;  4F18 A;  4C1T A;  4OVR A;  2ZYO A;  4I62 A;  4GWU A;  1SW2 A;  4GXS B;  4GWS A;  3KGC A;  4O3A A;  1Q1K A;  2XWV A;  4KD5 A;  2B4L A;  3CRB A;  2F3D A;  3TZA A;  4E0X A;  2PFY A;  1HSL A;  3WAE A;  1FPJ A;  2DWJ A;  4NF8 A;  4N6D A;  4BDM A;  1R9L A;  1DMB A;  5ICQ A;  2A5S A;  3LC8 A;  1B3G A;  3RTW B;  3PGF A;  3FVN A;  4DLD A;  4UAB A;  1B40 A;  4WEP A;  2XX8 A;  4ZEI A;  4F3P A;  3VLV A;  1OQG A;  1K9Y A;  2DSF A;  5I56 B;  4YZZ A;  1KA0 A;  1IMB A;  3A3U A;  3TMG A;  2FA7 A;  2UVI A;  1MXU A;  3N6T A;  2OZZ A;  5EYH A;  5JTY B;  4NF0 A;  1FPB A;  3K6X A;  2B4M A;  2QJE A;  3IJX B;  5KZT A;  2XXX A;  2XWK A;  5F7V A;  2NUV A;  1P1U A;  4F22 A;  3FXQ A;  3N6U A;  1LEV A;  1LBY A;  4MBP A;  4Z7E A;  1UTB A;  3E78 A;  4C1U A;  2W7Y A;  4DCY A;  3TEL A;  3VE1 B;  2I4C A;  4KFQ A;  2PX1 A;  1SQY A;  1NL5 A;  1FTO A;  1DPE A;  5T3J A;  3MC2 A;  1FQD A;  1P1Q A;  4N13 A;  3TTM A;  1IIT A;  3RN8 A;  3OO8 A;  3QIM A;  5DW8 A;  3KOT A;  1MQJ A;  4TOZ A;  2VPN A;  1BTJ A;  2L5V A;  3HHG A;  4THI A;  4PAK A;  1QUI A;  4RJZ A;  4P1E A;  3VXB A;  4ZE9 A;  3T1B A;  4GFR A;  5AA2 D;  1M5C A;  4ISU A;  1JP4 A;  5CBS A;  5TU0 A;  4DIG A;  4R73 A;  4ZEB A;  4NN3 A;  3RPL A;  3U1O A;  3S4U A;  3QUJ A;  2VPO A;  4HW8 A;  1MY0 A;  2F36 A;  3FXU A;  3L6G A;  4FE8 A;  1Y1Z A;  4QSD A;  4F19 A;  3O6H A;  5AA3 A;  4JWY A;  1NH8 A;  4EF2 A;  3SEU A;  5AA2 A;  5HM4 B;  1FBE A;  1SW4 A;  4IGR A;  4P1L A;  2XX9 A;  4XTC Q;  4OEU A;  4H8J A;  5L9O A;  3BKI B;  4ECF A;  4GX4 A;  1A8E A;  1B3H A;  1NNF A;  4G68 C;  4NG7 A;  2WBD A;  2O51 A;  3SZP A;  4FOR A;  3RY3 A;  4OMB A;  3KSX A;  1XHY A;  2GFE A;  4F39 A;  2H25 A;  3V5A A;  3GBA A;  4NF5 A;  4XKQ A;  2DXR A;  1I6A A;  4NHB A;  4PAI A;  4F3B A;  1LB8 A;  4PFW A;  2ZNS A;  1DOT A;  3T22 A;  2B65 A;  4M4G A;  1B0H A;  4ELR A;  1FRP A;  3OXN A;  1NMU A;  4MF3 A;  2CMO A;  2HXW A;  2Y7W A;  1NNT A;  1QW0 A;  1N7W A;  4JDF A;  1IXI A;  2DYX A;  3G3G A;  1G0I A;  4N81 A;  3DM0 A;  1MY3 A;  3IOR A;  5I58 A;  4P0G A;  3T93 B;  1OVT A;  3IB1 A;  3HCQ A;  2F3B A;  3PUV E;  2HPG A;  4QFL A;  3FUZ A;  1VDW A;  3SET A;  1PB8 A;  2V3U A;  1ZIU A;  4KQP A;  2Y7K A;  3GLB A;  3Q29 A;  4FIM A;  2DXY A;  4IR8 A;  3RTF B;  1OLC A;  2I4B A;  4KR5 A;  2H5Y A;  3M8U A;  2QS1 A;  3FJG A;  1QUL A;  4JSO A;  1MXW A;  2F8D A;  4GQO A;  4OVJ A;  3IO6 A;  4DXU A;  4G8N A;  1CE2 A;  2ZZV A;  5H8N A;  1KA1 A;  1BKA A;  1I6Q A;  2VD2 A;  5H8F A;  1NNK A;  1M5E A;  4IY5 A;  3T9U A;  5J16 A;  5KDT A;  3BIH A;  4YIC A;  5AA1 A;  1URD A;  1NH7 A;  3EKI A;  4GXA A;  2HFB A;  4PTK A;  1Y9U A;  4YMB A;  4H5G A;  4R6K A;  3FAS A;  3MST A;  3SER A;  2DE4 A;  1AIV A;  4IO2 A;  1URS A;  3P7I A;  1POY 1;  2RIN A;  4O7I A;  1B0L A;  5FBP A;  5IZZ A;  4GBW A;  4NED A;  4F1U A;  1NV0 A;  5I2K A;  1ATG A;  1EH3 A;  1FCK A;  4N6P A;  1OLA A;  3HV1 A;  2QFL A;  2ZZW A;  1RYO A;  3MVZ A;  4LZ5 A;  3SDF A;  4BDQ A;  3PPO A;  1MDP 1;  3KSJ A;  2FBP A;  4R72 A;  1LBC A;  4IGT A;  1VSO A;  1HSE A;  4BDN A;  4N4U A;  3TAJ A;  4RYA A;  4RXL A;  1WOD A;  5ITP A;  2H9B A;  3B7D A;  3PMX A;  4GWX A;  1MG1 A;  3FAT A;  3PPQ A;  4P11 A;  1H76 A;  3IOV A;  4G61 A;  1XI6 A;  5FHM A;  3H06 B;  1H45 A;  1B4H A;  5JK4 A;  2A5T B;  4POX A;  4GF8 A;  3FVK A;  3O66 A;  3QAX A;  3PD9 A;  3K6V A;  4P56 A;  3CI8 A;  4F2Q A;  4PBH A;  1A99 A;  5I2K B;  3MZ9 A;  3IFC A;  3CR9 A;  2DVC A;  2XWO A;  3PPN A;  2GH9 A; 
#chains in the Genus database with same CATH homology
 3H7M A;  3LSF B;  1MS7 A;  3JYR A;  4BDR A;  2Z22 A;  3IOT A;  2OK2 A;  3N5L A;  3UOR A;  4I9D A;  1MY2 A;  1POT A;  2VOZ A;  4PET A;  2I3W A;  4U22 A;  3ODB A;  4YB7 A;  3W9V A;  5I2N A;  1XS5 A;  1B5H A;  1P1W A;  4EXL A;  2HAU A;  4X1D A;  3T96 B;  3LSX A;  1NFT A;  1LST A;  1ELJ A;  4YB6 A;  3KJT A;  1AL3 A;  5H8Q A;  3FZV A;  3ILT B;  2HZK A;  3BFU A;  2NWJ A;  1VFD A;  4FED A;  2HQ0 A;  3PPR A;  3S9L C;  2F7A A;  1LFG A;  2UYF A;  4YKJ A;  1MPD A;  3OO6 A;  1Y3Q A;  1IUD A;  1LLS A;  1GGG A;  1Q35 A;  2RF1 A;  3IB2 A;  3TDJ A;  3FV2 A;  4F1V A;  3VLU A;  1B05 A;  3RUM A;  2AL4 A;  4OEN A;  5HBC A;  4NF6 B;  1N3X A;  4U4X A;  3O29 A;  5I2N B;  2NXO A;  4LQ5 A;  3TFL A;  1P1O A;  1O7T A;  3UN6 A;  3TOD A;  2M8C A;  3U93 A;  5H8Q B;  5L9S A;  1MXV A;  2X26 A;  1IXH A;  2OJT A;  4PFY A;  3QK6 A;  2UXA A;  1XOC A;  1JW5 A;  5ELV A;  3SEW A;  3IX1 A;  1BP5 A;  1FQE A;  1B7H A;  1ZTY A;  2ZYM A;  3K1M A;  1R9Q A;  3EHU A;  1MH3 A;  5FHO A;  4X9T A;  3K0V A;  1SI0 A;  3CG3 A;  3VV5 A;  2XXY A;  2BJJ X;  1IXC A;  3E13 X;  1JEV A;  3TTL A;  3TTR A;  3LBS A;  2PVU A;  2DWA A;  3D4G A;  1NKX A;  1PBQ A;  4EDP A;  5JEI A;  3IO4 A;  1VFE A;  2OWS A;  4FAT A;  5KCJ B;  1A7L A;  2YPN A;  2I6E A;  5DT6 A;  3FD3 A;  4ESX A;  1S9T A;  2GHA A;  2QMW A;  2I49 A;  5IAI A;  4TLL B;  2LAO A;  3U92 A;  4KYS A;  2OWT A;  2UVJ A;  3ILU B;  3U94 A;  1ZJL A;  1MQH A;  4H67 A;  3VFJ A;  1AMF A;  4R2F A;  1KWH A;  4F3S A;  4X48 A;  3KEI A;  5TP9 A;  2QS2 A;  3K6U A;  1GR2 A;  3IOU A;  2O84 X;  4U4S A;  4GIZ A;  5B70 A;  2ZNU A;  1IXG A;  4P0I A;  5AA4 A;  3N26 A;  3RGY A;  2QMX A;  2VHA A;  3TPA A;  3UIF A;  1D3K A;  3ZSF A;  4NF8 B;  3H03 A;  3U8Q A;  5B7D A;  1PDA A;  4OZ9 A;  4G4P A;  4JWX A;  4NE4 A;  3RLF E;  5TPA A;  1A54 A;  2XXI A;  3PU5 A;  4OER A;  2OBG A;  4MH5 A;  4KYD A;  4ND9 A;  3MAM A;  4R6Y A;  2Y7I A;  4DXC A;  2V25 A;  1MPC A;  4PQJ A;  3A09 A;  1MXZ A;  1I69 A;  4ZE8 A;  3M3L A;  5H8H A;  4IO5 A;  1ZLQ A;  4U1Z A;  1XVY A;  3TQW A;  4GLI A;  4OTE A;  3MVX A;  4AB6 A;  1B3L A;  2Z8F A;  1I6B A;  5ISU A;  2VP1 A;  1N04 A;  4U23 A;  4LVQ A;  3QUF A;  5AA4 B;  1UTB B;  1DPP A;  4OFJ A;  1D4N A;  4R9F A;  4ZEF A;  3TKD A;  3R26 A;  4ZDM A;  2O7I A;  3PUX E;  3OO9 A;  1N3W A;  2F97 A;  2OCU A;  1LFI A;  5TPA B;  4JB7 A;  3S2V A;  3KJ7 A;  2O6A A;  4GL0 A;  3CFX A;  2UYE A;  4ONY A;  1D9V A;  4OEV A;  2O1L A;  4JXI A;  1DTZ A;  1LAX A;  1DSN A;  1URG A;  2RC8 A;  3O2A A;  2X7P A;  5DVI A;  2DE3 A;  3EQ1 A;  5AA2 B;  3MP6 A;  2F5X A;  1S7Y A;  4UA8 A;  2ZYK A;  1FQF A;  1FTL A;  1JEU A;  2ZXT A;  3MPL A;  1CB6 A;  4OFL A;  3JZJ A;  1TFD A;  3MW0 A;  4NF5 B;  4RA1 A;  2F6G A;  2H99 A;  4ZEK A;  4FEC A;  2R71 A;  3CVG A;  3Q27 A;  1FTJ A;  1AH5 A;  2WKY A;  2B3F A;  4NF4 A;  4H65 A;  4GOT A;  3RQT A;  3UGW A;  3PUW E;  3GBB A;  4QSC A;  3G3F A;  3UA8 A;  1HSJ A;  3O6I A;  1BLF A;  1RKM A;  2QRY A;  3I6V A;  3HO7 A;  3KN3 A;  1MXX A;  2GRV A;  3HPI A;  3T9X B;  5I58 B;  1XT8 A;  2F78 A;  1FQC A;  3CG1 A;  3R7X A;  3QYT A;  2DS9 A;  3N94 A;  4F3G A;  4KPT A;  2ALU A;  5A5X A;  3Q28 A;  5AE4 A;  4WXJ A;  2XXT A;  4ZZA A;  4LA9 A;  3Q26 A;  4GWO A;  2P2A A;  2XX7 A;  5CC2 A;  4Q30 B;  3TUS A;  2DOJ A;  4KI0 E;  1MXY A;  5H8N B;  1A40 A;  1USY E;  2ANJ A;  1B2H A;  3K01 A;  4RPO A;  3FV1 A;  1MQI A;  5H8F B;  3SEX A;  4WED A;  2R9J A;  5KDT B;  4U2R A;  2F6P A;  3MVW A;  3MZB A;  4OQO A;  5I59 A;  1MM7 A;  3THI A;  2ABH A;  3SKP A;  3B6W A;  3OEK A;  2XD3 A;  5CMK A;  3FJM A;  1B3E A;  3C36 A;  1Z7N E;  1SI1 A;  3UP9 A;  3MP1 A;  5A5X B;  3VLW A;  1YCJ A;  2IEE A;  2XXQ A;  4EXK A;  3AXF A;  4PE5 B;  3IOW A;  5CMM A;  2REG A;  5DEX A;  5K2X A;  2ONK E;  1A55 A;  1DTG A;  2DWH A;  1D9Y A;  1VE4 A;  2REJ A;  1NNP A;  2DVZ A;  5DTB A;  4R6H A;  4H5F A;  1R1N A;  1VR5 A;  2HCA A;  4LUB A;  1UIU A;  4N07 A;  1UIV A;  5DYH A;  3VDF A;  1YAE A;  1EZ9 A;  5I59 B;  4E0W A;  2PT2 A;  2AL5 A;  3C34 A;  4YKI A;  2NOO A;  3OSR A;  4HCW A;  4GL8 A;  4IO4 A;  4XKP A;  2AIX A;  4U21 A;  4MLV A;  1SYH A;  1US5 A;  2XHD A;  3SEY A;  3B6Q A;  1N76 A;  3MJN A;  3M3F A;  2B3B A;  4GD5 A;  3EN3 A;  4Q5T A;  2D21 A;  2IA4 A;  2Q88 A;  3PMW A;  1US4 A;  3Q25 A;  3K00 A;  3TCG A;  1QKA A;  2Q89 A;  3PUZ E;  1N84 A;  4YU0 A;  2PT1 A;  4RK9 A;  3FGS A;  4OET A;  1LBB A;  1SVX B;  3MWB A;  3ZKK A;  1QUK A;  3O28 A;  1ZBM A;  2DE2 A;  3CFZ A;  1AOV A;  1Y4C A;  4M1V A;  5HPQ A;  5FTH A;  1B5I A;  2O69 A;  3S9N C;  2XXP A;  1SBP A;  1Y1M A;  4YAH X;  4R9G A;  4KHZ E;  2F34 A;  4X1B A;  3FJ7 A;  3H6W A;  2HEU A;  3C4M A;  3JV9 A;  2KLF A;  2RKM A;  2UVH A;  3EHT A;  4QFN A;  3RNN A;  4U1O A;  4F29 A;  2ONS A;  1B6H A;  5I84 A;  4XKN A;  2Z23 A;  1OIB A;  4GVO A;  1JW4 A;  4R2B A;  4DE8 A;  4TLM B;  4ELO A;  3M3K A;  3DLN A;  1FW0 A;  1XC1 A;  2Z8E A;  3C33 A;  4DCX A;  4KCD A;  1LAH E;  4NWD A;  1O64 A;  1A8F A;  3LR1 A;  1II5 A;  4IY6 A;  5I56 A;  5JTY A;  3HST A;  3GXA A;  1PB7 A;  2I0C A;  3G7W A;  1WVJ A;  3H6U A;  3O9P A;  3I3V A;  4MFI A;  1P99 A;  4BLA A;  1ANF A;  1B9J A;  3DEL B;  4EQ9 A;  3E3K A;  1B32 A;  3CSG A;  4FEB A;  5EHM A;  4ZED A;  3O6G A;  4OWD A;  4QSE A;  5L9M A;  2VGQ A;  1JVY A;  3DP6 A;  4HCY A;  3RT6 B;  5L8D A;  1N7X A;  3T9V A;  2ESN A;  4QHQ A;  4ZS9 A;  3MUQ A;  1MY4 A;  4G8M A;  4AQ4 A;  1B5J A;  4G8H A;  3UK4 A;  4XXU A;  4EF1 A;  4ZZE A;  1T0K A;  2THI A;  1B7U A;  4YKK A;  4PFU A;  1O63 A;  3G3I A;  3FVG A;  4ELQ A;  2I0B A;  3VVF A;  3EF7 A;  3IL1 B;  2P1S A;  1H44 A;  2Z8D A;  4LQ2 A;  2H4I A;  3CIJ A;  1LAF E;  1FTK A;  1F9B A;  4K3F A;  1B7Z A;  5EHS A;  1SW5 A;  3USD A;  3OEL A;  3BFT A;  3PV0 E;  4L17 A;  2G93 A;  4BDO A;  2V3Q A;  2Q9T A;  1SW1 A;  1B51 A;  1B1H A;  4OES A;  5I57 A;  5CI5 A;  3KG2 A;  5H8S A;  4F2O A;  4ELP A;  2PBW A;  4NMY A;  5FHN A;  2Q2A A;  2I3V A;  1TWY A;  1WDN A;  2F7C A;  1OMP A;  3KOS A;  4YB5 A;  5BWJ A;  5TP9 B;  3G3J A;  1MH4 A;  3KN7 A;  2QS3 A;  5CMB A;  3D4C A;  4F31 B;  1B3F A;  4PFT A;  1FQA A;  4H6D A;  4I1D A;  3TTN A;  5K2Y A;  3C9H A;  3H6V A;  3MZ1 A;  2PYY A;  4ZEC A;  4RY1 A;  3W15 C;  5CMC A;  5F1Q A;  3H4Z A;  1BIY A;  4OYV A;  1MRP A;  1Y3N A;  2D3I A;  2FNC A;  1M5D A;  2XXR A;  5BUU A;  2RCA A;  3TEP A;  2HAV A;  4HTG A;  4IB2 A;  1GVC A;  5I57 B;  3OSQ A;  1H3D A;  3OOA A;  4QRZ A;  5H8H B;  3RPW A;  1H43 A;  2CZL A;  1FTM A;  4EQ7 A;  1PC3 A;  1MM6 A;  4UAC A;  2H98 A;  1EU8 A;  2YLN A;  4OHN A;  2O1M A;  4XKR A;  1IIW A;  2I48 A;  4LP2 B;  1TXF A;  2G29 A;  2P0S A;  4R75 A;  1UQW A;  3ECR A;  2XXW A;  4JBZ A;  3OEN A;  1YTV A;  2OLB A;  1B4Z A;  1LCT A;  4LZ8 A;  3FIR A;  5M2V A;  3OD7 A;  3S9E A;  1LAG E;  1USY H;  1MQG A;  1FQB A;  3QSL A;  1SD3 A;  4O3B A;  4RPN A;  3VXC A;  2RC9 A;  3KFM A;  4O3C A;  2E1S A;  2YJP A;  4Q0C A;  3U72 A;  4H8I A;  1IQ7 A;  4JWO A;  2Q2C A;  3GZG A;  3EHS A;  1RYX A;  2XXU A;  2XXH A;  3ZKL A;  1IZ1 A;  3H3G A;  3IR1 A;  1LFH A;  3V89 B;  1Y4T A;  3IK6 B;  1UTH A;  4IO3 A;  3MPK A;  3A3C A;  2O68 A;  2Y7P A;  2DWI A;  1JQF A;  3MQ9 A;  3IB0 A;  4G2Z A;  3DP8 A;  3ONM A;  4POW A;  3PUY E;  4G77 A;  2A5T A;  4TQU Q;  1L5T A;  1IEJ A;  4XIG Q;  2E0S A;  3MVY A;  3OO7 A;  1P1N A;  1JNF A;  3K1N A;  4PP0 A;  3KZG A;  1JW1 A;  2Y7R A;  3OMB A;  4LZ7 A;  4NF4 B;  2NVU B;  2R6G E;  1SYI A;  3K2D A;  4I8C A;  3VVD A;  4H1X A;  5CBR A;  1PEB A;  1Z7M E;  3L6H A;  3K02 A;  3W9W A;  1UTH B;  2V3T A;  1MY1 A;  2ZMB A;  1EZP A;  2QSX A;  2DQV A;  5ITO A;  1ZU0 A;  4RNS A;  1SDX A;  1Y20 A;  4LAT A;  3TTK A;  3TYH A;  3VVE A;  4LON B;  2RCB A;  2ZNT A;  3PPP A;  3LSL A;  4FAJ A;  4HS7 A;  1JVX A;  5J1D A;  3CFL A;  3SES A;  1S50 A;  2XXV A;  3LUY A;  3OEM A;  1M5F A;  3K6W A;  1QJM A;  3DP4 A;  4H0W A;  4Z0I A;  4ESW A;  1EZO A;  3KBR A;  4G68 A;  1ZMG A;  1B1X A;  3I5O A;  1Y3P A;  2X7Q A;  4FJP A;  4IO7 A;  2QPQ A;  3RT8 A;  3TCH A;  1TFA A;  3E9X A;  1OQH A;  3HHF A;  4RK2 A;  5IKB A;  3K4U A;  2V93 A;  4EQB A;  5LOM A;  2UVG A;  3C31 A;  5ICT A;  3C35 A;  2ZYN A;  4KYE A;  3V8X B;  4NF6 A;  4KCC A;  1YPN A;  5CRY A;  1QKB A;  3V83 A;  3EPE A;  3KN8 A;  3SEV A;  4AB5 A;  2I58 A;  1B52 A;  4IO6 A;  3E4R A;  1JET A;  2HZL A;  3BBR A;  3C32 A;  4G68 B;  5DEX B;  4JSD A;  2DP8 A;  1PB9 A;  4Q8R A;  5CM6 A;  2VD3 A;  5DVJ A;  4BDL A;  1GTK A;  1XVX A;  2QL3 A;  4DDD A;  4QF9 A;  3QXM A;  2Q8J A;  1N0T A;  1QUJ A;  4OXV A;  3T9H B;  3T66 A;  1MDQ A;  2F35 A;  4F1Y A;  1J1N A;  2O7U A;  1PBP A;  1TT1 A;  4NWC A;  3IJO B;  2AYS A;  3ZS6 A;  1R6Z A;  3TQL A;  4WKM A;  4OFO A;  4R74 A;  3MBP A;  3R6U A;  4YMA A;  3S9M C;  4DXB A;  3G3H A;  1LCF A;  3O97 A;  3MP8 A;  3G3K A;  4EUO A;  4DZ1 A;  2RC7 A;  2XD2 A;  3B6T A;  1OVB A;  1B46 A;  3FVO A;  1B58 A;  3HN0 A;  3H6T A;  5KCJ A;  2QS4 A;  1GV8 A;  5FTI A;  4QFK A;  3LSW A;  4QFP A;  3PMV A;  5EYF A;  3TCF A;  2V84 A;  3WAF A;  2D5W A;  4YKP A;  4GRK A;  2GHB A;  4MLQ A;  3K1P A;  1ZKB A;  4C0R A;  1MQD A;  3FXR A;  2Y84 A;  3CSB A;  2ONR A;  3PD8 A;  5DVF A;  1QVS A;  2FYI A;  3F11 A;  1LGB C;  1M5B A;  2F7B A;  1LB9 A;  2PMS A;  1MPB A;  4QFO A;  3IAZ A;  4NTL A;  4F18 A;  4C1T A;  2ZYO A;  4I62 A;  1SW2 A;  4GXS B;  3KGC A;  4O3A A;  1Q1K A;  4KD5 A;  3CRB A;  3TZA A;  4E0X A;  1HSL A;  3WAE A;  2DWJ A;  4NF8 A;  4BDM A;  1R9L A;  1DMB A;  5ICQ A;  2A5S A;  3LC8 A;  1B3G A;  3RTW B;  3PGF A;  3FVN A;  4DLD A;  1B40 A;  4WEP A;  2XX8 A;  4ZEI A;  4F3P A;  3VLV A;  1OQG A;  2DSF A;  5I56 B;  4YZZ A;  3A3U A;  3TMG A;  2FA7 A;  2UVI A;  1MXU A;  3N6T A;  2OZZ A;  5JTY B;  3K6X A;  2QJE A;  3IJX B;  5KZT A;  2XXX A;  5F7V A;  2NUV A;  1P1U A;  4F22 A;  3FXQ A;  3N6U A;  4MBP A;  4Z7E A;  1UTB A;  4C1U A;  2W7Y A;  4DCY A;  3TEL A;  3VE1 B;  2I4C A;  4KFQ A;  2PX1 A;  1SQY A;  1NL5 A;  1FTO A;  1DPE A;  3MC2 A;  1FQD A;  1P1Q A;  4N13 A;  3TTM A;  1IIT A;  3RN8 A;  3OO8 A;  3QIM A;  3KOT A;  1MQJ A;  4TOZ A;  1BTJ A;  3HHG A;  4THI A;  1QUI A;  4RJZ A;  3VXB A;  4ZE9 A;  5AA2 D;  4GFR A;  1M5C A;  4ISU A;  5CBS A;  5TU0 A;  4DIG A;  4R73 A;  4ZEB A;  3U1O A;  3S4U A;  3QUJ A;  4HW8 A;  1MY0 A;  2F36 A;  3FXU A;  3L6G A;  4FE8 A;  1Y1Z A;  4QSD A;  4F19 A;  3O6H A;  5AA3 A;  4JWY A;  1NH8 A;  4EF2 A;  3SEU A;  5AA2 A;  5HM4 B;  1SW4 A;  4IGR A;  2XX9 A;  4XTC Q;  4OEU A;  4H8J A;  5L9O A;  3BKI B;  4ECF A;  1A8E A;  1B3H A;  1NNF A;  4G68 C;  2O51 A;  4FOR A;  3RY3 A;  4OMB A;  3KSX A;  1XHY A;  2GFE A;  4F39 A;  2H25 A;  3V5A A;  3GBA A;  4NF5 A;  4XKQ A;  2DXR A;  1I6A A;  4F3B A;  1LB8 A;  4PFW A;  2ZNS A;  1DOT A;  3T22 A;  2B65 A;  4M4G A;  1B0H A;  4ELR A;  3OXN A;  1NMU A;  4MF3 A;  2CMO A;  2HXW A;  2Y7W A;  1NNT A;  1QW0 A;  1N7W A;  4JDF A;  1IXI A;  2DYX A;  3G3G A;  3DM0 A;  1MY3 A;  3IOR A;  5I58 A;  4P0G A;  3T93 B;  1OVT A;  3IB1 A;  3HCQ A;  3PUV E;  3FUZ A;  4QFL A;  3SET A;  1PB8 A;  2V3U A;  1ZIU A;  4KQP A;  2Y7K A;  3GLB A;  3Q29 A;  4FIM A;  2DXY A;  3RTF B;  1OLC A;  2I4B A;  4KR5 A;  2H5Y A;  3M8U A;  2QS1 A;  3FJG A;  1QUL A;  4JSO A;  1MXW A;  2F8D A;  4GQO A;  4OVJ A;  3IO6 A;  4DXU A;  4G8N A;  1CE2 A;  5H8N A;  1BKA A;  1I6Q A;  2VD2 A;  5H8F A;  1NNK A;  1M5E A;  4IY5 A;  3T9U A;  5KDT A;  4YIC A;  5AA1 A;  1URD A;  1NH7 A;  4GXA A;  2HFB A;  1Y9U A;  4YMB A;  4H5G A;  4R6K A;  3FAS A;  3SER A;  2DE4 A;  1AIV A;  4IO2 A;  1URS A;  3P7I A;  1POY 1;  2RIN A;  1B0L A;  4NED A;  4F1U A;  5I2K A;  1ATG A;  1EH3 A;  1FCK A;  4N6P A;  1OLA A;  3HV1 A;  1RYO A;  3MVZ A;  4LZ5 A;  3SDF A;  4BDQ A;  3PPO A;  1MDP 1;  3KSJ A;  4R72 A;  1LBC A;  4IGT A;  1VSO A;  1HSE A;  4BDN A;  3TAJ A;  4RYA A;  4RXL A;  1WOD A;  5ITP A;  2H9B A;  3B7D A;  3PMX A;  1MG1 A;  3FAT A;  3PPQ A;  4P11 A;  1H76 A;  3IOV A;  5FHM A;  3H06 B;  1H45 A;  1B4H A;  5JK4 A;  2A5T B;  4POX A;  4GF8 A;  3FVK A;  3O66 A;  3QAX A;  3PD9 A;  3K6V A;  3CI8 A;  4F2Q A;  1A99 A;  5I2K B;  3MZ9 A;  3CR9 A;  2DVC A;  3PPN A;  2GH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...