5DVFA

Crystal structure of unliganded periplasmic glucose binding protein (ppgbp) from p. putida csv86
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
389
Chain Sequence
NPGTVDVLHWWTSGGEAKAVETLKQQIQKDGFIWKDNAAAMTVLKTRAISGNPPSAAQIKGPDIQEWGALGLLTELDDVAAANKWDDLLPRQVADIMKYDGHYVAVPVNIHRVNWLWINPQVFDKAGAKVPTTLDELFAAADKLKAAGFIPLAHGGQPWQDSTVFEDLVLSILGPKGYHAAFVDLDEKTLTGPQMTEAFATLKRLGTYMDPNRAGRDWNIAAAEVINGKAGMQIMGDWAKSEWSAAGKVAGKDYQCVAFPGTQGSFAYNIDSLAMFKLKDANDIKAQNDLAKVALEPEFQTVFNQNKGSLPVRQDMDMSKFDACTQKSAADFKEAAKGDGLQPSMAHNMATTLAVQGAIFDVVTNFLNDPQAEPATAVKQLNAAIKAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structures of Periplasmic Glucose-binding Protein of Pseudomonas putida CSV86 Reveal Structural Basis of Its Substrate Specificity
pubmed doi rcsb
source organism Pseudomonas putida csv86
molecule tags Transport protein
molecule keywords Binding protein component of ABC sugar transporter
total genus 140
structure length 389
sequence length 396
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5dvfA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5dvfA02
3SESA 2PBWA 4FECA 4GOTA 4JXIA 2ZNSA 1D3KA 3K6VA 1BLFA 3MWBA 1Y3PA 4OEVA 3WAEA 4DCYA 4EDPA 3TEPA 2Z23A 3LSWA 5CBSA 4U22A 5M2VA 2ABHA 1MXZA 3RN8A 5H8HA 1PB7A 1H76A 4QSEA 2ONRA 3PD8A 4HCYA 4NE4A 3ZS6A 2M8CA 4MLVA 3O9PA 1ATGA 2DS9A 1B58A 2DXYA 2RC9A 4NF6A 4R72A 4IY6A 4RK9A 1O64A 4OENA 3MVYA 1AMFA 4QFKA 5TPAB 5KCJA 5I2KA 3JV9A 4ZZEA 1H45A 3FJGA 4ZEBA 1R6ZA 2DE2A 2XD3A 4KCCA 4QFLA 3Q26A 2X26A 1D9YA 2I49A 3IOWA 1FTOA 3MVXA 4WXJA 2F97A 3U94A 2QS1A 1XOCA 1SVXB 3S9MC 3CR9A 4NF4B 4OEUA 5KDTA 1IZ1A 1B3HA 4OETA 2HQ0A 2GH9A 3CVGA 2XXHA 1MPCA 2O6AA 5K2YA 2I0BA 1Y1ZA 4UA8A 1URGA 4ONYA 2H5YA 1LB9A 4PP0A 5I56B 1LAXA 3TTKA 4GXAA 3M3KA 4GRKA 1D4NA 2QPQA 2HZLA 4P0IA 3KN8A 2OK2A 2F36A 1FQEA 3IL1B 3MVZA 3KZGA 4X48A 5KZTA 4KYEA 1B40A 4ZZAA 1AOVA 4ISUA 4F3PA 2DWAA 3UORA 2UVGA 3VLVA 3OO7A 1DPPA 4QFPA 3KOTA 5H8NB 2XX8A 1WODA 1XVXA 4OFJA 3OEKA 1NH7A 1VSOA 3A3CA 3RTWB 1MQJA 3K1PA 5ITPA 4M4GA 3H6VA 3KGCA 4WEPA 5KCJB 3KSJA 1MXWA 1OMPA 1JW5A 2H98A 2DYXA 3K00A 4L17A 2RCBA 2QS2A 4XTCQ 1MDQA 1N84A 2O84X 2P0SA 3HHFA 4THIA 1IIWA 1MDP1 1Y3QA 3PPOA 1B7UA 4H65A 4OYVA 1GVCA 5AA2A 4HS7A 1IXIA 1BKAA 5EHSA 1B4HA 3O6IA 1YAEA 2G29A 3UIFA 1DTZA 1SDXA 1N7XA 2ZXTA 2YLNA 4IB2A 4RPOA 3SEUA 3TODA 3QXMA 4YICA 4C0RA 1S9TA 3TELA 3PUVE 1MXYA 2XXYA 3OD7A 1EZ9A 1PB8A 4MBPA 4H6DA 5EHMA 4WEDA 4DCXA 4EXKA 1B6HA 2E1SA 1JVYA 1XT8A 4PQJA 4BDLA 3PMVA 5DVIA 3VLWA 1FCKA 1EU8A 3OXNA 4QFNA 1S50A 3CFZA 3U92A 2QS4A 2QL3A 4GL8A 4ECFA 1MPDA 2DWJA 2O1MA 3SDFA 4U21A 1HSEA 3UN6A 4NF8B 4RXLA 4YKPA 3KSXA 5I2NA 5AA1A 3HHGA 3SEYA 4U4SA 1POTA 4PE5B 3ECRA 4EF1A 4XIGQ 2H4IA 4KQPA 3K02A 4YB7A 1SYHA 3MZ1A 4IO2A 3QAXA 4XKNA 3CSBA 3LBSA 1Y1MA 3MJNA 1PBPA 3PV0E 1ANFA 2O69A 3IK6B 1H3DA 4MLQA 4OQOA 5TPAA 2NVUB 4KFQA 1OLAA 1Y4CA 3MUQA 2Y7WA 2Y84A 4F1UA 2RC8A 4FE8A 1QJMA 3FVOA 4TLMB 1KWHA 3TYHA 3IB1A 4LZ7A 3DP4A 3FV1A 3HV1A 3K6UA 1ZTYA 1CB6A 1PDAA 3GBAA 3I3VA 4AB6A 3HO7A 5B7DA 1TT1A 4H1XA 4P0GA 4YMAA 1PEBA 4H5GA 3V5AA 2H99A 3L6HA 2VGQA 5DEXA 5AA2D 5F1QA 3PUWE 1TFDA 4R6HA 4TOZA 3C34A 3BBRA 4HTGA 1CE2A 2QMWA 3K2DA 2V25A 1JNFA 3IJXB 3UP9A 3HCQA 5TP9A 5CBRA 3KEIA 3QUFA 2Y7IA 3RPWA 1Z7NE 3KG2A 1QULA 2O51A 2ZMBA 5I58B 3M3FA 5H8FA 1B1HA 1GR2A 1WVJA 4EQ9A 2OJTA 4OHNA 1FTKA 2UYFA 5J1DA 1P1QA 3K01A 4YKKA 4LZ8A 4F2QA 1POY1 3RT6B 3QIMA 2F5XA 2V3TA 3W15C 4KD5A 4F3SA 3EHTA 1ZU0A 3M3LA 4YMBA 3K4UA 1A8EA 4YB6A 2OBGA 1SW5A 3H03A 2DE4A 5FHOA 1B7ZA 4H67A 4IGRA 1VE4A 2XXRA 3DM0A 1LCFA 4ELQA 3SEVA 3ODBA 3Q27A 3O6GA 4GIZA 5JK4A 2R6GE 1A54A 2F78A 3OENA 2XD2A 4FIMA 4NF6B 4OERA 2RC7A 3KJTA 1FQBA 3CFXA 5DYHA 1SI1A 3IB0A 3SKPA 3PUXE 1A8FA 1I6BA 1P1OA 2OWTA 4DXUA 1LSTA 3GBBA 4H0WA 2UVIA 3PD9A 1DPEA 1MG1A 3E9XA 3MP1A 2B65A 1NMUA 3MZBA 3LR1A 2H25A 1QVSA 1B1XA 4WKMA 3RQTA 1OLCA 3TPAA 1R1NA 3C31A 4AB5A 4GQOA 3CRBA 4QHQA 1VR5A 1LGBC 2ALUA 4RA1A 4AQ4A 1UTHA 3UGWA 3IJOB 2ANJA 3KFMA 3T93B 4DDDA 1NKXA 1NNFA 3N26A 4KPTA 4OFOA 3FD3A 5H8QB 4YZZA 1YPNA 2V3QA 1B05A 2DOJA 2Q8JA 1XHYA 3D4GA 3ZKKA 1SI0A 4YU0A 5DVJA 4EUOA 3G3JA 2D3IA 2Q9TA 2QRYA 2UVHA 3QUJA 1JW1A 4GXSB 4X9TA 5TU0A 1B5IA 4FAJA 4EQBA 3HN0A 1UTBA 1DMBA 3PUYE 1PBQA 4F3GA 1P1UA 4QF9A 1MQDA 2FYIA 1IEJA 2ZYMA 4R9GA 3T9VA 2B3BA 4KI0E 4R2FA 4I8CA 1SW4A 2F6PA 2VD3A 1TWYA 2HCAA 4OVJA 4ZEFA 5I2KB 4R75A 3PU5A 5A5XA 4U23A 4RY1A 2OWSA 4FJPA 1B52A 4TLLB 3V83A 1MY4A 3H4ZA 5CC2A 3B6TA 2R71A 3DELB 5DT6A 3D4CA 1N3WA 4POWA 3H6TA 5FHMA 3IOVA 2I3VA 1GV8A 4K3FA 3TCFA 3OMBA 4LUBA 3MQ9A 2V3UA 4GLIA 3W9VA 3TAJA 1MXUA 3TUSA 4QSCA 3CI8A 4BDOA 3KBRA 1DOTA 4NF5B 4GD5A 3U1OA 3GXAA 1LFHA 2DVZA 3OOAA 5DTBA 2QMXA 1F9BA 2Z8EA 4Q0CA 1P1WA 1ZBMA 4XKRA 5I59B 1P1NA 5ICQA 3RNNA 1SBPA 1OIBA 2HAVA 4LONB 3F11A 1VFEA 4MFIA 5DEXB 2F6GA 4F1VA 4ZEDA 2VHAA 3S2VA 1ZIUA 4GFRA 1B3FA 4HCWA 4IO7A 1QUJA 3TCGA 2OCUA 1M5EA 3FIRA 3FVGA 4FEDA 4MF3A 3TTRA 4OTEA 4ESWA 2PT2A 2HFBA 3QYTA 1US4A 3EF7A 1GTKA 4I1DA 4EF2A 1Q35A 2V93A 2OZZA 2F34A 3IO6A 3USDA 2BJJX 1B3GA 1UQWA 2AIXA 5ELVA 4BDNA 3TCHA 3FXUA 4F39A 2VOZA 1XS5A 2H9BA 4JBZA 1MY3A 2ESNA 4H5FA 4EXLA 1FTMA 5BUUA 3C35A 4G2ZA 2Z8DA 4LQ2A 3E13X 1A7LA 3FGSA 3PPNA 1FTLA 3O28A 1N76A 3OEMA 4DE8A 5ISUA 3T96B 4X1DA 4R6KA 4OZ9A 3HPIA 3PUZE 4YAHX 1GGGA 3IAZA 2XXVA 4ZS9A 5I57B 1Y3NA 2F7BA 3Q25A 4GF8A 1Y9UA 1IUDA 4BDRA 2ZYKA 3T66A 4U4XA 1FQAA 2FNCA 1S7YA 2X7QA 5H8FB 1LAGE 4PETA 3FASA 2IA4A 2REJA 4ZDMA 2DWIA 2GHAA 3LC8A 4O3BA 1B0HA 1Y4TA 2D21A 5FTIA 2VD2A 1FQCA 1R9QA 3S9NC 2HXWA 4E0WA 4FEBA 3TFLA 3K6WA 3GZGA 3U8QA 4H8JA 4EQ7A 1H44A 1JW4A 2RKMA 3IX1A 3QK6A 4LZ5A 1NFTA 1LFIA 3LSLA 1I69A 1UTHB 3OSQA 4NF4A 2XXXA 5F7VA 3VDFA 3RGYA 4F1YA 4HW8A 4NTLA 2PT1A 1FQDA 3K1NA 1US5A 3Q28A 4F2OA 3PPRA 1II5A 3FXQA 2XXUA 3PMWA 3KOSA 2DE3A 4PFYA 2QS3A 5CMMA 2IEEA 2NUVA 2XHDA 4BDMA 3JZJA 1IXHA 4JB7A 2RINA 4R9FA 5FHNA 4PFTA 4JSOA 1FTJA 1N04A 4G68A 4QSDA 2VP1A 3S9EA 2DWHA 3I6VA 1B46A 1EH3A 4OWDA 2XXIA 1MS7A 2HEUA 2XX7A 3VE1B 4I62A 2PX1A 2R9JA 1MPBA 5H8SA 1B0LA 4F3BA 4R73A 3H7MA 4ZECA 2Y7KA 3DP6A 1URDA 3O29A 1DSNA 2NXOA 4U1ZA 4ZEIA 3FUZA 4GWOA 1UTBB 1ZMGA 4BDQA 1B9JA 3FJMA 1A99A 1A55A 1N7WA 3CG1A 1B5HA 2DXRA 2RF1A 3EHSA 3FVKA 3MVWA 1AL3A 3Q29A 4Z7EA 3FATA 3MW0A 4Q5TA 3T9UA 1JEVA 1MRPA 1M5FA 1MY0A 3E3KA 3G3IA 3BFTA 3TTNA 5I56A 4NWCA 5AA3A 1LAHE 1NNPA 5H8QA 3V89B 5B70A 3BKIB 4JWXA 1B2HA 3IR1A 4IO5A 4FORA 3MPLA 4G68B 5TP9B 4BLAA 4RYAA 1LAFE 5JTYB 1SQYA 4H8IA 2O68A 5AE4A 4QRZA 3TMGA 4NF5A 5I84A 1EZPA 4OFLA 2THIA 3JYRA 5I57A 3THIA 5AA2B 4I9DA 3MAMA 2Y7PA 3RY3A 2QJEA 2D5WA 1QW0A 4ZE9A 3MZ9A 1QUIA 2Q2CA 2XXPA 4G8MA 4NMYA 3K0VA 4ZEKA 1Y20A 1JEUA 3KN3A 4LP2B 3ZSFA 1RYXA 5JTYA 2REGA 3EQ1A 1YCJA 3CFLA 4IY5A 3TTMA 3EN3A 3IOTA 1MY2A 2UVJA 1BP5A 1M5DA 1NH8A 5H8NA 3EPEA 3FVNA 2ZYOA 5A5XB 5CI5A 4C1TA 2F8DA 1Z7ME 4G8HA 2CMOA 1B7HA 4JWYA 4LA9A 3ILTB 3H3GA 3KJ7A 1MQIA 1MXVA 1JQFA 2PVUA 1NNTA 3IOUA 4MH5A 4DIGA 3FJ7A 2P1SA 3VV5A 4LATA 3OSRA 2GHBA 1O7TA 4XKPA 4G77A 3C9HA 3N6UA 5CMKA 4NWDA 4IGTA 3K6XA 3QSLA 1M5CA 4RK2A 1JETA 1I6QA 1P99A 3RTFB 2E0SA 3DLNA 1YTVA 1IQ7A 4DXBA 4F19A 1T0KA 1PB9A 1RKMA 4YB5A 2ZYNA 3TZAA 5CMCA 4ESXA 3V8XB 3M8UA 4KHZE 4Q30B 3TTLA 2Z8FA 3O97A 5HPQA 3LUYA 2I6EA 2WKYA 1LFGA 2O7UA 4LQ5A 4G68C 4OXVA 4R74A 3VVDA 3C33A 1OVBA 4O3AA 4YKIA 3TDJA 5IAIA 5L9SA 4M1VA 1JVXA 2DP8A 1FQFA 3TQWA 3E4RA 3FZVA 1MH3A 2Y7RA 4Q8RA 2CZLA 3R26A 3C4MA 1URSA 2YJPA 3SEWA 1LBCA 4G4PA 1SW1A 4KR5A 3I5OA 5L9MA 4ELRA 4F31B 3K1MA 4N07A 4DZ1A 3MP6A 5JEIA 1ELJA 3VXCA 2ZNTA 4IO3A 5BWJA 3U93A 2Z22A 2I0CA 3EHUA 4PFWA 2A5TA 1N0TA 4POXA 3TKDA 3T9XB 3G7WA 4RJZA 2QSXA 2HZKA 4OESA 1BTJA 4U1OA 3VLUA 1IXGA 1O63A 2UXAA 2YPNA 3MP8A 1WDNA 4XKQA 1USYH 2W7YA 3G3FA 4JDFA 4Z0IA 3RUMA 3TQLA 5EYFA 3UK4A 3S4UA 3VVEA 4P11A 1D9VA 2A5SA 3B6WA 2LAOA 5FTHA 2F35A 1HSJA 4IO4A 2O1LA 4F18A 5KDTB 4ELOA 2I58A 3IORA 2P2AA 4U2RA 4X1BA 3VFJA 1B4ZA 2DQVA 3PGFA 4C1UA 5CM6A 5I58A 5IKBA 5K2XA 3VVFA 1LCTA 4TQUQ 1BIYA 2ONSA 3H6UA 3C32A 4LVQA 2G93A 1EZOA 1MM7A 3P7IA 3R6UA 4NEDA 2OLBA 1OQGA 3UA8A 2DVCA 4JWOA 2I4CA 1FW0A 3MPKA 3O2AA 3W9WA 2GRVA 4JSDA 1J1NA 2XXQA 2HAUA 1B32A 4DXCA 1OQHA 2UYEA 3O6HA 1LB8A 3O66A 4O3CA 4RPNA 1IXCA 3AXFA 3H06B 1Q1KA 1AH5A 3S9LC 1DTGA 1ZLQA 1SW2A 3C36A 3HSTA 3N5LA 3PMXA 4GL0A 3LSFB 4GVOA 4IO6A 3FV2A 3ILUB 3A09A 1SYIA 3ZKLA 3R7XA 1LLSA 1NNKA 1XC1A 2FA7A 3PPQA 4KYSA 4KCDA 5L9OA 1TXFA 1B3LA 4DLDA 1QUKA 2PMSA 3MC2A 2X7PA 1UIUA 3A3UA 1MQGA 4XXUA 4UACA 1NL5A 4QFOA 1XVYA 1A40A 5HM4B 5ICTA 1PC3A 4N13A 1B5JA 1MQHA 3T22A 1H43A 2XXWA 1TFAA 4NF8A 4YKJA 1AIVA 1RYOA 2B3FA 3OO8A 4PFUA 3FXRA 4KYDA 1MM6A 3SERA 2NOOA 2KLFA 1UIVA 5DVFA 3RLFE 3SEXA 4R2BA 2Q89A 3PPPA 4F22A 1R9LA 2AYSA 4RNSA 5LOMA 2V84A 1LBBA 2ONKE 1SD3A 2AL4A 2I3WA 1B3EA 2A5TB 4OMBA 2RCAA 3CIJA 1QKBA 3N94A 3OELA 1B51A 3N6TA 2Q2AA 5ITOA 2I48A 1MXXA 3ONMA 4FATA 5AA4B 1QKAA 3MBPA 5L8DA 1ZJLA 3L6GA 3B6QA 5HBCA 1USYE 2F7AA 3VXBA 3WAFA 4ZE8A 3OO9A 2Q88A 4E0XA 3U72A 1OVTA 3IO4A 4ELPA 5I2NB 1M5BA 1MY1A 3CSGA 2AL5A 5CRYA 2ZNUA 1IITA 1I6AA 3G3GA 1MH4A 3RT8A 2GFEA 4N6PA 3CG3A 5AA4A 2XXTA 3G3KA 3KN7A 2NWJA 4ND9A 3B7DA 3H6WA 2I4BA 5I59A 3G3HA 3T9HB 2F7CA 1N3XA 5H8HB 1ZKBA 3BFUA 3OO6A 1HSLA 2DSFA 2O7IA 2XX9A 3GLBA 3IB2A 3LSXA 5CMBA 4F29A 1VFDA 3DP8A 4R6YA 4G8NA 2PYYA 3SETA 1L5TA
chains in the Genus database with same CATH superfamily
4FECA 3K6VA 4OEVA 1Y3PA 3WAEA 4EDPA 5CBSA 4U22A 2HXRA 1MXZA 5H8HA 1H76A 1FBFA 2DXYA 4NF6A 5TPAB 1EYIA 1O64A 3MVYA 4QBAA 5I2KA 4WXJA 2X26A 1D9YA 4PAKA 1NV2A 3U94A 1SVXB 4X04A 1B3HA 2HQ0A 3CVGA 3RPLB 4PP0A 5ET6A 3M3KA 4GRKA 3KN8A 2F36A 1FQEA 3IL1B 4X48A 4KYEA 4ISUA 3UORA 2UVGA 3VLVA 4FBPA 4PFBA 2XX8A 4N17A 1WODA 3OEKA 1NH7A 2RCBA 4XTCQ 1MDQA 1N84A 1GVCA 3PPOA 5AA2A 5I7IA 1B7UA 4OYVA 5EHSA 3O6IA 3UIFA 1YAEA 2G29A 1SDXA 4IB2A 3SEUA 5EQ9A 1NV0A 1S9TA 3TELA 1EZ9A 1PB8A 5EHMA 4DCXA 2E1SA 5J16A 3PMVA 1EU8A 2QVVA 4PE3A 1S50A 4GL8A 2O1MA 3SDFA 3KSXA 5AA1A 4U4SA 4PE5B 3ECRA 3MZ1A 1NV1A 3CSBA 3PV0E 1ANFA 2O69A 3IK6B 4OVRA 1OLAA 1Y4CA 4TLMB 3FVOA 3IB1A 1NV6A 3FV1A 3HV1A 1CB6A 3HO7A 3V5AA 2F3BA 1CE2A 2V25A 3UP9A 3KEIA 2MKZA 4GWWA 5I58B 5H8FA 1B1HA 4F2QA 3M3LA 1A8EA 2OBGA 1SW5A 3SEVA 3Q27A 1A54A 4NF6B 3E79A 4GX3A 3IB0A 3SKPA 4JVDA 1A8FA 2OWTA 3PD9A 1DPEA 1MG1A 3E9XA 3MP1A 2H25A 3TPAA 1VR5A 2WEFA 4AQ4A 3EKIA 1UTHA 3UGWA 3T93B 4DDDA 1NNFA 3N26A 4OFOA 3FD3A 5H8QB 2Q8JA 4YU0A 5DVJA 2UVHA 3HN0A 3PUYE 1PBQA 4PGPA 4F3GA 4QF9A 1IEJA 4R2FA 4OVJA 4U23A 4RY1A 4FJPA 1B52A 4MHFA 4TLLB 3H4ZA 3B6TA 2R8TA 1N3WA 3SZPA 3MQ9A 4GLIA 2PFZA 3TUSA 5DTBA 1NUXA 1ZBMA 5ICQA 3RNNA 4LONB 4ZEDA 4GWYA 1FBDA 2OCUA 4OVPA 4FEDA 4MF3A 3QYTA 4I1DA 2OZZA 2BJJX 4HXVA 4PCDA 5ET8A 2VOZA 4JBZA 1G0HA 1MY3A 4DE8A 1N76A 3PUZE 2GQ1A 3IAZA 4ZS9A 1FQAA 5EQAA 4MJOA 3FASA 1B0HA 2D21A 3S9NC 2VD2A 1R9QA 3TEPA 3RYDA 4FEBA 3K6WA 3GZGA 4O94A 4H8JA 3U8QA 4LZ5A 1LFIA 3S9MC 1I69A 4F1YA 3RPLA 4NTLA 3Q28A 1FQDA 2P3VA 3PPRA 3FXQA 5CMMA 3KOSA 2DE3A 2RINA 5FHNA 1N04A 4G68A 3S9EA 2DWHA 1B46A 4OWDA 4I62A 2PX1A 5H8SA 1B0LA 4F3BA 3H7MA 2OX3A 1K9YA 4ZEIA 2NXOA 3FUZA 4GWOA 1A55A 2DXRA 4Z7EA 1MY0A 3G3IA 5AA3A 1LAHE 5H8QA 1B2HA 4G68B 5TP9B 3NOHA 4QRZA 1EZPA 3THIA 4H45A 1LBWA 3MAMA 2QJEA 1QUIA 4ZEKA 3KN3A 1KZ8A 5JTYA 2REGA 2QVRA 3IOTA 1NH8A 5A5LA 5A5XB 4G8HA 4JWYA 3H3GA 3KJ7A 3IOUA 4LATA 2GHBA 5EQ7A 4IGTA 3QSLA 2E0SA 1IQ7A 3TZAA 4ESXA 3M8UA 3TTLA 3O97A 2I6EA 2WKYA 3VVDA 4R74A 4G68C 1OVBA 3IFAA 1MH3A 2ZZVA 2CZLA 1SW1A 4IR8A 4F31B 4N07A 4DZ1A 3MP6A 5IZ3A 2ZNTA 2Z22A 4PFWA 4POXA 1AWBA 3G7WA 4RJZA 1BTJA 1IXGA 4XF5A 3RUMA 3UK4A 3S4UA 3VVEA 2DDKA 1LEVA 1HSJA 2O1LA 5KDTB 3H6UA 1FTAA 2G93A 1MM7A 4I3YA 2DVCA 1FW0A 1J1NA 2UYEA 2ZZWA 3AXFA 3S9LC 1DTGA 1SW2A 4GVOA 4GL0A 3LSFB 1LBXA 1NV7A 1XC1A 3PPQA 4KCDA 1MQGA 4QFOA 5HM4B 5I3SA 4AS4A 4KYDA 2NOOA 1UIVA 4GWZA 2PCRA 2V84A 2AL4A 1B3EA 2Q74A 2RCAA 1INPA 3N6TA 5ITOA 2I48A 1MXXA 4FATA 3B6QA 5HBCA 2F7AA 2Q88A 4E0XA 5I2NB 1MY1A 2ZNUA 3T1BA 2GFEA 4N6PA 3G3KA 5I59A 3B7DA 2I4BA 3G3HA 3T9HB 5H8HB 1ZKBA 1HSLA 2DSFA 2XX9A 4F29A 2PYYA 2BJIA 2PBWA 4DCYA 1BLFA 3RN8A 3ZS6A 3PD8A 4NE4A 1B58A 2RC9A 5KCJA 4OENA 4N15A 1AMFA 3FJGA 2FVZA 2I49A 4PBQA 1FTOA 3MVXA 3E78A 2WX9A 1IZ1A 5K2YA 1MPCA 2QVUA 4UA8A 1LAXA 4GXAA 1FJ6A 2XWIA 2QPQA 2HZLA 2OK2A 3MVZA 3KZGA 4ZZAA 2DWAA 4PAFA 3OO7A 1KA0A 4OFJA 1VSOA 1MQJA 5ITPA 5KCJB 4M4GA 1JW5A 4O8MA 2DYXA 3K00A 2P0SA 1IIWA 1Y3QA 4HS7A 1BKAA 4RPOA 2YLNA 4XEQA 3QXMA 4C0RA 3OD7A 4WEDA 1XT8A 5DVIA 4HE0A 3VLWA 1MPDA 4NF8B 5I2NA 1POTA 4EF1A 4XIGQ 3LBSA 1Y1MA 4OQOA 5TPAA 4KFQA 3MUQA 2Y7WA 4F1UA 2RC8A 1QJMA 4LZ7A 3K6UA 1PDAA 2WBBA 4YMAA 1PEBA 3L6HA 2VGQA 5AA2D 4R6HA 1TFDA 4HTGA 3K2DA 1JNFA 5TP9A 3QUFA 1QULA 1GR2A 2OWZA 1WVJA 4YKKA 3K01A 4LZ8A 1POY1 3QIMA 4KD5A 3EHTA 4YMBA 3K4UA 4YB6A 5FHOA 3H03A 1B7ZA 5ET7A 4H67A 4N6DA 1VE4A 1LCFA 4ELQA 2FIXA 3KJTA 3CFXA 1I6BA 3RTFB 5KDTA 4WKMA 4MEVA 3MZBA 1QVSA 1NUZA 3C31A 2ALUA 1FPIA 3IJOB 3KFMA 4KPTA 1XHYA 3G3JA 1YZ0A 1B5IA 1UTBA 1FJ9A 2XWVA 3FBPA 1P1UA 1MQDA 2FYIA 1D9QA 3TODA 2F6PA 1TWYA 2OWSA 3LUZA 2R71A 4POWA 1SPIA 1GV8A 2KQZA 4LUBA 4NGUA 2V3UA 3TAJA 4QXDA 1MXUA 4BDOA 3KBRA 4NF5B 3U1OA 3GXAA 2DVZA 3GYYA 3ISPA 4Q0CA 1SBPA 1OIBA 2HAVA 1IMBA 1VFEA 5DEXB 2VHAA 4GFRA 4IO7A 3A29A 2HFBA 1US4A 4P1LA 1Q35A 1IMCA 2F34A 3USDA 2AIXA 5ELVA 4BDNA 4MNPA 2H9BA 4EXLA 4H5FA 5BUUA 3C35A 4JVCA 2Z8DA 4LQ2A 3PPNA 1FTLA 3O28A 3OEMA 4OVTA 4KXPA 4OZ9A 4YAHX 1GGGA 2XXVA 3Q25A 1IUDA 2ZYKA 4U4XA 2FNCA 2X7QA 4PETA 4ZDMA 2REJA 2DWIA 2GHAA 4O3BA 1Y4TA 1FQCA 4MNCA 3TFLA 1H44A 1JW4A 1NFTA 3VDFA 1UTHB 4N6KA 4HW8A 2CEYA 2PT1A 3K1NA 1US5A 4P3LA 2QS3A 2XHDA 3JZJA 4JSOA 2VP1A 3I6VA 1EH3A 1NI9A 2XX7A 2R9JA 1MPBA 3DP6A 4OVQA 4BDQA 2RF1A 3Q29A 4Q5TA 1MRPA 1NUWA 5I56A 5B70A 3BKIB 4BLAA 4IO5A 4FORA 1SQYA 5AE4A 4MIJA 3HFUA 3RY3A 2Y7PA 4MAGA 1QW0A 3ZSFA 3K0VA 1Y20A 4LP2B 1RYXA 2FBPA 4GWSA 1MY2A 2WBDA 5H8NA 3IFCA 2F8DA 1B7HA 4LA9A 1MQIA 1JQFA 1NNTA 3OSRA 4XKPA 3C9HA 5CMKA 1I6QA 1P99A 4F19A 4DXBA 1PB9A 2ZYNA 3V8XB 4KHZE 3LUYA 1LFGA 5IAIA 4YKIA 4O3AA 5L9SA 1FQFA 3E4RA 2QFLA 4Q8RA 3C4MA 1URSA 3SEWA 4O7MA 3I5OA 5BWJA 3TKDA 3T9XB 4U1OA 4OESA 1O63A 1WDNA 5FTHA 2LAOA 4PAIA 2F35A 3KC1A 4I40A 3IORA 2P2AA 5CM6A 3PGFA 2FHYA 5IKBA 5K2XA 1LCTA 4TQUQ 1EZOA 2OLBA 1FSAA 4JWOA 2XWKA 4DXCA 1B32A 1OQHA 4PF8A 1ZLQA 3HSTA 3N5LA 4GWXA 4IO6A 4OA4A 1YXIA 3ZKLA 2FA7A 4NHBA 3MC2A 2X7PA 1IMDA 1PC3A 1B5JA 2XXWA 1TFAA 4YKJA 1AIVA 3OO8A 1MM6A 2KLFA 3D1RA 3PPPA 3B8BA 4N8YA 4F22A 5LOMA 2ONKE 4P0IA 4OMBA 3CIJA 1QKBA 1QKAA 3L6GA 3VXBA 3WAFA 1JP4A 4ZE8A 3IO4A 5EYHA 2AL5A 4NF0A 3G3GA 5AA4A 3KN7A 3H6WA 1EYJA 3BFUA 3IB2A 3GLBA 3DP8A 5EQ8A 3SETA 3SESA 4JXIA 2ZNSA 1D3KA 3MWBA 3BIGA 3LSWA 1FPJA 2ABHA 3O9PA 2DS9A 4RK9A 4R72A 4IY6A 4ZZEA 1H45A 1R6ZA 2DE2A 4QFLA 3Q26A 3IOWA 2F97A 3QMFA 4OETA 4P8BA 2GH9A 2XXHA 2O6AA 2I0BA 4ONYA 2H5YA 3MSTA 3TTKA 5F24A 2Y5LA 1AOVA 1B40A 4F3PA 1DPPA 3KOTA 5H8NB 3T0JA 1XVXA 1FBCA 3A3CA 3K1PA 5DW8A 4OANA 3KGCA 3KSJA 1MXWA 5T3JA 4L17A 2QS2A 4O7IA 2O84X 4THIA 3HHFA 1MDP1 4H65A 1IXIA 1N7XA 2XWOA 3PUVE 4MBPA 1B6HA 2CZIA 1FCKA 4DI4B 2QS4A 2DWJA 3UN6A 4RXLA 4YKPA 4N81A 3SEYA 1SYHA 2VPNA 3MJNA 1PBPA 4MLQA 4N91A 1H3DA 4FE8A 3TYHA 1EYKA 1ZTYA 3GBAA 4AB6A 4H1XA 4P0GA 4H5GA 3TTMA 4TOZA 1FPDA 2CZHA 3BBRA 2QMWA 3IJXB 3HCQA 3RPWA 2P3NA 1Z7NE 2O51A 2ZMBA 3M3FA 4OHNA 1FTKA 2HPGA 2UYFA 1P1QA 5J1DA 3RT6B 2V3TA 4F3SA 1ZU0A 1FPGA 4IGRA 3DM0A 3ODBA 1IMEA 4FIMA 2XD2A 1FQBA 3B50A 5DYHA 5ESYA 3PUXE 2HHMA 4DXUA 1LSTA 4H0WA 2B65A 1NMUA 5FBPA 1OLCA 4AB5A 3CRBA 2ANJA 3CHGA 1B05A 2Q9TA 3QUJA 4X9TA 5TU0A 1DMBA 2B3BA 2VD3A 3PU5A 3V83A 1MY4A 3DELB 1NV5A 3H6TA 3IOVA 4K3FA 3TCFA 3OMBA 3W9VA 4QSCA 1DOTA 4GD5A 3OOAA 2QMXA 1F9BA 1P1WA 5I59B 2F6GA 3S2VA 3FIRA 3FVGA 4MCOA 3KC0A 4OTEA 3EF7A 4EF2A 1GTKA 3IO6A 1B3GA 4PTKA 1FPBA 2ESNA 1DCUA 1FTMA 3E13X 3FGSA 1FPLA 1Y3NA 2F7BA 1S7YA 1YYZA 2IA4A 5FTIA 4E0WA 4EQ7A 3IX1A 2RKMA 3QK6A 4NF4A 3OSQA 3RGYA 2B4LA 1II5A 3PMWA 2IEEA 2NUVA 4R9FA 4JB7A 3PTYA 1FTJA 5ET5A 2XXIA 1MS7A 4ZECA 2Y7KA 1URDA 1B9JA 3CG1A 3EHSA 3FVKA 3MVWA 3FATA 3MW0A 3T9UA 1JEVA 5IGAA 3TTNA 1NNPA 4HE1A 1BK4A 3IR1A 1LAFE 4H8IA 3TMGA 4NF5A 4OFLA 1FBHA 3JYRA 5EYGA 4I9DA 4ZE9A 2Q2CA 4NMYA 1YCJA 1IMAA 2UVJA 1M5DA 4C1TA 2CMOA 3ILTB 1MXVA 4DIGA 3VV5A 3N6UA 2XXKA 3K6XA 4HE2A 1M5CA 1YTVA 1RDXA 1T0KA 4H46A 2Q8MA 5CMCA 2Z8FA 4JVIA 3C33A 4M1VA 1JVXA 2DP8A 3TQWA 4N8GA 2YJPA 2B4MA 4G4PA 3K1MA 5JEIA 1ELJA 4IO3A 3EHUA 2QSXA 2HZKA 3VLUA 2YPNA 4XKQA 3TQLA 1USYH 2W7YA 4JDFA 4Z0IA 5EYFA 4IO4A 2L5VA 1FPEA 4ELOA 2I58A 4U2RA 4C1UA 2DQVA 3VVFA 4LVQA 1FPKA 2VPOA 4NEDA 3P7IA 4PFRA 3UA8A 2I4CA 3MPKA 3O2AA 3W9WA 4ELPA 4JSDA 2XXQA 3O66A 4RPNA 1LB8A 3H06B 1AH5A 5IM2A 4PC9A 3ILUB 4GBVA 3A09A 3R7XA 5L9OA 1UIUA 3A3UA 4XXUA 1A40A 4P47A 5ICTA 4N13A 1MQHA 3T22A 2JJKA 4NF8A 3MYUA 5DVFA 1R9LA 4RNSA 1LBBA 1SD3A 3FXBA 4PDDA 2I3WA 3OELA 1B51A 2Q2AA 1IMFA 3ONMA 3MBPA 3BIHA 4PDHA 1USYE 1NUYA 1CNQA 1OVTA 3U72A 1IITA 1I6AA 3RT8A 1MH4A 2XXTA 1QGXA 2NWJA 1LBYA 1Q9DA 2F7CA 5IZ1A 3OO6A 3LSXA 1VFDA 4R6YA 4NX1A 1L5TA 4GOTA 1LBVA 2Z23A 5M2VA 1PB7A 4QSEA 2ONRA 4HCYA 5IZ3B 2M8CA 4MLVA 1ATGA 4QFKA 3JV9A 4ZEBA 1XI6A 2XD3A 4KCCA 2VT5A 2XA5A 2QS1A 1XOCA 3CR9A 4NF4B 4OEUA 4PBHA 1Y1ZA 1URGA 1LB9A 5I56B 1D4NA 5KZTA 4N4UA 4QFPA 3RTWB 3H6VA 4WEPA 1OMPA 2H98A 1B4HA 1DTZA 2ZXTA 4YICA 4PGNA 1MXYA 2XXYA 4H6DA 4EXKA 1JVYA 4PQJA 1NV3A 4BDLA 1NV4A 3OXNA 4QFNA 3U92A 3CFZA 4ECFA 2QL3A 4U21A 1HSEA 3ROJA 3HHGA 2H4IA 4KQPA 3K02A 4YB7A 4IO2A 3QAXA 4XKNA 4P1EA 2NVUB 4NN3A 2Y84A 4GBWA 1KWHA 3DP4A 1KA1A 3I3VA 5B7DA 1TT1A 2H99A 5DEXA 5F1QA 3PUWE 3C34A 5I5PA 5CBRA 2Y7IA 3KG2A 4EQ9A 2OJTA 3LV0A 2F5XA 3W15C 2DE4A 4I3EA 2XXRA 3O6GA 4GIZA 4GWUA 2R6GE 2F78A 5JK4A 3OENA 4OERA 2RC7A 1SI1A 1P1OA 3GBBA 2UVIA 3LR1A 3RQTA 1B1XA 1R1NA 4GQOA 4RA1A 4QHQA 1LGBC 1NKXA 3ZKKA 4YZZA 1YPNA 2KR0A 2DOJA 2V3QA 3D4GA 1SI0A 4EUOA 1FBPA 2WYKA 2D3IA 2QRYA 4MNIA 1JW1A 4GXSB 1FBEA 4FAJA 4EQBA 3T9VA 4R9GA 2ZYMA 4KI0E 4I8CA 1SW4A 5I2KB 1G0IA 5A5XA 2HCAA 4ZEFA 4R75A 4G61A 5CC2A 1VDWA 5DT6A 3D4CA 2F3DA 4MMPA 5FHMA 2I3VA 1RDZA 5LTCA 3CI8A 1LFHA 2Z8EA 4XKRA 1P1NA 3KBZA 1DK4A 2V4CA 4F1VA 3F11A 4MFIA 1ZIUA 1B3FA 4HCWA 4PF6A 1QUJA 3TCGA 1M5EA 3TTRA 4ESWA 2PT2A 2V93A 1UQWA 3TCHA 3FXUA 4F39A 1XS5A 4G2ZA 1A7LA 5ISUA 3T96B 4X1DA 4R6KA 3HPIA 4AS5A 5I57B 4GF8A 1Y9UA 4BDRA 3T66A 5H8FB 1LAGE 5IZZA 3LC8A 2HXWA 3LSLA 5F7VA 2XXXA 4F2OA 1LBZA 2XXUA 4PFYA 4BDMA 1K9ZA 1IXHA 4PFTA 4QSDA 4NQ8A 2HEUA 3VE1B 1DBZA 4R73A 3O29A 4U1ZA 1DSNA 4GX4A 1UTBB 1ZMGA 3FJMA 1A99A 1N7WA 1B5HA 1AL3A 1M5FA 3E3KA 3BFTA 4NWCA 4JWXA 3MPLA 2ZZXA 4RYAA 5JTYB 2O68A 5I84A 2THIA 5I57A 5AA2B 1FBGA 2D5WA 3MZ9A 2XXPA 4G8MA 1JEUA 3EQ1A 3U65A 3CFLA 4IY5A 3EN3A 1BP5A 3EPEA 3FVNA 2ZYOA 5CI5A 1Z7ME 2PVUA 4MH5A 3FJ7A 2P1SA 4X8RA 1O7TA 4G77A 1RDYA 4NWDA 4RK2A 1JETA 3DLNA 4UABA 4YB5A 1RKMA 4Q30B 5HPQA 2O7UA 4LQ5A 4OXVA 3TDJA 1FRPA 4NG7A 3FZVA 2Y7RA 3R26A 1LBCA 4KR5A 5L9MA 4ELRA 1FPFA 3VXCA 2FIEA 3U93A 2I0CA 2A5TA 1N0TA 2UXAA 3MP8A 4P9KA 3G3FA 4P11A 1D9VA 2A5SA 3B6WA 2Y5KA 4F18A 2CEXA 4X1BA 3VFJA 1B4ZA 5I58A 1BIYA 2ONSA 3C32A 4XFEA 3R6UA 1OQGA 2GRVA 2HAUA 3O6HA 4O3CA 4LN5A 1IXCA 1Q1KA 3C36A 2WYPA 3PMXA 3FV2A 4OVSA 1SYIA 4NAPA 1LLSA 1NNKA 4MX6A 4KYSA 1TXFA 1B3LA 4DLDA 1QUKA 2PMSA 4UACA 1NL5A 1XVYA 1H43A 1RYOA 2B3FA 4PFUA 3FXRA 3SERA 3SEXA 3RLFE 5LDZA 4R2BA 2Q89A 2AYSA 3V89B 4PFIA 2A5TB 3N94A 5AA4B 5L8DA 1ZJLA 3OO9A 4GX6A 1M5BA 3CSGA 5CRYA 4P56A 2PFYA 3CG3A 4ND9A 1N3XA 5CMBA 2O7IA 2CZKA 4G8NA 4DI3D
chains in the Genus database with same CATH topology
3SESA 2PBWA 4FECA 4GOTA 4JXIA 2ZNSA 1D3KA 3K6VA 1BLFA 3MWBA 1Y3PA 4OEVA 3WAEA 4DCYA 4EDPA 3TEPA 2Z23A 3LSWA 5CBSA 4U22A 5M2VA 2ABHA 1MXZA 3RN8A 5H8HA 1PB7A 1H76A 4QSEA 2ONRA 3PD8A 4HCYA 4NE4A 3ZS6A 2M8CA 4MLVA 3O9PA 1ATGA 2DS9A 1B58A 2DXYA 2RC9A 4NF6A 4R72A 4IY6A 4RK9A 1O64A 4OENA 3MVYA 1AMFA 4QFKA 5TPAB 5KCJA 5I2KA 3JV9A 4ZZEA 1H45A 3FJGA 4ZEBA 1R6ZA 2DE2A 2XD3A 4KCCA 4QFLA 3Q26A 2X26A 1D9YA 2I49A 3IOWA 1FTOA 3MVXA 4WXJA 2F97A 3U94A 2QS1A 1XOCA 1SVXB 3S9MC 3CR9A 4NF4B 4OEUA 5KDTA 1IZ1A 1B3HA 4OETA 2HQ0A 2GH9A 3CVGA 2XXHA 1MPCA 2O6AA 5K2YA 2I0BA 1Y1ZA 4UA8A 1URGA 4ONYA 2H5YA 1LB9A 4PP0A 5I56B 1LAXA 3TTKA 4GXAA 3M3KA 4GRKA 1D4NA 2QPQA 2HZLA 4P0IA 3KN8A 2OK2A 2F36A 1FQEA 3IL1B 3MVZA 3KZGA 4X48A 5KZTA 4KYEA 1B40A 4ZZAA 1AOVA 4ISUA 4F3PA 2DWAA 3UORA 2UVGA 3VLVA 3OO7A 1DPPA 4QFPA 3KOTA 5H8NB 2XX8A 1WODA 1XVXA 4OFJA 3OEKA 1NH7A 1VSOA 3A3CA 3RTWB 1MQJA 3K1PA 5ITPA 4M4GA 3H6VA 3KGCA 4WEPA 5KCJB 3KSJA 1MXWA 1OMPA 1JW5A 2H98A 2DYXA 3K00A 4L17A 2RCBA 2QS2A 4XTCQ 1MDQA 1N84A 2O84X 2P0SA 3HHFA 4THIA 1IIWA 1MDP1 1Y3QA 3PPOA 1B7UA 4H65A 4OYVA 1GVCA 5AA2A 4HS7A 1IXIA 1BKAA 5EHSA 1B4HA 3O6IA 1YAEA 2G29A 3UIFA 1DTZA 1SDXA 1N7XA 2ZXTA 2YLNA 4IB2A 4RPOA 3SEUA 3TODA 3QXMA 4YICA 4C0RA 1S9TA 3TELA 3PUVE 1MXYA 2XXYA 3OD7A 1EZ9A 1PB8A 4MBPA 4H6DA 5EHMA 4WEDA 4DCXA 4EXKA 1B6HA 2E1SA 1JVYA 1XT8A 4PQJA 4BDLA 3PMVA 5DVIA 3VLWA 1FCKA 1EU8A 3OXNA 4QFNA 1S50A 3CFZA 3U92A 2QS4A 2QL3A 4GL8A 4ECFA 1MPDA 2DWJA 2O1MA 3SDFA 4U21A 1HSEA 3UN6A 4NF8B 4RXLA 4YKPA 3KSXA 5I2NA 5AA1A 3HHGA 3SEYA 4U4SA 1POTA 4PE5B 3ECRA 4EF1A 4XIGQ 2H4IA 4KQPA 3K02A 4YB7A 1SYHA 3MZ1A 4IO2A 3QAXA 4XKNA 3CSBA 3LBSA 1Y1MA 3MJNA 1PBPA 3PV0E 1ANFA 2O69A 3IK6B 1H3DA 4MLQA 4OQOA 5TPAA 2NVUB 4KFQA 1OLAA 1Y4CA 3MUQA 2Y7WA 2Y84A 4F1UA 2RC8A 4FE8A 1QJMA 3FVOA 4TLMB 1KWHA 3TYHA 3IB1A 4LZ7A 3DP4A 3FV1A 3HV1A 3K6UA 1ZTYA 1CB6A 1PDAA 3GBAA 3I3VA 4AB6A 3HO7A 5B7DA 1TT1A 4H1XA 4P0GA 4YMAA 1PEBA 4H5GA 3V5AA 2H99A 3L6HA 2VGQA 5DEXA 5AA2D 5F1QA 3PUWE 1TFDA 4R6HA 4TOZA 3C34A 3BBRA 4HTGA 1CE2A 2QMWA 3K2DA 2V25A 1JNFA 3IJXB 3UP9A 3HCQA 5TP9A 5CBRA 3KEIA 3QUFA 2Y7IA 3RPWA 1Z7NE 3KG2A 1QULA 2O51A 2ZMBA 5I58B 3M3FA 5H8FA 1B1HA 1GR2A 1WVJA 4EQ9A 2OJTA 4OHNA 1FTKA 2UYFA 5J1DA 1P1QA 3K01A 4YKKA 4LZ8A 4F2QA 1POY1 3RT6B 3QIMA 2F5XA 2V3TA 3W15C 4KD5A 4F3SA 3EHTA 1ZU0A 3M3LA 4YMBA 3K4UA 1A8EA 4YB6A 2OBGA 1SW5A 3H03A 2DE4A 5FHOA 1B7ZA 4H67A 4IGRA 1VE4A 2XXRA 3DM0A 1LCFA 4ELQA 3SEVA 3ODBA 3Q27A 3O6GA 4GIZA 5JK4A 2R6GE 1A54A 2F78A 3OENA 2XD2A 4FIMA 4NF6B 4OERA 2RC7A 3KJTA 1FQBA 3CFXA 5DYHA 1SI1A 3IB0A 3SKPA 3PUXE 1A8FA 1I6BA 1P1OA 2OWTA 4DXUA 1LSTA 3GBBA 4H0WA 2UVIA 3PD9A 1DPEA 1MG1A 3E9XA 3MP1A 2B65A 1NMUA 3MZBA 3LR1A 2H25A 1QVSA 1B1XA 4WKMA 3RQTA 1OLCA 3TPAA 1R1NA 3C31A 4AB5A 4GQOA 3CRBA 4QHQA 1VR5A 1LGBC 2ALUA 4RA1A 4AQ4A 1UTHA 3UGWA 3IJOB 2ANJA 3KFMA 3T93B 4DDDA 1NKXA 1NNFA 3N26A 4KPTA 4OFOA 3FD3A 5H8QB 4YZZA 1YPNA 2V3QA 1B05A 2DOJA 2Q8JA 1XHYA 3D4GA 3ZKKA 1SI0A 4YU0A 5DVJA 4EUOA 3G3JA 2D3IA 2Q9TA 2QRYA 2UVHA 3QUJA 1JW1A 4GXSB 4X9TA 5TU0A 1B5IA 4FAJA 4EQBA 3HN0A 1UTBA 1DMBA 3PUYE 1PBQA 4F3GA 1P1UA 4QF9A 1MQDA 2FYIA 1IEJA 2ZYMA 4R9GA 3T9VA 2B3BA 4KI0E 4R2FA 4I8CA 1SW4A 2F6PA 2VD3A 1TWYA 2HCAA 4OVJA 4ZEFA 5I2KB 4R75A 3PU5A 5A5XA 4U23A 4RY1A 2OWSA 4FJPA 1B52A 4TLLB 3V83A 1MY4A 3H4ZA 5CC2A 3B6TA 2R71A 3DELB 5DT6A 3D4CA 1N3WA 4POWA 3H6TA 5FHMA 3IOVA 2I3VA 1GV8A 4K3FA 3TCFA 3OMBA 4LUBA 3MQ9A 2V3UA 4GLIA 3W9VA 3TAJA 1MXUA 3TUSA 4QSCA 3CI8A 4BDOA 3KBRA 1DOTA 4NF5B 4GD5A 3U1OA 3GXAA 1LFHA 2DVZA 3OOAA 5DTBA 2QMXA 1F9BA 2Z8EA 4Q0CA 1P1WA 1ZBMA 4XKRA 5I59B 1P1NA 5ICQA 3RNNA 1SBPA 1OIBA 2HAVA 4LONB 3F11A 1VFEA 4MFIA 5DEXB 2F6GA 4F1VA 4ZEDA 2VHAA 3S2VA 1ZIUA 4GFRA 1B3FA 4HCWA 4IO7A 1QUJA 3TCGA 2OCUA 1M5EA 3FIRA 3FVGA 4FEDA 4MF3A 3TTRA 4OTEA 4ESWA 2PT2A 2HFBA 3QYTA 1US4A 3EF7A 1GTKA 4I1DA 4EF2A 1Q35A 2V93A 2OZZA 2F34A 3IO6A 3USDA 2BJJX 1B3GA 1UQWA 2AIXA 5ELVA 4BDNA 3TCHA 3FXUA 4F39A 2VOZA 1XS5A 2H9BA 4JBZA 1MY3A 2ESNA 4H5FA 4EXLA 1FTMA 5BUUA 3C35A 4G2ZA 2Z8DA 4LQ2A 3E13X 1A7LA 3FGSA 3PPNA 1FTLA 3O28A 1N76A 3OEMA 4DE8A 5ISUA 3T96B 4X1DA 4R6KA 4OZ9A 3HPIA 3PUZE 4YAHX 1GGGA 3IAZA 2XXVA 4ZS9A 5I57B 1Y3NA 2F7BA 3Q25A 4GF8A 1Y9UA 1IUDA 4BDRA 2ZYKA 3T66A 4U4XA 1FQAA 2FNCA 1S7YA 2X7QA 5H8FB 1LAGE 4PETA 3FASA 2IA4A 2REJA 4ZDMA 2DWIA 2GHAA 3LC8A 4O3BA 1B0HA 1Y4TA 2D21A 5FTIA 2VD2A 1FQCA 1R9QA 3S9NC 2HXWA 4E0WA 4FEBA 3TFLA 3K6WA 3GZGA 3U8QA 4H8JA 4EQ7A 1H44A 1JW4A 2RKMA 3IX1A 3QK6A 4LZ5A 1NFTA 1LFIA 3LSLA 1I69A 1UTHB 3OSQA 4NF4A 2XXXA 5F7VA 3VDFA 3RGYA 4F1YA 4HW8A 4NTLA 2PT1A 1FQDA 3K1NA 1US5A 3Q28A 4F2OA 3PPRA 1II5A 3FXQA 2XXUA 3PMWA 3KOSA 2DE3A 4PFYA 2QS3A 5CMMA 2IEEA 2NUVA 2XHDA 4BDMA 3JZJA 1IXHA 4JB7A 2RINA 4R9FA 5FHNA 4PFTA 4JSOA 1FTJA 1N04A 4G68A 4QSDA 2VP1A 3S9EA 2DWHA 3I6VA 1B46A 1EH3A 4OWDA 2XXIA 1MS7A 2HEUA 2XX7A 3VE1B 4I62A 2PX1A 2R9JA 1MPBA 5H8SA 1B0LA 4F3BA 4R73A 3H7MA 4ZECA 2Y7KA 3DP6A 1URDA 3O29A 1DSNA 2NXOA 4U1ZA 4ZEIA 3FUZA 4GWOA 1UTBB 1ZMGA 4BDQA 1B9JA 3FJMA 1A99A 1A55A 1N7WA 3CG1A 1B5HA 2DXRA 2RF1A 3EHSA 3FVKA 3MVWA 1AL3A 3Q29A 4Z7EA 3FATA 3MW0A 4Q5TA 3T9UA 1JEVA 1MRPA 1M5FA 1MY0A 3E3KA 3G3IA 3BFTA 3TTNA 5I56A 4NWCA 5AA3A 1LAHE 1NNPA 5H8QA 3V89B 5B70A 3BKIB 4JWXA 1B2HA 3IR1A 4IO5A 4FORA 3MPLA 4G68B 5TP9B 4BLAA 4RYAA 1LAFE 5JTYB 1SQYA 4H8IA 2O68A 5AE4A 4QRZA 3TMGA 4NF5A 5I84A 1EZPA 4OFLA 2THIA 3JYRA 5I57A 3THIA 5AA2B 4I9DA 3MAMA 2Y7PA 3RY3A 2QJEA 2D5WA 1QW0A 4ZE9A 3MZ9A 1QUIA 2Q2CA 2XXPA 4G8MA 4NMYA 3K0VA 4ZEKA 1Y20A 1JEUA 3KN3A 4LP2B 3ZSFA 1RYXA 5JTYA 2REGA 3EQ1A 1YCJA 3CFLA 4IY5A 3TTMA 3EN3A 3IOTA 1MY2A 2UVJA 1BP5A 1M5DA 1NH8A 5H8NA 3EPEA 3FVNA 2ZYOA 5A5XB 5CI5A 4C1TA 2F8DA 1Z7ME 4G8HA 2CMOA 1B7HA 4JWYA 4LA9A 3ILTB 3H3GA 3KJ7A 1MQIA 1MXVA 1JQFA 2PVUA 1NNTA 3IOUA 4MH5A 4DIGA 3FJ7A 2P1SA 3VV5A 4LATA 3OSRA 2GHBA 1O7TA 4XKPA 4G77A 3C9HA 3N6UA 5CMKA 4NWDA 4IGTA 3K6XA 3QSLA 1M5CA 4RK2A 1JETA 1I6QA 1P99A 3RTFB 2E0SA 3DLNA 1YTVA 1IQ7A 4DXBA 4F19A 1T0KA 1PB9A 1RKMA 4YB5A 2ZYNA 3TZAA 5CMCA 4ESXA 3V8XB 3M8UA 4KHZE 4Q30B 3TTLA 2Z8FA 3O97A 5HPQA 3LUYA 2I6EA 2WKYA 1LFGA 2O7UA 4LQ5A 4G68C 4OXVA 4R74A 3VVDA 3C33A 1OVBA 4O3AA 4YKIA 3TDJA 5IAIA 5L9SA 4M1VA 1JVXA 2DP8A 1FQFA 3TQWA 3E4RA 3FZVA 1MH3A 2Y7RA 4Q8RA 2CZLA 3R26A 3C4MA 1URSA 2YJPA 3SEWA 1LBCA 4G4PA 1SW1A 4KR5A 3I5OA 5L9MA 4ELRA 4F31B 3K1MA 4N07A 4DZ1A 3MP6A 5JEIA 1ELJA 3VXCA 2ZNTA 4IO3A 5BWJA 3U93A 2Z22A 2I0CA 3EHUA 4PFWA 2A5TA 1N0TA 4POXA 3TKDA 3T9XB 3G7WA 4RJZA 2QSXA 2HZKA 4OESA 1BTJA 4U1OA 3VLUA 1IXGA 1O63A 2UXAA 2YPNA 3MP8A 1WDNA 4XKQA 1USYH 2W7YA 3G3FA 4JDFA 4Z0IA 3RUMA 3TQLA 5EYFA 3UK4A 3S4UA 3VVEA 4P11A 1D9VA 2A5SA 3B6WA 2LAOA 5FTHA 2F35A 1HSJA 4IO4A 2O1LA 4F18A 5KDTB 4ELOA 2I58A 3IORA 2P2AA 4U2RA 4X1BA 3VFJA 1B4ZA 2DQVA 3PGFA 4C1UA 5CM6A 5I58A 5IKBA 5K2XA 3VVFA 1LCTA 4TQUQ 1BIYA 2ONSA 3H6UA 3C32A 4LVQA 2G93A 1EZOA 1MM7A 3P7IA 3R6UA 4NEDA 2OLBA 1OQGA 3UA8A 2DVCA 4JWOA 2I4CA 1FW0A 3MPKA 3O2AA 3W9WA 2GRVA 4JSDA 1J1NA 2XXQA 2HAUA 1B32A 4DXCA 1OQHA 2UYEA 3O6HA 1LB8A 3O66A 4O3CA 4RPNA 1IXCA 3AXFA 3H06B 1Q1KA 1AH5A 3S9LC 1DTGA 1ZLQA 1SW2A 3C36A 3HSTA 3N5LA 3PMXA 4GL0A 3LSFB 4GVOA 4IO6A 3FV2A 3ILUB 3A09A 1SYIA 3ZKLA 3R7XA 1LLSA 1NNKA 1XC1A 2FA7A 3PPQA 4KYSA 4KCDA 5L9OA 1TXFA 1B3LA 4DLDA 1QUKA 2PMSA 3MC2A 2X7PA 1UIUA 3A3UA 1MQGA 4XXUA 4UACA 1NL5A 4QFOA 1XVYA 1A40A 5HM4B 5ICTA 1PC3A 4N13A 1B5JA 1MQHA 3T22A 1H43A 2XXWA 1TFAA 4NF8A 4YKJA 1AIVA 1RYOA 2B3FA 3OO8A 4PFUA 3FXRA 4KYDA 1MM6A 3SERA 2NOOA 2KLFA 1UIVA 5DVFA 3RLFE 3SEXA 4R2BA 2Q89A 3PPPA 4F22A 1R9LA 2AYSA 4RNSA 5LOMA 2V84A 1LBBA 2ONKE 1SD3A 2AL4A 2I3WA 1B3EA 2A5TB 4OMBA 2RCAA 3CIJA 1QKBA 3N94A 3OELA 1B51A 3N6TA 2Q2AA 5ITOA 2I48A 1MXXA 3ONMA 4FATA 5AA4B 1QKAA 3MBPA 5L8DA 1ZJLA 3L6GA 3B6QA 5HBCA 1USYE 2F7AA 3VXBA 3WAFA 4ZE8A 3OO9A 2Q88A 4E0XA 3U72A 1OVTA 3IO4A 4ELPA 5I2NB 1M5BA 1MY1A 3CSGA 2AL5A 5CRYA 2ZNUA 1IITA 1I6AA 3G3GA 1MH4A 3RT8A 2GFEA 4N6PA 3CG3A 5AA4A 2XXTA 3G3KA 3KN7A 2NWJA 4ND9A 3B7DA 3H6WA 2I4BA 5I59A 3G3HA 3T9HB 2F7CA 1N3XA 5H8HB 1ZKBA 3BFUA 3OO6A 1HSLA 2DSFA 2O7IA 2XX9A 3GLBA 3IB2A 3LSXA 5CMBA 4F29A 1VFDA 3DP8A 4R6YA 4G8NA 2PYYA 3SETA 1L5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SES A;  2PBW A;  4FEC A;  4GOT A;  4JXI A;  2ZNS A;  1D3K A;  3K6V A;  1BLF A;  3MWB A;  1Y3P A;  4OEV A;  3WAE A;  4DCY A;  4EDP A;  3TEP A;  2Z23 A;  3LSW A;  5CBS A;  4U22 A;  5M2V A;  2ABH A;  1MXZ A;  3RN8 A;  5H8H A;  1PB7 A;  1H76 A;  4QSE A;  2ONR A;  3PD8 A;  4HCY A;  4NE4 A;  3ZS6 A;  2M8C A;  4MLV A;  3O9P A;  1ATG A;  2DS9 A;  1B58 A;  2DXY A;  2RC9 A;  4NF6 A;  4R72 A;  4IY6 A;  4RK9 A;  1O64 A;  4OEN A;  3MVY A;  1AMF A;  4QFK A;  5TPA B;  5KCJ A;  5I2K A;  3JV9 A;  4ZZE A;  1H45 A;  3FJG A;  4ZEB A;  1R6Z A;  2DE2 A;  2XD3 A;  4KCC A;  4QFL A;  3Q26 A;  2X26 A;  1D9Y A;  2I49 A;  3IOW A;  1FTO A;  3MVX A;  4WXJ A;  2F97 A;  3U94 A;  2QS1 A;  1XOC A;  1SVX B;  3S9M C;  3CR9 A;  4NF4 B;  4OEU A;  5KDT A;  1IZ1 A;  1B3H A;  4OET A;  2HQ0 A;  2GH9 A;  3CVG A;  2XXH A;  1MPC A;  2O6A A;  5K2Y A;  2I0B A;  1Y1Z A;  4UA8 A;  1URG A;  4ONY A;  2H5Y A;  1LB9 A;  4PP0 A;  5I56 B;  1LAX A;  3TTK A;  4GXA A;  3M3K A;  4GRK A;  1D4N A;  2QPQ A;  2HZL A;  4P0I A;  3KN8 A;  2OK2 A;  2F36 A;  1FQE A;  3IL1 B;  3MVZ A;  3KZG A;  4X48 A;  5KZT A;  4KYE A;  1B40 A;  4ZZA A;  1AOV A;  4ISU A;  4F3P A;  2DWA A;  3UOR A;  2UVG A;  3VLV A;  3OO7 A;  1DPP A;  4QFP A;  3KOT A;  5H8N B;  2XX8 A;  1WOD A;  1XVX A;  4OFJ A;  3OEK A;  1NH7 A;  1VSO A;  3A3C A;  3RTW B;  1MQJ A;  3K1P A;  5ITP A;  4M4G A;  3H6V A;  3KGC A;  4WEP A;  5KCJ B;  3KSJ A;  1MXW A;  1OMP A;  1JW5 A;  2H98 A;  2DYX A;  3K00 A;  4L17 A;  2RCB A;  2QS2 A;  4XTC Q;  1MDQ A;  1N84 A;  2O84 X;  2P0S A;  3HHF A;  4THI A;  1IIW A;  1MDP 1;  1Y3Q A;  3PPO A;  1B7U A;  4H65 A;  4OYV A;  1GVC A;  5AA2 A;  4HS7 A;  1IXI A;  1BKA A;  5EHS A;  1B4H A;  3O6I A;  1YAE A;  2G29 A;  3UIF A;  1DTZ A;  1SDX A;  1N7X A;  2ZXT A;  2YLN A;  4IB2 A;  4RPO A;  3SEU A;  3TOD A;  3QXM A;  4YIC A;  4C0R A;  1S9T A;  3TEL A;  3PUV E;  1MXY A;  2XXY A;  3OD7 A;  1EZ9 A;  1PB8 A;  4MBP A;  4H6D A;  5EHM A;  4WED A;  4DCX A;  4EXK A;  1B6H A;  2E1S A;  1JVY A;  1XT8 A;  4PQJ A;  4BDL A;  3PMV A;  5DVI A;  3VLW A;  1FCK A;  1EU8 A;  3OXN A;  4QFN A;  1S50 A;  3CFZ A;  3U92 A;  2QS4 A;  2QL3 A;  4GL8 A;  4ECF A;  1MPD A;  2DWJ A;  2O1M A;  3SDF A;  4U21 A;  1HSE A;  3UN6 A;  4NF8 B;  4RXL A;  4YKP A;  3KSX A;  5I2N A;  5AA1 A;  3HHG A;  3SEY A;  4U4S A;  1POT A;  4PE5 B;  3ECR A;  4EF1 A;  4XIG Q;  2H4I A;  4KQP A;  3K02 A;  4YB7 A;  1SYH A;  3MZ1 A;  4IO2 A;  3QAX A;  4XKN A;  3CSB A;  3LBS A;  1Y1M A;  3MJN A;  1PBP A;  3PV0 E;  1ANF A;  2O69 A;  3IK6 B;  1H3D A;  4MLQ A;  4OQO A;  5TPA A;  2NVU B;  4KFQ A;  1OLA A;  1Y4C A;  3MUQ A;  2Y7W A;  2Y84 A;  4F1U A;  2RC8 A;  4FE8 A;  1QJM A;  3FVO A;  4TLM B;  1KWH A;  3TYH A;  3IB1 A;  4LZ7 A;  3DP4 A;  3FV1 A;  3HV1 A;  3K6U A;  1ZTY A;  1CB6 A;  1PDA A;  3GBA A;  3I3V A;  4AB6 A;  3HO7 A;  5B7D A;  1TT1 A;  4H1X A;  4P0G A;  4YMA A;  1PEB A;  4H5G A;  3V5A A;  2H99 A;  3L6H A;  2VGQ A;  5DEX A;  5AA2 D;  5F1Q A;  3PUW E;  1TFD A;  4R6H A;  4TOZ A;  3C34 A;  3BBR A;  4HTG A;  1CE2 A;  2QMW A;  3K2D A;  2V25 A;  1JNF A;  3IJX B;  3UP9 A;  3HCQ A;  5TP9 A;  5CBR A;  3KEI A;  3QUF A;  2Y7I A;  3RPW A;  1Z7N E;  3KG2 A;  1QUL A;  2O51 A;  2ZMB A;  5I58 B;  3M3F A;  5H8F A;  1B1H A;  1GR2 A;  1WVJ A;  4EQ9 A;  2OJT A;  4OHN A;  1FTK A;  2UYF A;  5J1D A;  1P1Q A;  3K01 A;  4YKK A;  4LZ8 A;  4F2Q A;  1POY 1;  3RT6 B;  3QIM A;  2F5X A;  2V3T A;  3W15 C;  4KD5 A;  4F3S A;  3EHT A;  1ZU0 A;  3M3L A;  4YMB A;  3K4U A;  1A8E A;  4YB6 A;  2OBG A;  1SW5 A;  3H03 A;  2DE4 A;  5FHO A;  1B7Z A;  4H67 A;  4IGR A;  1VE4 A;  2XXR A;  3DM0 A;  1LCF A;  4ELQ A;  3SEV A;  3ODB A;  3Q27 A;  3O6G A;  4GIZ A;  5JK4 A;  2R6G E;  1A54 A;  2F78 A;  3OEN A;  2XD2 A;  4FIM A;  4NF6 B;  4OER A;  2RC7 A;  3KJT A;  1FQB A;  3CFX A;  5DYH A;  1SI1 A;  3IB0 A;  3SKP A;  3PUX E;  1A8F A;  1I6B A;  1P1O A;  2OWT A;  4DXU A;  1LST A;  3GBB A;  4H0W A;  2UVI A;  3PD9 A;  1DPE A;  1MG1 A;  3E9X A;  3MP1 A;  2B65 A;  1NMU A;  3MZB A;  3LR1 A;  2H25 A;  1QVS A;  1B1X A;  4WKM A;  3RQT A;  1OLC A;  3TPA A;  1R1N A;  3C31 A;  4AB5 A;  4GQO A;  3CRB A;  4QHQ A;  1VR5 A;  1LGB C;  2ALU A;  4RA1 A;  4AQ4 A;  1UTH A;  3UGW A;  3IJO B;  2ANJ A;  3KFM A;  3T93 B;  4DDD A;  1NKX A;  1NNF A;  3N26 A;  4KPT A;  4OFO A;  3FD3 A;  5H8Q B;  4YZZ A;  1YPN A;  2V3Q A;  1B05 A;  2DOJ A;  2Q8J A;  1XHY A;  3D4G A;  3ZKK A;  1SI0 A;  4YU0 A;  5DVJ A;  4EUO A;  3G3J A;  2D3I A;  2Q9T A;  2QRY A;  2UVH A;  3QUJ A;  1JW1 A;  4GXS B;  4X9T A;  5TU0 A;  1B5I A;  4FAJ A;  4EQB A;  3HN0 A;  1UTB A;  1DMB A;  3PUY E;  1PBQ A;  4F3G A;  1P1U A;  4QF9 A;  1MQD A;  2FYI A;  1IEJ A;  2ZYM A;  4R9G A;  3T9V A;  2B3B A;  4KI0 E;  4R2F A;  4I8C A;  1SW4 A;  2F6P A;  2VD3 A;  1TWY A;  2HCA A;  4OVJ A;  4ZEF A;  5I2K B;  4R75 A;  3PU5 A;  5A5X A;  4U23 A;  4RY1 A;  2OWS A;  4FJP A;  1B52 A;  4TLL B;  3V83 A;  1MY4 A;  3H4Z A;  5CC2 A;  3B6T A;  2R71 A;  3DEL B;  5DT6 A;  3D4C A;  1N3W A;  4POW A;  3H6T A;  5FHM A;  3IOV A;  2I3V A;  1GV8 A;  4K3F A;  3TCF A;  3OMB A;  4LUB A;  3MQ9 A;  2V3U A;  4GLI A;  3W9V A;  3TAJ A;  1MXU A;  3TUS A;  4QSC A;  3CI8 A;  4BDO A;  3KBR A;  1DOT A;  4NF5 B;  4GD5 A;  3U1O A;  3GXA A;  1LFH A;  2DVZ A;  3OOA A;  5DTB A;  2QMX A;  1F9B A;  2Z8E A;  4Q0C A;  1P1W A;  1ZBM A;  4XKR A;  5I59 B;  1P1N A;  5ICQ A;  3RNN A;  1SBP A;  1OIB A;  2HAV A;  4LON B;  3F11 A;  1VFE A;  4MFI A;  5DEX B;  2F6G A;  4F1V A;  4ZED A;  2VHA A;  3S2V A;  1ZIU A;  4GFR A;  1B3F A;  4HCW A;  4IO7 A;  1QUJ A;  3TCG A;  2OCU A;  1M5E A;  3FIR A;  3FVG A;  4FED A;  4MF3 A;  3TTR A;  4OTE A;  4ESW A;  2PT2 A;  2HFB A;  3QYT A;  1US4 A;  3EF7 A;  1GTK A;  4I1D A;  4EF2 A;  1Q35 A;  2V93 A;  2OZZ A;  2F34 A;  3IO6 A;  3USD A;  2BJJ X;  1B3G A;  1UQW A;  2AIX A;  5ELV A;  4BDN A;  3TCH A;  3FXU A;  4F39 A;  2VOZ A;  1XS5 A;  2H9B A;  4JBZ A;  1MY3 A;  2ESN A;  4H5F A;  4EXL A;  1FTM A;  5BUU A;  3C35 A;  4G2Z A;  2Z8D A;  4LQ2 A;  3E13 X;  1A7L A;  3FGS A;  3PPN A;  1FTL A;  3O28 A;  1N76 A;  3OEM A;  4DE8 A;  5ISU A;  3T96 B;  4X1D A;  4R6K A;  4OZ9 A;  3HPI A;  3PUZ E;  4YAH X;  1GGG A;  3IAZ A;  2XXV A;  4ZS9 A;  5I57 B;  1Y3N A;  2F7B A;  3Q25 A;  4GF8 A;  1Y9U A;  1IUD A;  4BDR A;  2ZYK A;  3T66 A;  4U4X A;  1FQA A;  2FNC A;  1S7Y A;  2X7Q A;  5H8F B;  1LAG E;  4PET A;  3FAS A;  2IA4 A;  2REJ A;  4ZDM A;  2DWI A;  2GHA A;  3LC8 A;  4O3B A;  1B0H A;  1Y4T A;  2D21 A;  5FTI A;  2VD2 A;  1FQC A;  1R9Q A;  3S9N C;  2HXW A;  4E0W A;  4FEB A;  3TFL A;  3K6W A;  3GZG A;  3U8Q A;  4H8J A;  4EQ7 A;  1H44 A;  1JW4 A;  2RKM A;  3IX1 A;  3QK6 A;  4LZ5 A;  1NFT A;  1LFI A;  3LSL A;  1I69 A;  1UTH B;  3OSQ A;  4NF4 A;  2XXX A;  5F7V A;  3VDF A;  3RGY A;  4F1Y A;  4HW8 A;  4NTL A;  2PT1 A;  1FQD A;  3K1N A;  1US5 A;  3Q28 A;  4F2O A;  3PPR A;  1II5 A;  3FXQ A;  2XXU A;  3PMW A;  3KOS A;  2DE3 A;  4PFY A;  2QS3 A;  5CMM A;  2IEE A;  2NUV A;  2XHD A;  4BDM A;  3JZJ A;  1IXH A;  4JB7 A;  2RIN A;  4R9F A;  5FHN A;  4PFT A;  4JSO A;  1FTJ A;  1N04 A;  4G68 A;  4QSD A;  2VP1 A;  3S9E A;  2DWH A;  3I6V A;  1B46 A;  1EH3 A;  4OWD A;  2XXI A;  1MS7 A;  2HEU A;  2XX7 A;  3VE1 B;  4I62 A;  2PX1 A;  2R9J A;  1MPB A;  5H8S A;  1B0L A;  4F3B A;  4R73 A;  3H7M A;  4ZEC A;  2Y7K A;  3DP6 A;  1URD A;  3O29 A;  1DSN A;  2NXO A;  4U1Z A;  4ZEI A;  3FUZ A;  4GWO A;  1UTB B;  1ZMG A;  4BDQ A;  1B9J A;  3FJM A;  1A99 A;  1A55 A;  1N7W A;  3CG1 A;  1B5H A;  2DXR A;  2RF1 A;  3EHS A;  3FVK A;  3MVW A;  1AL3 A;  3Q29 A;  4Z7E A;  3FAT A;  3MW0 A;  4Q5T A;  3T9U A;  1JEV A;  1MRP A;  1M5F A;  1MY0 A;  3E3K A;  3G3I A;  3BFT A;  3TTN A;  5I56 A;  4NWC A;  5AA3 A;  1LAH E;  1NNP A;  5H8Q A;  3V89 B;  5B70 A;  3BKI B;  4JWX A;  1B2H A;  3IR1 A;  4IO5 A;  4FOR A;  3MPL A;  4G68 B;  5TP9 B;  4BLA A;  4RYA A;  1LAF E;  5JTY B;  1SQY A;  4H8I A;  2O68 A;  5AE4 A;  4QRZ A;  3TMG A;  4NF5 A;  5I84 A;  1EZP A;  4OFL A;  2THI A;  3JYR A;  5I57 A;  3THI A;  5AA2 B;  4I9D A;  3MAM A;  2Y7P A;  3RY3 A;  2QJE A;  2D5W A;  1QW0 A;  4ZE9 A;  3MZ9 A;  1QUI A;  2Q2C A;  2XXP A;  4G8M A;  4NMY A;  3K0V A;  4ZEK A;  1Y20 A;  1JEU A;  3KN3 A;  4LP2 B;  3ZSF A;  1RYX A;  5JTY A;  2REG A;  3EQ1 A;  1YCJ A;  3CFL A;  4IY5 A;  3TTM A;  3EN3 A;  3IOT A;  1MY2 A;  2UVJ A;  1BP5 A;  1M5D A;  1NH8 A;  5H8N A;  3EPE A;  3FVN A;  2ZYO A;  5A5X B;  5CI5 A;  4C1T A;  2F8D A;  1Z7M E;  4G8H A;  2CMO A;  1B7H A;  4JWY A;  4LA9 A;  3ILT B;  3H3G A;  3KJ7 A;  1MQI A;  1MXV A;  1JQF A;  2PVU A;  1NNT A;  3IOU A;  4MH5 A;  4DIG A;  3FJ7 A;  2P1S A;  3VV5 A;  4LAT A;  3OSR A;  2GHB A;  1O7T A;  4XKP A;  4G77 A;  3C9H A;  3N6U A;  5CMK A;  4NWD A;  4IGT A;  3K6X A;  3QSL A;  1M5C A;  4RK2 A;  1JET A;  1I6Q A;  1P99 A;  3RTF B;  2E0S A;  3DLN A;  1YTV A;  1IQ7 A;  4DXB A;  4F19 A;  1T0K A;  1PB9 A;  1RKM A;  4YB5 A;  2ZYN A;  3TZA A;  5CMC A;  4ESX A;  3V8X B;  3M8U A;  4KHZ E;  4Q30 B;  3TTL A;  2Z8F A;  3O97 A;  5HPQ A;  3LUY A;  2I6E A;  2WKY A;  1LFG A;  2O7U A;  4LQ5 A;  4G68 C;  4OXV A;  4R74 A;  3VVD A;  3C33 A;  1OVB A;  4O3A A;  4YKI A;  3TDJ A;  5IAI A;  5L9S A;  4M1V A;  1JVX A;  2DP8 A;  1FQF A;  3TQW A;  3E4R A;  3FZV A;  1MH3 A;  2Y7R A;  4Q8R A;  2CZL A;  3R26 A;  3C4M A;  1URS A;  2YJP A;  3SEW A;  1LBC A;  4G4P A;  1SW1 A;  4KR5 A;  3I5O A;  5L9M A;  4ELR A;  4F31 B;  3K1M A;  4N07 A;  4DZ1 A;  3MP6 A;  5JEI A;  1ELJ A;  3VXC A;  2ZNT A;  4IO3 A;  5BWJ A;  3U93 A;  2Z22 A;  2I0C A;  3EHU A;  4PFW A;  2A5T A;  1N0T A;  4POX A;  3TKD A;  3T9X B;  3G7W A;  4RJZ A;  2QSX A;  2HZK A;  4OES A;  1BTJ A;  4U1O A;  3VLU A;  1IXG A;  1O63 A;  2UXA A;  2YPN A;  3MP8 A;  1WDN A;  4XKQ A;  1USY H;  2W7Y A;  3G3F A;  4JDF A;  4Z0I A;  3RUM A;  3TQL A;  5EYF A;  3UK4 A;  3S4U A;  3VVE A;  4P11 A;  1D9V A;  2A5S A;  3B6W A;  2LAO A;  5FTH A;  2F35 A;  1HSJ A;  4IO4 A;  2O1L A;  4F18 A;  5KDT B;  4ELO A;  2I58 A;  3IOR A;  2P2A A;  4U2R A;  4X1B A;  3VFJ A;  1B4Z A;  2DQV A;  3PGF A;  4C1U A;  5CM6 A;  5I58 A;  5IKB A;  5K2X A;  3VVF A;  1LCT A;  4TQU Q;  1BIY A;  2ONS A;  3H6U A;  3C32 A;  4LVQ A;  2G93 A;  1EZO A;  1MM7 A;  3P7I A;  3R6U A;  4NED A;  2OLB A;  1OQG A;  3UA8 A;  2DVC A;  4JWO A;  2I4C A;  1FW0 A;  3MPK A;  3O2A A;  3W9W A;  2GRV A;  4JSD A;  1J1N A;  2XXQ A;  2HAU A;  1B32 A;  4DXC A;  1OQH A;  2UYE A;  3O6H A;  1LB8 A;  3O66 A;  4O3C A;  4RPN A;  1IXC A;  3AXF A;  3H06 B;  1Q1K A;  1AH5 A;  3S9L C;  1DTG A;  1ZLQ A;  1SW2 A;  3C36 A;  3HST A;  3N5L A;  3PMX A;  4GL0 A;  3LSF B;  4GVO A;  4IO6 A;  3FV2 A;  3ILU B;  3A09 A;  1SYI A;  3ZKL A;  3R7X A;  1LLS A;  1NNK A;  1XC1 A;  2FA7 A;  3PPQ A;  4KYS A;  4KCD A;  5L9O A;  1TXF A;  1B3L A;  4DLD A;  1QUK A;  2PMS A;  3MC2 A;  2X7P A;  1UIU A;  3A3U A;  1MQG A;  4XXU A;  4UAC A;  1NL5 A;  4QFO A;  1XVY A;  1A40 A;  5HM4 B;  5ICT A;  1PC3 A;  4N13 A;  1B5J A;  1MQH A;  3T22 A;  1H43 A;  2XXW A;  1TFA A;  4NF8 A;  4YKJ A;  1AIV A;  1RYO A;  2B3F A;  3OO8 A;  4PFU A;  3FXR A;  4KYD A;  1MM6 A;  3SER A;  2NOO A;  2KLF A;  1UIV A;  5DVF A;  3RLF E;  3SEX A;  4R2B A;  2Q89 A;  3PPP A;  4F22 A;  1R9L A;  2AYS A;  4RNS A;  5LOM A;  2V84 A;  1LBB A;  2ONK E;  1SD3 A;  2AL4 A;  2I3W A;  1B3E A;  2A5T B;  4OMB A;  2RCA A;  3CIJ A;  1QKB A;  3N94 A;  3OEL A;  1B51 A;  3N6T A;  2Q2A A;  5ITO A;  2I48 A;  1MXX A;  3ONM A;  4FAT A;  5AA4 B;  1QKA A;  3MBP A;  5L8D A;  1ZJL A;  3L6G A;  3B6Q A;  5HBC A;  1USY E;  2F7A A;  3VXB A;  3WAF A;  4ZE8 A;  3OO9 A;  2Q88 A;  4E0X A;  3U72 A;  1OVT A;  3IO4 A;  4ELP A;  5I2N B;  1M5B A;  1MY1 A;  3CSG A;  2AL5 A;  5CRY A;  2ZNU A;  1IIT A;  1I6A A;  3G3G A;  1MH4 A;  3RT8 A;  2GFE A;  4N6P A;  3CG3 A;  5AA4 A;  2XXT A;  3G3K A;  3KN7 A;  2NWJ A;  4ND9 A;  3B7D A;  3H6W A;  2I4B A;  5I59 A;  3G3H A;  3T9H B;  2F7C A;  1N3X A;  5H8H B;  1ZKB A;  3BFU A;  3OO6 A;  1HSL A;  2DSF A;  2O7I A;  2XX9 A;  3GLB A;  3IB2 A;  3LSX A;  5CMB A;  4F29 A;  1VFD A;  3DP8 A;  4R6Y A;  4G8N A;  2PYY A;  3SET A;  1L5T A; 
#chains in the Genus database with same CATH topology
 4FEC A;  3K6V A;  4OEV A;  1Y3P A;  3WAE A;  4EDP A;  5CBS A;  4U22 A;  2HXR A;  1MXZ A;  5H8H A;  1H76 A;  1FBF A;  2DXY A;  4NF6 A;  5TPA B;  1EYI A;  1O64 A;  3MVY A;  4QBA A;  5I2K A;  4WXJ A;  2X26 A;  1D9Y A;  4PAK A;  1NV2 A;  3U94 A;  1SVX B;  4X04 A;  1B3H A;  2HQ0 A;  3CVG A;  3RPL B;  4PP0 A;  5ET6 A;  3M3K A;  4GRK A;  3KN8 A;  2F36 A;  1FQE A;  3IL1 B;  4X48 A;  4KYE A;  4ISU A;  3UOR A;  2UVG A;  3VLV A;  4FBP A;  4PFB A;  2XX8 A;  4N17 A;  1WOD A;  3OEK A;  1NH7 A;  2RCB A;  4XTC Q;  1MDQ A;  1N84 A;  1GVC A;  3PPO A;  5AA2 A;  5I7I A;  1B7U A;  4OYV A;  5EHS A;  3O6I A;  3UIF A;  1YAE A;  2G29 A;  1SDX A;  4IB2 A;  3SEU A;  5EQ9 A;  1NV0 A;  1S9T A;  3TEL A;  1EZ9 A;  1PB8 A;  5EHM A;  4DCX A;  2E1S A;  5J16 A;  3PMV A;  1EU8 A;  2QVV A;  4PE3 A;  1S50 A;  4GL8 A;  2O1M A;  3SDF A;  3KSX A;  5AA1 A;  4U4S A;  4PE5 B;  3ECR A;  3MZ1 A;  1NV1 A;  3CSB A;  3PV0 E;  1ANF A;  2O69 A;  3IK6 B;  4OVR A;  1OLA A;  1Y4C A;  4TLM B;  3FVO A;  3IB1 A;  1NV6 A;  3FV1 A;  3HV1 A;  1CB6 A;  3HO7 A;  3V5A A;  2F3B A;  1CE2 A;  2V25 A;  3UP9 A;  3KEI A;  2MKZ A;  4GWW A;  5I58 B;  5H8F A;  1B1H A;  4F2Q A;  3M3L A;  1A8E A;  2OBG A;  1SW5 A;  3SEV A;  3Q27 A;  1A54 A;  4NF6 B;  3E79 A;  4GX3 A;  3IB0 A;  3SKP A;  4JVD A;  1A8F A;  2OWT A;  3PD9 A;  1DPE A;  1MG1 A;  3E9X A;  3MP1 A;  2H25 A;  3TPA A;  1VR5 A;  2WEF A;  4AQ4 A;  3EKI A;  1UTH A;  3UGW A;  3T93 B;  4DDD A;  1NNF A;  3N26 A;  4OFO A;  3FD3 A;  5H8Q B;  2Q8J A;  4YU0 A;  5DVJ A;  2UVH A;  3HN0 A;  3PUY E;  1PBQ A;  4PGP A;  4F3G A;  4QF9 A;  1IEJ A;  4R2F A;  4OVJ A;  4U23 A;  4RY1 A;  4FJP A;  1B52 A;  4MHF A;  4TLL B;  3H4Z A;  3B6T A;  2R8T A;  1N3W A;  3SZP A;  3MQ9 A;  4GLI A;  2PFZ A;  3TUS A;  5DTB A;  1NUX A;  1ZBM A;  5ICQ A;  3RNN A;  4LON B;  4ZED A;  4GWY A;  1FBD A;  2OCU A;  4OVP A;  4FED A;  4MF3 A;  3QYT A;  4I1D A;  2OZZ A;  2BJJ X;  4HXV A;  4PCD A;  5ET8 A;  2VOZ A;  4JBZ A;  1G0H A;  1MY3 A;  4DE8 A;  1N76 A;  3PUZ E;  2GQ1 A;  3IAZ A;  4ZS9 A;  1FQA A;  5EQA A;  4MJO A;  3FAS A;  1B0H A;  2D21 A;  3S9N C;  2VD2 A;  1R9Q A;  3TEP A;  3RYD A;  4FEB A;  3K6W A;  3GZG A;  4O94 A;  4H8J A;  3U8Q A;  4LZ5 A;  1LFI A;  3S9M C;  1I69 A;  4F1Y A;  3RPL A;  4NTL A;  3Q28 A;  1FQD A;  2P3V A;  3PPR A;  3FXQ A;  5CMM A;  3KOS A;  2DE3 A;  2RIN A;  5FHN A;  1N04 A;  4G68 A;  3S9E A;  2DWH A;  1B46 A;  4OWD A;  4I62 A;  2PX1 A;  5H8S A;  1B0L A;  4F3B A;  3H7M A;  2OX3 A;  1K9Y A;  4ZEI A;  2NXO A;  3FUZ A;  4GWO A;  1A55 A;  2DXR A;  4Z7E A;  1MY0 A;  3G3I A;  5AA3 A;  1LAH E;  5H8Q A;  1B2H A;  4G68 B;  5TP9 B;  3NOH A;  4QRZ A;  1EZP A;  3THI A;  4H45 A;  1LBW A;  3MAM A;  2QJE A;  1QUI A;  4ZEK A;  3KN3 A;  1KZ8 A;  5JTY A;  2REG A;  2QVR A;  3IOT A;  1NH8 A;  5A5L A;  5A5X B;  4G8H A;  4JWY A;  3H3G A;  3KJ7 A;  3IOU A;  4LAT A;  2GHB A;  5EQ7 A;  4IGT A;  3QSL A;  2E0S A;  1IQ7 A;  3TZA A;  4ESX A;  3M8U A;  3TTL A;  3O97 A;  2I6E A;  2WKY A;  3VVD A;  4R74 A;  4G68 C;  1OVB A;  3IFA A;  1MH3 A;  2ZZV A;  2CZL A;  1SW1 A;  4IR8 A;  4F31 B;  4N07 A;  4DZ1 A;  3MP6 A;  5IZ3 A;  2ZNT A;  2Z22 A;  4PFW A;  4POX A;  1AWB A;  3G7W A;  4RJZ A;  1BTJ A;  1IXG A;  4XF5 A;  3RUM A;  3UK4 A;  3S4U A;  3VVE A;  2DDK A;  1LEV A;  1HSJ A;  2O1L A;  5KDT B;  3H6U A;  1FTA A;  2G93 A;  1MM7 A;  4I3Y A;  2DVC A;  1FW0 A;  1J1N A;  2UYE A;  2ZZW A;  3AXF A;  3S9L C;  1DTG A;  1SW2 A;  4GVO A;  4GL0 A;  3LSF B;  1LBX A;  1NV7 A;  1XC1 A;  3PPQ A;  4KCD A;  1MQG A;  4QFO A;  5HM4 B;  5I3S A;  4AS4 A;  4KYD A;  2NOO A;  1UIV A;  4GWZ A;  2PCR A;  2V84 A;  2AL4 A;  1B3E A;  2Q74 A;  2RCA A;  1INP A;  3N6T A;  5ITO A;  2I48 A;  1MXX A;  4FAT A;  3B6Q A;  5HBC A;  2F7A A;  2Q88 A;  4E0X A;  5I2N B;  1MY1 A;  2ZNU A;  3T1B A;  2GFE A;  4N6P A;  3G3K A;  5I59 A;  3B7D A;  2I4B A;  3G3H A;  3T9H B;  5H8H B;  1ZKB A;  1HSL A;  2DSF A;  2XX9 A;  4F29 A;  2PYY A;  2BJI A;  2PBW A;  4DCY A;  1BLF A;  3RN8 A;  3ZS6 A;  3PD8 A;  4NE4 A;  1B58 A;  2RC9 A;  5KCJ A;  4OEN A;  4N15 A;  1AMF A;  3FJG A;  2FVZ A;  2I49 A;  4PBQ A;  1FTO A;  3MVX A;  3E78 A;  2WX9 A;  1IZ1 A;  5K2Y A;  1MPC A;  2QVU A;  4UA8 A;  1LAX A;  4GXA A;  1FJ6 A;  2XWI A;  2QPQ A;  2HZL A;  2OK2 A;  3MVZ A;  3KZG A;  4ZZA A;  2DWA A;  4PAF A;  3OO7 A;  1KA0 A;  4OFJ A;  1VSO A;  1MQJ A;  5ITP A;  5KCJ B;  4M4G A;  1JW5 A;  4O8M A;  2DYX A;  3K00 A;  2P0S A;  1IIW A;  1Y3Q A;  4HS7 A;  1BKA A;  4RPO A;  2YLN A;  4XEQ A;  3QXM A;  4C0R A;  3OD7 A;  4WED A;  1XT8 A;  5DVI A;  4HE0 A;  3VLW A;  1MPD A;  4NF8 B;  5I2N A;  1POT A;  4EF1 A;  4XIG Q;  3LBS A;  1Y1M A;  4OQO A;  5TPA A;  4KFQ A;  3MUQ A;  2Y7W A;  4F1U A;  2RC8 A;  1QJM A;  4LZ7 A;  3K6U A;  1PDA A;  2WBB A;  4YMA A;  1PEB A;  3L6H A;  2VGQ A;  5AA2 D;  4R6H A;  1TFD A;  4HTG A;  3K2D A;  1JNF A;  5TP9 A;  3QUF A;  1QUL A;  1GR2 A;  2OWZ A;  1WVJ A;  4YKK A;  3K01 A;  4LZ8 A;  1POY 1;  3QIM A;  4KD5 A;  3EHT A;  4YMB A;  3K4U A;  4YB6 A;  5FHO A;  3H03 A;  1B7Z A;  5ET7 A;  4H67 A;  4N6D A;  1VE4 A;  1LCF A;  4ELQ A;  2FIX A;  3KJT A;  3CFX A;  1I6B A;  3RTF B;  5KDT A;  4WKM A;  4MEV A;  3MZB A;  1QVS A;  1NUZ A;  3C31 A;  2ALU A;  1FPI A;  3IJO B;  3KFM A;  4KPT A;  1XHY A;  3G3J A;  1YZ0 A;  1B5I A;  1UTB A;  1FJ9 A;  2XWV A;  3FBP A;  1P1U A;  1MQD A;  2FYI A;  1D9Q A;  3TOD A;  2F6P A;  1TWY A;  2OWS A;  3LUZ A;  2R71 A;  4POW A;  1SPI A;  1GV8 A;  2KQZ A;  4LUB A;  4NGU A;  2V3U A;  3TAJ A;  4QXD A;  1MXU A;  4BDO A;  3KBR A;  4NF5 B;  3U1O A;  3GXA A;  2DVZ A;  3GYY A;  3ISP A;  4Q0C A;  1SBP A;  1OIB A;  2HAV A;  1IMB A;  1VFE A;  5DEX B;  2VHA A;  4GFR A;  4IO7 A;  3A29 A;  2HFB A;  1US4 A;  4P1L A;  1Q35 A;  1IMC A;  2F34 A;  3USD A;  2AIX A;  5ELV A;  4BDN A;  4MNP A;  2H9B A;  4EXL A;  4H5F A;  5BUU A;  3C35 A;  4JVC A;  2Z8D A;  4LQ2 A;  3PPN A;  1FTL A;  3O28 A;  3OEM A;  4OVT A;  4KXP A;  4OZ9 A;  4YAH X;  1GGG A;  2XXV A;  3Q25 A;  1IUD A;  2ZYK A;  4U4X A;  2FNC A;  2X7Q A;  4PET A;  4ZDM A;  2REJ A;  2DWI A;  2GHA A;  4O3B A;  1Y4T A;  1FQC A;  4MNC A;  3TFL A;  1H44 A;  1JW4 A;  1NFT A;  3VDF A;  1UTH B;  4N6K A;  4HW8 A;  2CEY A;  2PT1 A;  3K1N A;  1US5 A;  4P3L A;  2QS3 A;  2XHD A;  3JZJ A;  4JSO A;  2VP1 A;  3I6V A;  1EH3 A;  1NI9 A;  2XX7 A;  2R9J A;  1MPB A;  3DP6 A;  4OVQ A;  4BDQ A;  2RF1 A;  3Q29 A;  4Q5T A;  1MRP A;  1NUW A;  5I56 A;  5B70 A;  3BKI B;  4BLA A;  4IO5 A;  4FOR A;  1SQY A;  5AE4 A;  4MIJ A;  3HFU A;  3RY3 A;  2Y7P A;  4MAG A;  1QW0 A;  3ZSF A;  3K0V A;  1Y20 A;  4LP2 B;  1RYX A;  2FBP A;  4GWS A;  1MY2 A;  2WBD A;  5H8N A;  3IFC A;  2F8D A;  1B7H A;  4LA9 A;  1MQI A;  1JQF A;  1NNT A;  3OSR A;  4XKP A;  3C9H A;  5CMK A;  1I6Q A;  1P99 A;  4F19 A;  4DXB A;  1PB9 A;  2ZYN A;  3V8X B;  4KHZ E;  3LUY A;  1LFG A;  5IAI A;  4YKI A;  4O3A A;  5L9S A;  1FQF A;  3E4R A;  2QFL A;  4Q8R A;  3C4M A;  1URS A;  3SEW A;  4O7M A;  3I5O A;  5BWJ A;  3TKD A;  3T9X B;  4U1O A;  4OES A;  1O63 A;  1WDN A;  5FTH A;  2LAO A;  4PAI A;  2F35 A;  3KC1 A;  4I40 A;  3IOR A;  2P2A A;  5CM6 A;  3PGF A;  2FHY A;  5IKB A;  5K2X A;  1LCT A;  4TQU Q;  1EZO A;  2OLB A;  1FSA A;  4JWO A;  2XWK A;  4DXC A;  1B32 A;  1OQH A;  4PF8 A;  1ZLQ A;  3HST A;  3N5L A;  4GWX A;  4IO6 A;  4OA4 A;  1YXI A;  3ZKL A;  2FA7 A;  4NHB A;  3MC2 A;  2X7P A;  1IMD A;  1PC3 A;  1B5J A;  2XXW A;  1TFA A;  4YKJ A;  1AIV A;  3OO8 A;  1MM6 A;  2KLF A;  3D1R A;  3PPP A;  3B8B A;  4N8Y A;  4F22 A;  5LOM A;  2ONK E;  4P0I A;  4OMB A;  3CIJ A;  1QKB A;  1QKA A;  3L6G A;  3VXB A;  3WAF A;  1JP4 A;  4ZE8 A;  3IO4 A;  5EYH A;  2AL5 A;  4NF0 A;  3G3G A;  5AA4 A;  3KN7 A;  3H6W A;  1EYJ A;  3BFU A;  3IB2 A;  3GLB A;  3DP8 A;  5EQ8 A;  3SET A;  3SES A;  4JXI A;  2ZNS A;  1D3K A;  3MWB A;  3BIG A;  3LSW A;  1FPJ A;  2ABH A;  3O9P A;  2DS9 A;  4RK9 A;  4R72 A;  4IY6 A;  4ZZE A;  1H45 A;  1R6Z A;  2DE2 A;  4QFL A;  3Q26 A;  3IOW A;  2F97 A;  3QMF A;  4OET A;  4P8B A;  2GH9 A;  2XXH A;  2O6A A;  2I0B A;  4ONY A;  2H5Y A;  3MST A;  3TTK A;  5F24 A;  2Y5L A;  1AOV A;  1B40 A;  4F3P A;  1DPP A;  3KOT A;  5H8N B;  3T0J A;  1XVX A;  1FBC A;  3A3C A;  3K1P A;  5DW8 A;  4OAN A;  3KGC A;  3KSJ A;  1MXW A;  5T3J A;  4L17 A;  2QS2 A;  4O7I A;  2O84 X;  4THI A;  3HHF A;  1MDP 1;  4H65 A;  1IXI A;  1N7X A;  2XWO A;  3PUV E;  4MBP A;  1B6H A;  2CZI A;  1FCK A;  4DI4 B;  2QS4 A;  2DWJ A;  3UN6 A;  4RXL A;  4YKP A;  4N81 A;  3SEY A;  1SYH A;  2VPN A;  3MJN A;  1PBP A;  4MLQ A;  4N91 A;  1H3D A;  4FE8 A;  3TYH A;  1EYK A;  1ZTY A;  3GBA A;  4AB6 A;  4H1X A;  4P0G A;  4H5G A;  3TTM A;  4TOZ A;  1FPD A;  2CZH A;  3BBR A;  2QMW A;  3IJX B;  3HCQ A;  3RPW A;  2P3N A;  1Z7N E;  2O51 A;  2ZMB A;  3M3F A;  4OHN A;  1FTK A;  2HPG A;  2UYF A;  1P1Q A;  5J1D A;  3RT6 B;  2V3T A;  4F3S A;  1ZU0 A;  1FPG A;  4IGR A;  3DM0 A;  3ODB A;  1IME A;  4FIM A;  2XD2 A;  1FQB A;  3B50 A;  5DYH A;  5ESY A;  3PUX E;  2HHM A;  4DXU A;  1LST A;  4H0W A;  2B65 A;  1NMU A;  5FBP A;  1OLC A;  4AB5 A;  3CRB A;  2ANJ A;  3CHG A;  1B05 A;  2Q9T A;  3QUJ A;  4X9T A;  5TU0 A;  1DMB A;  2B3B A;  2VD3 A;  3PU5 A;  3V83 A;  1MY4 A;  3DEL B;  1NV5 A;  3H6T A;  3IOV A;  4K3F A;  3TCF A;  3OMB A;  3W9V A;  4QSC A;  1DOT A;  4GD5 A;  3OOA A;  2QMX A;  1F9B A;  1P1W A;  5I59 B;  2F6G A;  3S2V A;  3FIR A;  3FVG A;  4MCO A;  3KC0 A;  4OTE A;  3EF7 A;  4EF2 A;  1GTK A;  3IO6 A;  1B3G A;  4PTK A;  1FPB A;  2ESN A;  1DCU A;  1FTM A;  3E13 X;  3FGS A;  1FPL A;  1Y3N A;  2F7B A;  1S7Y A;  1YYZ A;  2IA4 A;  5FTI A;  4E0W A;  4EQ7 A;  3IX1 A;  2RKM A;  3QK6 A;  4NF4 A;  3OSQ A;  3RGY A;  2B4L A;  1II5 A;  3PMW A;  2IEE A;  2NUV A;  4R9F A;  4JB7 A;  3PTY A;  1FTJ A;  5ET5 A;  2XXI A;  1MS7 A;  4ZEC A;  2Y7K A;  1URD A;  1B9J A;  3CG1 A;  3EHS A;  3FVK A;  3MVW A;  3FAT A;  3MW0 A;  3T9U A;  1JEV A;  5IGA A;  3TTN A;  1NNP A;  4HE1 A;  1BK4 A;  3IR1 A;  1LAF E;  4H8I A;  3TMG A;  4NF5 A;  4OFL A;  1FBH A;  3JYR A;  5EYG A;  4I9D A;  4ZE9 A;  2Q2C A;  4NMY A;  1YCJ A;  1IMA A;  2UVJ A;  1M5D A;  4C1T A;  2CMO A;  3ILT B;  1MXV A;  4DIG A;  3VV5 A;  3N6U A;  2XXK A;  3K6X A;  4HE2 A;  1M5C A;  1YTV A;  1RDX A;  1T0K A;  4H46 A;  2Q8M A;  5CMC A;  2Z8F A;  4JVI A;  3C33 A;  4M1V A;  1JVX A;  2DP8 A;  3TQW A;  4N8G A;  2YJP A;  2B4M A;  4G4P A;  3K1M A;  5JEI A;  1ELJ A;  4IO3 A;  3EHU A;  2QSX A;  2HZK A;  3VLU A;  2YPN A;  4XKQ A;  3TQL A;  1USY H;  2W7Y A;  4JDF A;  4Z0I A;  5EYF A;  4IO4 A;  2L5V A;  1FPE A;  4ELO A;  2I58 A;  4U2R A;  4C1U A;  2DQV A;  3VVF A;  4LVQ A;  1FPK A;  2VPO A;  4NED A;  3P7I A;  4PFR A;  3UA8 A;  2I4C A;  3MPK A;  3O2A A;  3W9W A;  4ELP A;  4JSD A;  2XXQ A;  3O66 A;  4RPN A;  1LB8 A;  3H06 B;  1AH5 A;  5IM2 A;  4PC9 A;  3ILU B;  4GBV A;  3A09 A;  3R7X A;  5L9O A;  1UIU A;  3A3U A;  4XXU A;  1A40 A;  4P47 A;  5ICT A;  4N13 A;  1MQH A;  3T22 A;  2JJK A;  4NF8 A;  3MYU A;  5DVF A;  1R9L A;  4RNS A;  1LBB A;  1SD3 A;  3FXB A;  4PDD A;  2I3W A;  3OEL A;  1B51 A;  2Q2A A;  1IMF A;  3ONM A;  3MBP A;  3BIH A;  4PDH A;  1USY E;  1NUY A;  1CNQ A;  1OVT A;  3U72 A;  1IIT A;  1I6A A;  3RT8 A;  1MH4 A;  2XXT A;  1QGX A;  2NWJ A;  1LBY A;  1Q9D A;  2F7C A;  5IZ1 A;  3OO6 A;  3LSX A;  1VFD A;  4R6Y A;  4NX1 A;  1L5T A;  4GOT A;  1LBV A;  2Z23 A;  5M2V A;  1PB7 A;  4QSE A;  2ONR A;  4HCY A;  5IZ3 B;  2M8C A;  4MLV A;  1ATG A;  4QFK A;  3JV9 A;  4ZEB A;  1XI6 A;  2XD3 A;  4KCC A;  2VT5 A;  2XA5 A;  2QS1 A;  1XOC A;  3CR9 A;  4NF4 B;  4OEU A;  4PBH A;  1Y1Z A;  1URG A;  1LB9 A;  5I56 B;  1D4N A;  5KZT A;  4N4U A;  4QFP A;  3RTW B;  3H6V A;  4WEP A;  1OMP A;  2H98 A;  1B4H A;  1DTZ A;  2ZXT A;  4YIC A;  4PGN A;  1MXY A;  2XXY A;  4H6D A;  4EXK A;  1JVY A;  4PQJ A;  1NV3 A;  4BDL A;  1NV4 A;  3OXN A;  4QFN A;  3U92 A;  3CFZ A;  4ECF A;  2QL3 A;  4U21 A;  1HSE A;  3ROJ A;  3HHG A;  2H4I A;  4KQP A;  3K02 A;  4YB7 A;  4IO2 A;  3QAX A;  4XKN A;  4P1E A;  2NVU B;  4NN3 A;  2Y84 A;  4GBW A;  1KWH A;  3DP4 A;  1KA1 A;  3I3V A;  5B7D A;  1TT1 A;  2H99 A;  5DEX A;  5F1Q A;  3PUW E;  3C34 A;  5I5P A;  5CBR A;  2Y7I A;  3KG2 A;  4EQ9 A;  2OJT A;  3LV0 A;  2F5X A;  3W15 C;  2DE4 A;  4I3E A;  2XXR A;  3O6G A;  4GIZ A;  4GWU A;  2R6G E;  2F78 A;  5JK4 A;  3OEN A;  4OER A;  2RC7 A;  1SI1 A;  1P1O A;  3GBB A;  2UVI A;  3LR1 A;  3RQT A;  1B1X A;  1R1N A;  4GQO A;  4RA1 A;  4QHQ A;  1LGB C;  1NKX A;  3ZKK A;  4YZZ A;  1YPN A;  2KR0 A;  2DOJ A;  2V3Q A;  3D4G A;  1SI0 A;  4EUO A;  1FBP A;  2WYK A;  2D3I A;  2QRY A;  4MNI A;  1JW1 A;  4GXS B;  1FBE A;  4FAJ A;  4EQB A;  3T9V A;  4R9G A;  2ZYM A;  4KI0 E;  4I8C A;  1SW4 A;  5I2K B;  1G0I A;  5A5X A;  2HCA A;  4ZEF A;  4R75 A;  4G61 A;  5CC2 A;  1VDW A;  5DT6 A;  3D4C A;  2F3D A;  4MMP A;  5FHM A;  2I3V A;  1RDZ A;  5LTC A;  3CI8 A;  1LFH A;  2Z8E A;  4XKR A;  1P1N A;  3KBZ A;  1DK4 A;  2V4C A;  4F1V A;  3F11 A;  4MFI A;  1ZIU A;  1B3F A;  4HCW A;  4PF6 A;  1QUJ A;  3TCG A;  1M5E A;  3TTR A;  4ESW A;  2PT2 A;  2V93 A;  1UQW A;  3TCH A;  3FXU A;  4F39 A;  1XS5 A;  4G2Z A;  1A7L A;  5ISU A;  3T96 B;  4X1D A;  4R6K A;  3HPI A;  4AS5 A;  5I57 B;  4GF8 A;  1Y9U A;  4BDR A;  3T66 A;  5H8F B;  1LAG E;  5IZZ A;  3LC8 A;  2HXW A;  3LSL A;  5F7V A;  2XXX A;  4F2O A;  1LBZ A;  2XXU A;  4PFY A;  4BDM A;  1K9Z A;  1IXH A;  4PFT A;  4QSD A;  4NQ8 A;  2HEU A;  3VE1 B;  1DBZ A;  4R73 A;  3O29 A;  4U1Z A;  1DSN A;  4GX4 A;  1UTB B;  1ZMG A;  3FJM A;  1A99 A;  1N7W A;  1B5H A;  1AL3 A;  1M5F A;  3E3K A;  3BFT A;  4NWC A;  4JWX A;  3MPL A;  2ZZX A;  4RYA A;  5JTY B;  2O68 A;  5I84 A;  2THI A;  5I57 A;  5AA2 B;  1FBG A;  2D5W A;  3MZ9 A;  2XXP A;  4G8M A;  1JEU A;  3EQ1 A;  3U65 A;  3CFL A;  4IY5 A;  3EN3 A;  1BP5 A;  3EPE A;  3FVN A;  2ZYO A;  5CI5 A;  1Z7M E;  2PVU A;  4MH5 A;  3FJ7 A;  2P1S A;  4X8R A;  1O7T A;  4G77 A;  1RDY A;  4NWD A;  4RK2 A;  1JET A;  3DLN A;  4UAB A;  4YB5 A;  1RKM A;  4Q30 B;  5HPQ A;  2O7U A;  4LQ5 A;  4OXV A;  3TDJ A;  1FRP A;  4NG7 A;  3FZV A;  2Y7R A;  3R26 A;  1LBC A;  4KR5 A;  5L9M A;  4ELR A;  1FPF A;  3VXC A;  2FIE A;  3U93 A;  2I0C A;  2A5T A;  1N0T A;  2UXA A;  3MP8 A;  4P9K A;  3G3F A;  4P11 A;  1D9V A;  2A5S A;  3B6W A;  2Y5K A;  4F18 A;  2CEX A;  4X1B A;  3VFJ A;  1B4Z A;  5I58 A;  1BIY A;  2ONS A;  3C32 A;  4XFE A;  3R6U A;  1OQG A;  2GRV A;  2HAU A;  3O6H A;  4O3C A;  4LN5 A;  1IXC A;  1Q1K A;  3C36 A;  2WYP A;  3PMX A;  3FV2 A;  4OVS A;  1SYI A;  4NAP A;  1LLS A;  1NNK A;  4MX6 A;  4KYS A;  1TXF A;  1B3L A;  4DLD A;  1QUK A;  2PMS A;  4UAC A;  1NL5 A;  1XVY A;  1H43 A;  1RYO A;  2B3F A;  4PFU A;  3FXR A;  3SER A;  3SEX A;  3RLF E;  5LDZ A;  4R2B A;  2Q89 A;  2AYS A;  3V89 B;  4PFI A;  2A5T B;  3N94 A;  5AA4 B;  5L8D A;  1ZJL A;  3OO9 A;  4GX6 A;  1M5B A;  3CSG A;  5CRY A;  4P56 A;  2PFY A;  3CG3 A;  4ND9 A;  1N3X A;  5CMB A;  2O7I A;  2CZK A;  4G8N A;  4DI3 D; 
#chains in the Genus database with same CATH homology
 3SES A;  2PBW A;  4FEC A;  4GOT A;  4JXI A;  2ZNS A;  1D3K A;  3K6V A;  1BLF A;  3MWB A;  1Y3P A;  4OEV A;  3WAE A;  4DCY A;  4EDP A;  3TEP A;  2Z23 A;  3LSW A;  5CBS A;  4U22 A;  5M2V A;  2ABH A;  1MXZ A;  3RN8 A;  5H8H A;  1PB7 A;  1H76 A;  4QSE A;  2ONR A;  3PD8 A;  4HCY A;  4NE4 A;  3ZS6 A;  2M8C A;  4MLV A;  3O9P A;  1ATG A;  2DS9 A;  1B58 A;  2DXY A;  2RC9 A;  4NF6 A;  4R72 A;  4IY6 A;  4RK9 A;  1O64 A;  4OEN A;  3MVY A;  1AMF A;  4QFK A;  5TPA B;  5KCJ A;  5I2K A;  3JV9 A;  4ZZE A;  1H45 A;  3FJG A;  4ZEB A;  1R6Z A;  2DE2 A;  2XD3 A;  4KCC A;  4QFL A;  3Q26 A;  2X26 A;  1D9Y A;  2I49 A;  3IOW A;  1FTO A;  3MVX A;  4WXJ A;  2F97 A;  3U94 A;  2QS1 A;  1XOC A;  1SVX B;  3S9M C;  3CR9 A;  4NF4 B;  4OEU A;  5KDT A;  1IZ1 A;  1B3H A;  4OET A;  2HQ0 A;  2GH9 A;  3CVG A;  2XXH A;  1MPC A;  2O6A A;  5K2Y A;  2I0B A;  1Y1Z A;  4UA8 A;  1URG A;  4ONY A;  2H5Y A;  1LB9 A;  4PP0 A;  5I56 B;  1LAX A;  3TTK A;  4GXA A;  3M3K A;  4GRK A;  1D4N A;  2QPQ A;  2HZL A;  4P0I A;  3KN8 A;  2OK2 A;  2F36 A;  1FQE A;  3IL1 B;  3MVZ A;  3KZG A;  4X48 A;  5KZT A;  4KYE A;  1B40 A;  4ZZA A;  1AOV A;  4ISU A;  4F3P A;  2DWA A;  3UOR A;  2UVG A;  3VLV A;  3OO7 A;  1DPP A;  4QFP A;  3KOT A;  5H8N B;  2XX8 A;  1WOD A;  1XVX A;  4OFJ A;  3OEK A;  1NH7 A;  1VSO A;  3A3C A;  3RTW B;  1MQJ A;  3K1P A;  5ITP A;  4M4G A;  3H6V A;  3KGC A;  4WEP A;  5KCJ B;  3KSJ A;  1MXW A;  1OMP A;  1JW5 A;  2H98 A;  2DYX A;  3K00 A;  4L17 A;  2RCB A;  2QS2 A;  4XTC Q;  1MDQ A;  1N84 A;  2O84 X;  2P0S A;  3HHF A;  4THI A;  1IIW A;  1MDP 1;  1Y3Q A;  3PPO A;  1B7U A;  4H65 A;  4OYV A;  1GVC A;  5AA2 A;  4HS7 A;  1IXI A;  1BKA A;  5EHS A;  1B4H A;  3O6I A;  1YAE A;  2G29 A;  3UIF A;  1DTZ A;  1SDX A;  1N7X A;  2ZXT A;  2YLN A;  4IB2 A;  4RPO A;  3SEU A;  3TOD A;  3QXM A;  4YIC A;  4C0R A;  1S9T A;  3TEL A;  3PUV E;  1MXY A;  2XXY A;  3OD7 A;  1EZ9 A;  1PB8 A;  4MBP A;  4H6D A;  5EHM A;  4WED A;  4DCX A;  4EXK A;  1B6H A;  2E1S A;  1JVY A;  1XT8 A;  4PQJ A;  4BDL A;  3PMV A;  5DVI A;  3VLW A;  1FCK A;  1EU8 A;  3OXN A;  4QFN A;  1S50 A;  3CFZ A;  3U92 A;  2QS4 A;  2QL3 A;  4GL8 A;  4ECF A;  1MPD A;  2DWJ A;  2O1M A;  3SDF A;  4U21 A;  1HSE A;  3UN6 A;  4NF8 B;  4RXL A;  4YKP A;  3KSX A;  5I2N A;  5AA1 A;  3HHG A;  3SEY A;  4U4S A;  1POT A;  4PE5 B;  3ECR A;  4EF1 A;  4XIG Q;  2H4I A;  4KQP A;  3K02 A;  4YB7 A;  1SYH A;  3MZ1 A;  4IO2 A;  3QAX A;  4XKN A;  3CSB A;  3LBS A;  1Y1M A;  3MJN A;  1PBP A;  3PV0 E;  1ANF A;  2O69 A;  3IK6 B;  1H3D A;  4MLQ A;  4OQO A;  5TPA A;  2NVU B;  4KFQ A;  1OLA A;  1Y4C A;  3MUQ A;  2Y7W A;  2Y84 A;  4F1U A;  2RC8 A;  4FE8 A;  1QJM A;  3FVO A;  4TLM B;  1KWH A;  3TYH A;  3IB1 A;  4LZ7 A;  3DP4 A;  3FV1 A;  3HV1 A;  3K6U A;  1ZTY A;  1CB6 A;  1PDA A;  3GBA A;  3I3V A;  4AB6 A;  3HO7 A;  5B7D A;  1TT1 A;  4H1X A;  4P0G A;  4YMA A;  1PEB A;  4H5G A;  3V5A A;  2H99 A;  3L6H A;  2VGQ A;  5DEX A;  5AA2 D;  5F1Q A;  3PUW E;  1TFD A;  4R6H A;  4TOZ A;  3C34 A;  3BBR A;  4HTG A;  1CE2 A;  2QMW A;  3K2D A;  2V25 A;  1JNF A;  3IJX B;  3UP9 A;  3HCQ A;  5TP9 A;  5CBR A;  3KEI A;  3QUF A;  2Y7I A;  3RPW A;  1Z7N E;  3KG2 A;  1QUL A;  2O51 A;  2ZMB A;  5I58 B;  3M3F A;  5H8F A;  1B1H A;  1GR2 A;  1WVJ A;  4EQ9 A;  2OJT A;  4OHN A;  1FTK A;  2UYF A;  5J1D A;  1P1Q A;  3K01 A;  4YKK A;  4LZ8 A;  4F2Q A;  1POY 1;  3RT6 B;  3QIM A;  2F5X A;  2V3T A;  3W15 C;  4KD5 A;  4F3S A;  3EHT A;  1ZU0 A;  3M3L A;  4YMB A;  3K4U A;  1A8E A;  4YB6 A;  2OBG A;  1SW5 A;  3H03 A;  2DE4 A;  5FHO A;  1B7Z A;  4H67 A;  4IGR A;  1VE4 A;  2XXR A;  3DM0 A;  1LCF A;  4ELQ A;  3SEV A;  3ODB A;  3Q27 A;  3O6G A;  4GIZ A;  5JK4 A;  2R6G E;  1A54 A;  2F78 A;  3OEN A;  2XD2 A;  4FIM A;  4NF6 B;  4OER A;  2RC7 A;  3KJT A;  1FQB A;  3CFX A;  5DYH A;  1SI1 A;  3IB0 A;  3SKP A;  3PUX E;  1A8F A;  1I6B A;  1P1O A;  2OWT A;  4DXU A;  1LST A;  3GBB A;  4H0W A;  2UVI A;  3PD9 A;  1DPE A;  1MG1 A;  3E9X A;  3MP1 A;  2B65 A;  1NMU A;  3MZB A;  3LR1 A;  2H25 A;  1QVS A;  1B1X A;  4WKM A;  3RQT A;  1OLC A;  3TPA A;  1R1N A;  3C31 A;  4AB5 A;  4GQO A;  3CRB A;  4QHQ A;  1VR5 A;  1LGB C;  2ALU A;  4RA1 A;  4AQ4 A;  1UTH A;  3UGW A;  3IJO B;  2ANJ A;  3KFM A;  3T93 B;  4DDD A;  1NKX A;  1NNF A;  3N26 A;  4KPT A;  4OFO A;  3FD3 A;  5H8Q B;  4YZZ A;  1YPN A;  2V3Q A;  1B05 A;  2DOJ A;  2Q8J A;  1XHY A;  3D4G A;  3ZKK A;  1SI0 A;  4YU0 A;  5DVJ A;  4EUO A;  3G3J A;  2D3I A;  2Q9T A;  2QRY A;  2UVH A;  3QUJ A;  1JW1 A;  4GXS B;  4X9T A;  5TU0 A;  1B5I A;  4FAJ A;  4EQB A;  3HN0 A;  1UTB A;  1DMB A;  3PUY E;  1PBQ A;  4F3G A;  1P1U A;  4QF9 A;  1MQD A;  2FYI A;  1IEJ A;  2ZYM A;  4R9G A;  3T9V A;  2B3B A;  4KI0 E;  4R2F A;  4I8C A;  1SW4 A;  2F6P A;  2VD3 A;  1TWY A;  2HCA A;  4OVJ A;  4ZEF A;  5I2K B;  4R75 A;  3PU5 A;  5A5X A;  4U23 A;  4RY1 A;  2OWS A;  4FJP A;  1B52 A;  4TLL B;  3V83 A;  1MY4 A;  3H4Z A;  5CC2 A;  3B6T A;  2R71 A;  3DEL B;  5DT6 A;  3D4C A;  1N3W A;  4POW A;  3H6T A;  5FHM A;  3IOV A;  2I3V A;  1GV8 A;  4K3F A;  3TCF A;  3OMB A;  4LUB A;  3MQ9 A;  2V3U A;  4GLI A;  3W9V A;  3TAJ A;  1MXU A;  3TUS A;  4QSC A;  3CI8 A;  4BDO A;  3KBR A;  1DOT A;  4NF5 B;  4GD5 A;  3U1O A;  3GXA A;  1LFH A;  2DVZ A;  3OOA A;  5DTB A;  2QMX A;  1F9B A;  2Z8E A;  4Q0C A;  1P1W A;  1ZBM A;  4XKR A;  5I59 B;  1P1N A;  5ICQ A;  3RNN A;  1SBP A;  1OIB A;  2HAV A;  4LON B;  3F11 A;  1VFE A;  4MFI A;  5DEX B;  2F6G A;  4F1V A;  4ZED A;  2VHA A;  3S2V A;  1ZIU A;  4GFR A;  1B3F A;  4HCW A;  4IO7 A;  1QUJ A;  3TCG A;  2OCU A;  1M5E A;  3FIR A;  3FVG A;  4FED A;  4MF3 A;  3TTR A;  4OTE A;  4ESW A;  2PT2 A;  2HFB A;  3QYT A;  1US4 A;  3EF7 A;  1GTK A;  4I1D A;  4EF2 A;  1Q35 A;  2V93 A;  2OZZ A;  2F34 A;  3IO6 A;  3USD A;  2BJJ X;  1B3G A;  1UQW A;  2AIX A;  5ELV A;  4BDN A;  3TCH A;  3FXU A;  4F39 A;  2VOZ A;  1XS5 A;  2H9B A;  4JBZ A;  1MY3 A;  2ESN A;  4H5F A;  4EXL A;  1FTM A;  5BUU A;  3C35 A;  4G2Z A;  2Z8D A;  4LQ2 A;  3E13 X;  1A7L A;  3FGS A;  3PPN A;  1FTL A;  3O28 A;  1N76 A;  3OEM A;  4DE8 A;  5ISU A;  3T96 B;  4X1D A;  4R6K A;  4OZ9 A;  3HPI A;  3PUZ E;  4YAH X;  1GGG A;  3IAZ A;  2XXV A;  4ZS9 A;  5I57 B;  1Y3N A;  2F7B A;  3Q25 A;  4GF8 A;  1Y9U A;  1IUD A;  4BDR A;  2ZYK A;  3T66 A;  4U4X A;  1FQA A;  2FNC A;  1S7Y A;  2X7Q A;  5H8F B;  1LAG E;  4PET A;  3FAS A;  2IA4 A;  2REJ A;  4ZDM A;  2DWI A;  2GHA A;  3LC8 A;  4O3B A;  1B0H A;  1Y4T A;  2D21 A;  5FTI A;  2VD2 A;  1FQC A;  1R9Q A;  3S9N C;  2HXW A;  4E0W A;  4FEB A;  3TFL A;  3K6W A;  3GZG A;  3U8Q A;  4H8J A;  4EQ7 A;  1H44 A;  1JW4 A;  2RKM A;  3IX1 A;  3QK6 A;  4LZ5 A;  1NFT A;  1LFI A;  3LSL A;  1I69 A;  1UTH B;  3OSQ A;  4NF4 A;  2XXX A;  5F7V A;  3VDF A;  3RGY A;  4F1Y A;  4HW8 A;  4NTL A;  2PT1 A;  1FQD A;  3K1N A;  1US5 A;  3Q28 A;  4F2O A;  3PPR A;  1II5 A;  3FXQ A;  2XXU A;  3PMW A;  3KOS A;  2DE3 A;  4PFY A;  2QS3 A;  5CMM A;  2IEE A;  2NUV A;  2XHD A;  4BDM A;  3JZJ A;  1IXH A;  4JB7 A;  2RIN A;  4R9F A;  5FHN A;  4PFT A;  4JSO A;  1FTJ A;  1N04 A;  4G68 A;  4QSD A;  2VP1 A;  3S9E A;  2DWH A;  3I6V A;  1B46 A;  1EH3 A;  4OWD A;  2XXI A;  1MS7 A;  2HEU A;  2XX7 A;  3VE1 B;  4I62 A;  2PX1 A;  2R9J A;  1MPB A;  5H8S A;  1B0L A;  4F3B A;  4R73 A;  3H7M A;  4ZEC A;  2Y7K A;  3DP6 A;  1URD A;  3O29 A;  1DSN A;  2NXO A;  4U1Z A;  4ZEI A;  3FUZ A;  4GWO A;  1UTB B;  1ZMG A;  4BDQ A;  1B9J A;  3FJM A;  1A99 A;  1A55 A;  1N7W A;  3CG1 A;  1B5H A;  2DXR A;  2RF1 A;  3EHS A;  3FVK A;  3MVW A;  1AL3 A;  3Q29 A;  4Z7E A;  3FAT A;  3MW0 A;  4Q5T A;  3T9U A;  1JEV A;  1MRP A;  1M5F A;  1MY0 A;  3E3K A;  3G3I A;  3BFT A;  3TTN A;  5I56 A;  4NWC A;  5AA3 A;  1LAH E;  1NNP A;  5H8Q A;  3V89 B;  5B70 A;  3BKI B;  4JWX A;  1B2H A;  3IR1 A;  4IO5 A;  4FOR A;  3MPL A;  4G68 B;  5TP9 B;  4BLA A;  4RYA A;  1LAF E;  5JTY B;  1SQY A;  4H8I A;  2O68 A;  5AE4 A;  4QRZ A;  3TMG A;  4NF5 A;  5I84 A;  1EZP A;  4OFL A;  2THI A;  3JYR A;  5I57 A;  3THI A;  5AA2 B;  4I9D A;  3MAM A;  2Y7P A;  3RY3 A;  2QJE A;  2D5W A;  1QW0 A;  4ZE9 A;  3MZ9 A;  1QUI A;  2Q2C A;  2XXP A;  4G8M A;  4NMY A;  3K0V A;  4ZEK A;  1Y20 A;  1JEU A;  3KN3 A;  4LP2 B;  3ZSF A;  1RYX A;  5JTY A;  2REG A;  3EQ1 A;  1YCJ A;  3CFL A;  4IY5 A;  3TTM A;  3EN3 A;  3IOT A;  1MY2 A;  2UVJ A;  1BP5 A;  1M5D A;  1NH8 A;  5H8N A;  3EPE A;  3FVN A;  2ZYO A;  5A5X B;  5CI5 A;  4C1T A;  2F8D A;  1Z7M E;  4G8H A;  2CMO A;  1B7H A;  4JWY A;  4LA9 A;  3ILT B;  3H3G A;  3KJ7 A;  1MQI A;  1MXV A;  1JQF A;  2PVU A;  1NNT A;  3IOU A;  4MH5 A;  4DIG A;  3FJ7 A;  2P1S A;  3VV5 A;  4LAT A;  3OSR A;  2GHB A;  1O7T A;  4XKP A;  4G77 A;  3C9H A;  3N6U A;  5CMK A;  4NWD A;  4IGT A;  3K6X A;  3QSL A;  1M5C A;  4RK2 A;  1JET A;  1I6Q A;  1P99 A;  3RTF B;  2E0S A;  3DLN A;  1YTV A;  1IQ7 A;  4DXB A;  4F19 A;  1T0K A;  1PB9 A;  1RKM A;  4YB5 A;  2ZYN A;  3TZA A;  5CMC A;  4ESX A;  3V8X B;  3M8U A;  4KHZ E;  4Q30 B;  3TTL A;  2Z8F A;  3O97 A;  5HPQ A;  3LUY A;  2I6E A;  2WKY A;  1LFG A;  2O7U A;  4LQ5 A;  4G68 C;  4OXV A;  4R74 A;  3VVD A;  3C33 A;  1OVB A;  4O3A A;  4YKI A;  3TDJ A;  5IAI A;  5L9S A;  4M1V A;  1JVX A;  2DP8 A;  1FQF A;  3TQW A;  3E4R A;  3FZV A;  1MH3 A;  2Y7R A;  4Q8R A;  2CZL A;  3R26 A;  3C4M A;  1URS A;  2YJP A;  3SEW A;  1LBC A;  4G4P A;  1SW1 A;  4KR5 A;  3I5O A;  5L9M A;  4ELR A;  4F31 B;  3K1M A;  4N07 A;  4DZ1 A;  3MP6 A;  5JEI A;  1ELJ A;  3VXC A;  2ZNT A;  4IO3 A;  5BWJ A;  3U93 A;  2Z22 A;  2I0C A;  3EHU A;  4PFW A;  2A5T A;  1N0T A;  4POX A;  3TKD A;  3T9X B;  3G7W A;  4RJZ A;  2QSX A;  2HZK A;  4OES A;  1BTJ A;  4U1O A;  3VLU A;  1IXG A;  1O63 A;  2UXA A;  2YPN A;  3MP8 A;  1WDN A;  4XKQ A;  1USY H;  2W7Y A;  3G3F A;  4JDF A;  4Z0I A;  3RUM A;  3TQL A;  5EYF A;  3UK4 A;  3S4U A;  3VVE A;  4P11 A;  1D9V A;  2A5S A;  3B6W A;  2LAO A;  5FTH A;  2F35 A;  1HSJ A;  4IO4 A;  2O1L A;  4F18 A;  5KDT B;  4ELO A;  2I58 A;  3IOR A;  2P2A A;  4U2R A;  4X1B A;  3VFJ A;  1B4Z A;  2DQV A;  3PGF A;  4C1U A;  5CM6 A;  5I58 A;  5IKB A;  5K2X A;  3VVF A;  1LCT A;  4TQU Q;  1BIY A;  2ONS A;  3H6U A;  3C32 A;  4LVQ A;  2G93 A;  1EZO A;  1MM7 A;  3P7I A;  3R6U A;  4NED A;  2OLB A;  1OQG A;  3UA8 A;  2DVC A;  4JWO A;  2I4C A;  1FW0 A;  3MPK A;  3O2A A;  3W9W A;  2GRV A;  4JSD A;  1J1N A;  2XXQ A;  2HAU A;  1B32 A;  4DXC A;  1OQH A;  2UYE A;  3O6H A;  1LB8 A;  3O66 A;  4O3C A;  4RPN A;  1IXC A;  3AXF A;  3H06 B;  1Q1K A;  1AH5 A;  3S9L C;  1DTG A;  1ZLQ A;  1SW2 A;  3C36 A;  3HST A;  3N5L A;  3PMX A;  4GL0 A;  3LSF B;  4GVO A;  4IO6 A;  3FV2 A;  3ILU B;  3A09 A;  1SYI A;  3ZKL A;  3R7X A;  1LLS A;  1NNK A;  1XC1 A;  2FA7 A;  3PPQ A;  4KYS A;  4KCD A;  5L9O A;  1TXF A;  1B3L A;  4DLD A;  1QUK A;  2PMS A;  3MC2 A;  2X7P A;  1UIU A;  3A3U A;  1MQG A;  4XXU A;  4UAC A;  1NL5 A;  4QFO A;  1XVY A;  1A40 A;  5HM4 B;  5ICT A;  1PC3 A;  4N13 A;  1B5J A;  1MQH A;  3T22 A;  1H43 A;  2XXW A;  1TFA A;  4NF8 A;  4YKJ A;  1AIV A;  1RYO A;  2B3F A;  3OO8 A;  4PFU A;  3FXR A;  4KYD A;  1MM6 A;  3SER A;  2NOO A;  2KLF A;  1UIV A;  5DVF A;  3RLF E;  3SEX A;  4R2B A;  2Q89 A;  3PPP A;  4F22 A;  1R9L A;  2AYS A;  4RNS A;  5LOM A;  2V84 A;  1LBB A;  2ONK E;  1SD3 A;  2AL4 A;  2I3W A;  1B3E A;  2A5T B;  4OMB A;  2RCA A;  3CIJ A;  1QKB A;  3N94 A;  3OEL A;  1B51 A;  3N6T A;  2Q2A A;  5ITO A;  2I48 A;  1MXX A;  3ONM A;  4FAT A;  5AA4 B;  1QKA A;  3MBP A;  5L8D A;  1ZJL A;  3L6G A;  3B6Q A;  5HBC A;  1USY E;  2F7A A;  3VXB A;  3WAF A;  4ZE8 A;  3OO9 A;  2Q88 A;  4E0X A;  3U72 A;  1OVT A;  3IO4 A;  4ELP A;  5I2N B;  1M5B A;  1MY1 A;  3CSG A;  2AL5 A;  5CRY A;  2ZNU A;  1IIT A;  1I6A A;  3G3G A;  1MH4 A;  3RT8 A;  2GFE A;  4N6P A;  3CG3 A;  5AA4 A;  2XXT A;  3G3K A;  3KN7 A;  2NWJ A;  4ND9 A;  3B7D A;  3H6W A;  2I4B A;  5I59 A;  3G3H A;  3T9H B;  2F7C A;  1N3X A;  5H8H B;  1ZKB A;  3BFU A;  3OO6 A;  1HSL A;  2DSF A;  2O7I A;  2XX9 A;  3GLB A;  3IB2 A;  3LSX A;  5CMB A;  4F29 A;  1VFD A;  3DP8 A;  4R6Y A;  4G8N A;  2PYY A;  3SET A;  1L5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...