4EQ9A

1.4 angstrom crystal structure of abc transporter glutathione-binding protein gsht from streptococcus pneumoniae strain canada mdr_19a in complex with glutathione
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
240
structure length
240
Chain Sequence
KKEIIVATNGSPRPFIYEENGELTGYEIEVVRAIFKDSDKYDVKFEKTEWSGVFAGLDADRYNMAVNNLSYTKERAEKYLYAAPIAQNPNVLVVKKDDSSIKSLDDIGGKSTEVVQATTSAKQLEAYNAEHTDNPTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGLDNLKVIELPSDQQPYVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYLPAEADIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.4 Angstrom Crystal Structure of Putative ABC Transporter Substrate-Binding Protein from Streptococcus pneumoniae strain Canada MDR_19A in Complex with Glutathione.
rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
molecule keywords ABC transporter substrate-binding protein-amino acid transpo
total genus 84
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4eq9A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4eq9A02
4F1VA 2O1LA 3RT8A 1OQHA 3IJOB 3ONMA 3UP9A 5AA2A 4LQ5A 4HS7A 2PT1A 4KI0E 1B3LA 2VD3A 3VV5A 3CRBA 3TPAA 5A5XA 1IZ1A 4JSDA 2PVUA 3RN8A 2QJEA 4RJZA 1OLAA 1JEUA 2RC9A 1URSA 3EF7A 4BDNA 2FA7A 3FVNA 1Y1MA 2Z8FA 3FVOA 3ILTB 3MP8A 3VE1B 2Y7WA 1LAGE 3QXMA 3T22A 5CM6A 3CFXA 4XTCQ 3L6GA 3GBAA 4YICA 3T66A 4G68B 1MXZA 2ANJA 5JTYB 2A5TA 1P99A 4ZE8A 4KCCA 1JVYA 4U4SA 4KPTA 5DTBA 5FHMA 3TCFA 3FASA 3TCHA 1FQCA 4F22A 2H4IA 4F3SA 5I58A 1Q35A 3R6UA 3KOTA 3RT6B 3A3UA 1DSNA 1MY3A 4LA9A 1M5FA 1MXVA 1I6BA 2RC8A 2DXRA 3QUFA 4RK9A 1IIWA 2E1SA 4I1DA 2F36A 1B40A 1YAEA 2HAVA 2I6EA 4LZ5A 4OXVA 3TELA 2W7YA 3TMGA 4ELQA 2F7AA 5I59A 5JEIA 4EXKA 1SW1A 3S4UA 1Y3QA 1TWYA 5IKBA 4JWOA 1ZMGA 4BDRA 3CR9A 1FTLA 4IB2A 4MLVA 1HSLA 4OYVA 4DE8A 1UTHB 3H7MA 4PFTA 4ESWA 5I57A 1SYIA 2QL3A 3BBRA 3IO4A 4C0RA 5IAIA 1S50A 3DP4A 3KN7A 5I58B 1JNFA 1LB8A 3C34A 4OHNA 4FECA 4O3CA 4R9FA 3N94A 2DXYA 4QSEA 2XXTA 3TAJA 4C1UA 2A5TB 1BTJA 2QS4A 1MH4A 1MPBA 3DP8A 3IR1A 4H65A 4K3FA 4OWDA 4POXA 3TTMA 1BIYA 1RYXA 4ZE9A 3ILUB 3DELB 1B7HA 1P1QA 1ELJA 4ZEBA 1NNTA 4I9DA 4IO5A 3K6XA 5CI5A 3VXBA 4R75A 3UGWA 4KYDA 3WAEA 3EN3A 1XOCA 4G8MA 4IO6A 5KCJB 2F34A 4LONB 2H9BA 5A5XB 3T93B 2XXUA 4DLDA 2ONSA 4R74A 4UA8A 1XS5A 2H25A 3TODA 1P1UA 4GXSB 1TT1A 1B51A 1D4NA 1B4HA 1MPCA 1P1WA 2XX9A 3OO6A 4IY6A 2OLBA 3K1NA 2O7IA 2NXOA 3O6IA 3L6HA 3HPIA 2RINA 4GL8A 1ZTYA 1EZ9A 1B7ZA 5BWJA 2VHAA 2O84X 5DEXB 1A7LA 3SERA 3TZAA 4XKRA 4DDDA 3B6WA 1IUDA 2P1SA 2XX7A 4G77A 2Y7PA 1ANFA 2A5SA 3IJXB 4R2BA 4X48A 3SETA 4NMYA 2GHAA 2QS3A 5CC2A 1MQGA 2RCAA 4FEDA 1SI1A 2YJPA 3Q26A 4BDLA 3C33A 1WODA 4MBPA 1J1NA 2ZNSA 4X1BA 1B5IA 3VLUA 3THIA 2XX8A 3OD7A 4MF3A 1GGGA 3C31A 3MC2A 3H3GA 3MVYA 4OQOA 3T9UA 3TDJA 4AB5A 4M1VA 3M3FA 4DCXA 2I49A 3IOUA 4R6KA 4JWXA 4U23A 2H5YA 3IB2A 1IXIA 3LC8A 3MPLA 3RNNA 4YMBA 5DEXA 1LBCA 2ZYOA 4R6HA 2I0CA 4N6PA 5AA1A 4ZEIA 1NNPA 4NF6B 2FNCA 3PGFA 5AE4A 1QUJA 3KJ7A 4GXAA 4PFYA 2VP1A 4HCWA 4YKJA 1N7WA 2F7BA 3VDFA 3RPWA 1DTGA 2QRYA 1YTVA 4KHZE 3MJNA 3CFLA 4ISUA 1OMPA 3RUMA 3TTKA 1PC3A 4OZ9A 1YCJA 3V8XB 3ZSFA 4FEBA 3D4GA 2REJA 4Q30B 2ONKE 3PUWE 4NF8A 4PFUA 3FXUA 4XXUA 1B5JA 4F3BA 1EU8A 4Z0IA 4OFJA 5TPAB 4F2OA 3OSRA 5FTIA 5H8HB 5I2KB 1R1NA 2HXWA 3O29A 1GV8A 1DTZA 1FCKA 3G3JA 4BDQA 2R9JA 5LOMA 2V3TA 3KSXA 4U21A 1B52A 1MY1A 1IXGA 2HEUA 2G29A 2VOZA 3LR1A 1XVXA 4ZEDA 5I57B 1MXWA 1UTHA 1B32A 3QUJA 4QSCA 2ZMBA 1ZBMA 3Q27A 3PPPA 2E0SA 4H1XA 4YKPA 2F35A 1TXFA 2O68A 1US4A 2OWSA 2XD2A 4C1TA 1MY0A 2XXWA 1SVXB 3CI8A 3KBRA 1UQWA 4GRKA 4GVOA 5HPQA 1LB9A 1RKMA 1Y9UA 2DWJA 1SYHA 2AL5A 4QFNA 4F3PA 5I56B 4QFOA 1OVTA 3G3HA 4KR5A 3QAXA 3FVGA 4RPOA 4RYAA 4Q5TA 5KDTB 3FZVA 3SEVA 3KZGA 3V83A 2XXPA 1DOTA 4LZ7A 4TQUQ 3H6UA 4Q8RA 2DVCA 1QW0A 2Y7IA 5F7VA 1S9TA 4JBZA 5ICTA 2ESNA 4RK2A 1JW1A 2CMOA 1LFGA 1MQDA 3FJMA 1MXUA 1MDQA 1MDP1 2XXXA 3F11A 5CRYA 4EF2A 5K2YA 3CSBA 3K4UA 3TTRA 4OEUA 2RF1A 4OVJA 3VLVA 4U1ZA 3W15C 3W9WA 4ELRA 4N13A 3JZJA 3PPQA 4NF5B 5CBSA 3K2DA 1EZOA 1NL5A 1XT8A 2QMWA 4M4GA 3TFLA 4EQBA 2XXYA 3OSQA 1AOVA 4IO4A 3UIFA 1PB9A 3N26A 3ZS6A 2KLFA 1LCTA 3PMXA 2Z8DA 1WDNA 5DVJA 1MQHA 4DZ1A 1JEVA 5CMCA 3C35A 3SEUA 1UIVA 1N0TA 4QSDA 4YKIA 4JB7A 1DMBA 3MZ1A 5FTHA 3UORA 1MQJA 3SDFA 1N04A 3K01A 3KN3A 1NKXA 4NF4B 2DWAA 4O3BA 3K6WA 4H8JA 4H5FA 5BUUA 4R6YA 1SDXA 2ZNTA 3CG3A 2R6GE 4EDPA 4ND9A 3G3KA 5CMBA 5FHNA 3R7XA 3N5LA 1D3KA 3BFTA 2ZYNA 1P1OA 1USYH 3PMWA 2DQVA 3S2VA 3EHUA 1SI0A 3OENA 1B3EA 4PE5B 3T9VA 2D21A 3CSGA 4PETA 3E13X 5JK4A 1B05A 1SQYA 3IOVA 2Q8JA 4R72A 1VR5A 3RY3A 3MZ9A 2OCUA 1RYOA 4G8NA 3LBSA 4F1YA 3OXNA 4YB6A 4UACA 3I5OA 2F97A 2UVJA 3K6VA 3O66A 3WAFA 2RCBA 5DVFA 3S9NC 2ZYKA 3RGYA 4X1DA 2V3UA 3HN0A 4H8IA 1IITA 1FTJA 4U2RA 5H8QB 1BKAA 3QSLA 1Z7NE 5H8FB 4LZ8A 3MBPA 4PP0A 4YB7A 3FIRA 4RPNA 3PV0E 4L17A 1SBPA 1PB7A 2AL4A 1PEBA 3TQWA 1DPPA 1LLSA 3LUYA 4ZS9A 1M5DA 1M5EA 3TCGA 3FVKA 2UXAA 4FE8A 3U93A 1URGA 3FV1A 4GWOA 4FAJA 3Q28A 3M8UA 1B46A 2CZLA 2Q9TA 3K1PA 3RTWB 3K0VA 2NVUB 5H8QA 3H03A 3E9XA 3OO8A 1B0LA 1A8EA 1S7YA 1B7UA 3IAZA 5M2VA 3B6TA 5TP9B 3PUVE 1BLFA 3OMBA 4HTGA 4WKMA 4F1UA 2DE4A 1QKBA 1JW5A 2O6AA 1SW4A 2X26A 3I6VA 3M3KA 2YPNA 3PPRA 3FD3A 2LAOA 4DXUA 5EHSA 3HO7A 4EXLA 4XKPA 3O9PA 2QSXA 3KG2A 4ZEKA 3U72A 4BDOA 3MQ9A 1UTBB 1MQIA 2Q2AA 2NWJA 1D9VA 3H06B 1NH8A 3DM0A 3KSJA 3K02A 2PBWA 2PYYA 1B1XA 1FTMA 3DP6A 2XD3A 4WEDA 1NFTA 4GD5A 1FTKA 5AA2D 1PBPA 3FXRA 4FIMA 3C9HA 4QFKA 2DYXA 2QS1A 3IL1B 1MY4A 2IEEA 1R9QA 1Y4CA 3G3GA 3GLBA 4KFQA 2HZKA 1O7TA 4TOZA 1SW5A 5H8NB 3SEXA 1LAXA 3OEMA 4LVQA 3B7DA 4GQOA 1JQFA 5I2NA 4GIZA 1M5BA 4G8HA 3MZBA 4QRZA 2I48A 4DCYA 3PPOA 5EHMA 2THIA 2YLNA 3KN8A 4LUBA 3T9XB 2GH9A 2PT2A 2OWTA 3A09A 1WVJA 1B6HA 1IEJA 3K00A 5J1DA 1AL3A 1NH7A 3T96B 2HAUA 4QHQA 1VFEA 2GFEA 2NUVA 3ZKKA 3LSFB 5TU0A 2RC7A 4DIGA 1SD3A 5L8DA 3EHSA 1P1NA 2I4BA 2P0SA 3KOSA 4N07A 4RNSA 5B70A 1LAHE 3ZKLA 1MY2A 4WEPA 5ITPA 2DE3A 4NF5A 4IO2A 1N3XA 2DS9A 2G93A 4MH5A 5DVIA 2FYIA 4MLQA 4HW8A 4XKQA 4U22A 5ICQA 4H67A 1B0HA 3C36A 1OLCA 1VSOA 1JETA 3TYHA 2O1MA 4FATA 3KGCA 5I2NB 5ITOA 1Y20A 4G68C 3FATA 3CIJA 1H76A 3FXQA 4Q0CA 4OFLA 1QUIA 1ZIUA 2H99A 4QF9A 3PUYE 3MUQA 2ZNUA 3M3LA 1VE4A 2B65A 2PMSA 2XHDA 3MWBA 4IY5A 2GHBA 1MG1A 5L9OA 5KDTA 3S9MC 1GR2A 2UVIA 1LSTA 2V25A 4OMBA 3TTNA 3U8QA 1B3GA 4WXJA 4F31B 2OK2A 3HHGA 1PBQA 1QUKA 1R6ZA 2V93A 2XXHA 5I56A 3HCQA 1O63A 1CE2A 1XC1A 3IX1A 2DP8A 2OBGA 4ZZEA 1UTBA 1AIVA 1BP5A 5HM4B 1AMFA 3IORA 2F78A 3OEKA 4I8CA 1A8FA 4OTEA 4R73A 5CMMA 5DT6A 1OIBA 4G2ZA 3PUXE 1I69A 5AA4B 3ECRA 1US5A 2X7QA 1A55A 1ZKBA 3MVXA 5L9MA 4F2QA 3FJGA 4P11A 1Q1KA 3GZGA 3O97A 4I62A 4TLLB 5H8SA 4F3GA 2Q88A 3A3CA 5H8HA 1MPDA 2B3FA 2Y84A 1MH3A 3VVDA 5L9SA 5TPAA 4P0IA 1NMUA 1II5A 2Y7RA 5CBRA 1FQEA 1POTA 3MVZA 4KQPA 1IXHA 5AA4A 3C32A 1SW2A 2F6PA 1GTKA 1TFAA 2Y7KA 2DSFA 1A99A 2UVHA 2AIXA 2QPQA 2NOOA 2GRVA 1USYE 3MP6A 4ONYA 4ZECA 4F29A 4ZEFA 3TUSA 4GL0A 1Y3PA 4O3AA 1GVCA 1O64A 2ZYMA 4X9TA 2I3VA 1FQBA 3GXAA 3H6TA 4EF1A 4H0WA 2ONRA 1DPEA 4YB5A 1MM7A 1Y4TA 1I6QA 4LP2B 3VVFA 4BDMA 3U92A 3GBBA 3USDA 2VD2A 3BFUA 3E4RA 2F6GA 3OO7A 3QK6A 2O7UA 2AYSA 1CB6A 4KCDA 2F8DA 2I3WA 5AA3A 4YU0A 1Y3NA 2B3BA 1N7XA 4GFRA 3B6QA 1ATGA 1PDAA 3MAMA 4YKKA 3H6WA 4DXCA 5HBCA 4RY1A 1T0KA 1B58A 3P7IA 3LSLA 1LBBA 1M5CA 2QS2A 2XXQA 3PPNA 4PFWA 4QFLA 3K1MA 4F19A 3OOAA 3TTLA 2Z8EA 3TKDA 1ZU0A 3RTFB 2WKYA 4NEDA 3VVEA 4YAHX 3IOTA 2H98A 3VXCA 4ECFA 4XIGQ 4NF4A 4BLAA 2IA4A 1HSEA 3PD9A 4JSOA 4OEVA 4OETA 4QFPA 1B3HA 4IO3A 1Z7ME 3I3VA 2BJJX 2OJTA 3U1OA 3UK4A 4LATA 4EUOA 2Q89A 1QJMA 3O2AA 2RKMA 4JXIA 4IGTA 5ELVA 3RLFE 5CMKA 1F9BA 1Y1ZA 1B5HA 3D4CA 1HSJA 4THIA 4TLMB 3SKPA 3OELA 5H8NA 2HQ0A 3K6UA 1QULA 4FORA 3VFJA 2XXRA 1FQFA 2F7CA 4U4XA 1LGBC 2QMXA 3N6TA 4U1OA 5DYHA 4NTLA 1MRPA 3O28A 3Q29A 1UIUA 1L5TA 4EQ9A 2I4CA 2P2AA 3CVGA 1H45A 4H5GA 2M8CA 4H6DA 3KJTA 4GOTA 5KCJA 2OZZA 1B4ZA 3PUZE 1PB8A 3SESA 3U94A 3LSWA 1JVXA 1MXYA 1OQGA 3TQLA 4FJPA 4ELOA 3SEYA 2F5XA 2HZLA 3EPEA 3FGSA 3S9LC 2V3QA 4LQ2A 1QVSA 3HV1A 3UA8A 4EQ7A 1B3FA 3KEIA 1POY1 3MW0A 2Z22A 4JDFA 4XKNA 3UN6A 4AQ4A 3MPKA 2DOJA 3W9VA 4KYEA 1VFDA 5EYFA 1N3WA 3SEWA 1N84A 1OVBA 2DVZA 2PX1A 4HCYA 4PQJA 1YPNA 2I0BA 4NWCA 1TFDA 5TP9A 1NNKA 4KD5A 3G7WA 1LFIA 3FV2A 3JYRA 2O51A 4OESA 2UYEA 2D5WA 2HFBA 3H4ZA 4IO7A 4P0GA 2D3IA 3KFMA 2ABHA 2REGA 3G3FA 4NF8B 1IXCA 1D9YA 2UYFA 3AXFA 3CFZA 4R9GA 3LSXA 3PMVA 4YZZA 3V89B 5I59B 4AB6A 1QKAA 2DWHA 2HCAA 3DLNA 3O6HA 5K2XA 3FUZA 3OO9A 3PD8A 1AH5A 1FTOA 4F18A 1ZJLA 3MVWA 4GF8A 1IQ7A 4OFOA 4RXLA 3IOWA 3V5AA 4ELPA 5FHOA 5H8FA 1FQDA 4R2FA 2Z23A 1JW4A 1LFHA 2V84A 3FJ7A 5I84A 3C4MA 1NNFA 4NWDA 2I58A 5I2KA 1EZPA 4G68A 1EH3A 1FQAA 2VGQA 3HHFA 3PU5A 3H6VA 4POWA 3RQTA 5JTYA 1LCFA 3T9HB 1B9JA 4MFIA 3JV9A 5F1QA 3CG1A 4JWYA 1H44A 4OERA 1KWHA 3EQ1A 1I6AA 1R9LA 3IO6A 3TEPA 1MXXA 3O6GA 1MS7A 3QYTA 3IB0A 3Q25A 1N76A 4IGRA 4RA1A 2X7PA 3E3KA 4OENA 3N6UA 1B2HA 4E0WA 1FW0A 5AA2B 1XVYA 3S9EA 2XXIA 3MP1A 4Z7EA 2DE2A 2ZXTA 4F39A 2Q2CA 3BKIB 4DXBA 4ESXA 5ISUA 1ZLQA 4NF6A 4ZZAA 3IB1A 4E0XA 4GLIA 3VLWA 3QIMA 5KZTA 1LAFE 1MM6A 3IK6B 1A54A 4YMAA 3EHTA 2DWIA 1XHYA 4KYSA 4ZDMA 4NE4A 1B1HA 1A40A 3ODBA 1H43A 3R26A 1URDA 2XXVA 4G4PA 5B7DA 2R71A 1H3DA 3G3IA 2ALUA 2UVGA 3HSTA 2O69A
chains in the Genus database with same CATH superfamily
2O1LA 3RT8A 1OQHA 4HS7A 3VV5A 2V4CA 4JSDA 1OLAA 1URSA 4NAPA 1LAGE 3QXMA 4G68B 5JTYB 1P99A 4KPTA 2B4MA 4F22A 4I40A 3TZAA 1DSNA 1I6BA 3QUFA 1IIWA 2E1SA 2I6EA 3TELA 3ISPA 5JEIA 4EXKA 1TWYA 5IKBA 3CR9A 4MLVA 4DE8A 1JNFA 1LB8A 2WBDA 3N94A 1MPBA 3DELB 1NNTA 4IO5A 3VXBA 1XOCA 2F34A 1IMCA 2XXUA 3TODA 1B51A 1P1WA 2XX9A 3L6HA 4GL8A 1EZ9A 1B7ZA 2P1SA 4G77A 4X48A 4XF5A 1WODA 2ZNSA 1B5IA 4NHBA 3OD7A 5J1DA 1GGGA 3MC2A 3TDJA 3T9UA 3IOUA 4R6KA 4JWXA 3IB2A 3MPLA 4YMBA 2FIEA 2ZYOA 4N6PA 4NF6B 3PGFA 3KJ7A 3EKIA 4PBQA 3CFLA 1PC3A 3D4GA 2FVZA 3PUWE 4F3BA 1LBVA 4F2OA 1K9YA 4BDQA 2R9JA 2V3TA 2HEUA 5I57B 5IAIA 2ZMBA 1TXFA 1US4A 3CI8A 4GRKA 1LB9A 1RKMA 4F3PA 2FIXA 5I56B 3FVGA 4RPOA 5KDTB 5IGAA 5F7VA 2CZKA 5ICTA 2ESNA 3FJMA 3F11A 3CSBA 3K4UA 4OVJA 2RF1A 3VLVA 1FBGA 1INPA 1XT8A 2XXYA 4PDHA 1WDNA 4LN5A 3C35A 1LBYA 1DMBA 3UORA 1N04A 4O3BA 2DWAA 5IZ3B 2Q74A 4H8JA 4P9KA 4R6YA 1SDXA 3CG3A 4HE2A 1P1OA 1USYH 3OENA 1B3EA 4PETA 2Q8JA 3RY3A 1RYOA 4YB6A 2KQZA 2CZIA 2F97A 2UVJA 3K6VA 1FTJA 4RPNA 2AL4A 3TQWA 1M5EA 3FVKA 3U93A 3Q28A 5H8QA 1B0LA 3KC0A 4HTGA 1BLFA 4WKMA 4DXUA 5EHSA 5EQ8A 4OANA 1YYZA 2QSXA 3MQ9A 1D9QA 1D9VA 3KC1A 2XD3A 4GD5A 1FTKA 4QFKA 2IEEA 1R9QA 1Y4CA 1SW5A 5H8NB 3SEXA 3OEMA 4N17A 4GIZA 1WVJA 1B6HA 2P3VA 3T96B 2HAUA 3ZKKA 5TU0A 1SD3A 5L8DA 3EHSA 1P1NA 4RNSA 5ITPA 4NF5A 4IO2A 4MH5A 2G93A 4MLQA 1B0HA 2WEFA 4P8BA 1NI9A 4XEQA 1VDWA 5ITOA 4G68C 3CIJA 1H76A 4Q0CA 1VE4A 2XHDA 2HXRA 2GHBA 3S9MC 2UVIA 4OMBA 1PBQA 1CE2A 2DP8A 4ZZEA 1UTBA 3IORA 3PUXE 1NV6A 1A55A 5L9MA 4P11A 1Q1KA 4TLLB 2Q88A 3VVDA 4PFIA 1NMUA 4KQPA 1SW2A 1TFAA 2AIXA 1NV3A 1USYE 3MP6A 4N6DA 1GVCA 4O3AA 1FQBA 3GXAA 2ONRA 1DPEA 1MM7A 1Y4TA 5EYHA 3E4RA 3QK6A 2AYSA 4P1LA 3RYDA 4GFRA 1N7XA 3MAMA 1NV1A 4RY1A 1LBBA 2XXQA 3K1MA 3TTLA 1ZU0A 3RTFB 4YAHX 2H98A 4ECFA 4XIGQ 4BLAA 3PD9A 4QFPA 4PAIA 4H45A 4MIJA 3UK4A 4LATA 1HSJA 3K6UA 3SZPA 4U4XA 2F7CA 3N6TA 4U1OA 4NTLA 1UIUA 1H45A 5KCJA 4GOTA 3PUZE 1PB8A 4I3YA 3TQLA 4FJPA 3S9LC 3BIHA 4JDFA 2Z22A 3MPKA 2XWVA 1N3WA 4HCYA 4NWCA 1TFDA 5TP9A 4PFRA 2D5WA 2HFBA 1IXCA 1QKAA 5M2VA 4F18A 3QMFA 4RXLA 1IQ7A 2Z23A 1NNFA 4NWDA 1EZPA 3HHFA 3PU5A 1LCFA 1B9JA 2WX9A 3CG1A 4JWYA 3IO6A 3B50A 1N76A 2X7PA 4E0WA 5AA2B 4N8YA 3S9EA 4F39A 2Q2CA 4ZZAA 1FSAA 1MM6A 2DWIA 3R26A 1IMEA 2XXVA 3HSTA 2O69A 2ZZVA 3UP9A 1FJ6A 2VD3A 3CRBA 1NUXA 1LBZA 2PVUA 2QVVA 1JEUA 3LUZA 2FA7A 3FVNA 3T22A 4XTCQ 2ANJA 3TCHA 1FQCA 1Q35A 3RT6B 3KOTA 4RK9A 4LA9A 1M5FA 4I1DA 2F36A 1B40A 4LZ5A 2HAVA 5I59A 2F7AA 1Y3QA 4JWOA 1ZMGA 4IB2A 2KR0A 1HSLA 4ESWA 3BBRA 3IO4A 1S50A 3DP4A 3C34A 4FECA 4NGUA 4QSEA 2XXTA 4C1UA 1BTJA 1MH4A 3DP8A 1RYXA 1ELJA 1FPFA 3HFUA 3WAEA 3EN3A 2FHYA 4R74A 2Q8MA 1B4HA 3OO6A 5BWJA 2VHAA 5DEXB 3B6WA 1IUDA 2XX7A 3ROJA 4R2BA 3IJXB 2GHAA 4PCDA 2YJPA 4BDLA 1J1NA 3VLUA 2XX8A 3MVYA 4OVRA 3M3FA 4DCXA 2I49A 4U23A 3LV0A 1IXIA 5DEXA 5AA1A 4DI3D 2VP1A 1N7WA 1DTGA 2QRYA 1YTVA 4KHZE 3MJNA 4MHFA 4ISUA 3RUMA 3TTKA 4OZ9A 1YCJA 4FEBA 1FBPA 4N91A 4NF8A 4XXUA 1B5JA 4Z0IA 4OFJA 3OSRA 5FTIA 3IFAA 1R1NA 2HXWA 1GV8A 3G3JA 3KSXA 1IXGA 2VOZA 3QUJA 4QSCA 1ZBMA 3Q27A 3SEUA 2E0SA 4YKPA 4PGNA 1FPKA 1UQWA 4QFNA 1Y9UA 2AL5A 3U65A 4KR5A 3A29A 3QAXA 4RYAA 1DBZA 3FZVA 1LBXA 3SEVA 3KZGA 4TQUQ 3H6UA 2DVCA 1QW0A 2Y7IA 4P47A 1YXIA 4H46A 1MDQA 2QFLA 3W15C 4N13A 3JZJA 3K2DA 4GBWA 5I3SA 1AOVA 1FBCA 4IO4A 1LCTA 4N6KA 1UIVA 1JP4A 4YKIA 5FTHA 2HPGA 3K6WA 1NV2A 2ZNTA 5FHNA 3S2VA 2DQVA 3EHUA 2D21A 3E13X 5JK4A 1SQYA 2P3NA 3IOVA 1FBDA 5ET6A 3MZ9A 4G8NA 3LBSA 3OXNA 4UACA 3WAFA 3S9NC 4X1DA 2V3UA 4H8IA 2F3DA 4U2RA 5EQ7A 4YB7A 3FIRA 5FBPA 1PB7A 1LLSA 1URGA 1NUWA 3FV1A 3M8UA 2Q9TA 2NVUB 1B7UA 1S7YA 5TP9B 3B6TA 1RDXA 3PUVE 1NUYA 2X26A 2YPNA 3HO7A 3U72A 1MQIA 1NH8A 1FPLA 3KSJA 2PYYA 1EYKA 2DDKA 4FIMA 4XFEA 2DYXA 2QS1A 4TOZA 2HZKA 4PAFA 5I2NA 4LVQA 4G8HA 1CNQA 4DCYA 1RDYA 2THIA 2YLNA 2GH9A 1IEJA 3K00A 2NUVA 2GFEA 3LSFB 4DIGA 5B70A 4N07A 4WEPA 2DS9A 2FYIA 4HW8A 4U22A 1JETA 1Y20A 3FATA 2L5VA 3FXQA 1QUIA 1ZIUA 4QF9A 3PUYE 4IY5A 4N8GA 3TTNA 4IR8A 1R6ZA 2V93A 1O63A 1XC1A 3IX1A 2F3BA 1AIVA 2F78A 4OTEA 5DT6A 5CMMA 3E78A 1OIBA 1US5A 2X7QA 1ZKBA 3MVXA 4F2QA 1NV4A 4I62A 1MPDA 1MH3A 2Y7RA 1POTA 3MVZA 4O7IA 2UVHA 2QPQA 4ONYA 2WBBA 1Y3PA 3H6TA 3VVFA 3U92A 2VD2A 3OO7A 2O7UA 2F8DA 5AA3A 4YU0A 3B6QA 4MEVA 4P56A 3H6WA 1B58A 4PFWA 3PPNA 2QS2A 4OVQA 4F19A 3E79A 5ET8A 3VVEA 4N4UA 4NF4A 2IA4A 1HSEA 4JSOA 4OETA 1IMBA 4IO3A 1Z7ME 3U1OA 4QXDA 1NV7A 4EUOA 1FPBA 5H8NA 1FQFA 1K9ZA 1LGBC 3CVGA 3KJTA 2OZZA 1B4ZA 3U94A 3SESA 1MXYA 3EPEA 3D1RA 3HV1A 4EQ7A 1KZ8A 5T3JA 4GX4A 1RDZA 2GQ1A 4PQJA 1YPNA 2I0BA 4JVDA 1NNKA 1LFIA 3FV2A 4OESA 2UYEA 3H4ZA 3G3FA 1D9YA 4R9GA 3LSXA 3PMVA 5I59B 2DWHA 3DLNA 1ZJLA 3MVWA 4OFOA 3V5AA 5FHOA 1FQDA 4GWUA 3RPLB 3C4MA 5I2KA 2I58A 1FQAA 4NG7A 3EQ1A 4RA1A 1XVYA 4AS5A 4PF8A 3BKIB 1G0HA 1ZLQA 3IB1A 4E0XA 1LAFE 1XHYA 5IZ3A 1B1HA 3ODBA 1H43A 3FXBA 1H3DA 4F1VA 2PFYA 5AA2A 1B3LA 3RN8A 2RC9A 4BDNA 3EF7A 3MP8A 2Z8FA 2Y7WA 5CM6A 4NN3A 3L6GA 4YICA 3T66A 1MXZA 4ZE8A 1JVYA 4U4SA 5FHMA 3TCFA 2H4IA 5I58A 3R6UA 2RC8A 2ZZWA 1FRPA 3PTYA 2WYPA 3TMGA 4OXVA 2W7YA 5ET5A 1SW1A 4BDRA 4OYVA 3H7MA 5I57A 4C0RA 4OHNA 3TAJA 2A5TB 2QS4A 3IR1A 4OWDA 4H65A 4K3FA 4POXA 3TTMA 1BIYA 2WYKA 4ZE9A 3ILUB 1P1QA 4O8MA 2OWZA 3UGWA 4KYDA 5EQAA 5KCJB 5A5XB 2H9BA 3T93B 4NX1A 2ONSA 4MJOA 1FBFA 2H25A 3MYUA 1P1UA 4GXSB 1TT1A 1MPCA 1D4NA 4TLMB 4IY6A 2OLBA 3HPIA 2RINA 4XKRA 4DDDA 3SETA 2Y7PA 5CC2A 4NMYA 2QS3A 2RCAA 1SI1A 3C33A 4MBPA 4MF3A 4AB5A 4M1VA 1FPGA 3RNNA 1NUZA 1LBCA 4PF6A 4R6HA 2I0CA 1NNPA 5AE4A 1QUJA 2PFZA 4YKJA 4PFBA 2F7BA 3VDFA 3ZSFA 2ONKE 4PFUA 1EU8A 5I2KB 3O29A 1DTZA 1FCKA 4U21A 1MY1A 3LR1A 2G29A 1XVXA 1MXWA 3PPPA 2F35A 2O68A 2OWSA 5HPQA 1MY0A 1SVXB 4GVOA 2DWJA 4QFOA 4Q5TA 2XXPA 4QBAA 2CMOA 1MXUA 2XXXA 5CRYA 4EF2A 3CHGA 5K2YA 4OEUA 4ELRA 4OA4A 4U1ZA 3PPQA 4NF5B 2QMWA 1PB9A 3PMXA 2Z8DA 4DZ1A 1MQHA 1JEVA 1FTAA 1N0TA 3SDFA 3K01A 1NKXA 4NF4B 1IMFA 4P3LA 5ESYA 2ZYNA 2CEXA 1SI0A 3T9VA 3CSGA 4R72A 1VR5A 4JVIA 2CZHA 4F1YA 3I5OA 2RCBA 3RGYA 3HN0A 1IITA 5H8QB 1BKAA 3QSLA 4MMPA 4LZ8A 3MBPA 4PP0A 1PEBA 1DPPA 3LUYA 2UXAA 4GWOA 2CZLA 3K1PA 4GWSA 3H03A 3E9XA 3OO8A 3S4UA 1A8EA 3OMBA 2DE4A 1QKBA 1JW5A 1SW4A 3I6VA 1FBHA 4FBPA 4EXLA 3O9PA 2NWJA 3H06B 4PGPA 1G0IA 3K02A 2PBWA 1FTMA 3DP6A 4WEDA 1PBPA 3FXRA 3C9HA 4MAGA 3IL1B 4KFQA 1SPIA 1LAXA 4GQOA 3MZBA 4QRZA 3T9XB 4LUBA 4HE1A 3A09A 1VFEA 2RC7A 2I4BA 2P0SA 3KOSA 1LAHE 3ZKLA 1MY2A 4PTKA 5EYGA 3IFCA 1N3XA 5DVIA 5ICQA 4MCOA 4XKQA 1OLCA 1VSOA 2O1MA 4FATA 5I2NB 4OFLA 3MUQA 3M3LA 2B65A 2VT5A 5KDTA 3U8QA 1LSTA 2V25A 4F31B 1B3GA 3HHGA 2QVUA 1QUKA 5I56A 3HCQA 4PAKA 1KA1A 2OBGA 1BP5A 5HM4B 1AMFA 4I8CA 1A8FA 4GWZA 4G2ZA 1AWBA 1I69A 3GZGA 3O97A 2JJKA 4F3GA 3NOHA 5L9SA 2MKZA 1IXHA 5AA4A 3C32A 2F6PA 2Y7KA 2DSFA 2NOOA 2GRVA 4UABA 2VPOA 4F29A 4ZEFA 3TUSA 1O64A 2ZYMA 4HXVA 4BDMA 3BFUA 2F6GA 4KCDA 2B3BA 1ATGA 1PDAA 4DXCA 5HBCA 1T0KA 3OOAA 5LDZA 2Z8EA 4PDDA 3TKDA 1EYJA 3IOTA 4OEVA 3I3VA 2BJJX 5J16A 1QJMA 3O2AA 2RKMA 5ELVA 3RLFE 1F9BA 3D4CA 1B5HA 4THIA 4X8RA 2HQ0A 3VFJA 1QULA 2XXRA 5DYHA 2QMXA 3O28A 1L5TA 4EQ9A 2ZZXA 2P2AA 4ELOA 3SEYA 2F5XA 3FGSA 2V3QA 3UA8A 5IZZA 4XKNA 2DOJA 3W9VA 5EYFA 2PX1A 1OVBA 3MSTA 4KD5A 3G7WA 3JYRA 4IO7A 2D3IA 3KFMA 2ABHA 3V89B 4YZZA 4AB6A 2HCAA 3O6HA 5K2XA 3PD8A 3FBPA 3IOWA 5H8FA 4R2FA 4MNPA 1LFHA 2V84A 5I84A 3KBZA 4G68A 5JTYA 3RQTA 3T9HB 4MNIA 4OERA 1KWHA 1R9LA 1I6AA 3O6GA 1MS7A 3QYTA 3IB0A 3Q25A 1B2HA 3MP1A 4ESXA 3IK6B 4O94A 2PCRA 4JVCA 4KYSA 4NE4A 4AS4A 1NV5A 1URDA 5DW8A 1QGXA 4G4PA 5B7DA 2ALUA 1DK4A 2UVGA 2OX3A 3IJOB 3ONMA 4LQ5A 2PT1A 4KI0E 3TPAA 5A5XA 1IZ1A 2QJEA 4RJZA 4NF0A 5LTCA 2FBPA 1Y1MA 3VE1B 3FVOA 3ILTB 3CFXA 3GBAA 2A5TA 4KCCA 5DTBA 3FASA 4F3SA 3A3UA 1MY3A 1MXVA 2DXRA 1YZ0A 1YAEA 4ELQA 4G61A 2QVRA 1FTLA 1UTHB 4PFTA 4OVTA 1SYIA 2QL3A 3KN7A 5I58B 4O3CA 4R9FA 2DXYA 2Y5KA 1B7HA 4ZEBA 1KA0A 4I9DA 3K6XA 5CI5A 4P1EA 4R75A 4G8MA 4IO6A 5I7IA 4LONB 3B8BA 4DLDA 4UA8A 1XS5A 3BIGA 3K1NA 2O7IA 2NXOA 3O6IA 1ZTYA 2O84X 1A7LA 3SERA 5IM2A 3V83A 1ANFA 2A5SA 1FPJA 1MQGA 4FEDA 3Q26A 4X1BA 3THIA 1FBEA 3C31A 4OQOA 3H3GA 2H5YA 3LC8A 1FJ9A 4ZEIA 2FNCA 4GXAA 4PFYA 4HCWA 4PBHA 4N15A 3RPLA 3RPWA 1OMPA 4O7MA 3V8XB 2XWKA 2REJA 4Q30B 3FXUA 5F24A 5TPAB 5H8HB 5LOMA 1B52A 4ZEDA 1BK4A 1UTHA 5I5PA 1B32A 4H1XA 4C1TA 2XD2A 3KBRA 2XXWA 1SYHA 1OVTA 3G3HA 4DI4B 1DOTA 4LZ7A 4Q8RA 1S9TA 4JBZA 4RK2A 1JW1A 1LFGA 1MQDA 1MDP1 3TTRA 3W9WA 1EZOA 4GBVA 5CBSA 1NL5A 4M4GA 3TFLA 4EQBA 3OSQA 3UIFA 3N26A 3ZS6A 2KLFA 3T1BA 5DVJA 5CMCA 2Y5LA 4QSDA 4JB7A 3MZ1A 1MQJA 3KN3A 5IZ1A 4H5FA 2R6GE 4PC9A 4EDPA 4ND9A 5ET7A 3G3KA 5CMBA 3R7XA 3N5LA 1D3KA 3BFTA 3PMWA 4I3EA 4PE5B 1B05A 2OCUA 3O66A 5DVFA 2ZYKA 1Z7NE 5H8FB 3PV0E 4L17A 1SBPA 4ZS9A 1M5DA 3TCGA 4FE8A 4FAJA 3RTWB 1B46A 3K0VA 4GWYA 3IAZA 4F1UA 2XWOA 2O6AA 1IMAA 4MX6A 3M3KA 3PPRA 3FD3A 2LAOA 4XKPA 4ZEKA 4BDOA 3KG2A 1UTBB 2Q2AA 1LEVA 3DM0A 1B1XA 1NFTA 5AA2D 1MY4A 3G3GA 3GLBA 1O7TA 1FPDA 3B7DA 1JQFA 2XWIA 1M5BA 2I48A 3PPOA 5EHMA 3KN8A 2PT2A 2OWTA 1AL3A 1NH7A 4QHQA 3T0JA 2DE3A 5BUUA 1FPIA 4X04A 4H67A 3C36A 5EQ9A 3TYHA 3KGCA 2H99A 2ZNUA 2PMSA 3MWBA 1MG1A 5L9OA 1GR2A 5ISUA 4WXJA 2OK2A 2XXHA 3OEKA 4GWWA 4R73A 3GYYA 5AA4B 3ECRA 2XXKA 3FJGA 1IMDA 5H8SA 3A3CA 5H8HA 2B3FA 2Y84A 5TPAA 4P0IA 1LBWA 1II5A 5CBRA 1FQEA 4GX3A 4N81A 1GTKA 1A99A 4ZECA 2HHMA 4GL0A 4X9TA 2I3VA 4GWXA 4KXPA 4EF1A 4H0WA 4YB5A 4LP2B 1I6QA 3GBBA 3USDA 1CB6A 1NV0A 2I3WA 1Y3NA 4YKKA 2CEYA 3P7IA 3LSLA 4QFLA 1M5CA 2WKYA 4MNCA 4NEDA 3VXCA 2XA5A 1B3HA 2OJTA 2Q89A 5A5LA 4JXIA 4IGTA 5CMKA 1Y1ZA 3SKPA 4OVPA 3OELA 2R8TA 4FORA 1MRPA 3Q29A 2BJIA 2I4CA 4H5GA 2M8CA 4H6DA 3LSWA 1JVXA 1OQGA 1Q9DA 2HZLA 1EYIA 4LQ2A 1QVSA 2B4LA 1B3FA 3KEIA 1POY1 3MW0A 1FPEA 3UN6A 4NQ8A 4AQ4A 4KYEA 1VFDA 3SEWA 1N84A 2DVZA 2O51A 4P0GA 2REGA 4NF8B 2UYFA 3AXFA 3CFZA 3FUZA 3OO9A 1AH5A 1FTOA 4GF8A 4ELPA 1DCUA 1JW4A 3FJ7A 1EH3A 2VGQA 4POWA 3H6VA 4MFIA 3JV9A 5F1QA 1H44A 1XI6A 3TEPA 1MXXA 4IGRA 3E3KA 4OENA 3N6UA 1FW0A 4OVSA 2XXIA 4Z7EA 2DE2A 4GX6A 2ZXTA 4DXBA 4NF6A 4GLIA 2VPNA 3QIMA 3VLWA 5KZTA 1A54A 4YMAA 3EHTA 4ZDMA 4PE3A 1A40A 4HE0A 2R71A 3G3IA
chains in the Genus database with same CATH topology
4F1VA 2O1LA 3RT8A 1OQHA 3IJOB 3ONMA 3UP9A 5AA2A 4LQ5A 4HS7A 2PT1A 4KI0E 1B3LA 2VD3A 3VV5A 3CRBA 3TPAA 5A5XA 1IZ1A 4JSDA 2PVUA 3RN8A 2QJEA 4RJZA 1OLAA 1JEUA 2RC9A 1URSA 3EF7A 4BDNA 2FA7A 3FVNA 1Y1MA 2Z8FA 3FVOA 3ILTB 3MP8A 3VE1B 2Y7WA 1LAGE 3QXMA 3T22A 5CM6A 3CFXA 4XTCQ 3L6GA 3GBAA 4YICA 3T66A 4G68B 1MXZA 2ANJA 5JTYB 2A5TA 1P99A 4ZE8A 4KCCA 1JVYA 4U4SA 4KPTA 5DTBA 5FHMA 3TCFA 3FASA 3TCHA 1FQCA 4F22A 2H4IA 4F3SA 5I58A 1Q35A 3R6UA 3KOTA 3RT6B 3A3UA 1DSNA 1MY3A 4LA9A 1M5FA 1MXVA 1I6BA 2RC8A 2DXRA 3QUFA 4RK9A 1IIWA 2E1SA 4I1DA 2F36A 1B40A 1YAEA 2HAVA 2I6EA 4LZ5A 4OXVA 3TELA 2W7YA 3TMGA 4ELQA 2F7AA 5I59A 5JEIA 4EXKA 1SW1A 3S4UA 1Y3QA 1TWYA 5IKBA 4JWOA 1ZMGA 4BDRA 3CR9A 1FTLA 4IB2A 4MLVA 1HSLA 4OYVA 4DE8A 1UTHB 3H7MA 4PFTA 4ESWA 5I57A 1SYIA 2QL3A 3BBRA 3IO4A 4C0RA 5IAIA 1S50A 3DP4A 3KN7A 5I58B 1JNFA 1LB8A 3C34A 4OHNA 4FECA 4O3CA 4R9FA 3N94A 2DXYA 4QSEA 2XXTA 3TAJA 4C1UA 2A5TB 1BTJA 2QS4A 1MH4A 1MPBA 3DP8A 3IR1A 4H65A 4K3FA 4OWDA 4POXA 3TTMA 1BIYA 1RYXA 4ZE9A 3ILUB 3DELB 1B7HA 1P1QA 1ELJA 4ZEBA 1NNTA 4I9DA 4IO5A 3K6XA 5CI5A 3VXBA 4R75A 3UGWA 4KYDA 3WAEA 3EN3A 1XOCA 4G8MA 4IO6A 5KCJB 2F34A 4LONB 2H9BA 5A5XB 3T93B 2XXUA 4DLDA 2ONSA 4R74A 4UA8A 1XS5A 2H25A 3TODA 1P1UA 4GXSB 1TT1A 1B51A 1D4NA 1B4HA 1MPCA 1P1WA 2XX9A 3OO6A 4IY6A 2OLBA 3K1NA 2O7IA 2NXOA 3O6IA 3L6HA 3HPIA 2RINA 4GL8A 1ZTYA 1EZ9A 1B7ZA 5BWJA 2VHAA 2O84X 5DEXB 1A7LA 3SERA 3TZAA 4XKRA 4DDDA 3B6WA 1IUDA 2P1SA 2XX7A 4G77A 2Y7PA 1ANFA 2A5SA 3IJXB 4R2BA 4X48A 3SETA 4NMYA 2GHAA 2QS3A 5CC2A 1MQGA 2RCAA 4FEDA 1SI1A 2YJPA 3Q26A 4BDLA 3C33A 1WODA 4MBPA 1J1NA 2ZNSA 4X1BA 1B5IA 3VLUA 3THIA 2XX8A 3OD7A 4MF3A 1GGGA 3C31A 3MC2A 3H3GA 3MVYA 4OQOA 3T9UA 3TDJA 4AB5A 4M1VA 3M3FA 4DCXA 2I49A 3IOUA 4R6KA 4JWXA 4U23A 2H5YA 3IB2A 1IXIA 3LC8A 3MPLA 3RNNA 4YMBA 5DEXA 1LBCA 2ZYOA 4R6HA 2I0CA 4N6PA 5AA1A 4ZEIA 1NNPA 4NF6B 2FNCA 3PGFA 5AE4A 1QUJA 3KJ7A 4GXAA 4PFYA 2VP1A 4HCWA 4YKJA 1N7WA 2F7BA 3VDFA 3RPWA 1DTGA 2QRYA 1YTVA 4KHZE 3MJNA 3CFLA 4ISUA 1OMPA 3RUMA 3TTKA 1PC3A 4OZ9A 1YCJA 3V8XB 3ZSFA 4FEBA 3D4GA 2REJA 4Q30B 2ONKE 3PUWE 4NF8A 4PFUA 3FXUA 4XXUA 1B5JA 4F3BA 1EU8A 4Z0IA 4OFJA 5TPAB 4F2OA 3OSRA 5FTIA 5H8HB 5I2KB 1R1NA 2HXWA 3O29A 1GV8A 1DTZA 1FCKA 3G3JA 4BDQA 2R9JA 5LOMA 2V3TA 3KSXA 4U21A 1B52A 1MY1A 1IXGA 2HEUA 2G29A 2VOZA 3LR1A 1XVXA 4ZEDA 5I57B 1MXWA 1UTHA 1B32A 3QUJA 4QSCA 2ZMBA 1ZBMA 3Q27A 3PPPA 2E0SA 4H1XA 4YKPA 2F35A 1TXFA 2O68A 1US4A 2OWSA 2XD2A 4C1TA 1MY0A 2XXWA 1SVXB 3CI8A 3KBRA 1UQWA 4GRKA 4GVOA 5HPQA 1LB9A 1RKMA 1Y9UA 2DWJA 1SYHA 2AL5A 4QFNA 4F3PA 5I56B 4QFOA 1OVTA 3G3HA 4KR5A 3QAXA 3FVGA 4RPOA 4RYAA 4Q5TA 5KDTB 3FZVA 3SEVA 3KZGA 3V83A 2XXPA 1DOTA 4LZ7A 4TQUQ 3H6UA 4Q8RA 2DVCA 1QW0A 2Y7IA 5F7VA 1S9TA 4JBZA 5ICTA 2ESNA 4RK2A 1JW1A 2CMOA 1LFGA 1MQDA 3FJMA 1MXUA 1MDQA 1MDP1 2XXXA 3F11A 5CRYA 4EF2A 5K2YA 3CSBA 3K4UA 3TTRA 4OEUA 2RF1A 4OVJA 3VLVA 4U1ZA 3W15C 3W9WA 4ELRA 4N13A 3JZJA 3PPQA 4NF5B 5CBSA 3K2DA 1EZOA 1NL5A 1XT8A 2QMWA 4M4GA 3TFLA 4EQBA 2XXYA 3OSQA 1AOVA 4IO4A 3UIFA 1PB9A 3N26A 3ZS6A 2KLFA 1LCTA 3PMXA 2Z8DA 1WDNA 5DVJA 1MQHA 4DZ1A 1JEVA 5CMCA 3C35A 3SEUA 1UIVA 1N0TA 4QSDA 4YKIA 4JB7A 1DMBA 3MZ1A 5FTHA 3UORA 1MQJA 3SDFA 1N04A 3K01A 3KN3A 1NKXA 4NF4B 2DWAA 4O3BA 3K6WA 4H8JA 4H5FA 5BUUA 4R6YA 1SDXA 2ZNTA 3CG3A 2R6GE 4EDPA 4ND9A 3G3KA 5CMBA 5FHNA 3R7XA 3N5LA 1D3KA 3BFTA 2ZYNA 1P1OA 1USYH 3PMWA 2DQVA 3S2VA 3EHUA 1SI0A 3OENA 1B3EA 4PE5B 3T9VA 2D21A 3CSGA 4PETA 3E13X 5JK4A 1B05A 1SQYA 3IOVA 2Q8JA 4R72A 1VR5A 3RY3A 3MZ9A 2OCUA 1RYOA 4G8NA 3LBSA 4F1YA 3OXNA 4YB6A 4UACA 3I5OA 2F97A 2UVJA 3K6VA 3O66A 3WAFA 2RCBA 5DVFA 3S9NC 2ZYKA 3RGYA 4X1DA 2V3UA 3HN0A 4H8IA 1IITA 1FTJA 4U2RA 5H8QB 1BKAA 3QSLA 1Z7NE 5H8FB 4LZ8A 3MBPA 4PP0A 4YB7A 3FIRA 4RPNA 3PV0E 4L17A 1SBPA 1PB7A 2AL4A 1PEBA 3TQWA 1DPPA 1LLSA 3LUYA 4ZS9A 1M5DA 1M5EA 3TCGA 3FVKA 2UXAA 4FE8A 3U93A 1URGA 3FV1A 4GWOA 4FAJA 3Q28A 3M8UA 1B46A 2CZLA 2Q9TA 3K1PA 3RTWB 3K0VA 2NVUB 5H8QA 3H03A 3E9XA 3OO8A 1B0LA 1A8EA 1S7YA 1B7UA 3IAZA 5M2VA 3B6TA 5TP9B 3PUVE 1BLFA 3OMBA 4HTGA 4WKMA 4F1UA 2DE4A 1QKBA 1JW5A 2O6AA 1SW4A 2X26A 3I6VA 3M3KA 2YPNA 3PPRA 3FD3A 2LAOA 4DXUA 5EHSA 3HO7A 4EXLA 4XKPA 3O9PA 2QSXA 3KG2A 4ZEKA 3U72A 4BDOA 3MQ9A 1UTBB 1MQIA 2Q2AA 2NWJA 1D9VA 3H06B 1NH8A 3DM0A 3KSJA 3K02A 2PBWA 2PYYA 1B1XA 1FTMA 3DP6A 2XD3A 4WEDA 1NFTA 4GD5A 1FTKA 5AA2D 1PBPA 3FXRA 4FIMA 3C9HA 4QFKA 2DYXA 2QS1A 3IL1B 1MY4A 2IEEA 1R9QA 1Y4CA 3G3GA 3GLBA 4KFQA 2HZKA 1O7TA 4TOZA 1SW5A 5H8NB 3SEXA 1LAXA 3OEMA 4LVQA 3B7DA 4GQOA 1JQFA 5I2NA 4GIZA 1M5BA 4G8HA 3MZBA 4QRZA 2I48A 4DCYA 3PPOA 5EHMA 2THIA 2YLNA 3KN8A 4LUBA 3T9XB 2GH9A 2PT2A 2OWTA 3A09A 1WVJA 1B6HA 1IEJA 3K00A 5J1DA 1AL3A 1NH7A 3T96B 2HAUA 4QHQA 1VFEA 2GFEA 2NUVA 3ZKKA 3LSFB 5TU0A 2RC7A 4DIGA 1SD3A 5L8DA 3EHSA 1P1NA 2I4BA 2P0SA 3KOSA 4N07A 4RNSA 5B70A 1LAHE 3ZKLA 1MY2A 4WEPA 5ITPA 2DE3A 4NF5A 4IO2A 1N3XA 2DS9A 2G93A 4MH5A 5DVIA 2FYIA 4MLQA 4HW8A 4XKQA 4U22A 5ICQA 4H67A 1B0HA 3C36A 1OLCA 1VSOA 1JETA 3TYHA 2O1MA 4FATA 3KGCA 5I2NB 5ITOA 1Y20A 4G68C 3FATA 3CIJA 1H76A 3FXQA 4Q0CA 4OFLA 1QUIA 1ZIUA 2H99A 4QF9A 3PUYE 3MUQA 2ZNUA 3M3LA 1VE4A 2B65A 2PMSA 2XHDA 3MWBA 4IY5A 2GHBA 1MG1A 5L9OA 5KDTA 3S9MC 1GR2A 2UVIA 1LSTA 2V25A 4OMBA 3TTNA 3U8QA 1B3GA 4WXJA 4F31B 2OK2A 3HHGA 1PBQA 1QUKA 1R6ZA 2V93A 2XXHA 5I56A 3HCQA 1O63A 1CE2A 1XC1A 3IX1A 2DP8A 2OBGA 4ZZEA 1UTBA 1AIVA 1BP5A 5HM4B 1AMFA 3IORA 2F78A 3OEKA 4I8CA 1A8FA 4OTEA 4R73A 5CMMA 5DT6A 1OIBA 4G2ZA 3PUXE 1I69A 5AA4B 3ECRA 1US5A 2X7QA 1A55A 1ZKBA 3MVXA 5L9MA 4F2QA 3FJGA 4P11A 1Q1KA 3GZGA 3O97A 4I62A 4TLLB 5H8SA 4F3GA 2Q88A 3A3CA 5H8HA 1MPDA 2B3FA 2Y84A 1MH3A 3VVDA 5L9SA 5TPAA 4P0IA 1NMUA 1II5A 2Y7RA 5CBRA 1FQEA 1POTA 3MVZA 4KQPA 1IXHA 5AA4A 3C32A 1SW2A 2F6PA 1GTKA 1TFAA 2Y7KA 2DSFA 1A99A 2UVHA 2AIXA 2QPQA 2NOOA 2GRVA 1USYE 3MP6A 4ONYA 4ZECA 4F29A 4ZEFA 3TUSA 4GL0A 1Y3PA 4O3AA 1GVCA 1O64A 2ZYMA 4X9TA 2I3VA 1FQBA 3GXAA 3H6TA 4EF1A 4H0WA 2ONRA 1DPEA 4YB5A 1MM7A 1Y4TA 1I6QA 4LP2B 3VVFA 4BDMA 3U92A 3GBBA 3USDA 2VD2A 3BFUA 3E4RA 2F6GA 3OO7A 3QK6A 2O7UA 2AYSA 1CB6A 4KCDA 2F8DA 2I3WA 5AA3A 4YU0A 1Y3NA 2B3BA 1N7XA 4GFRA 3B6QA 1ATGA 1PDAA 3MAMA 4YKKA 3H6WA 4DXCA 5HBCA 4RY1A 1T0KA 1B58A 3P7IA 3LSLA 1LBBA 1M5CA 2QS2A 2XXQA 3PPNA 4PFWA 4QFLA 3K1MA 4F19A 3OOAA 3TTLA 2Z8EA 3TKDA 1ZU0A 3RTFB 2WKYA 4NEDA 3VVEA 4YAHX 3IOTA 2H98A 3VXCA 4ECFA 4XIGQ 4NF4A 4BLAA 2IA4A 1HSEA 3PD9A 4JSOA 4OEVA 4OETA 4QFPA 1B3HA 4IO3A 1Z7ME 3I3VA 2BJJX 2OJTA 3U1OA 3UK4A 4LATA 4EUOA 2Q89A 1QJMA 3O2AA 2RKMA 4JXIA 4IGTA 5ELVA 3RLFE 5CMKA 1F9BA 1Y1ZA 1B5HA 3D4CA 1HSJA 4THIA 4TLMB 3SKPA 3OELA 5H8NA 2HQ0A 3K6UA 1QULA 4FORA 3VFJA 2XXRA 1FQFA 2F7CA 4U4XA 1LGBC 2QMXA 3N6TA 4U1OA 5DYHA 4NTLA 1MRPA 3O28A 3Q29A 1UIUA 1L5TA 4EQ9A 2I4CA 2P2AA 3CVGA 1H45A 4H5GA 2M8CA 4H6DA 3KJTA 4GOTA 5KCJA 2OZZA 1B4ZA 3PUZE 1PB8A 3SESA 3U94A 3LSWA 1JVXA 1MXYA 1OQGA 3TQLA 4FJPA 4ELOA 3SEYA 2F5XA 2HZLA 3EPEA 3FGSA 3S9LC 2V3QA 4LQ2A 1QVSA 3HV1A 3UA8A 4EQ7A 1B3FA 3KEIA 1POY1 3MW0A 2Z22A 4JDFA 4XKNA 3UN6A 4AQ4A 3MPKA 2DOJA 3W9VA 4KYEA 1VFDA 5EYFA 1N3WA 3SEWA 1N84A 1OVBA 2DVZA 2PX1A 4HCYA 4PQJA 1YPNA 2I0BA 4NWCA 1TFDA 5TP9A 1NNKA 4KD5A 3G7WA 1LFIA 3FV2A 3JYRA 2O51A 4OESA 2UYEA 2D5WA 2HFBA 3H4ZA 4IO7A 4P0GA 2D3IA 3KFMA 2ABHA 2REGA 3G3FA 4NF8B 1IXCA 1D9YA 2UYFA 3AXFA 3CFZA 4R9GA 3LSXA 3PMVA 4YZZA 3V89B 5I59B 4AB6A 1QKAA 2DWHA 2HCAA 3DLNA 3O6HA 5K2XA 3FUZA 3OO9A 3PD8A 1AH5A 1FTOA 4F18A 1ZJLA 3MVWA 4GF8A 1IQ7A 4OFOA 4RXLA 3IOWA 3V5AA 4ELPA 5FHOA 5H8FA 1FQDA 4R2FA 2Z23A 1JW4A 1LFHA 2V84A 3FJ7A 5I84A 3C4MA 1NNFA 4NWDA 2I58A 5I2KA 1EZPA 4G68A 1EH3A 1FQAA 2VGQA 3HHFA 3PU5A 3H6VA 4POWA 3RQTA 5JTYA 1LCFA 3T9HB 1B9JA 4MFIA 3JV9A 5F1QA 3CG1A 4JWYA 1H44A 4OERA 1KWHA 3EQ1A 1I6AA 1R9LA 3IO6A 3TEPA 1MXXA 3O6GA 1MS7A 3QYTA 3IB0A 3Q25A 1N76A 4IGRA 4RA1A 2X7PA 3E3KA 4OENA 3N6UA 1B2HA 4E0WA 1FW0A 5AA2B 1XVYA 3S9EA 2XXIA 3MP1A 4Z7EA 2DE2A 2ZXTA 4F39A 2Q2CA 3BKIB 4DXBA 4ESXA 5ISUA 1ZLQA 4NF6A 4ZZAA 3IB1A 4E0XA 4GLIA 3VLWA 3QIMA 5KZTA 1LAFE 1MM6A 3IK6B 1A54A 4YMAA 3EHTA 2DWIA 1XHYA 4KYSA 4ZDMA 4NE4A 1B1HA 1A40A 3ODBA 1H43A 3R26A 1URDA 2XXVA 4G4PA 5B7DA 2R71A 1H3DA 3G3IA 2ALUA 2UVGA 3HSTA 2O69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F1V A;  2O1L A;  3RT8 A;  1OQH A;  3IJO B;  3ONM A;  3UP9 A;  5AA2 A;  4LQ5 A;  4HS7 A;  2PT1 A;  4KI0 E;  1B3L A;  2VD3 A;  3VV5 A;  3CRB A;  3TPA A;  5A5X A;  1IZ1 A;  4JSD A;  2PVU A;  3RN8 A;  2QJE A;  4RJZ A;  1OLA A;  1JEU A;  2RC9 A;  1URS A;  3EF7 A;  4BDN A;  2FA7 A;  3FVN A;  1Y1M A;  2Z8F A;  3FVO A;  3ILT B;  3MP8 A;  3VE1 B;  2Y7W A;  1LAG E;  3QXM A;  3T22 A;  5CM6 A;  3CFX A;  4XTC Q;  3L6G A;  3GBA A;  4YIC A;  3T66 A;  4G68 B;  1MXZ A;  2ANJ A;  5JTY B;  2A5T A;  1P99 A;  4ZE8 A;  4KCC A;  1JVY A;  4U4S A;  4KPT A;  5DTB A;  5FHM A;  3TCF A;  3FAS A;  3TCH A;  1FQC A;  4F22 A;  2H4I A;  4F3S A;  5I58 A;  1Q35 A;  3R6U A;  3KOT A;  3RT6 B;  3A3U A;  1DSN A;  1MY3 A;  4LA9 A;  1M5F A;  1MXV A;  1I6B A;  2RC8 A;  2DXR A;  3QUF A;  4RK9 A;  1IIW A;  2E1S A;  4I1D A;  2F36 A;  1B40 A;  1YAE A;  2HAV A;  2I6E A;  4LZ5 A;  4OXV A;  3TEL A;  2W7Y A;  3TMG A;  4ELQ A;  2F7A A;  5I59 A;  5JEI A;  4EXK A;  1SW1 A;  3S4U A;  1Y3Q A;  1TWY A;  5IKB A;  4JWO A;  1ZMG A;  4BDR A;  3CR9 A;  1FTL A;  4IB2 A;  4MLV A;  1HSL A;  4OYV A;  4DE8 A;  1UTH B;  3H7M A;  4PFT A;  4ESW A;  5I57 A;  1SYI A;  2QL3 A;  3BBR A;  3IO4 A;  4C0R A;  5IAI A;  1S50 A;  3DP4 A;  3KN7 A;  5I58 B;  1JNF A;  1LB8 A;  3C34 A;  4OHN A;  4FEC A;  4O3C A;  4R9F A;  3N94 A;  2DXY A;  4QSE A;  2XXT A;  3TAJ A;  4C1U A;  2A5T B;  1BTJ A;  2QS4 A;  1MH4 A;  1MPB A;  3DP8 A;  3IR1 A;  4H65 A;  4K3F A;  4OWD A;  4POX A;  3TTM A;  1BIY A;  1RYX A;  4ZE9 A;  3ILU B;  3DEL B;  1B7H A;  1P1Q A;  1ELJ A;  4ZEB A;  1NNT A;  4I9D A;  4IO5 A;  3K6X A;  5CI5 A;  3VXB A;  4R75 A;  3UGW A;  4KYD A;  3WAE A;  3EN3 A;  1XOC A;  4G8M A;  4IO6 A;  5KCJ B;  2F34 A;  4LON B;  2H9B A;  5A5X B;  3T93 B;  2XXU A;  4DLD A;  2ONS A;  4R74 A;  4UA8 A;  1XS5 A;  2H25 A;  3TOD A;  1P1U A;  4GXS B;  1TT1 A;  1B51 A;  1D4N A;  1B4H A;  1MPC A;  1P1W A;  2XX9 A;  3OO6 A;  4IY6 A;  2OLB A;  3K1N A;  2O7I A;  2NXO A;  3O6I A;  3L6H A;  3HPI A;  2RIN A;  4GL8 A;  1ZTY A;  1EZ9 A;  1B7Z A;  5BWJ A;  2VHA A;  2O84 X;  5DEX B;  1A7L A;  3SER A;  3TZA A;  4XKR A;  4DDD A;  3B6W A;  1IUD A;  2P1S A;  2XX7 A;  4G77 A;  2Y7P A;  1ANF A;  2A5S A;  3IJX B;  4R2B A;  4X48 A;  3SET A;  4NMY A;  2GHA A;  2QS3 A;  5CC2 A;  1MQG A;  2RCA A;  4FED A;  1SI1 A;  2YJP A;  3Q26 A;  4BDL A;  3C33 A;  1WOD A;  4MBP A;  1J1N A;  2ZNS A;  4X1B A;  1B5I A;  3VLU A;  3THI A;  2XX8 A;  3OD7 A;  4MF3 A;  1GGG A;  3C31 A;  3MC2 A;  3H3G A;  3MVY A;  4OQO A;  3T9U A;  3TDJ A;  4AB5 A;  4M1V A;  3M3F A;  4DCX A;  2I49 A;  3IOU A;  4R6K A;  4JWX A;  4U23 A;  2H5Y A;  3IB2 A;  1IXI A;  3LC8 A;  3MPL A;  3RNN A;  4YMB A;  5DEX A;  1LBC A;  2ZYO A;  4R6H A;  2I0C A;  4N6P A;  5AA1 A;  4ZEI A;  1NNP A;  4NF6 B;  2FNC A;  3PGF A;  5AE4 A;  1QUJ A;  3KJ7 A;  4GXA A;  4PFY A;  2VP1 A;  4HCW A;  4YKJ A;  1N7W A;  2F7B A;  3VDF A;  3RPW A;  1DTG A;  2QRY A;  1YTV A;  4KHZ E;  3MJN A;  3CFL A;  4ISU A;  1OMP A;  3RUM A;  3TTK A;  1PC3 A;  4OZ9 A;  1YCJ A;  3V8X B;  3ZSF A;  4FEB A;  3D4G A;  2REJ A;  4Q30 B;  2ONK E;  3PUW E;  4NF8 A;  4PFU A;  3FXU A;  4XXU A;  1B5J A;  4F3B A;  1EU8 A;  4Z0I A;  4OFJ A;  5TPA B;  4F2O A;  3OSR A;  5FTI A;  5H8H B;  5I2K B;  1R1N A;  2HXW A;  3O29 A;  1GV8 A;  1DTZ A;  1FCK A;  3G3J A;  4BDQ A;  2R9J A;  5LOM A;  2V3T A;  3KSX A;  4U21 A;  1B52 A;  1MY1 A;  1IXG A;  2HEU A;  2G29 A;  2VOZ A;  3LR1 A;  1XVX A;  4ZED A;  5I57 B;  1MXW A;  1UTH A;  1B32 A;  3QUJ A;  4QSC A;  2ZMB A;  1ZBM A;  3Q27 A;  3PPP A;  2E0S A;  4H1X A;  4YKP A;  2F35 A;  1TXF A;  2O68 A;  1US4 A;  2OWS A;  2XD2 A;  4C1T A;  1MY0 A;  2XXW A;  1SVX B;  3CI8 A;  3KBR A;  1UQW A;  4GRK A;  4GVO A;  5HPQ A;  1LB9 A;  1RKM A;  1Y9U A;  2DWJ A;  1SYH A;  2AL5 A;  4QFN A;  4F3P A;  5I56 B;  4QFO A;  1OVT A;  3G3H A;  4KR5 A;  3QAX A;  3FVG A;  4RPO A;  4RYA A;  4Q5T A;  5KDT B;  3FZV A;  3SEV A;  3KZG A;  3V83 A;  2XXP A;  1DOT A;  4LZ7 A;  4TQU Q;  3H6U A;  4Q8R A;  2DVC A;  1QW0 A;  2Y7I A;  5F7V A;  1S9T A;  4JBZ A;  5ICT A;  2ESN A;  4RK2 A;  1JW1 A;  2CMO A;  1LFG A;  1MQD A;  3FJM A;  1MXU A;  1MDQ A;  1MDP 1;  2XXX A;  3F11 A;  5CRY A;  4EF2 A;  5K2Y A;  3CSB A;  3K4U A;  3TTR A;  4OEU A;  2RF1 A;  4OVJ A;  3VLV A;  4U1Z A;  3W15 C;  3W9W A;  4ELR A;  4N13 A;  3JZJ A;  3PPQ A;  4NF5 B;  5CBS A;  3K2D A;  1EZO A;  1NL5 A;  1XT8 A;  2QMW A;  4M4G A;  3TFL A;  4EQB A;  2XXY A;  3OSQ A;  1AOV A;  4IO4 A;  3UIF A;  1PB9 A;  3N26 A;  3ZS6 A;  2KLF A;  1LCT A;  3PMX A;  2Z8D A;  1WDN A;  5DVJ A;  1MQH A;  4DZ1 A;  1JEV A;  5CMC A;  3C35 A;  3SEU A;  1UIV A;  1N0T A;  4QSD A;  4YKI A;  4JB7 A;  1DMB A;  3MZ1 A;  5FTH A;  3UOR A;  1MQJ A;  3SDF A;  1N04 A;  3K01 A;  3KN3 A;  1NKX A;  4NF4 B;  2DWA A;  4O3B A;  3K6W A;  4H8J A;  4H5F A;  5BUU A;  4R6Y A;  1SDX A;  2ZNT A;  3CG3 A;  2R6G E;  4EDP A;  4ND9 A;  3G3K A;  5CMB A;  5FHN A;  3R7X A;  3N5L A;  1D3K A;  3BFT A;  2ZYN A;  1P1O A;  1USY H;  3PMW A;  2DQV A;  3S2V A;  3EHU A;  1SI0 A;  3OEN A;  1B3E A;  4PE5 B;  3T9V A;  2D21 A;  3CSG A;  4PET A;  3E13 X;  5JK4 A;  1B05 A;  1SQY A;  3IOV A;  2Q8J A;  4R72 A;  1VR5 A;  3RY3 A;  3MZ9 A;  2OCU A;  1RYO A;  4G8N A;  3LBS A;  4F1Y A;  3OXN A;  4YB6 A;  4UAC A;  3I5O A;  2F97 A;  2UVJ A;  3K6V A;  3O66 A;  3WAF A;  2RCB A;  5DVF A;  3S9N C;  2ZYK A;  3RGY A;  4X1D A;  2V3U A;  3HN0 A;  4H8I A;  1IIT A;  1FTJ A;  4U2R A;  5H8Q B;  1BKA A;  3QSL A;  1Z7N E;  5H8F B;  4LZ8 A;  3MBP A;  4PP0 A;  4YB7 A;  3FIR A;  4RPN A;  3PV0 E;  4L17 A;  1SBP A;  1PB7 A;  2AL4 A;  1PEB A;  3TQW A;  1DPP A;  1LLS A;  3LUY A;  4ZS9 A;  1M5D A;  1M5E A;  3TCG A;  3FVK A;  2UXA A;  4FE8 A;  3U93 A;  1URG A;  3FV1 A;  4GWO A;  4FAJ A;  3Q28 A;  3M8U A;  1B46 A;  2CZL A;  2Q9T A;  3K1P A;  3RTW B;  3K0V A;  2NVU B;  5H8Q A;  3H03 A;  3E9X A;  3OO8 A;  1B0L A;  1A8E A;  1S7Y A;  1B7U A;  3IAZ A;  5M2V A;  3B6T A;  5TP9 B;  3PUV E;  1BLF A;  3OMB A;  4HTG A;  4WKM A;  4F1U A;  2DE4 A;  1QKB A;  1JW5 A;  2O6A A;  1SW4 A;  2X26 A;  3I6V A;  3M3K A;  2YPN A;  3PPR A;  3FD3 A;  2LAO A;  4DXU A;  5EHS A;  3HO7 A;  4EXL A;  4XKP A;  3O9P A;  2QSX A;  3KG2 A;  4ZEK A;  3U72 A;  4BDO A;  3MQ9 A;  1UTB B;  1MQI A;  2Q2A A;  2NWJ A;  1D9V A;  3H06 B;  1NH8 A;  3DM0 A;  3KSJ A;  3K02 A;  2PBW A;  2PYY A;  1B1X A;  1FTM A;  3DP6 A;  2XD3 A;  4WED A;  1NFT A;  4GD5 A;  1FTK A;  5AA2 D;  1PBP A;  3FXR A;  4FIM A;  3C9H A;  4QFK A;  2DYX A;  2QS1 A;  3IL1 B;  1MY4 A;  2IEE A;  1R9Q A;  1Y4C A;  3G3G A;  3GLB A;  4KFQ A;  2HZK A;  1O7T A;  4TOZ A;  1SW5 A;  5H8N B;  3SEX A;  1LAX A;  3OEM A;  4LVQ A;  3B7D A;  4GQO A;  1JQF A;  5I2N A;  4GIZ A;  1M5B A;  4G8H A;  3MZB A;  4QRZ A;  2I48 A;  4DCY A;  3PPO A;  5EHM A;  2THI A;  2YLN A;  3KN8 A;  4LUB A;  3T9X B;  2GH9 A;  2PT2 A;  2OWT A;  3A09 A;  1WVJ A;  1B6H A;  1IEJ A;  3K00 A;  5J1D A;  1AL3 A;  1NH7 A;  3T96 B;  2HAU A;  4QHQ A;  1VFE A;  2GFE A;  2NUV A;  3ZKK A;  3LSF B;  5TU0 A;  2RC7 A;  4DIG A;  1SD3 A;  5L8D A;  3EHS A;  1P1N A;  2I4B A;  2P0S A;  3KOS A;  4N07 A;  4RNS A;  5B70 A;  1LAH E;  3ZKL A;  1MY2 A;  4WEP A;  5ITP A;  2DE3 A;  4NF5 A;  4IO2 A;  1N3X A;  2DS9 A;  2G93 A;  4MH5 A;  5DVI A;  2FYI A;  4MLQ A;  4HW8 A;  4XKQ A;  4U22 A;  5ICQ A;  4H67 A;  1B0H A;  3C36 A;  1OLC A;  1VSO A;  1JET A;  3TYH A;  2O1M A;  4FAT A;  3KGC A;  5I2N B;  5ITO A;  1Y20 A;  4G68 C;  3FAT A;  3CIJ A;  1H76 A;  3FXQ A;  4Q0C A;  4OFL A;  1QUI A;  1ZIU A;  2H99 A;  4QF9 A;  3PUY E;  3MUQ A;  2ZNU A;  3M3L A;  1VE4 A;  2B65 A;  2PMS A;  2XHD A;  3MWB A;  4IY5 A;  2GHB A;  1MG1 A;  5L9O A;  5KDT A;  3S9M C;  1GR2 A;  2UVI A;  1LST A;  2V25 A;  4OMB A;  3TTN A;  3U8Q A;  1B3G A;  4WXJ A;  4F31 B;  2OK2 A;  3HHG A;  1PBQ A;  1QUK A;  1R6Z A;  2V93 A;  2XXH A;  5I56 A;  3HCQ A;  1O63 A;  1CE2 A;  1XC1 A;  3IX1 A;  2DP8 A;  2OBG A;  4ZZE A;  1UTB A;  1AIV A;  1BP5 A;  5HM4 B;  1AMF A;  3IOR A;  2F78 A;  3OEK A;  4I8C A;  1A8F A;  4OTE A;  4R73 A;  5CMM A;  5DT6 A;  1OIB A;  4G2Z A;  3PUX E;  1I69 A;  5AA4 B;  3ECR A;  1US5 A;  2X7Q A;  1A55 A;  1ZKB A;  3MVX A;  5L9M A;  4F2Q A;  3FJG A;  4P11 A;  1Q1K A;  3GZG A;  3O97 A;  4I62 A;  4TLL B;  5H8S A;  4F3G A;  2Q88 A;  3A3C A;  5H8H A;  1MPD A;  2B3F A;  2Y84 A;  1MH3 A;  3VVD A;  5L9S A;  5TPA A;  4P0I A;  1NMU A;  1II5 A;  2Y7R A;  5CBR A;  1FQE A;  1POT A;  3MVZ A;  4KQP A;  1IXH A;  5AA4 A;  3C32 A;  1SW2 A;  2F6P A;  1GTK A;  1TFA A;  2Y7K A;  2DSF A;  1A99 A;  2UVH A;  2AIX A;  2QPQ A;  2NOO A;  2GRV A;  1USY E;  3MP6 A;  4ONY A;  4ZEC A;  4F29 A;  4ZEF A;  3TUS A;  4GL0 A;  1Y3P A;  4O3A A;  1GVC A;  1O64 A;  2ZYM A;  4X9T A;  2I3V A;  1FQB A;  3GXA A;  3H6T A;  4EF1 A;  4H0W A;  2ONR A;  1DPE A;  4YB5 A;  1MM7 A;  1Y4T A;  1I6Q A;  4LP2 B;  3VVF A;  4BDM A;  3U92 A;  3GBB A;  3USD A;  2VD2 A;  3BFU A;  3E4R A;  2F6G A;  3OO7 A;  3QK6 A;  2O7U A;  2AYS A;  1CB6 A;  4KCD A;  2F8D A;  2I3W A;  5AA3 A;  4YU0 A;  1Y3N A;  2B3B A;  1N7X A;  4GFR A;  3B6Q A;  1ATG A;  1PDA A;  3MAM A;  4YKK A;  3H6W A;  4DXC A;  5HBC A;  4RY1 A;  1T0K A;  1B58 A;  3P7I A;  3LSL A;  1LBB A;  1M5C A;  2QS2 A;  2XXQ A;  3PPN A;  4PFW A;  4QFL A;  3K1M A;  4F19 A;  3OOA A;  3TTL A;  2Z8E A;  3TKD A;  1ZU0 A;  3RTF B;  2WKY A;  4NED A;  3VVE A;  4YAH X;  3IOT A;  2H98 A;  3VXC A;  4ECF A;  4XIG Q;  4NF4 A;  4BLA A;  2IA4 A;  1HSE A;  3PD9 A;  4JSO A;  4OEV A;  4OET A;  4QFP A;  1B3H A;  4IO3 A;  1Z7M E;  3I3V A;  2BJJ X;  2OJT A;  3U1O A;  3UK4 A;  4LAT A;  4EUO A;  2Q89 A;  1QJM A;  3O2A A;  2RKM A;  4JXI A;  4IGT A;  5ELV A;  3RLF E;  5CMK A;  1F9B A;  1Y1Z A;  1B5H A;  3D4C A;  1HSJ A;  4THI A;  4TLM B;  3SKP A;  3OEL A;  5H8N A;  2HQ0 A;  3K6U A;  1QUL A;  4FOR A;  3VFJ A;  2XXR A;  1FQF A;  2F7C A;  4U4X A;  1LGB C;  2QMX A;  3N6T A;  4U1O A;  5DYH A;  4NTL A;  1MRP A;  3O28 A;  3Q29 A;  1UIU A;  1L5T A;  4EQ9 A;  2I4C A;  2P2A A;  3CVG A;  1H45 A;  4H5G A;  2M8C A;  4H6D A;  3KJT A;  4GOT A;  5KCJ A;  2OZZ A;  1B4Z A;  3PUZ E;  1PB8 A;  3SES A;  3U94 A;  3LSW A;  1JVX A;  1MXY A;  1OQG A;  3TQL A;  4FJP A;  4ELO A;  3SEY A;  2F5X A;  2HZL A;  3EPE A;  3FGS A;  3S9L C;  2V3Q A;  4LQ2 A;  1QVS A;  3HV1 A;  3UA8 A;  4EQ7 A;  1B3F A;  3KEI A;  1POY 1;  3MW0 A;  2Z22 A;  4JDF A;  4XKN A;  3UN6 A;  4AQ4 A;  3MPK A;  2DOJ A;  3W9V A;  4KYE A;  1VFD A;  5EYF A;  1N3W A;  3SEW A;  1N84 A;  1OVB A;  2DVZ A;  2PX1 A;  4HCY A;  4PQJ A;  1YPN A;  2I0B A;  4NWC A;  1TFD A;  5TP9 A;  1NNK A;  4KD5 A;  3G7W A;  1LFI A;  3FV2 A;  3JYR A;  2O51 A;  4OES A;  2UYE A;  2D5W A;  2HFB A;  3H4Z A;  4IO7 A;  4P0G A;  2D3I A;  3KFM A;  2ABH A;  2REG A;  3G3F A;  4NF8 B;  1IXC A;  1D9Y A;  2UYF A;  3AXF A;  3CFZ A;  4R9G A;  3LSX A;  3PMV A;  4YZZ A;  3V89 B;  5I59 B;  4AB6 A;  1QKA A;  2DWH A;  2HCA A;  3DLN A;  3O6H A;  5K2X A;  3FUZ A;  3OO9 A;  3PD8 A;  1AH5 A;  1FTO A;  4F18 A;  1ZJL A;  3MVW A;  4GF8 A;  1IQ7 A;  4OFO A;  4RXL A;  3IOW A;  3V5A A;  4ELP A;  5FHO A;  5H8F A;  1FQD A;  4R2F A;  2Z23 A;  1JW4 A;  1LFH A;  2V84 A;  3FJ7 A;  5I84 A;  3C4M A;  1NNF A;  4NWD A;  2I58 A;  5I2K A;  1EZP A;  4G68 A;  1EH3 A;  1FQA A;  2VGQ A;  3HHF A;  3PU5 A;  3H6V A;  4POW A;  3RQT A;  5JTY A;  1LCF A;  3T9H B;  1B9J A;  4MFI A;  3JV9 A;  5F1Q A;  3CG1 A;  4JWY A;  1H44 A;  4OER A;  1KWH A;  3EQ1 A;  1I6A A;  1R9L A;  3IO6 A;  3TEP A;  1MXX A;  3O6G A;  1MS7 A;  3QYT A;  3IB0 A;  3Q25 A;  1N76 A;  4IGR A;  4RA1 A;  2X7P A;  3E3K A;  4OEN A;  3N6U A;  1B2H A;  4E0W A;  1FW0 A;  5AA2 B;  1XVY A;  3S9E A;  2XXI A;  3MP1 A;  4Z7E A;  2DE2 A;  2ZXT A;  4F39 A;  2Q2C A;  3BKI B;  4DXB A;  4ESX A;  5ISU A;  1ZLQ A;  4NF6 A;  4ZZA A;  3IB1 A;  4E0X A;  4GLI A;  3VLW A;  3QIM A;  5KZT A;  1LAF E;  1MM6 A;  3IK6 B;  1A54 A;  4YMA A;  3EHT A;  2DWI A;  1XHY A;  4KYS A;  4ZDM A;  4NE4 A;  1B1H A;  1A40 A;  3ODB A;  1H43 A;  3R26 A;  1URD A;  2XXV A;  4G4P A;  5B7D A;  2R71 A;  1H3D A;  3G3I A;  2ALU A;  2UVG A;  3HST A;  2O69 A; 
#chains in the Genus database with same CATH topology
 2O1L A;  3RT8 A;  1OQH A;  4HS7 A;  3VV5 A;  2V4C A;  4JSD A;  1OLA A;  1URS A;  4NAP A;  1LAG E;  3QXM A;  4G68 B;  5JTY B;  1P99 A;  4KPT A;  2B4M A;  4F22 A;  4I40 A;  3TZA A;  1DSN A;  1I6B A;  3QUF A;  1IIW A;  2E1S A;  2I6E A;  3TEL A;  3ISP A;  5JEI A;  4EXK A;  1TWY A;  5IKB A;  3CR9 A;  4MLV A;  4DE8 A;  1JNF A;  1LB8 A;  2WBD A;  3N94 A;  1MPB A;  3DEL B;  1NNT A;  4IO5 A;  3VXB A;  1XOC A;  2F34 A;  1IMC A;  2XXU A;  3TOD A;  1B51 A;  1P1W A;  2XX9 A;  3L6H A;  4GL8 A;  1EZ9 A;  1B7Z A;  2P1S A;  4G77 A;  4X48 A;  4XF5 A;  1WOD A;  2ZNS A;  1B5I A;  4NHB A;  3OD7 A;  5J1D A;  1GGG A;  3MC2 A;  3TDJ A;  3T9U A;  3IOU A;  4R6K A;  4JWX A;  3IB2 A;  3MPL A;  4YMB A;  2FIE A;  2ZYO A;  4N6P A;  4NF6 B;  3PGF A;  3KJ7 A;  3EKI A;  4PBQ A;  3CFL A;  1PC3 A;  3D4G A;  2FVZ A;  3PUW E;  4F3B A;  1LBV A;  4F2O A;  1K9Y A;  4BDQ A;  2R9J A;  2V3T A;  2HEU A;  5I57 B;  5IAI A;  2ZMB A;  1TXF A;  1US4 A;  3CI8 A;  4GRK A;  1LB9 A;  1RKM A;  4F3P A;  2FIX A;  5I56 B;  3FVG A;  4RPO A;  5KDT B;  5IGA A;  5F7V A;  2CZK A;  5ICT A;  2ESN A;  3FJM A;  3F11 A;  3CSB A;  3K4U A;  4OVJ A;  2RF1 A;  3VLV A;  1FBG A;  1INP A;  1XT8 A;  2XXY A;  4PDH A;  1WDN A;  4LN5 A;  3C35 A;  1LBY A;  1DMB A;  3UOR A;  1N04 A;  4O3B A;  2DWA A;  5IZ3 B;  2Q74 A;  4H8J A;  4P9K A;  4R6Y A;  1SDX A;  3CG3 A;  4HE2 A;  1P1O A;  1USY H;  3OEN A;  1B3E A;  4PET A;  2Q8J A;  3RY3 A;  1RYO A;  4YB6 A;  2KQZ A;  2CZI A;  2F97 A;  2UVJ A;  3K6V A;  1FTJ A;  4RPN A;  2AL4 A;  3TQW A;  1M5E A;  3FVK A;  3U93 A;  3Q28 A;  5H8Q A;  1B0L A;  3KC0 A;  4HTG A;  1BLF A;  4WKM A;  4DXU A;  5EHS A;  5EQ8 A;  4OAN A;  1YYZ A;  2QSX A;  3MQ9 A;  1D9Q A;  1D9V A;  3KC1 A;  2XD3 A;  4GD5 A;  1FTK A;  4QFK A;  2IEE A;  1R9Q A;  1Y4C A;  1SW5 A;  5H8N B;  3SEX A;  3OEM A;  4N17 A;  4GIZ A;  1WVJ A;  1B6H A;  2P3V A;  3T96 B;  2HAU A;  3ZKK A;  5TU0 A;  1SD3 A;  5L8D A;  3EHS A;  1P1N A;  4RNS A;  5ITP A;  4NF5 A;  4IO2 A;  4MH5 A;  2G93 A;  4MLQ A;  1B0H A;  2WEF A;  4P8B A;  1NI9 A;  4XEQ A;  1VDW A;  5ITO A;  4G68 C;  3CIJ A;  1H76 A;  4Q0C A;  1VE4 A;  2XHD A;  2HXR A;  2GHB A;  3S9M C;  2UVI A;  4OMB A;  1PBQ A;  1CE2 A;  2DP8 A;  4ZZE A;  1UTB A;  3IOR A;  3PUX E;  1NV6 A;  1A55 A;  5L9M A;  4P11 A;  1Q1K A;  4TLL B;  2Q88 A;  3VVD A;  4PFI A;  1NMU A;  4KQP A;  1SW2 A;  1TFA A;  2AIX A;  1NV3 A;  1USY E;  3MP6 A;  4N6D A;  1GVC A;  4O3A A;  1FQB A;  3GXA A;  2ONR A;  1DPE A;  1MM7 A;  1Y4T A;  5EYH A;  3E4R A;  3QK6 A;  2AYS A;  4P1L A;  3RYD A;  4GFR A;  1N7X A;  3MAM A;  1NV1 A;  4RY1 A;  1LBB A;  2XXQ A;  3K1M A;  3TTL A;  1ZU0 A;  3RTF B;  4YAH X;  2H98 A;  4ECF A;  4XIG Q;  4BLA A;  3PD9 A;  4QFP A;  4PAI A;  4H45 A;  4MIJ A;  3UK4 A;  4LAT A;  1HSJ A;  3K6U A;  3SZP A;  4U4X A;  2F7C A;  3N6T A;  4U1O A;  4NTL A;  1UIU A;  1H45 A;  5KCJ A;  4GOT A;  3PUZ E;  1PB8 A;  4I3Y A;  3TQL A;  4FJP A;  3S9L C;  3BIH A;  4JDF A;  2Z22 A;  3MPK A;  2XWV A;  1N3W A;  4HCY A;  4NWC A;  1TFD A;  5TP9 A;  4PFR A;  2D5W A;  2HFB A;  1IXC A;  1QKA A;  5M2V A;  4F18 A;  3QMF A;  4RXL A;  1IQ7 A;  2Z23 A;  1NNF A;  4NWD A;  1EZP A;  3HHF A;  3PU5 A;  1LCF A;  1B9J A;  2WX9 A;  3CG1 A;  4JWY A;  3IO6 A;  3B50 A;  1N76 A;  2X7P A;  4E0W A;  5AA2 B;  4N8Y A;  3S9E A;  4F39 A;  2Q2C A;  4ZZA A;  1FSA A;  1MM6 A;  2DWI A;  3R26 A;  1IME A;  2XXV A;  3HST A;  2O69 A;  2ZZV A;  3UP9 A;  1FJ6 A;  2VD3 A;  3CRB A;  1NUX A;  1LBZ A;  2PVU A;  2QVV A;  1JEU A;  3LUZ A;  2FA7 A;  3FVN A;  3T22 A;  4XTC Q;  2ANJ A;  3TCH A;  1FQC A;  1Q35 A;  3RT6 B;  3KOT A;  4RK9 A;  4LA9 A;  1M5F A;  4I1D A;  2F36 A;  1B40 A;  4LZ5 A;  2HAV A;  5I59 A;  2F7A A;  1Y3Q A;  4JWO A;  1ZMG A;  4IB2 A;  2KR0 A;  1HSL A;  4ESW A;  3BBR A;  3IO4 A;  1S50 A;  3DP4 A;  3C34 A;  4FEC A;  4NGU A;  4QSE A;  2XXT A;  4C1U A;  1BTJ A;  1MH4 A;  3DP8 A;  1RYX A;  1ELJ A;  1FPF A;  3HFU A;  3WAE A;  3EN3 A;  2FHY A;  4R74 A;  2Q8M A;  1B4H A;  3OO6 A;  5BWJ A;  2VHA A;  5DEX B;  3B6W A;  1IUD A;  2XX7 A;  3ROJ A;  4R2B A;  3IJX B;  2GHA A;  4PCD A;  2YJP A;  4BDL A;  1J1N A;  3VLU A;  2XX8 A;  3MVY A;  4OVR A;  3M3F A;  4DCX A;  2I49 A;  4U23 A;  3LV0 A;  1IXI A;  5DEX A;  5AA1 A;  4DI3 D;  2VP1 A;  1N7W A;  1DTG A;  2QRY A;  1YTV A;  4KHZ E;  3MJN A;  4MHF A;  4ISU A;  3RUM A;  3TTK A;  4OZ9 A;  1YCJ A;  4FEB A;  1FBP A;  4N91 A;  4NF8 A;  4XXU A;  1B5J A;  4Z0I A;  4OFJ A;  3OSR A;  5FTI A;  3IFA A;  1R1N A;  2HXW A;  1GV8 A;  3G3J A;  3KSX A;  1IXG A;  2VOZ A;  3QUJ A;  4QSC A;  1ZBM A;  3Q27 A;  3SEU A;  2E0S A;  4YKP A;  4PGN A;  1FPK A;  1UQW A;  4QFN A;  1Y9U A;  2AL5 A;  3U65 A;  4KR5 A;  3A29 A;  3QAX A;  4RYA A;  1DBZ A;  3FZV A;  1LBX A;  3SEV A;  3KZG A;  4TQU Q;  3H6U A;  2DVC A;  1QW0 A;  2Y7I A;  4P47 A;  1YXI A;  4H46 A;  1MDQ A;  2QFL A;  3W15 C;  4N13 A;  3JZJ A;  3K2D A;  4GBW A;  5I3S A;  1AOV A;  1FBC A;  4IO4 A;  1LCT A;  4N6K A;  1UIV A;  1JP4 A;  4YKI A;  5FTH A;  2HPG A;  3K6W A;  1NV2 A;  2ZNT A;  5FHN A;  3S2V A;  2DQV A;  3EHU A;  2D21 A;  3E13 X;  5JK4 A;  1SQY A;  2P3N A;  3IOV A;  1FBD A;  5ET6 A;  3MZ9 A;  4G8N A;  3LBS A;  3OXN A;  4UAC A;  3WAF A;  3S9N C;  4X1D A;  2V3U A;  4H8I A;  2F3D A;  4U2R A;  5EQ7 A;  4YB7 A;  3FIR A;  5FBP A;  1PB7 A;  1LLS A;  1URG A;  1NUW A;  3FV1 A;  3M8U A;  2Q9T A;  2NVU B;  1B7U A;  1S7Y A;  5TP9 B;  3B6T A;  1RDX A;  3PUV E;  1NUY A;  2X26 A;  2YPN A;  3HO7 A;  3U72 A;  1MQI A;  1NH8 A;  1FPL A;  3KSJ A;  2PYY A;  1EYK A;  2DDK A;  4FIM A;  4XFE A;  2DYX A;  2QS1 A;  4TOZ A;  2HZK A;  4PAF A;  5I2N A;  4LVQ A;  4G8H A;  1CNQ A;  4DCY A;  1RDY A;  2THI A;  2YLN A;  2GH9 A;  1IEJ A;  3K00 A;  2NUV A;  2GFE A;  3LSF B;  4DIG A;  5B70 A;  4N07 A;  4WEP A;  2DS9 A;  2FYI A;  4HW8 A;  4U22 A;  1JET A;  1Y20 A;  3FAT A;  2L5V A;  3FXQ A;  1QUI A;  1ZIU A;  4QF9 A;  3PUY E;  4IY5 A;  4N8G A;  3TTN A;  4IR8 A;  1R6Z A;  2V93 A;  1O63 A;  1XC1 A;  3IX1 A;  2F3B A;  1AIV A;  2F78 A;  4OTE A;  5DT6 A;  5CMM A;  3E78 A;  1OIB A;  1US5 A;  2X7Q A;  1ZKB A;  3MVX A;  4F2Q A;  1NV4 A;  4I62 A;  1MPD A;  1MH3 A;  2Y7R A;  1POT A;  3MVZ A;  4O7I A;  2UVH A;  2QPQ A;  4ONY A;  2WBB A;  1Y3P A;  3H6T A;  3VVF A;  3U92 A;  2VD2 A;  3OO7 A;  2O7U A;  2F8D A;  5AA3 A;  4YU0 A;  3B6Q A;  4MEV A;  4P56 A;  3H6W A;  1B58 A;  4PFW A;  3PPN A;  2QS2 A;  4OVQ A;  4F19 A;  3E79 A;  5ET8 A;  3VVE A;  4N4U A;  4NF4 A;  2IA4 A;  1HSE A;  4JSO A;  4OET A;  1IMB A;  4IO3 A;  1Z7M E;  3U1O A;  4QXD A;  1NV7 A;  4EUO A;  1FPB A;  5H8N A;  1FQF A;  1K9Z A;  1LGB C;  3CVG A;  3KJT A;  2OZZ A;  1B4Z A;  3U94 A;  3SES A;  1MXY A;  3EPE A;  3D1R A;  3HV1 A;  4EQ7 A;  1KZ8 A;  5T3J A;  4GX4 A;  1RDZ A;  2GQ1 A;  4PQJ A;  1YPN A;  2I0B A;  4JVD A;  1NNK A;  1LFI A;  3FV2 A;  4OES A;  2UYE A;  3H4Z A;  3G3F A;  1D9Y A;  4R9G A;  3LSX A;  3PMV A;  5I59 B;  2DWH A;  3DLN A;  1ZJL A;  3MVW A;  4OFO A;  3V5A A;  5FHO A;  1FQD A;  4GWU A;  3RPL B;  3C4M A;  5I2K A;  2I58 A;  1FQA A;  4NG7 A;  3EQ1 A;  4RA1 A;  1XVY A;  4AS5 A;  4PF8 A;  3BKI B;  1G0H A;  1ZLQ A;  3IB1 A;  4E0X A;  1LAF E;  1XHY A;  5IZ3 A;  1B1H A;  3ODB A;  1H43 A;  3FXB A;  1H3D A;  4F1V A;  2PFY A;  5AA2 A;  1B3L A;  3RN8 A;  2RC9 A;  4BDN A;  3EF7 A;  3MP8 A;  2Z8F A;  2Y7W A;  5CM6 A;  4NN3 A;  3L6G A;  4YIC A;  3T66 A;  1MXZ A;  4ZE8 A;  1JVY A;  4U4S A;  5FHM A;  3TCF A;  2H4I A;  5I58 A;  3R6U A;  2RC8 A;  2ZZW A;  1FRP A;  3PTY A;  2WYP A;  3TMG A;  4OXV A;  2W7Y A;  5ET5 A;  1SW1 A;  4BDR A;  4OYV A;  3H7M A;  5I57 A;  4C0R A;  4OHN A;  3TAJ A;  2A5T B;  2QS4 A;  3IR1 A;  4OWD A;  4H65 A;  4K3F A;  4POX A;  3TTM A;  1BIY A;  2WYK A;  4ZE9 A;  3ILU B;  1P1Q A;  4O8M A;  2OWZ A;  3UGW A;  4KYD A;  5EQA A;  5KCJ B;  5A5X B;  2H9B A;  3T93 B;  4NX1 A;  2ONS A;  4MJO A;  1FBF A;  2H25 A;  3MYU A;  1P1U A;  4GXS B;  1TT1 A;  1MPC A;  1D4N A;  4TLM B;  4IY6 A;  2OLB A;  3HPI A;  2RIN A;  4XKR A;  4DDD A;  3SET A;  2Y7P A;  5CC2 A;  4NMY A;  2QS3 A;  2RCA A;  1SI1 A;  3C33 A;  4MBP A;  4MF3 A;  4AB5 A;  4M1V A;  1FPG A;  3RNN A;  1NUZ A;  1LBC A;  4PF6 A;  4R6H A;  2I0C A;  1NNP A;  5AE4 A;  1QUJ A;  2PFZ A;  4YKJ A;  4PFB A;  2F7B A;  3VDF A;  3ZSF A;  2ONK E;  4PFU A;  1EU8 A;  5I2K B;  3O29 A;  1DTZ A;  1FCK A;  4U21 A;  1MY1 A;  3LR1 A;  2G29 A;  1XVX A;  1MXW A;  3PPP A;  2F35 A;  2O68 A;  2OWS A;  5HPQ A;  1MY0 A;  1SVX B;  4GVO A;  2DWJ A;  4QFO A;  4Q5T A;  2XXP A;  4QBA A;  2CMO A;  1MXU A;  2XXX A;  5CRY A;  4EF2 A;  3CHG A;  5K2Y A;  4OEU A;  4ELR A;  4OA4 A;  4U1Z A;  3PPQ A;  4NF5 B;  2QMW A;  1PB9 A;  3PMX A;  2Z8D A;  4DZ1 A;  1MQH A;  1JEV A;  1FTA A;  1N0T A;  3SDF A;  3K01 A;  1NKX A;  4NF4 B;  1IMF A;  4P3L A;  5ESY A;  2ZYN A;  2CEX A;  1SI0 A;  3T9V A;  3CSG A;  4R72 A;  1VR5 A;  4JVI A;  2CZH A;  4F1Y A;  3I5O A;  2RCB A;  3RGY A;  3HN0 A;  1IIT A;  5H8Q B;  1BKA A;  3QSL A;  4MMP A;  4LZ8 A;  3MBP A;  4PP0 A;  1PEB A;  1DPP A;  3LUY A;  2UXA A;  4GWO A;  2CZL A;  3K1P A;  4GWS A;  3H03 A;  3E9X A;  3OO8 A;  3S4U A;  1A8E A;  3OMB A;  2DE4 A;  1QKB A;  1JW5 A;  1SW4 A;  3I6V A;  1FBH A;  4FBP A;  4EXL A;  3O9P A;  2NWJ A;  3H06 B;  4PGP A;  1G0I A;  3K02 A;  2PBW A;  1FTM A;  3DP6 A;  4WED A;  1PBP A;  3FXR A;  3C9H A;  4MAG A;  3IL1 B;  4KFQ A;  1SPI A;  1LAX A;  4GQO A;  3MZB A;  4QRZ A;  3T9X B;  4LUB A;  4HE1 A;  3A09 A;  1VFE A;  2RC7 A;  2I4B A;  2P0S A;  3KOS A;  1LAH E;  3ZKL A;  1MY2 A;  4PTK A;  5EYG A;  3IFC A;  1N3X A;  5DVI A;  5ICQ A;  4MCO A;  4XKQ A;  1OLC A;  1VSO A;  2O1M A;  4FAT A;  5I2N B;  4OFL A;  3MUQ A;  3M3L A;  2B65 A;  2VT5 A;  5KDT A;  3U8Q A;  1LST A;  2V25 A;  4F31 B;  1B3G A;  3HHG A;  2QVU A;  1QUK A;  5I56 A;  3HCQ A;  4PAK A;  1KA1 A;  2OBG A;  1BP5 A;  5HM4 B;  1AMF A;  4I8C A;  1A8F A;  4GWZ A;  4G2Z A;  1AWB A;  1I69 A;  3GZG A;  3O97 A;  2JJK A;  4F3G A;  3NOH A;  5L9S A;  2MKZ A;  1IXH A;  5AA4 A;  3C32 A;  2F6P A;  2Y7K A;  2DSF A;  2NOO A;  2GRV A;  4UAB A;  2VPO A;  4F29 A;  4ZEF A;  3TUS A;  1O64 A;  2ZYM A;  4HXV A;  4BDM A;  3BFU A;  2F6G A;  4KCD A;  2B3B A;  1ATG A;  1PDA A;  4DXC A;  5HBC A;  1T0K A;  3OOA A;  5LDZ A;  2Z8E A;  4PDD A;  3TKD A;  1EYJ A;  3IOT A;  4OEV A;  3I3V A;  2BJJ X;  5J16 A;  1QJM A;  3O2A A;  2RKM A;  5ELV A;  3RLF E;  1F9B A;  3D4C A;  1B5H A;  4THI A;  4X8R A;  2HQ0 A;  3VFJ A;  1QUL A;  2XXR A;  5DYH A;  2QMX A;  3O28 A;  1L5T A;  4EQ9 A;  2ZZX A;  2P2A A;  4ELO A;  3SEY A;  2F5X A;  3FGS A;  2V3Q A;  3UA8 A;  5IZZ A;  4XKN A;  2DOJ A;  3W9V A;  5EYF A;  2PX1 A;  1OVB A;  3MST A;  4KD5 A;  3G7W A;  3JYR A;  4IO7 A;  2D3I A;  3KFM A;  2ABH A;  3V89 B;  4YZZ A;  4AB6 A;  2HCA A;  3O6H A;  5K2X A;  3PD8 A;  3FBP A;  3IOW A;  5H8F A;  4R2F A;  4MNP A;  1LFH A;  2V84 A;  5I84 A;  3KBZ A;  4G68 A;  5JTY A;  3RQT A;  3T9H B;  4MNI A;  4OER A;  1KWH A;  1R9L A;  1I6A A;  3O6G A;  1MS7 A;  3QYT A;  3IB0 A;  3Q25 A;  1B2H A;  3MP1 A;  4ESX A;  3IK6 B;  4O94 A;  2PCR A;  4JVC A;  4KYS A;  4NE4 A;  4AS4 A;  1NV5 A;  1URD A;  5DW8 A;  1QGX A;  4G4P A;  5B7D A;  2ALU A;  1DK4 A;  2UVG A;  2OX3 A;  3IJO B;  3ONM A;  4LQ5 A;  2PT1 A;  4KI0 E;  3TPA A;  5A5X A;  1IZ1 A;  2QJE A;  4RJZ A;  4NF0 A;  5LTC A;  2FBP A;  1Y1M A;  3VE1 B;  3FVO A;  3ILT B;  3CFX A;  3GBA A;  2A5T A;  4KCC A;  5DTB A;  3FAS A;  4F3S A;  3A3U A;  1MY3 A;  1MXV A;  2DXR A;  1YZ0 A;  1YAE A;  4ELQ A;  4G61 A;  2QVR A;  1FTL A;  1UTH B;  4PFT A;  4OVT A;  1SYI A;  2QL3 A;  3KN7 A;  5I58 B;  4O3C A;  4R9F A;  2DXY A;  2Y5K A;  1B7H A;  4ZEB A;  1KA0 A;  4I9D A;  3K6X A;  5CI5 A;  4P1E A;  4R75 A;  4G8M A;  4IO6 A;  5I7I A;  4LON B;  3B8B A;  4DLD A;  4UA8 A;  1XS5 A;  3BIG A;  3K1N A;  2O7I A;  2NXO A;  3O6I A;  1ZTY A;  2O84 X;  1A7L A;  3SER A;  5IM2 A;  3V83 A;  1ANF A;  2A5S A;  1FPJ A;  1MQG A;  4FED A;  3Q26 A;  4X1B A;  3THI A;  1FBE A;  3C31 A;  4OQO A;  3H3G A;  2H5Y A;  3LC8 A;  1FJ9 A;  4ZEI A;  2FNC A;  4GXA A;  4PFY A;  4HCW A;  4PBH A;  4N15 A;  3RPL A;  3RPW A;  1OMP A;  4O7M A;  3V8X B;  2XWK A;  2REJ A;  4Q30 B;  3FXU A;  5F24 A;  5TPA B;  5H8H B;  5LOM A;  1B52 A;  4ZED A;  1BK4 A;  1UTH A;  5I5P A;  1B32 A;  4H1X A;  4C1T A;  2XD2 A;  3KBR A;  2XXW A;  1SYH A;  1OVT A;  3G3H A;  4DI4 B;  1DOT A;  4LZ7 A;  4Q8R A;  1S9T A;  4JBZ A;  4RK2 A;  1JW1 A;  1LFG A;  1MQD A;  1MDP 1;  3TTR A;  3W9W A;  1EZO A;  4GBV A;  5CBS A;  1NL5 A;  4M4G A;  3TFL A;  4EQB A;  3OSQ A;  3UIF A;  3N26 A;  3ZS6 A;  2KLF A;  3T1B A;  5DVJ A;  5CMC A;  2Y5L A;  4QSD A;  4JB7 A;  3MZ1 A;  1MQJ A;  3KN3 A;  5IZ1 A;  4H5F A;  2R6G E;  4PC9 A;  4EDP A;  4ND9 A;  5ET7 A;  3G3K A;  5CMB A;  3R7X A;  3N5L A;  1D3K A;  3BFT A;  3PMW A;  4I3E A;  4PE5 B;  1B05 A;  2OCU A;  3O66 A;  5DVF A;  2ZYK A;  1Z7N E;  5H8F B;  3PV0 E;  4L17 A;  1SBP A;  4ZS9 A;  1M5D A;  3TCG A;  4FE8 A;  4FAJ A;  3RTW B;  1B46 A;  3K0V A;  4GWY A;  3IAZ A;  4F1U A;  2XWO A;  2O6A A;  1IMA A;  4MX6 A;  3M3K A;  3PPR A;  3FD3 A;  2LAO A;  4XKP A;  4ZEK A;  4BDO A;  3KG2 A;  1UTB B;  2Q2A A;  1LEV A;  3DM0 A;  1B1X A;  1NFT A;  5AA2 D;  1MY4 A;  3G3G A;  3GLB A;  1O7T A;  1FPD A;  3B7D A;  1JQF A;  2XWI A;  1M5B A;  2I48 A;  3PPO A;  5EHM A;  3KN8 A;  2PT2 A;  2OWT A;  1AL3 A;  1NH7 A;  4QHQ A;  3T0J A;  2DE3 A;  5BUU A;  1FPI A;  4X04 A;  4H67 A;  3C36 A;  5EQ9 A;  3TYH A;  3KGC A;  2H99 A;  2ZNU A;  2PMS A;  3MWB A;  1MG1 A;  5L9O A;  1GR2 A;  5ISU A;  4WXJ A;  2OK2 A;  2XXH A;  3OEK A;  4GWW A;  4R73 A;  3GYY A;  5AA4 B;  3ECR A;  2XXK A;  3FJG A;  1IMD A;  5H8S A;  3A3C A;  5H8H A;  2B3F A;  2Y84 A;  5TPA A;  4P0I A;  1LBW A;  1II5 A;  5CBR A;  1FQE A;  4GX3 A;  4N81 A;  1GTK A;  1A99 A;  4ZEC A;  2HHM A;  4GL0 A;  4X9T A;  2I3V A;  4GWX A;  4KXP A;  4EF1 A;  4H0W A;  4YB5 A;  4LP2 B;  1I6Q A;  3GBB A;  3USD A;  1CB6 A;  1NV0 A;  2I3W A;  1Y3N A;  4YKK A;  2CEY A;  3P7I A;  3LSL A;  4QFL A;  1M5C A;  2WKY A;  4MNC A;  4NED A;  3VXC A;  2XA5 A;  1B3H A;  2OJT A;  2Q89 A;  5A5L A;  4JXI A;  4IGT A;  5CMK A;  1Y1Z A;  3SKP A;  4OVP A;  3OEL A;  2R8T A;  4FOR A;  1MRP A;  3Q29 A;  2BJI A;  2I4C A;  4H5G A;  2M8C A;  4H6D A;  3LSW A;  1JVX A;  1OQG A;  1Q9D A;  2HZL A;  1EYI A;  4LQ2 A;  1QVS A;  2B4L A;  1B3F A;  3KEI A;  1POY 1;  3MW0 A;  1FPE A;  3UN6 A;  4NQ8 A;  4AQ4 A;  4KYE A;  1VFD A;  3SEW A;  1N84 A;  2DVZ A;  2O51 A;  4P0G A;  2REG A;  4NF8 B;  2UYF A;  3AXF A;  3CFZ A;  3FUZ A;  3OO9 A;  1AH5 A;  1FTO A;  4GF8 A;  4ELP A;  1DCU A;  1JW4 A;  3FJ7 A;  1EH3 A;  2VGQ A;  4POW A;  3H6V A;  4MFI A;  3JV9 A;  5F1Q A;  1H44 A;  1XI6 A;  3TEP A;  1MXX A;  4IGR A;  3E3K A;  4OEN A;  3N6U A;  1FW0 A;  4OVS A;  2XXI A;  4Z7E A;  2DE2 A;  4GX6 A;  2ZXT A;  4DXB A;  4NF6 A;  4GLI A;  2VPN A;  3QIM A;  3VLW A;  5KZT A;  1A54 A;  4YMA A;  3EHT A;  4ZDM A;  4PE3 A;  1A40 A;  4HE0 A;  2R71 A;  3G3I A; 
#chains in the Genus database with same CATH homology
 4F1V A;  2O1L A;  3RT8 A;  1OQH A;  3IJO B;  3ONM A;  3UP9 A;  5AA2 A;  4LQ5 A;  4HS7 A;  2PT1 A;  4KI0 E;  1B3L A;  2VD3 A;  3VV5 A;  3CRB A;  3TPA A;  5A5X A;  1IZ1 A;  4JSD A;  2PVU A;  3RN8 A;  2QJE A;  4RJZ A;  1OLA A;  1JEU A;  2RC9 A;  1URS A;  3EF7 A;  4BDN A;  2FA7 A;  3FVN A;  1Y1M A;  2Z8F A;  3FVO A;  3ILT B;  3MP8 A;  3VE1 B;  2Y7W A;  1LAG E;  3QXM A;  3T22 A;  5CM6 A;  3CFX A;  4XTC Q;  3L6G A;  3GBA A;  4YIC A;  3T66 A;  4G68 B;  1MXZ A;  2ANJ A;  5JTY B;  2A5T A;  1P99 A;  4ZE8 A;  4KCC A;  1JVY A;  4U4S A;  4KPT A;  5DTB A;  5FHM A;  3TCF A;  3FAS A;  3TCH A;  1FQC A;  4F22 A;  2H4I A;  4F3S A;  5I58 A;  1Q35 A;  3R6U A;  3KOT A;  3RT6 B;  3A3U A;  1DSN A;  1MY3 A;  4LA9 A;  1M5F A;  1MXV A;  1I6B A;  2RC8 A;  2DXR A;  3QUF A;  4RK9 A;  1IIW A;  2E1S A;  4I1D A;  2F36 A;  1B40 A;  1YAE A;  2HAV A;  2I6E A;  4LZ5 A;  4OXV A;  3TEL A;  2W7Y A;  3TMG A;  4ELQ A;  2F7A A;  5I59 A;  5JEI A;  4EXK A;  1SW1 A;  3S4U A;  1Y3Q A;  1TWY A;  5IKB A;  4JWO A;  1ZMG A;  4BDR A;  3CR9 A;  1FTL A;  4IB2 A;  4MLV A;  1HSL A;  4OYV A;  4DE8 A;  1UTH B;  3H7M A;  4PFT A;  4ESW A;  5I57 A;  1SYI A;  2QL3 A;  3BBR A;  3IO4 A;  4C0R A;  5IAI A;  1S50 A;  3DP4 A;  3KN7 A;  5I58 B;  1JNF A;  1LB8 A;  3C34 A;  4OHN A;  4FEC A;  4O3C A;  4R9F A;  3N94 A;  2DXY A;  4QSE A;  2XXT A;  3TAJ A;  4C1U A;  2A5T B;  1BTJ A;  2QS4 A;  1MH4 A;  1MPB A;  3DP8 A;  3IR1 A;  4H65 A;  4K3F A;  4OWD A;  4POX A;  3TTM A;  1BIY A;  1RYX A;  4ZE9 A;  3ILU B;  3DEL B;  1B7H A;  1P1Q A;  1ELJ A;  4ZEB A;  1NNT A;  4I9D A;  4IO5 A;  3K6X A;  5CI5 A;  3VXB A;  4R75 A;  3UGW A;  4KYD A;  3WAE A;  3EN3 A;  1XOC A;  4G8M A;  4IO6 A;  5KCJ B;  2F34 A;  4LON B;  2H9B A;  5A5X B;  3T93 B;  2XXU A;  4DLD A;  2ONS A;  4R74 A;  4UA8 A;  1XS5 A;  2H25 A;  3TOD A;  1P1U A;  4GXS B;  1TT1 A;  1B51 A;  1D4N A;  1B4H A;  1MPC A;  1P1W A;  2XX9 A;  3OO6 A;  4IY6 A;  2OLB A;  3K1N A;  2O7I A;  2NXO A;  3O6I A;  3L6H A;  3HPI A;  2RIN A;  4GL8 A;  1ZTY A;  1EZ9 A;  1B7Z A;  5BWJ A;  2VHA A;  2O84 X;  5DEX B;  1A7L A;  3SER A;  3TZA A;  4XKR A;  4DDD A;  3B6W A;  1IUD A;  2P1S A;  2XX7 A;  4G77 A;  2Y7P A;  1ANF A;  2A5S A;  3IJX B;  4R2B A;  4X48 A;  3SET A;  4NMY A;  2GHA A;  2QS3 A;  5CC2 A;  1MQG A;  2RCA A;  4FED A;  1SI1 A;  2YJP A;  3Q26 A;  4BDL A;  3C33 A;  1WOD A;  4MBP A;  1J1N A;  2ZNS A;  4X1B A;  1B5I A;  3VLU A;  3THI A;  2XX8 A;  3OD7 A;  4MF3 A;  1GGG A;  3C31 A;  3MC2 A;  3H3G A;  3MVY A;  4OQO A;  3T9U A;  3TDJ A;  4AB5 A;  4M1V A;  3M3F A;  4DCX A;  2I49 A;  3IOU A;  4R6K A;  4JWX A;  4U23 A;  2H5Y A;  3IB2 A;  1IXI A;  3LC8 A;  3MPL A;  3RNN A;  4YMB A;  5DEX A;  1LBC A;  2ZYO A;  4R6H A;  2I0C A;  4N6P A;  5AA1 A;  4ZEI A;  1NNP A;  4NF6 B;  2FNC A;  3PGF A;  5AE4 A;  1QUJ A;  3KJ7 A;  4GXA A;  4PFY A;  2VP1 A;  4HCW A;  4YKJ A;  1N7W A;  2F7B A;  3VDF A;  3RPW A;  1DTG A;  2QRY A;  1YTV A;  4KHZ E;  3MJN A;  3CFL A;  4ISU A;  1OMP A;  3RUM A;  3TTK A;  1PC3 A;  4OZ9 A;  1YCJ A;  3V8X B;  3ZSF A;  4FEB A;  3D4G A;  2REJ A;  4Q30 B;  2ONK E;  3PUW E;  4NF8 A;  4PFU A;  3FXU A;  4XXU A;  1B5J A;  4F3B A;  1EU8 A;  4Z0I A;  4OFJ A;  5TPA B;  4F2O A;  3OSR A;  5FTI A;  5H8H B;  5I2K B;  1R1N A;  2HXW A;  3O29 A;  1GV8 A;  1DTZ A;  1FCK A;  3G3J A;  4BDQ A;  2R9J A;  5LOM A;  2V3T A;  3KSX A;  4U21 A;  1B52 A;  1MY1 A;  1IXG A;  2HEU A;  2G29 A;  2VOZ A;  3LR1 A;  1XVX A;  4ZED A;  5I57 B;  1MXW A;  1UTH A;  1B32 A;  3QUJ A;  4QSC A;  2ZMB A;  1ZBM A;  3Q27 A;  3PPP A;  2E0S A;  4H1X A;  4YKP A;  2F35 A;  1TXF A;  2O68 A;  1US4 A;  2OWS A;  2XD2 A;  4C1T A;  1MY0 A;  2XXW A;  1SVX B;  3CI8 A;  3KBR A;  1UQW A;  4GRK A;  4GVO A;  5HPQ A;  1LB9 A;  1RKM A;  1Y9U A;  2DWJ A;  1SYH A;  2AL5 A;  4QFN A;  4F3P A;  5I56 B;  4QFO A;  1OVT A;  3G3H A;  4KR5 A;  3QAX A;  3FVG A;  4RPO A;  4RYA A;  4Q5T A;  5KDT B;  3FZV A;  3SEV A;  3KZG A;  3V83 A;  2XXP A;  1DOT A;  4LZ7 A;  4TQU Q;  3H6U A;  4Q8R A;  2DVC A;  1QW0 A;  2Y7I A;  5F7V A;  1S9T A;  4JBZ A;  5ICT A;  2ESN A;  4RK2 A;  1JW1 A;  2CMO A;  1LFG A;  1MQD A;  3FJM A;  1MXU A;  1MDQ A;  1MDP 1;  2XXX A;  3F11 A;  5CRY A;  4EF2 A;  5K2Y A;  3CSB A;  3K4U A;  3TTR A;  4OEU A;  2RF1 A;  4OVJ A;  3VLV A;  4U1Z A;  3W15 C;  3W9W A;  4ELR A;  4N13 A;  3JZJ A;  3PPQ A;  4NF5 B;  5CBS A;  3K2D A;  1EZO A;  1NL5 A;  1XT8 A;  2QMW A;  4M4G A;  3TFL A;  4EQB A;  2XXY A;  3OSQ A;  1AOV A;  4IO4 A;  3UIF A;  1PB9 A;  3N26 A;  3ZS6 A;  2KLF A;  1LCT A;  3PMX A;  2Z8D A;  1WDN A;  5DVJ A;  1MQH A;  4DZ1 A;  1JEV A;  5CMC A;  3C35 A;  3SEU A;  1UIV A;  1N0T A;  4QSD A;  4YKI A;  4JB7 A;  1DMB A;  3MZ1 A;  5FTH A;  3UOR A;  1MQJ A;  3SDF A;  1N04 A;  3K01 A;  3KN3 A;  1NKX A;  4NF4 B;  2DWA A;  4O3B A;  3K6W A;  4H8J A;  4H5F A;  5BUU A;  4R6Y A;  1SDX A;  2ZNT A;  3CG3 A;  2R6G E;  4EDP A;  4ND9 A;  3G3K A;  5CMB A;  5FHN A;  3R7X A;  3N5L A;  1D3K A;  3BFT A;  2ZYN A;  1P1O A;  1USY H;  3PMW A;  2DQV A;  3S2V A;  3EHU A;  1SI0 A;  3OEN A;  1B3E A;  4PE5 B;  3T9V A;  2D21 A;  3CSG A;  4PET A;  3E13 X;  5JK4 A;  1B05 A;  1SQY A;  3IOV A;  2Q8J A;  4R72 A;  1VR5 A;  3RY3 A;  3MZ9 A;  2OCU A;  1RYO A;  4G8N A;  3LBS A;  4F1Y A;  3OXN A;  4YB6 A;  4UAC A;  3I5O A;  2F97 A;  2UVJ A;  3K6V A;  3O66 A;  3WAF A;  2RCB A;  5DVF A;  3S9N C;  2ZYK A;  3RGY A;  4X1D A;  2V3U A;  3HN0 A;  4H8I A;  1IIT A;  1FTJ A;  4U2R A;  5H8Q B;  1BKA A;  3QSL A;  1Z7N E;  5H8F B;  4LZ8 A;  3MBP A;  4PP0 A;  4YB7 A;  3FIR A;  4RPN A;  3PV0 E;  4L17 A;  1SBP A;  1PB7 A;  2AL4 A;  1PEB A;  3TQW A;  1DPP A;  1LLS A;  3LUY A;  4ZS9 A;  1M5D A;  1M5E A;  3TCG A;  3FVK A;  2UXA A;  4FE8 A;  3U93 A;  1URG A;  3FV1 A;  4GWO A;  4FAJ A;  3Q28 A;  3M8U A;  1B46 A;  2CZL A;  2Q9T A;  3K1P A;  3RTW B;  3K0V A;  2NVU B;  5H8Q A;  3H03 A;  3E9X A;  3OO8 A;  1B0L A;  1A8E A;  1S7Y A;  1B7U A;  3IAZ A;  5M2V A;  3B6T A;  5TP9 B;  3PUV E;  1BLF A;  3OMB A;  4HTG A;  4WKM A;  4F1U A;  2DE4 A;  1QKB A;  1JW5 A;  2O6A A;  1SW4 A;  2X26 A;  3I6V A;  3M3K A;  2YPN A;  3PPR A;  3FD3 A;  2LAO A;  4DXU A;  5EHS A;  3HO7 A;  4EXL A;  4XKP A;  3O9P A;  2QSX A;  3KG2 A;  4ZEK A;  3U72 A;  4BDO A;  3MQ9 A;  1UTB B;  1MQI A;  2Q2A A;  2NWJ A;  1D9V A;  3H06 B;  1NH8 A;  3DM0 A;  3KSJ A;  3K02 A;  2PBW A;  2PYY A;  1B1X A;  1FTM A;  3DP6 A;  2XD3 A;  4WED A;  1NFT A;  4GD5 A;  1FTK A;  5AA2 D;  1PBP A;  3FXR A;  4FIM A;  3C9H A;  4QFK A;  2DYX A;  2QS1 A;  3IL1 B;  1MY4 A;  2IEE A;  1R9Q A;  1Y4C A;  3G3G A;  3GLB A;  4KFQ A;  2HZK A;  1O7T A;  4TOZ A;  1SW5 A;  5H8N B;  3SEX A;  1LAX A;  3OEM A;  4LVQ A;  3B7D A;  4GQO A;  1JQF A;  5I2N A;  4GIZ A;  1M5B A;  4G8H A;  3MZB A;  4QRZ A;  2I48 A;  4DCY A;  3PPO A;  5EHM A;  2THI A;  2YLN A;  3KN8 A;  4LUB A;  3T9X B;  2GH9 A;  2PT2 A;  2OWT A;  3A09 A;  1WVJ A;  1B6H A;  1IEJ A;  3K00 A;  5J1D A;  1AL3 A;  1NH7 A;  3T96 B;  2HAU A;  4QHQ A;  1VFE A;  2GFE A;  2NUV A;  3ZKK A;  3LSF B;  5TU0 A;  2RC7 A;  4DIG A;  1SD3 A;  5L8D A;  3EHS A;  1P1N A;  2I4B A;  2P0S A;  3KOS A;  4N07 A;  4RNS A;  5B70 A;  1LAH E;  3ZKL A;  1MY2 A;  4WEP A;  5ITP A;  2DE3 A;  4NF5 A;  4IO2 A;  1N3X A;  2DS9 A;  2G93 A;  4MH5 A;  5DVI A;  2FYI A;  4MLQ A;  4HW8 A;  4XKQ A;  4U22 A;  5ICQ A;  4H67 A;  1B0H A;  3C36 A;  1OLC A;  1VSO A;  1JET A;  3TYH A;  2O1M A;  4FAT A;  3KGC A;  5I2N B;  5ITO A;  1Y20 A;  4G68 C;  3FAT A;  3CIJ A;  1H76 A;  3FXQ A;  4Q0C A;  4OFL A;  1QUI A;  1ZIU A;  2H99 A;  4QF9 A;  3PUY E;  3MUQ A;  2ZNU A;  3M3L A;  1VE4 A;  2B65 A;  2PMS A;  2XHD A;  3MWB A;  4IY5 A;  2GHB A;  1MG1 A;  5L9O A;  5KDT A;  3S9M C;  1GR2 A;  2UVI A;  1LST A;  2V25 A;  4OMB A;  3TTN A;  3U8Q A;  1B3G A;  4WXJ A;  4F31 B;  2OK2 A;  3HHG A;  1PBQ A;  1QUK A;  1R6Z A;  2V93 A;  2XXH A;  5I56 A;  3HCQ A;  1O63 A;  1CE2 A;  1XC1 A;  3IX1 A;  2DP8 A;  2OBG A;  4ZZE A;  1UTB A;  1AIV A;  1BP5 A;  5HM4 B;  1AMF A;  3IOR A;  2F78 A;  3OEK A;  4I8C A;  1A8F A;  4OTE A;  4R73 A;  5CMM A;  5DT6 A;  1OIB A;  4G2Z A;  3PUX E;  1I69 A;  5AA4 B;  3ECR A;  1US5 A;  2X7Q A;  1A55 A;  1ZKB A;  3MVX A;  5L9M A;  4F2Q A;  3FJG A;  4P11 A;  1Q1K A;  3GZG A;  3O97 A;  4I62 A;  4TLL B;  5H8S A;  4F3G A;  2Q88 A;  3A3C A;  5H8H A;  1MPD A;  2B3F A;  2Y84 A;  1MH3 A;  3VVD A;  5L9S A;  5TPA A;  4P0I A;  1NMU A;  1II5 A;  2Y7R A;  5CBR A;  1FQE A;  1POT A;  3MVZ A;  4KQP A;  1IXH A;  5AA4 A;  3C32 A;  1SW2 A;  2F6P A;  1GTK A;  1TFA A;  2Y7K A;  2DSF A;  1A99 A;  2UVH A;  2AIX A;  2QPQ A;  2NOO A;  2GRV A;  1USY E;  3MP6 A;  4ONY A;  4ZEC A;  4F29 A;  4ZEF A;  3TUS A;  4GL0 A;  1Y3P A;  4O3A A;  1GVC A;  1O64 A;  2ZYM A;  4X9T A;  2I3V A;  1FQB A;  3GXA A;  3H6T A;  4EF1 A;  4H0W A;  2ONR A;  1DPE A;  4YB5 A;  1MM7 A;  1Y4T A;  1I6Q A;  4LP2 B;  3VVF A;  4BDM A;  3U92 A;  3GBB A;  3USD A;  2VD2 A;  3BFU A;  3E4R A;  2F6G A;  3OO7 A;  3QK6 A;  2O7U A;  2AYS A;  1CB6 A;  4KCD A;  2F8D A;  2I3W A;  5AA3 A;  4YU0 A;  1Y3N A;  2B3B A;  1N7X A;  4GFR A;  3B6Q A;  1ATG A;  1PDA A;  3MAM A;  4YKK A;  3H6W A;  4DXC A;  5HBC A;  4RY1 A;  1T0K A;  1B58 A;  3P7I A;  3LSL A;  1LBB A;  1M5C A;  2QS2 A;  2XXQ A;  3PPN A;  4PFW A;  4QFL A;  3K1M A;  4F19 A;  3OOA A;  3TTL A;  2Z8E A;  3TKD A;  1ZU0 A;  3RTF B;  2WKY A;  4NED A;  3VVE A;  4YAH X;  3IOT A;  2H98 A;  3VXC A;  4ECF A;  4XIG Q;  4NF4 A;  4BLA A;  2IA4 A;  1HSE A;  3PD9 A;  4JSO A;  4OEV A;  4OET A;  4QFP A;  1B3H A;  4IO3 A;  1Z7M E;  3I3V A;  2BJJ X;  2OJT A;  3U1O A;  3UK4 A;  4LAT A;  4EUO A;  2Q89 A;  1QJM A;  3O2A A;  2RKM A;  4JXI A;  4IGT A;  5ELV A;  3RLF E;  5CMK A;  1F9B A;  1Y1Z A;  1B5H A;  3D4C A;  1HSJ A;  4THI A;  4TLM B;  3SKP A;  3OEL A;  5H8N A;  2HQ0 A;  3K6U A;  1QUL A;  4FOR A;  3VFJ A;  2XXR A;  1FQF A;  2F7C A;  4U4X A;  1LGB C;  2QMX A;  3N6T A;  4U1O A;  5DYH A;  4NTL A;  1MRP A;  3O28 A;  3Q29 A;  1UIU A;  1L5T A;  4EQ9 A;  2I4C A;  2P2A A;  3CVG A;  1H45 A;  4H5G A;  2M8C A;  4H6D A;  3KJT A;  4GOT A;  5KCJ A;  2OZZ A;  1B4Z A;  3PUZ E;  1PB8 A;  3SES A;  3U94 A;  3LSW A;  1JVX A;  1MXY A;  1OQG A;  3TQL A;  4FJP A;  4ELO A;  3SEY A;  2F5X A;  2HZL A;  3EPE A;  3FGS A;  3S9L C;  2V3Q A;  4LQ2 A;  1QVS A;  3HV1 A;  3UA8 A;  4EQ7 A;  1B3F A;  3KEI A;  1POY 1;  3MW0 A;  2Z22 A;  4JDF A;  4XKN A;  3UN6 A;  4AQ4 A;  3MPK A;  2DOJ A;  3W9V A;  4KYE A;  1VFD A;  5EYF A;  1N3W A;  3SEW A;  1N84 A;  1OVB A;  2DVZ A;  2PX1 A;  4HCY A;  4PQJ A;  1YPN A;  2I0B A;  4NWC A;  1TFD A;  5TP9 A;  1NNK A;  4KD5 A;  3G7W A;  1LFI A;  3FV2 A;  3JYR A;  2O51 A;  4OES A;  2UYE A;  2D5W A;  2HFB A;  3H4Z A;  4IO7 A;  4P0G A;  2D3I A;  3KFM A;  2ABH A;  2REG A;  3G3F A;  4NF8 B;  1IXC A;  1D9Y A;  2UYF A;  3AXF A;  3CFZ A;  4R9G A;  3LSX A;  3PMV A;  4YZZ A;  3V89 B;  5I59 B;  4AB6 A;  1QKA A;  2DWH A;  2HCA A;  3DLN A;  3O6H A;  5K2X A;  3FUZ A;  3OO9 A;  3PD8 A;  1AH5 A;  1FTO A;  4F18 A;  1ZJL A;  3MVW A;  4GF8 A;  1IQ7 A;  4OFO A;  4RXL A;  3IOW A;  3V5A A;  4ELP A;  5FHO A;  5H8F A;  1FQD A;  4R2F A;  2Z23 A;  1JW4 A;  1LFH A;  2V84 A;  3FJ7 A;  5I84 A;  3C4M A;  1NNF A;  4NWD A;  2I58 A;  5I2K A;  1EZP A;  4G68 A;  1EH3 A;  1FQA A;  2VGQ A;  3HHF A;  3PU5 A;  3H6V A;  4POW A;  3RQT A;  5JTY A;  1LCF A;  3T9H B;  1B9J A;  4MFI A;  3JV9 A;  5F1Q A;  3CG1 A;  4JWY A;  1H44 A;  4OER A;  1KWH A;  3EQ1 A;  1I6A A;  1R9L A;  3IO6 A;  3TEP A;  1MXX A;  3O6G A;  1MS7 A;  3QYT A;  3IB0 A;  3Q25 A;  1N76 A;  4IGR A;  4RA1 A;  2X7P A;  3E3K A;  4OEN A;  3N6U A;  1B2H A;  4E0W A;  1FW0 A;  5AA2 B;  1XVY A;  3S9E A;  2XXI A;  3MP1 A;  4Z7E A;  2DE2 A;  2ZXT A;  4F39 A;  2Q2C A;  3BKI B;  4DXB A;  4ESX A;  5ISU A;  1ZLQ A;  4NF6 A;  4ZZA A;  3IB1 A;  4E0X A;  4GLI A;  3VLW A;  3QIM A;  5KZT A;  1LAF E;  1MM6 A;  3IK6 B;  1A54 A;  4YMA A;  3EHT A;  2DWI A;  1XHY A;  4KYS A;  4ZDM A;  4NE4 A;  1B1H A;  1A40 A;  3ODB A;  1H43 A;  3R26 A;  1URD A;  2XXV A;  4G4P A;  5B7D A;  2R71 A;  1H3D A;  3G3I A;  2ALU A;  2UVG A;  3HST A;  2O69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...