4EQ9A

1.4 angstrom crystal structure of abc transporter glutathione-binding protein gsht from streptococcus pneumoniae strain canada mdr_19a in complex with glutathione
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
240
structure length
240
Chain Sequence
KKEIIVATNGSPRPFIYEENGELTGYEIEVVRAIFKDSDKYDVKFEKTEWSGVFAGLDADRYNMAVNNLSYTKERAEKYLYAAPIAQNPNVLVVKKDDSSIKSLDDIGGKSTEVVQATTSAKQLEAYNAEHTDNPTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGLDNLKVIELPSDQQPYVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYLPAEADIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter substrate-binding protein-amino acid transpo
publication title 1.4 Angstrom Crystal Structure of Putative ABC Transporter Substrate-Binding Protein from Streptococcus pneumoniae strain Canada MDR_19A in Complex with Glutathione.
rcsb
source organism Streptococcus pneumoniae
total genus 84
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4eq9A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4eq9A02
2CMOA 4HTGA 4PFUA 4XIGQ 2ONSA 4LUBA 3TTLA 4EXLA 1XT8A 4KD5A 4C1TA 2ANJA 3M3LA 3TUSA 4R9GA 1H45A 3K02A 1DTZA 4ZZEA 1YCJA 2BJJX 4OVJA 1R9LA 4U22A 4KR5A 1B0LA 3ZKKA 3UORA 3I6VA 2DS9A 1HSJA 4U4XA 4C1UA 3OO7A 1Q1KA 4MH5A 5ELVA 3SETA 4ZEBA 1ZIUA 3OSRA 1ATGA 2D3IA 3SEUA 4G68B 1HSLA 3KEIA 3PPOA 3ZKLA 2OWSA 4OEVA 1MY3A 2RCAA 2E1SA 1Y3NA 1NNPA 4H8JA 3PUVE 1R9QA 4KI0E 3TCGA 4Q8RA 2QS2A 2PYYA 3R7XA 1CE2A 1MXXA 3N5LA 3PPPA 2XXPA 2AIXA 3MVWA 5KDTA 3QUJA 4FIMA 5TPAB 4RXLA 5IAIA 3TODA 4H8IA 1EH3A 3Q25A 1B51A 1MPDA 1R1NA 3SEYA 1MM6A 3G3IA 2RF1A 2RCBA 4QFPA 4KQPA 4OXVA 4GD5A 3C9HA 2HZLA 2DWHA 2XX7A 4IO6A 1JVXA 3BBRA 3UN6A 3O6IA 1VSOA 5CMCA 1B0HA 5JTYA 4R73A 2UYFA 3IOUA 3FXUA 3FVNA 2I0BA 4WEDA 3OSQA 4JSDA 3GBBA 1PDAA 1QUJA 4PFWA 2REJA 4OFJA 5AE4A 3KG2A 4ECFA 1BTJA 4GL0A 2ONRA 2ONKE 3O28A 3SEXA 4GWOA 1T0KA 2YJPA 4RPNA 3DELB 1NH7A 3IR1A 1FQAA 5H8FA 3T9UA 4X48A 4NF5A 5DEXA 2HXWA 3IB2A 3K6WA 3U1OA 1GGGA 1B2HA 4L17A 1MY0A 4YICA 3H6UA 1SYIA 2AL5A 1M5DA 2I49A 3VV5A 1UTHA 3JZJA 3TDJA 4OZ9A 4M1VA 5IKBA 3K1MA 3PPRA 4FORA 4GFRA 3RPWA 2FA7A 3G3JA 5CMKA 2ESNA 3B6WA 3TTRA 1JW1A 3PD9A 2XX9A 2W7YA 3FZVA 2A5TB 1ZJLA 4H1XA 5L9SA 5HM4B 2HQ0A 2V93A 1SVXB 2XD2A 3FUZA 1PB7A 1Y9UA 1Y20A 1N3XA 2XXWA 3JYRA 4TLMB 2Y7RA 1B3HA 1Y4CA 3SKPA 2ABHA 1B52A 3H6WA 1EZOA 2Y7WA 4BDNA 3V89B 4ELOA 5DYHA 4AQ4A 1BKAA 3B6QA 3MZBA 3QK6A 4YB6A 1Y4TA 4MLQA 3PV0E 4E0WA 1SQYA 3RGYA 4Q0CA 1PBPA 3IO6A 3BKIB 5JK4A 3A09A 3EHSA 1B40A 4P11A 4P0IA 4F2OA 1MQHA 4GXSB 1MM7A 4F3BA 3THIA 2I58A 3MBPA 4U1OA 3S9LC 3PUXE 2DVCA 4FEDA 4QFLA 1B7UA 3PPNA 1NNKA 2XXQA 3QYTA 1Y1ZA 3E13X 2VHAA 2XXHA 2I3WA 3MP8A 1A7LA 3K4UA 1B3FA 2H5YA 1A8FA 3FD3A 1LB9A 1US5A 4R72A 1QUIA 5DVIA 4KCDA 3K6UA 3KSXA 1MG1A 1JQFA 1MRPA 1KWHA 5FTHA 2OK2A 4X9TA 1USYE 1NFTA 1FW0A 4EDPA 2HCAA 1PB9A 1MS7A 3HCQA 2QS3A 3KJTA 3Q26A 5AA3A 1I6AA 1LAHE 1FTLA 4JWYA 4Z7EA 3EHTA 3MQ9A 3O66A 3BFTA 2PT2A 3KOTA 3L6GA 1PBQA 4QF9A 4OWDA 2FNCA 3U93A 4NWDA 2UVGA 5I57B 4NMYA 3ECRA 1ZLQA 3CFLA 5FHNA 4OESA 3USDA 2O68A 4YKPA 1D4NA 5AA4B 2H25A 3O6HA 3VLUA 1UIUA 1N7WA 3WAFA 4BDOA 3VXBA 3CG1A 3N26A 4MLVA 1J1NA 2Y7IA 5K2YA 4I9DA 3D4CA 2NVUB 1LAXA 3OENA 2DQVA 3CG3A 1OVBA 4BDLA 1DOTA 1GTKA 3PUZE 2DSFA 4ELQA 1US4A 2YPNA 1ZU0A 4IGTA 1YPNA 2D21A 4FATA 1O64A 1DPEA 4EQ7A 5JEIA 3W9VA 1NNTA 1QVSA 3TAJA 5ISUA 3CIJA 4G8HA 3CFXA 1MXZA 1S9TA 3TFLA 1YTVA 4K3FA 5A5XA 3IJOB 5KCJB 4BDQA 1B9JA 1BP5A 4KCCA 1Z7ME 4XXUA 4PP0A 1SDXA 4RPOA 4WEPA 3IB0A 5CM6A 4G8MA 4JWOA 1H43A 4HS7A 3K00A 1B7HA 4R75A 2QS1A 1N76A 3RTWB 3K2DA 3OMBA 2F34A 4ZS9A 4XKNA 3LSWA 4R6KA 4ZDMA 1B5HA 1SI0A 2NWJA 3H3GA 4EXKA 4QSEA 5I2NA 5DT6A 1TWYA 1JW4A 3C34A 1POY1 3ZSFA 4U23A 5ICTA 1A54A 3QXMA 4AB6A 1BLFA 5FTIA 1P1QA 1GV8A 2AYSA 1N0TA 4WXJA 1FQFA 1GVCA 1GR2A 3C31A 3M3FA 1MXUA 2M8CA 4NTLA 5FHOA 2DP8A 2DOJA 2G29A 4OTEA 1AOVA 1SI1A 3TTNA 3TELA 1Z7NE 3OXNA 4H6DA 2XXXA 2REGA 3Q27A 3IOTA 5KDTB 4F3GA 3TEPA 4JBZA 4F18A 2O6AA 2E0SA 3ILTB 3MVYA 4N13A 2ZMBA 1IXHA 2OJTA 2Z8EA 1O7TA 3H6VA 1B5JA 1LCTA 2B65A 4EQBA 4FECA 4POXA 5L8DA 3EN3A 3S2VA 2ZYKA 3O9PA 1LFGA 4F3PA 5DVFA 3PGFA 2ZYOA 4LQ2A 2P0SA 1VFDA 4GOTA 4DIGA 3S9NC 2QMXA 2I3VA 1ELJA 5JTYB 4JSOA 2V84A 2QRYA 3O6GA 5CBRA 3TCFA 4PFYA 3FVGA 5TU0A 2QMWA 3OEMA 1NKXA 1LBCA 3W9WA 4P0GA 3RUMA 1MY2A 4PETA 4HW8A 3G3GA 1XS5A 1IITA 5H8FB 1QKAA 1FTJA 4NF5B 4U1ZA 5DEXB 1A8EA 3S4UA 3TTMA 4F22A 4F3SA 1P1OA 3KOSA 1UTBA 2XHDA 3ONMA 3GZGA 3O2AA 4H5GA 2H4IA 1AL3A 2Q2AA 1UTHB 2IA4A 1MY1A 3EQ1A 4TOZA 1JNFA 3TQWA 5CC2A 2XXUA 3WAEA 3VVEA 3EHUA 2RC7A 2IEEA 3DM0A 3CFZA 4JXIA 3T9XB 4R2BA 1M5FA 3M8UA 1I6QA 3QIMA 1MQGA 4GL8A 1XOCA 3ODBA 3OOAA 2GH9A 4ZEDA 1B3EA 3DLNA 5EYFA 1MQJA 1B58A 1LGBC 2O69A 2Q2CA 5CMMA 2X7QA 4DDDA 1SW1A 2O84X 1M5CA 3LSLA 3RT8A 2GHAA 2O7UA 2DWJA 4NE4A 1MQIA 2DE3A 4G77A 4RK2A 3MPKA 2B3BA 3FXRA 4KYDA 1RYOA 2I4CA 3T96B 3KZGA 4ESWA 2WKYA 3MZ9A 4JB7A 4MBPA 4N07A 2VD3A 2QL3A 2UXAA 4ISUA 4R6YA 1DTGA 3IOVA 2O1LA 2H98A 3U72A 3VVFA 2OLBA 4UA8A 4R9FA 3T66A 1WDNA 4OFLA 1PEBA 3G3FA 4OFOA 4BDMA 4ELPA 3RQTA 5AA2D 3FV1A 4DXCA 1DMBA 3T22A 3MWBA 1FTOA 3N94A 3ILUB 5K2XA 3O97A 3PD8A 1LB8A 3IK6B 3KSJA 4XKPA 4G4PA 2R71A 4IO4A 1PB8A 4OERA 1ZTYA 4G8NA 3FVOA 1B32A 2R6GE 1S7YA 1P1WA 3HV1A 2F7BA 2F97A 1UQWA 2XXVA 2UVIA 5H8HA 1H44A 4I62A 4ZEKA 1SW4A 3S9EA 5AA2A 4YKJA 4IY6A 4RA1A 1B46A 4F1YA 1B4HA 1TT1A 1B6HA 4LVQA 4EF1A 1YAEA 4QFOA 5KZTA 1XVYA 5J1DA 3H6TA 1LCFA 1MXVA 2RINA 4GF8A 2FYIA 3CSBA 1OQHA 4NF6B 1Y1MA 4LQ5A 4NWCA 3FJGA 1B5IA 1B7ZA 4M4GA 3C32A 1Y3PA 4F1VA 5TP9A 4UACA 3E9XA 2O7IA 5BUUA 1MPCA 2DE2A 1BIYA 1IUDA 4FAJA 1Q35A 5FHMA 5I59A 4RYAA 1P1NA 4EUOA 4EQ9A 4HCWA 5AA1A 3IORA 4PFTA 2Q8JA 3VVDA 1M5BA 2X7PA 1FQCA 2P1SA 2I48A 3ZS6A 3OO9A 4YKIA 2H9BA 3PUYE 2HAVA 5A5XB 3SEVA 2ALUA 3JV9A 1LAGE 4YZZA 4FEBA 3C35A 3OEKA 4E0XA 3FVKA 1N84A 4O3CA 4F19A 1HSEA 1D9YA 3F11A 1RYXA 5ICQA 2DWIA 3K0VA 5L9MA 4XKRA 3QSLA 3CVGA 4NEDA 2V25A 2O1MA 5I2NB 3LUYA 3L6HA 3IAZA 3K1NA 1XC1A 4NF8A 3W15C 5CMBA 1M5EA 3MPLA 4JDFA 3C4MA 3AXFA 4F31B 4DZ1A 4LZ5A 3UA8A 2A5SA 1MPBA 3OO6A 4TLLB 3OELA 1WODA 2PX1A 3C33A 4ZZAA 2VGQA 4OETA 4GIZA 3FXQA 2F35A 4X1DA 3GXAA 5M2VA 1P1UA 4OYVA 1DSNA 5CRYA 3UGWA 3EPEA 2D5WA 3KN7A 3VDFA 4I8CA 4LATA 4ZE8A 4Q5TA 3TQLA 1B05A 2DVZA 4H5FA 4IY5A 3SERA 4YB5A 5ITPA 1IZ1A 3CR9A 3U92A 2UVJA 3R26A 1WVJA 1MDQA 2X26A 2UYEA 3DP6A 4XKQA 1O63A 3DP8A 1OMPA 3FV2A 4LZ7A 1IIWA 5I2KA 3S9MC 2Z8DA 3E4RA 4TQUQ 2QJEA 3IOWA 5H8QA 3KBRA 4QFNA 1XVXA 5F1QA 4ZEIA 3IJXB 3A3CA 3B7DA 3RN8A 3PMWA 1SYHA 5H8NA 2I4BA 3VXCA 2Z8FA 4XTCQ 1LSTA 3MVZA 1AH5A 5I56A 2V3TA 3CRBA 3D4GA 4AB5A 2F8DA 3LSFB 3K6XA 4KYSA 4RNSA 3PU5A 3A3UA 3KN3A 1B1XA 2Q89A 2Q88A 3KGCA 4OENA 1ZKBA 1JETA 3FIRA 2DE4A 1TFAA 5ITOA 3IL1B 3VFJA 3HSTA 1P99A 1FCKA 1UTBB 1QUKA 3TKDA 4MF3A 4QHQA 3QAXA 4DXBA 4IO2A 2VOZA 1EU8A 4EF2A 2Q9TA 5I84A 1QW0A 3RY3A 2GFEA 1OQGA 4BLAA 1MY4A 4H67A 4KPTA 2XXRA 4RK9A 2OZZA 4RY1A 1I6BA 4WKMA 5I58A 3TCHA 1SD3A 3CSGA 3MP1A 3KFMA 4THIA 3TMGA 2Z23A 3G7WA 3MAMA 3CI8A 5DTBA 4Q30B 2QS4A 4NF4A 5CI5A 4O3AA 2ZNTA 3TPAA 3LSXA 3SDFA 2HAUA 2XD3A 3K6VA 4G68C 3H03A 4FE8A 3BFUA 3PMXA 3V83A 3IB1A 3HO7A 3O29A 5HPQA 5BWJA 3MUQA 2I0CA 2XXTA 1IXGA 1LLSA 4F1UA 3LBSA 2ZYNA 5F7VA 3RT6B 4ONYA 3HPIA 4ZECA 3FATA 4IO3A 3KJ7A 4OQOA 3R6UA 2O51A 3T9HB 1MXWA 4G68A 2R9JA 4F29A 1B3LA 2DXRA 2F6PA 2F6GA 3SEWA 1USYH 2Y7KA 2QPQA 3FJ7A 1L5TA 3B6TA 3LC8A 3SESA 4R6HA 2OCUA 4PE5B 2P2AA 2ZNSA 3RNNA 4ELRA 3QUFA 1VFEA 4ND9A 4U21A 5TPAA 2ZNUA 2PT1A 3PUWE 1XHYA 4KFQA 4C0RA 4IO5A 4DLDA 3N6UA 5H8HB 3RLFE 2DWAA 4U4SA 5B7DA 1AMFA 2F36A 5AA2B 2YLNA 4ESXA 4YU0A 4F39A 2HFBA 4GLIA 5HBCA 2F5XA 3K1PA 1IXCA 4R74A 4OEUA 1QKBA 1IQ7A 2RKMA 2GHBA 3EF7A 1RKMA 4QRZA 1H3DA 1FTKA 1A99A 1II5A 1MDP1 2CZLA 2RC8A 5TP9B 1JEUA 1MH3A 2B3FA 2NOOA 2UVHA 1SW5A 1TXFA 1NL5A 2VP1A 5I59B 2NXOA 2Y7PA 1S50A 3IO4A 4H0WA 2V3UA 3N6TA 1B4ZA 4FJPA 2GRVA 4Z0IA 3Q28A 3M3KA 4IB2A 2ZXTA 4DCXA 2OBGA 2XXIA 3H06B 2HEUA 1AIVA 1A55A 1POTA 1QULA 4PQJA 1FQBA 5L9OA 1PC3A 1D3KA 3I3VA 1DPPA 1N04A 4YB7A 3OO8A 4KHZE 2I6EA 3HHFA 2A5TA 5EHSA 5B70A 2OWTA 1QJMA 2HZKA 1EZPA 1VR5A 4LP2B 4JWXA 1UIVA 4G2ZA 1SBPA 2ZYMA 3MJNA 4OMBA 2XX8A 4NF8B 3FGSA 1IEJA 3G3KA 4MFIA 1OLCA 3GLBA 2H99A 4QSDA 3TZAA 2F7CA 3P7IA 4U2RA 1N3WA 5CBSA 1B3GA 3FASA 2PBWA 4DE8A 2PVUA 1MH4A 4HCYA 1N7XA 1FQDA 4ZEFA 4YAHX 4QSCA 1OVTA 3LR1A 4IO7A 3U94A 1JEVA 2V3QA 1FQEA 4IGRA 1VE4A 3MC2A 2KLFA 4I1DA 4O3BA 4KYEA 3VLVA 2XXYA 1OIBA 3MP6A 1JW5A 3UIFA 1SW2A 4N6PA 3G3HA 2RC9A 4LONB 3FJMA 4NF6A 3UK4A 3E3KA 4GQOA 3U8QA 5I2KB 1Y3QA 5EHMA 1H76A 4X1BA 4OHNA 3OD7A 4LA9A 5H8QB 4RJZA 1NH8A 3MZ1A 4R2FA 1I69A 1LAFE 1NNFA 1R6ZA 3MW0A 3MVXA 2NUVA 2F7AA 5H8NB 1URGA 1MXYA 2F78A 1FTMA 2QSXA 5I56B 2LAOA 4BDRA 4H65A 4QFKA 3C36A 1LBBA 4GVOA 3UP9A 1URDA 1D9VA 1NMUA 1OLAA 3T9VA 3DP4A 5I57A 4DCYA 1CB6A 1A40A 5AA4A 1MQDA 4GRKA 3PPQA 3K01A 2Z22A 1ZBMA 1IXIA 4DXUA 2DXYA 4YKKA 1JVYA 3HHGA 2DYXA 3PMVA 1TFDA 5DVJA 3VE1B 1URSA 3KN8A 2G93A 4LZ8A 3GBAA 2AL4A 4YMBA 1F9BA 2PMSA 3HN0A 1B1HA 2THIA 2VD2A 3TTKA 3V5AA 1ANFA 3H7MA 1ZMGA 4GXAA 4F2QA 3RTFB 2Y84A 5I58B 3I5OA 3IX1A 3TYHA 4ZE9A 3H4ZA 5LOMA 3T93B 1EZ9A 4POWA 1LFIA 3V8XB 5H8SA 5KCJA 4NF4B 4YMAA 3Q29A 1LFHA 3VLWA
chains in the Genus database with same CATH superfamily
2CMOA 4HTGA 4PFUA 4XIGQ 2ONSA 4LUBA 3TTLA 4EXLA 2P3NA 1XT8A 4KD5A 4C1TA 2ANJA 3M3LA 3TUSA 4R9GA 1H45A 3K02A 1DTZA 4ZZEA 1YCJA 2BJJX 1FPDA 4OVJA 1R9LA 4U22A 4KR5A 1B0LA 3ZKKA 3UORA 4GWXA 2WBBA 4JVIA 2XWIA 3I6VA 3LV0A 2DS9A 1HSJA 4U4XA 4N6DA 4C1UA 3OO7A 1Q1KA 4MH5A 5ELVA 3SETA 4ZEBA 1ZIUA 3OSRA 4PGNA 4OANA 4JVCA 1ATGA 2D3IA 3SEUA 1QGXA 4G68B 1HSLA 5I5PA 2XA5A 3KEIA 3PPOA 3ZKLA 5ET8A 2OWSA 4OEVA 1MY3A 2RCAA 1FBCA 3B8BA 2E1SA 1Y3NA 3E78A 1NNPA 2XWOA 1NUYA 2XWKA 4H8JA 3PUVE 4PF6A 1R9QA 4KI0E 3TCGA 4Q8RA 2FHYA 2QS2A 2PYYA 3R7XA 1CE2A 1MXXA 3N5LA 3PPPA 2XXPA 2AIXA 2R8TA 3MVWA 5KDTA 3QUJA 4FIMA 5TPAB 4RXLA 5IAIA 3TODA 4H8IA 1EH3A 3Q25A 4NG7A 1B51A 1MPDA 1R1NA 3SEYA 1MM6A 1FPEA 2RF1A 3G3IA 2RCBA 3U65A 4QFPA 5ET7A 4X04A 2FIEA 4KQPA 4OXVA 4GD5A 3C9HA 2HZLA 2DWHA 2XX7A 4IO6A 1JVXA 3BBRA 3UN6A 3O6IA 1VSOA 5CMCA 3RPLB 1B0HA 4XEQA 5JTYA 4MEVA 1NUXA 4R73A 2UYFA 3IOUA 3FXUA 3FVNA 2I0BA 4WEDA 4P1LA 3OSQA 4JSDA 3GBBA 1PDAA 1QUJA 4PFWA 2REJA 1FPIA 4NN3A 4OFJA 5AE4A 3KG2A 4ECFA 1BTJA 3EKIA 4GL0A 2ONRA 2ONKE 3O28A 3SEXA 4GWOA 1T0KA 2YJPA 4RPNA 4PC9A 1FBDA 3DELB 1NH7A 3IR1A 1FQAA 5H8FA 3T9UA 4X48A 4NF5A 5DEXA 2HXWA 4MNIA 5FBPA 3IB2A 3K6WA 3U1OA 1GGGA 1B2HA 4L17A 1MY0A 4YICA 3H6UA 1SYIA 2AL5A 4NGUA 1M5DA 2I49A 3VV5A 1UTHA 3JZJA 3TDJA 4OZ9A 4M1VA 5IKBA 2PCRA 3K1MA 3PPRA 4FORA 4GFRA 3RPWA 4DI4B 2FA7A 3G3JA 5CMKA 4N81A 2ESNA 2XXKA 3B6WA 3TTRA 4P9KA 1JW1A 3PD9A 2XX9A 2W7YA 3FZVA 2A5TB 1ZJLA 4H1XA 5L9SA 5HM4B 2HQ0A 4MIJA 2V93A 1SVXB 2XD2A 3FUZA 1PB7A 2ZZWA 4MJOA 1Y9UA 1Y20A 1EYKA 1N3XA 2XXWA 3JYRA 3IFCA 4TLMB 2Y7RA 1B3HA 1Y4CA 3SKPA 1INPA 4PF8A 2ABHA 1B52A 3H6WA 1EZOA 2Y7WA 4BDNA 3V89B 4ELOA 5DYHA 2WEFA 3IFAA 4AQ4A 1BKAA 3B6QA 3MZBA 3QK6A 4YB6A 1Y4TA 4MLQA 3PV0E 4E0WA 1SQYA 3RGYA 4Q0CA 1PBPA 3IO6A 3BKIB 5JK4A 1DCUA 3A09A 3EHSA 4MNCA 1B40A 4P11A 4P0IA 4F2OA 1MQHA 3NOHA 4GXSB 1MM7A 4F3BA 3THIA 2I58A 1AWBA 3MBPA 4U1OA 4XFEA 3S9LC 3PUXE 2DVCA 4FEDA 4QFLA 1B7UA 3PPNA 1NNKA 2XXQA 3QYTA 1Y1ZA 3E13X 2VHAA 2XXHA 2I3WA 3MP8A 1A7LA 3K4UA 1B3FA 2H5YA 1A8FA 1IMCA 1LB9A 3FD3A 1US5A 4R72A 1QUIA 5DVIA 4KCDA 2B4LA 3K6UA 3KSXA 1MG1A 2GQ1A 1JQFA 4X8RA 1FJ6A 5LTCA 1MRPA 1KWHA 5FTHA 2OK2A 4X9TA 1USYE 1NFTA 1FW0A 4EDPA 1FBHA 2HCAA 1LEVA 1PB9A 1MS7A 3HCQA 2QS3A 3KJTA 3Q26A 4N6KA 1RDYA 5I3SA 5AA3A 1I6AA 1LAHE 1FTLA 4JWYA 3EHTA 3MQ9A 4Z7EA 3O66A 5IM2A 3BFTA 2PT2A 3KOTA 3L6GA 1PBQA 4QF9A 4MMPA 2FNCA 4OWDA 1NI9A 3U93A 4NWDA 2UVGA 1FPBA 5I57B 4NMYA 3ECRA 1ZLQA 3CFLA 5FHNA 4OESA 3USDA 2O68A 4HE1A 1D4NA 4YKPA 5AA4B 2H25A 3O6HA 3VLUA 1UIUA 4PDHA 1N7WA 3WAFA 4BDOA 4PGPA 3VXBA 3CG1A 3N26A 4MLVA 1J1NA 5ESYA 2Y7IA 5K2YA 4I9DA 3D4CA 2NVUB 1LAXA 3OENA 2DQVA 3CG3A 1OVBA 1DOTA 1GTKA 4BDLA 3PUZE 1K9YA 2DSFA 4ELQA 1US4A 2YPNA 1ZU0A 1YXIA 4IGTA 4P1EA 1YPNA 2D21A 4FATA 1O64A 1DPEA 1NUWA 3BIGA 2CEXA 4EQ7A 5JEIA 1FPLA 3W9VA 1NNTA 1QVSA 2PFYA 3TAJA 5EYHA 5ISUA 3CIJA 1FPGA 4G8HA 3CFXA 1MXZA 4MNPA 1S9TA 4HXVA 3TFLA 1YTVA 4K3FA 5A5XA 3IJOB 5KCJB 4BDQA 1B9JA 1BP5A 2HPGA 4KCCA 1Z7ME 2F3DA 4XXUA 4PP0A 1SDXA 4RPOA 4WEPA 3IB0A 5CM6A 4G8MA 4JWOA 1H43A 4HS7A 3K00A 1B7HA 4R75A 2QS1A 1N76A 3RTWB 3K2DA 3OMBA 4OVPA 2F34A 4ZS9A 4XKNA 3LSWA 4R6KA 4ZDMA 1B5HA 1SI0A 2NWJA 3H3GA 4EXKA 4QSEA 5I2NA 5DT6A 3GYYA 1NV6A 1TWYA 1JW4A 3C34A 1POY1 1FBEA 3ZSFA 4U23A 5ICTA 1A54A 1JP4A 3QXMA 4AB6A 1BLFA 3ISPA 5FTIA 1P1QA 1GV8A 2AYSA 1N0TA 5IZ3B 4WXJA 1FQFA 1GVCA 1GR2A 3C31A 3M3FA 1MXUA 3D1RA 4N4UA 2M8CA 4NTLA 5FHOA 2DP8A 2DOJA 2G29A 4OTEA 1AOVA 1SI1A 3TTNA 3TELA 1Z7NE 3OXNA 4H6DA 2XXXA 2REGA 3Q27A 1NV5A 3FXBA 3IOTA 5KDTB 4F3GA 1D9QA 3TEPA 4JBZA 1IMFA 4F18A 2O6AA 2E0SA 3ILTB 3MVYA 4N13A 2ZMBA 1IXHA 2OJTA 2Z8EA 1O7TA 3H6VA 1B5JA 1LCTA 2B65A 4EQBA 4FECA 4POXA 5L8DA 3EN3A 3S2VA 2ZYKA 3O9PA 1LFGA 4F3PA 5DVFA 5LDZA 3PGFA 2ZYOA 4LQ2A 2P0SA 1VFDA 4GOTA 4DIGA 3S9NC 2QMXA 2I3VA 1ELJA 5JTYB 4JSOA 2V84A 2FVZA 2QRYA 3O6GA 5CBRA 4OVRA 1YYZA 3TCFA 4PFYA 5IZ1A 3FVGA 5TU0A 5DW8A 2QMWA 3OEMA 1NKXA 1LBCA 2FBPA 4DI3D 3W9WA 4P0GA 3RUMA 1LBYA 1MY2A 4PETA 4HW8A 3G3GA 1FJ9A 4GWWA 1XS5A 1IITA 5H8FB 1QKAA 1FTJA 4NF5B 4U1ZA 5DEXB 1A8EA 3S4UA 3TTMA 4F22A 4F3SA 1P1OA 3KOSA 1UTBA 2XHDA 3ONMA 3GZGA 3O2AA 4H5GA 2H4IA 1AL3A 2Q2AA 1UTHB 2IA4A 1MY1A 3EQ1A 2HHMA 4TOZA 1JNFA 2BJIA 3TQWA 5CC2A 2XXUA 3WAEA 3VVEA 3EHUA 1EYJA 2RC7A 2IEEA 3DM0A 3CFZA 4JXIA 5EQAA 3T9XB 4GBVA 2OWZA 4R2BA 1M5FA 3M8UA 1I6QA 3QIMA 1MQGA 1CNQA 4GL8A 1XOCA 3ODBA 2FIXA 4LN5A 3OOAA 2GH9A 4ZEDA 1B3EA 4GX4A 3DLNA 5EYFA 1MQJA 1B58A 1LGBC 2O69A 4XF5A 2Q2CA 1NV1A 5CMMA 4MHFA 2X7QA 4DDDA 1SW1A 2O84X 1M5CA 3LSLA 3RT8A 1YZ0A 4PTKA 2GHAA 2O7UA 2DWJA 4NE4A 1MQIA 2DE3A 4G77A 4RK2A 3MPKA 2OX3A 2B3BA 2DDKA 3FXRA 4PAIA 4KYDA 1RYOA 2I4CA 3T96B 3BIHA 3KZGA 3T1BA 2WKYA 4ESWA 3MZ9A 4JB7A 4MBPA 4N07A 3MYUA 2VD3A 2QL3A 4R6YA 2UXAA 4ISUA 1DTGA 1LBVA 3HFUA 3IOVA 2O1LA 2H98A 3U72A 3VVFA 2OLBA 4UA8A 2KQZA 4JVDA 1FPFA 4R9FA 3T66A 1WDNA 4OFLA 1PEBA 3G3FA 4OFOA 5J16A 4BDMA 4ELPA 3RQTA 5AA2D 3FV1A 3KBZA 5EYGA 4DXCA 2Y5KA 1DMBA 3T22A 3MWBA 1FTOA 3N94A 3ILUB 5K2XA 3O97A 3PD8A 1LB8A 3IK6B 1SPIA 3KSJA 4XKPA 4G4PA 2R71A 4IO4A 1PB8A 4OERA 1ZTYA 4G8NA 3FVOA 1B32A 2R6GE 1S7YA 4NAPA 4PBHA 4QBAA 4OVTA 1P1WA 3HV1A 2F7BA 2F97A 1UQWA 1NV0A 2XXVA 2UVIA 5H8HA 1H44A 4I62A 4ZEKA 1SW4A 3S9EA 5AA2A 4YKJA 4N91A 4IY6A 4RA1A 1B46A 4F1YA 1B4HA 1TT1A 1B6HA 4LVQA 1K9ZA 4HE2A 4EF1A 1YAEA 4QFOA 5KZTA 1XVYA 4FBPA 5J1DA 3H6TA 1LCFA 1MXVA 2RINA 4GF8A 2FYIA 3CSBA 4H46A 4NHBA 1OQHA 4NF6B 3B50A 1BK4A 1Y1MA 4LQ5A 4NWCA 4QXDA 3FJGA 1B5IA 1B7ZA 4M4GA 3C32A 1Y3PA 4GWSA 4F1VA 5TP9A 4UACA 3E9XA 2O7IA 5BUUA 1MPCA 2DE2A 1BIYA 1IUDA 4FAJA 1Q35A 5FHMA 2L5VA 5I59A 4RYAA 1P1NA 4EUOA 2KR0A 4EQ9A 4HCWA 5AA1A 1IMAA 3IORA 4PFTA 2Q8JA 3VVDA 1M5BA 2X7PA 1FQCA 2P1SA 2P3VA 2QVVA 2I48A 3ZS6A 3OO9A 4YKIA 2H9BA 3PUYE 2HAVA 5A5XB 4NX1A 2ALUA 3SEVA 3JV9A 1LAGE 4YZZA 4FEBA 3C35A 3OEKA 4E0XA 3FVKA 4O7IA 1N84A 4O3CA 4F19A 1HSEA 1D9YA 3F11A 1VDWA 1RYXA 5ICQA 2DWIA 3K0VA 5L9MA 4XKRA 3QSLA 3CVGA 4O7MA 4NEDA 2V25A 2O1MA 4OVSA 5I2NB 3LUYA 3L6HA 3SZPA 3IAZA 3K1NA 1XC1A 4NF8A 3W15C 5CMBA 1M5EA 3MPLA 4JDFA 3C4MA 3AXFA 4F31B 4DZ1A 4LZ5A 3UA8A 2A5SA 1MPBA 3OO6A 4TLLB 3OELA 1WODA 2PX1A 3C33A 4P47A 4ZZAA 2VGQA 4HE0A 4OETA 4GIZA 3FXQA 2F35A 4X1DA 3GXAA 5M2VA 2PFZA 1P1UA 4OYVA 1DSNA 5CRYA 3UGWA 4IR8A 3EPEA 2D5WA 3KN7A 3VDFA 4I8CA 4LATA 4ZE8A 5A5LA 4Q5TA 3TQLA 1B05A 2DVZA 4AS5A 4H5FA 4IY5A 4YB5A 3SERA 2QFLA 5ITPA 1IZ1A 3CR9A 3U92A 4UABA 2WBDA 2UVJA 4PFIA 3R26A 1WVJA 1MDQA 2X26A 5EQ9A 2UYEA 3DP6A 4XKQA 1O63A 3DP8A 1OMPA 4NQ8A 3FV2A 4LZ7A 1IIWA 2Q74A 5I2KA 3S9MC 2Z8DA 3E4RA 4TQUQ 2V4CA 2QJEA 1G0HA 3IOWA 1FBFA 5H8QA 3KBRA 4QFNA 1XVXA 5F1QA 4ZEIA 3IJXB 3A3CA 3B7DA 2VPOA 3RN8A 3PMWA 1SYHA 5H8NA 1NV7A 4GWZA 2I4BA 3VXCA 2Z8FA 4XTCQ 1LSTA 3MVZA 1AH5A 5I56A 2V3TA 3CRBA 3D4GA 4AB5A 2F8DA 3LSFB 3T0JA 3K6XA 4PFRA 4KYSA 4G61A 4RNSA 3PU5A 3A3UA 3KN3A 1B1XA 2Q89A 2Q88A 2VPNA 3KGCA 4OENA 1ZKBA 1JETA 5I7IA 3FIRA 2DE4A 1TFAA 5ITOA 3IL1B 4MCOA 3VFJA 3HSTA 1P99A 1FCKA 1UTBB 1QUKA 1FPJA 3TKDA 2WYPA 4MF3A 3E79A 4QHQA 3QAXA 4DXBA 4I40A 4IO2A 2VOZA 1EU8A 4EF2A 2Q9TA 5I84A 1QW0A 3RY3A 4GWUA 2GFEA 1OQGA 4BLAA 1NV2A 1LBXA 1MY4A 4H67A 4KPTA 2XXRA 4RK9A 2OZZA 4RY1A 5IZ3A 1I6BA 4WKMA 5I58A 3TCHA 1SD3A 3CSGA 1FRPA 4THIA 1IMDA 3KFMA 3MP1A 3TMGA 2Z23A 3G7WA 4GBWA 3MAMA 3CI8A 5DTBA 4Q30B 2QS4A 4NF4A 5CI5A 4O3AA 2ZNTA 1RDXA 3TPAA 3LSXA 5IGAA 3SDFA 2HAUA 1DBZA 2XD3A 2WX9A 3K6VA 4G68C 3H03A 4FE8A 3BFUA 3PMXA 3V83A 2CZKA 3IB1A 3HO7A 3O29A 1FSAA 5HPQA 1KA1A 3MUQA 5BWJA 2I0CA 2XXTA 1IXGA 1LLSA 4F1UA 3LBSA 2ZYNA 5F7VA 3RT6B 4ONYA 3HPIA 5T3JA 1FBPA 4ZECA 3FATA 4IO3A 1IMBA 3KJ7A 4PE3A 4OQOA 2XWVA 3R6UA 2O51A 3T9HB 1MXWA 4G68A 2R9JA 4F29A 1B3LA 2DXRA 5EQ7A 2F6PA 4OA4A 2F6GA 3SEWA 1USYH 2Y7KA 5ET5A 2QPQA 3FJ7A 1L5TA 3B6TA 3LC8A 3LUZA 2Y5LA 3SESA 4R6HA 2OCUA 4O8MA 4I3YA 4PE5B 2P2AA 2ZNSA 3RNNA 4N17A 4ELRA 3QUFA 1VFEA 1NV3A 4ND9A 4U21A 5TPAA 2ZNUA 2PT1A 3PUWE 1XHYA 4KFQA 2MKZA 4C0RA 4IO5A 4DLDA 3N6UA 3A29A 5H8HB 3RLFE 2DWAA 4U4SA 1DK4A 5B7DA 1AMFA 2F36A 5AA2B 2YLNA 2CZIA 4ESXA 4YU0A 4F39A 4N15A 2HFBA 4H45A 4GLIA 5HBCA 2F5XA 3K1PA 1IXCA 4R74A 4OEUA 1QKBA 5ET6A 3RPLA 1IQ7A 2RKMA 2GHBA 4GWYA 4PDDA 3EF7A 1RKMA 3CHGA 4QRZA 4N8YA 1H3DA 4PCDA 1FTKA 1A99A 1II5A 1MDP1 2CZLA 2RC8A 5TP9B 1JEUA 1MH3A 1NV4A 2B3FA 2NOOA 2UVHA 1SW5A 1TXFA 1NL5A 2VP1A 5I59B 2NXOA 1Q9DA 2Y7PA 2HXRA 1S50A 4GX6A 3IO4A 4H0WA 2V3UA 4AS4A 3N6TA 1B4ZA 1EYIA 4FJPA 2Q8MA 2GRVA 4Z0IA 3Q28A 3M3KA 4IB2A 2ZXTA 4DCXA 2OBGA 4MAGA 2XXIA 3H06B 2HEUA 1AIVA 1A55A 1POTA 1QULA 3FBPA 4PQJA 1FQBA 5L9OA 1PC3A 1D3KA 3I3VA 4N8GA 1DPPA 1N04A 4YB7A 3OO8A 4KHZE 2I6EA 3HHFA 2A5TA 5EHSA 5B70A 2OWTA 1QJMA 3KC1A 2HZKA 5F24A 2F3BA 1EZPA 1VR5A 4OVQA 4NF0A 4LP2B 4JWXA 1UIVA 4G2ZA 3RYDA 1SBPA 2ZYMA 4OMBA 3MJNA 4I3EA 2XX8A 4NF8B 2CZHA 2ZZXA 3FGSA 1IEJA 4KXPA 3G3KA 4MFIA 1OLCA 3GLBA 2H99A 4QSDA 2JJKA 1LBWA 3TZAA 2F7CA 3P7IA 1KZ8A 4U2RA 1N3WA 5CBSA 1B3GA 2WYKA 3FASA 2PBWA 4DE8A 2PVUA 1MH4A 4HCYA 1N7XA 1FQDA 1NUZA 4ZEFA 4YAHX 4QSCA 1OVTA 3LR1A 4IO7A 3U94A 1JEVA 2V3QA 1FQEA 4IGRA 2CEYA 1FBGA 1VE4A 1KA0A 3MC2A 2KLFA 4I1DA 4O3BA 4KYEA 3VLVA 1XI6A 2XXYA 1OIBA 3MP6A 1JW5A 3UIFA 1SW2A 4N6PA 3G3HA 2RC9A 4LONB 3FJMA 3PTYA 4NF6A 3ROJA 3UK4A 3E3KA 4PAKA 4GQOA 3U8QA 2B4MA 1Y3QA 5I2KB 1G0IA 4MX6A 5EHMA 1H76A 4X1BA 4OHNA 4PAFA 3OD7A 5IZZA 4P56A 1LBZA 4LA9A 5H8QB 4RJZA 1NH8A 3MZ1A 4R2FA 4PFBA 1I69A 1LAFE 1NNFA 1R6ZA 3MW0A 3MVXA 2NUVA 2F7AA 5H8NB 1URGA 1MXYA 4GX3A 1FTAA 2F78A 1IMEA 1FTMA 2QSXA 4O94A 2ZZVA 5I56B 2LAOA 2VT5A 4BDRA 4H65A 4QFKA 4P3LA 3C36A 1LBBA 4GVOA 1RDZA 5EQ8A 3UP9A 1URDA 1D9VA 1NMUA 1OLAA 4P8BA 3T9VA 3DP4A 2QVUA 5I57A 4DCYA 1CB6A 1A40A 5AA4A 1MQDA 4GRKA 3PPQA 3K01A 2Z22A 1ZBMA 1IXIA 4DXUA 2DXYA 4YKKA 1JVYA 1FPKA 3HHGA 2DYXA 3PMVA 1TFDA 5DVJA 3VE1B 1URSA 3KN8A 2G93A 3KC0A 4LZ8A 3GBAA 2AL4A 4YMBA 1F9BA 2PMSA 3HN0A 1B1HA 2THIA 2VD2A 3TTKA 2QVRA 3V5AA 1ANFA 3H7MA 1ZMGA 4GXAA 4F2QA 3RTFB 2Y84A 5I58B 3I5OA 3IX1A 3TYHA 3QMFA 4ZE9A 3H4ZA 5LOMA 3T93B 1EZ9A 4POWA 1LFIA 3V8XB 5H8SA 5KCJA 4NF4B 4YMAA 3Q29A 1LFHA 3VLWA 4PBQA 3MSTA
chains in the Genus database with same CATH topology
2CMOA 4HTGA 4PFUA 4XIGQ 2ONSA 4LUBA 3TTLA 4EXLA 1XT8A 4KD5A 4C1TA 2ANJA 3M3LA 3TUSA 4R9GA 1H45A 3K02A 1DTZA 4ZZEA 1YCJA 2BJJX 4OVJA 1R9LA 4U22A 4KR5A 1B0LA 3ZKKA 3UORA 3I6VA 2DS9A 1HSJA 4U4XA 4C1UA 3OO7A 1Q1KA 4MH5A 5ELVA 3SETA 4ZEBA 1ZIUA 3OSRA 1ATGA 2D3IA 3SEUA 4G68B 1HSLA 3KEIA 3PPOA 3ZKLA 2OWSA 4OEVA 1MY3A 2RCAA 2E1SA 1Y3NA 1NNPA 4H8JA 3PUVE 1R9QA 4KI0E 3TCGA 4Q8RA 2QS2A 2PYYA 3R7XA 1CE2A 1MXXA 3N5LA 3PPPA 2XXPA 2AIXA 3MVWA 5KDTA 3QUJA 4FIMA 5TPAB 4RXLA 5IAIA 3TODA 4H8IA 1EH3A 3Q25A 1B51A 1MPDA 1R1NA 3SEYA 1MM6A 3G3IA 2RF1A 2RCBA 4QFPA 4KQPA 4OXVA 4GD5A 3C9HA 2HZLA 2DWHA 2XX7A 4IO6A 1JVXA 3BBRA 3UN6A 3O6IA 1VSOA 5CMCA 1B0HA 5JTYA 4R73A 2UYFA 3IOUA 3FXUA 3FVNA 2I0BA 4WEDA 3OSQA 4JSDA 3GBBA 1PDAA 1QUJA 4PFWA 2REJA 4OFJA 5AE4A 3KG2A 4ECFA 1BTJA 4GL0A 2ONRA 2ONKE 3O28A 3SEXA 4GWOA 1T0KA 2YJPA 4RPNA 3DELB 1NH7A 3IR1A 1FQAA 5H8FA 3T9UA 4X48A 4NF5A 5DEXA 2HXWA 3IB2A 3K6WA 3U1OA 1GGGA 1B2HA 4L17A 1MY0A 4YICA 3H6UA 1SYIA 2AL5A 1M5DA 2I49A 3VV5A 1UTHA 3JZJA 3TDJA 4OZ9A 4M1VA 5IKBA 3K1MA 3PPRA 4FORA 4GFRA 3RPWA 2FA7A 3G3JA 5CMKA 2ESNA 3B6WA 3TTRA 1JW1A 3PD9A 2XX9A 2W7YA 3FZVA 2A5TB 1ZJLA 4H1XA 5L9SA 5HM4B 2HQ0A 2V93A 1SVXB 2XD2A 3FUZA 1PB7A 1Y9UA 1Y20A 1N3XA 2XXWA 3JYRA 4TLMB 2Y7RA 1B3HA 1Y4CA 3SKPA 2ABHA 1B52A 3H6WA 1EZOA 2Y7WA 4BDNA 3V89B 4ELOA 5DYHA 4AQ4A 1BKAA 3B6QA 3MZBA 3QK6A 4YB6A 1Y4TA 4MLQA 3PV0E 4E0WA 1SQYA 3RGYA 4Q0CA 1PBPA 3IO6A 3BKIB 5JK4A 3A09A 3EHSA 1B40A 4P11A 4P0IA 4F2OA 1MQHA 4GXSB 1MM7A 4F3BA 3THIA 2I58A 3MBPA 4U1OA 3S9LC 3PUXE 2DVCA 4FEDA 4QFLA 1B7UA 3PPNA 1NNKA 2XXQA 3QYTA 1Y1ZA 3E13X 2VHAA 2XXHA 2I3WA 3MP8A 1A7LA 3K4UA 1B3FA 2H5YA 1A8FA 3FD3A 1LB9A 1US5A 4R72A 1QUIA 5DVIA 4KCDA 3K6UA 3KSXA 1MG1A 1JQFA 1MRPA 1KWHA 5FTHA 2OK2A 4X9TA 1USYE 1NFTA 1FW0A 4EDPA 2HCAA 1PB9A 1MS7A 3HCQA 2QS3A 3KJTA 3Q26A 5AA3A 1I6AA 1LAHE 1FTLA 4JWYA 4Z7EA 3EHTA 3MQ9A 3O66A 3BFTA 2PT2A 3KOTA 3L6GA 1PBQA 4QF9A 4OWDA 2FNCA 3U93A 4NWDA 2UVGA 5I57B 4NMYA 3ECRA 1ZLQA 3CFLA 5FHNA 4OESA 3USDA 2O68A 4YKPA 1D4NA 5AA4B 2H25A 3O6HA 3VLUA 1UIUA 1N7WA 3WAFA 4BDOA 3VXBA 3CG1A 3N26A 4MLVA 1J1NA 2Y7IA 5K2YA 4I9DA 3D4CA 2NVUB 1LAXA 3OENA 2DQVA 3CG3A 1OVBA 4BDLA 1DOTA 1GTKA 3PUZE 2DSFA 4ELQA 1US4A 2YPNA 1ZU0A 4IGTA 1YPNA 2D21A 4FATA 1O64A 1DPEA 4EQ7A 5JEIA 3W9VA 1NNTA 1QVSA 3TAJA 5ISUA 3CIJA 4G8HA 3CFXA 1MXZA 1S9TA 3TFLA 1YTVA 4K3FA 5A5XA 3IJOB 5KCJB 4BDQA 1B9JA 1BP5A 4KCCA 1Z7ME 4XXUA 4PP0A 1SDXA 4RPOA 4WEPA 3IB0A 5CM6A 4G8MA 4JWOA 1H43A 4HS7A 3K00A 1B7HA 4R75A 2QS1A 1N76A 3RTWB 3K2DA 3OMBA 2F34A 4ZS9A 4XKNA 3LSWA 4R6KA 4ZDMA 1B5HA 1SI0A 2NWJA 3H3GA 4EXKA 4QSEA 5I2NA 5DT6A 1TWYA 1JW4A 3C34A 1POY1 3ZSFA 4U23A 5ICTA 1A54A 3QXMA 4AB6A 1BLFA 5FTIA 1P1QA 1GV8A 2AYSA 1N0TA 4WXJA 1FQFA 1GVCA 1GR2A 3C31A 3M3FA 1MXUA 2M8CA 4NTLA 5FHOA 2DP8A 2DOJA 2G29A 4OTEA 1AOVA 1SI1A 3TTNA 3TELA 1Z7NE 3OXNA 4H6DA 2XXXA 2REGA 3Q27A 3IOTA 5KDTB 4F3GA 3TEPA 4JBZA 4F18A 2O6AA 2E0SA 3ILTB 3MVYA 4N13A 2ZMBA 1IXHA 2OJTA 2Z8EA 1O7TA 3H6VA 1B5JA 1LCTA 2B65A 4EQBA 4FECA 4POXA 5L8DA 3EN3A 3S2VA 2ZYKA 3O9PA 1LFGA 4F3PA 5DVFA 3PGFA 2ZYOA 4LQ2A 2P0SA 1VFDA 4GOTA 4DIGA 3S9NC 2QMXA 2I3VA 1ELJA 5JTYB 4JSOA 2V84A 2QRYA 3O6GA 5CBRA 3TCFA 4PFYA 3FVGA 5TU0A 2QMWA 3OEMA 1NKXA 1LBCA 3W9WA 4P0GA 3RUMA 1MY2A 4PETA 4HW8A 3G3GA 1XS5A 1IITA 5H8FB 1QKAA 1FTJA 4NF5B 4U1ZA 5DEXB 1A8EA 3S4UA 3TTMA 4F22A 4F3SA 1P1OA 3KOSA 1UTBA 2XHDA 3ONMA 3GZGA 3O2AA 4H5GA 2H4IA 1AL3A 2Q2AA 1UTHB 2IA4A 1MY1A 3EQ1A 4TOZA 1JNFA 3TQWA 5CC2A 2XXUA 3WAEA 3VVEA 3EHUA 2RC7A 2IEEA 3DM0A 3CFZA 4JXIA 3T9XB 4R2BA 1M5FA 3M8UA 1I6QA 3QIMA 1MQGA 4GL8A 1XOCA 3ODBA 3OOAA 2GH9A 4ZEDA 1B3EA 3DLNA 5EYFA 1MQJA 1B58A 1LGBC 2O69A 2Q2CA 5CMMA 2X7QA 4DDDA 1SW1A 2O84X 1M5CA 3LSLA 3RT8A 2GHAA 2O7UA 2DWJA 4NE4A 1MQIA 2DE3A 4G77A 4RK2A 3MPKA 2B3BA 3FXRA 4KYDA 1RYOA 2I4CA 3T96B 3KZGA 4ESWA 2WKYA 3MZ9A 4JB7A 4MBPA 4N07A 2VD3A 2QL3A 2UXAA 4ISUA 4R6YA 1DTGA 3IOVA 2O1LA 2H98A 3U72A 3VVFA 2OLBA 4UA8A 4R9FA 3T66A 1WDNA 4OFLA 1PEBA 3G3FA 4OFOA 4BDMA 4ELPA 3RQTA 5AA2D 3FV1A 4DXCA 1DMBA 3T22A 3MWBA 1FTOA 3N94A 3ILUB 5K2XA 3O97A 3PD8A 1LB8A 3IK6B 3KSJA 4XKPA 4G4PA 2R71A 4IO4A 1PB8A 4OERA 1ZTYA 4G8NA 3FVOA 1B32A 2R6GE 1S7YA 1P1WA 3HV1A 2F7BA 2F97A 1UQWA 2XXVA 2UVIA 5H8HA 1H44A 4I62A 4ZEKA 1SW4A 3S9EA 5AA2A 4YKJA 4IY6A 4RA1A 1B46A 4F1YA 1B4HA 1TT1A 1B6HA 4LVQA 4EF1A 1YAEA 4QFOA 5KZTA 1XVYA 5J1DA 3H6TA 1LCFA 1MXVA 2RINA 4GF8A 2FYIA 3CSBA 1OQHA 4NF6B 1Y1MA 4LQ5A 4NWCA 3FJGA 1B5IA 1B7ZA 4M4GA 3C32A 1Y3PA 4F1VA 5TP9A 4UACA 3E9XA 2O7IA 5BUUA 1MPCA 2DE2A 1BIYA 1IUDA 4FAJA 1Q35A 5FHMA 5I59A 4RYAA 1P1NA 4EUOA 4EQ9A 4HCWA 5AA1A 3IORA 4PFTA 2Q8JA 3VVDA 1M5BA 2X7PA 1FQCA 2P1SA 2I48A 3ZS6A 3OO9A 4YKIA 2H9BA 3PUYE 2HAVA 5A5XB 3SEVA 2ALUA 3JV9A 1LAGE 4YZZA 4FEBA 3C35A 3OEKA 4E0XA 3FVKA 1N84A 4O3CA 4F19A 1HSEA 1D9YA 3F11A 1RYXA 5ICQA 2DWIA 3K0VA 5L9MA 4XKRA 3QSLA 3CVGA 4NEDA 2V25A 2O1MA 5I2NB 3LUYA 3L6HA 3IAZA 3K1NA 1XC1A 4NF8A 3W15C 5CMBA 1M5EA 3MPLA 4JDFA 3C4MA 3AXFA 4F31B 4DZ1A 4LZ5A 3UA8A 2A5SA 1MPBA 3OO6A 4TLLB 3OELA 1WODA 2PX1A 3C33A 4ZZAA 2VGQA 4OETA 4GIZA 3FXQA 2F35A 4X1DA 3GXAA 5M2VA 1P1UA 4OYVA 1DSNA 5CRYA 3UGWA 3EPEA 2D5WA 3KN7A 3VDFA 4I8CA 4LATA 4ZE8A 4Q5TA 3TQLA 1B05A 2DVZA 4H5FA 4IY5A 3SERA 4YB5A 5ITPA 1IZ1A 3CR9A 3U92A 2UVJA 3R26A 1WVJA 1MDQA 2X26A 2UYEA 3DP6A 4XKQA 1O63A 3DP8A 1OMPA 3FV2A 4LZ7A 1IIWA 5I2KA 3S9MC 2Z8DA 3E4RA 4TQUQ 2QJEA 3IOWA 5H8QA 3KBRA 4QFNA 1XVXA 5F1QA 4ZEIA 3IJXB 3A3CA 3B7DA 3RN8A 3PMWA 1SYHA 5H8NA 2I4BA 3VXCA 2Z8FA 4XTCQ 1LSTA 3MVZA 1AH5A 5I56A 2V3TA 3CRBA 3D4GA 4AB5A 2F8DA 3LSFB 3K6XA 4KYSA 4RNSA 3PU5A 3A3UA 3KN3A 1B1XA 2Q89A 2Q88A 3KGCA 4OENA 1ZKBA 1JETA 3FIRA 2DE4A 1TFAA 5ITOA 3IL1B 3VFJA 3HSTA 1P99A 1FCKA 1UTBB 1QUKA 3TKDA 4MF3A 4QHQA 3QAXA 4DXBA 4IO2A 2VOZA 1EU8A 4EF2A 2Q9TA 5I84A 1QW0A 3RY3A 2GFEA 1OQGA 4BLAA 1MY4A 4H67A 4KPTA 2XXRA 4RK9A 2OZZA 4RY1A 1I6BA 4WKMA 5I58A 3TCHA 1SD3A 3CSGA 3MP1A 3KFMA 4THIA 3TMGA 2Z23A 3G7WA 3MAMA 3CI8A 5DTBA 4Q30B 2QS4A 4NF4A 5CI5A 4O3AA 2ZNTA 3TPAA 3LSXA 3SDFA 2HAUA 2XD3A 3K6VA 4G68C 3H03A 4FE8A 3BFUA 3PMXA 3V83A 3IB1A 3HO7A 3O29A 5HPQA 5BWJA 3MUQA 2I0CA 2XXTA 1IXGA 1LLSA 4F1UA 3LBSA 2ZYNA 5F7VA 3RT6B 4ONYA 3HPIA 4ZECA 3FATA 4IO3A 3KJ7A 4OQOA 3R6UA 2O51A 3T9HB 1MXWA 4G68A 2R9JA 4F29A 1B3LA 2DXRA 2F6PA 2F6GA 3SEWA 1USYH 2Y7KA 2QPQA 3FJ7A 1L5TA 3B6TA 3LC8A 3SESA 4R6HA 2OCUA 4PE5B 2P2AA 2ZNSA 3RNNA 4ELRA 3QUFA 1VFEA 4ND9A 4U21A 5TPAA 2ZNUA 2PT1A 3PUWE 1XHYA 4KFQA 4C0RA 4IO5A 4DLDA 3N6UA 5H8HB 3RLFE 2DWAA 4U4SA 5B7DA 1AMFA 2F36A 5AA2B 2YLNA 4ESXA 4YU0A 4F39A 2HFBA 4GLIA 5HBCA 2F5XA 3K1PA 1IXCA 4R74A 4OEUA 1QKBA 1IQ7A 2RKMA 2GHBA 3EF7A 1RKMA 4QRZA 1H3DA 1FTKA 1A99A 1II5A 1MDP1 2CZLA 2RC8A 5TP9B 1JEUA 1MH3A 2B3FA 2NOOA 2UVHA 1SW5A 1TXFA 1NL5A 2VP1A 5I59B 2NXOA 2Y7PA 1S50A 3IO4A 4H0WA 2V3UA 3N6TA 1B4ZA 4FJPA 2GRVA 4Z0IA 3Q28A 3M3KA 4IB2A 2ZXTA 4DCXA 2OBGA 2XXIA 3H06B 2HEUA 1AIVA 1A55A 1POTA 1QULA 4PQJA 1FQBA 5L9OA 1PC3A 1D3KA 3I3VA 1DPPA 1N04A 4YB7A 3OO8A 4KHZE 2I6EA 3HHFA 2A5TA 5EHSA 5B70A 2OWTA 1QJMA 2HZKA 1EZPA 1VR5A 4LP2B 4JWXA 1UIVA 4G2ZA 1SBPA 2ZYMA 3MJNA 4OMBA 2XX8A 4NF8B 3FGSA 1IEJA 3G3KA 4MFIA 1OLCA 3GLBA 2H99A 4QSDA 3TZAA 2F7CA 3P7IA 4U2RA 1N3WA 5CBSA 1B3GA 3FASA 2PBWA 4DE8A 2PVUA 1MH4A 4HCYA 1N7XA 1FQDA 4ZEFA 4YAHX 4QSCA 1OVTA 3LR1A 4IO7A 3U94A 1JEVA 2V3QA 1FQEA 4IGRA 1VE4A 3MC2A 2KLFA 4I1DA 4O3BA 4KYEA 3VLVA 2XXYA 1OIBA 3MP6A 1JW5A 3UIFA 1SW2A 4N6PA 3G3HA 2RC9A 4LONB 3FJMA 4NF6A 3UK4A 3E3KA 4GQOA 3U8QA 5I2KB 1Y3QA 5EHMA 1H76A 4X1BA 4OHNA 3OD7A 4LA9A 5H8QB 4RJZA 1NH8A 3MZ1A 4R2FA 1I69A 1LAFE 1NNFA 1R6ZA 3MW0A 3MVXA 2NUVA 2F7AA 5H8NB 1URGA 1MXYA 2F78A 1FTMA 2QSXA 5I56B 2LAOA 4BDRA 4H65A 4QFKA 3C36A 1LBBA 4GVOA 3UP9A 1URDA 1D9VA 1NMUA 1OLAA 3T9VA 3DP4A 5I57A 4DCYA 1CB6A 1A40A 5AA4A 1MQDA 4GRKA 3PPQA 3K01A 2Z22A 1ZBMA 1IXIA 4DXUA 2DXYA 4YKKA 1JVYA 3HHGA 2DYXA 3PMVA 1TFDA 5DVJA 3VE1B 1URSA 3KN8A 2G93A 4LZ8A 3GBAA 2AL4A 4YMBA 1F9BA 2PMSA 3HN0A 1B1HA 2THIA 2VD2A 3TTKA 3V5AA 1ANFA 3H7MA 1ZMGA 4GXAA 4F2QA 3RTFB 2Y84A 5I58B 3I5OA 3IX1A 3TYHA 4ZE9A 3H4ZA 5LOMA 3T93B 1EZ9A 4POWA 1LFIA 3V8XB 5H8SA 5KCJA 4NF4B 4YMAA 3Q29A 1LFHA 3VLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CMO A;  4HTG A;  4PFU A;  4XIG Q;  2ONS A;  4LUB A;  3TTL A;  4EXL A;  1XT8 A;  4KD5 A;  4C1T A;  2ANJ A;  3M3L A;  3TUS A;  4R9G A;  1H45 A;  3K02 A;  1DTZ A;  4ZZE A;  1YCJ A;  2BJJ X;  4OVJ A;  1R9L A;  4U22 A;  4KR5 A;  1B0L A;  3ZKK A;  3UOR A;  3I6V A;  2DS9 A;  1HSJ A;  4U4X A;  4C1U A;  3OO7 A;  1Q1K A;  4MH5 A;  5ELV A;  3SET A;  4ZEB A;  1ZIU A;  3OSR A;  1ATG A;  2D3I A;  3SEU A;  4G68 B;  1HSL A;  3KEI A;  3PPO A;  3ZKL A;  2OWS A;  4OEV A;  1MY3 A;  2RCA A;  2E1S A;  1Y3N A;  1NNP A;  4H8J A;  3PUV E;  1R9Q A;  4KI0 E;  3TCG A;  4Q8R A;  2QS2 A;  2PYY A;  3R7X A;  1CE2 A;  1MXX A;  3N5L A;  3PPP A;  2XXP A;  2AIX A;  3MVW A;  5KDT A;  3QUJ A;  4FIM A;  5TPA B;  4RXL A;  5IAI A;  3TOD A;  4H8I A;  1EH3 A;  3Q25 A;  1B51 A;  1MPD A;  1R1N A;  3SEY A;  1MM6 A;  3G3I A;  2RF1 A;  2RCB A;  4QFP A;  4KQP A;  4OXV A;  4GD5 A;  3C9H A;  2HZL A;  2DWH A;  2XX7 A;  4IO6 A;  1JVX A;  3BBR A;  3UN6 A;  3O6I A;  1VSO A;  5CMC A;  1B0H A;  5JTY A;  4R73 A;  2UYF A;  3IOU A;  3FXU A;  3FVN A;  2I0B A;  4WED A;  3OSQ A;  4JSD A;  3GBB A;  1PDA A;  1QUJ A;  4PFW A;  2REJ A;  4OFJ A;  5AE4 A;  3KG2 A;  4ECF A;  1BTJ A;  4GL0 A;  2ONR A;  2ONK E;  3O28 A;  3SEX A;  4GWO A;  1T0K A;  2YJP A;  4RPN A;  3DEL B;  1NH7 A;  3IR1 A;  1FQA A;  5H8F A;  3T9U A;  4X48 A;  4NF5 A;  5DEX A;  2HXW A;  3IB2 A;  3K6W A;  3U1O A;  1GGG A;  1B2H A;  4L17 A;  1MY0 A;  4YIC A;  3H6U A;  1SYI A;  2AL5 A;  1M5D A;  2I49 A;  3VV5 A;  1UTH A;  3JZJ A;  3TDJ A;  4OZ9 A;  4M1V A;  5IKB A;  3K1M A;  3PPR A;  4FOR A;  4GFR A;  3RPW A;  2FA7 A;  3G3J A;  5CMK A;  2ESN A;  3B6W A;  3TTR A;  1JW1 A;  3PD9 A;  2XX9 A;  2W7Y A;  3FZV A;  2A5T B;  1ZJL A;  4H1X A;  5L9S A;  5HM4 B;  2HQ0 A;  2V93 A;  1SVX B;  2XD2 A;  3FUZ A;  1PB7 A;  1Y9U A;  1Y20 A;  1N3X A;  2XXW A;  3JYR A;  4TLM B;  2Y7R A;  1B3H A;  1Y4C A;  3SKP A;  2ABH A;  1B52 A;  3H6W A;  1EZO A;  2Y7W A;  4BDN A;  3V89 B;  4ELO A;  5DYH A;  4AQ4 A;  1BKA A;  3B6Q A;  3MZB A;  3QK6 A;  4YB6 A;  1Y4T A;  4MLQ A;  3PV0 E;  4E0W A;  1SQY A;  3RGY A;  4Q0C A;  1PBP A;  3IO6 A;  3BKI B;  5JK4 A;  3A09 A;  3EHS A;  1B40 A;  4P11 A;  4P0I A;  4F2O A;  1MQH A;  4GXS B;  1MM7 A;  4F3B A;  3THI A;  2I58 A;  3MBP A;  4U1O A;  3S9L C;  3PUX E;  2DVC A;  4FED A;  4QFL A;  1B7U A;  3PPN A;  1NNK A;  2XXQ A;  3QYT A;  1Y1Z A;  3E13 X;  2VHA A;  2XXH A;  2I3W A;  3MP8 A;  1A7L A;  3K4U A;  1B3F A;  2H5Y A;  1A8F A;  3FD3 A;  1LB9 A;  1US5 A;  4R72 A;  1QUI A;  5DVI A;  4KCD A;  3K6U A;  3KSX A;  1MG1 A;  1JQF A;  1MRP A;  1KWH A;  5FTH A;  2OK2 A;  4X9T A;  1USY E;  1NFT A;  1FW0 A;  4EDP A;  2HCA A;  1PB9 A;  1MS7 A;  3HCQ A;  2QS3 A;  3KJT A;  3Q26 A;  5AA3 A;  1I6A A;  1LAH E;  1FTL A;  4JWY A;  4Z7E A;  3EHT A;  3MQ9 A;  3O66 A;  3BFT A;  2PT2 A;  3KOT A;  3L6G A;  1PBQ A;  4QF9 A;  4OWD A;  2FNC A;  3U93 A;  4NWD A;  2UVG A;  5I57 B;  4NMY A;  3ECR A;  1ZLQ A;  3CFL A;  5FHN A;  4OES A;  3USD A;  2O68 A;  4YKP A;  1D4N A;  5AA4 B;  2H25 A;  3O6H A;  3VLU A;  1UIU A;  1N7W A;  3WAF A;  4BDO A;  3VXB A;  3CG1 A;  3N26 A;  4MLV A;  1J1N A;  2Y7I A;  5K2Y A;  4I9D A;  3D4C A;  2NVU B;  1LAX A;  3OEN A;  2DQV A;  3CG3 A;  1OVB A;  4BDL A;  1DOT A;  1GTK A;  3PUZ E;  2DSF A;  4ELQ A;  1US4 A;  2YPN A;  1ZU0 A;  4IGT A;  1YPN A;  2D21 A;  4FAT A;  1O64 A;  1DPE A;  4EQ7 A;  5JEI A;  3W9V A;  1NNT A;  1QVS A;  3TAJ A;  5ISU A;  3CIJ A;  4G8H A;  3CFX A;  1MXZ A;  1S9T A;  3TFL A;  1YTV A;  4K3F A;  5A5X A;  3IJO B;  5KCJ B;  4BDQ A;  1B9J A;  1BP5 A;  4KCC A;  1Z7M E;  4XXU A;  4PP0 A;  1SDX A;  4RPO A;  4WEP A;  3IB0 A;  5CM6 A;  4G8M A;  4JWO A;  1H43 A;  4HS7 A;  3K00 A;  1B7H A;  4R75 A;  2QS1 A;  1N76 A;  3RTW B;  3K2D A;  3OMB A;  2F34 A;  4ZS9 A;  4XKN A;  3LSW A;  4R6K A;  4ZDM A;  1B5H A;  1SI0 A;  2NWJ A;  3H3G A;  4EXK A;  4QSE A;  5I2N A;  5DT6 A;  1TWY A;  1JW4 A;  3C34 A;  1POY 1;  3ZSF A;  4U23 A;  5ICT A;  1A54 A;  3QXM A;  4AB6 A;  1BLF A;  5FTI A;  1P1Q A;  1GV8 A;  2AYS A;  1N0T A;  4WXJ A;  1FQF A;  1GVC A;  1GR2 A;  3C31 A;  3M3F A;  1MXU A;  2M8C A;  4NTL A;  5FHO A;  2DP8 A;  2DOJ A;  2G29 A;  4OTE A;  1AOV A;  1SI1 A;  3TTN A;  3TEL A;  1Z7N E;  3OXN A;  4H6D A;  2XXX A;  2REG A;  3Q27 A;  3IOT A;  5KDT B;  4F3G A;  3TEP A;  4JBZ A;  4F18 A;  2O6A A;  2E0S A;  3ILT B;  3MVY A;  4N13 A;  2ZMB A;  1IXH A;  2OJT A;  2Z8E A;  1O7T A;  3H6V A;  1B5J A;  1LCT A;  2B65 A;  4EQB A;  4FEC A;  4POX A;  5L8D A;  3EN3 A;  3S2V A;  2ZYK A;  3O9P A;  1LFG A;  4F3P A;  5DVF A;  3PGF A;  2ZYO A;  4LQ2 A;  2P0S A;  1VFD A;  4GOT A;  4DIG A;  3S9N C;  2QMX A;  2I3V A;  1ELJ A;  5JTY B;  4JSO A;  2V84 A;  2QRY A;  3O6G A;  5CBR A;  3TCF A;  4PFY A;  3FVG A;  5TU0 A;  2QMW A;  3OEM A;  1NKX A;  1LBC A;  3W9W A;  4P0G A;  3RUM A;  1MY2 A;  4PET A;  4HW8 A;  3G3G A;  1XS5 A;  1IIT A;  5H8F B;  1QKA A;  1FTJ A;  4NF5 B;  4U1Z A;  5DEX B;  1A8E A;  3S4U A;  3TTM A;  4F22 A;  4F3S A;  1P1O A;  3KOS A;  1UTB A;  2XHD A;  3ONM A;  3GZG A;  3O2A A;  4H5G A;  2H4I A;  1AL3 A;  2Q2A A;  1UTH B;  2IA4 A;  1MY1 A;  3EQ1 A;  4TOZ A;  1JNF A;  3TQW A;  5CC2 A;  2XXU A;  3WAE A;  3VVE A;  3EHU A;  2RC7 A;  2IEE A;  3DM0 A;  3CFZ A;  4JXI A;  3T9X B;  4R2B A;  1M5F A;  3M8U A;  1I6Q A;  3QIM A;  1MQG A;  4GL8 A;  1XOC A;  3ODB A;  3OOA A;  2GH9 A;  4ZED A;  1B3E A;  3DLN A;  5EYF A;  1MQJ A;  1B58 A;  1LGB C;  2O69 A;  2Q2C A;  5CMM A;  2X7Q A;  4DDD A;  1SW1 A;  2O84 X;  1M5C A;  3LSL A;  3RT8 A;  2GHA A;  2O7U A;  2DWJ A;  4NE4 A;  1MQI A;  2DE3 A;  4G77 A;  4RK2 A;  3MPK A;  2B3B A;  3FXR A;  4KYD A;  1RYO A;  2I4C A;  3T96 B;  3KZG A;  4ESW A;  2WKY A;  3MZ9 A;  4JB7 A;  4MBP A;  4N07 A;  2VD3 A;  2QL3 A;  2UXA A;  4ISU A;  4R6Y A;  1DTG A;  3IOV A;  2O1L A;  2H98 A;  3U72 A;  3VVF A;  2OLB A;  4UA8 A;  4R9F A;  3T66 A;  1WDN A;  4OFL A;  1PEB A;  3G3F A;  4OFO A;  4BDM A;  4ELP A;  3RQT A;  5AA2 D;  3FV1 A;  4DXC A;  1DMB A;  3T22 A;  3MWB A;  1FTO A;  3N94 A;  3ILU B;  5K2X A;  3O97 A;  3PD8 A;  1LB8 A;  3IK6 B;  3KSJ A;  4XKP A;  4G4P A;  2R71 A;  4IO4 A;  1PB8 A;  4OER A;  1ZTY A;  4G8N A;  3FVO A;  1B32 A;  2R6G E;  1S7Y A;  1P1W A;  3HV1 A;  2F7B A;  2F97 A;  1UQW A;  2XXV A;  2UVI A;  5H8H A;  1H44 A;  4I62 A;  4ZEK A;  1SW4 A;  3S9E A;  5AA2 A;  4YKJ A;  4IY6 A;  4RA1 A;  1B46 A;  4F1Y A;  1B4H A;  1TT1 A;  1B6H A;  4LVQ A;  4EF1 A;  1YAE A;  4QFO A;  5KZT A;  1XVY A;  5J1D A;  3H6T A;  1LCF A;  1MXV A;  2RIN A;  4GF8 A;  2FYI A;  3CSB A;  1OQH A;  4NF6 B;  1Y1M A;  4LQ5 A;  4NWC A;  3FJG A;  1B5I A;  1B7Z A;  4M4G A;  3C32 A;  1Y3P A;  4F1V A;  5TP9 A;  4UAC A;  3E9X A;  2O7I A;  5BUU A;  1MPC A;  2DE2 A;  1BIY A;  1IUD A;  4FAJ A;  1Q35 A;  5FHM A;  5I59 A;  4RYA A;  1P1N A;  4EUO A;  4EQ9 A;  4HCW A;  5AA1 A;  3IOR A;  4PFT A;  2Q8J A;  3VVD A;  1M5B A;  2X7P A;  1FQC A;  2P1S A;  2I48 A;  3ZS6 A;  3OO9 A;  4YKI A;  2H9B A;  3PUY E;  2HAV A;  5A5X B;  3SEV A;  2ALU A;  3JV9 A;  1LAG E;  4YZZ A;  4FEB A;  3C35 A;  3OEK A;  4E0X A;  3FVK A;  1N84 A;  4O3C A;  4F19 A;  1HSE A;  1D9Y A;  3F11 A;  1RYX A;  5ICQ A;  2DWI A;  3K0V A;  5L9M A;  4XKR A;  3QSL A;  3CVG A;  4NED A;  2V25 A;  2O1M A;  5I2N B;  3LUY A;  3L6H A;  3IAZ A;  3K1N A;  1XC1 A;  4NF8 A;  3W15 C;  5CMB A;  1M5E A;  3MPL A;  4JDF A;  3C4M A;  3AXF A;  4F31 B;  4DZ1 A;  4LZ5 A;  3UA8 A;  2A5S A;  1MPB A;  3OO6 A;  4TLL B;  3OEL A;  1WOD A;  2PX1 A;  3C33 A;  4ZZA A;  2VGQ A;  4OET A;  4GIZ A;  3FXQ A;  2F35 A;  4X1D A;  3GXA A;  5M2V A;  1P1U A;  4OYV A;  1DSN A;  5CRY A;  3UGW A;  3EPE A;  2D5W A;  3KN7 A;  3VDF A;  4I8C A;  4LAT A;  4ZE8 A;  4Q5T A;  3TQL A;  1B05 A;  2DVZ A;  4H5F A;  4IY5 A;  3SER A;  4YB5 A;  5ITP A;  1IZ1 A;  3CR9 A;  3U92 A;  2UVJ A;  3R26 A;  1WVJ A;  1MDQ A;  2X26 A;  2UYE A;  3DP6 A;  4XKQ A;  1O63 A;  3DP8 A;  1OMP A;  3FV2 A;  4LZ7 A;  1IIW A;  5I2K A;  3S9M C;  2Z8D A;  3E4R A;  4TQU Q;  2QJE A;  3IOW A;  5H8Q A;  3KBR A;  4QFN A;  1XVX A;  5F1Q A;  4ZEI A;  3IJX B;  3A3C A;  3B7D A;  3RN8 A;  3PMW A;  1SYH A;  5H8N A;  2I4B A;  3VXC A;  2Z8F A;  4XTC Q;  1LST A;  3MVZ A;  1AH5 A;  5I56 A;  2V3T A;  3CRB A;  3D4G A;  4AB5 A;  2F8D A;  3LSF B;  3K6X A;  4KYS A;  4RNS A;  3PU5 A;  3A3U A;  3KN3 A;  1B1X A;  2Q89 A;  2Q88 A;  3KGC A;  4OEN A;  1ZKB A;  1JET A;  3FIR A;  2DE4 A;  1TFA A;  5ITO A;  3IL1 B;  3VFJ A;  3HST A;  1P99 A;  1FCK A;  1UTB B;  1QUK A;  3TKD A;  4MF3 A;  4QHQ A;  3QAX A;  4DXB A;  4IO2 A;  2VOZ A;  1EU8 A;  4EF2 A;  2Q9T A;  5I84 A;  1QW0 A;  3RY3 A;  2GFE A;  1OQG A;  4BLA A;  1MY4 A;  4H67 A;  4KPT A;  2XXR A;  4RK9 A;  2OZZ A;  4RY1 A;  1I6B A;  4WKM A;  5I58 A;  3TCH A;  1SD3 A;  3CSG A;  3MP1 A;  3KFM A;  4THI A;  3TMG A;  2Z23 A;  3G7W A;  3MAM A;  3CI8 A;  5DTB A;  4Q30 B;  2QS4 A;  4NF4 A;  5CI5 A;  4O3A A;  2ZNT A;  3TPA A;  3LSX A;  3SDF A;  2HAU A;  2XD3 A;  3K6V A;  4G68 C;  3H03 A;  4FE8 A;  3BFU A;  3PMX A;  3V83 A;  3IB1 A;  3HO7 A;  3O29 A;  5HPQ A;  5BWJ A;  3MUQ A;  2I0C A;  2XXT A;  1IXG A;  1LLS A;  4F1U A;  3LBS A;  2ZYN A;  5F7V A;  3RT6 B;  4ONY A;  3HPI A;  4ZEC A;  3FAT A;  4IO3 A;  3KJ7 A;  4OQO A;  3R6U A;  2O51 A;  3T9H B;  1MXW A;  4G68 A;  2R9J A;  4F29 A;  1B3L A;  2DXR A;  2F6P A;  2F6G A;  3SEW A;  1USY H;  2Y7K A;  2QPQ A;  3FJ7 A;  1L5T A;  3B6T A;  3LC8 A;  3SES A;  4R6H A;  2OCU A;  4PE5 B;  2P2A A;  2ZNS A;  3RNN A;  4ELR A;  3QUF A;  1VFE A;  4ND9 A;  4U21 A;  5TPA A;  2ZNU A;  2PT1 A;  3PUW E;  1XHY A;  4KFQ A;  4C0R A;  4IO5 A;  4DLD A;  3N6U A;  5H8H B;  3RLF E;  2DWA A;  4U4S A;  5B7D A;  1AMF A;  2F36 A;  5AA2 B;  2YLN A;  4ESX A;  4YU0 A;  4F39 A;  2HFB A;  4GLI A;  5HBC A;  2F5X A;  3K1P A;  1IXC A;  4R74 A;  4OEU A;  1QKB A;  1IQ7 A;  2RKM A;  2GHB A;  3EF7 A;  1RKM A;  4QRZ A;  1H3D A;  1FTK A;  1A99 A;  1II5 A;  1MDP 1;  2CZL A;  2RC8 A;  5TP9 B;  1JEU A;  1MH3 A;  2B3F A;  2NOO A;  2UVH A;  1SW5 A;  1TXF A;  1NL5 A;  2VP1 A;  5I59 B;  2NXO A;  2Y7P A;  1S50 A;  3IO4 A;  4H0W A;  2V3U A;  3N6T A;  1B4Z A;  4FJP A;  2GRV A;  4Z0I A;  3Q28 A;  3M3K A;  4IB2 A;  2ZXT A;  4DCX A;  2OBG A;  2XXI A;  3H06 B;  2HEU A;  1AIV A;  1A55 A;  1POT A;  1QUL A;  4PQJ A;  1FQB A;  5L9O A;  1PC3 A;  1D3K A;  3I3V A;  1DPP A;  1N04 A;  4YB7 A;  3OO8 A;  4KHZ E;  2I6E A;  3HHF A;  2A5T A;  5EHS A;  5B70 A;  2OWT A;  1QJM A;  2HZK A;  1EZP A;  1VR5 A;  4LP2 B;  4JWX A;  1UIV A;  4G2Z A;  1SBP A;  2ZYM A;  3MJN A;  4OMB A;  2XX8 A;  4NF8 B;  3FGS A;  1IEJ A;  3G3K A;  4MFI A;  1OLC A;  3GLB A;  2H99 A;  4QSD A;  3TZA A;  2F7C A;  3P7I A;  4U2R A;  1N3W A;  5CBS A;  1B3G A;  3FAS A;  2PBW A;  4DE8 A;  2PVU A;  1MH4 A;  4HCY A;  1N7X A;  1FQD A;  4ZEF A;  4YAH X;  4QSC A;  1OVT A;  3LR1 A;  4IO7 A;  3U94 A;  1JEV A;  2V3Q A;  1FQE A;  4IGR A;  1VE4 A;  3MC2 A;  2KLF A;  4I1D A;  4O3B A;  4KYE A;  3VLV A;  2XXY A;  1OIB A;  3MP6 A;  1JW5 A;  3UIF A;  1SW2 A;  4N6P A;  3G3H A;  2RC9 A;  4LON B;  3FJM A;  4NF6 A;  3UK4 A;  3E3K A;  4GQO A;  3U8Q A;  5I2K B;  1Y3Q A;  5EHM A;  1H76 A;  4X1B A;  4OHN A;  3OD7 A;  4LA9 A;  5H8Q B;  4RJZ A;  1NH8 A;  3MZ1 A;  4R2F A;  1I69 A;  1LAF E;  1NNF A;  1R6Z A;  3MW0 A;  3MVX A;  2NUV A;  2F7A A;  5H8N B;  1URG A;  1MXY A;  2F78 A;  1FTM A;  2QSX A;  5I56 B;  2LAO A;  4BDR A;  4H65 A;  4QFK A;  3C36 A;  1LBB A;  4GVO A;  3UP9 A;  1URD A;  1D9V A;  1NMU A;  1OLA A;  3T9V A;  3DP4 A;  5I57 A;  4DCY A;  1CB6 A;  1A40 A;  5AA4 A;  1MQD A;  4GRK A;  3PPQ A;  3K01 A;  2Z22 A;  1ZBM A;  1IXI A;  4DXU A;  2DXY A;  4YKK A;  1JVY A;  3HHG A;  2DYX A;  3PMV A;  1TFD A;  5DVJ A;  3VE1 B;  1URS A;  3KN8 A;  2G93 A;  4LZ8 A;  3GBA A;  2AL4 A;  4YMB A;  1F9B A;  2PMS A;  3HN0 A;  1B1H A;  2THI A;  2VD2 A;  3TTK A;  3V5A A;  1ANF A;  3H7M A;  1ZMG A;  4GXA A;  4F2Q A;  3RTF B;  2Y84 A;  5I58 B;  3I5O A;  3IX1 A;  3TYH A;  4ZE9 A;  3H4Z A;  5LOM A;  3T93 B;  1EZ9 A;  4POW A;  1LFI A;  3V8X B;  5H8S A;  5KCJ A;  4NF4 B;  4YMA A;  3Q29 A;  1LFH A;  3VLW A; 
#chains in the Genus database with same CATH topology
 2CMO A;  4HTG A;  4PFU A;  4XIG Q;  2ONS A;  4LUB A;  3TTL A;  4EXL A;  2P3N A;  1XT8 A;  4KD5 A;  4C1T A;  2ANJ A;  3M3L A;  3TUS A;  4R9G A;  1H45 A;  3K02 A;  1DTZ A;  4ZZE A;  1YCJ A;  2BJJ X;  1FPD A;  4OVJ A;  1R9L A;  4U22 A;  4KR5 A;  1B0L A;  3ZKK A;  3UOR A;  4GWX A;  2WBB A;  4JVI A;  2XWI A;  3I6V A;  3LV0 A;  2DS9 A;  1HSJ A;  4U4X A;  4N6D A;  4C1U A;  3OO7 A;  1Q1K A;  4MH5 A;  5ELV A;  3SET A;  4ZEB A;  1ZIU A;  3OSR A;  4PGN A;  4OAN A;  4JVC A;  1ATG A;  2D3I A;  3SEU A;  1QGX A;  4G68 B;  1HSL A;  5I5P A;  2XA5 A;  3KEI A;  3PPO A;  3ZKL A;  5ET8 A;  2OWS A;  4OEV A;  1MY3 A;  2RCA A;  1FBC A;  3B8B A;  2E1S A;  1Y3N A;  3E78 A;  1NNP A;  2XWO A;  1NUY A;  2XWK A;  4H8J A;  3PUV E;  4PF6 A;  1R9Q A;  4KI0 E;  3TCG A;  4Q8R A;  2FHY A;  2QS2 A;  2PYY A;  3R7X A;  1CE2 A;  1MXX A;  3N5L A;  3PPP A;  2XXP A;  2AIX A;  2R8T A;  3MVW A;  5KDT A;  3QUJ A;  4FIM A;  5TPA B;  4RXL A;  5IAI A;  3TOD A;  4H8I A;  1EH3 A;  3Q25 A;  4NG7 A;  1B51 A;  1MPD A;  1R1N A;  3SEY A;  1MM6 A;  1FPE A;  2RF1 A;  3G3I A;  2RCB A;  3U65 A;  4QFP A;  5ET7 A;  4X04 A;  2FIE A;  4KQP A;  4OXV A;  4GD5 A;  3C9H A;  2HZL A;  2DWH A;  2XX7 A;  4IO6 A;  1JVX A;  3BBR A;  3UN6 A;  3O6I A;  1VSO A;  5CMC A;  3RPL B;  1B0H A;  4XEQ A;  5JTY A;  4MEV A;  1NUX A;  4R73 A;  2UYF A;  3IOU A;  3FXU A;  3FVN A;  2I0B A;  4WED A;  4P1L A;  3OSQ A;  4JSD A;  3GBB A;  1PDA A;  1QUJ A;  4PFW A;  2REJ A;  1FPI A;  4NN3 A;  4OFJ A;  5AE4 A;  3KG2 A;  4ECF A;  1BTJ A;  3EKI A;  4GL0 A;  2ONR A;  2ONK E;  3O28 A;  3SEX A;  4GWO A;  1T0K A;  2YJP A;  4RPN A;  4PC9 A;  1FBD A;  3DEL B;  1NH7 A;  3IR1 A;  1FQA A;  5H8F A;  3T9U A;  4X48 A;  4NF5 A;  5DEX A;  2HXW A;  4MNI A;  5FBP A;  3IB2 A;  3K6W A;  3U1O A;  1GGG A;  1B2H A;  4L17 A;  1MY0 A;  4YIC A;  3H6U A;  1SYI A;  2AL5 A;  4NGU A;  1M5D A;  2I49 A;  3VV5 A;  1UTH A;  3JZJ A;  3TDJ A;  4OZ9 A;  4M1V A;  5IKB A;  2PCR A;  3K1M A;  3PPR A;  4FOR A;  4GFR A;  3RPW A;  4DI4 B;  2FA7 A;  3G3J A;  5CMK A;  4N81 A;  2ESN A;  2XXK A;  3B6W A;  3TTR A;  4P9K A;  1JW1 A;  3PD9 A;  2XX9 A;  2W7Y A;  3FZV A;  2A5T B;  1ZJL A;  4H1X A;  5L9S A;  5HM4 B;  2HQ0 A;  4MIJ A;  2V93 A;  1SVX B;  2XD2 A;  3FUZ A;  1PB7 A;  2ZZW A;  4MJO A;  1Y9U A;  1Y20 A;  1EYK A;  1N3X A;  2XXW A;  3JYR A;  3IFC A;  4TLM B;  2Y7R A;  1B3H A;  1Y4C A;  3SKP A;  1INP A;  4PF8 A;  2ABH A;  1B52 A;  3H6W A;  1EZO A;  2Y7W A;  4BDN A;  3V89 B;  4ELO A;  5DYH A;  2WEF A;  3IFA A;  4AQ4 A;  1BKA A;  3B6Q A;  3MZB A;  3QK6 A;  4YB6 A;  1Y4T A;  4MLQ A;  3PV0 E;  4E0W A;  1SQY A;  3RGY A;  4Q0C A;  1PBP A;  3IO6 A;  3BKI B;  5JK4 A;  1DCU A;  3A09 A;  3EHS A;  4MNC A;  1B40 A;  4P11 A;  4P0I A;  4F2O A;  1MQH A;  3NOH A;  4GXS B;  1MM7 A;  4F3B A;  3THI A;  2I58 A;  1AWB A;  3MBP A;  4U1O A;  4XFE A;  3S9L C;  3PUX E;  2DVC A;  4FED A;  4QFL A;  1B7U A;  3PPN A;  1NNK A;  2XXQ A;  3QYT A;  1Y1Z A;  3E13 X;  2VHA A;  2XXH A;  2I3W A;  3MP8 A;  1A7L A;  3K4U A;  1B3F A;  2H5Y A;  1A8F A;  1IMC A;  1LB9 A;  3FD3 A;  1US5 A;  4R72 A;  1QUI A;  5DVI A;  4KCD A;  2B4L A;  3K6U A;  3KSX A;  1MG1 A;  2GQ1 A;  1JQF A;  4X8R A;  1FJ6 A;  5LTC A;  1MRP A;  1KWH A;  5FTH A;  2OK2 A;  4X9T A;  1USY E;  1NFT A;  1FW0 A;  4EDP A;  1FBH A;  2HCA A;  1LEV A;  1PB9 A;  1MS7 A;  3HCQ A;  2QS3 A;  3KJT A;  3Q26 A;  4N6K A;  1RDY A;  5I3S A;  5AA3 A;  1I6A A;  1LAH E;  1FTL A;  4JWY A;  3EHT A;  3MQ9 A;  4Z7E A;  3O66 A;  5IM2 A;  3BFT A;  2PT2 A;  3KOT A;  3L6G A;  1PBQ A;  4QF9 A;  4MMP A;  2FNC A;  4OWD A;  1NI9 A;  3U93 A;  4NWD A;  2UVG A;  1FPB A;  5I57 B;  4NMY A;  3ECR A;  1ZLQ A;  3CFL A;  5FHN A;  4OES A;  3USD A;  2O68 A;  4HE1 A;  1D4N A;  4YKP A;  5AA4 B;  2H25 A;  3O6H A;  3VLU A;  1UIU A;  4PDH A;  1N7W A;  3WAF A;  4BDO A;  4PGP A;  3VXB A;  3CG1 A;  3N26 A;  4MLV A;  1J1N A;  5ESY A;  2Y7I A;  5K2Y A;  4I9D A;  3D4C A;  2NVU B;  1LAX A;  3OEN A;  2DQV A;  3CG3 A;  1OVB A;  1DOT A;  1GTK A;  4BDL A;  3PUZ E;  1K9Y A;  2DSF A;  4ELQ A;  1US4 A;  2YPN A;  1ZU0 A;  1YXI A;  4IGT A;  4P1E A;  1YPN A;  2D21 A;  4FAT A;  1O64 A;  1DPE A;  1NUW A;  3BIG A;  2CEX A;  4EQ7 A;  5JEI A;  1FPL A;  3W9V A;  1NNT A;  1QVS A;  2PFY A;  3TAJ A;  5EYH A;  5ISU A;  3CIJ A;  1FPG A;  4G8H A;  3CFX A;  1MXZ A;  4MNP A;  1S9T A;  4HXV A;  3TFL A;  1YTV A;  4K3F A;  5A5X A;  3IJO B;  5KCJ B;  4BDQ A;  1B9J A;  1BP5 A;  2HPG A;  4KCC A;  1Z7M E;  2F3D A;  4XXU A;  4PP0 A;  1SDX A;  4RPO A;  4WEP A;  3IB0 A;  5CM6 A;  4G8M A;  4JWO A;  1H43 A;  4HS7 A;  3K00 A;  1B7H A;  4R75 A;  2QS1 A;  1N76 A;  3RTW B;  3K2D A;  3OMB A;  4OVP A;  2F34 A;  4ZS9 A;  4XKN A;  3LSW A;  4R6K A;  4ZDM A;  1B5H A;  1SI0 A;  2NWJ A;  3H3G A;  4EXK A;  4QSE A;  5I2N A;  5DT6 A;  3GYY A;  1NV6 A;  1TWY A;  1JW4 A;  3C34 A;  1POY 1;  1FBE A;  3ZSF A;  4U23 A;  5ICT A;  1A54 A;  1JP4 A;  3QXM A;  4AB6 A;  1BLF A;  3ISP A;  5FTI A;  1P1Q A;  1GV8 A;  2AYS A;  1N0T A;  5IZ3 B;  4WXJ A;  1FQF A;  1GVC A;  1GR2 A;  3C31 A;  3M3F A;  1MXU A;  3D1R A;  4N4U A;  2M8C A;  4NTL A;  5FHO A;  2DP8 A;  2DOJ A;  2G29 A;  4OTE A;  1AOV A;  1SI1 A;  3TTN A;  3TEL A;  1Z7N E;  3OXN A;  4H6D A;  2XXX A;  2REG A;  3Q27 A;  1NV5 A;  3FXB A;  3IOT A;  5KDT B;  4F3G A;  1D9Q A;  3TEP A;  4JBZ A;  1IMF A;  4F18 A;  2O6A A;  2E0S A;  3ILT B;  3MVY A;  4N13 A;  2ZMB A;  1IXH A;  2OJT A;  2Z8E A;  1O7T A;  3H6V A;  1B5J A;  1LCT A;  2B65 A;  4EQB A;  4FEC A;  4POX A;  5L8D A;  3EN3 A;  3S2V A;  2ZYK A;  3O9P A;  1LFG A;  4F3P A;  5DVF A;  5LDZ A;  3PGF A;  2ZYO A;  4LQ2 A;  2P0S A;  1VFD A;  4GOT A;  4DIG A;  3S9N C;  2QMX A;  2I3V A;  1ELJ A;  5JTY B;  4JSO A;  2V84 A;  2FVZ A;  2QRY A;  3O6G A;  5CBR A;  4OVR A;  1YYZ A;  3TCF A;  4PFY A;  5IZ1 A;  3FVG A;  5TU0 A;  5DW8 A;  2QMW A;  3OEM A;  1NKX A;  1LBC A;  2FBP A;  4DI3 D;  3W9W A;  4P0G A;  3RUM A;  1LBY A;  1MY2 A;  4PET A;  4HW8 A;  3G3G A;  1FJ9 A;  4GWW A;  1XS5 A;  1IIT A;  5H8F B;  1QKA A;  1FTJ A;  4NF5 B;  4U1Z A;  5DEX B;  1A8E A;  3S4U A;  3TTM A;  4F22 A;  4F3S A;  1P1O A;  3KOS A;  1UTB A;  2XHD A;  3ONM A;  3GZG A;  3O2A A;  4H5G A;  2H4I A;  1AL3 A;  2Q2A A;  1UTH B;  2IA4 A;  1MY1 A;  3EQ1 A;  2HHM A;  4TOZ A;  1JNF A;  2BJI A;  3TQW A;  5CC2 A;  2XXU A;  3WAE A;  3VVE A;  3EHU A;  1EYJ A;  2RC7 A;  2IEE A;  3DM0 A;  3CFZ A;  4JXI A;  5EQA A;  3T9X B;  4GBV A;  2OWZ A;  4R2B A;  1M5F A;  3M8U A;  1I6Q A;  3QIM A;  1MQG A;  1CNQ A;  4GL8 A;  1XOC A;  3ODB A;  2FIX A;  4LN5 A;  3OOA A;  2GH9 A;  4ZED A;  1B3E A;  4GX4 A;  3DLN A;  5EYF A;  1MQJ A;  1B58 A;  1LGB C;  2O69 A;  4XF5 A;  2Q2C A;  1NV1 A;  5CMM A;  4MHF A;  2X7Q A;  4DDD A;  1SW1 A;  2O84 X;  1M5C A;  3LSL A;  3RT8 A;  1YZ0 A;  4PTK A;  2GHA A;  2O7U A;  2DWJ A;  4NE4 A;  1MQI A;  2DE3 A;  4G77 A;  4RK2 A;  3MPK A;  2OX3 A;  2B3B A;  2DDK A;  3FXR A;  4PAI A;  4KYD A;  1RYO A;  2I4C A;  3T96 B;  3BIH A;  3KZG A;  3T1B A;  2WKY A;  4ESW A;  3MZ9 A;  4JB7 A;  4MBP A;  4N07 A;  3MYU A;  2VD3 A;  2QL3 A;  4R6Y A;  2UXA A;  4ISU A;  1DTG A;  1LBV A;  3HFU A;  3IOV A;  2O1L A;  2H98 A;  3U72 A;  3VVF A;  2OLB A;  4UA8 A;  2KQZ A;  4JVD A;  1FPF A;  4R9F A;  3T66 A;  1WDN A;  4OFL A;  1PEB A;  3G3F A;  4OFO A;  5J16 A;  4BDM A;  4ELP A;  3RQT A;  5AA2 D;  3FV1 A;  3KBZ A;  5EYG A;  4DXC A;  2Y5K A;  1DMB A;  3T22 A;  3MWB A;  1FTO A;  3N94 A;  3ILU B;  5K2X A;  3O97 A;  3PD8 A;  1LB8 A;  3IK6 B;  1SPI A;  3KSJ A;  4XKP A;  4G4P A;  2R71 A;  4IO4 A;  1PB8 A;  4OER A;  1ZTY A;  4G8N A;  3FVO A;  1B32 A;  2R6G E;  1S7Y A;  4NAP A;  4PBH A;  4QBA A;  4OVT A;  1P1W A;  3HV1 A;  2F7B A;  2F97 A;  1UQW A;  1NV0 A;  2XXV A;  2UVI A;  5H8H A;  1H44 A;  4I62 A;  4ZEK A;  1SW4 A;  3S9E A;  5AA2 A;  4YKJ A;  4N91 A;  4IY6 A;  4RA1 A;  1B46 A;  4F1Y A;  1B4H A;  1TT1 A;  1B6H A;  4LVQ A;  1K9Z A;  4HE2 A;  4EF1 A;  1YAE A;  4QFO A;  5KZT A;  1XVY A;  4FBP A;  5J1D A;  3H6T A;  1LCF A;  1MXV A;  2RIN A;  4GF8 A;  2FYI A;  3CSB A;  4H46 A;  4NHB A;  1OQH A;  4NF6 B;  3B50 A;  1BK4 A;  1Y1M A;  4LQ5 A;  4NWC A;  4QXD A;  3FJG A;  1B5I A;  1B7Z A;  4M4G A;  3C32 A;  1Y3P A;  4GWS A;  4F1V A;  5TP9 A;  4UAC A;  3E9X A;  2O7I A;  5BUU A;  1MPC A;  2DE2 A;  1BIY A;  1IUD A;  4FAJ A;  1Q35 A;  5FHM A;  2L5V A;  5I59 A;  4RYA A;  1P1N A;  4EUO A;  2KR0 A;  4EQ9 A;  4HCW A;  5AA1 A;  1IMA A;  3IOR A;  4PFT A;  2Q8J A;  3VVD A;  1M5B A;  2X7P A;  1FQC A;  2P1S A;  2P3V A;  2QVV A;  2I48 A;  3ZS6 A;  3OO9 A;  4YKI A;  2H9B A;  3PUY E;  2HAV A;  5A5X B;  4NX1 A;  2ALU A;  3SEV A;  3JV9 A;  1LAG E;  4YZZ A;  4FEB A;  3C35 A;  3OEK A;  4E0X A;  3FVK A;  4O7I A;  1N84 A;  4O3C A;  4F19 A;  1HSE A;  1D9Y A;  3F11 A;  1VDW A;  1RYX A;  5ICQ A;  2DWI A;  3K0V A;  5L9M A;  4XKR A;  3QSL A;  3CVG A;  4O7M A;  4NED A;  2V25 A;  2O1M A;  4OVS A;  5I2N B;  3LUY A;  3L6H A;  3SZP A;  3IAZ A;  3K1N A;  1XC1 A;  4NF8 A;  3W15 C;  5CMB A;  1M5E A;  3MPL A;  4JDF A;  3C4M A;  3AXF A;  4F31 B;  4DZ1 A;  4LZ5 A;  3UA8 A;  2A5S A;  1MPB A;  3OO6 A;  4TLL B;  3OEL A;  1WOD A;  2PX1 A;  3C33 A;  4P47 A;  4ZZA A;  2VGQ A;  4HE0 A;  4OET A;  4GIZ A;  3FXQ A;  2F35 A;  4X1D A;  3GXA A;  5M2V A;  2PFZ A;  1P1U A;  4OYV A;  1DSN A;  5CRY A;  3UGW A;  4IR8 A;  3EPE A;  2D5W A;  3KN7 A;  3VDF A;  4I8C A;  4LAT A;  4ZE8 A;  5A5L A;  4Q5T A;  3TQL A;  1B05 A;  2DVZ A;  4AS5 A;  4H5F A;  4IY5 A;  4YB5 A;  3SER A;  2QFL A;  5ITP A;  1IZ1 A;  3CR9 A;  3U92 A;  4UAB A;  2WBD A;  2UVJ A;  4PFI A;  3R26 A;  1WVJ A;  1MDQ A;  2X26 A;  5EQ9 A;  2UYE A;  3DP6 A;  4XKQ A;  1O63 A;  3DP8 A;  1OMP A;  4NQ8 A;  3FV2 A;  4LZ7 A;  1IIW A;  2Q74 A;  5I2K A;  3S9M C;  2Z8D A;  3E4R A;  4TQU Q;  2V4C A;  2QJE A;  1G0H A;  3IOW A;  1FBF A;  5H8Q A;  3KBR A;  4QFN A;  1XVX A;  5F1Q A;  4ZEI A;  3IJX B;  3A3C A;  3B7D A;  2VPO A;  3RN8 A;  3PMW A;  1SYH A;  5H8N A;  1NV7 A;  4GWZ A;  2I4B A;  3VXC A;  2Z8F A;  4XTC Q;  1LST A;  3MVZ A;  1AH5 A;  5I56 A;  2V3T A;  3CRB A;  3D4G A;  4AB5 A;  2F8D A;  3LSF B;  3T0J A;  3K6X A;  4PFR A;  4KYS A;  4G61 A;  4RNS A;  3PU5 A;  3A3U A;  3KN3 A;  1B1X A;  2Q89 A;  2Q88 A;  2VPN A;  3KGC A;  4OEN A;  1ZKB A;  1JET A;  5I7I A;  3FIR A;  2DE4 A;  1TFA A;  5ITO A;  3IL1 B;  4MCO A;  3VFJ A;  3HST A;  1P99 A;  1FCK A;  1UTB B;  1QUK A;  1FPJ A;  3TKD A;  2WYP A;  4MF3 A;  3E79 A;  4QHQ A;  3QAX A;  4DXB A;  4I40 A;  4IO2 A;  2VOZ A;  1EU8 A;  4EF2 A;  2Q9T A;  5I84 A;  1QW0 A;  3RY3 A;  4GWU A;  2GFE A;  1OQG A;  4BLA A;  1NV2 A;  1LBX A;  1MY4 A;  4H67 A;  4KPT A;  2XXR A;  4RK9 A;  2OZZ A;  4RY1 A;  5IZ3 A;  1I6B A;  4WKM A;  5I58 A;  3TCH A;  1SD3 A;  3CSG A;  1FRP A;  4THI A;  1IMD A;  3KFM A;  3MP1 A;  3TMG A;  2Z23 A;  3G7W A;  4GBW A;  3MAM A;  3CI8 A;  5DTB A;  4Q30 B;  2QS4 A;  4NF4 A;  5CI5 A;  4O3A A;  2ZNT A;  1RDX A;  3TPA A;  3LSX A;  5IGA A;  3SDF A;  2HAU A;  1DBZ A;  2XD3 A;  2WX9 A;  3K6V A;  4G68 C;  3H03 A;  4FE8 A;  3BFU A;  3PMX A;  3V83 A;  2CZK A;  3IB1 A;  3HO7 A;  3O29 A;  1FSA A;  5HPQ A;  1KA1 A;  3MUQ A;  5BWJ A;  2I0C A;  2XXT A;  1IXG A;  1LLS A;  4F1U A;  3LBS A;  2ZYN A;  5F7V A;  3RT6 B;  4ONY A;  3HPI A;  5T3J A;  1FBP A;  4ZEC A;  3FAT A;  4IO3 A;  1IMB A;  3KJ7 A;  4PE3 A;  4OQO A;  2XWV A;  3R6U A;  2O51 A;  3T9H B;  1MXW A;  4G68 A;  2R9J A;  4F29 A;  1B3L A;  2DXR A;  5EQ7 A;  2F6P A;  4OA4 A;  2F6G A;  3SEW A;  1USY H;  2Y7K A;  5ET5 A;  2QPQ A;  3FJ7 A;  1L5T A;  3B6T A;  3LC8 A;  3LUZ A;  2Y5L A;  3SES A;  4R6H A;  2OCU A;  4O8M A;  4I3Y A;  4PE5 B;  2P2A A;  2ZNS A;  3RNN A;  4N17 A;  4ELR A;  3QUF A;  1VFE A;  1NV3 A;  4ND9 A;  4U21 A;  5TPA A;  2ZNU A;  2PT1 A;  3PUW E;  1XHY A;  4KFQ A;  2MKZ A;  4C0R A;  4IO5 A;  4DLD A;  3N6U A;  3A29 A;  5H8H B;  3RLF E;  2DWA A;  4U4S A;  1DK4 A;  5B7D A;  1AMF A;  2F36 A;  5AA2 B;  2YLN A;  2CZI A;  4ESX A;  4YU0 A;  4F39 A;  4N15 A;  2HFB A;  4H45 A;  4GLI A;  5HBC A;  2F5X A;  3K1P A;  1IXC A;  4R74 A;  4OEU A;  1QKB A;  5ET6 A;  3RPL A;  1IQ7 A;  2RKM A;  2GHB A;  4GWY A;  4PDD A;  3EF7 A;  1RKM A;  3CHG A;  4QRZ A;  4N8Y A;  1H3D A;  4PCD A;  1FTK A;  1A99 A;  1II5 A;  1MDP 1;  2CZL A;  2RC8 A;  5TP9 B;  1JEU A;  1MH3 A;  1NV4 A;  2B3F A;  2NOO A;  2UVH A;  1SW5 A;  1TXF A;  1NL5 A;  2VP1 A;  5I59 B;  2NXO A;  1Q9D A;  2Y7P A;  2HXR A;  1S50 A;  4GX6 A;  3IO4 A;  4H0W A;  2V3U A;  4AS4 A;  3N6T A;  1B4Z A;  1EYI A;  4FJP A;  2Q8M A;  2GRV A;  4Z0I A;  3Q28 A;  3M3K A;  4IB2 A;  2ZXT A;  4DCX A;  2OBG A;  4MAG A;  2XXI A;  3H06 B;  2HEU A;  1AIV A;  1A55 A;  1POT A;  1QUL A;  3FBP A;  4PQJ A;  1FQB A;  5L9O A;  1PC3 A;  1D3K A;  3I3V A;  4N8G A;  1DPP A;  1N04 A;  4YB7 A;  3OO8 A;  4KHZ E;  2I6E A;  3HHF A;  2A5T A;  5EHS A;  5B70 A;  2OWT A;  1QJM A;  3KC1 A;  2HZK A;  5F24 A;  2F3B A;  1EZP A;  1VR5 A;  4OVQ A;  4NF0 A;  4LP2 B;  4JWX A;  1UIV A;  4G2Z A;  3RYD A;  1SBP A;  2ZYM A;  4OMB A;  3MJN A;  4I3E A;  2XX8 A;  4NF8 B;  2CZH A;  2ZZX A;  3FGS A;  1IEJ A;  4KXP A;  3G3K A;  4MFI A;  1OLC A;  3GLB A;  2H99 A;  4QSD A;  2JJK A;  1LBW A;  3TZA A;  2F7C A;  3P7I A;  1KZ8 A;  4U2R A;  1N3W A;  5CBS A;  1B3G A;  2WYK A;  3FAS A;  2PBW A;  4DE8 A;  2PVU A;  1MH4 A;  4HCY A;  1N7X A;  1FQD A;  1NUZ A;  4ZEF A;  4YAH X;  4QSC A;  1OVT A;  3LR1 A;  4IO7 A;  3U94 A;  1JEV A;  2V3Q A;  1FQE A;  4IGR A;  2CEY A;  1FBG A;  1VE4 A;  1KA0 A;  3MC2 A;  2KLF A;  4I1D A;  4O3B A;  4KYE A;  3VLV A;  1XI6 A;  2XXY A;  1OIB A;  3MP6 A;  1JW5 A;  3UIF A;  1SW2 A;  4N6P A;  3G3H A;  2RC9 A;  4LON B;  3FJM A;  3PTY A;  4NF6 A;  3ROJ A;  3UK4 A;  3E3K A;  4PAK A;  4GQO A;  3U8Q A;  2B4M A;  1Y3Q A;  5I2K B;  1G0I A;  4MX6 A;  5EHM A;  1H76 A;  4X1B A;  4OHN A;  4PAF A;  3OD7 A;  5IZZ A;  4P56 A;  1LBZ A;  4LA9 A;  5H8Q B;  4RJZ A;  1NH8 A;  3MZ1 A;  4R2F A;  4PFB A;  1I69 A;  1LAF E;  1NNF A;  1R6Z A;  3MW0 A;  3MVX A;  2NUV A;  2F7A A;  5H8N B;  1URG A;  1MXY A;  4GX3 A;  1FTA A;  2F78 A;  1IME A;  1FTM A;  2QSX A;  4O94 A;  2ZZV A;  5I56 B;  2LAO A;  2VT5 A;  4BDR A;  4H65 A;  4QFK A;  4P3L A;  3C36 A;  1LBB A;  4GVO A;  1RDZ A;  5EQ8 A;  3UP9 A;  1URD A;  1D9V A;  1NMU A;  1OLA A;  4P8B A;  3T9V A;  3DP4 A;  2QVU A;  5I57 A;  4DCY A;  1CB6 A;  1A40 A;  5AA4 A;  1MQD A;  4GRK A;  3PPQ A;  3K01 A;  2Z22 A;  1ZBM A;  1IXI A;  4DXU A;  2DXY A;  4YKK A;  1JVY A;  1FPK A;  3HHG A;  2DYX A;  3PMV A;  1TFD A;  5DVJ A;  3VE1 B;  1URS A;  3KN8 A;  2G93 A;  3KC0 A;  4LZ8 A;  3GBA A;  2AL4 A;  4YMB A;  1F9B A;  2PMS A;  3HN0 A;  1B1H A;  2THI A;  2VD2 A;  3TTK A;  2QVR A;  3V5A A;  1ANF A;  3H7M A;  1ZMG A;  4GXA A;  4F2Q A;  3RTF B;  2Y84 A;  5I58 B;  3I5O A;  3IX1 A;  3TYH A;  3QMF A;  4ZE9 A;  3H4Z A;  5LOM A;  3T93 B;  1EZ9 A;  4POW A;  1LFI A;  3V8X B;  5H8S A;  5KCJ A;  4NF4 B;  4YMA A;  3Q29 A;  1LFH A;  3VLW A;  4PBQ A;  3MST A; 
#chains in the Genus database with same CATH homology
 2CMO A;  4HTG A;  4PFU A;  4XIG Q;  2ONS A;  4LUB A;  3TTL A;  4EXL A;  1XT8 A;  4KD5 A;  4C1T A;  2ANJ A;  3M3L A;  3TUS A;  4R9G A;  1H45 A;  3K02 A;  1DTZ A;  4ZZE A;  1YCJ A;  2BJJ X;  4OVJ A;  1R9L A;  4U22 A;  4KR5 A;  1B0L A;  3ZKK A;  3UOR A;  3I6V A;  2DS9 A;  1HSJ A;  4U4X A;  4C1U A;  3OO7 A;  1Q1K A;  4MH5 A;  5ELV A;  3SET A;  4ZEB A;  1ZIU A;  3OSR A;  1ATG A;  2D3I A;  3SEU A;  4G68 B;  1HSL A;  3KEI A;  3PPO A;  3ZKL A;  2OWS A;  4OEV A;  1MY3 A;  2RCA A;  2E1S A;  1Y3N A;  1NNP A;  4H8J A;  3PUV E;  1R9Q A;  4KI0 E;  3TCG A;  4Q8R A;  2QS2 A;  2PYY A;  3R7X A;  1CE2 A;  1MXX A;  3N5L A;  3PPP A;  2XXP A;  2AIX A;  3MVW A;  5KDT A;  3QUJ A;  4FIM A;  5TPA B;  4RXL A;  5IAI A;  3TOD A;  4H8I A;  1EH3 A;  3Q25 A;  1B51 A;  1MPD A;  1R1N A;  3SEY A;  1MM6 A;  3G3I A;  2RF1 A;  2RCB A;  4QFP A;  4KQP A;  4OXV A;  4GD5 A;  3C9H A;  2HZL A;  2DWH A;  2XX7 A;  4IO6 A;  1JVX A;  3BBR A;  3UN6 A;  3O6I A;  1VSO A;  5CMC A;  1B0H A;  5JTY A;  4R73 A;  2UYF A;  3IOU A;  3FXU A;  3FVN A;  2I0B A;  4WED A;  3OSQ A;  4JSD A;  3GBB A;  1PDA A;  1QUJ A;  4PFW A;  2REJ A;  4OFJ A;  5AE4 A;  3KG2 A;  4ECF A;  1BTJ A;  4GL0 A;  2ONR A;  2ONK E;  3O28 A;  3SEX A;  4GWO A;  1T0K A;  2YJP A;  4RPN A;  3DEL B;  1NH7 A;  3IR1 A;  1FQA A;  5H8F A;  3T9U A;  4X48 A;  4NF5 A;  5DEX A;  2HXW A;  3IB2 A;  3K6W A;  3U1O A;  1GGG A;  1B2H A;  4L17 A;  1MY0 A;  4YIC A;  3H6U A;  1SYI A;  2AL5 A;  1M5D A;  2I49 A;  3VV5 A;  1UTH A;  3JZJ A;  3TDJ A;  4OZ9 A;  4M1V A;  5IKB A;  3K1M A;  3PPR A;  4FOR A;  4GFR A;  3RPW A;  2FA7 A;  3G3J A;  5CMK A;  2ESN A;  3B6W A;  3TTR A;  1JW1 A;  3PD9 A;  2XX9 A;  2W7Y A;  3FZV A;  2A5T B;  1ZJL A;  4H1X A;  5L9S A;  5HM4 B;  2HQ0 A;  2V93 A;  1SVX B;  2XD2 A;  3FUZ A;  1PB7 A;  1Y9U A;  1Y20 A;  1N3X A;  2XXW A;  3JYR A;  4TLM B;  2Y7R A;  1B3H A;  1Y4C A;  3SKP A;  2ABH A;  1B52 A;  3H6W A;  1EZO A;  2Y7W A;  4BDN A;  3V89 B;  4ELO A;  5DYH A;  4AQ4 A;  1BKA A;  3B6Q A;  3MZB A;  3QK6 A;  4YB6 A;  1Y4T A;  4MLQ A;  3PV0 E;  4E0W A;  1SQY A;  3RGY A;  4Q0C A;  1PBP A;  3IO6 A;  3BKI B;  5JK4 A;  3A09 A;  3EHS A;  1B40 A;  4P11 A;  4P0I A;  4F2O A;  1MQH A;  4GXS B;  1MM7 A;  4F3B A;  3THI A;  2I58 A;  3MBP A;  4U1O A;  3S9L C;  3PUX E;  2DVC A;  4FED A;  4QFL A;  1B7U A;  3PPN A;  1NNK A;  2XXQ A;  3QYT A;  1Y1Z A;  3E13 X;  2VHA A;  2XXH A;  2I3W A;  3MP8 A;  1A7L A;  3K4U A;  1B3F A;  2H5Y A;  1A8F A;  3FD3 A;  1LB9 A;  1US5 A;  4R72 A;  1QUI A;  5DVI A;  4KCD A;  3K6U A;  3KSX A;  1MG1 A;  1JQF A;  1MRP A;  1KWH A;  5FTH A;  2OK2 A;  4X9T A;  1USY E;  1NFT A;  1FW0 A;  4EDP A;  2HCA A;  1PB9 A;  1MS7 A;  3HCQ A;  2QS3 A;  3KJT A;  3Q26 A;  5AA3 A;  1I6A A;  1LAH E;  1FTL A;  4JWY A;  4Z7E A;  3EHT A;  3MQ9 A;  3O66 A;  3BFT A;  2PT2 A;  3KOT A;  3L6G A;  1PBQ A;  4QF9 A;  4OWD A;  2FNC A;  3U93 A;  4NWD A;  2UVG A;  5I57 B;  4NMY A;  3ECR A;  1ZLQ A;  3CFL A;  5FHN A;  4OES A;  3USD A;  2O68 A;  4YKP A;  1D4N A;  5AA4 B;  2H25 A;  3O6H A;  3VLU A;  1UIU A;  1N7W A;  3WAF A;  4BDO A;  3VXB A;  3CG1 A;  3N26 A;  4MLV A;  1J1N A;  2Y7I A;  5K2Y A;  4I9D A;  3D4C A;  2NVU B;  1LAX A;  3OEN A;  2DQV A;  3CG3 A;  1OVB A;  4BDL A;  1DOT A;  1GTK A;  3PUZ E;  2DSF A;  4ELQ A;  1US4 A;  2YPN A;  1ZU0 A;  4IGT A;  1YPN A;  2D21 A;  4FAT A;  1O64 A;  1DPE A;  4EQ7 A;  5JEI A;  3W9V A;  1NNT A;  1QVS A;  3TAJ A;  5ISU A;  3CIJ A;  4G8H A;  3CFX A;  1MXZ A;  1S9T A;  3TFL A;  1YTV A;  4K3F A;  5A5X A;  3IJO B;  5KCJ B;  4BDQ A;  1B9J A;  1BP5 A;  4KCC A;  1Z7M E;  4XXU A;  4PP0 A;  1SDX A;  4RPO A;  4WEP A;  3IB0 A;  5CM6 A;  4G8M A;  4JWO A;  1H43 A;  4HS7 A;  3K00 A;  1B7H A;  4R75 A;  2QS1 A;  1N76 A;  3RTW B;  3K2D A;  3OMB A;  2F34 A;  4ZS9 A;  4XKN A;  3LSW A;  4R6K A;  4ZDM A;  1B5H A;  1SI0 A;  2NWJ A;  3H3G A;  4EXK A;  4QSE A;  5I2N A;  5DT6 A;  1TWY A;  1JW4 A;  3C34 A;  1POY 1;  3ZSF A;  4U23 A;  5ICT A;  1A54 A;  3QXM A;  4AB6 A;  1BLF A;  5FTI A;  1P1Q A;  1GV8 A;  2AYS A;  1N0T A;  4WXJ A;  1FQF A;  1GVC A;  1GR2 A;  3C31 A;  3M3F A;  1MXU A;  2M8C A;  4NTL A;  5FHO A;  2DP8 A;  2DOJ A;  2G29 A;  4OTE A;  1AOV A;  1SI1 A;  3TTN A;  3TEL A;  1Z7N E;  3OXN A;  4H6D A;  2XXX A;  2REG A;  3Q27 A;  3IOT A;  5KDT B;  4F3G A;  3TEP A;  4JBZ A;  4F18 A;  2O6A A;  2E0S A;  3ILT B;  3MVY A;  4N13 A;  2ZMB A;  1IXH A;  2OJT A;  2Z8E A;  1O7T A;  3H6V A;  1B5J A;  1LCT A;  2B65 A;  4EQB A;  4FEC A;  4POX A;  5L8D A;  3EN3 A;  3S2V A;  2ZYK A;  3O9P A;  1LFG A;  4F3P A;  5DVF A;  3PGF A;  2ZYO A;  4LQ2 A;  2P0S A;  1VFD A;  4GOT A;  4DIG A;  3S9N C;  2QMX A;  2I3V A;  1ELJ A;  5JTY B;  4JSO A;  2V84 A;  2QRY A;  3O6G A;  5CBR A;  3TCF A;  4PFY A;  3FVG A;  5TU0 A;  2QMW A;  3OEM A;  1NKX A;  1LBC A;  3W9W A;  4P0G A;  3RUM A;  1MY2 A;  4PET A;  4HW8 A;  3G3G A;  1XS5 A;  1IIT A;  5H8F B;  1QKA A;  1FTJ A;  4NF5 B;  4U1Z A;  5DEX B;  1A8E A;  3S4U A;  3TTM A;  4F22 A;  4F3S A;  1P1O A;  3KOS A;  1UTB A;  2XHD A;  3ONM A;  3GZG A;  3O2A A;  4H5G A;  2H4I A;  1AL3 A;  2Q2A A;  1UTH B;  2IA4 A;  1MY1 A;  3EQ1 A;  4TOZ A;  1JNF A;  3TQW A;  5CC2 A;  2XXU A;  3WAE A;  3VVE A;  3EHU A;  2RC7 A;  2IEE A;  3DM0 A;  3CFZ A;  4JXI A;  3T9X B;  4R2B A;  1M5F A;  3M8U A;  1I6Q A;  3QIM A;  1MQG A;  4GL8 A;  1XOC A;  3ODB A;  3OOA A;  2GH9 A;  4ZED A;  1B3E A;  3DLN A;  5EYF A;  1MQJ A;  1B58 A;  1LGB C;  2O69 A;  2Q2C A;  5CMM A;  2X7Q A;  4DDD A;  1SW1 A;  2O84 X;  1M5C A;  3LSL A;  3RT8 A;  2GHA A;  2O7U A;  2DWJ A;  4NE4 A;  1MQI A;  2DE3 A;  4G77 A;  4RK2 A;  3MPK A;  2B3B A;  3FXR A;  4KYD A;  1RYO A;  2I4C A;  3T96 B;  3KZG A;  4ESW A;  2WKY A;  3MZ9 A;  4JB7 A;  4MBP A;  4N07 A;  2VD3 A;  2QL3 A;  2UXA A;  4ISU A;  4R6Y A;  1DTG A;  3IOV A;  2O1L A;  2H98 A;  3U72 A;  3VVF A;  2OLB A;  4UA8 A;  4R9F A;  3T66 A;  1WDN A;  4OFL A;  1PEB A;  3G3F A;  4OFO A;  4BDM A;  4ELP A;  3RQT A;  5AA2 D;  3FV1 A;  4DXC A;  1DMB A;  3T22 A;  3MWB A;  1FTO A;  3N94 A;  3ILU B;  5K2X A;  3O97 A;  3PD8 A;  1LB8 A;  3IK6 B;  3KSJ A;  4XKP A;  4G4P A;  2R71 A;  4IO4 A;  1PB8 A;  4OER A;  1ZTY A;  4G8N A;  3FVO A;  1B32 A;  2R6G E;  1S7Y A;  1P1W A;  3HV1 A;  2F7B A;  2F97 A;  1UQW A;  2XXV A;  2UVI A;  5H8H A;  1H44 A;  4I62 A;  4ZEK A;  1SW4 A;  3S9E A;  5AA2 A;  4YKJ A;  4IY6 A;  4RA1 A;  1B46 A;  4F1Y A;  1B4H A;  1TT1 A;  1B6H A;  4LVQ A;  4EF1 A;  1YAE A;  4QFO A;  5KZT A;  1XVY A;  5J1D A;  3H6T A;  1LCF A;  1MXV A;  2RIN A;  4GF8 A;  2FYI A;  3CSB A;  1OQH A;  4NF6 B;  1Y1M A;  4LQ5 A;  4NWC A;  3FJG A;  1B5I A;  1B7Z A;  4M4G A;  3C32 A;  1Y3P A;  4F1V A;  5TP9 A;  4UAC A;  3E9X A;  2O7I A;  5BUU A;  1MPC A;  2DE2 A;  1BIY A;  1IUD A;  4FAJ A;  1Q35 A;  5FHM A;  5I59 A;  4RYA A;  1P1N A;  4EUO A;  4EQ9 A;  4HCW A;  5AA1 A;  3IOR A;  4PFT A;  2Q8J A;  3VVD A;  1M5B A;  2X7P A;  1FQC A;  2P1S A;  2I48 A;  3ZS6 A;  3OO9 A;  4YKI A;  2H9B A;  3PUY E;  2HAV A;  5A5X B;  3SEV A;  2ALU A;  3JV9 A;  1LAG E;  4YZZ A;  4FEB A;  3C35 A;  3OEK A;  4E0X A;  3FVK A;  1N84 A;  4O3C A;  4F19 A;  1HSE A;  1D9Y A;  3F11 A;  1RYX A;  5ICQ A;  2DWI A;  3K0V A;  5L9M A;  4XKR A;  3QSL A;  3CVG A;  4NED A;  2V25 A;  2O1M A;  5I2N B;  3LUY A;  3L6H A;  3IAZ A;  3K1N A;  1XC1 A;  4NF8 A;  3W15 C;  5CMB A;  1M5E A;  3MPL A;  4JDF A;  3C4M A;  3AXF A;  4F31 B;  4DZ1 A;  4LZ5 A;  3UA8 A;  2A5S A;  1MPB A;  3OO6 A;  4TLL B;  3OEL A;  1WOD A;  2PX1 A;  3C33 A;  4ZZA A;  2VGQ A;  4OET A;  4GIZ A;  3FXQ A;  2F35 A;  4X1D A;  3GXA A;  5M2V A;  1P1U A;  4OYV A;  1DSN A;  5CRY A;  3UGW A;  3EPE A;  2D5W A;  3KN7 A;  3VDF A;  4I8C A;  4LAT A;  4ZE8 A;  4Q5T A;  3TQL A;  1B05 A;  2DVZ A;  4H5F A;  4IY5 A;  3SER A;  4YB5 A;  5ITP A;  1IZ1 A;  3CR9 A;  3U92 A;  2UVJ A;  3R26 A;  1WVJ A;  1MDQ A;  2X26 A;  2UYE A;  3DP6 A;  4XKQ A;  1O63 A;  3DP8 A;  1OMP A;  3FV2 A;  4LZ7 A;  1IIW A;  5I2K A;  3S9M C;  2Z8D A;  3E4R A;  4TQU Q;  2QJE A;  3IOW A;  5H8Q A;  3KBR A;  4QFN A;  1XVX A;  5F1Q A;  4ZEI A;  3IJX B;  3A3C A;  3B7D A;  3RN8 A;  3PMW A;  1SYH A;  5H8N A;  2I4B A;  3VXC A;  2Z8F A;  4XTC Q;  1LST A;  3MVZ A;  1AH5 A;  5I56 A;  2V3T A;  3CRB A;  3D4G A;  4AB5 A;  2F8D A;  3LSF B;  3K6X A;  4KYS A;  4RNS A;  3PU5 A;  3A3U A;  3KN3 A;  1B1X A;  2Q89 A;  2Q88 A;  3KGC A;  4OEN A;  1ZKB A;  1JET A;  3FIR A;  2DE4 A;  1TFA A;  5ITO A;  3IL1 B;  3VFJ A;  3HST A;  1P99 A;  1FCK A;  1UTB B;  1QUK A;  3TKD A;  4MF3 A;  4QHQ A;  3QAX A;  4DXB A;  4IO2 A;  2VOZ A;  1EU8 A;  4EF2 A;  2Q9T A;  5I84 A;  1QW0 A;  3RY3 A;  2GFE A;  1OQG A;  4BLA A;  1MY4 A;  4H67 A;  4KPT A;  2XXR A;  4RK9 A;  2OZZ A;  4RY1 A;  1I6B A;  4WKM A;  5I58 A;  3TCH A;  1SD3 A;  3CSG A;  3MP1 A;  3KFM A;  4THI A;  3TMG A;  2Z23 A;  3G7W A;  3MAM A;  3CI8 A;  5DTB A;  4Q30 B;  2QS4 A;  4NF4 A;  5CI5 A;  4O3A A;  2ZNT A;  3TPA A;  3LSX A;  3SDF A;  2HAU A;  2XD3 A;  3K6V A;  4G68 C;  3H03 A;  4FE8 A;  3BFU A;  3PMX A;  3V83 A;  3IB1 A;  3HO7 A;  3O29 A;  5HPQ A;  5BWJ A;  3MUQ A;  2I0C A;  2XXT A;  1IXG A;  1LLS A;  4F1U A;  3LBS A;  2ZYN A;  5F7V A;  3RT6 B;  4ONY A;  3HPI A;  4ZEC A;  3FAT A;  4IO3 A;  3KJ7 A;  4OQO A;  3R6U A;  2O51 A;  3T9H B;  1MXW A;  4G68 A;  2R9J A;  4F29 A;  1B3L A;  2DXR A;  2F6P A;  2F6G A;  3SEW A;  1USY H;  2Y7K A;  2QPQ A;  3FJ7 A;  1L5T A;  3B6T A;  3LC8 A;  3SES A;  4R6H A;  2OCU A;  4PE5 B;  2P2A A;  2ZNS A;  3RNN A;  4ELR A;  3QUF A;  1VFE A;  4ND9 A;  4U21 A;  5TPA A;  2ZNU A;  2PT1 A;  3PUW E;  1XHY A;  4KFQ A;  4C0R A;  4IO5 A;  4DLD A;  3N6U A;  5H8H B;  3RLF E;  2DWA A;  4U4S A;  5B7D A;  1AMF A;  2F36 A;  5AA2 B;  2YLN A;  4ESX A;  4YU0 A;  4F39 A;  2HFB A;  4GLI A;  5HBC A;  2F5X A;  3K1P A;  1IXC A;  4R74 A;  4OEU A;  1QKB A;  1IQ7 A;  2RKM A;  2GHB A;  3EF7 A;  1RKM A;  4QRZ A;  1H3D A;  1FTK A;  1A99 A;  1II5 A;  1MDP 1;  2CZL A;  2RC8 A;  5TP9 B;  1JEU A;  1MH3 A;  2B3F A;  2NOO A;  2UVH A;  1SW5 A;  1TXF A;  1NL5 A;  2VP1 A;  5I59 B;  2NXO A;  2Y7P A;  1S50 A;  3IO4 A;  4H0W A;  2V3U A;  3N6T A;  1B4Z A;  4FJP A;  2GRV A;  4Z0I A;  3Q28 A;  3M3K A;  4IB2 A;  2ZXT A;  4DCX A;  2OBG A;  2XXI A;  3H06 B;  2HEU A;  1AIV A;  1A55 A;  1POT A;  1QUL A;  4PQJ A;  1FQB A;  5L9O A;  1PC3 A;  1D3K A;  3I3V A;  1DPP A;  1N04 A;  4YB7 A;  3OO8 A;  4KHZ E;  2I6E A;  3HHF A;  2A5T A;  5EHS A;  5B70 A;  2OWT A;  1QJM A;  2HZK A;  1EZP A;  1VR5 A;  4LP2 B;  4JWX A;  1UIV A;  4G2Z A;  1SBP A;  2ZYM A;  3MJN A;  4OMB A;  2XX8 A;  4NF8 B;  3FGS A;  1IEJ A;  3G3K A;  4MFI A;  1OLC A;  3GLB A;  2H99 A;  4QSD A;  3TZA A;  2F7C A;  3P7I A;  4U2R A;  1N3W A;  5CBS A;  1B3G A;  3FAS A;  2PBW A;  4DE8 A;  2PVU A;  1MH4 A;  4HCY A;  1N7X A;  1FQD A;  4ZEF A;  4YAH X;  4QSC A;  1OVT A;  3LR1 A;  4IO7 A;  3U94 A;  1JEV A;  2V3Q A;  1FQE A;  4IGR A;  1VE4 A;  3MC2 A;  2KLF A;  4I1D A;  4O3B A;  4KYE A;  3VLV A;  2XXY A;  1OIB A;  3MP6 A;  1JW5 A;  3UIF A;  1SW2 A;  4N6P A;  3G3H A;  2RC9 A;  4LON B;  3FJM A;  4NF6 A;  3UK4 A;  3E3K A;  4GQO A;  3U8Q A;  5I2K B;  1Y3Q A;  5EHM A;  1H76 A;  4X1B A;  4OHN A;  3OD7 A;  4LA9 A;  5H8Q B;  4RJZ A;  1NH8 A;  3MZ1 A;  4R2F A;  1I69 A;  1LAF E;  1NNF A;  1R6Z A;  3MW0 A;  3MVX A;  2NUV A;  2F7A A;  5H8N B;  1URG A;  1MXY A;  2F78 A;  1FTM A;  2QSX A;  5I56 B;  2LAO A;  4BDR A;  4H65 A;  4QFK A;  3C36 A;  1LBB A;  4GVO A;  3UP9 A;  1URD A;  1D9V A;  1NMU A;  1OLA A;  3T9V A;  3DP4 A;  5I57 A;  4DCY A;  1CB6 A;  1A40 A;  5AA4 A;  1MQD A;  4GRK A;  3PPQ A;  3K01 A;  2Z22 A;  1ZBM A;  1IXI A;  4DXU A;  2DXY A;  4YKK A;  1JVY A;  3HHG A;  2DYX A;  3PMV A;  1TFD A;  5DVJ A;  3VE1 B;  1URS A;  3KN8 A;  2G93 A;  4LZ8 A;  3GBA A;  2AL4 A;  4YMB A;  1F9B A;  2PMS A;  3HN0 A;  1B1H A;  2THI A;  2VD2 A;  3TTK A;  3V5A A;  1ANF A;  3H7M A;  1ZMG A;  4GXA A;  4F2Q A;  3RTF B;  2Y84 A;  5I58 B;  3I5O A;  3IX1 A;  3TYH A;  4ZE9 A;  3H4Z A;  5LOM A;  3T93 B;  1EZ9 A;  4POW A;  1LFI A;  3V8X B;  5H8S A;  5KCJ A;  4NF4 B;  4YMA A;  3Q29 A;  1LFH A;  3VLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...