3JYRA

Crystal structures of the gach receptor of streptomyces glaucescens gla.o in the unliganded form and in complex with acarbose and an acarbose homolog. comparison with acarbose-loaded maltose binding protein of salmonella typhimurium.
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
370
structure length
370
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEQDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEVTPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLVPNPPKTWEEIPALDKELKVKGKSAIMFNLQEPYFTWPLIAADGGYAFKFENGKYDVKDVGVDNAGAKAGLTFLIDMIKNKNMSADTDYSIAEAAFNKGETAMTINGPWAWSNIDKSKVNYGVTLLPTFKGKPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDQGLEAVNKDKPLGAVALKSFQEQLAKDPRIAATMDNAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALKDAQSRITK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Crystal Structures of the Solute Receptor GacH of Streptomyces glaucescens in Complex with Acarbose and an Acarbose Homolog: Comparison with the Acarbose-Loaded Maltose-Binding Protein of Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transport protein
total genus 124
structure length 370
sequence length 370
ec nomenclature
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3jyrA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3jyrA01
3VVFA 1EH3A 2Y7WA 2VOZA 2F8DA 4OEUA 2O1LA 1N0TA 1AMFA 3N6TA 2CMOA 2IEEA 4H0WA 2ZYMA 1BIYA 4NEDA 4ESWA 4EDPA 2ZYNA 2O7IA 4H8JA 5JTYA 4M1VA 4F29A 1AOVA 4FECA 3SETA 3OENA 2NUVA 5L9OA 4OEVA 5CMBA 4Z7EA 3MPLA 2G29A 3CR9A 4OFLA 3QXMA 3SEYA 2GH9A 3CG3A 4PETA 5KCJB 1LLSA 3USDA 1UIVA 1JQFA 1LCTA 5EHSA 1MXZA 4XKPA 2XXWA 4NWCA 3ZS6A 3RT6B 4FORA 3PMWA 1YAEA 1OMPA 1QUJA 1H45A 1FQBA 3CI8A 3I5OA 5AA2D 3TAJA 2VP1A 4JB7A 5ICQA 1VSOA 1QW0A 4LUBA 3HHFA 2DE4A 1LAXA 1QVSA 4JBZA 1LAFE 2THIA 1TWYA 5B70A 2Q9TA 1LB9A 1B5IA 1QUIA 2Y84A 2RCBA 3IK6B 5K2XA 2O6AA 3EHSA 4XKNA 3TPAA 4MH5A 3BFTA 1M5CA 1AH5A 2AIXA 1B51A 3C31A 1NFTA 3DP8A 4IO6A 4YB5A 1HSJA 4LONB 1OLCA 3K00A 3KGCA 2YPNA 1ZU0A 3CIJA 1KWHA 3PGFA 4F39A 4U23A 1NKXA 3TTNA 1MQHA 3RT8A 3RGYA 4GIZA 3IOVA 4RK2A 3WAEA 3T96B 1NH7A 1B5HA 4F19A 4ISUA 5L9MA 3KN7A 3PUWE 4JDFA 4MLQA 5DYHA 1LGBC 1XHYA 5DEXA 4OENA 5CBSA 1XVXA 4JWXA 1N04A 1L5TA 1MM7A 2NXOA 2Z23A 1XC1A 3FV1A 3S2VA 3PD8A 1S50A 4NF8B 3K02A 4BLAA 2ONRA 4N6PA 2I0CA 2O1MA 4BDQA 1GGGA 1MPCA 1LCFA 1QKAA 3K4UA 1B46A 4OWDA 1IXIA 1JVYA 3RUMA 3HHGA 4EXKA 4C1TA 4EUOA 3G3GA 1IXGA 2V93A 2BJJX 3BBRA 1VFDA 2XXVA 2DXYA 2ZXTA 1WODA 5I2KA 1P1OA 2HAVA 2PBWA 4U2RA 1I6AA 2F97A 3R7XA 3I6VA 4F1UA 4R6KA 3JYRA 1I69A 4NF4B 3TMGA 4NF6B 1FQFA 3KEIA 3MVZA 3KG2A 5KDTB 4OMBA 4H1XA 4O3AA 2H9BA 4BDLA 4DZ1A 2H4IA 2OCUA 5HM4B 2B65A 2PYYA 4BDOA 2QS1A 1SW4A 1CB6A 4YKIA 3EHUA 5J1DA 5AA4A 4FEDA 2DVZA 2NVUB 3GZGA 2GHBA 3CRBA 2DP8A 3Q25A 4QRZA 3HO7A 4JSOA 1FTOA 4XIGQ 2P1SA 3HSTA 5I57A 3OO9A 3GXAA 4ZDMA 3T9UA 1LSTA 4H8IA 4QFLA 4R6HA 3LBSA 3O29A 4YAHX 1URSA 3MVYA 4XKRA 5TP9A 4G68C 3TYHA 4LVQA 1DPPA 1A8FA 5I59B 4WXJA 4YB6A 4IGRA 2ZNTA 1H44A 2UVJA 3FJGA 5BUUA 1NNFA 1FQCA 1B05A 1MDQA 3D4CA 3S9LC 3QAXA 4GL0A 4HS7A 1SYIA 3K1MA 3MZ1A 3W9VA 4GXSB 4OHNA 4O3CA 2DWAA 2F6PA 4GLIA 4OETA 2QMXA 3VXBA 4OYVA 1RKMA 4DE8A 4Z0IA 4LA9A 5CMKA 3LSWA 1UTBB 2RCAA 3E4RA 3IB0A 3VVEA 2I58A 5ITOA 3IOTA 1GR2A 5FHMA 4YKKA 1D9YA 4ZEIA 1FTJA 4G68B 1B0LA 1FQEA 3ONMA 4YB7A 4NTLA 3KBRA 3C9HA 1DOTA 2DOJA 2GFEA 4N07A 3IB1A 3TTKA 4G77A 3IOUA 2QRYA 3QYTA 1MQGA 4PFWA 1Y9UA 1FQDA 1IQ7A 3SDFA 4MLVA 1DTGA 1FTKA 3ZKLA 4LZ8A 1YPNA 3OSRA 1HSLA 4KYEA 4QSDA 3IOWA 1UTHB 5DVFA 1S9TA 3MJNA 4F3GA 1B5JA 1PB9A 3RN8A 3ODBA 5ITPA 2QPQA 2XHDA 3H6VA 3RY3A 1TT1A 3MVWA 4Q8RA 1XS5A 3DP6A 1BKAA 2F7BA 3C4MA 3VE1B 4EXLA 5H8FA 1NH8A 2OBGA 4YICA 1EU8A 2Q8JA 1USYE 1OVBA 5AA2A 3FUZA 4KI0E 3THIA 3MPKA 4EF2A 4H67A 1TFDA 1A54A 5JEIA 3PU5A 4GD5A 1TXFA 1US4A 4DXBA 1JETA 2RINA 4P0IA 4F3BA 4DIGA 2DE2A 1POY1 4YMBA 1B58A 3T9HB 3LSFB 3MP6A 3TKDA 5I56A 1FTLA 4I9DA 5TU0A 1GVCA 4OERA 3MZBA 4I62A 3H4ZA 2WKYA 2Z8DA 3K6UA 2DWJA 2UVIA 3LSXA 5CM6A 2ALUA 3QSLA 3OO8A 3C34A 3C32A 4XTCQ 1D9VA 3M3LA 2OK2A 4ECFA 1B3EA 3DLNA 4F1VA 3B6WA 3FXUA 3V8XB 3FJ7A 2QJEA 1Y4TA 4RXLA 1MXXA 2XX9A 4FE8A 4H65A 1J1NA 1P1QA 5F7VA 1SD3A 4OZ9A 4EF1A 5I2NB 3K6WA 1NMUA 4PP0A 2XXRA 3LC8A 3N94A 2XD3A 3U72A 3UA8A 1B3GA 2GRVA 1B52A 3ECRA 2REGA 3T9VA 4F3PA 2KLFA 2LAOA 3ILUB 1MH4A 2B3BA 2FYIA 1RYXA 4UACA 4YU0A 2Z8FA 3RPWA 3PPNA 3PPQA 5I58A 1AL3A 5H8QB 2PX1A 4KHZE 1LB8A 3PD9A 1UIUA 2D5WA 4H5GA 3U94A 4HCYA 3EHTA 4TQUQ 4GOTA 1DPEA 1SVXB 5ELVA 1PC3A 4TLLB 2UVGA 1ANFA 3HN0A 5CMCA 1B3LA 4ELPA 1IZ1A 4QFKA 2A5TA 5H8NB 3FVOA 1MQJA 3OSQA 2X7PA 1QULA 1USYH 1Y20A 4BDRA 5CRYA 3VDFA 2XXXA 1MXVA 4POXA 4F1YA 2V3TA 2Q2CA 5AA4B 4YZZA 3TTRA 2Y7RA 3FVNA 1H43A 3K1PA 5HBCA 2RC8A 1OVTA 1ZJLA 4FJPA 1B6HA 4O3BA 3H6WA 1N84A 4PFTA 5I57B 4XXUA 2OLBA 4U4SA 4QF9A 3K6VA 1I6QA 3OMBA 3H6UA 3MWBA 3U92A 2ZMBA 3UN6A 3B7DA 4Q0CA 3V5AA 1M5BA 1JW1A 4LQ2A 3T93B 1M5DA 2M8CA 5CC2A 4RYAA 3IJXB 1Y1MA 4RPNA 4OFJA 3T66A 2O69A 1LBCA 2D21A 3T9XB 4AB6A 1FCKA 5H8SA 4U4XA 4OTEA 3KJTA 4IY6A 4HW8A 4WKMA 3G3KA 1LFGA 2Y7PA 1O7TA 5L8DA 1P1NA 2Y7IA 4ZEFA 3TQLA 3KZGA 2W7YA 3SERA 4WEDA 3L6GA 3V89B 2XXQA 3C33A 1Y4CA 2DXRA 4R6YA 3LR1A 5IAIA 1MG1A 3IAZA 5EYFA 3DM0A 5BWJA 3CFXA 3S9MC 3A3CA 4GF8A 4OFOA 3O28A 3Q27A 4IO7A 5DVIA 2V25A 2H25A 1D3KA 2I6EA 3B6TA 3H03A 1IXHA 5DT6A 1SBPA 1N7XA 2HQ0A 2PVUA 4GVOA 1DSNA 4X1DA 1P1UA 1D4NA 3UK4A 1TFAA 4NWDA 1Y3PA 5ISUA 2R6GE 2RF1A 1BLFA 3W9WA 3M3FA 1MY4A 4I1DA 3FGSA 3E3KA 2QMWA 4NF5A 4G8NA 4BDNA 1ZTYA 4IO5A 5AA3A 2H98A 4LP2B 2RC7A 3O6HA 4P11A 3A09A 2F7AA 5AE4A 5K2YA 1N3WA 3O6IA 2VGQA 4KFQA 2X26A 1IITA 5A5XB 2XXPA 3RTWB 2Y7KA 3G3FA 5CBRA 5H8HB 5HPQA 3TUSA 3K1NA 5JK4A 1B40A 3PUYE 4GQOA 4EQ9A 3VLWA 1PB8A 4NMYA 5DVJA 4RNSA 4PQJA 1I6BA 2I49A 5FHOA 3OEMA 3Q26A 2QS2A 4QHQA 2DQVA 3S9EA 1MY2A 3GBAA 2ESNA 4R75A 1Q1KA 2O7UA 1LFHA 3I3VA 1JW4A 2UXAA 1Z7ME 4WEPA 4HCWA 1B4ZA 2P0SA 1B7HA 4JWYA 4KQPA 3RQTA 2HFBA 3FVKA 2Z8EA 3PMVA 3SEXA 2P2AA 3BKIB 4IO3A 3RLFE 4KYDA 1POTA 1JVXA 1PB7A 1B32A 4U21A 4PE5B 2OWSA 3OELA 3HV1A 2XX7A 3O2AA 3FJMA 4NE4A 4R2FA 2YLNA 5JTYB 4NF4A 1OQHA 1URGA 1II5A 3PPOA 3VV5A 1O64A 1EZ9A 2HXWA 3HCQA 2DWHA 3H3GA 2DS9A 4JSDA 1IEJA 4AQ4A 3QUFA 4GRKA 3RTFB 4YKJA 3C35A 4L17A 4C0RA 5IKBA 5TPAA 1R1NA 1XVYA 1M5EA 3SEVA 3WAFA 3OD7A 1UQWA 5EHMA 4C1UA 4QFOA 2DE3A 1ZKBA 1PEBA 3ZKKA 4KYSA 1WVJA 2R71A 3MAMA 4POWA 3EF7A 2O68A 2V3QA 2F36A 2AL4A 3KOTA 1IXCA 2D3IA 1MXUA 3OO7A 4DCYA 3KFMA 4F31B 1MQIA 3DELB 2QSXA 2E1SA 1HSEA 2ZYOA 4XKQA 4DXUA 3TZAA 3IB2A 1LBBA 3CFLA 5M2VA 3PV0E 1B3HA 4R2BA 2DYXA 4ZS9A 3PPPA 5I59A 1IIWA 1ZLQA 3LSLA 4RA1A 2RC9A 4Q5TA 1GTKA 4GFRA 2F78A 1B1XA 2F34A 3SEUA 3E13X 3FIRA 4E0XA 5FHNA 4KPTA 4Q30B 2HEUA 2IA4A 1VE4A 2DSFA 4TOZA 1MH3A 1MRPA 3N6UA 4UA8A 1R9QA 2PT2A 4IB2A 3KN3A 5ICTA 1IUDA 2I48A 3FD3A 4DXCA 4G68A 3KOSA 4K3FA 4G2ZA 1AIVA 1MXWA 5DTBA 1MQDA 4F2QA 3MUQA 5DEXB 3U93A 3UORA 3PUZE 4ZZAA 4KR5A 4YMAA 3H06B 1Y3NA 5KZTA 3OXNA 2H99A 4PFUA 3A3UA 4MF3A 3QUJA 2O84X 4ZEBA 4ZEDA 3CSBA 4N13A 3TDJA 2AYSA 3IX1A 1XT8A 1UTHA 3SESA 3JZJA 1B0HA 2B3FA 1NNKA 2HCAA 4X1BA 4RJZA 5I2KB 3VFJA 4FAJA 3IORA 1S7YA 3P7IA 4E0WA 3IL1B 2ANJA 2R9JA 4GXAA 1JEVA 2ABHA 3IJOB 4G4PA 3GBBA 1SQYA 1PDAA 2QS4A 5I84A 2ONKE 4QFNA 2UYFA 2Q2AA 4ZEKA 4IO4A 4QSCA 5L9SA 3G3JA 2DVCA 3CVGA 3EQ1A 1PBPA 1MY1A 3IO4A 2NOOA 1A8EA 4KCDA 1SDXA 3K01A 1SW5A 3VVDA 2A5SA 2OZZA 2XX8A 1ATGA 1OLAA 1R6ZA 3MW0A 1NL5A 1OIBA 4NF5B 1XOCA 2OWTA 1LFIA 3R6UA 1GV8A 1A40A 1M5FA 4RPOA 4OXVA 3M3KA 2OJTA 2AL5A 2I3WA 2Z22A 2UYEA 1FW0A 2XXHA 3TCGA 1ZMGA 2E0SA 5TP9B 1ZBMA 3V83A 3MZ9A 4F2OA 4RK9A 2XXUA 3N26A 3B6QA 4YKPA 5CMMA 3C36A 1FTMA 2HZKA 3VLUA 4KCCA 5I2NA 1R9LA 3RNNA 3AXFA 3FVGA 4LQ5A 1N76A 3TCFA 3K0VA 4F22A 4BDMA 1NNTA 3KSXA 2UVHA 1MDP1 4ESXA 3TCHA 1VR5A 1WDNA 1SW1A 1ELJA 5KCJA 1RYOA 5FTHA 1SI0A 3U1OA 3FZVA 2XXTA 5H8QA 1LAHE 1JW5A 5LOMA 4EQ7A 1EZOA 2PMSA 4ZE8A 4FATA 3MC2A 3H7MA 2FNCA 3TEPA 1DMBA 2O51A 1SYHA 1B7UA 2XXIA 3PMXA 4ZECA 2G93A 4IY5A 4I8CA 2FA7A 4G8HA 2H5YA 3KJ7A 5H8NA 4G8MA 1N7WA 3MBPA 1H76A 1B4HA 4IGTA 4GL8A 2ZNSA 1A55A 5TPAB 5F1QA 4X48A 3PUXE 3QIMA 2F6GA 1FQAA 1MY0A 1MXYA 4OQOA 2NWJA 3W15C 4R9GA 3TTLA 3TFLA 1A99A 3F11A 1QKBA 2QL3A 2V84A 5FTIA 2Q89A 3G7WA 3PUVE 2PT1A 3CSGA 5H8FB 2ZNUA 4TLMB 3FASA 1B2HA 5AA2B 3HPIA 4H6DA 3ILTB 4QFPA 3LUYA 4FIMA 3KN8A 3UP9A 5CI5A 4HTGA 4IO2A 3UIFA 1F9BA 4THIA 3MP1A 2CZLA 1JNFA 4EQBA 3K6XA 3G3HA 3OOAA 1US5A 4U1OA 5B7DA 3N5LA 3U8QA 4NF8A 4DDDA 2DWIA 2YJPA 2Q88A 4AB5A 2XXYA 1JEUA 4ELOA 5I56B 4ZE9A 1PBQA 2QS3A 3TQWA 1MY3A 1MS7A 3SEWA 3R26A 1B1HA 2I3VA 3K2DA 2REJA 3OEKA 3PPRA 1BTJA 4P0GA 3G3IA 4ZZEA 2I4BA 1Y1ZA 3GLBA 3EN3A 4OVJA 1SI1A 5AA1A 2I4CA 3CFZA 4QSEA 1QJMA 3M8UA 4NF6A 1A7LA 3ZSFA 3OO6A 3UGWA 2VD3A 1BP5A 2I0BA 2ZYKA 1CE2A 2X7QA 4DCXA 4DLDA 3H6TA 5KDTA 4MFIA 3CG1A 1OQGA 4X9TA 3Q29A 3BFUA 3L6HA 2HAUA 3EPEA 3FXQA 4F3SA 4JWOA 3E9XA 1YCJA 3T22A 4LATA 2XD2A 2F5XA 1Q35A 1Y3QA 1B3FA 3VXCA 4GWOA 1MPDA 5I58B 3MP8A 1QUKA 2HZLA 4F18A 4ONYA 4ELRA 3FXRA 1DTZA 1MM6A 1P1WA 3S4UA 4H5FA 1H3DA 4R73A 4U22A 1YTVA 2ONSA 2VD2A 1SW2A 1MPBA 3O97A 1B9JA 2F7CA 3IR1A 2A5TB 3MQ9A 4RY1A 3FATA 4R72A 4MBPA 3IO6A 4M4GA 2F35A 1NNPA 3O6GA 3VLVA 5A5XA 5H8HA 1N3XA 4JXIA 4ND9A 3TELA 4U1ZA 2VHAA 4LZ5A 2RKMA 4PFYA 4R9FA 1EZPA 3QK6A 1B7ZA 3FV2A 3TTMA 4FEBA 4OESA 4KD5A 3O9PA 1ZIUA 4ELQA 1O63A 3SKPA 3TODA 3MVXA 2GHAA 1URDA 2V3UA 1T0KA 4R74A 3S9NC 3KSJA 3DP4A 1Z7NE 1UTBA 3D4GA 3Q28A 1LAGE 4LZ7A 3O66A 3JV9A 1P99A 1VFEA
chains in the Genus database with same CATH superfamily
3VVFA 1EH3A 2Y7WA 2VOZA 1FTAA 1DCUA 2F8DA 4OEUA 2O1LA 1N0TA 1AMFA 4GWZA 3N6TA 2PCRA 2CMOA 2IEEA 4H0WA 2ZYMA 1BIYA 4N91A 4PFBA 4NEDA 4ESWA 4EDPA 2ZYNA 2O7IA 4H8JA 5JTYA 4M1VA 4F29A 1AOVA 4FECA 3SETA 3OENA 2NUVA 5L9OA 4OEVA 1KZ8A 1FPKA 1FPEA 5CMBA 4Z7EA 3T1BA 3MPLA 2G29A 3CR9A 4OFLA 3QXMA 3SEYA 2GH9A 3CG3A 2B4LA 4PETA 5KCJB 4NQ8A 1LLSA 3USDA 1UIVA 1JQFA 1LCTA 5EHSA 5F24A 1MXZA 4XKPA 2XXWA 4NWCA 3ZS6A 4PE3A 3RT6B 3HFUA 4FORA 3PMWA 3FXBA 1YAEA 4O94A 1OMPA 1QUJA 4I3EA 1JP4A 4GX3A 1H45A 1FQBA 3CI8A 3I5OA 5AA2D 3TAJA 2VP1A 4JB7A 5I3SA 5ICQA 1VSOA 4NN3A 1QW0A 4LUBA 3HHFA 2DE4A 1LAXA 1QVSA 4JBZA 1LAFE 2THIA 1TWYA 4P56A 5B70A 2Q9TA 1LB9A 1B5IA 1QUIA 2Y84A 2RCBA 2FBPA 3IK6B 5K2XA 4NGUA 2O6AA 4X8RA 3EHSA 4XKNA 1IMCA 3TPAA 4MH5A 3BFTA 1M5CA 1AH5A 2AIXA 1B51A 3C31A 1NFTA 3DP8A 4IO6A 4YB5A 1HSJA 4LONB 1OLCA 3K00A 3KGCA 2YPNA 5EQ8A 1ZU0A 3CIJA 1KWHA 3PGFA 4F39A 4U23A 1NKXA 3TTNA 1MQHA 3RT8A 2PFZA 3RGYA 2WEFA 4GIZA 3IOVA 4RK2A 3WAEA 2XA5A 3T96B 1NH7A 1B5HA 4F19A 4ISUA 5L9MA 3KN7A 3PUWE 4JDFA 4MLQA 5DYHA 1LGBC 1XHYA 5DEXA 4OENA 5CBSA 1XVXA 4JWXA 1N04A 1L5TA 5I5PA 1MM7A 2NXOA 4NX1A 1XI6A 2Z23A 1XC1A 3FV1A 3S2VA 5ET6A 4OVPA 3PD8A 1S50A 4NF8B 3K02A 4BLAA 2ONRA 4N6PA 2I0CA 2F3BA 2O1MA 4BDQA 1GGGA 1MPCA 1LCFA 1QKAA 3K4UA 1B46A 1NV2A 4OWDA 1IXIA 1JVYA 3RUMA 3HHGA 4EXKA 2QVVA 4C1TA 4EUOA 3G3GA 1IXGA 2V93A 2BJJX 2CEXA 3BBRA 1VFDA 2XXVA 2DXYA 2ZXTA 1WODA 2ZZVA 5I2KA 1P1OA 2HAVA 2PBWA 2XWVA 4U2RA 4MCOA 1LBVA 1I6AA 2F97A 1LEVA 3R7XA 3I6VA 4F1UA 4R6KA 3JYRA 1I69A 4NF4B 3TMGA 4NF6B 4MJOA 1FQFA 4NAPA 4OVRA 4MEVA 3KEIA 3MVZA 3KG2A 5KDTB 4OMBA 4H1XA 4O3AA 2H9BA 4BDLA 4DZ1A 2H4IA 2OCUA 1IMBA 5HM4B 1FPBA 2B65A 2PYYA 4BDOA 2QS1A 1EYKA 1SW4A 2OWZA 3ISPA 4HE0A 1CB6A 4YKIA 3EHUA 5J1DA 5AA4A 4FEDA 2DVZA 2NVUB 3GZGA 2GHBA 2OX3A 3CRBA 2VPOA 2DP8A 3Q25A 4QRZA 3HO7A 4JSOA 4MAGA 1FTOA 4XIGQ 2P1SA 3HSTA 5I57A 3OO9A 3GXAA 4ZDMA 1CNQA 3T9UA 1LSTA 4H8IA 4QFLA 4R6HA 4X04A 3LBSA 3O29A 4YAHX 1URSA 4GBVA 3MVYA 4XKRA 5TP9A 4G68C 3IFCA 4LVQA 3TYHA 1DPPA 1NI9A 1A8FA 4N81A 5I59B 4WXJA 4YB6A 4IGRA 2ZNTA 1FPLA 1H44A 2UVJA 3FJGA 5BUUA 1NNFA 1FQCA 1B05A 1MDQA 3D4CA 4N17A 3S9LC 3QAXA 4GL0A 4HS7A 1SYIA 5IM2A 3K1MA 4OVQA 3MZ1A 3W9VA 1NV6A 4GXSB 4OHNA 4O3CA 2DWAA 2F6PA 4GLIA 4OETA 2QMXA 3VXBA 4OYVA 1RKMA 4DE8A 4Z0IA 4LA9A 5CMKA 4H45A 3MSTA 2JJKA 3LSWA 1UTBB 2RCAA 3E4RA 3IB0A 3VVEA 4PAIA 2I58A 5ITOA 3IOTA 1GR2A 5FHMA 4YKKA 1D9YA 4ZEIA 1FTJA 2HPGA 4G68B 1B0LA 1FQEA 3ONMA 4YB7A 4NTLA 3KBRA 3C9HA 1DOTA 2DOJA 2GFEA 2QVRA 4N07A 3IB1A 3TTKA 4G77A 4PC9A 4I40A 3IOUA 2QRYA 3QYTA 1MQGA 4LN5A 4HE1A 4PFWA 1Y9UA 4MX6A 1FQDA 1IQ7A 3SDFA 4MLVA 1DTGA 1FTKA 3ZKLA 4LZ8A 1YPNA 3OSRA 1HSLA 4KYEA 4QSDA 4I3YA 1DBZA 2L5VA 3IOWA 1UTHB 4NF0A 5DVFA 1S9TA 3PTYA 1FBDA 3MJNA 4F3GA 1B5JA 1PB9A 3RN8A 3ODBA 4GWSA 2WYPA 1YXIA 2P3VA 5ITPA 2QPQA 2XHDA 3H6VA 4MMPA 3RY3A 1TT1A 3MVWA 4Q8RA 1XS5A 3DP6A 1BKAA 2F7BA 3C4MA 3VE1B 4EXLA 5H8FA 1LBZA 1NH8A 2OBGA 4YICA 1EU8A 2Q8JA 1USYE 1OVBA 5AA2A 3FUZA 4KI0E 3THIA 3MPKA 4EF2A 4JVCA 4H67A 4P9KA 1TFDA 1A54A 5JEIA 3PU5A 4GD5A 1TXFA 1US4A 4DXBA 1JETA 2RINA 4P0IA 1FBEA 4F3BA 4DIGA 3KBZA 2ZZXA 2DE2A 1POY1 4YMBA 1B58A 3T9HB 3LSFB 3MP6A 3TKDA 5I56A 1FTLA 4I9DA 4PFIA 5TU0A 1GVCA 4OERA 3MZBA 4I62A 3H4ZA 2WKYA 2Z8DA 4OVTA 1FPIA 4HE2A 3K6UA 2DWJA 2UVIA 3LSXA 5CM6A 4PF8A 2ALUA 3QSLA 3OO8A 3C34A 3C32A 4XTCQ 1D9VA 3M3LA 2OK2A 4ECFA 1B3EA 3DLNA 4F1VA 3B6WA 1LBYA 3FXUA 3V8XB 3FJ7A 2QJEA 1Y4TA 3U65A 4RXLA 1MXXA 2XX9A 4FE8A 4H65A 1J1NA 1P1QA 4GWUA 5F7VA 4N6KA 2Y5KA 1SD3A 4OZ9A 4EF1A 5I2NB 3K6WA 1NMUA 4PP0A 2XXRA 3LC8A 3N94A 2XD3A 3U72A 3UA8A 1B3GA 2GRVA 1B52A 3ECRA 2REGA 3T9VA 2BJIA 4F3PA 2KLFA 1Q9DA 2LAOA 3ILUB 1MH4A 2B3BA 2GQ1A 2FYIA 1RYXA 4UACA 3SZPA 3RPLA 4PFRA 3LV0A 4YU0A 2Z8FA 3RPWA 5I7IA 3PPNA 3PPQA 2WX9A 5I58A 1AL3A 5H8QB 2PX1A 4KHZE 1LB8A 3PD9A 1UIUA 2D5WA 4H5GA 3U94A 4HCYA 3EHTA 4TQUQ 4GOTA 1DPEA 1SVXB 5ELVA 4N8GA 1PC3A 4TLLB 2UVGA 4PF6A 1ANFA 4XF5A 3HN0A 5CMCA 1B3LA 4ELPA 1IZ1A 1G0IA 1EYJA 4QFKA 2A5TA 5H8NB 3FVOA 1QGXA 1MQJA 3OSQA 3QMFA 2X7PA 1QULA 1USYH 2WBBA 1Y20A 4BDRA 1NV5A 4KXPA 5CRYA 3VDFA 2XXXA 1MXVA 4POXA 4F1YA 2V3TA 2Q2CA 5AA4B 4YZZA 3TTRA 1NV3A 4GBWA 4GWWA 1FJ6A 2R8TA 2Y7RA 3FVNA 1H43A 3K1PA 5HBCA 2RC8A 1OVTA 1ZJLA 4FJPA 1B6HA 1IMFA 2VPNA 4O3BA 3H6WA 1N84A 4PFTA 1FBHA 5I57B 4XXUA 2OLBA 4U4SA 4QF9A 3K6VA 1I6QA 3OMBA 3H6UA 1VDWA 3MWBA 3U92A 2ZMBA 1RDXA 3UN6A 3B7DA 4Q0CA 5IZ1A 4O7IA 3V5AA 1M5BA 5EYGA 1JW1A 2QFLA 2MKZA 4LQ2A 3T93B 1M5DA 2M8CA 5CC2A 4RYAA 3IJXB 1Y1MA 4RPNA 4OFJA 3T66A 2O69A 1K9ZA 1LBCA 2D21A 3T9XB 4AB6A 1FCKA 1BK4A 5H8SA 4U4XA 5LDZA 4OTEA 3KJTA 4IY6A 4HW8A 5EQ7A 4WKMA 3G3KA 1LFGA 2Y7PA 1O7TA 5L8DA 1P1NA 2Y7IA 4ZEFA 3TQLA 3KZGA 2W7YA 3SERA 4PTKA 4WEDA 4N15A 3L6GA 3V89B 2XXQA 1IMAA 3C33A 2CZIA 1Y4CA 2DXRA 4R6YA 3LR1A 5IAIA 1MG1A 3IAZA 4JVIA 4DI4B 5EYFA 3DM0A 4P47A 5BWJA 3CFXA 3S9MC 3A3CA 4GF8A 4OFOA 3O28A 3Q27A 4IO7A 4FBPA 5DVIA 5ET8A 2V25A 1FSAA 3EKIA 2H25A 1NUZA 1D3KA 2I6EA 3B6TA 3H03A 1IXHA 4MHFA 5DT6A 1SBPA 3CHGA 1N7XA 2HQ0A 4MNIA 1FPGA 2PVUA 4GVOA 1DSNA 4X1DA 1P1UA 1D4NA 2XWKA 3UK4A 5IZ3B 1TFAA 2V4CA 1Y3PA 4NWDA 3ROJA 5ISUA 2R6GE 2RF1A 1BLFA 3W9WA 3M3FA 1MY4A 4I1DA 3FGSA 5ET5A 3E3KA 2QMWA 4NF5A 4G8NA 4BDNA 1ZTYA 4IO5A 5AA3A 4N6DA 2H98A 4AS4A 4LP2B 2RC7A 3O6HA 4P11A 1EYIA 3A09A 3E79A 2F7AA 5AE4A 5K2YA 1N3WA 3O6IA 2VGQA 4KFQA 2X26A 1IITA 5A5XB 2XXPA 3RTWB 2Y7KA 3G3FA 5CBRA 2FHYA 5H8HB 5HPQA 3TUSA 3K1NA 5JK4A 1B40A 3PUYE 4GQOA 4EQ9A 3VLWA 1PB8A 4NMYA 5DVJA 4RNSA 4PQJA 1I6BA 2I49A 5FHOA 1NUYA 3OEMA 3Q26A 2QS2A 4QHQA 2DQVA 3S9EA 1MY2A 3GBAA 5EQAA 2ESNA 3E78A 4R75A 5IZZA 1Q1KA 2O7UA 1LFHA 3I3VA 1JW4A 4QXDA 2UXAA 1Z7ME 4WEPA 4HCWA 1B4ZA 2P0SA 1B7HA 4JWYA 4KQPA 1INPA 3RQTA 2HFBA 3FVKA 1NV4A 2Z8EA 3PMVA 3SEXA 2P2AA 3BKIB 1LBWA 4IO3A 1AWBA 3RLFE 4KYDA 3D1RA 1POTA 1JVXA 1PB7A 1B32A 2FVZA 4U21A 4PE5B 2OWSA 3OELA 3T0JA 3HV1A 2XX7A 3O2AA 3BIGA 5A5LA 3FJMA 4NE4A 4R2FA 2YLNA 5JTYB 4NF4A 1OQHA 1URGA 1NV0A 1II5A 3PPOA 3VV5A 1O64A 4PBQA 1EZ9A 2HXWA 1FPJA 3HCQA 2DWHA 3H3GA 2DS9A 4JSDA 1FPDA 5LTCA 1SPIA 1IEJA 4AQ4A 2Q74A 3QUFA 4GRKA 4GWXA 3RTFB 4GWYA 4YKJA 3C35A 4L17A 4C0RA 5IKBA 4GX4A 5TPAA 1R1NA 2VT5A 4JVDA 1XVYA 1M5EA 3SEVA 3WAFA 3OD7A 5ESYA 1UQWA 5EHMA 4C1UA 4QFOA 2DE3A 1ZKBA 1PEBA 3ZKKA 2CZHA 4KYSA 1WVJA 4QBAA 2R71A 3MAMA 4POWA 3EF7A 2O68A 2V3QA 2F36A 2AL4A 3KOTA 1IXCA 2D3IA 1MXUA 3OO7A 4DCYA 3KFMA 4F31B 4N4UA 1MQIA 3DELB 2QSXA 2E1SA 1HSEA 2ZYOA 4O7MA 4XKQA 4DXUA 2F3DA 3TZAA 3IB2A 1LBBA 3CFLA 5M2VA 3PV0E 1B3HA 4R2BA 4OANA 2DYXA 4ZS9A 3PPPA 5I59A 1IIWA 1ZLQA 4OA4A 3LSLA 4RA1A 2RC9A 4Q5TA 1GTKA 4GFRA 2F78A 1B1XA 1D9QA 2F34A 3SEUA 3E13X 3FIRA 4E0XA 5FHNA 4KPTA 4OVSA 4Q30B 2HEUA 2IA4A 1VE4A 2DSFA 4TOZA 1MH3A 1MRPA 3N6UA 1NV1A 4P3LA 4UA8A 1R9QA 2PT2A 4IB2A 3KN3A 4NHBA 5ICTA 1IUDA 2I48A 3FD3A 4DXCA 4G68A 3KOSA 4K3FA 4G2ZA 1AIVA 4O8MA 1MXWA 5DTBA 1MQDA 4F2QA 1KA0A 3MUQA 5DEXB 3U93A 3UORA 5IGAA 3FBPA 4UABA 3PUZE 1FPFA 4ZZAA 2DDKA 4KR5A 4YMAA 3H06B 1Y3NA 5KZTA 3OXNA 2H99A 2KQZA 4PFUA 3A3UA 4MF3A 3QUJA 2O84X 4ZEBA 4ZEDA 3CSBA 4N13A 3TDJA 2AYSA 1FBFA 3IX1A 1XT8A 1FRPA 1UTHA 3SESA 1DK4A 1NUWA 3JZJA 1B0HA 2B3FA 1NNKA 2HCAA 4X1BA 4RJZA 5I2KB 3B50A 3VFJA 4FAJA 5FBPA 3IORA 1S7YA 3P7IA 4E0WA 3IL1B 4PDDA 2XWIA 1IMEA 2ANJA 2R9JA 4GXAA 1JEVA 4NG7A 2ABHA 5EYHA 3IJOB 2XXKA 4G4PA 3GBBA 1SQYA 1PDAA 2CZKA 2QS4A 2WBDA 2KR0A 5I84A 2ONKE 4QFNA 2UYFA 4G61A 2Q2AA 4ZEKA 4IO4A 4QSCA 5L9SA 3G3JA 2DVCA 3CVGA 3EQ1A 1PBPA 1MY1A 3IO4A 2NOOA 1A8EA 4KCDA 1SDXA 3K01A 1SW5A 3VVDA 2A5SA 2OZZA 2XX8A 1ATGA 1OLAA 1R6ZA 3MW0A 1NL5A 1OIBA 4NF5B 1XOCA 2OWTA 1LFIA 3R6UA 1GV8A 1A40A 1FBPA 1M5FA 4RPOA 4OXVA 3M3KA 2OJTA 2AL5A 2I3WA 2Z22A 2UYEA 1FW0A 2XXHA 3TCGA 1ZMGA 2E0SA 5TP9B 4PCDA 1ZBMA 3V83A 3MZ9A 2HXRA 4F2OA 4RK9A 2XXUA 3N26A 3B6QA 4YKPA 5CMMA 3C36A 1KA1A 1FTMA 2HZKA 4GX6A 3VLUA 4KCCA 1G0HA 5I2NA 1R9LA 3RNNA 3AXFA 3FVGA 4LQ5A 1N76A 3TCFA 4P1LA 2Y5LA 3K0VA 4F22A 4BDMA 1NNTA 3KSXA 2UVHA 1MDP1 4ESXA 3TCHA 1VR5A 1WDNA 1SW1A 2FIXA 1ELJA 5KCJA 1RYOA 1FBGA 5FTHA 1SI0A 3U1OA 3FZVA 2XXTA 5H8QA 1LAHE 1JW5A 5LOMA 4EQ7A 1EZOA 2PMSA 4ZE8A 1YYZA 3MC2A 4FATA 3H7MA 1K9YA 2FNCA 3TEPA 4IR8A 1DMBA 2HHMA 2O51A 3KC0A 1SYHA 1B7UA 2XXIA 3PMXA 4ZECA 2G93A 4IY5A 4I8CA 2FA7A 4G8HA 2H5YA 3KJ7A 2PFYA 5H8NA 4G8MA 1N7WA 3MBPA 1H76A 4XEQA 1B4HA 1IMDA 4HXVA 4IGTA 4GL8A 2ZNSA 1A55A 4PGNA 5TPAB 5F1QA 3PUXE 3QIMA 4X48A 2F6GA 1FQAA 1MY0A 1MXYA 4OQOA 2NWJA 3W15C 4R9GA 3TTLA 3TFLA 1A99A 1YZ0A 3F11A 1QKBA 2QL3A 2V84A 5FTIA 2Q89A 3BIHA 3G7WA 3PUVE 3NOHA 2CEYA 2PT1A 3CSGA 5H8FB 3MYUA 3IFAA 2ZNUA 4TLMB 3FASA 3GYYA 1NV7A 1B2HA 4AS5A 5AA2B 3HPIA 4H6DA 3ILTB 4QFPA 3LUYA 4FIMA 3KN8A 3UP9A 5CI5A 4HTGA 4IO2A 3UIFA 1F9BA 4PAFA 4THIA 3MP1A 2CZLA 1JNFA 1FJ9A 4EQBA 3K6XA 3G3HA 4PAKA 3OOAA 1US5A 4U1OA 5B7DA 3KC1A 3N5LA 3U8QA 4NF8A 1LBXA 4DDDA 2DWIA 2YJPA 2Q88A 4AB5A 1NUXA 2XXYA 1JEUA 4ELOA 5I56B 4ZE9A 1PBQA 4H46A 3A29A 2B4MA 2QS3A 3TQWA 1MY3A 1MS7A 3SEWA 3R26A 1B1HA 4N8YA 2I3VA 3K2DA 2REJA 3OEKA 4P8BA 3PPRA 1BTJA 4P0GA 3G3IA 4ZZEA 2I4BA 1Y1ZA 3GLBA 3EN3A 4OVJA 1SI1A 5AA1A 2I4CA 3CFZA 4QSEA 4MIJA 1QJMA 3M8UA 4NF6A 3LUZA 3RYDA 1A7LA 3ZSFA 3OO6A 3UGWA 2VD3A 1BP5A 2I0BA 2ZYKA 2WYKA 1CE2A 4P1EA 3B8BA 2X7QA 4DCXA 4DLDA 3H6TA 5KDTA 4MFIA 3CG1A 1OQGA 4X9TA 3Q29A 3BFUA 3L6HA 2HAUA 4PDHA 3EPEA 2FIEA 4PGPA 3FXQA 4F3SA 4JWOA 3E9XA 1YCJA 3T22A 4LATA 2XD2A 2F5XA 1Q35A 3RPLB 1Y3QA 1B3FA 3VXCA 4GWOA 1MPDA 2XWOA 5I58B 3MP8A 1QUKA 2HZLA 4F18A 5IZ3A 4ONYA 4ELRA 3FXRA 1RDYA 1DTZA 1MM6A 1P1WA 3S4UA 4H5FA 2QVUA 1H3DA 4R73A 5ET7A 4U22A 4DI3D 1YTVA 2ONSA 2VD2A 1SW2A 1MPBA 3O97A 2Q8MA 1B9JA 2F7CA 3IR1A 2A5TB 3MQ9A 5DW8A 4RY1A 3FATA 4R72A 4MBPA 5J16A 3IO6A 4M4GA 2F35A 1NNPA 3O6GA 3VLVA 5A5XA 5H8HA 1N3XA 4JXIA 4ND9A 3TELA 4U1ZA 2VHAA 4LZ5A 2RKMA 4PFYA 4R9FA 2P3NA 1EZPA 4MNCA 3QK6A 1B7ZA 3FV2A 3TTMA 4FEBA 1RDZA 4OESA 4KD5A 3O9PA 1ZIUA 4ELQA 1O63A 3SKPA 5T3JA 4MNPA 3TODA 3MVXA 2GHAA 1URDA 2V3UA 1T0KA 4R74A 3S9NC 3KSJA 3DP4A 1Z7NE 1UTBA 3D4GA 3Q28A 1LAGE 5EQ9A 2ZZWA 4LZ7A 4PBHA 1FBCA 3O66A 4XFEA 3JV9A 1P99A 1VFEA
chains in the Genus database with same CATH topology
3VVFA 1EH3A 2Y7WA 2VOZA 2F8DA 4OEUA 2O1LA 1N0TA 1AMFA 3N6TA 2CMOA 2IEEA 4H0WA 2ZYMA 1BIYA 4NEDA 4ESWA 4EDPA 2ZYNA 2O7IA 4H8JA 5JTYA 4M1VA 4F29A 1AOVA 4FECA 3SETA 3OENA 2NUVA 5L9OA 4OEVA 5CMBA 4Z7EA 3MPLA 2G29A 3CR9A 4OFLA 3QXMA 3SEYA 2GH9A 3CG3A 4PETA 5KCJB 1LLSA 3USDA 1UIVA 1JQFA 1LCTA 5EHSA 1MXZA 4XKPA 2XXWA 4NWCA 3ZS6A 3RT6B 4FORA 3PMWA 1YAEA 1OMPA 1QUJA 1H45A 1FQBA 3CI8A 3I5OA 5AA2D 3TAJA 2VP1A 4JB7A 5ICQA 1VSOA 1QW0A 4LUBA 3HHFA 2DE4A 1LAXA 1QVSA 4JBZA 1LAFE 2THIA 1TWYA 5B70A 2Q9TA 1LB9A 1B5IA 1QUIA 2Y84A 2RCBA 3IK6B 5K2XA 2O6AA 3EHSA 4XKNA 3TPAA 4MH5A 3BFTA 1M5CA 1AH5A 2AIXA 1B51A 3C31A 1NFTA 3DP8A 4IO6A 4YB5A 1HSJA 4LONB 1OLCA 3K00A 3KGCA 2YPNA 1ZU0A 3CIJA 1KWHA 3PGFA 4F39A 4U23A 1NKXA 3TTNA 1MQHA 3RT8A 3RGYA 4GIZA 3IOVA 4RK2A 3WAEA 3T96B 1NH7A 1B5HA 4F19A 4ISUA 5L9MA 3KN7A 3PUWE 4JDFA 4MLQA 5DYHA 1LGBC 1XHYA 5DEXA 4OENA 5CBSA 1XVXA 4JWXA 1N04A 1L5TA 1MM7A 2NXOA 2Z23A 1XC1A 3FV1A 3S2VA 3PD8A 1S50A 4NF8B 3K02A 4BLAA 2ONRA 4N6PA 2I0CA 2O1MA 4BDQA 1GGGA 1MPCA 1LCFA 1QKAA 3K4UA 1B46A 4OWDA 1IXIA 1JVYA 3RUMA 3HHGA 4EXKA 4C1TA 4EUOA 3G3GA 1IXGA 2V93A 2BJJX 3BBRA 1VFDA 2XXVA 2DXYA 2ZXTA 1WODA 5I2KA 1P1OA 2HAVA 2PBWA 4U2RA 1I6AA 2F97A 3R7XA 3I6VA 4F1UA 4R6KA 3JYRA 1I69A 4NF4B 3TMGA 4NF6B 1FQFA 3KEIA 3MVZA 3KG2A 5KDTB 4OMBA 4H1XA 4O3AA 2H9BA 4BDLA 4DZ1A 2H4IA 2OCUA 5HM4B 2B65A 2PYYA 4BDOA 2QS1A 1SW4A 1CB6A 4YKIA 3EHUA 5J1DA 5AA4A 4FEDA 2DVZA 2NVUB 3GZGA 2GHBA 3CRBA 2DP8A 3Q25A 4QRZA 3HO7A 4JSOA 1FTOA 4XIGQ 2P1SA 3HSTA 5I57A 3OO9A 3GXAA 4ZDMA 3T9UA 1LSTA 4H8IA 4QFLA 4R6HA 3LBSA 3O29A 4YAHX 1URSA 3MVYA 4XKRA 5TP9A 4G68C 3TYHA 4LVQA 1DPPA 1A8FA 5I59B 4WXJA 4YB6A 4IGRA 2ZNTA 1H44A 2UVJA 3FJGA 5BUUA 1NNFA 1FQCA 1B05A 1MDQA 3D4CA 3S9LC 3QAXA 4GL0A 4HS7A 1SYIA 3K1MA 3MZ1A 3W9VA 4GXSB 4OHNA 4O3CA 2DWAA 2F6PA 4GLIA 4OETA 2QMXA 3VXBA 4OYVA 1RKMA 4DE8A 4Z0IA 4LA9A 5CMKA 3LSWA 1UTBB 2RCAA 3E4RA 3IB0A 3VVEA 2I58A 5ITOA 3IOTA 1GR2A 5FHMA 4YKKA 1D9YA 4ZEIA 1FTJA 4G68B 1B0LA 1FQEA 3ONMA 4YB7A 4NTLA 3KBRA 3C9HA 1DOTA 2DOJA 2GFEA 4N07A 3IB1A 3TTKA 4G77A 3IOUA 2QRYA 3QYTA 1MQGA 4PFWA 1Y9UA 1FQDA 1IQ7A 3SDFA 4MLVA 1DTGA 1FTKA 3ZKLA 4LZ8A 1YPNA 3OSRA 1HSLA 4KYEA 4QSDA 3IOWA 1UTHB 5DVFA 1S9TA 3MJNA 4F3GA 1B5JA 1PB9A 3RN8A 3ODBA 5ITPA 2QPQA 2XHDA 3H6VA 3RY3A 1TT1A 3MVWA 4Q8RA 1XS5A 3DP6A 1BKAA 2F7BA 3C4MA 3VE1B 4EXLA 5H8FA 1NH8A 2OBGA 4YICA 1EU8A 2Q8JA 1USYE 1OVBA 5AA2A 3FUZA 4KI0E 3THIA 3MPKA 4EF2A 4H67A 1TFDA 1A54A 5JEIA 3PU5A 4GD5A 1TXFA 1US4A 4DXBA 1JETA 2RINA 4P0IA 4F3BA 4DIGA 2DE2A 1POY1 4YMBA 1B58A 3T9HB 3LSFB 3MP6A 3TKDA 5I56A 1FTLA 4I9DA 5TU0A 1GVCA 4OERA 3MZBA 4I62A 3H4ZA 2WKYA 2Z8DA 3K6UA 2DWJA 2UVIA 3LSXA 5CM6A 2ALUA 3QSLA 3OO8A 3C34A 3C32A 4XTCQ 1D9VA 3M3LA 2OK2A 4ECFA 1B3EA 3DLNA 4F1VA 3B6WA 3FXUA 3V8XB 3FJ7A 2QJEA 1Y4TA 4RXLA 1MXXA 2XX9A 4FE8A 4H65A 1J1NA 1P1QA 5F7VA 1SD3A 4OZ9A 4EF1A 5I2NB 3K6WA 1NMUA 4PP0A 2XXRA 3LC8A 3N94A 2XD3A 3U72A 3UA8A 1B3GA 2GRVA 1B52A 3ECRA 2REGA 3T9VA 4F3PA 2KLFA 2LAOA 3ILUB 1MH4A 2B3BA 2FYIA 1RYXA 4UACA 4YU0A 2Z8FA 3RPWA 3PPNA 3PPQA 5I58A 1AL3A 5H8QB 2PX1A 4KHZE 1LB8A 3PD9A 1UIUA 2D5WA 4H5GA 3U94A 4HCYA 3EHTA 4TQUQ 4GOTA 1DPEA 1SVXB 5ELVA 1PC3A 4TLLB 2UVGA 1ANFA 3HN0A 5CMCA 1B3LA 4ELPA 1IZ1A 4QFKA 2A5TA 5H8NB 3FVOA 1MQJA 3OSQA 2X7PA 1QULA 1USYH 1Y20A 4BDRA 5CRYA 3VDFA 2XXXA 1MXVA 4POXA 4F1YA 2V3TA 2Q2CA 5AA4B 4YZZA 3TTRA 2Y7RA 3FVNA 1H43A 3K1PA 5HBCA 2RC8A 1OVTA 1ZJLA 4FJPA 1B6HA 4O3BA 3H6WA 1N84A 4PFTA 5I57B 4XXUA 2OLBA 4U4SA 4QF9A 3K6VA 1I6QA 3OMBA 3H6UA 3MWBA 3U92A 2ZMBA 3UN6A 3B7DA 4Q0CA 3V5AA 1M5BA 1JW1A 4LQ2A 3T93B 1M5DA 2M8CA 5CC2A 4RYAA 3IJXB 1Y1MA 4RPNA 4OFJA 3T66A 2O69A 1LBCA 2D21A 3T9XB 4AB6A 1FCKA 5H8SA 4U4XA 4OTEA 3KJTA 4IY6A 4HW8A 4WKMA 3G3KA 1LFGA 2Y7PA 1O7TA 5L8DA 1P1NA 2Y7IA 4ZEFA 3TQLA 3KZGA 2W7YA 3SERA 4WEDA 3L6GA 3V89B 2XXQA 3C33A 1Y4CA 2DXRA 4R6YA 3LR1A 5IAIA 1MG1A 3IAZA 5EYFA 3DM0A 5BWJA 3CFXA 3S9MC 3A3CA 4GF8A 4OFOA 3O28A 3Q27A 4IO7A 5DVIA 2V25A 2H25A 1D3KA 2I6EA 3B6TA 3H03A 1IXHA 5DT6A 1SBPA 1N7XA 2HQ0A 2PVUA 4GVOA 1DSNA 4X1DA 1P1UA 1D4NA 3UK4A 1TFAA 4NWDA 1Y3PA 5ISUA 2R6GE 2RF1A 1BLFA 3W9WA 3M3FA 1MY4A 4I1DA 3FGSA 3E3KA 2QMWA 4NF5A 4G8NA 4BDNA 1ZTYA 4IO5A 5AA3A 2H98A 4LP2B 2RC7A 3O6HA 4P11A 3A09A 2F7AA 5AE4A 5K2YA 1N3WA 3O6IA 2VGQA 4KFQA 2X26A 1IITA 5A5XB 2XXPA 3RTWB 2Y7KA 3G3FA 5CBRA 5H8HB 5HPQA 3TUSA 3K1NA 5JK4A 1B40A 3PUYE 4GQOA 4EQ9A 3VLWA 1PB8A 4NMYA 5DVJA 4RNSA 4PQJA 1I6BA 2I49A 5FHOA 3OEMA 3Q26A 2QS2A 4QHQA 2DQVA 3S9EA 1MY2A 3GBAA 2ESNA 4R75A 1Q1KA 2O7UA 1LFHA 3I3VA 1JW4A 2UXAA 1Z7ME 4WEPA 4HCWA 1B4ZA 2P0SA 1B7HA 4JWYA 4KQPA 3RQTA 2HFBA 3FVKA 2Z8EA 3PMVA 3SEXA 2P2AA 3BKIB 4IO3A 3RLFE 4KYDA 1POTA 1JVXA 1PB7A 1B32A 4U21A 4PE5B 2OWSA 3OELA 3HV1A 2XX7A 3O2AA 3FJMA 4NE4A 4R2FA 2YLNA 5JTYB 4NF4A 1OQHA 1URGA 1II5A 3PPOA 3VV5A 1O64A 1EZ9A 2HXWA 3HCQA 2DWHA 3H3GA 2DS9A 4JSDA 1IEJA 4AQ4A 3QUFA 4GRKA 3RTFB 4YKJA 3C35A 4L17A 4C0RA 5IKBA 5TPAA 1R1NA 1XVYA 1M5EA 3SEVA 3WAFA 3OD7A 1UQWA 5EHMA 4C1UA 4QFOA 2DE3A 1ZKBA 1PEBA 3ZKKA 4KYSA 1WVJA 2R71A 3MAMA 4POWA 3EF7A 2O68A 2V3QA 2F36A 2AL4A 3KOTA 1IXCA 2D3IA 1MXUA 3OO7A 4DCYA 3KFMA 4F31B 1MQIA 3DELB 2QSXA 2E1SA 1HSEA 2ZYOA 4XKQA 4DXUA 3TZAA 3IB2A 1LBBA 3CFLA 5M2VA 3PV0E 1B3HA 4R2BA 2DYXA 4ZS9A 3PPPA 5I59A 1IIWA 1ZLQA 3LSLA 4RA1A 2RC9A 4Q5TA 1GTKA 4GFRA 2F78A 1B1XA 2F34A 3SEUA 3E13X 3FIRA 4E0XA 5FHNA 4KPTA 4Q30B 2HEUA 2IA4A 1VE4A 2DSFA 4TOZA 1MH3A 1MRPA 3N6UA 4UA8A 1R9QA 2PT2A 4IB2A 3KN3A 5ICTA 1IUDA 2I48A 3FD3A 4DXCA 4G68A 3KOSA 4K3FA 4G2ZA 1AIVA 1MXWA 5DTBA 1MQDA 4F2QA 3MUQA 5DEXB 3U93A 3UORA 3PUZE 4ZZAA 4KR5A 4YMAA 3H06B 1Y3NA 5KZTA 3OXNA 2H99A 4PFUA 3A3UA 4MF3A 3QUJA 2O84X 4ZEBA 4ZEDA 3CSBA 4N13A 3TDJA 2AYSA 3IX1A 1XT8A 1UTHA 3SESA 3JZJA 1B0HA 2B3FA 1NNKA 2HCAA 4X1BA 4RJZA 5I2KB 3VFJA 4FAJA 3IORA 1S7YA 3P7IA 4E0WA 3IL1B 2ANJA 2R9JA 4GXAA 1JEVA 2ABHA 3IJOB 4G4PA 3GBBA 1SQYA 1PDAA 2QS4A 5I84A 2ONKE 4QFNA 2UYFA 2Q2AA 4ZEKA 4IO4A 4QSCA 5L9SA 3G3JA 2DVCA 3CVGA 3EQ1A 1PBPA 1MY1A 3IO4A 2NOOA 1A8EA 4KCDA 1SDXA 3K01A 1SW5A 3VVDA 2A5SA 2OZZA 2XX8A 1ATGA 1OLAA 1R6ZA 3MW0A 1NL5A 1OIBA 4NF5B 1XOCA 2OWTA 1LFIA 3R6UA 1GV8A 1A40A 1M5FA 4RPOA 4OXVA 3M3KA 2OJTA 2AL5A 2I3WA 2Z22A 2UYEA 1FW0A 2XXHA 3TCGA 1ZMGA 2E0SA 5TP9B 1ZBMA 3V83A 3MZ9A 4F2OA 4RK9A 2XXUA 3N26A 3B6QA 4YKPA 5CMMA 3C36A 1FTMA 2HZKA 3VLUA 4KCCA 5I2NA 1R9LA 3RNNA 3AXFA 3FVGA 4LQ5A 1N76A 3TCFA 3K0VA 4F22A 4BDMA 1NNTA 3KSXA 2UVHA 1MDP1 4ESXA 3TCHA 1VR5A 1WDNA 1SW1A 1ELJA 5KCJA 1RYOA 5FTHA 1SI0A 3U1OA 3FZVA 2XXTA 5H8QA 1LAHE 1JW5A 5LOMA 4EQ7A 1EZOA 2PMSA 4ZE8A 4FATA 3MC2A 3H7MA 2FNCA 3TEPA 1DMBA 2O51A 1SYHA 1B7UA 2XXIA 3PMXA 4ZECA 2G93A 4IY5A 4I8CA 2FA7A 4G8HA 2H5YA 3KJ7A 5H8NA 4G8MA 1N7WA 3MBPA 1H76A 1B4HA 4IGTA 4GL8A 2ZNSA 1A55A 5TPAB 5F1QA 4X48A 3PUXE 3QIMA 2F6GA 1FQAA 1MY0A 1MXYA 4OQOA 2NWJA 3W15C 4R9GA 3TTLA 3TFLA 1A99A 3F11A 1QKBA 2QL3A 2V84A 5FTIA 2Q89A 3G7WA 3PUVE 2PT1A 3CSGA 5H8FB 2ZNUA 4TLMB 3FASA 1B2HA 5AA2B 3HPIA 4H6DA 3ILTB 4QFPA 3LUYA 4FIMA 3KN8A 3UP9A 5CI5A 4HTGA 4IO2A 3UIFA 1F9BA 4THIA 3MP1A 2CZLA 1JNFA 4EQBA 3K6XA 3G3HA 3OOAA 1US5A 4U1OA 5B7DA 3N5LA 3U8QA 4NF8A 4DDDA 2DWIA 2YJPA 2Q88A 4AB5A 2XXYA 1JEUA 4ELOA 5I56B 4ZE9A 1PBQA 2QS3A 3TQWA 1MY3A 1MS7A 3SEWA 3R26A 1B1HA 2I3VA 3K2DA 2REJA 3OEKA 3PPRA 1BTJA 4P0GA 3G3IA 4ZZEA 2I4BA 1Y1ZA 3GLBA 3EN3A 4OVJA 1SI1A 5AA1A 2I4CA 3CFZA 4QSEA 1QJMA 3M8UA 4NF6A 1A7LA 3ZSFA 3OO6A 3UGWA 2VD3A 1BP5A 2I0BA 2ZYKA 1CE2A 2X7QA 4DCXA 4DLDA 3H6TA 5KDTA 4MFIA 3CG1A 1OQGA 4X9TA 3Q29A 3BFUA 3L6HA 2HAUA 3EPEA 3FXQA 4F3SA 4JWOA 3E9XA 1YCJA 3T22A 4LATA 2XD2A 2F5XA 1Q35A 1Y3QA 1B3FA 3VXCA 4GWOA 1MPDA 5I58B 3MP8A 1QUKA 2HZLA 4F18A 4ONYA 4ELRA 3FXRA 1DTZA 1MM6A 1P1WA 3S4UA 4H5FA 1H3DA 4R73A 4U22A 1YTVA 2ONSA 2VD2A 1SW2A 1MPBA 3O97A 1B9JA 2F7CA 3IR1A 2A5TB 3MQ9A 4RY1A 3FATA 4R72A 4MBPA 3IO6A 4M4GA 2F35A 1NNPA 3O6GA 3VLVA 5A5XA 5H8HA 1N3XA 4JXIA 4ND9A 3TELA 4U1ZA 2VHAA 4LZ5A 2RKMA 4PFYA 4R9FA 1EZPA 3QK6A 1B7ZA 3FV2A 3TTMA 4FEBA 4OESA 4KD5A 3O9PA 1ZIUA 4ELQA 1O63A 3SKPA 3TODA 3MVXA 2GHAA 1URDA 2V3UA 1T0KA 4R74A 3S9NC 3KSJA 3DP4A 1Z7NE 1UTBA 3D4GA 3Q28A 1LAGE 4LZ7A 3O66A 3JV9A 1P99A 1VFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VVF A;  1EH3 A;  2Y7W A;  2VOZ A;  2F8D A;  4OEU A;  2O1L A;  1N0T A;  1AMF A;  3N6T A;  2CMO A;  2IEE A;  4H0W A;  2ZYM A;  1BIY A;  4NED A;  4ESW A;  4EDP A;  2ZYN A;  2O7I A;  4H8J A;  5JTY A;  4M1V A;  4F29 A;  1AOV A;  4FEC A;  3SET A;  3OEN A;  2NUV A;  5L9O A;  4OEV A;  5CMB A;  4Z7E A;  3MPL A;  2G29 A;  3CR9 A;  4OFL A;  3QXM A;  3SEY A;  2GH9 A;  3CG3 A;  4PET A;  5KCJ B;  1LLS A;  3USD A;  1UIV A;  1JQF A;  1LCT A;  5EHS A;  1MXZ A;  4XKP A;  2XXW A;  4NWC A;  3ZS6 A;  3RT6 B;  4FOR A;  3PMW A;  1YAE A;  1OMP A;  1QUJ A;  1H45 A;  1FQB A;  3CI8 A;  3I5O A;  5AA2 D;  3TAJ A;  2VP1 A;  4JB7 A;  5ICQ A;  1VSO A;  1QW0 A;  4LUB A;  3HHF A;  2DE4 A;  1LAX A;  1QVS A;  4JBZ A;  1LAF E;  2THI A;  1TWY A;  5B70 A;  2Q9T A;  1LB9 A;  1B5I A;  1QUI A;  2Y84 A;  2RCB A;  3IK6 B;  5K2X A;  2O6A A;  3EHS A;  4XKN A;  3TPA A;  4MH5 A;  3BFT A;  1M5C A;  1AH5 A;  2AIX A;  1B51 A;  3C31 A;  1NFT A;  3DP8 A;  4IO6 A;  4YB5 A;  1HSJ A;  4LON B;  1OLC A;  3K00 A;  3KGC A;  2YPN A;  1ZU0 A;  3CIJ A;  1KWH A;  3PGF A;  4F39 A;  4U23 A;  1NKX A;  3TTN A;  1MQH A;  3RT8 A;  3RGY A;  4GIZ A;  3IOV A;  4RK2 A;  3WAE A;  3T96 B;  1NH7 A;  1B5H A;  4F19 A;  4ISU A;  5L9M A;  3KN7 A;  3PUW E;  4JDF A;  4MLQ A;  5DYH A;  1LGB C;  1XHY A;  5DEX A;  4OEN A;  5CBS A;  1XVX A;  4JWX A;  1N04 A;  1L5T A;  1MM7 A;  2NXO A;  2Z23 A;  1XC1 A;  3FV1 A;  3S2V A;  3PD8 A;  1S50 A;  4NF8 B;  3K02 A;  4BLA A;  2ONR A;  4N6P A;  2I0C A;  2O1M A;  4BDQ A;  1GGG A;  1MPC A;  1LCF A;  1QKA A;  3K4U A;  1B46 A;  4OWD A;  1IXI A;  1JVY A;  3RUM A;  3HHG A;  4EXK A;  4C1T A;  4EUO A;  3G3G A;  1IXG A;  2V93 A;  2BJJ X;  3BBR A;  1VFD A;  2XXV A;  2DXY A;  2ZXT A;  1WOD A;  5I2K A;  1P1O A;  2HAV A;  2PBW A;  4U2R A;  1I6A A;  2F97 A;  3R7X A;  3I6V A;  4F1U A;  4R6K A;  3JYR A;  1I69 A;  4NF4 B;  3TMG A;  4NF6 B;  1FQF A;  3KEI A;  3MVZ A;  3KG2 A;  5KDT B;  4OMB A;  4H1X A;  4O3A A;  2H9B A;  4BDL A;  4DZ1 A;  2H4I A;  2OCU A;  5HM4 B;  2B65 A;  2PYY A;  4BDO A;  2QS1 A;  1SW4 A;  1CB6 A;  4YKI A;  3EHU A;  5J1D A;  5AA4 A;  4FED A;  2DVZ A;  2NVU B;  3GZG A;  2GHB A;  3CRB A;  2DP8 A;  3Q25 A;  4QRZ A;  3HO7 A;  4JSO A;  1FTO A;  4XIG Q;  2P1S A;  3HST A;  5I57 A;  3OO9 A;  3GXA A;  4ZDM A;  3T9U A;  1LST A;  4H8I A;  4QFL A;  4R6H A;  3LBS A;  3O29 A;  4YAH X;  1URS A;  3MVY A;  4XKR A;  5TP9 A;  4G68 C;  3TYH A;  4LVQ A;  1DPP A;  1A8F A;  5I59 B;  4WXJ A;  4YB6 A;  4IGR A;  2ZNT A;  1H44 A;  2UVJ A;  3FJG A;  5BUU A;  1NNF A;  1FQC A;  1B05 A;  1MDQ A;  3D4C A;  3S9L C;  3QAX A;  4GL0 A;  4HS7 A;  1SYI A;  3K1M A;  3MZ1 A;  3W9V A;  4GXS B;  4OHN A;  4O3C A;  2DWA A;  2F6P A;  4GLI A;  4OET A;  2QMX A;  3VXB A;  4OYV A;  1RKM A;  4DE8 A;  4Z0I A;  4LA9 A;  5CMK A;  3LSW A;  1UTB B;  2RCA A;  3E4R A;  3IB0 A;  3VVE A;  2I58 A;  5ITO A;  3IOT A;  1GR2 A;  5FHM A;  4YKK A;  1D9Y A;  4ZEI A;  1FTJ A;  4G68 B;  1B0L A;  1FQE A;  3ONM A;  4YB7 A;  4NTL A;  3KBR A;  3C9H A;  1DOT A;  2DOJ A;  2GFE A;  4N07 A;  3IB1 A;  3TTK A;  4G77 A;  3IOU A;  2QRY A;  3QYT A;  1MQG A;  4PFW A;  1Y9U A;  1FQD A;  1IQ7 A;  3SDF A;  4MLV A;  1DTG A;  1FTK A;  3ZKL A;  4LZ8 A;  1YPN A;  3OSR A;  1HSL A;  4KYE A;  4QSD A;  3IOW A;  1UTH B;  5DVF A;  1S9T A;  3MJN A;  4F3G A;  1B5J A;  1PB9 A;  3RN8 A;  3ODB A;  5ITP A;  2QPQ A;  2XHD A;  3H6V A;  3RY3 A;  1TT1 A;  3MVW A;  4Q8R A;  1XS5 A;  3DP6 A;  1BKA A;  2F7B A;  3C4M A;  3VE1 B;  4EXL A;  5H8F A;  1NH8 A;  2OBG A;  4YIC A;  1EU8 A;  2Q8J A;  1USY E;  1OVB A;  5AA2 A;  3FUZ A;  4KI0 E;  3THI A;  3MPK A;  4EF2 A;  4H67 A;  1TFD A;  1A54 A;  5JEI A;  3PU5 A;  4GD5 A;  1TXF A;  1US4 A;  4DXB A;  1JET A;  2RIN A;  4P0I A;  4F3B A;  4DIG A;  2DE2 A;  1POY 1;  4YMB A;  1B58 A;  3T9H B;  3LSF B;  3MP6 A;  3TKD A;  5I56 A;  1FTL A;  4I9D A;  5TU0 A;  1GVC A;  4OER A;  3MZB A;  4I62 A;  3H4Z A;  2WKY A;  2Z8D A;  3K6U A;  2DWJ A;  2UVI A;  3LSX A;  5CM6 A;  2ALU A;  3QSL A;  3OO8 A;  3C34 A;  3C32 A;  4XTC Q;  1D9V A;  3M3L A;  2OK2 A;  4ECF A;  1B3E A;  3DLN A;  4F1V A;  3B6W A;  3FXU A;  3V8X B;  3FJ7 A;  2QJE A;  1Y4T A;  4RXL A;  1MXX A;  2XX9 A;  4FE8 A;  4H65 A;  1J1N A;  1P1Q A;  5F7V A;  1SD3 A;  4OZ9 A;  4EF1 A;  5I2N B;  3K6W A;  1NMU A;  4PP0 A;  2XXR A;  3LC8 A;  3N94 A;  2XD3 A;  3U72 A;  3UA8 A;  1B3G A;  2GRV A;  1B52 A;  3ECR A;  2REG A;  3T9V A;  4F3P A;  2KLF A;  2LAO A;  3ILU B;  1MH4 A;  2B3B A;  2FYI A;  1RYX A;  4UAC A;  4YU0 A;  2Z8F A;  3RPW A;  3PPN A;  3PPQ A;  5I58 A;  1AL3 A;  5H8Q B;  2PX1 A;  4KHZ E;  1LB8 A;  3PD9 A;  1UIU A;  2D5W A;  4H5G A;  3U94 A;  4HCY A;  3EHT A;  4TQU Q;  4GOT A;  1DPE A;  1SVX B;  5ELV A;  1PC3 A;  4TLL B;  2UVG A;  1ANF A;  3HN0 A;  5CMC A;  1B3L A;  4ELP A;  1IZ1 A;  4QFK A;  2A5T A;  5H8N B;  3FVO A;  1MQJ A;  3OSQ A;  2X7P A;  1QUL A;  1USY H;  1Y20 A;  4BDR A;  5CRY A;  3VDF A;  2XXX A;  1MXV A;  4POX A;  4F1Y A;  2V3T A;  2Q2C A;  5AA4 B;  4YZZ A;  3TTR A;  2Y7R A;  3FVN A;  1H43 A;  3K1P A;  5HBC A;  2RC8 A;  1OVT A;  1ZJL A;  4FJP A;  1B6H A;  4O3B A;  3H6W A;  1N84 A;  4PFT A;  5I57 B;  4XXU A;  2OLB A;  4U4S A;  4QF9 A;  3K6V A;  1I6Q A;  3OMB A;  3H6U A;  3MWB A;  3U92 A;  2ZMB A;  3UN6 A;  3B7D A;  4Q0C A;  3V5A A;  1M5B A;  1JW1 A;  4LQ2 A;  3T93 B;  1M5D A;  2M8C A;  5CC2 A;  4RYA A;  3IJX B;  1Y1M A;  4RPN A;  4OFJ A;  3T66 A;  2O69 A;  1LBC A;  2D21 A;  3T9X B;  4AB6 A;  1FCK A;  5H8S A;  4U4X A;  4OTE A;  3KJT A;  4IY6 A;  4HW8 A;  4WKM A;  3G3K A;  1LFG A;  2Y7P A;  1O7T A;  5L8D A;  1P1N A;  2Y7I A;  4ZEF A;  3TQL A;  3KZG A;  2W7Y A;  3SER A;  4WED A;  3L6G A;  3V89 B;  2XXQ A;  3C33 A;  1Y4C A;  2DXR A;  4R6Y A;  3LR1 A;  5IAI A;  1MG1 A;  3IAZ A;  5EYF A;  3DM0 A;  5BWJ A;  3CFX A;  3S9M C;  3A3C A;  4GF8 A;  4OFO A;  3O28 A;  3Q27 A;  4IO7 A;  5DVI A;  2V25 A;  2H25 A;  1D3K A;  2I6E A;  3B6T A;  3H03 A;  1IXH A;  5DT6 A;  1SBP A;  1N7X A;  2HQ0 A;  2PVU A;  4GVO A;  1DSN A;  4X1D A;  1P1U A;  1D4N A;  3UK4 A;  1TFA A;  4NWD A;  1Y3P A;  5ISU A;  2R6G E;  2RF1 A;  1BLF A;  3W9W A;  3M3F A;  1MY4 A;  4I1D A;  3FGS A;  3E3K A;  2QMW A;  4NF5 A;  4G8N A;  4BDN A;  1ZTY A;  4IO5 A;  5AA3 A;  2H98 A;  4LP2 B;  2RC7 A;  3O6H A;  4P11 A;  3A09 A;  2F7A A;  5AE4 A;  5K2Y A;  1N3W A;  3O6I A;  2VGQ A;  4KFQ A;  2X26 A;  1IIT A;  5A5X B;  2XXP A;  3RTW B;  2Y7K A;  3G3F A;  5CBR A;  5H8H B;  5HPQ A;  3TUS A;  3K1N A;  5JK4 A;  1B40 A;  3PUY E;  4GQO A;  4EQ9 A;  3VLW A;  1PB8 A;  4NMY A;  5DVJ A;  4RNS A;  4PQJ A;  1I6B A;  2I49 A;  5FHO A;  3OEM A;  3Q26 A;  2QS2 A;  4QHQ A;  2DQV A;  3S9E A;  1MY2 A;  3GBA A;  2ESN A;  4R75 A;  1Q1K A;  2O7U A;  1LFH A;  3I3V A;  1JW4 A;  2UXA A;  1Z7M E;  4WEP A;  4HCW A;  1B4Z A;  2P0S A;  1B7H A;  4JWY A;  4KQP A;  3RQT A;  2HFB A;  3FVK A;  2Z8E A;  3PMV A;  3SEX A;  2P2A A;  3BKI B;  4IO3 A;  3RLF E;  4KYD A;  1POT A;  1JVX A;  1PB7 A;  1B32 A;  4U21 A;  4PE5 B;  2OWS A;  3OEL A;  3HV1 A;  2XX7 A;  3O2A A;  3FJM A;  4NE4 A;  4R2F A;  2YLN A;  5JTY B;  4NF4 A;  1OQH A;  1URG A;  1II5 A;  3PPO A;  3VV5 A;  1O64 A;  1EZ9 A;  2HXW A;  3HCQ A;  2DWH A;  3H3G A;  2DS9 A;  4JSD A;  1IEJ A;  4AQ4 A;  3QUF A;  4GRK A;  3RTF B;  4YKJ A;  3C35 A;  4L17 A;  4C0R A;  5IKB A;  5TPA A;  1R1N A;  1XVY A;  1M5E A;  3SEV A;  3WAF A;  3OD7 A;  1UQW A;  5EHM A;  4C1U A;  4QFO A;  2DE3 A;  1ZKB A;  1PEB A;  3ZKK A;  4KYS A;  1WVJ A;  2R71 A;  3MAM A;  4POW A;  3EF7 A;  2O68 A;  2V3Q A;  2F36 A;  2AL4 A;  3KOT A;  1IXC A;  2D3I A;  1MXU A;  3OO7 A;  4DCY A;  3KFM A;  4F31 B;  1MQI A;  3DEL B;  2QSX A;  2E1S A;  1HSE A;  2ZYO A;  4XKQ A;  4DXU A;  3TZA A;  3IB2 A;  1LBB A;  3CFL A;  5M2V A;  3PV0 E;  1B3H A;  4R2B A;  2DYX A;  4ZS9 A;  3PPP A;  5I59 A;  1IIW A;  1ZLQ A;  3LSL A;  4RA1 A;  2RC9 A;  4Q5T A;  1GTK A;  4GFR A;  2F78 A;  1B1X A;  2F34 A;  3SEU A;  3E13 X;  3FIR A;  4E0X A;  5FHN A;  4KPT A;  4Q30 B;  2HEU A;  2IA4 A;  1VE4 A;  2DSF A;  4TOZ A;  1MH3 A;  1MRP A;  3N6U A;  4UA8 A;  1R9Q A;  2PT2 A;  4IB2 A;  3KN3 A;  5ICT A;  1IUD A;  2I48 A;  3FD3 A;  4DXC A;  4G68 A;  3KOS A;  4K3F A;  4G2Z A;  1AIV A;  1MXW A;  5DTB A;  1MQD A;  4F2Q A;  3MUQ A;  5DEX B;  3U93 A;  3UOR A;  3PUZ E;  4ZZA A;  4KR5 A;  4YMA A;  3H06 B;  1Y3N A;  5KZT A;  3OXN A;  2H99 A;  4PFU A;  3A3U A;  4MF3 A;  3QUJ A;  2O84 X;  4ZEB A;  4ZED A;  3CSB A;  4N13 A;  3TDJ A;  2AYS A;  3IX1 A;  1XT8 A;  1UTH A;  3SES A;  3JZJ A;  1B0H A;  2B3F A;  1NNK A;  2HCA A;  4X1B A;  4RJZ A;  5I2K B;  3VFJ A;  4FAJ A;  3IOR A;  1S7Y A;  3P7I A;  4E0W A;  3IL1 B;  2ANJ A;  2R9J A;  4GXA A;  1JEV A;  2ABH A;  3IJO B;  4G4P A;  3GBB A;  1SQY A;  1PDA A;  2QS4 A;  5I84 A;  2ONK E;  4QFN A;  2UYF A;  2Q2A A;  4ZEK A;  4IO4 A;  4QSC A;  5L9S A;  3G3J A;  2DVC A;  3CVG A;  3EQ1 A;  1PBP A;  1MY1 A;  3IO4 A;  2NOO A;  1A8E A;  4KCD A;  1SDX A;  3K01 A;  1SW5 A;  3VVD A;  2A5S A;  2OZZ A;  2XX8 A;  1ATG A;  1OLA A;  1R6Z A;  3MW0 A;  1NL5 A;  1OIB A;  4NF5 B;  1XOC A;  2OWT A;  1LFI A;  3R6U A;  1GV8 A;  1A40 A;  1M5F A;  4RPO A;  4OXV A;  3M3K A;  2OJT A;  2AL5 A;  2I3W A;  2Z22 A;  2UYE A;  1FW0 A;  2XXH A;  3TCG A;  1ZMG A;  2E0S A;  5TP9 B;  1ZBM A;  3V83 A;  3MZ9 A;  4F2O A;  4RK9 A;  2XXU A;  3N26 A;  3B6Q A;  4YKP A;  5CMM A;  3C36 A;  1FTM A;  2HZK A;  3VLU A;  4KCC A;  5I2N A;  1R9L A;  3RNN A;  3AXF A;  3FVG A;  4LQ5 A;  1N76 A;  3TCF A;  3K0V A;  4F22 A;  4BDM A;  1NNT A;  3KSX A;  2UVH A;  1MDP 1;  4ESX A;  3TCH A;  1VR5 A;  1WDN A;  1SW1 A;  1ELJ A;  5KCJ A;  1RYO A;  5FTH A;  1SI0 A;  3U1O A;  3FZV A;  2XXT A;  5H8Q A;  1LAH E;  1JW5 A;  5LOM A;  4EQ7 A;  1EZO A;  2PMS A;  4ZE8 A;  4FAT A;  3MC2 A;  3H7M A;  2FNC A;  3TEP A;  1DMB A;  2O51 A;  1SYH A;  1B7U A;  2XXI A;  3PMX A;  4ZEC A;  2G93 A;  4IY5 A;  4I8C A;  2FA7 A;  4G8H A;  2H5Y A;  3KJ7 A;  5H8N A;  4G8M A;  1N7W A;  3MBP A;  1H76 A;  1B4H A;  4IGT A;  4GL8 A;  2ZNS A;  1A55 A;  5TPA B;  5F1Q A;  4X48 A;  3PUX E;  3QIM A;  2F6G A;  1FQA A;  1MY0 A;  1MXY A;  4OQO A;  2NWJ A;  3W15 C;  4R9G A;  3TTL A;  3TFL A;  1A99 A;  3F11 A;  1QKB A;  2QL3 A;  2V84 A;  5FTI A;  2Q89 A;  3G7W A;  3PUV E;  2PT1 A;  3CSG A;  5H8F B;  2ZNU A;  4TLM B;  3FAS A;  1B2H A;  5AA2 B;  3HPI A;  4H6D A;  3ILT B;  4QFP A;  3LUY A;  4FIM A;  3KN8 A;  3UP9 A;  5CI5 A;  4HTG A;  4IO2 A;  3UIF A;  1F9B A;  4THI A;  3MP1 A;  2CZL A;  1JNF A;  4EQB A;  3K6X A;  3G3H A;  3OOA A;  1US5 A;  4U1O A;  5B7D A;  3N5L A;  3U8Q A;  4NF8 A;  4DDD A;  2DWI A;  2YJP A;  2Q88 A;  4AB5 A;  2XXY A;  1JEU A;  4ELO A;  5I56 B;  4ZE9 A;  1PBQ A;  2QS3 A;  3TQW A;  1MY3 A;  1MS7 A;  3SEW A;  3R26 A;  1B1H A;  2I3V A;  3K2D A;  2REJ A;  3OEK A;  3PPR A;  1BTJ A;  4P0G A;  3G3I A;  4ZZE A;  2I4B A;  1Y1Z A;  3GLB A;  3EN3 A;  4OVJ A;  1SI1 A;  5AA1 A;  2I4C A;  3CFZ A;  4QSE A;  1QJM A;  3M8U A;  4NF6 A;  1A7L A;  3ZSF A;  3OO6 A;  3UGW A;  2VD3 A;  1BP5 A;  2I0B A;  2ZYK A;  1CE2 A;  2X7Q A;  4DCX A;  4DLD A;  3H6T A;  5KDT A;  4MFI A;  3CG1 A;  1OQG A;  4X9T A;  3Q29 A;  3BFU A;  3L6H A;  2HAU A;  3EPE A;  3FXQ A;  4F3S A;  4JWO A;  3E9X A;  1YCJ A;  3T22 A;  4LAT A;  2XD2 A;  2F5X A;  1Q35 A;  1Y3Q A;  1B3F A;  3VXC A;  4GWO A;  1MPD A;  5I58 B;  3MP8 A;  1QUK A;  2HZL A;  4F18 A;  4ONY A;  4ELR A;  3FXR A;  1DTZ A;  1MM6 A;  1P1W A;  3S4U A;  4H5F A;  1H3D A;  4R73 A;  4U22 A;  1YTV A;  2ONS A;  2VD2 A;  1SW2 A;  1MPB A;  3O97 A;  1B9J A;  2F7C A;  3IR1 A;  2A5T B;  3MQ9 A;  4RY1 A;  3FAT A;  4R72 A;  4MBP A;  3IO6 A;  4M4G A;  2F35 A;  1NNP A;  3O6G A;  3VLV A;  5A5X A;  5H8H A;  1N3X A;  4JXI A;  4ND9 A;  3TEL A;  4U1Z A;  2VHA A;  4LZ5 A;  2RKM A;  4PFY A;  4R9F A;  1EZP A;  3QK6 A;  1B7Z A;  3FV2 A;  3TTM A;  4FEB A;  4OES A;  4KD5 A;  3O9P A;  1ZIU A;  4ELQ A;  1O63 A;  3SKP A;  3TOD A;  3MVX A;  2GHA A;  1URD A;  2V3U A;  1T0K A;  4R74 A;  3S9N C;  3KSJ A;  3DP4 A;  1Z7N E;  1UTB A;  3D4G A;  3Q28 A;  1LAG E;  4LZ7 A;  3O66 A;  3JV9 A;  1P99 A;  1VFE A; 
#chains in the Genus database with same CATH topology
 3VVF A;  1EH3 A;  2Y7W A;  2VOZ A;  1FTA A;  1DCU A;  2F8D A;  4OEU A;  2O1L A;  1N0T A;  1AMF A;  4GWZ A;  3N6T A;  2PCR A;  2CMO A;  2IEE A;  4H0W A;  2ZYM A;  1BIY A;  4N91 A;  4PFB A;  4NED A;  4ESW A;  4EDP A;  2ZYN A;  2O7I A;  4H8J A;  5JTY A;  4M1V A;  4F29 A;  1AOV A;  4FEC A;  3SET A;  3OEN A;  2NUV A;  5L9O A;  4OEV A;  1KZ8 A;  1FPK A;  1FPE A;  5CMB A;  4Z7E A;  3T1B A;  3MPL A;  2G29 A;  3CR9 A;  4OFL A;  3QXM A;  3SEY A;  2GH9 A;  3CG3 A;  2B4L A;  4PET A;  5KCJ B;  4NQ8 A;  1LLS A;  3USD A;  1UIV A;  1JQF A;  1LCT A;  5EHS A;  5F24 A;  1MXZ A;  4XKP A;  2XXW A;  4NWC A;  3ZS6 A;  4PE3 A;  3RT6 B;  3HFU A;  4FOR A;  3PMW A;  3FXB A;  1YAE A;  4O94 A;  1OMP A;  1QUJ A;  4I3E A;  1JP4 A;  4GX3 A;  1H45 A;  1FQB A;  3CI8 A;  3I5O A;  5AA2 D;  3TAJ A;  2VP1 A;  4JB7 A;  5I3S A;  5ICQ A;  1VSO A;  4NN3 A;  1QW0 A;  4LUB A;  3HHF A;  2DE4 A;  1LAX A;  1QVS A;  4JBZ A;  1LAF E;  2THI A;  1TWY A;  4P56 A;  5B70 A;  2Q9T A;  1LB9 A;  1B5I A;  1QUI A;  2Y84 A;  2RCB A;  2FBP A;  3IK6 B;  5K2X A;  4NGU A;  2O6A A;  4X8R A;  3EHS A;  4XKN A;  1IMC A;  3TPA A;  4MH5 A;  3BFT A;  1M5C A;  1AH5 A;  2AIX A;  1B51 A;  3C31 A;  1NFT A;  3DP8 A;  4IO6 A;  4YB5 A;  1HSJ A;  4LON B;  1OLC A;  3K00 A;  3KGC A;  2YPN A;  5EQ8 A;  1ZU0 A;  3CIJ A;  1KWH A;  3PGF A;  4F39 A;  4U23 A;  1NKX A;  3TTN A;  1MQH A;  3RT8 A;  2PFZ A;  3RGY A;  2WEF A;  4GIZ A;  3IOV A;  4RK2 A;  3WAE A;  2XA5 A;  3T96 B;  1NH7 A;  1B5H A;  4F19 A;  4ISU A;  5L9M A;  3KN7 A;  3PUW E;  4JDF A;  4MLQ A;  5DYH A;  1LGB C;  1XHY A;  5DEX A;  4OEN A;  5CBS A;  1XVX A;  4JWX A;  1N04 A;  1L5T A;  5I5P A;  1MM7 A;  2NXO A;  4NX1 A;  1XI6 A;  2Z23 A;  1XC1 A;  3FV1 A;  3S2V A;  5ET6 A;  4OVP A;  3PD8 A;  1S50 A;  4NF8 B;  3K02 A;  4BLA A;  2ONR A;  4N6P A;  2I0C A;  2F3B A;  2O1M A;  4BDQ A;  1GGG A;  1MPC A;  1LCF A;  1QKA A;  3K4U A;  1B46 A;  1NV2 A;  4OWD A;  1IXI A;  1JVY A;  3RUM A;  3HHG A;  4EXK A;  2QVV A;  4C1T A;  4EUO A;  3G3G A;  1IXG A;  2V93 A;  2BJJ X;  2CEX A;  3BBR A;  1VFD A;  2XXV A;  2DXY A;  2ZXT A;  1WOD A;  2ZZV A;  5I2K A;  1P1O A;  2HAV A;  2PBW A;  2XWV A;  4U2R A;  4MCO A;  1LBV A;  1I6A A;  2F97 A;  1LEV A;  3R7X A;  3I6V A;  4F1U A;  4R6K A;  3JYR A;  1I69 A;  4NF4 B;  3TMG A;  4NF6 B;  4MJO A;  1FQF A;  4NAP A;  4OVR A;  4MEV A;  3KEI A;  3MVZ A;  3KG2 A;  5KDT B;  4OMB A;  4H1X A;  4O3A A;  2H9B A;  4BDL A;  4DZ1 A;  2H4I A;  2OCU A;  1IMB A;  5HM4 B;  1FPB A;  2B65 A;  2PYY A;  4BDO A;  2QS1 A;  1EYK A;  1SW4 A;  2OWZ A;  3ISP A;  4HE0 A;  1CB6 A;  4YKI A;  3EHU A;  5J1D A;  5AA4 A;  4FED A;  2DVZ A;  2NVU B;  3GZG A;  2GHB A;  2OX3 A;  3CRB A;  2VPO A;  2DP8 A;  3Q25 A;  4QRZ A;  3HO7 A;  4JSO A;  4MAG A;  1FTO A;  4XIG Q;  2P1S A;  3HST A;  5I57 A;  3OO9 A;  3GXA A;  4ZDM A;  1CNQ A;  3T9U A;  1LST A;  4H8I A;  4QFL A;  4R6H A;  4X04 A;  3LBS A;  3O29 A;  4YAH X;  1URS A;  4GBV A;  3MVY A;  4XKR A;  5TP9 A;  4G68 C;  3IFC A;  4LVQ A;  3TYH A;  1DPP A;  1NI9 A;  1A8F A;  4N81 A;  5I59 B;  4WXJ A;  4YB6 A;  4IGR A;  2ZNT A;  1FPL A;  1H44 A;  2UVJ A;  3FJG A;  5BUU A;  1NNF A;  1FQC A;  1B05 A;  1MDQ A;  3D4C A;  4N17 A;  3S9L C;  3QAX A;  4GL0 A;  4HS7 A;  1SYI A;  5IM2 A;  3K1M A;  4OVQ A;  3MZ1 A;  3W9V A;  1NV6 A;  4GXS B;  4OHN A;  4O3C A;  2DWA A;  2F6P A;  4GLI A;  4OET A;  2QMX A;  3VXB A;  4OYV A;  1RKM A;  4DE8 A;  4Z0I A;  4LA9 A;  5CMK A;  4H45 A;  3MST A;  2JJK A;  3LSW A;  1UTB B;  2RCA A;  3E4R A;  3IB0 A;  3VVE A;  4PAI A;  2I58 A;  5ITO A;  3IOT A;  1GR2 A;  5FHM A;  4YKK A;  1D9Y A;  4ZEI A;  1FTJ A;  2HPG A;  4G68 B;  1B0L A;  1FQE A;  3ONM A;  4YB7 A;  4NTL A;  3KBR A;  3C9H A;  1DOT A;  2DOJ A;  2GFE A;  2QVR A;  4N07 A;  3IB1 A;  3TTK A;  4G77 A;  4PC9 A;  4I40 A;  3IOU A;  2QRY A;  3QYT A;  1MQG A;  4LN5 A;  4HE1 A;  4PFW A;  1Y9U A;  4MX6 A;  1FQD A;  1IQ7 A;  3SDF A;  4MLV A;  1DTG A;  1FTK A;  3ZKL A;  4LZ8 A;  1YPN A;  3OSR A;  1HSL A;  4KYE A;  4QSD A;  4I3Y A;  1DBZ A;  2L5V A;  3IOW A;  1UTH B;  4NF0 A;  5DVF A;  1S9T A;  3PTY A;  1FBD A;  3MJN A;  4F3G A;  1B5J A;  1PB9 A;  3RN8 A;  3ODB A;  4GWS A;  2WYP A;  1YXI A;  2P3V A;  5ITP A;  2QPQ A;  2XHD A;  3H6V A;  4MMP A;  3RY3 A;  1TT1 A;  3MVW A;  4Q8R A;  1XS5 A;  3DP6 A;  1BKA A;  2F7B A;  3C4M A;  3VE1 B;  4EXL A;  5H8F A;  1LBZ A;  1NH8 A;  2OBG A;  4YIC A;  1EU8 A;  2Q8J A;  1USY E;  1OVB A;  5AA2 A;  3FUZ A;  4KI0 E;  3THI A;  3MPK A;  4EF2 A;  4JVC A;  4H67 A;  4P9K A;  1TFD A;  1A54 A;  5JEI A;  3PU5 A;  4GD5 A;  1TXF A;  1US4 A;  4DXB A;  1JET A;  2RIN A;  4P0I A;  1FBE A;  4F3B A;  4DIG A;  3KBZ A;  2ZZX A;  2DE2 A;  1POY 1;  4YMB A;  1B58 A;  3T9H B;  3LSF B;  3MP6 A;  3TKD A;  5I56 A;  1FTL A;  4I9D A;  4PFI A;  5TU0 A;  1GVC A;  4OER A;  3MZB A;  4I62 A;  3H4Z A;  2WKY A;  2Z8D A;  4OVT A;  1FPI A;  4HE2 A;  3K6U A;  2DWJ A;  2UVI A;  3LSX A;  5CM6 A;  4PF8 A;  2ALU A;  3QSL A;  3OO8 A;  3C34 A;  3C32 A;  4XTC Q;  1D9V A;  3M3L A;  2OK2 A;  4ECF A;  1B3E A;  3DLN A;  4F1V A;  3B6W A;  1LBY A;  3FXU A;  3V8X B;  3FJ7 A;  2QJE A;  1Y4T A;  3U65 A;  4RXL A;  1MXX A;  2XX9 A;  4FE8 A;  4H65 A;  1J1N A;  1P1Q A;  4GWU A;  5F7V A;  4N6K A;  2Y5K A;  1SD3 A;  4OZ9 A;  4EF1 A;  5I2N B;  3K6W A;  1NMU A;  4PP0 A;  2XXR A;  3LC8 A;  3N94 A;  2XD3 A;  3U72 A;  3UA8 A;  1B3G A;  2GRV A;  1B52 A;  3ECR A;  2REG A;  3T9V A;  2BJI A;  4F3P A;  2KLF A;  1Q9D A;  2LAO A;  3ILU B;  1MH4 A;  2B3B A;  2GQ1 A;  2FYI A;  1RYX A;  4UAC A;  3SZP A;  3RPL A;  4PFR A;  3LV0 A;  4YU0 A;  2Z8F A;  3RPW A;  5I7I A;  3PPN A;  3PPQ A;  2WX9 A;  5I58 A;  1AL3 A;  5H8Q B;  2PX1 A;  4KHZ E;  1LB8 A;  3PD9 A;  1UIU A;  2D5W A;  4H5G A;  3U94 A;  4HCY A;  3EHT A;  4TQU Q;  4GOT A;  1DPE A;  1SVX B;  5ELV A;  4N8G A;  1PC3 A;  4TLL B;  2UVG A;  4PF6 A;  1ANF A;  4XF5 A;  3HN0 A;  5CMC A;  1B3L A;  4ELP A;  1IZ1 A;  1G0I A;  1EYJ A;  4QFK A;  2A5T A;  5H8N B;  3FVO A;  1QGX A;  1MQJ A;  3OSQ A;  3QMF A;  2X7P A;  1QUL A;  1USY H;  2WBB A;  1Y20 A;  4BDR A;  1NV5 A;  4KXP A;  5CRY A;  3VDF A;  2XXX A;  1MXV A;  4POX A;  4F1Y A;  2V3T A;  2Q2C A;  5AA4 B;  4YZZ A;  3TTR A;  1NV3 A;  4GBW A;  4GWW A;  1FJ6 A;  2R8T A;  2Y7R A;  3FVN A;  1H43 A;  3K1P A;  5HBC A;  2RC8 A;  1OVT A;  1ZJL A;  4FJP A;  1B6H A;  1IMF A;  2VPN A;  4O3B A;  3H6W A;  1N84 A;  4PFT A;  1FBH A;  5I57 B;  4XXU A;  2OLB A;  4U4S A;  4QF9 A;  3K6V A;  1I6Q A;  3OMB A;  3H6U A;  1VDW A;  3MWB A;  3U92 A;  2ZMB A;  1RDX A;  3UN6 A;  3B7D A;  4Q0C A;  5IZ1 A;  4O7I A;  3V5A A;  1M5B A;  5EYG A;  1JW1 A;  2QFL A;  2MKZ A;  4LQ2 A;  3T93 B;  1M5D A;  2M8C A;  5CC2 A;  4RYA A;  3IJX B;  1Y1M A;  4RPN A;  4OFJ A;  3T66 A;  2O69 A;  1K9Z A;  1LBC A;  2D21 A;  3T9X B;  4AB6 A;  1FCK A;  1BK4 A;  5H8S A;  4U4X A;  5LDZ A;  4OTE A;  3KJT A;  4IY6 A;  4HW8 A;  5EQ7 A;  4WKM A;  3G3K A;  1LFG A;  2Y7P A;  1O7T A;  5L8D A;  1P1N A;  2Y7I A;  4ZEF A;  3TQL A;  3KZG A;  2W7Y A;  3SER A;  4PTK A;  4WED A;  4N15 A;  3L6G A;  3V89 B;  2XXQ A;  1IMA A;  3C33 A;  2CZI A;  1Y4C A;  2DXR A;  4R6Y A;  3LR1 A;  5IAI A;  1MG1 A;  3IAZ A;  4JVI A;  4DI4 B;  5EYF A;  3DM0 A;  4P47 A;  5BWJ A;  3CFX A;  3S9M C;  3A3C A;  4GF8 A;  4OFO A;  3O28 A;  3Q27 A;  4IO7 A;  4FBP A;  5DVI A;  5ET8 A;  2V25 A;  1FSA A;  3EKI A;  2H25 A;  1NUZ A;  1D3K A;  2I6E A;  3B6T A;  3H03 A;  1IXH A;  4MHF A;  5DT6 A;  1SBP A;  3CHG A;  1N7X A;  2HQ0 A;  4MNI A;  1FPG A;  2PVU A;  4GVO A;  1DSN A;  4X1D A;  1P1U A;  1D4N A;  2XWK A;  3UK4 A;  5IZ3 B;  1TFA A;  2V4C A;  1Y3P A;  4NWD A;  3ROJ A;  5ISU A;  2R6G E;  2RF1 A;  1BLF A;  3W9W A;  3M3F A;  1MY4 A;  4I1D A;  3FGS A;  5ET5 A;  3E3K A;  2QMW A;  4NF5 A;  4G8N A;  4BDN A;  1ZTY A;  4IO5 A;  5AA3 A;  4N6D A;  2H98 A;  4AS4 A;  4LP2 B;  2RC7 A;  3O6H A;  4P11 A;  1EYI A;  3A09 A;  3E79 A;  2F7A A;  5AE4 A;  5K2Y A;  1N3W A;  3O6I A;  2VGQ A;  4KFQ A;  2X26 A;  1IIT A;  5A5X B;  2XXP A;  3RTW B;  2Y7K A;  3G3F A;  5CBR A;  2FHY A;  5H8H B;  5HPQ A;  3TUS A;  3K1N A;  5JK4 A;  1B40 A;  3PUY E;  4GQO A;  4EQ9 A;  3VLW A;  1PB8 A;  4NMY A;  5DVJ A;  4RNS A;  4PQJ A;  1I6B A;  2I49 A;  5FHO A;  1NUY A;  3OEM A;  3Q26 A;  2QS2 A;  4QHQ A;  2DQV A;  3S9E A;  1MY2 A;  3GBA A;  5EQA A;  2ESN A;  3E78 A;  4R75 A;  5IZZ A;  1Q1K A;  2O7U A;  1LFH A;  3I3V A;  1JW4 A;  4QXD A;  2UXA A;  1Z7M E;  4WEP A;  4HCW A;  1B4Z A;  2P0S A;  1B7H A;  4JWY A;  4KQP A;  1INP A;  3RQT A;  2HFB A;  3FVK A;  1NV4 A;  2Z8E A;  3PMV A;  3SEX A;  2P2A A;  3BKI B;  1LBW A;  4IO3 A;  1AWB A;  3RLF E;  4KYD A;  3D1R A;  1POT A;  1JVX A;  1PB7 A;  1B32 A;  2FVZ A;  4U21 A;  4PE5 B;  2OWS A;  3OEL A;  3T0J A;  3HV1 A;  2XX7 A;  3O2A A;  3BIG A;  5A5L A;  3FJM A;  4NE4 A;  4R2F A;  2YLN A;  5JTY B;  4NF4 A;  1OQH A;  1URG A;  1NV0 A;  1II5 A;  3PPO A;  3VV5 A;  1O64 A;  4PBQ A;  1EZ9 A;  2HXW A;  1FPJ A;  3HCQ A;  2DWH A;  3H3G A;  2DS9 A;  4JSD A;  1FPD A;  5LTC A;  1SPI A;  1IEJ A;  4AQ4 A;  2Q74 A;  3QUF A;  4GRK A;  4GWX A;  3RTF B;  4GWY A;  4YKJ A;  3C35 A;  4L17 A;  4C0R A;  5IKB A;  4GX4 A;  5TPA A;  1R1N A;  2VT5 A;  4JVD A;  1XVY A;  1M5E A;  3SEV A;  3WAF A;  3OD7 A;  5ESY A;  1UQW A;  5EHM A;  4C1U A;  4QFO A;  2DE3 A;  1ZKB A;  1PEB A;  3ZKK A;  2CZH A;  4KYS A;  1WVJ A;  4QBA A;  2R71 A;  3MAM A;  4POW A;  3EF7 A;  2O68 A;  2V3Q A;  2F36 A;  2AL4 A;  3KOT A;  1IXC A;  2D3I A;  1MXU A;  3OO7 A;  4DCY A;  3KFM A;  4F31 B;  4N4U A;  1MQI A;  3DEL B;  2QSX A;  2E1S A;  1HSE A;  2ZYO A;  4O7M A;  4XKQ A;  4DXU A;  2F3D A;  3TZA A;  3IB2 A;  1LBB A;  3CFL A;  5M2V A;  3PV0 E;  1B3H A;  4R2B A;  4OAN A;  2DYX A;  4ZS9 A;  3PPP A;  5I59 A;  1IIW A;  1ZLQ A;  4OA4 A;  3LSL A;  4RA1 A;  2RC9 A;  4Q5T A;  1GTK A;  4GFR A;  2F78 A;  1B1X A;  1D9Q A;  2F34 A;  3SEU A;  3E13 X;  3FIR A;  4E0X A;  5FHN A;  4KPT A;  4OVS A;  4Q30 B;  2HEU A;  2IA4 A;  1VE4 A;  2DSF A;  4TOZ A;  1MH3 A;  1MRP A;  3N6U A;  1NV1 A;  4P3L A;  4UA8 A;  1R9Q A;  2PT2 A;  4IB2 A;  3KN3 A;  4NHB A;  5ICT A;  1IUD A;  2I48 A;  3FD3 A;  4DXC A;  4G68 A;  3KOS A;  4K3F A;  4G2Z A;  1AIV A;  4O8M A;  1MXW A;  5DTB A;  1MQD A;  4F2Q A;  1KA0 A;  3MUQ A;  5DEX B;  3U93 A;  3UOR A;  5IGA A;  3FBP A;  4UAB A;  3PUZ E;  1FPF A;  4ZZA A;  2DDK A;  4KR5 A;  4YMA A;  3H06 B;  1Y3N A;  5KZT A;  3OXN A;  2H99 A;  2KQZ A;  4PFU A;  3A3U A;  4MF3 A;  3QUJ A;  2O84 X;  4ZEB A;  4ZED A;  3CSB A;  4N13 A;  3TDJ A;  2AYS A;  1FBF A;  3IX1 A;  1XT8 A;  1FRP A;  1UTH A;  3SES A;  1DK4 A;  1NUW A;  3JZJ A;  1B0H A;  2B3F A;  1NNK A;  2HCA A;  4X1B A;  4RJZ A;  5I2K B;  3B50 A;  3VFJ A;  4FAJ A;  5FBP A;  3IOR A;  1S7Y A;  3P7I A;  4E0W A;  3IL1 B;  4PDD A;  2XWI A;  1IME A;  2ANJ A;  2R9J A;  4GXA A;  1JEV A;  4NG7 A;  2ABH A;  5EYH A;  3IJO B;  2XXK A;  4G4P A;  3GBB A;  1SQY A;  1PDA A;  2CZK A;  2QS4 A;  2WBD A;  2KR0 A;  5I84 A;  2ONK E;  4QFN A;  2UYF A;  4G61 A;  2Q2A A;  4ZEK A;  4IO4 A;  4QSC A;  5L9S A;  3G3J A;  2DVC A;  3CVG A;  3EQ1 A;  1PBP A;  1MY1 A;  3IO4 A;  2NOO A;  1A8E A;  4KCD A;  1SDX A;  3K01 A;  1SW5 A;  3VVD A;  2A5S A;  2OZZ A;  2XX8 A;  1ATG A;  1OLA A;  1R6Z A;  3MW0 A;  1NL5 A;  1OIB A;  4NF5 B;  1XOC A;  2OWT A;  1LFI A;  3R6U A;  1GV8 A;  1A40 A;  1FBP A;  1M5F A;  4RPO A;  4OXV A;  3M3K A;  2OJT A;  2AL5 A;  2I3W A;  2Z22 A;  2UYE A;  1FW0 A;  2XXH A;  3TCG A;  1ZMG A;  2E0S A;  5TP9 B;  4PCD A;  1ZBM A;  3V83 A;  3MZ9 A;  2HXR A;  4F2O A;  4RK9 A;  2XXU A;  3N26 A;  3B6Q A;  4YKP A;  5CMM A;  3C36 A;  1KA1 A;  1FTM A;  2HZK A;  4GX6 A;  3VLU A;  4KCC A;  1G0H A;  5I2N A;  1R9L A;  3RNN A;  3AXF A;  3FVG A;  4LQ5 A;  1N76 A;  3TCF A;  4P1L A;  2Y5L A;  3K0V A;  4F22 A;  4BDM A;  1NNT A;  3KSX A;  2UVH A;  1MDP 1;  4ESX A;  3TCH A;  1VR5 A;  1WDN A;  1SW1 A;  2FIX A;  1ELJ A;  5KCJ A;  1RYO A;  1FBG A;  5FTH A;  1SI0 A;  3U1O A;  3FZV A;  2XXT A;  5H8Q A;  1LAH E;  1JW5 A;  5LOM A;  4EQ7 A;  1EZO A;  2PMS A;  4ZE8 A;  1YYZ A;  3MC2 A;  4FAT A;  3H7M A;  1K9Y A;  2FNC A;  3TEP A;  4IR8 A;  1DMB A;  2HHM A;  2O51 A;  3KC0 A;  1SYH A;  1B7U A;  2XXI A;  3PMX A;  4ZEC A;  2G93 A;  4IY5 A;  4I8C A;  2FA7 A;  4G8H A;  2H5Y A;  3KJ7 A;  2PFY A;  5H8N A;  4G8M A;  1N7W A;  3MBP A;  1H76 A;  4XEQ A;  1B4H A;  1IMD A;  4HXV A;  4IGT A;  4GL8 A;  2ZNS A;  1A55 A;  4PGN A;  5TPA B;  5F1Q A;  3PUX E;  3QIM A;  4X48 A;  2F6G A;  1FQA A;  1MY0 A;  1MXY A;  4OQO A;  2NWJ A;  3W15 C;  4R9G A;  3TTL A;  3TFL A;  1A99 A;  1YZ0 A;  3F11 A;  1QKB A;  2QL3 A;  2V84 A;  5FTI A;  2Q89 A;  3BIH A;  3G7W A;  3PUV E;  3NOH A;  2CEY A;  2PT1 A;  3CSG A;  5H8F B;  3MYU A;  3IFA A;  2ZNU A;  4TLM B;  3FAS A;  3GYY A;  1NV7 A;  1B2H A;  4AS5 A;  5AA2 B;  3HPI A;  4H6D A;  3ILT B;  4QFP A;  3LUY A;  4FIM A;  3KN8 A;  3UP9 A;  5CI5 A;  4HTG A;  4IO2 A;  3UIF A;  1F9B A;  4PAF A;  4THI A;  3MP1 A;  2CZL A;  1JNF A;  1FJ9 A;  4EQB A;  3K6X A;  3G3H A;  4PAK A;  3OOA A;  1US5 A;  4U1O A;  5B7D A;  3KC1 A;  3N5L A;  3U8Q A;  4NF8 A;  1LBX A;  4DDD A;  2DWI A;  2YJP A;  2Q88 A;  4AB5 A;  1NUX A;  2XXY A;  1JEU A;  4ELO A;  5I56 B;  4ZE9 A;  1PBQ A;  4H46 A;  3A29 A;  2B4M A;  2QS3 A;  3TQW A;  1MY3 A;  1MS7 A;  3SEW A;  3R26 A;  1B1H A;  4N8Y A;  2I3V A;  3K2D A;  2REJ A;  3OEK A;  4P8B A;  3PPR A;  1BTJ A;  4P0G A;  3G3I A;  4ZZE A;  2I4B A;  1Y1Z A;  3GLB A;  3EN3 A;  4OVJ A;  1SI1 A;  5AA1 A;  2I4C A;  3CFZ A;  4QSE A;  4MIJ A;  1QJM A;  3M8U A;  4NF6 A;  3LUZ A;  3RYD A;  1A7L A;  3ZSF A;  3OO6 A;  3UGW A;  2VD3 A;  1BP5 A;  2I0B A;  2ZYK A;  2WYK A;  1CE2 A;  4P1E A;  3B8B A;  2X7Q A;  4DCX A;  4DLD A;  3H6T A;  5KDT A;  4MFI A;  3CG1 A;  1OQG A;  4X9T A;  3Q29 A;  3BFU A;  3L6H A;  2HAU A;  4PDH A;  3EPE A;  2FIE A;  4PGP A;  3FXQ A;  4F3S A;  4JWO A;  3E9X A;  1YCJ A;  3T22 A;  4LAT A;  2XD2 A;  2F5X A;  1Q35 A;  3RPL B;  1Y3Q A;  1B3F A;  3VXC A;  4GWO A;  1MPD A;  2XWO A;  5I58 B;  3MP8 A;  1QUK A;  2HZL A;  4F18 A;  5IZ3 A;  4ONY A;  4ELR A;  3FXR A;  1RDY A;  1DTZ A;  1MM6 A;  1P1W A;  3S4U A;  4H5F A;  2QVU A;  1H3D A;  4R73 A;  5ET7 A;  4U22 A;  4DI3 D;  1YTV A;  2ONS A;  2VD2 A;  1SW2 A;  1MPB A;  3O97 A;  2Q8M A;  1B9J A;  2F7C A;  3IR1 A;  2A5T B;  3MQ9 A;  5DW8 A;  4RY1 A;  3FAT A;  4R72 A;  4MBP A;  5J16 A;  3IO6 A;  4M4G A;  2F35 A;  1NNP A;  3O6G A;  3VLV A;  5A5X A;  5H8H A;  1N3X A;  4JXI A;  4ND9 A;  3TEL A;  4U1Z A;  2VHA A;  4LZ5 A;  2RKM A;  4PFY A;  4R9F A;  2P3N A;  1EZP A;  4MNC A;  3QK6 A;  1B7Z A;  3FV2 A;  3TTM A;  4FEB A;  1RDZ A;  4OES A;  4KD5 A;  3O9P A;  1ZIU A;  4ELQ A;  1O63 A;  3SKP A;  5T3J A;  4MNP A;  3TOD A;  3MVX A;  2GHA A;  1URD A;  2V3U A;  1T0K A;  4R74 A;  3S9N C;  3KSJ A;  3DP4 A;  1Z7N E;  1UTB A;  3D4G A;  3Q28 A;  1LAG E;  5EQ9 A;  2ZZW A;  4LZ7 A;  4PBH A;  1FBC A;  3O66 A;  4XFE A;  3JV9 A;  1P99 A;  1VFE A; 
#chains in the Genus database with same CATH homology
 3VVF A;  1EH3 A;  2Y7W A;  2VOZ A;  2F8D A;  4OEU A;  2O1L A;  1N0T A;  1AMF A;  3N6T A;  2CMO A;  2IEE A;  4H0W A;  2ZYM A;  1BIY A;  4NED A;  4ESW A;  4EDP A;  2ZYN A;  2O7I A;  4H8J A;  5JTY A;  4M1V A;  4F29 A;  1AOV A;  4FEC A;  3SET A;  3OEN A;  2NUV A;  5L9O A;  4OEV A;  5CMB A;  4Z7E A;  3MPL A;  2G29 A;  3CR9 A;  4OFL A;  3QXM A;  3SEY A;  2GH9 A;  3CG3 A;  4PET A;  5KCJ B;  1LLS A;  3USD A;  1UIV A;  1JQF A;  1LCT A;  5EHS A;  1MXZ A;  4XKP A;  2XXW A;  4NWC A;  3ZS6 A;  3RT6 B;  4FOR A;  3PMW A;  1YAE A;  1OMP A;  1QUJ A;  1H45 A;  1FQB A;  3CI8 A;  3I5O A;  5AA2 D;  3TAJ A;  2VP1 A;  4JB7 A;  5ICQ A;  1VSO A;  1QW0 A;  4LUB A;  3HHF A;  2DE4 A;  1LAX A;  1QVS A;  4JBZ A;  1LAF E;  2THI A;  1TWY A;  5B70 A;  2Q9T A;  1LB9 A;  1B5I A;  1QUI A;  2Y84 A;  2RCB A;  3IK6 B;  5K2X A;  2O6A A;  3EHS A;  4XKN A;  3TPA A;  4MH5 A;  3BFT A;  1M5C A;  1AH5 A;  2AIX A;  1B51 A;  3C31 A;  1NFT A;  3DP8 A;  4IO6 A;  4YB5 A;  1HSJ A;  4LON B;  1OLC A;  3K00 A;  3KGC A;  2YPN A;  1ZU0 A;  3CIJ A;  1KWH A;  3PGF A;  4F39 A;  4U23 A;  1NKX A;  3TTN A;  1MQH A;  3RT8 A;  3RGY A;  4GIZ A;  3IOV A;  4RK2 A;  3WAE A;  3T96 B;  1NH7 A;  1B5H A;  4F19 A;  4ISU A;  5L9M A;  3KN7 A;  3PUW E;  4JDF A;  4MLQ A;  5DYH A;  1LGB C;  1XHY A;  5DEX A;  4OEN A;  5CBS A;  1XVX A;  4JWX A;  1N04 A;  1L5T A;  1MM7 A;  2NXO A;  2Z23 A;  1XC1 A;  3FV1 A;  3S2V A;  3PD8 A;  1S50 A;  4NF8 B;  3K02 A;  4BLA A;  2ONR A;  4N6P A;  2I0C A;  2O1M A;  4BDQ A;  1GGG A;  1MPC A;  1LCF A;  1QKA A;  3K4U A;  1B46 A;  4OWD A;  1IXI A;  1JVY A;  3RUM A;  3HHG A;  4EXK A;  4C1T A;  4EUO A;  3G3G A;  1IXG A;  2V93 A;  2BJJ X;  3BBR A;  1VFD A;  2XXV A;  2DXY A;  2ZXT A;  1WOD A;  5I2K A;  1P1O A;  2HAV A;  2PBW A;  4U2R A;  1I6A A;  2F97 A;  3R7X A;  3I6V A;  4F1U A;  4R6K A;  3JYR A;  1I69 A;  4NF4 B;  3TMG A;  4NF6 B;  1FQF A;  3KEI A;  3MVZ A;  3KG2 A;  5KDT B;  4OMB A;  4H1X A;  4O3A A;  2H9B A;  4BDL A;  4DZ1 A;  2H4I A;  2OCU A;  5HM4 B;  2B65 A;  2PYY A;  4BDO A;  2QS1 A;  1SW4 A;  1CB6 A;  4YKI A;  3EHU A;  5J1D A;  5AA4 A;  4FED A;  2DVZ A;  2NVU B;  3GZG A;  2GHB A;  3CRB A;  2DP8 A;  3Q25 A;  4QRZ A;  3HO7 A;  4JSO A;  1FTO A;  4XIG Q;  2P1S A;  3HST A;  5I57 A;  3OO9 A;  3GXA A;  4ZDM A;  3T9U A;  1LST A;  4H8I A;  4QFL A;  4R6H A;  3LBS A;  3O29 A;  4YAH X;  1URS A;  3MVY A;  4XKR A;  5TP9 A;  4G68 C;  3TYH A;  4LVQ A;  1DPP A;  1A8F A;  5I59 B;  4WXJ A;  4YB6 A;  4IGR A;  2ZNT A;  1H44 A;  2UVJ A;  3FJG A;  5BUU A;  1NNF A;  1FQC A;  1B05 A;  1MDQ A;  3D4C A;  3S9L C;  3QAX A;  4GL0 A;  4HS7 A;  1SYI A;  3K1M A;  3MZ1 A;  3W9V A;  4GXS B;  4OHN A;  4O3C A;  2DWA A;  2F6P A;  4GLI A;  4OET A;  2QMX A;  3VXB A;  4OYV A;  1RKM A;  4DE8 A;  4Z0I A;  4LA9 A;  5CMK A;  3LSW A;  1UTB B;  2RCA A;  3E4R A;  3IB0 A;  3VVE A;  2I58 A;  5ITO A;  3IOT A;  1GR2 A;  5FHM A;  4YKK A;  1D9Y A;  4ZEI A;  1FTJ A;  4G68 B;  1B0L A;  1FQE A;  3ONM A;  4YB7 A;  4NTL A;  3KBR A;  3C9H A;  1DOT A;  2DOJ A;  2GFE A;  4N07 A;  3IB1 A;  3TTK A;  4G77 A;  3IOU A;  2QRY A;  3QYT A;  1MQG A;  4PFW A;  1Y9U A;  1FQD A;  1IQ7 A;  3SDF A;  4MLV A;  1DTG A;  1FTK A;  3ZKL A;  4LZ8 A;  1YPN A;  3OSR A;  1HSL A;  4KYE A;  4QSD A;  3IOW A;  1UTH B;  5DVF A;  1S9T A;  3MJN A;  4F3G A;  1B5J A;  1PB9 A;  3RN8 A;  3ODB A;  5ITP A;  2QPQ A;  2XHD A;  3H6V A;  3RY3 A;  1TT1 A;  3MVW A;  4Q8R A;  1XS5 A;  3DP6 A;  1BKA A;  2F7B A;  3C4M A;  3VE1 B;  4EXL A;  5H8F A;  1NH8 A;  2OBG A;  4YIC A;  1EU8 A;  2Q8J A;  1USY E;  1OVB A;  5AA2 A;  3FUZ A;  4KI0 E;  3THI A;  3MPK A;  4EF2 A;  4H67 A;  1TFD A;  1A54 A;  5JEI A;  3PU5 A;  4GD5 A;  1TXF A;  1US4 A;  4DXB A;  1JET A;  2RIN A;  4P0I A;  4F3B A;  4DIG A;  2DE2 A;  1POY 1;  4YMB A;  1B58 A;  3T9H B;  3LSF B;  3MP6 A;  3TKD A;  5I56 A;  1FTL A;  4I9D A;  5TU0 A;  1GVC A;  4OER A;  3MZB A;  4I62 A;  3H4Z A;  2WKY A;  2Z8D A;  3K6U A;  2DWJ A;  2UVI A;  3LSX A;  5CM6 A;  2ALU A;  3QSL A;  3OO8 A;  3C34 A;  3C32 A;  4XTC Q;  1D9V A;  3M3L A;  2OK2 A;  4ECF A;  1B3E A;  3DLN A;  4F1V A;  3B6W A;  3FXU A;  3V8X B;  3FJ7 A;  2QJE A;  1Y4T A;  4RXL A;  1MXX A;  2XX9 A;  4FE8 A;  4H65 A;  1J1N A;  1P1Q A;  5F7V A;  1SD3 A;  4OZ9 A;  4EF1 A;  5I2N B;  3K6W A;  1NMU A;  4PP0 A;  2XXR A;  3LC8 A;  3N94 A;  2XD3 A;  3U72 A;  3UA8 A;  1B3G A;  2GRV A;  1B52 A;  3ECR A;  2REG A;  3T9V A;  4F3P A;  2KLF A;  2LAO A;  3ILU B;  1MH4 A;  2B3B A;  2FYI A;  1RYX A;  4UAC A;  4YU0 A;  2Z8F A;  3RPW A;  3PPN A;  3PPQ A;  5I58 A;  1AL3 A;  5H8Q B;  2PX1 A;  4KHZ E;  1LB8 A;  3PD9 A;  1UIU A;  2D5W A;  4H5G A;  3U94 A;  4HCY A;  3EHT A;  4TQU Q;  4GOT A;  1DPE A;  1SVX B;  5ELV A;  1PC3 A;  4TLL B;  2UVG A;  1ANF A;  3HN0 A;  5CMC A;  1B3L A;  4ELP A;  1IZ1 A;  4QFK A;  2A5T A;  5H8N B;  3FVO A;  1MQJ A;  3OSQ A;  2X7P A;  1QUL A;  1USY H;  1Y20 A;  4BDR A;  5CRY A;  3VDF A;  2XXX A;  1MXV A;  4POX A;  4F1Y A;  2V3T A;  2Q2C A;  5AA4 B;  4YZZ A;  3TTR A;  2Y7R A;  3FVN A;  1H43 A;  3K1P A;  5HBC A;  2RC8 A;  1OVT A;  1ZJL A;  4FJP A;  1B6H A;  4O3B A;  3H6W A;  1N84 A;  4PFT A;  5I57 B;  4XXU A;  2OLB A;  4U4S A;  4QF9 A;  3K6V A;  1I6Q A;  3OMB A;  3H6U A;  3MWB A;  3U92 A;  2ZMB A;  3UN6 A;  3B7D A;  4Q0C A;  3V5A A;  1M5B A;  1JW1 A;  4LQ2 A;  3T93 B;  1M5D A;  2M8C A;  5CC2 A;  4RYA A;  3IJX B;  1Y1M A;  4RPN A;  4OFJ A;  3T66 A;  2O69 A;  1LBC A;  2D21 A;  3T9X B;  4AB6 A;  1FCK A;  5H8S A;  4U4X A;  4OTE A;  3KJT A;  4IY6 A;  4HW8 A;  4WKM A;  3G3K A;  1LFG A;  2Y7P A;  1O7T A;  5L8D A;  1P1N A;  2Y7I A;  4ZEF A;  3TQL A;  3KZG A;  2W7Y A;  3SER A;  4WED A;  3L6G A;  3V89 B;  2XXQ A;  3C33 A;  1Y4C A;  2DXR A;  4R6Y A;  3LR1 A;  5IAI A;  1MG1 A;  3IAZ A;  5EYF A;  3DM0 A;  5BWJ A;  3CFX A;  3S9M C;  3A3C A;  4GF8 A;  4OFO A;  3O28 A;  3Q27 A;  4IO7 A;  5DVI A;  2V25 A;  2H25 A;  1D3K A;  2I6E A;  3B6T A;  3H03 A;  1IXH A;  5DT6 A;  1SBP A;  1N7X A;  2HQ0 A;  2PVU A;  4GVO A;  1DSN A;  4X1D A;  1P1U A;  1D4N A;  3UK4 A;  1TFA A;  4NWD A;  1Y3P A;  5ISU A;  2R6G E;  2RF1 A;  1BLF A;  3W9W A;  3M3F A;  1MY4 A;  4I1D A;  3FGS A;  3E3K A;  2QMW A;  4NF5 A;  4G8N A;  4BDN A;  1ZTY A;  4IO5 A;  5AA3 A;  2H98 A;  4LP2 B;  2RC7 A;  3O6H A;  4P11 A;  3A09 A;  2F7A A;  5AE4 A;  5K2Y A;  1N3W A;  3O6I A;  2VGQ A;  4KFQ A;  2X26 A;  1IIT A;  5A5X B;  2XXP A;  3RTW B;  2Y7K A;  3G3F A;  5CBR A;  5H8H B;  5HPQ A;  3TUS A;  3K1N A;  5JK4 A;  1B40 A;  3PUY E;  4GQO A;  4EQ9 A;  3VLW A;  1PB8 A;  4NMY A;  5DVJ A;  4RNS A;  4PQJ A;  1I6B A;  2I49 A;  5FHO A;  3OEM A;  3Q26 A;  2QS2 A;  4QHQ A;  2DQV A;  3S9E A;  1MY2 A;  3GBA A;  2ESN A;  4R75 A;  1Q1K A;  2O7U A;  1LFH A;  3I3V A;  1JW4 A;  2UXA A;  1Z7M E;  4WEP A;  4HCW A;  1B4Z A;  2P0S A;  1B7H A;  4JWY A;  4KQP A;  3RQT A;  2HFB A;  3FVK A;  2Z8E A;  3PMV A;  3SEX A;  2P2A A;  3BKI B;  4IO3 A;  3RLF E;  4KYD A;  1POT A;  1JVX A;  1PB7 A;  1B32 A;  4U21 A;  4PE5 B;  2OWS A;  3OEL A;  3HV1 A;  2XX7 A;  3O2A A;  3FJM A;  4NE4 A;  4R2F A;  2YLN A;  5JTY B;  4NF4 A;  1OQH A;  1URG A;  1II5 A;  3PPO A;  3VV5 A;  1O64 A;  1EZ9 A;  2HXW A;  3HCQ A;  2DWH A;  3H3G A;  2DS9 A;  4JSD A;  1IEJ A;  4AQ4 A;  3QUF A;  4GRK A;  3RTF B;  4YKJ A;  3C35 A;  4L17 A;  4C0R A;  5IKB A;  5TPA A;  1R1N A;  1XVY A;  1M5E A;  3SEV A;  3WAF A;  3OD7 A;  1UQW A;  5EHM A;  4C1U A;  4QFO A;  2DE3 A;  1ZKB A;  1PEB A;  3ZKK A;  4KYS A;  1WVJ A;  2R71 A;  3MAM A;  4POW A;  3EF7 A;  2O68 A;  2V3Q A;  2F36 A;  2AL4 A;  3KOT A;  1IXC A;  2D3I A;  1MXU A;  3OO7 A;  4DCY A;  3KFM A;  4F31 B;  1MQI A;  3DEL B;  2QSX A;  2E1S A;  1HSE A;  2ZYO A;  4XKQ A;  4DXU A;  3TZA A;  3IB2 A;  1LBB A;  3CFL A;  5M2V A;  3PV0 E;  1B3H A;  4R2B A;  2DYX A;  4ZS9 A;  3PPP A;  5I59 A;  1IIW A;  1ZLQ A;  3LSL A;  4RA1 A;  2RC9 A;  4Q5T A;  1GTK A;  4GFR A;  2F78 A;  1B1X A;  2F34 A;  3SEU A;  3E13 X;  3FIR A;  4E0X A;  5FHN A;  4KPT A;  4Q30 B;  2HEU A;  2IA4 A;  1VE4 A;  2DSF A;  4TOZ A;  1MH3 A;  1MRP A;  3N6U A;  4UA8 A;  1R9Q A;  2PT2 A;  4IB2 A;  3KN3 A;  5ICT A;  1IUD A;  2I48 A;  3FD3 A;  4DXC A;  4G68 A;  3KOS A;  4K3F A;  4G2Z A;  1AIV A;  1MXW A;  5DTB A;  1MQD A;  4F2Q A;  3MUQ A;  5DEX B;  3U93 A;  3UOR A;  3PUZ E;  4ZZA A;  4KR5 A;  4YMA A;  3H06 B;  1Y3N A;  5KZT A;  3OXN A;  2H99 A;  4PFU A;  3A3U A;  4MF3 A;  3QUJ A;  2O84 X;  4ZEB A;  4ZED A;  3CSB A;  4N13 A;  3TDJ A;  2AYS A;  3IX1 A;  1XT8 A;  1UTH A;  3SES A;  3JZJ A;  1B0H A;  2B3F A;  1NNK A;  2HCA A;  4X1B A;  4RJZ A;  5I2K B;  3VFJ A;  4FAJ A;  3IOR A;  1S7Y A;  3P7I A;  4E0W A;  3IL1 B;  2ANJ A;  2R9J A;  4GXA A;  1JEV A;  2ABH A;  3IJO B;  4G4P A;  3GBB A;  1SQY A;  1PDA A;  2QS4 A;  5I84 A;  2ONK E;  4QFN A;  2UYF A;  2Q2A A;  4ZEK A;  4IO4 A;  4QSC A;  5L9S A;  3G3J A;  2DVC A;  3CVG A;  3EQ1 A;  1PBP A;  1MY1 A;  3IO4 A;  2NOO A;  1A8E A;  4KCD A;  1SDX A;  3K01 A;  1SW5 A;  3VVD A;  2A5S A;  2OZZ A;  2XX8 A;  1ATG A;  1OLA A;  1R6Z A;  3MW0 A;  1NL5 A;  1OIB A;  4NF5 B;  1XOC A;  2OWT A;  1LFI A;  3R6U A;  1GV8 A;  1A40 A;  1M5F A;  4RPO A;  4OXV A;  3M3K A;  2OJT A;  2AL5 A;  2I3W A;  2Z22 A;  2UYE A;  1FW0 A;  2XXH A;  3TCG A;  1ZMG A;  2E0S A;  5TP9 B;  1ZBM A;  3V83 A;  3MZ9 A;  4F2O A;  4RK9 A;  2XXU A;  3N26 A;  3B6Q A;  4YKP A;  5CMM A;  3C36 A;  1FTM A;  2HZK A;  3VLU A;  4KCC A;  5I2N A;  1R9L A;  3RNN A;  3AXF A;  3FVG A;  4LQ5 A;  1N76 A;  3TCF A;  3K0V A;  4F22 A;  4BDM A;  1NNT A;  3KSX A;  2UVH A;  1MDP 1;  4ESX A;  3TCH A;  1VR5 A;  1WDN A;  1SW1 A;  1ELJ A;  5KCJ A;  1RYO A;  5FTH A;  1SI0 A;  3U1O A;  3FZV A;  2XXT A;  5H8Q A;  1LAH E;  1JW5 A;  5LOM A;  4EQ7 A;  1EZO A;  2PMS A;  4ZE8 A;  4FAT A;  3MC2 A;  3H7M A;  2FNC A;  3TEP A;  1DMB A;  2O51 A;  1SYH A;  1B7U A;  2XXI A;  3PMX A;  4ZEC A;  2G93 A;  4IY5 A;  4I8C A;  2FA7 A;  4G8H A;  2H5Y A;  3KJ7 A;  5H8N A;  4G8M A;  1N7W A;  3MBP A;  1H76 A;  1B4H A;  4IGT A;  4GL8 A;  2ZNS A;  1A55 A;  5TPA B;  5F1Q A;  4X48 A;  3PUX E;  3QIM A;  2F6G A;  1FQA A;  1MY0 A;  1MXY A;  4OQO A;  2NWJ A;  3W15 C;  4R9G A;  3TTL A;  3TFL A;  1A99 A;  3F11 A;  1QKB A;  2QL3 A;  2V84 A;  5FTI A;  2Q89 A;  3G7W A;  3PUV E;  2PT1 A;  3CSG A;  5H8F B;  2ZNU A;  4TLM B;  3FAS A;  1B2H A;  5AA2 B;  3HPI A;  4H6D A;  3ILT B;  4QFP A;  3LUY A;  4FIM A;  3KN8 A;  3UP9 A;  5CI5 A;  4HTG A;  4IO2 A;  3UIF A;  1F9B A;  4THI A;  3MP1 A;  2CZL A;  1JNF A;  4EQB A;  3K6X A;  3G3H A;  3OOA A;  1US5 A;  4U1O A;  5B7D A;  3N5L A;  3U8Q A;  4NF8 A;  4DDD A;  2DWI A;  2YJP A;  2Q88 A;  4AB5 A;  2XXY A;  1JEU A;  4ELO A;  5I56 B;  4ZE9 A;  1PBQ A;  2QS3 A;  3TQW A;  1MY3 A;  1MS7 A;  3SEW A;  3R26 A;  1B1H A;  2I3V A;  3K2D A;  2REJ A;  3OEK A;  3PPR A;  1BTJ A;  4P0G A;  3G3I A;  4ZZE A;  2I4B A;  1Y1Z A;  3GLB A;  3EN3 A;  4OVJ A;  1SI1 A;  5AA1 A;  2I4C A;  3CFZ A;  4QSE A;  1QJM A;  3M8U A;  4NF6 A;  1A7L A;  3ZSF A;  3OO6 A;  3UGW A;  2VD3 A;  1BP5 A;  2I0B A;  2ZYK A;  1CE2 A;  2X7Q A;  4DCX A;  4DLD A;  3H6T A;  5KDT A;  4MFI A;  3CG1 A;  1OQG A;  4X9T A;  3Q29 A;  3BFU A;  3L6H A;  2HAU A;  3EPE A;  3FXQ A;  4F3S A;  4JWO A;  3E9X A;  1YCJ A;  3T22 A;  4LAT A;  2XD2 A;  2F5X A;  1Q35 A;  1Y3Q A;  1B3F A;  3VXC A;  4GWO A;  1MPD A;  5I58 B;  3MP8 A;  1QUK A;  2HZL A;  4F18 A;  4ONY A;  4ELR A;  3FXR A;  1DTZ A;  1MM6 A;  1P1W A;  3S4U A;  4H5F A;  1H3D A;  4R73 A;  4U22 A;  1YTV A;  2ONS A;  2VD2 A;  1SW2 A;  1MPB A;  3O97 A;  1B9J A;  2F7C A;  3IR1 A;  2A5T B;  3MQ9 A;  4RY1 A;  3FAT A;  4R72 A;  4MBP A;  3IO6 A;  4M4G A;  2F35 A;  1NNP A;  3O6G A;  3VLV A;  5A5X A;  5H8H A;  1N3X A;  4JXI A;  4ND9 A;  3TEL A;  4U1Z A;  2VHA A;  4LZ5 A;  2RKM A;  4PFY A;  4R9F A;  1EZP A;  3QK6 A;  1B7Z A;  3FV2 A;  3TTM A;  4FEB A;  4OES A;  4KD5 A;  3O9P A;  1ZIU A;  4ELQ A;  1O63 A;  3SKP A;  3TOD A;  3MVX A;  2GHA A;  1URD A;  2V3U A;  1T0K A;  4R74 A;  3S9N C;  3KSJ A;  3DP4 A;  1Z7N E;  1UTB A;  3D4G A;  3Q28 A;  1LAG E;  4LZ7 A;  3O66 A;  3JV9 A;  1P99 A;  1VFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...