3JYRA

Crystal structures of the gach receptor of streptomyces glaucescens gla.o in the unliganded form and in complex with acarbose and an acarbose homolog. comparison with acarbose-loaded maltose binding protein of salmonella typhimurium.
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
370
structure length
370
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEQDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEVTPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLVPNPPKTWEEIPALDKELKVKGKSAIMFNLQEPYFTWPLIAADGGYAFKFENGKYDVKDVGVDNAGAKAGLTFLIDMIKNKNMSADTDYSIAEAAFNKGETAMTINGPWAWSNIDKSKVNYGVTLLPTFKGKPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDQGLEAVNKDKPLGAVALKSFQEQLAKDPRIAATMDNAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALKDAQSRITK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Maltose-binding periplasmic protein
publication title Crystal Structures of the Solute Receptor GacH of Streptomyces glaucescens in Complex with Acarbose and an Acarbose Homolog: Comparison with the Acarbose-Loaded Maltose-Binding Protein of Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 124
structure length 370
sequence length 370
ec nomenclature
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3jyrA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3jyrA01
4WEDA 3IOTA 3MAMA 3H6TA 1DSNA 3FVKA 3PPOA 4DZ1A 4R9GA 1JEVA 4JWXA 3BBRA 3SEYA 4ELRA 5A5XB 2PBWA 5A5XA 1NNTA 3TFLA 4BLAA 1A8FA 4F1YA 1YPNA 3IX1A 1N7XA 3O28A 5ICTA 5HBCA 5CM6A 1FQDA 3PUZE 4ONYA 3UK4A 4EUOA 2F6GA 2IA4A 4RNSA 4R6HA 4QHQA 3K1PA 1ZTYA 4GXSB 1NNPA 1UTBB 1UTBA 1UIVA 1D3KA 5AA1A 1GTKA 1N0TA 1P1NA 2DVZA 2XXQA 2V3UA 2PMSA 3FVOA 3RN8A 3PPPA 3K0VA 2ESNA 4ESWA 2DVCA 2ABHA 1TFDA 4LQ5A 1H45A 3A09A 3FV2A 3TYHA 1USYH 1JEUA 3LR1A 4U4XA 1DPEA 3FJ7A 3QUJA 1MY1A 2DSFA 3FASA 2XHDA 3SEWA 4F22A 1IZ1A 4OXVA 3LSFB 1MPDA 1B3HA 4AQ4A 2GHBA 4QSEA 1SI0A 4MLVA 1MY0A 2HZLA 4FEDA 1EZPA 3DP8A 1MY3A 3IJOB 3RUMA 2H9BA 1OVTA 2UXAA 1YCJA 3QUFA 1FTKA 2XXHA 1Y20A 3SEUA 1FTOA 4O3AA 1MG1A 3TZAA 1UQWA 1OMPA 5FTIA 2NVUB 2Z8FA 1PEBA 3K2DA 4OQOA 4F1VA 1H3DA 4UA8A 4YKJA 3RGYA 2Q2CA 3ODBA 3V8XB 3CR9A 4DXBA 3FD3A 2AL4A 1QJMA 3TTNA 2OBGA 3KEIA 4U4SA 3UN6A 3KN3A 3MC2A 2Q2AA 2CMOA 4U23A 3I5OA 3U93A 1B0LA 4ZZEA 4XIGQ 2W7YA 1NH7A 1DPPA 4QFPA 4OFJA 3KBRA 2G29A 3DP4A 3CI8A 4MLQA 3R26A 3KJ7A 4JWYA 2QS3A 4KCCA 4HS7A 3KN8A 4ECFA 3LSLA 4OENA 3D4GA 2PT1A 5DVJA 2Z8EA 1OLCA 1AIVA 1YAEA 4ZZAA 3ZKKA 1Y3QA 5TU0A 1AMFA 3K6UA 3MZBA 2F6PA 5H8NB 1PB7A 5H8NA 5AA2B 1NNKA 2GH9A 5AA2A 1XOCA 2Y7WA 4EXKA 3GLBA 3W15C 3FXQA 4U22A 3V5AA 3WAFA 4NWCA 4JBZA 3VDFA 1EH3A 4IO5A 2E1SA 3PV0E 4NE4A 1Z7NE 2ZYMA 2ZNUA 3MPKA 4P0GA 4OZ9A 1EU8A 5F1QA 1GGGA 3CFLA 3N26A 3O29A 4DIGA 4TQUQ 2V25A 3FGSA 4L17A 3TUSA 2XX8A 3S4UA 5CMBA 3S9MC 1XVYA 5KDTB 2OZZA 5KDTA 1A99A 1QULA 1R6ZA 4NEDA 3VVDA 1I6QA 1SYHA 1MDQA 5BUUA 2V93A 3C4MA 3PPQA 5I59B 1SW5A 3GBAA 3T9HB 4F2QA 5I59A 1FQEA 3K00A 1POY1 1URDA 3FXUA 3H6UA 1ATGA 4YMBA 3N6TA 4WKMA 1IEJA 2H5YA 1MPCA 3SERA 1B5JA 1N76A 3O6GA 3MW0A 2Q8JA 2HFBA 2P1SA 1S7YA 4ZEFA 3T22A 3O97A 1XC1A 3T93B 4OMBA 3MP6A 1Y4TA 2R6GE 4QFKA 1II5A 4RPOA 4ZEIA 4O3CA 3PUYE 5I56B 3HO7A 3MP8A 5I56A 1VR5A 5ISUA 5CMKA 4Q0CA 1ZIUA 2DXYA 3LSXA 4P11A 1M5EA 4EQ7A 2X7QA 5K2XA 4XXUA 3B6WA 1IXIA 1B52A 4RPNA 4AB5A 3OSQA 3UA8A 3RTFB 4XKQA 4KQPA 2XXIA 4TLLB 2V84A 4IO2A 3OELA 2B65A 4DLDA 4PETA 1MPBA 4IO7A 3PMWA 3HCQA 2O1MA 5DTBA 3CSBA 2DE2A 3OD7A 3N5LA 4N13A 3F11A 3K6XA 1NH8A 3TTLA 5JK4A 1MXZA 1MRPA 5AA3A 2REGA 1FTLA 2QMXA 1D9YA 2RCAA 3UGWA 1MDP1 2GFEA 2I4BA 3UIFA 4HW8A 4FORA 4KHZE 3OSRA 1R9QA 4ELPA 4KYEA 4YICA 1ZBMA 3IO4A 3N94A 3PPRA 5FHMA 1DMBA 4QFLA 5CMCA 1WVJA 4YB7A 1OLAA 1ZLQA 4GRKA 1N3WA 3UORA 3SETA 4XKPA 1Y1MA 4OFLA 1P1QA 4OESA 1JVXA 2XX7A 1BLFA 3VLUA 2YLNA 1LAHE 4P0IA 4F39A 5KCJB 2BJJX 4JXIA 3P7IA 3VLVA 5KCJA 4RA1A 2I0BA 4LA9A 4F19A 2QS4A 3MJNA 4GL0A 1XT8A 3U92A 1DTGA 1HSLA 3PUWE 4H8JA 1B2HA 4H1XA 3PU5A 2Q88A 1JNFA 3IB2A 2B3BA 4Q30B 1A54A 1IXHA 5F7VA 3EQ1A 3MUQA 1MY2A 5FHNA 3ZS6A 1HSEA 3TQLA 4PFUA 4ELOA 2ONKE 4UACA 4GFRA 2F35A 2D5WA 4R75A 2QS1A 2O68A 3KG2A 3AXFA 3C34A 5EHMA 4FATA 4OERA 1N84A 1SQYA 1H44A 1LBBA 3C36A 1P99A 5DT6A 4E0WA 4H6DA 1URGA 3K1NA 2Y7KA 1NNFA 1B9JA 2DQVA 4G8NA 4Q5TA 3ILTB 4OVJA 5I58B 2Q9TA 3MVXA 5I58A 5CI5A 2ZMBA 2DYXA 1LB9A 2F34A 1URSA 4HCWA 4OWDA 4ZEBA 1JW1A 3IB1A 5J1DA 2VP1A 3HV1A 4ZS9A 4BDLA 1KWHA 1B51A 1UIUA 4EXLA 1Y9UA 4OHNA 2O7IA 2A5TB 1SD3A 2QMWA 1VE4A 4YMAA 3T66A 4X48A 3Q26A 2A5TA 3IOVA 4PP0A 3THIA 3IK6B 3JYRA 3RLFE 1MQHA 2OWSA 3OMBA 2I3VA 1DTZA 4U2RA 3A3CA 1MS7A 2ALUA 2I6EA 5ICQA 3M8UA 1TWYA 2VD3A 3LBSA 2XXRA 3FZVA 3QYTA 4X1DA 2HCAA 5H8FB 5ITOA 3ONMA 2GHAA 5H8FA 1QUKA 4OETA 4I1DA 4H5FA 4GD5A 2THIA 2Y7PA 1H43A 2I58A 4ND9A 1SDXA 4NTLA 1MM7A 2ONSA 3KSXA 3RT8A 1FQCA 4EDPA 4OTEA 2YJPA 3DP6A 2DWAA 1IIWA 4JSOA 4DXUA 3MVZA 3ZSFA 4YB5A 3SKPA 2RKMA 2AYSA 2ONRA 4LZ8A 1LCFA 3TMGA 3IAZA 4ZE9A 4N07A 4ZECA 4G2ZA 1XS5A 1B32A 4I9DA 1M5DA 2QJEA 4KYDA 2G93A 1NFTA 4MBPA 1NL5A 1RKMA 3RNNA 1B7UA 2P2AA 3OENA 3OO8A 1IUDA 4TLMB 3TEPA 3W9WA 3SDFA 4H5GA 1LFHA 4Z0IA 2QPQA 5K2YA 3VVEA 3VE1B 3MZ9A 2Y7IA 4GXAA 2GRVA 1USYE 4JWOA 1L5TA 4R2FA 1R9LA 2UVIA 5I57B 1SI1A 3H3GA 3ZKLA 4GLIA 4IO3A 5I57A 2ZYNA 1O7TA 3T96B 3TTKA 2RC9A 3RT6B 2ZYOA 4POXA 1MY4A 1FTJA 1J1NA 1M5FA 3H4ZA 3C9HA 2NOOA 3T9VA 1P1UA 2NWJA 2VD2A 4NWDA 2RC7A 3OOAA 1SW4A 4RYAA 4X1BA 5FHOA 4G8MA 1CE2A 1DOTA 3CFZA 1SYIA 3K1MA 1HSJA 5M2VA 3SEVA 3LC8A 2DE3A 3IOUA 3IB0A 3CFXA 5IKBA 4GOTA 1PB8A 2DOJA 3T9XB 2F8DA 4F3SA 3U72A 4IGTA 2ZXTA 3PUVE 4BDNA 3H06B 1QUIA 2H25A 1Y3NA 3K4UA 1ZU0A 2I3WA 3MBPA 3PUXE 2ANJA 2DWHA 1MM6A 2FYIA 2Z23A 1LAFE 1IITA 4N6PA 2I4CA 3K01A 2NXOA 3KOTA 3SESA 1O63A 4NF8B 5JTYB 2V3TA 2KLFA 4LATA 4NF8A 5JTYA 2F36A 2I49A 1RYXA 4PE5B 3E13X 3G3JA 1ZMGA 1B7ZA 5L9MA 3QSLA 4PFWA 4R2BA 2UVHA 1B7HA 1B58A 2O51A 1MH4A 3G3IA 4I8CA 5TPAB 3KSJA 5TPAA 4ZEDA 5AA4B 1JW5A 5CMMA 5AA4A 1GR2A 4JSDA 2XD2A 3U1OA 2XXVA 1BIYA 3H03A 3BKIB 3LSWA 3M3LA 1N7WA 3Q25A 5DVIA 3VFJA 1MXYA 5H8QB 4LZ5A 1LLSA 3G3FA 1SW1A 3FIRA 5H8QA 2X7PA 1Y1ZA 2HXWA 1B4HA 3QK6A 3KZGA 2QL3A 2HAVA 2RF1A 4IO4A 3OEKA 4LONB 2M8CA 2UVGA 1FW0A 1MXVA 2RINA 1B3LA 1B6HA 3R6UA 2OCUA 3Q27A 5H8HB 4YU0A 1A40A 5H8HA 1B1HA 4GF8A 4C0RA 5HM4B 1BKAA 1F9BA 3B6QA 4I62A 3TQWA 3FATA 1LCTA 1PB9A 3T9UA 3HSTA 4EF2A 4MFIA 1POTA 2QSXA 3E9XA 4QSDA 4OFOA 3LUYA 5B7DA 1SW2A 2PYYA 5AE4A 4F2OA 4BDMA 3KN7A 3GXAA 4QFNA 3CIJA 4F1UA 3G3HA 1BP5A 3KOSA 1NKXA 2AIXA 2F78A 1TT1A 1SBPA 2UVJA 3C31A 3IO6A 4Q8RA 1PBPA 3MP1A 2REJA 1MQDA 4Z7EA 2XXWA 4XTCQ 3IORA 2F97A 1A8EA 1T0KA 1OQHA 3VV5A 4C1TA 2HEUA 3K6VA 4DXCA 2VHAA 4QFOA 3MVYA 1P1OA 4LZ7A 1Q1KA 2DP8A 1P1WA 1AL3A 4PFTA 5H8SA 3FV1A 2D3IA 1OVBA 1AOVA 2O7UA 4YKPA 4ZEKA 4U1OA 1RYOA 2HQ0A 4FE8A 4KPTA 1UTHB 2DXRA 1B1XA 4THIA 1UTHA 4OYVA 2FA7A 1FQAA 3HN0A 1WODA 4GL8A 3MWBA 4F3PA 3CSGA 1YTVA 2I48A 3TELA 1M5BA 3C32A 2Y84A 3IJXB 4GWOA 5L9SA 3PD8A 1LAGE 3OO7A 4M4GA 5L8DA 1FQBA 3FVNA 2R9JA 4TOZA 3DLNA 4F3BA 1H76A 2X26A 4IY5A 4LP2B 3VXBA 1QW0A 4ZDMA 4RJZA 3M3KA 1Z7ME 5CBRA 4BDOA 3G3KA 2NUVA 5B70A 1LB8A 3OEMA 3OXNA 1LFGA 3RPWA 2QS2A 1IXCA 1EZ9A 1MXXA 3L6GA 1D4NA 5JEIA 4HTGA 1MXWA 5I2KB 1TFAA 5I2KA 2FNCA 1B40A 3C33A 3EHTA 3S9EA 4LVQA 2PVUA 5CRYA 4JDFA 3FUZA 1QUJA 5HPQA 1JQFA 4KCDA 2UYEA 3TCGA 1MQGA 1LFIA 4G4PA 3PD9A 2OLBA 3GBBA 3G3GA 3B7DA 3I3VA 3FVGA 4FECA 2HZKA 1Y4CA 1WDNA 4M1VA 3HHGA 4ELQA 3MZ1A 2ZYKA 4WEPA 4DCXA 5ITPA 4QSCA 1Y3PA 4OEVA 3N6UA 3TPAA 5CBSA 2DWIA 4IO6A 1I6AA 4IGRA 4NF4B 1B0HA 4F18A 3KJTA 4NF4A 2F5XA 5IAIA 3H7MA 5L9OA 2F7AA 1PBQA 3TTRA 1IXGA 1N04A 2UYFA 2O69A 1PC3A 4X9TA 2DE4A 1US4A 5DVFA 3HHFA 2LAOA 1S9TA 4E0XA 1XHYA 1A55A 3SEXA 4NF6B 3QAXA 3BFUA 1QKBA 4NF6A 4YZZA 4PQJA 1B3GA 1SVXB 3R7XA 4KD5A 1US5A 3MQ9A 3TAJA 4RK2A 5I84A 3EHSA 2XXUA 4G68B 3IOWA 4ZE8A 4G68A 3D4CA 3B6TA 3PPNA 1N3XA 3S9NC 3K6WA 2O6AA 1B05A 3TODA 2XXXA 3CRBA 1I6BA 1MH3A 2H4IA 4K3FA 1A7LA 1MQJA 1MQIA 1M5CA 4LQ2A 3BFTA 4IY6A 1OQGA 1MXUA 1B3EA 3O66A 4H67A 4F31B 3V83A 4IB2A 3VXCA 4FEBA 4POWA 3PMVA 4RXLA 3CG1A 3IL1B 4KFQA 3OO6A 3E3KA 2QRYA 3EPEA 4XKRA 4ESXA 1JVYA 3U8QA 5ELVA 4NMYA 4GVOA 4LUBA 4BDQA 4FAJA 4FIMA 3OO9A 2OK2A 2XXTA 1B4ZA 1ZJLA 2YPNA 1ANFA 2WKYA 1VFDA 4R6YA 4R6KA 1TXFA 1I69A 4YB6A 1GVCA 3C35A 1JETA 3MPLA 3U94A 4U1ZA 4U21A 3ECRA 1IQ7A 3H6VA 2RCBA 3UP9A 5EHSA 2O84X 4G68C 3Q29A 1VSOA 5DEXB 4RY1A 1B5IA 4NF5B 5DEXA 2F7BA 4NF5A 1R1NA 4DCYA 4C1UA 2XX9A 3EF7A 4KR5A 2CZLA 2XXYA 3L6HA 4WXJA 2HAUA 1PDAA 1BTJA 4BDRA 4XKNA 3E4RA 1ELJA 4GQOA 2Z8DA 5TP9B 4KYSA 3JV9A 5TP9A 2VGQA 1VFEA 1NMUA 2B3FA 5FTHA 2Q89A 1LGBC 3VVFA 3KGCA 4FJPA 3QXMA 4EQBA 1EZOA 4F29A 1AH5A 2R71A 4R9FA 3PGFA 4O3BA 2PT2A 2OJTA 2IEEA 3MVWA 3KFMA 4YKKA 3EHUA 2PX1A 3S9LC 4QRZA 2VOZA 2P0SA 3FJGA 3DM0A 1LSTA 2I0CA 3EN3A 4DDDA 4KI0E 3CG3A 4JB7A 5CC2A 4F3GA 4G8HA 3HPIA 2AL5A 4H8IA 4OEUA 3CVGA 4R73A 1CB6A 1ZKBA 3PMXA 4H65A 3IR1A 4G77A 3S2VA 1O64A 3GZGA 5EYFA 3O9PA 1Q35A 5AA2D 2F7CA 3K02A 2ZNTA 4AB6A 4MH5A 3A3UA 3VLWA 4ISUA 3JZJA 2H99A 3O6HA 2Y7RA 1LBCA 1FQFA 3Q28A 4R74A 3RY3A 1XVXA 2OWTA 3TCFA 2O1LA 2E0SA 4GIZA 1FCKA 5BWJA 3I6VA 5LOMA 3TDJA 4EQ9A 4PFYA 1S50A 1FTMA 4EF1A 1QVSA 3FXRA 4RK9A 1B5HA 3TTMA 4R72A 3H6WA 3RTWB 5DYHA 3DELB 1JW4A 4YAHX 3TCHA 4HCYA 2RC8A 2Z22A 3W9VA 3WAEA 3FJMA 2XD3A 4QF9A 3USDA 3O2AA 3G7WA 3O6IA 2A5SA 3M3FA 3QIMA 2DS9A 4MF3A 3TKDA 3V89B 1B3FA 2ZNSA 5I2NB 2DWJA 2H98A 5I2NA 2V3QA 1QKAA 4YKIA 3RQTA 1LAXA 2XXPA 1B46A 3ILUB 5KZTA 1OIBA 4DE8A 4H0WA 1GV8A 1D9VA 2D21A
chains in the Genus database with same CATH superfamily
4WEDA 3IOTA 3MAMA 3H6TA 5FBPA 1DSNA 3FVKA 3PPOA 4DZ1A 4R9GA 1JEVA 4JWXA 3BBRA 3SEYA 1NV1A 4ELRA 5A5XB 2Y5KA 2PBWA 5A5XA 1NNTA 3TFLA 4BLAA 1A8FA 4F1YA 1YPNA 3IX1A 1N7XA 3O28A 5ICTA 5HBCA 1FPKA 2PCRA 5CM6A 1FQDA 3PUZE 4ONYA 2P3VA 3UK4A 4EUOA 4JVIA 2F6GA 2IA4A 3QMFA 3FBPA 4RNSA 4R6HA 4OA4A 4QHQA 3K1PA 1ZTYA 4GX3A 4GXSB 1NNPA 1FBGA 3SZPA 4N4UA 1UTBB 1UTBA 1UIVA 1D3KA 5AA1A 1GTKA 1N0TA 1P1NA 2DVZA 2XXQA 2V3UA 2PMSA 3FVOA 3RN8A 3PPPA 3K0VA 4GWXA 2ESNA 4ESWA 4MHFA 4GBWA 2DVCA 2ABHA 1TFDA 4LQ5A 3A29A 5I7IA 1H45A 3A09A 3FV2A 3TYHA 1USYH 1JEUA 3LR1A 4U4XA 1DPEA 3FJ7A 3QUJA 1MY1A 2DSFA 4HE0A 3FASA 1KA1A 2XHDA 3SEWA 4F22A 1IZ1A 4OXVA 1FPJA 3LSFB 1DK4A 1MPDA 5ET8A 1B3HA 4AQ4A 2GHBA 4QSEA 1SI0A 4MLVA 1MY0A 1IMBA 2HZLA 4FEDA 1SPIA 1EZPA 3DP8A 5EQ8A 1FBFA 1MY3A 3IJOB 3RUMA 2H9BA 1OVTA 2UXAA 1YCJA 3QUFA 1FTKA 2XXHA 1Y20A 3SEUA 1FTOA 4O3AA 1MG1A 3TZAA 1UQWA 1OMPA 5FTIA 2NVUB 2Z8FA 4MMPA 1FPBA 3FXBA 1PEBA 3K2DA 4OQOA 1FBHA 4F1VA 1H3DA 4UA8A 4YKJA 3RGYA 2Q2CA 2V4CA 3ODBA 3V8XB 3CR9A 4DXBA 3FD3A 2AL4A 1QJMA 3TTNA 2OBGA 3KEIA 4U4SA 3UN6A 3KN3A 3MC2A 2Q2AA 2CMOA 4U23A 3I5OA 3U93A 2Q8MA 1B0LA 4ZZEA 4XIGQ 2W7YA 1FPDA 1NH7A 1DPPA 4QFPA 4MCOA 4OFJA 3KBRA 1IMDA 4GBVA 2G29A 3DP4A 3CI8A 4MLQA 4N91A 3R26A 3KJ7A 4GWWA 4JWYA 4MJOA 2QS3A 4KCCA 4HS7A 3KN8A 4ECFA 3LSLA 4OENA 3D4GA 4MX6A 2PT1A 5DVJA 2Z8EA 1OLCA 1XI6A 2VPNA 1AIVA 1YAEA 4ZZAA 3ZKKA 1Y3QA 5TU0A 1AMFA 3K6UA 3MZBA 2F6PA 5H8NB 1PB7A 5H8NA 5ESYA 5AA2B 1NNKA 2GH9A 5AA2A 4PE3A 1XOCA 2Y7WA 4EXKA 1Q9DA 4MEVA 3GLBA 3W15C 3FXQA 4U22A 3V5AA 3WAFA 4NWCA 4PAFA 4JBZA 2XXKA 5IZZA 3BIGA 3VDFA 1EH3A 1FRPA 4IO5A 2E1SA 3RYDA 1G0IA 3IFAA 2GQ1A 3PV0E 4NE4A 1Z7NE 2ZYMA 2ZNUA 3MPKA 5J16A 4QBAA 4N8YA 4P0GA 4OZ9A 1EU8A 5F1QA 1GGGA 3CFLA 3N26A 3O29A 4DIGA 4TQUQ 4MNPA 2V25A 3FGSA 4L17A 3TUSA 2XX8A 3S4UA 5CMBA 3S9MC 1XVYA 5KDTB 2OZZA 5KDTA 1A99A 1QULA 1R6ZA 4NEDA 4NG7A 3D1RA 3VVDA 1FSAA 1I6QA 1SYHA 1MDQA 5BUUA 2V93A 3C4MA 3PPQA 2FBPA 5I59B 1SW5A 3GBAA 3T9HB 4F2QA 5I59A 1FQEA 3K00A 1POY1 4PGNA 1URDA 3FXUA 3H6UA 1ATGA 4YMBA 3N6TA 4XFEA 4WKMA 1IEJA 2H5YA 1MPCA 3KC1A 3SERA 1B5JA 1N76A 3O6GA 3MW0A 2Q8JA 2HFBA 2P1SA 1S7YA 5LTCA 4ZEFA 3T22A 3O97A 1XC1A 3T93B 4OMBA 2WBDA 3MP6A 1Y4TA 2R6GE 2XWOA 4QFKA 1II5A 4RPOA 4ZEIA 4O3CA 3PUYE 5I56B 3HO7A 3MP8A 5I56A 1VR5A 5ISUA 5CMKA 4Q0CA 4O94A 1ZIUA 2DXYA 4N81A 3LSXA 4P11A 1M5EA 4EQ7A 2X7QA 5K2XA 4XXUA 3B6WA 1IXIA 1B52A 1YZ0A 4RPNA 4AB5A 3OSQA 4N17A 3UA8A 3RTFB 4XKQA 4KQPA 1NV0A 2PFZA 2XXIA 4TLLB 2V84A 4IO2A 3OELA 2B65A 4DLDA 4PETA 4UABA 1MPBA 4IO7A 3PMWA 3HCQA 4FBPA 2O1MA 5DTBA 3CSBA 2DE2A 3OD7A 3N5LA 4N13A 3F11A 3K6XA 1NH8A 3TTLA 5JK4A 1MXZA 1MRPA 3T1BA 5AA3A 2REGA 1FTLA 2QMXA 1D9YA 2RCAA 3UGWA 1MDP1 4P1LA 2GFEA 2I4BA 3UIFA 4HW8A 2FIEA 4FORA 4KXPA 4KHZE 3OSRA 1R9QA 4ELPA 1NUWA 4XF5A 1LBYA 4KYEA 4YICA 4HE2A 1ZBMA 3IO4A 3N94A 3PPRA 5FHMA 1DMBA 4QFLA 5CMCA 1WVJA 4YB7A 1OLAA 1NV5A 1ZLQA 4GRKA 1N3WA 3UORA 3SETA 4XKPA 1INPA 1Y1MA 1P1QA 4OFLA 4OESA 1JVXA 4GWZA 2XX7A 1BLFA 4PGPA 3VLUA 2YLNA 3U65A 1LAHE 4P0IA 3E78A 2MKZA 4N6KA 4F39A 5KCJB 5I5PA 2BJJX 4JXIA 3P7IA 3VLVA 5KCJA 4RA1A 2I0BA 4LA9A 4F19A 2QS4A 3MJNA 4GL0A 1XT8A 3U92A 2VPOA 1EYIA 1DTGA 1HSLA 3PUWE 4H8JA 1B2HA 4OVQA 4H1XA 3PU5A 2Q88A 1JNFA 3ROJA 3IB2A 2B3BA 4Q30B 1A54A 1IXHA 5F7VA 3EQ1A 3MUQA 4PBQA 1MY2A 5FHNA 3ZS6A 1HSEA 3TQLA 4PFUA 4ELOA 2ONKE 4UACA 4GFRA 2F35A 2D5WA 4R75A 2QS1A 2O68A 3KG2A 3AXFA 2B4MA 3C34A 5EHMA 2OWZA 4MIJA 4FATA 4OERA 1N84A 1K9YA 1SQYA 1H44A 1LBBA 3C36A 1P99A 5DT6A 1NV3A 4E0WA 4H6DA 1URGA 3K1NA 2Y7KA 1NNFA 1B9JA 2DQVA 4PAIA 2CEXA 3KC0A 4G8NA 4Q5TA 3ILTB 4OVJA 5I58B 2Q9TA 1YXIA 3MVXA 5I58A 5CI5A 2ZMBA 2DYXA 1LB9A 2F34A 1URSA 1LBVA 4HCWA 4GX4A 4OWDA 4ZEBA 1JW1A 3IB1A 5J1DA 1RDZA 2VP1A 3HV1A 4ZS9A 4BDLA 5I3SA 1KWHA 1B51A 1UIUA 4EXLA 1Y9UA 2XWKA 4OHNA 2VT5A 2O7IA 2A5TB 1SD3A 2QMWA 1VE4A 3T66A 4YMAA 4X48A 3Q26A 2A5TA 3IOVA 4PP0A 3IK6B 3THIA 3JYRA 3RLFE 1MQHA 2OWSA 3OMBA 2I3VA 5IM2A 1DTZA 1FTAA 2ZZXA 1NI9A 4U2RA 3A3CA 1MS7A 2JJKA 2ALUA 2I6EA 5ICQA 3M8UA 1TWYA 2VD3A 3LBSA 2XXRA 3FZVA 3QYTA 5DW8A 4X1DA 2HCAA 5H8FB 2OX3A 5ITOA 2B4LA 3ONMA 2GHAA 5H8FA 1QUKA 3B50A 1KA0A 4OETA 4I1DA 4H5FA 4GD5A 2THIA 2Y7PA 1H43A 2ZZWA 2Y5LA 2I58A 3T0JA 4ND9A 1SDXA 4NTLA 1MM7A 2ONSA 3KSXA 3RT8A 1FQCA 4EDPA 4OTEA 4HE1A 2YJPA 3DP6A 2DWAA 1IIWA 3KBZA 2R8TA 1NV6A 4JSOA 4DXUA 4PAKA 3MVZA 3ZSFA 3RPLB 4YB5A 3SKPA 2RKMA 3RPLA 2AYSA 2ONRA 2HXRA 4LZ8A 1LCFA 3TMGA 3IAZA 5ET7A 2BJIA 4ZE9A 4N07A 4ZECA 4G2ZA 1XS5A 1B32A 4I9DA 1M5DA 2QJEA 4KYDA 2G93A 1NFTA 4MBPA 1NL5A 1RKMA 3RNNA 1B7UA 2P2AA 3OENA 3OO8A 1IUDA 4TLMB 3TEPA 3W9WA 1RDYA 4N8GA 4MNIA 3SDFA 4H5GA 1LFHA 4GX6A 4Z0IA 2QPQA 5K2YA 3VVEA 3VE1B 3MZ9A 2Y7IA 4JVCA 4GXAA 1BK4A 2GRVA 5F24A 1USYE 4JWOA 4N6DA 1L5TA 4R2FA 1R9LA 2UVIA 5I57B 1SI1A 3H3GA 3ZKLA 4GLIA 4IO3A 5I57A 4JVDA 2ZYNA 4GWSA 4DI3D 1O7TA 3T96B 2HHMA 3TTKA 2RC9A 3RT6B 4OVTA 2ZYOA 5T3JA 4POXA 1MY4A 1FTJA 1J1NA 4I40A 1M5FA 3H4ZA 3C9HA 2NOOA 3T9VA 1P1UA 4PCDA 2WYKA 2NWJA 2VD2A 4NWDA 2RC7A 3OOAA 1SW4A 4RYAA 4X1BA 5FHOA 2XWIA 4G8MA 1CE2A 1DOTA 2P3NA 3CFZA 1SYIA 3K1MA 1HSJA 5M2VA 3SEVA 3LC8A 2KR0A 2F3BA 2DE3A 3IOUA 3IB0A 5EQ7A 2FHYA 3CFXA 5IKBA 4GOTA 1PB8A 1LEVA 2DOJA 3T9XB 2F8DA 4F3SA 1K9ZA 3U72A 4IGTA 2CEYA 2ZXTA 3PUVE 4BDNA 3H06B 1QUIA 2H25A 1Y3NA 4O7MA 3K4UA 1KZ8A 4PTKA 5EQAA 4O8MA 1ZU0A 4X04A 2I3WA 3MBPA 1IMFA 2ANJA 3PUXE 2DWHA 1FBDA 1MM6A 3LUZA 2FYIA 4PFBA 2Z23A 1LAFE 1IITA 4N6PA 2I4CA 3K01A 2NXOA 3KOTA 3SESA 4P9KA 1O63A 4NF8B 5JTYB 2V3TA 2KLFA 4LATA 4NF8A 5JTYA 2F36A 2I49A 2L5VA 5ET6A 2WX9A 1RYXA 4PE5B 3E13X 2QFLA 4P8BA 3G3JA 1ZMGA 1B7ZA 5L9MA 3QSLA 4PFWA 4R2BA 2UVHA 1B7HA 1B58A 2O51A 2F3DA 1MH4A 3G3IA 4I8CA 5TPAB 3KSJA 5TPAA 4ZEDA 5AA4B 1JW5A 5CMMA 5EYHA 5AA4A 1GR2A 4JSDA 2XD2A 3U1OA 2XXVA 1BIYA 3H03A 3BKIB 3LSWA 3M3LA 1N7WA 3Q25A 4OVRA 5DVIA 3VFJA 1MXYA 5H8QB 4LZ5A 1LLSA 3G3FA 1SW1A 3FIRA 5H8QA 2X7PA 1Y1ZA 2HXWA 3MYUA 4MAGA 1B4HA 3QK6A 3KZGA 2QL3A 2HAVA 2RF1A 4IO4A 3OEKA 4LONB 2M8CA 2UVGA 1FW0A 1MXVA 2RINA 2QVUA 4I3EA 4OANA 1B3LA 1B6HA 3R6UA 2OCUA 3Q27A 5H8HB 4YU0A 4P47A 1A40A 5H8HA 1B1HA 4GF8A 4C0RA 5HM4B 1BKAA 1F9BA 3B6QA 4I62A 3TQWA 3FATA 1LCTA 1PB9A 3T9UA 1FPFA 3HSTA 4EF2A 4MFIA 1POTA 2QSXA 4LN5A 3E9XA 4QSDA 4OFOA 3LUYA 5B7DA 2CZKA 3PTYA 1SW2A 1CNQA 4XEQA 1FBPA 2PYYA 5AE4A 4F2OA 4BDMA 3KN7A 3GXAA 4QFNA 5ET5A 4P1EA 3CIJA 4F1UA 3G3HA 1BP5A 3KOSA 1NKXA 2AIXA 1FPEA 2F78A 1TT1A 1SBPA 2UVJA 2ZZVA 3C31A 3IO6A 4Q8RA 1PBPA 3MP1A 2REJA 1MQDA 4Z7EA 2XXWA 4XTCQ 3IORA 2F97A 1A8EA 1T0KA 1OQHA 3VV5A 1DCUA 4C1TA 2HEUA 3K6VA 4DXCA 2VHAA 4QFOA 3MVYA 1P1OA 3E79A 4LZ7A 1Q1KA 1AWBA 2DP8A 1P1WA 1AL3A 4PC9A 1FPLA 3FV1A 4PFTA 5H8SA 2D3IA 1OVBA 1AOVA 2O7UA 4YKPA 4MNCA 4ZEKA 3BIHA 4U1OA 3LV0A 1RYOA 2CZHA 2HQ0A 2QVVA 4FE8A 4KPTA 1UTHB 2DXRA 1B1XA 2XWVA 4THIA 1UTHA 4OYVA 2FA7A 1FQAA 3HFUA 3HN0A 1WODA 4GL8A 3MWBA 4PF6A 4F3PA 3CSGA 1YTVA 2I48A 3TELA 1M5BA 3C32A 4PF8A 4PDHA 4DI4B 2Y84A 3IJXB 4GWOA 5L9SA 3PD8A 1LAGE 3OO7A 4M4GA 5L8DA 1FQBA 3FVNA 2R9JA 4TOZA 3DLNA 4F3BA 1H76A 2X26A 2CZIA 4IY5A 1FJ9A 2QVRA 4LP2B 1FBEA 3VXBA 1QW0A 1EYJA 4ZDMA 4RJZA 3M3KA 1Z7ME 5CBRA 4BDOA 3G3KA 5IZ1A 2NUVA 5B70A 1LB8A 3OEMA 3OXNA 1LFGA 3RPWA 2QS2A 1IXCA 1EZ9A 1LBZA 1MXXA 3L6GA 1D4NA 5JEIA 1FPIA 4HTGA 1MXWA 3GYYA 5I2KB 4AS5A 1JP4A 1TFAA 1QGXA 5I2KA 2FNCA 1B40A 3C33A 3EHTA 3S9EA 4LVQA 2PVUA 2XA5A 5CRYA 4JDFA 3FUZA 1QUJA 5HPQA 1JQFA 4PFRA 4KCDA 2UYEA 3TCGA 1MQGA 1LFIA 4G4PA 3PD9A 2OLBA 3GBBA 3G3GA 3B7DA 3I3VA 3FVGA 4FECA 4GWYA 2HZKA 1Y4CA 1WDNA 4M1VA 3HHGA 4ELQA 3EKIA 3MZ1A 2ZYKA 4WEPA 5EQ9A 4DCXA 5ITPA 4QSCA 1Y3PA 4OEVA 3N6UA 3TPAA 5CBSA 2DWIA 4IO6A 1I6AA 4IGRA 4NF4B 1B0HA 4F18A 3KJTA 4NF4A 2F5XA 5IAIA 3H7MA 5L9OA 4OVPA 2F7AA 1PBQA 3TTRA 1IXGA 1N04A 1NUZA 2FIXA 2UYFA 2O69A 1PC3A 4X9TA 2DE4A 1US4A 5DVFA 3HHFA 2LAOA 1S9TA 1NV4A 4E0XA 1XHYA 1A55A 4NHBA 3SEXA 4NF6B 3QAXA 3BFUA 4NGUA 1QKBA 4NF6A 4YZZA 4PQJA 1B3GA 4AS4A 1SVXB 3R7XA 4KD5A 1US5A 3MQ9A 4NQ8A 3TAJA 4RK2A 5I84A 4NN3A 3EHSA 2XXUA 4G68B 1LBXA 3IOWA 4ZE8A 4G68A 3D4CA 3NOHA 3B6TA 3PPNA 1NV7A 1N3XA 3S9NC 1NUXA 1DBZA 3K6WA 2O6AA 1B05A 3TODA 2XXXA 3CRBA 2KQZA 1I6BA 1MH3A 2H4IA 4IR8A 4K3FA 1A7LA 1IMAA 1MQJA 1MQIA 1M5CA 4LQ2A 3BFTA 4IY6A 1OQGA 1MXUA 1B3EA 3O66A 1G0HA 4H67A 4F31B 3V83A 4IB2A 5A5LA 3VXCA 4FEBA 4POWA 3PMVA 4RXLA 3CG1A 3IL1B 4KFQA 3OO6A 3E3KA 4I3YA 2QRYA 3EPEA 4XKRA 4ESXA 1JVYA 3U8QA 5ELVA 4PDDA 4NMYA 4H46A 4GVOA 4P3LA 4LUBA 4BDQA 4FAJA 4FIMA 3OO9A 2OK2A 2XXTA 1B4ZA 1ZJLA 2YPNA 1ANFA 2WKYA 1VFDA 4R6YA 4R6KA 1TXFA 1I69A 4YB6A 1GVCA 3C35A 2WEFA 1JETA 3MPLA 3U94A 4U1ZA 4U21A 3ECRA 1IQ7A 3H6VA 2RCBA 3UP9A 5EHSA 2O84X 1FBCA 4G68C 4O7IA 3Q29A 1VSOA 4HXVA 5DEXB 4RY1A 1B5IA 4NF5B 2FVZA 4N15A 5DEXA 2F7BA 4NF5A 1R1NA 4DCYA 4C1UA 2XX9A 3EF7A 4KR5A 2CZLA 2XXYA 5LDZA 3L6HA 4WXJA 1LBWA 2HAUA 1PDAA 1BTJA 4BDRA 4XKNA 3E4RA 1ELJA 4GQOA 4X8RA 2Z8DA 5TP9B 4KYSA 3JV9A 5TP9A 1NV2A 2VGQA 1VFEA 1NMUA 2B3FA 5FTHA 2Q89A 1LGBC 3VVFA 3KGCA 4FJPA 3QXMA 4EQBA 1EZOA 4F29A 1AH5A 2R71A 1EYKA 4R9FA 2PFYA 3PGFA 4O3BA 2PT2A 2OJTA 2IEEA 3MVWA 4G61A 3KFMA 4YKKA 3EHUA 4QXDA 2PX1A 3S9LC 4QRZA 2VOZA 2P0SA 3FJGA 3DM0A 1LSTA 2I0CA 3EN3A 4DDDA 2Q74A 4KI0E 3CG3A 4JB7A 5CC2A 4F3GA 4G8HA 3HPIA 2AL5A 4H8IA 4OEUA 3CVGA 4R73A 1CB6A 1ZKBA 3PMXA 4H65A 3IR1A 4G77A 4NF0A 3S2VA 1O64A 3GZGA 5EYFA 3O9PA 3CHGA 1Q35A 5AA2D 5IZ3B 2F7CA 3K02A 5IZ3A 2ZNTA 4AB6A 4MH5A 5IGAA 3A3UA 3VLWA 3IFCA 4ISUA 3JZJA 2H99A 1FPGA 1NUYA 3O6HA 2Y7RA 1LBCA 1FQFA 3Q28A 4R74A 3RY3A 1XVXA 2OWTA 3TCFA 2O1LA 3B8BA 4NAPA 2E0SA 4GIZA 1FCKA 5BWJA 3I6VA 5LOMA 3TDJA 4EQ9A 4PFIA 4PFYA 2WBBA 1S50A 1IMCA 1FTMA 4EF1A 1QVSA 3FXRA 4RK9A 4OVSA 1B5HA 3TTMA 4R72A 3H6WA 3RTWB 5DYHA 3DELB 2DDKA 1JW4A 4YAHX 3TCHA 4HCYA 2RC8A 2Z22A 3W9VA 3WAEA 3FJMA 2XD3A 4QF9A 3USDA 4H45A 4NX1A 3O2AA 3G7WA 3O6IA 2A5SA 3M3FA 1RDXA 3QIMA 2DS9A 3ISPA 4MF3A 4PBHA 3TKDA 3V89B 1VDWA 1B3FA 2ZNSA 5I2NB 2DWJA 2H98A 4P56A 2WYPA 5I2NA 2V3QA 1QKAA 3MSTA 4YKIA 5EYGA 3RQTA 1LAXA 2XXPA 1B46A 1YYZA 1IMEA 3ILUB 5KZTA 4GWUA 1OIBA 2HPGA 4DE8A 4H0WA 1GV8A 1D9QA 1D9VA 1FJ6A 2D21A
chains in the Genus database with same CATH topology
4WEDA 3IOTA 3MAMA 3H6TA 1DSNA 3FVKA 3PPOA 4DZ1A 4R9GA 1JEVA 4JWXA 3BBRA 3SEYA 4ELRA 5A5XB 2PBWA 5A5XA 1NNTA 3TFLA 4BLAA 1A8FA 4F1YA 1YPNA 3IX1A 1N7XA 3O28A 5ICTA 5HBCA 5CM6A 1FQDA 3PUZE 4ONYA 3UK4A 4EUOA 2F6GA 2IA4A 4RNSA 4R6HA 4QHQA 3K1PA 1ZTYA 4GXSB 1NNPA 1UTBB 1UTBA 1UIVA 1D3KA 5AA1A 1GTKA 1N0TA 1P1NA 2DVZA 2XXQA 2V3UA 2PMSA 3FVOA 3RN8A 3PPPA 3K0VA 2ESNA 4ESWA 2DVCA 2ABHA 1TFDA 4LQ5A 1H45A 3A09A 3FV2A 3TYHA 1USYH 1JEUA 3LR1A 4U4XA 1DPEA 3FJ7A 3QUJA 1MY1A 2DSFA 3FASA 2XHDA 3SEWA 4F22A 1IZ1A 4OXVA 3LSFB 1MPDA 1B3HA 4AQ4A 2GHBA 4QSEA 1SI0A 4MLVA 1MY0A 2HZLA 4FEDA 1EZPA 3DP8A 1MY3A 3IJOB 3RUMA 2H9BA 1OVTA 2UXAA 1YCJA 3QUFA 1FTKA 2XXHA 1Y20A 3SEUA 1FTOA 4O3AA 1MG1A 3TZAA 1UQWA 1OMPA 5FTIA 2NVUB 2Z8FA 1PEBA 3K2DA 4OQOA 4F1VA 1H3DA 4UA8A 4YKJA 3RGYA 2Q2CA 3ODBA 3V8XB 3CR9A 4DXBA 3FD3A 2AL4A 1QJMA 3TTNA 2OBGA 3KEIA 4U4SA 3UN6A 3KN3A 3MC2A 2Q2AA 2CMOA 4U23A 3I5OA 3U93A 1B0LA 4ZZEA 4XIGQ 2W7YA 1NH7A 1DPPA 4QFPA 4OFJA 3KBRA 2G29A 3DP4A 3CI8A 4MLQA 3R26A 3KJ7A 4JWYA 2QS3A 4KCCA 4HS7A 3KN8A 4ECFA 3LSLA 4OENA 3D4GA 2PT1A 5DVJA 2Z8EA 1OLCA 1AIVA 1YAEA 4ZZAA 3ZKKA 1Y3QA 5TU0A 1AMFA 3K6UA 3MZBA 2F6PA 5H8NB 1PB7A 5H8NA 5AA2B 1NNKA 2GH9A 5AA2A 1XOCA 2Y7WA 4EXKA 3GLBA 3W15C 3FXQA 4U22A 3V5AA 3WAFA 4NWCA 4JBZA 3VDFA 1EH3A 4IO5A 2E1SA 3PV0E 4NE4A 1Z7NE 2ZYMA 2ZNUA 3MPKA 4P0GA 4OZ9A 1EU8A 5F1QA 1GGGA 3CFLA 3N26A 3O29A 4DIGA 4TQUQ 2V25A 3FGSA 4L17A 3TUSA 2XX8A 3S4UA 5CMBA 3S9MC 1XVYA 5KDTB 2OZZA 5KDTA 1A99A 1QULA 1R6ZA 4NEDA 3VVDA 1I6QA 1SYHA 1MDQA 5BUUA 2V93A 3C4MA 3PPQA 5I59B 1SW5A 3GBAA 3T9HB 4F2QA 5I59A 1FQEA 3K00A 1POY1 1URDA 3FXUA 3H6UA 1ATGA 4YMBA 3N6TA 4WKMA 1IEJA 2H5YA 1MPCA 3SERA 1B5JA 1N76A 3O6GA 3MW0A 2Q8JA 2HFBA 2P1SA 1S7YA 4ZEFA 3T22A 3O97A 1XC1A 3T93B 4OMBA 3MP6A 1Y4TA 2R6GE 4QFKA 1II5A 4RPOA 4ZEIA 4O3CA 3PUYE 5I56B 3HO7A 3MP8A 5I56A 1VR5A 5ISUA 5CMKA 4Q0CA 1ZIUA 2DXYA 3LSXA 4P11A 1M5EA 4EQ7A 2X7QA 5K2XA 4XXUA 3B6WA 1IXIA 1B52A 4RPNA 4AB5A 3OSQA 3UA8A 3RTFB 4XKQA 4KQPA 2XXIA 4TLLB 2V84A 4IO2A 3OELA 2B65A 4DLDA 4PETA 1MPBA 4IO7A 3PMWA 3HCQA 2O1MA 5DTBA 3CSBA 2DE2A 3OD7A 3N5LA 4N13A 3F11A 3K6XA 1NH8A 3TTLA 5JK4A 1MXZA 1MRPA 5AA3A 2REGA 1FTLA 2QMXA 1D9YA 2RCAA 3UGWA 1MDP1 2GFEA 2I4BA 3UIFA 4HW8A 4FORA 4KHZE 3OSRA 1R9QA 4ELPA 4KYEA 4YICA 1ZBMA 3IO4A 3N94A 3PPRA 5FHMA 1DMBA 4QFLA 5CMCA 1WVJA 4YB7A 1OLAA 1ZLQA 4GRKA 1N3WA 3UORA 3SETA 4XKPA 1Y1MA 4OFLA 1P1QA 4OESA 1JVXA 2XX7A 1BLFA 3VLUA 2YLNA 1LAHE 4P0IA 4F39A 5KCJB 2BJJX 4JXIA 3P7IA 3VLVA 5KCJA 4RA1A 2I0BA 4LA9A 4F19A 2QS4A 3MJNA 4GL0A 1XT8A 3U92A 1DTGA 1HSLA 3PUWE 4H8JA 1B2HA 4H1XA 3PU5A 2Q88A 1JNFA 3IB2A 2B3BA 4Q30B 1A54A 1IXHA 5F7VA 3EQ1A 3MUQA 1MY2A 5FHNA 3ZS6A 1HSEA 3TQLA 4PFUA 4ELOA 2ONKE 4UACA 4GFRA 2F35A 2D5WA 4R75A 2QS1A 2O68A 3KG2A 3AXFA 3C34A 5EHMA 4FATA 4OERA 1N84A 1SQYA 1H44A 1LBBA 3C36A 1P99A 5DT6A 4E0WA 4H6DA 1URGA 3K1NA 2Y7KA 1NNFA 1B9JA 2DQVA 4G8NA 4Q5TA 3ILTB 4OVJA 5I58B 2Q9TA 3MVXA 5I58A 5CI5A 2ZMBA 2DYXA 1LB9A 2F34A 1URSA 4HCWA 4OWDA 4ZEBA 1JW1A 3IB1A 5J1DA 2VP1A 3HV1A 4ZS9A 4BDLA 1KWHA 1B51A 1UIUA 4EXLA 1Y9UA 4OHNA 2O7IA 2A5TB 1SD3A 2QMWA 1VE4A 4YMAA 3T66A 4X48A 3Q26A 2A5TA 3IOVA 4PP0A 3THIA 3IK6B 3JYRA 3RLFE 1MQHA 2OWSA 3OMBA 2I3VA 1DTZA 4U2RA 3A3CA 1MS7A 2ALUA 2I6EA 5ICQA 3M8UA 1TWYA 2VD3A 3LBSA 2XXRA 3FZVA 3QYTA 4X1DA 2HCAA 5H8FB 5ITOA 3ONMA 2GHAA 5H8FA 1QUKA 4OETA 4I1DA 4H5FA 4GD5A 2THIA 2Y7PA 1H43A 2I58A 4ND9A 1SDXA 4NTLA 1MM7A 2ONSA 3KSXA 3RT8A 1FQCA 4EDPA 4OTEA 2YJPA 3DP6A 2DWAA 1IIWA 4JSOA 4DXUA 3MVZA 3ZSFA 4YB5A 3SKPA 2RKMA 2AYSA 2ONRA 4LZ8A 1LCFA 3TMGA 3IAZA 4ZE9A 4N07A 4ZECA 4G2ZA 1XS5A 1B32A 4I9DA 1M5DA 2QJEA 4KYDA 2G93A 1NFTA 4MBPA 1NL5A 1RKMA 3RNNA 1B7UA 2P2AA 3OENA 3OO8A 1IUDA 4TLMB 3TEPA 3W9WA 3SDFA 4H5GA 1LFHA 4Z0IA 2QPQA 5K2YA 3VVEA 3VE1B 3MZ9A 2Y7IA 4GXAA 2GRVA 1USYE 4JWOA 1L5TA 4R2FA 1R9LA 2UVIA 5I57B 1SI1A 3H3GA 3ZKLA 4GLIA 4IO3A 5I57A 2ZYNA 1O7TA 3T96B 3TTKA 2RC9A 3RT6B 2ZYOA 4POXA 1MY4A 1FTJA 1J1NA 1M5FA 3H4ZA 3C9HA 2NOOA 3T9VA 1P1UA 2NWJA 2VD2A 4NWDA 2RC7A 3OOAA 1SW4A 4RYAA 4X1BA 5FHOA 4G8MA 1CE2A 1DOTA 3CFZA 1SYIA 3K1MA 1HSJA 5M2VA 3SEVA 3LC8A 2DE3A 3IOUA 3IB0A 3CFXA 5IKBA 4GOTA 1PB8A 2DOJA 3T9XB 2F8DA 4F3SA 3U72A 4IGTA 2ZXTA 3PUVE 4BDNA 3H06B 1QUIA 2H25A 1Y3NA 3K4UA 1ZU0A 2I3WA 3MBPA 3PUXE 2ANJA 2DWHA 1MM6A 2FYIA 2Z23A 1LAFE 1IITA 4N6PA 2I4CA 3K01A 2NXOA 3KOTA 3SESA 1O63A 4NF8B 5JTYB 2V3TA 2KLFA 4LATA 4NF8A 5JTYA 2F36A 2I49A 1RYXA 4PE5B 3E13X 3G3JA 1ZMGA 1B7ZA 5L9MA 3QSLA 4PFWA 4R2BA 2UVHA 1B7HA 1B58A 2O51A 1MH4A 3G3IA 4I8CA 5TPAB 3KSJA 5TPAA 4ZEDA 5AA4B 1JW5A 5CMMA 5AA4A 1GR2A 4JSDA 2XD2A 3U1OA 2XXVA 1BIYA 3H03A 3BKIB 3LSWA 3M3LA 1N7WA 3Q25A 5DVIA 3VFJA 1MXYA 5H8QB 4LZ5A 1LLSA 3G3FA 1SW1A 3FIRA 5H8QA 2X7PA 1Y1ZA 2HXWA 1B4HA 3QK6A 3KZGA 2QL3A 2HAVA 2RF1A 4IO4A 3OEKA 4LONB 2M8CA 2UVGA 1FW0A 1MXVA 2RINA 1B3LA 1B6HA 3R6UA 2OCUA 3Q27A 5H8HB 4YU0A 1A40A 5H8HA 1B1HA 4GF8A 4C0RA 5HM4B 1BKAA 1F9BA 3B6QA 4I62A 3TQWA 3FATA 1LCTA 1PB9A 3T9UA 3HSTA 4EF2A 4MFIA 1POTA 2QSXA 3E9XA 4QSDA 4OFOA 3LUYA 5B7DA 1SW2A 2PYYA 5AE4A 4F2OA 4BDMA 3KN7A 3GXAA 4QFNA 3CIJA 4F1UA 3G3HA 1BP5A 3KOSA 1NKXA 2AIXA 2F78A 1TT1A 1SBPA 2UVJA 3C31A 3IO6A 4Q8RA 1PBPA 3MP1A 2REJA 1MQDA 4Z7EA 2XXWA 4XTCQ 3IORA 2F97A 1A8EA 1T0KA 1OQHA 3VV5A 4C1TA 2HEUA 3K6VA 4DXCA 2VHAA 4QFOA 3MVYA 1P1OA 4LZ7A 1Q1KA 2DP8A 1P1WA 1AL3A 4PFTA 5H8SA 3FV1A 2D3IA 1OVBA 1AOVA 2O7UA 4YKPA 4ZEKA 4U1OA 1RYOA 2HQ0A 4FE8A 4KPTA 1UTHB 2DXRA 1B1XA 4THIA 1UTHA 4OYVA 2FA7A 1FQAA 3HN0A 1WODA 4GL8A 3MWBA 4F3PA 3CSGA 1YTVA 2I48A 3TELA 1M5BA 3C32A 2Y84A 3IJXB 4GWOA 5L9SA 3PD8A 1LAGE 3OO7A 4M4GA 5L8DA 1FQBA 3FVNA 2R9JA 4TOZA 3DLNA 4F3BA 1H76A 2X26A 4IY5A 4LP2B 3VXBA 1QW0A 4ZDMA 4RJZA 3M3KA 1Z7ME 5CBRA 4BDOA 3G3KA 2NUVA 5B70A 1LB8A 3OEMA 3OXNA 1LFGA 3RPWA 2QS2A 1IXCA 1EZ9A 1MXXA 3L6GA 1D4NA 5JEIA 4HTGA 1MXWA 5I2KB 1TFAA 5I2KA 2FNCA 1B40A 3C33A 3EHTA 3S9EA 4LVQA 2PVUA 5CRYA 4JDFA 3FUZA 1QUJA 5HPQA 1JQFA 4KCDA 2UYEA 3TCGA 1MQGA 1LFIA 4G4PA 3PD9A 2OLBA 3GBBA 3G3GA 3B7DA 3I3VA 3FVGA 4FECA 2HZKA 1Y4CA 1WDNA 4M1VA 3HHGA 4ELQA 3MZ1A 2ZYKA 4WEPA 4DCXA 5ITPA 4QSCA 1Y3PA 4OEVA 3N6UA 3TPAA 5CBSA 2DWIA 4IO6A 1I6AA 4IGRA 4NF4B 1B0HA 4F18A 3KJTA 4NF4A 2F5XA 5IAIA 3H7MA 5L9OA 2F7AA 1PBQA 3TTRA 1IXGA 1N04A 2UYFA 2O69A 1PC3A 4X9TA 2DE4A 1US4A 5DVFA 3HHFA 2LAOA 1S9TA 4E0XA 1XHYA 1A55A 3SEXA 4NF6B 3QAXA 3BFUA 1QKBA 4NF6A 4YZZA 4PQJA 1B3GA 1SVXB 3R7XA 4KD5A 1US5A 3MQ9A 3TAJA 4RK2A 5I84A 3EHSA 2XXUA 4G68B 3IOWA 4ZE8A 4G68A 3D4CA 3B6TA 3PPNA 1N3XA 3S9NC 3K6WA 2O6AA 1B05A 3TODA 2XXXA 3CRBA 1I6BA 1MH3A 2H4IA 4K3FA 1A7LA 1MQJA 1MQIA 1M5CA 4LQ2A 3BFTA 4IY6A 1OQGA 1MXUA 1B3EA 3O66A 4H67A 4F31B 3V83A 4IB2A 3VXCA 4FEBA 4POWA 3PMVA 4RXLA 3CG1A 3IL1B 4KFQA 3OO6A 3E3KA 2QRYA 3EPEA 4XKRA 4ESXA 1JVYA 3U8QA 5ELVA 4NMYA 4GVOA 4LUBA 4BDQA 4FAJA 4FIMA 3OO9A 2OK2A 2XXTA 1B4ZA 1ZJLA 2YPNA 1ANFA 2WKYA 1VFDA 4R6YA 4R6KA 1TXFA 1I69A 4YB6A 1GVCA 3C35A 1JETA 3MPLA 3U94A 4U1ZA 4U21A 3ECRA 1IQ7A 3H6VA 2RCBA 3UP9A 5EHSA 2O84X 4G68C 3Q29A 1VSOA 5DEXB 4RY1A 1B5IA 4NF5B 5DEXA 2F7BA 4NF5A 1R1NA 4DCYA 4C1UA 2XX9A 3EF7A 4KR5A 2CZLA 2XXYA 3L6HA 4WXJA 2HAUA 1PDAA 1BTJA 4BDRA 4XKNA 3E4RA 1ELJA 4GQOA 2Z8DA 5TP9B 4KYSA 3JV9A 5TP9A 2VGQA 1VFEA 1NMUA 2B3FA 5FTHA 2Q89A 1LGBC 3VVFA 3KGCA 4FJPA 3QXMA 4EQBA 1EZOA 4F29A 1AH5A 2R71A 4R9FA 3PGFA 4O3BA 2PT2A 2OJTA 2IEEA 3MVWA 3KFMA 4YKKA 3EHUA 2PX1A 3S9LC 4QRZA 2VOZA 2P0SA 3FJGA 3DM0A 1LSTA 2I0CA 3EN3A 4DDDA 4KI0E 3CG3A 4JB7A 5CC2A 4F3GA 4G8HA 3HPIA 2AL5A 4H8IA 4OEUA 3CVGA 4R73A 1CB6A 1ZKBA 3PMXA 4H65A 3IR1A 4G77A 3S2VA 1O64A 3GZGA 5EYFA 3O9PA 1Q35A 5AA2D 2F7CA 3K02A 2ZNTA 4AB6A 4MH5A 3A3UA 3VLWA 4ISUA 3JZJA 2H99A 3O6HA 2Y7RA 1LBCA 1FQFA 3Q28A 4R74A 3RY3A 1XVXA 2OWTA 3TCFA 2O1LA 2E0SA 4GIZA 1FCKA 5BWJA 3I6VA 5LOMA 3TDJA 4EQ9A 4PFYA 1S50A 1FTMA 4EF1A 1QVSA 3FXRA 4RK9A 1B5HA 3TTMA 4R72A 3H6WA 3RTWB 5DYHA 3DELB 1JW4A 4YAHX 3TCHA 4HCYA 2RC8A 2Z22A 3W9VA 3WAEA 3FJMA 2XD3A 4QF9A 3USDA 3O2AA 3G7WA 3O6IA 2A5SA 3M3FA 3QIMA 2DS9A 4MF3A 3TKDA 3V89B 1B3FA 2ZNSA 5I2NB 2DWJA 2H98A 5I2NA 2V3QA 1QKAA 4YKIA 3RQTA 1LAXA 2XXPA 1B46A 3ILUB 5KZTA 1OIBA 4DE8A 4H0WA 1GV8A 1D9VA 2D21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WED A;  3IOT A;  3MAM A;  3H6T A;  1DSN A;  3FVK A;  3PPO A;  4DZ1 A;  4R9G A;  1JEV A;  4JWX A;  3BBR A;  3SEY A;  4ELR A;  5A5X B;  2PBW A;  5A5X A;  1NNT A;  3TFL A;  4BLA A;  1A8F A;  4F1Y A;  1YPN A;  3IX1 A;  1N7X A;  3O28 A;  5ICT A;  5HBC A;  5CM6 A;  1FQD A;  3PUZ E;  4ONY A;  3UK4 A;  4EUO A;  2F6G A;  2IA4 A;  4RNS A;  4R6H A;  4QHQ A;  3K1P A;  1ZTY A;  4GXS B;  1NNP A;  1UTB B;  1UTB A;  1UIV A;  1D3K A;  5AA1 A;  1GTK A;  1N0T A;  1P1N A;  2DVZ A;  2XXQ A;  2V3U A;  2PMS A;  3FVO A;  3RN8 A;  3PPP A;  3K0V A;  2ESN A;  4ESW A;  2DVC A;  2ABH A;  1TFD A;  4LQ5 A;  1H45 A;  3A09 A;  3FV2 A;  3TYH A;  1USY H;  1JEU A;  3LR1 A;  4U4X A;  1DPE A;  3FJ7 A;  3QUJ A;  1MY1 A;  2DSF A;  3FAS A;  2XHD A;  3SEW A;  4F22 A;  1IZ1 A;  4OXV A;  3LSF B;  1MPD A;  1B3H A;  4AQ4 A;  2GHB A;  4QSE A;  1SI0 A;  4MLV A;  1MY0 A;  2HZL A;  4FED A;  1EZP A;  3DP8 A;  1MY3 A;  3IJO B;  3RUM A;  2H9B A;  1OVT A;  2UXA A;  1YCJ A;  3QUF A;  1FTK A;  2XXH A;  1Y20 A;  3SEU A;  1FTO A;  4O3A A;  1MG1 A;  3TZA A;  1UQW A;  1OMP A;  5FTI A;  2NVU B;  2Z8F A;  1PEB A;  3K2D A;  4OQO A;  4F1V A;  1H3D A;  4UA8 A;  4YKJ A;  3RGY A;  2Q2C A;  3ODB A;  3V8X B;  3CR9 A;  4DXB A;  3FD3 A;  2AL4 A;  1QJM A;  3TTN A;  2OBG A;  3KEI A;  4U4S A;  3UN6 A;  3KN3 A;  3MC2 A;  2Q2A A;  2CMO A;  4U23 A;  3I5O A;  3U93 A;  1B0L A;  4ZZE A;  4XIG Q;  2W7Y A;  1NH7 A;  1DPP A;  4QFP A;  4OFJ A;  3KBR A;  2G29 A;  3DP4 A;  3CI8 A;  4MLQ A;  3R26 A;  3KJ7 A;  4JWY A;  2QS3 A;  4KCC A;  4HS7 A;  3KN8 A;  4ECF A;  3LSL A;  4OEN A;  3D4G A;  2PT1 A;  5DVJ A;  2Z8E A;  1OLC A;  1AIV A;  1YAE A;  4ZZA A;  3ZKK A;  1Y3Q A;  5TU0 A;  1AMF A;  3K6U A;  3MZB A;  2F6P A;  5H8N B;  1PB7 A;  5H8N A;  5AA2 B;  1NNK A;  2GH9 A;  5AA2 A;  1XOC A;  2Y7W A;  4EXK A;  3GLB A;  3W15 C;  3FXQ A;  4U22 A;  3V5A A;  3WAF A;  4NWC A;  4JBZ A;  3VDF A;  1EH3 A;  4IO5 A;  2E1S A;  3PV0 E;  4NE4 A;  1Z7N E;  2ZYM A;  2ZNU A;  3MPK A;  4P0G A;  4OZ9 A;  1EU8 A;  5F1Q A;  1GGG A;  3CFL A;  3N26 A;  3O29 A;  4DIG A;  4TQU Q;  2V25 A;  3FGS A;  4L17 A;  3TUS A;  2XX8 A;  3S4U A;  5CMB A;  3S9M C;  1XVY A;  5KDT B;  2OZZ A;  5KDT A;  1A99 A;  1QUL A;  1R6Z A;  4NED A;  3VVD A;  1I6Q A;  1SYH A;  1MDQ A;  5BUU A;  2V93 A;  3C4M A;  3PPQ A;  5I59 B;  1SW5 A;  3GBA A;  3T9H B;  4F2Q A;  5I59 A;  1FQE A;  3K00 A;  1POY 1;  1URD A;  3FXU A;  3H6U A;  1ATG A;  4YMB A;  3N6T A;  4WKM A;  1IEJ A;  2H5Y A;  1MPC A;  3SER A;  1B5J A;  1N76 A;  3O6G A;  3MW0 A;  2Q8J A;  2HFB A;  2P1S A;  1S7Y A;  4ZEF A;  3T22 A;  3O97 A;  1XC1 A;  3T93 B;  4OMB A;  3MP6 A;  1Y4T A;  2R6G E;  4QFK A;  1II5 A;  4RPO A;  4ZEI A;  4O3C A;  3PUY E;  5I56 B;  3HO7 A;  3MP8 A;  5I56 A;  1VR5 A;  5ISU A;  5CMK A;  4Q0C A;  1ZIU A;  2DXY A;  3LSX A;  4P11 A;  1M5E A;  4EQ7 A;  2X7Q A;  5K2X A;  4XXU A;  3B6W A;  1IXI A;  1B52 A;  4RPN A;  4AB5 A;  3OSQ A;  3UA8 A;  3RTF B;  4XKQ A;  4KQP A;  2XXI A;  4TLL B;  2V84 A;  4IO2 A;  3OEL A;  2B65 A;  4DLD A;  4PET A;  1MPB A;  4IO7 A;  3PMW A;  3HCQ A;  2O1M A;  5DTB A;  3CSB A;  2DE2 A;  3OD7 A;  3N5L A;  4N13 A;  3F11 A;  3K6X A;  1NH8 A;  3TTL A;  5JK4 A;  1MXZ A;  1MRP A;  5AA3 A;  2REG A;  1FTL A;  2QMX A;  1D9Y A;  2RCA A;  3UGW A;  1MDP 1;  2GFE A;  2I4B A;  3UIF A;  4HW8 A;  4FOR A;  4KHZ E;  3OSR A;  1R9Q A;  4ELP A;  4KYE A;  4YIC A;  1ZBM A;  3IO4 A;  3N94 A;  3PPR A;  5FHM A;  1DMB A;  4QFL A;  5CMC A;  1WVJ A;  4YB7 A;  1OLA A;  1ZLQ A;  4GRK A;  1N3W A;  3UOR A;  3SET A;  4XKP A;  1Y1M A;  4OFL A;  1P1Q A;  4OES A;  1JVX A;  2XX7 A;  1BLF A;  3VLU A;  2YLN A;  1LAH E;  4P0I A;  4F39 A;  5KCJ B;  2BJJ X;  4JXI A;  3P7I A;  3VLV A;  5KCJ A;  4RA1 A;  2I0B A;  4LA9 A;  4F19 A;  2QS4 A;  3MJN A;  4GL0 A;  1XT8 A;  3U92 A;  1DTG A;  1HSL A;  3PUW E;  4H8J A;  1B2H A;  4H1X A;  3PU5 A;  2Q88 A;  1JNF A;  3IB2 A;  2B3B A;  4Q30 B;  1A54 A;  1IXH A;  5F7V A;  3EQ1 A;  3MUQ A;  1MY2 A;  5FHN A;  3ZS6 A;  1HSE A;  3TQL A;  4PFU A;  4ELO A;  2ONK E;  4UAC A;  4GFR A;  2F35 A;  2D5W A;  4R75 A;  2QS1 A;  2O68 A;  3KG2 A;  3AXF A;  3C34 A;  5EHM A;  4FAT A;  4OER A;  1N84 A;  1SQY A;  1H44 A;  1LBB A;  3C36 A;  1P99 A;  5DT6 A;  4E0W A;  4H6D A;  1URG A;  3K1N A;  2Y7K A;  1NNF A;  1B9J A;  2DQV A;  4G8N A;  4Q5T A;  3ILT B;  4OVJ A;  5I58 B;  2Q9T A;  3MVX A;  5I58 A;  5CI5 A;  2ZMB A;  2DYX A;  1LB9 A;  2F34 A;  1URS A;  4HCW A;  4OWD A;  4ZEB A;  1JW1 A;  3IB1 A;  5J1D A;  2VP1 A;  3HV1 A;  4ZS9 A;  4BDL A;  1KWH A;  1B51 A;  1UIU A;  4EXL A;  1Y9U A;  4OHN A;  2O7I A;  2A5T B;  1SD3 A;  2QMW A;  1VE4 A;  4YMA A;  3T66 A;  4X48 A;  3Q26 A;  2A5T A;  3IOV A;  4PP0 A;  3THI A;  3IK6 B;  3JYR A;  3RLF E;  1MQH A;  2OWS A;  3OMB A;  2I3V A;  1DTZ A;  4U2R A;  3A3C A;  1MS7 A;  2ALU A;  2I6E A;  5ICQ A;  3M8U A;  1TWY A;  2VD3 A;  3LBS A;  2XXR A;  3FZV A;  3QYT A;  4X1D A;  2HCA A;  5H8F B;  5ITO A;  3ONM A;  2GHA A;  5H8F A;  1QUK A;  4OET A;  4I1D A;  4H5F A;  4GD5 A;  2THI A;  2Y7P A;  1H43 A;  2I58 A;  4ND9 A;  1SDX A;  4NTL A;  1MM7 A;  2ONS A;  3KSX A;  3RT8 A;  1FQC A;  4EDP A;  4OTE A;  2YJP A;  3DP6 A;  2DWA A;  1IIW A;  4JSO A;  4DXU A;  3MVZ A;  3ZSF A;  4YB5 A;  3SKP A;  2RKM A;  2AYS A;  2ONR A;  4LZ8 A;  1LCF A;  3TMG A;  3IAZ A;  4ZE9 A;  4N07 A;  4ZEC A;  4G2Z A;  1XS5 A;  1B32 A;  4I9D A;  1M5D A;  2QJE A;  4KYD A;  2G93 A;  1NFT A;  4MBP A;  1NL5 A;  1RKM A;  3RNN A;  1B7U A;  2P2A A;  3OEN A;  3OO8 A;  1IUD A;  4TLM B;  3TEP A;  3W9W A;  3SDF A;  4H5G A;  1LFH A;  4Z0I A;  2QPQ A;  5K2Y A;  3VVE A;  3VE1 B;  3MZ9 A;  2Y7I A;  4GXA A;  2GRV A;  1USY E;  4JWO A;  1L5T A;  4R2F A;  1R9L A;  2UVI A;  5I57 B;  1SI1 A;  3H3G A;  3ZKL A;  4GLI A;  4IO3 A;  5I57 A;  2ZYN A;  1O7T A;  3T96 B;  3TTK A;  2RC9 A;  3RT6 B;  2ZYO A;  4POX A;  1MY4 A;  1FTJ A;  1J1N A;  1M5F A;  3H4Z A;  3C9H A;  2NOO A;  3T9V A;  1P1U A;  2NWJ A;  2VD2 A;  4NWD A;  2RC7 A;  3OOA A;  1SW4 A;  4RYA A;  4X1B A;  5FHO A;  4G8M A;  1CE2 A;  1DOT A;  3CFZ A;  1SYI A;  3K1M A;  1HSJ A;  5M2V A;  3SEV A;  3LC8 A;  2DE3 A;  3IOU A;  3IB0 A;  3CFX A;  5IKB A;  4GOT A;  1PB8 A;  2DOJ A;  3T9X B;  2F8D A;  4F3S A;  3U72 A;  4IGT A;  2ZXT A;  3PUV E;  4BDN A;  3H06 B;  1QUI A;  2H25 A;  1Y3N A;  3K4U A;  1ZU0 A;  2I3W A;  3MBP A;  3PUX E;  2ANJ A;  2DWH A;  1MM6 A;  2FYI A;  2Z23 A;  1LAF E;  1IIT A;  4N6P A;  2I4C A;  3K01 A;  2NXO A;  3KOT A;  3SES A;  1O63 A;  4NF8 B;  5JTY B;  2V3T A;  2KLF A;  4LAT A;  4NF8 A;  5JTY A;  2F36 A;  2I49 A;  1RYX A;  4PE5 B;  3E13 X;  3G3J A;  1ZMG A;  1B7Z A;  5L9M A;  3QSL A;  4PFW A;  4R2B A;  2UVH A;  1B7H A;  1B58 A;  2O51 A;  1MH4 A;  3G3I A;  4I8C A;  5TPA B;  3KSJ A;  5TPA A;  4ZED A;  5AA4 B;  1JW5 A;  5CMM A;  5AA4 A;  1GR2 A;  4JSD A;  2XD2 A;  3U1O A;  2XXV A;  1BIY A;  3H03 A;  3BKI B;  3LSW A;  3M3L A;  1N7W A;  3Q25 A;  5DVI A;  3VFJ A;  1MXY A;  5H8Q B;  4LZ5 A;  1LLS A;  3G3F A;  1SW1 A;  3FIR A;  5H8Q A;  2X7P A;  1Y1Z A;  2HXW A;  1B4H A;  3QK6 A;  3KZG A;  2QL3 A;  2HAV A;  2RF1 A;  4IO4 A;  3OEK A;  4LON B;  2M8C A;  2UVG A;  1FW0 A;  1MXV A;  2RIN A;  1B3L A;  1B6H A;  3R6U A;  2OCU A;  3Q27 A;  5H8H B;  4YU0 A;  1A40 A;  5H8H A;  1B1H A;  4GF8 A;  4C0R A;  5HM4 B;  1BKA A;  1F9B A;  3B6Q A;  4I62 A;  3TQW A;  3FAT A;  1LCT A;  1PB9 A;  3T9U A;  3HST A;  4EF2 A;  4MFI A;  1POT A;  2QSX A;  3E9X A;  4QSD A;  4OFO A;  3LUY A;  5B7D A;  1SW2 A;  2PYY A;  5AE4 A;  4F2O A;  4BDM A;  3KN7 A;  3GXA A;  4QFN A;  3CIJ A;  4F1U A;  3G3H A;  1BP5 A;  3KOS A;  1NKX A;  2AIX A;  2F78 A;  1TT1 A;  1SBP A;  2UVJ A;  3C31 A;  3IO6 A;  4Q8R A;  1PBP A;  3MP1 A;  2REJ A;  1MQD A;  4Z7E A;  2XXW A;  4XTC Q;  3IOR A;  2F97 A;  1A8E A;  1T0K A;  1OQH A;  3VV5 A;  4C1T A;  2HEU A;  3K6V A;  4DXC A;  2VHA A;  4QFO A;  3MVY A;  1P1O A;  4LZ7 A;  1Q1K A;  2DP8 A;  1P1W A;  1AL3 A;  4PFT A;  5H8S A;  3FV1 A;  2D3I A;  1OVB A;  1AOV A;  2O7U A;  4YKP A;  4ZEK A;  4U1O A;  1RYO A;  2HQ0 A;  4FE8 A;  4KPT A;  1UTH B;  2DXR A;  1B1X A;  4THI A;  1UTH A;  4OYV A;  2FA7 A;  1FQA A;  3HN0 A;  1WOD A;  4GL8 A;  3MWB A;  4F3P A;  3CSG A;  1YTV A;  2I48 A;  3TEL A;  1M5B A;  3C32 A;  2Y84 A;  3IJX B;  4GWO A;  5L9S A;  3PD8 A;  1LAG E;  3OO7 A;  4M4G A;  5L8D A;  1FQB A;  3FVN A;  2R9J A;  4TOZ A;  3DLN A;  4F3B A;  1H76 A;  2X26 A;  4IY5 A;  4LP2 B;  3VXB A;  1QW0 A;  4ZDM A;  4RJZ A;  3M3K A;  1Z7M E;  5CBR A;  4BDO A;  3G3K A;  2NUV A;  5B70 A;  1LB8 A;  3OEM A;  3OXN A;  1LFG A;  3RPW A;  2QS2 A;  1IXC A;  1EZ9 A;  1MXX A;  3L6G A;  1D4N A;  5JEI A;  4HTG A;  1MXW A;  5I2K B;  1TFA A;  5I2K A;  2FNC A;  1B40 A;  3C33 A;  3EHT A;  3S9E A;  4LVQ A;  2PVU A;  5CRY A;  4JDF A;  3FUZ A;  1QUJ A;  5HPQ A;  1JQF A;  4KCD A;  2UYE A;  3TCG A;  1MQG A;  1LFI A;  4G4P A;  3PD9 A;  2OLB A;  3GBB A;  3G3G A;  3B7D A;  3I3V A;  3FVG A;  4FEC A;  2HZK A;  1Y4C A;  1WDN A;  4M1V A;  3HHG A;  4ELQ A;  3MZ1 A;  2ZYK A;  4WEP A;  4DCX A;  5ITP A;  4QSC A;  1Y3P A;  4OEV A;  3N6U A;  3TPA A;  5CBS A;  2DWI A;  4IO6 A;  1I6A A;  4IGR A;  4NF4 B;  1B0H A;  4F18 A;  3KJT A;  4NF4 A;  2F5X A;  5IAI A;  3H7M A;  5L9O A;  2F7A A;  1PBQ A;  3TTR A;  1IXG A;  1N04 A;  2UYF A;  2O69 A;  1PC3 A;  4X9T A;  2DE4 A;  1US4 A;  5DVF A;  3HHF A;  2LAO A;  1S9T A;  4E0X A;  1XHY A;  1A55 A;  3SEX A;  4NF6 B;  3QAX A;  3BFU A;  1QKB A;  4NF6 A;  4YZZ A;  4PQJ A;  1B3G A;  1SVX B;  3R7X A;  4KD5 A;  1US5 A;  3MQ9 A;  3TAJ A;  4RK2 A;  5I84 A;  3EHS A;  2XXU A;  4G68 B;  3IOW A;  4ZE8 A;  4G68 A;  3D4C A;  3B6T A;  3PPN A;  1N3X A;  3S9N C;  3K6W A;  2O6A A;  1B05 A;  3TOD A;  2XXX A;  3CRB A;  1I6B A;  1MH3 A;  2H4I A;  4K3F A;  1A7L A;  1MQJ A;  1MQI A;  1M5C A;  4LQ2 A;  3BFT A;  4IY6 A;  1OQG A;  1MXU A;  1B3E A;  3O66 A;  4H67 A;  4F31 B;  3V83 A;  4IB2 A;  3VXC A;  4FEB A;  4POW A;  3PMV A;  4RXL A;  3CG1 A;  3IL1 B;  4KFQ A;  3OO6 A;  3E3K A;  2QRY A;  3EPE A;  4XKR A;  4ESX A;  1JVY A;  3U8Q A;  5ELV A;  4NMY A;  4GVO A;  4LUB A;  4BDQ A;  4FAJ A;  4FIM A;  3OO9 A;  2OK2 A;  2XXT A;  1B4Z A;  1ZJL A;  2YPN A;  1ANF A;  2WKY A;  1VFD A;  4R6Y A;  4R6K A;  1TXF A;  1I69 A;  4YB6 A;  1GVC A;  3C35 A;  1JET A;  3MPL A;  3U94 A;  4U1Z A;  4U21 A;  3ECR A;  1IQ7 A;  3H6V A;  2RCB A;  3UP9 A;  5EHS A;  2O84 X;  4G68 C;  3Q29 A;  1VSO A;  5DEX B;  4RY1 A;  1B5I A;  4NF5 B;  5DEX A;  2F7B A;  4NF5 A;  1R1N A;  4DCY A;  4C1U A;  2XX9 A;  3EF7 A;  4KR5 A;  2CZL A;  2XXY A;  3L6H A;  4WXJ A;  2HAU A;  1PDA A;  1BTJ A;  4BDR A;  4XKN A;  3E4R A;  1ELJ A;  4GQO A;  2Z8D A;  5TP9 B;  4KYS A;  3JV9 A;  5TP9 A;  2VGQ A;  1VFE A;  1NMU A;  2B3F A;  5FTH A;  2Q89 A;  1LGB C;  3VVF A;  3KGC A;  4FJP A;  3QXM A;  4EQB A;  1EZO A;  4F29 A;  1AH5 A;  2R71 A;  4R9F A;  3PGF A;  4O3B A;  2PT2 A;  2OJT A;  2IEE A;  3MVW A;  3KFM A;  4YKK A;  3EHU A;  2PX1 A;  3S9L C;  4QRZ A;  2VOZ A;  2P0S A;  3FJG A;  3DM0 A;  1LST A;  2I0C A;  3EN3 A;  4DDD A;  4KI0 E;  3CG3 A;  4JB7 A;  5CC2 A;  4F3G A;  4G8H A;  3HPI A;  2AL5 A;  4H8I A;  4OEU A;  3CVG A;  4R73 A;  1CB6 A;  1ZKB A;  3PMX A;  4H65 A;  3IR1 A;  4G77 A;  3S2V A;  1O64 A;  3GZG A;  5EYF A;  3O9P A;  1Q35 A;  5AA2 D;  2F7C A;  3K02 A;  2ZNT A;  4AB6 A;  4MH5 A;  3A3U A;  3VLW A;  4ISU A;  3JZJ A;  2H99 A;  3O6H A;  2Y7R A;  1LBC A;  1FQF A;  3Q28 A;  4R74 A;  3RY3 A;  1XVX A;  2OWT A;  3TCF A;  2O1L A;  2E0S A;  4GIZ A;  1FCK A;  5BWJ A;  3I6V A;  5LOM A;  3TDJ A;  4EQ9 A;  4PFY A;  1S50 A;  1FTM A;  4EF1 A;  1QVS A;  3FXR A;  4RK9 A;  1B5H A;  3TTM A;  4R72 A;  3H6W A;  3RTW B;  5DYH A;  3DEL B;  1JW4 A;  4YAH X;  3TCH A;  4HCY A;  2RC8 A;  2Z22 A;  3W9V A;  3WAE A;  3FJM A;  2XD3 A;  4QF9 A;  3USD A;  3O2A A;  3G7W A;  3O6I A;  2A5S A;  3M3F A;  3QIM A;  2DS9 A;  4MF3 A;  3TKD A;  3V89 B;  1B3F A;  2ZNS A;  5I2N B;  2DWJ A;  2H98 A;  5I2N A;  2V3Q A;  1QKA A;  4YKI A;  3RQT A;  1LAX A;  2XXP A;  1B46 A;  3ILU B;  5KZT A;  1OIB A;  4DE8 A;  4H0W A;  1GV8 A;  1D9V A;  2D21 A; 
#chains in the Genus database with same CATH topology
 4WED A;  3IOT A;  3MAM A;  3H6T A;  5FBP A;  1DSN A;  3FVK A;  3PPO A;  4DZ1 A;  4R9G A;  1JEV A;  4JWX A;  3BBR A;  3SEY A;  1NV1 A;  4ELR A;  5A5X B;  2Y5K A;  2PBW A;  5A5X A;  1NNT A;  3TFL A;  4BLA A;  1A8F A;  4F1Y A;  1YPN A;  3IX1 A;  1N7X A;  3O28 A;  5ICT A;  5HBC A;  1FPK A;  2PCR A;  5CM6 A;  1FQD A;  3PUZ E;  4ONY A;  2P3V A;  3UK4 A;  4EUO A;  4JVI A;  2F6G A;  2IA4 A;  3QMF A;  3FBP A;  4RNS A;  4R6H A;  4OA4 A;  4QHQ A;  3K1P A;  1ZTY A;  4GX3 A;  4GXS B;  1NNP A;  1FBG A;  3SZP A;  4N4U A;  1UTB B;  1UTB A;  1UIV A;  1D3K A;  5AA1 A;  1GTK A;  1N0T A;  1P1N A;  2DVZ A;  2XXQ A;  2V3U A;  2PMS A;  3FVO A;  3RN8 A;  3PPP A;  3K0V A;  4GWX A;  2ESN A;  4ESW A;  4MHF A;  4GBW A;  2DVC A;  2ABH A;  1TFD A;  4LQ5 A;  3A29 A;  5I7I A;  1H45 A;  3A09 A;  3FV2 A;  3TYH A;  1USY H;  1JEU A;  3LR1 A;  4U4X A;  1DPE A;  3FJ7 A;  3QUJ A;  1MY1 A;  2DSF A;  4HE0 A;  3FAS A;  1KA1 A;  2XHD A;  3SEW A;  4F22 A;  1IZ1 A;  4OXV A;  1FPJ A;  3LSF B;  1DK4 A;  1MPD A;  5ET8 A;  1B3H A;  4AQ4 A;  2GHB A;  4QSE A;  1SI0 A;  4MLV A;  1MY0 A;  1IMB A;  2HZL A;  4FED A;  1SPI A;  1EZP A;  3DP8 A;  5EQ8 A;  1FBF A;  1MY3 A;  3IJO B;  3RUM A;  2H9B A;  1OVT A;  2UXA A;  1YCJ A;  3QUF A;  1FTK A;  2XXH A;  1Y20 A;  3SEU A;  1FTO A;  4O3A A;  1MG1 A;  3TZA A;  1UQW A;  1OMP A;  5FTI A;  2NVU B;  2Z8F A;  4MMP A;  1FPB A;  3FXB A;  1PEB A;  3K2D A;  4OQO A;  1FBH A;  4F1V A;  1H3D A;  4UA8 A;  4YKJ A;  3RGY A;  2Q2C A;  2V4C A;  3ODB A;  3V8X B;  3CR9 A;  4DXB A;  3FD3 A;  2AL4 A;  1QJM A;  3TTN A;  2OBG A;  3KEI A;  4U4S A;  3UN6 A;  3KN3 A;  3MC2 A;  2Q2A A;  2CMO A;  4U23 A;  3I5O A;  3U93 A;  2Q8M A;  1B0L A;  4ZZE A;  4XIG Q;  2W7Y A;  1FPD A;  1NH7 A;  1DPP A;  4QFP A;  4MCO A;  4OFJ A;  3KBR A;  1IMD A;  4GBV A;  2G29 A;  3DP4 A;  3CI8 A;  4MLQ A;  4N91 A;  3R26 A;  3KJ7 A;  4GWW A;  4JWY A;  4MJO A;  2QS3 A;  4KCC A;  4HS7 A;  3KN8 A;  4ECF A;  3LSL A;  4OEN A;  3D4G A;  4MX6 A;  2PT1 A;  5DVJ A;  2Z8E A;  1OLC A;  1XI6 A;  2VPN A;  1AIV A;  1YAE A;  4ZZA A;  3ZKK A;  1Y3Q A;  5TU0 A;  1AMF A;  3K6U A;  3MZB A;  2F6P A;  5H8N B;  1PB7 A;  5H8N A;  5ESY A;  5AA2 B;  1NNK A;  2GH9 A;  5AA2 A;  4PE3 A;  1XOC A;  2Y7W A;  4EXK A;  1Q9D A;  4MEV A;  3GLB A;  3W15 C;  3FXQ A;  4U22 A;  3V5A A;  3WAF A;  4NWC A;  4PAF A;  4JBZ A;  2XXK A;  5IZZ A;  3BIG A;  3VDF A;  1EH3 A;  1FRP A;  4IO5 A;  2E1S A;  3RYD A;  1G0I A;  3IFA A;  2GQ1 A;  3PV0 E;  4NE4 A;  1Z7N E;  2ZYM A;  2ZNU A;  3MPK A;  5J16 A;  4QBA A;  4N8Y A;  4P0G A;  4OZ9 A;  1EU8 A;  5F1Q A;  1GGG A;  3CFL A;  3N26 A;  3O29 A;  4DIG A;  4TQU Q;  4MNP A;  2V25 A;  3FGS A;  4L17 A;  3TUS A;  2XX8 A;  3S4U A;  5CMB A;  3S9M C;  1XVY A;  5KDT B;  2OZZ A;  5KDT A;  1A99 A;  1QUL A;  1R6Z A;  4NED A;  4NG7 A;  3D1R A;  3VVD A;  1FSA A;  1I6Q A;  1SYH A;  1MDQ A;  5BUU A;  2V93 A;  3C4M A;  3PPQ A;  2FBP A;  5I59 B;  1SW5 A;  3GBA A;  3T9H B;  4F2Q A;  5I59 A;  1FQE A;  3K00 A;  1POY 1;  4PGN A;  1URD A;  3FXU A;  3H6U A;  1ATG A;  4YMB A;  3N6T A;  4XFE A;  4WKM A;  1IEJ A;  2H5Y A;  1MPC A;  3KC1 A;  3SER A;  1B5J A;  1N76 A;  3O6G A;  3MW0 A;  2Q8J A;  2HFB A;  2P1S A;  1S7Y A;  5LTC A;  4ZEF A;  3T22 A;  3O97 A;  1XC1 A;  3T93 B;  4OMB A;  2WBD A;  3MP6 A;  1Y4T A;  2R6G E;  2XWO A;  4QFK A;  1II5 A;  4RPO A;  4ZEI A;  4O3C A;  3PUY E;  5I56 B;  3HO7 A;  3MP8 A;  5I56 A;  1VR5 A;  5ISU A;  5CMK A;  4Q0C A;  4O94 A;  1ZIU A;  2DXY A;  4N81 A;  3LSX A;  4P11 A;  1M5E A;  4EQ7 A;  2X7Q A;  5K2X A;  4XXU A;  3B6W A;  1IXI A;  1B52 A;  1YZ0 A;  4RPN A;  4AB5 A;  3OSQ A;  4N17 A;  3UA8 A;  3RTF B;  4XKQ A;  4KQP A;  1NV0 A;  2PFZ A;  2XXI A;  4TLL B;  2V84 A;  4IO2 A;  3OEL A;  2B65 A;  4DLD A;  4PET A;  4UAB A;  1MPB A;  4IO7 A;  3PMW A;  3HCQ A;  4FBP A;  2O1M A;  5DTB A;  3CSB A;  2DE2 A;  3OD7 A;  3N5L A;  4N13 A;  3F11 A;  3K6X A;  1NH8 A;  3TTL A;  5JK4 A;  1MXZ A;  1MRP A;  3T1B A;  5AA3 A;  2REG A;  1FTL A;  2QMX A;  1D9Y A;  2RCA A;  3UGW A;  1MDP 1;  4P1L A;  2GFE A;  2I4B A;  3UIF A;  4HW8 A;  2FIE A;  4FOR A;  4KXP A;  4KHZ E;  3OSR A;  1R9Q A;  4ELP A;  1NUW A;  4XF5 A;  1LBY A;  4KYE A;  4YIC A;  4HE2 A;  1ZBM A;  3IO4 A;  3N94 A;  3PPR A;  5FHM A;  1DMB A;  4QFL A;  5CMC A;  1WVJ A;  4YB7 A;  1OLA A;  1NV5 A;  1ZLQ A;  4GRK A;  1N3W A;  3UOR A;  3SET A;  4XKP A;  1INP A;  1Y1M A;  1P1Q A;  4OFL A;  4OES A;  1JVX A;  4GWZ A;  2XX7 A;  1BLF A;  4PGP A;  3VLU A;  2YLN A;  3U65 A;  1LAH E;  4P0I A;  3E78 A;  2MKZ A;  4N6K A;  4F39 A;  5KCJ B;  5I5P A;  2BJJ X;  4JXI A;  3P7I A;  3VLV A;  5KCJ A;  4RA1 A;  2I0B A;  4LA9 A;  4F19 A;  2QS4 A;  3MJN A;  4GL0 A;  1XT8 A;  3U92 A;  2VPO A;  1EYI A;  1DTG A;  1HSL A;  3PUW E;  4H8J A;  1B2H A;  4OVQ A;  4H1X A;  3PU5 A;  2Q88 A;  1JNF A;  3ROJ A;  3IB2 A;  2B3B A;  4Q30 B;  1A54 A;  1IXH A;  5F7V A;  3EQ1 A;  3MUQ A;  4PBQ A;  1MY2 A;  5FHN A;  3ZS6 A;  1HSE A;  3TQL A;  4PFU A;  4ELO A;  2ONK E;  4UAC A;  4GFR A;  2F35 A;  2D5W A;  4R75 A;  2QS1 A;  2O68 A;  3KG2 A;  3AXF A;  2B4M A;  3C34 A;  5EHM A;  2OWZ A;  4MIJ A;  4FAT A;  4OER A;  1N84 A;  1K9Y A;  1SQY A;  1H44 A;  1LBB A;  3C36 A;  1P99 A;  5DT6 A;  1NV3 A;  4E0W A;  4H6D A;  1URG A;  3K1N A;  2Y7K A;  1NNF A;  1B9J A;  2DQV A;  4PAI A;  2CEX A;  3KC0 A;  4G8N A;  4Q5T A;  3ILT B;  4OVJ A;  5I58 B;  2Q9T A;  1YXI A;  3MVX A;  5I58 A;  5CI5 A;  2ZMB A;  2DYX A;  1LB9 A;  2F34 A;  1URS A;  1LBV A;  4HCW A;  4GX4 A;  4OWD A;  4ZEB A;  1JW1 A;  3IB1 A;  5J1D A;  1RDZ A;  2VP1 A;  3HV1 A;  4ZS9 A;  4BDL A;  5I3S A;  1KWH A;  1B51 A;  1UIU A;  4EXL A;  1Y9U A;  2XWK A;  4OHN A;  2VT5 A;  2O7I A;  2A5T B;  1SD3 A;  2QMW A;  1VE4 A;  3T66 A;  4YMA A;  4X48 A;  3Q26 A;  2A5T A;  3IOV A;  4PP0 A;  3IK6 B;  3THI A;  3JYR A;  3RLF E;  1MQH A;  2OWS A;  3OMB A;  2I3V A;  5IM2 A;  1DTZ A;  1FTA A;  2ZZX A;  1NI9 A;  4U2R A;  3A3C A;  1MS7 A;  2JJK A;  2ALU A;  2I6E A;  5ICQ A;  3M8U A;  1TWY A;  2VD3 A;  3LBS A;  2XXR A;  3FZV A;  3QYT A;  5DW8 A;  4X1D A;  2HCA A;  5H8F B;  2OX3 A;  5ITO A;  2B4L A;  3ONM A;  2GHA A;  5H8F A;  1QUK A;  3B50 A;  1KA0 A;  4OET A;  4I1D A;  4H5F A;  4GD5 A;  2THI A;  2Y7P A;  1H43 A;  2ZZW A;  2Y5L A;  2I58 A;  3T0J A;  4ND9 A;  1SDX A;  4NTL A;  1MM7 A;  2ONS A;  3KSX A;  3RT8 A;  1FQC A;  4EDP A;  4OTE A;  4HE1 A;  2YJP A;  3DP6 A;  2DWA A;  1IIW A;  3KBZ A;  2R8T A;  1NV6 A;  4JSO A;  4DXU A;  4PAK A;  3MVZ A;  3ZSF A;  3RPL B;  4YB5 A;  3SKP A;  2RKM A;  3RPL A;  2AYS A;  2ONR A;  2HXR A;  4LZ8 A;  1LCF A;  3TMG A;  3IAZ A;  5ET7 A;  2BJI A;  4ZE9 A;  4N07 A;  4ZEC A;  4G2Z A;  1XS5 A;  1B32 A;  4I9D A;  1M5D A;  2QJE A;  4KYD A;  2G93 A;  1NFT A;  4MBP A;  1NL5 A;  1RKM A;  3RNN A;  1B7U A;  2P2A A;  3OEN A;  3OO8 A;  1IUD A;  4TLM B;  3TEP A;  3W9W A;  1RDY A;  4N8G A;  4MNI A;  3SDF A;  4H5G A;  1LFH A;  4GX6 A;  4Z0I A;  2QPQ A;  5K2Y A;  3VVE A;  3VE1 B;  3MZ9 A;  2Y7I A;  4JVC A;  4GXA A;  1BK4 A;  2GRV A;  5F24 A;  1USY E;  4JWO A;  4N6D A;  1L5T A;  4R2F A;  1R9L A;  2UVI A;  5I57 B;  1SI1 A;  3H3G A;  3ZKL A;  4GLI A;  4IO3 A;  5I57 A;  4JVD A;  2ZYN A;  4GWS A;  4DI3 D;  1O7T A;  3T96 B;  2HHM A;  3TTK A;  2RC9 A;  3RT6 B;  4OVT A;  2ZYO A;  5T3J A;  4POX A;  1MY4 A;  1FTJ A;  1J1N A;  4I40 A;  1M5F A;  3H4Z A;  3C9H A;  2NOO A;  3T9V A;  1P1U A;  4PCD A;  2WYK A;  2NWJ A;  2VD2 A;  4NWD A;  2RC7 A;  3OOA A;  1SW4 A;  4RYA A;  4X1B A;  5FHO A;  2XWI A;  4G8M A;  1CE2 A;  1DOT A;  2P3N A;  3CFZ A;  1SYI A;  3K1M A;  1HSJ A;  5M2V A;  3SEV A;  3LC8 A;  2KR0 A;  2F3B A;  2DE3 A;  3IOU A;  3IB0 A;  5EQ7 A;  2FHY A;  3CFX A;  5IKB A;  4GOT A;  1PB8 A;  1LEV A;  2DOJ A;  3T9X B;  2F8D A;  4F3S A;  1K9Z A;  3U72 A;  4IGT A;  2CEY A;  2ZXT A;  3PUV E;  4BDN A;  3H06 B;  1QUI A;  2H25 A;  1Y3N A;  4O7M A;  3K4U A;  1KZ8 A;  4PTK A;  5EQA A;  4O8M A;  1ZU0 A;  4X04 A;  2I3W A;  3MBP A;  1IMF A;  2ANJ A;  3PUX E;  2DWH A;  1FBD A;  1MM6 A;  3LUZ A;  2FYI A;  4PFB A;  2Z23 A;  1LAF E;  1IIT A;  4N6P A;  2I4C A;  3K01 A;  2NXO A;  3KOT A;  3SES A;  4P9K A;  1O63 A;  4NF8 B;  5JTY B;  2V3T A;  2KLF A;  4LAT A;  4NF8 A;  5JTY A;  2F36 A;  2I49 A;  2L5V A;  5ET6 A;  2WX9 A;  1RYX A;  4PE5 B;  3E13 X;  2QFL A;  4P8B A;  3G3J A;  1ZMG A;  1B7Z A;  5L9M A;  3QSL A;  4PFW A;  4R2B A;  2UVH A;  1B7H A;  1B58 A;  2O51 A;  2F3D A;  1MH4 A;  3G3I A;  4I8C A;  5TPA B;  3KSJ A;  5TPA A;  4ZED A;  5AA4 B;  1JW5 A;  5CMM A;  5EYH A;  5AA4 A;  1GR2 A;  4JSD A;  2XD2 A;  3U1O A;  2XXV A;  1BIY A;  3H03 A;  3BKI B;  3LSW A;  3M3L A;  1N7W A;  3Q25 A;  4OVR A;  5DVI A;  3VFJ A;  1MXY A;  5H8Q B;  4LZ5 A;  1LLS A;  3G3F A;  1SW1 A;  3FIR A;  5H8Q A;  2X7P A;  1Y1Z A;  2HXW A;  3MYU A;  4MAG A;  1B4H A;  3QK6 A;  3KZG A;  2QL3 A;  2HAV A;  2RF1 A;  4IO4 A;  3OEK A;  4LON B;  2M8C A;  2UVG A;  1FW0 A;  1MXV A;  2RIN A;  2QVU A;  4I3E A;  4OAN A;  1B3L A;  1B6H A;  3R6U A;  2OCU A;  3Q27 A;  5H8H B;  4YU0 A;  4P47 A;  1A40 A;  5H8H A;  1B1H A;  4GF8 A;  4C0R A;  5HM4 B;  1BKA A;  1F9B A;  3B6Q A;  4I62 A;  3TQW A;  3FAT A;  1LCT A;  1PB9 A;  3T9U A;  1FPF A;  3HST A;  4EF2 A;  4MFI A;  1POT A;  2QSX A;  4LN5 A;  3E9X A;  4QSD A;  4OFO A;  3LUY A;  5B7D A;  2CZK A;  3PTY A;  1SW2 A;  1CNQ A;  4XEQ A;  1FBP A;  2PYY A;  5AE4 A;  4F2O A;  4BDM A;  3KN7 A;  3GXA A;  4QFN A;  5ET5 A;  4P1E A;  3CIJ A;  4F1U A;  3G3H A;  1BP5 A;  3KOS A;  1NKX A;  2AIX A;  1FPE A;  2F78 A;  1TT1 A;  1SBP A;  2UVJ A;  2ZZV A;  3C31 A;  3IO6 A;  4Q8R A;  1PBP A;  3MP1 A;  2REJ A;  1MQD A;  4Z7E A;  2XXW A;  4XTC Q;  3IOR A;  2F97 A;  1A8E A;  1T0K A;  1OQH A;  3VV5 A;  1DCU A;  4C1T A;  2HEU A;  3K6V A;  4DXC A;  2VHA A;  4QFO A;  3MVY A;  1P1O A;  3E79 A;  4LZ7 A;  1Q1K A;  1AWB A;  2DP8 A;  1P1W A;  1AL3 A;  4PC9 A;  1FPL A;  3FV1 A;  4PFT A;  5H8S A;  2D3I A;  1OVB A;  1AOV A;  2O7U A;  4YKP A;  4MNC A;  4ZEK A;  3BIH A;  4U1O A;  3LV0 A;  1RYO A;  2CZH A;  2HQ0 A;  2QVV A;  4FE8 A;  4KPT A;  1UTH B;  2DXR A;  1B1X A;  2XWV A;  4THI A;  1UTH A;  4OYV A;  2FA7 A;  1FQA A;  3HFU A;  3HN0 A;  1WOD A;  4GL8 A;  3MWB A;  4PF6 A;  4F3P A;  3CSG A;  1YTV A;  2I48 A;  3TEL A;  1M5B A;  3C32 A;  4PF8 A;  4PDH A;  4DI4 B;  2Y84 A;  3IJX B;  4GWO A;  5L9S A;  3PD8 A;  1LAG E;  3OO7 A;  4M4G A;  5L8D A;  1FQB A;  3FVN A;  2R9J A;  4TOZ A;  3DLN A;  4F3B A;  1H76 A;  2X26 A;  2CZI A;  4IY5 A;  1FJ9 A;  2QVR A;  4LP2 B;  1FBE A;  3VXB A;  1QW0 A;  1EYJ A;  4ZDM A;  4RJZ A;  3M3K A;  1Z7M E;  5CBR A;  4BDO A;  3G3K A;  5IZ1 A;  2NUV A;  5B70 A;  1LB8 A;  3OEM A;  3OXN A;  1LFG A;  3RPW A;  2QS2 A;  1IXC A;  1EZ9 A;  1LBZ A;  1MXX A;  3L6G A;  1D4N A;  5JEI A;  1FPI A;  4HTG A;  1MXW A;  3GYY A;  5I2K B;  4AS5 A;  1JP4 A;  1TFA A;  1QGX A;  5I2K A;  2FNC A;  1B40 A;  3C33 A;  3EHT A;  3S9E A;  4LVQ A;  2PVU A;  2XA5 A;  5CRY A;  4JDF A;  3FUZ A;  1QUJ A;  5HPQ A;  1JQF A;  4PFR A;  4KCD A;  2UYE A;  3TCG A;  1MQG A;  1LFI A;  4G4P A;  3PD9 A;  2OLB A;  3GBB A;  3G3G A;  3B7D A;  3I3V A;  3FVG A;  4FEC A;  4GWY A;  2HZK A;  1Y4C A;  1WDN A;  4M1V A;  3HHG A;  4ELQ A;  3EKI A;  3MZ1 A;  2ZYK A;  4WEP A;  5EQ9 A;  4DCX A;  5ITP A;  4QSC A;  1Y3P A;  4OEV A;  3N6U A;  3TPA A;  5CBS A;  2DWI A;  4IO6 A;  1I6A A;  4IGR A;  4NF4 B;  1B0H A;  4F18 A;  3KJT A;  4NF4 A;  2F5X A;  5IAI A;  3H7M A;  5L9O A;  4OVP A;  2F7A A;  1PBQ A;  3TTR A;  1IXG A;  1N04 A;  1NUZ A;  2FIX A;  2UYF A;  2O69 A;  1PC3 A;  4X9T A;  2DE4 A;  1US4 A;  5DVF A;  3HHF A;  2LAO A;  1S9T A;  1NV4 A;  4E0X A;  1XHY A;  1A55 A;  4NHB A;  3SEX A;  4NF6 B;  3QAX A;  3BFU A;  4NGU A;  1QKB A;  4NF6 A;  4YZZ A;  4PQJ A;  1B3G A;  4AS4 A;  1SVX B;  3R7X A;  4KD5 A;  1US5 A;  3MQ9 A;  4NQ8 A;  3TAJ A;  4RK2 A;  5I84 A;  4NN3 A;  3EHS A;  2XXU A;  4G68 B;  1LBX A;  3IOW A;  4ZE8 A;  4G68 A;  3D4C A;  3NOH A;  3B6T A;  3PPN A;  1NV7 A;  1N3X A;  3S9N C;  1NUX A;  1DBZ A;  3K6W A;  2O6A A;  1B05 A;  3TOD A;  2XXX A;  3CRB A;  2KQZ A;  1I6B A;  1MH3 A;  2H4I A;  4IR8 A;  4K3F A;  1A7L A;  1IMA A;  1MQJ A;  1MQI A;  1M5C A;  4LQ2 A;  3BFT A;  4IY6 A;  1OQG A;  1MXU A;  1B3E A;  3O66 A;  1G0H A;  4H67 A;  4F31 B;  3V83 A;  4IB2 A;  5A5L A;  3VXC A;  4FEB A;  4POW A;  3PMV A;  4RXL A;  3CG1 A;  3IL1 B;  4KFQ A;  3OO6 A;  3E3K A;  4I3Y A;  2QRY A;  3EPE A;  4XKR A;  4ESX A;  1JVY A;  3U8Q A;  5ELV A;  4PDD A;  4NMY A;  4H46 A;  4GVO A;  4P3L A;  4LUB A;  4BDQ A;  4FAJ A;  4FIM A;  3OO9 A;  2OK2 A;  2XXT A;  1B4Z A;  1ZJL A;  2YPN A;  1ANF A;  2WKY A;  1VFD A;  4R6Y A;  4R6K A;  1TXF A;  1I69 A;  4YB6 A;  1GVC A;  3C35 A;  2WEF A;  1JET A;  3MPL A;  3U94 A;  4U1Z A;  4U21 A;  3ECR A;  1IQ7 A;  3H6V A;  2RCB A;  3UP9 A;  5EHS A;  2O84 X;  1FBC A;  4G68 C;  4O7I A;  3Q29 A;  1VSO A;  4HXV A;  5DEX B;  4RY1 A;  1B5I A;  4NF5 B;  2FVZ A;  4N15 A;  5DEX A;  2F7B A;  4NF5 A;  1R1N A;  4DCY A;  4C1U A;  2XX9 A;  3EF7 A;  4KR5 A;  2CZL A;  2XXY A;  5LDZ A;  3L6H A;  4WXJ A;  1LBW A;  2HAU A;  1PDA A;  1BTJ A;  4BDR A;  4XKN A;  3E4R A;  1ELJ A;  4GQO A;  4X8R A;  2Z8D A;  5TP9 B;  4KYS A;  3JV9 A;  5TP9 A;  1NV2 A;  2VGQ A;  1VFE A;  1NMU A;  2B3F A;  5FTH A;  2Q89 A;  1LGB C;  3VVF A;  3KGC A;  4FJP A;  3QXM A;  4EQB A;  1EZO A;  4F29 A;  1AH5 A;  2R71 A;  1EYK A;  4R9F A;  2PFY A;  3PGF A;  4O3B A;  2PT2 A;  2OJT A;  2IEE A;  3MVW A;  4G61 A;  3KFM A;  4YKK A;  3EHU A;  4QXD A;  2PX1 A;  3S9L C;  4QRZ A;  2VOZ A;  2P0S A;  3FJG A;  3DM0 A;  1LST A;  2I0C A;  3EN3 A;  4DDD A;  2Q74 A;  4KI0 E;  3CG3 A;  4JB7 A;  5CC2 A;  4F3G A;  4G8H A;  3HPI A;  2AL5 A;  4H8I A;  4OEU A;  3CVG A;  4R73 A;  1CB6 A;  1ZKB A;  3PMX A;  4H65 A;  3IR1 A;  4G77 A;  4NF0 A;  3S2V A;  1O64 A;  3GZG A;  5EYF A;  3O9P A;  3CHG A;  1Q35 A;  5AA2 D;  5IZ3 B;  2F7C A;  3K02 A;  5IZ3 A;  2ZNT A;  4AB6 A;  4MH5 A;  5IGA A;  3A3U A;  3VLW A;  3IFC A;  4ISU A;  3JZJ A;  2H99 A;  1FPG A;  1NUY A;  3O6H A;  2Y7R A;  1LBC A;  1FQF A;  3Q28 A;  4R74 A;  3RY3 A;  1XVX A;  2OWT A;  3TCF A;  2O1L A;  3B8B A;  4NAP A;  2E0S A;  4GIZ A;  1FCK A;  5BWJ A;  3I6V A;  5LOM A;  3TDJ A;  4EQ9 A;  4PFI A;  4PFY A;  2WBB A;  1S50 A;  1IMC A;  1FTM A;  4EF1 A;  1QVS A;  3FXR A;  4RK9 A;  4OVS A;  1B5H A;  3TTM A;  4R72 A;  3H6W A;  3RTW B;  5DYH A;  3DEL B;  2DDK A;  1JW4 A;  4YAH X;  3TCH A;  4HCY A;  2RC8 A;  2Z22 A;  3W9V A;  3WAE A;  3FJM A;  2XD3 A;  4QF9 A;  3USD A;  4H45 A;  4NX1 A;  3O2A A;  3G7W A;  3O6I A;  2A5S A;  3M3F A;  1RDX A;  3QIM A;  2DS9 A;  3ISP A;  4MF3 A;  4PBH A;  3TKD A;  3V89 B;  1VDW A;  1B3F A;  2ZNS A;  5I2N B;  2DWJ A;  2H98 A;  4P56 A;  2WYP A;  5I2N A;  2V3Q A;  1QKA A;  3MST A;  4YKI A;  5EYG A;  3RQT A;  1LAX A;  2XXP A;  1B46 A;  1YYZ A;  1IME A;  3ILU B;  5KZT A;  4GWU A;  1OIB A;  2HPG A;  4DE8 A;  4H0W A;  1GV8 A;  1D9Q A;  1D9V A;  1FJ6 A;  2D21 A; 
#chains in the Genus database with same CATH homology
 4WED A;  3IOT A;  3MAM A;  3H6T A;  1DSN A;  3FVK A;  3PPO A;  4DZ1 A;  4R9G A;  1JEV A;  4JWX A;  3BBR A;  3SEY A;  4ELR A;  5A5X B;  2PBW A;  5A5X A;  1NNT A;  3TFL A;  4BLA A;  1A8F A;  4F1Y A;  1YPN A;  3IX1 A;  1N7X A;  3O28 A;  5ICT A;  5HBC A;  5CM6 A;  1FQD A;  3PUZ E;  4ONY A;  3UK4 A;  4EUO A;  2F6G A;  2IA4 A;  4RNS A;  4R6H A;  4QHQ A;  3K1P A;  1ZTY A;  4GXS B;  1NNP A;  1UTB B;  1UTB A;  1UIV A;  1D3K A;  5AA1 A;  1GTK A;  1N0T A;  1P1N A;  2DVZ A;  2XXQ A;  2V3U A;  2PMS A;  3FVO A;  3RN8 A;  3PPP A;  3K0V A;  2ESN A;  4ESW A;  2DVC A;  2ABH A;  1TFD A;  4LQ5 A;  1H45 A;  3A09 A;  3FV2 A;  3TYH A;  1USY H;  1JEU A;  3LR1 A;  4U4X A;  1DPE A;  3FJ7 A;  3QUJ A;  1MY1 A;  2DSF A;  3FAS A;  2XHD A;  3SEW A;  4F22 A;  1IZ1 A;  4OXV A;  3LSF B;  1MPD A;  1B3H A;  4AQ4 A;  2GHB A;  4QSE A;  1SI0 A;  4MLV A;  1MY0 A;  2HZL A;  4FED A;  1EZP A;  3DP8 A;  1MY3 A;  3IJO B;  3RUM A;  2H9B A;  1OVT A;  2UXA A;  1YCJ A;  3QUF A;  1FTK A;  2XXH A;  1Y20 A;  3SEU A;  1FTO A;  4O3A A;  1MG1 A;  3TZA A;  1UQW A;  1OMP A;  5FTI A;  2NVU B;  2Z8F A;  1PEB A;  3K2D A;  4OQO A;  4F1V A;  1H3D A;  4UA8 A;  4YKJ A;  3RGY A;  2Q2C A;  3ODB A;  3V8X B;  3CR9 A;  4DXB A;  3FD3 A;  2AL4 A;  1QJM A;  3TTN A;  2OBG A;  3KEI A;  4U4S A;  3UN6 A;  3KN3 A;  3MC2 A;  2Q2A A;  2CMO A;  4U23 A;  3I5O A;  3U93 A;  1B0L A;  4ZZE A;  4XIG Q;  2W7Y A;  1NH7 A;  1DPP A;  4QFP A;  4OFJ A;  3KBR A;  2G29 A;  3DP4 A;  3CI8 A;  4MLQ A;  3R26 A;  3KJ7 A;  4JWY A;  2QS3 A;  4KCC A;  4HS7 A;  3KN8 A;  4ECF A;  3LSL A;  4OEN A;  3D4G A;  2PT1 A;  5DVJ A;  2Z8E A;  1OLC A;  1AIV A;  1YAE A;  4ZZA A;  3ZKK A;  1Y3Q A;  5TU0 A;  1AMF A;  3K6U A;  3MZB A;  2F6P A;  5H8N B;  1PB7 A;  5H8N A;  5AA2 B;  1NNK A;  2GH9 A;  5AA2 A;  1XOC A;  2Y7W A;  4EXK A;  3GLB A;  3W15 C;  3FXQ A;  4U22 A;  3V5A A;  3WAF A;  4NWC A;  4JBZ A;  3VDF A;  1EH3 A;  4IO5 A;  2E1S A;  3PV0 E;  4NE4 A;  1Z7N E;  2ZYM A;  2ZNU A;  3MPK A;  4P0G A;  4OZ9 A;  1EU8 A;  5F1Q A;  1GGG A;  3CFL A;  3N26 A;  3O29 A;  4DIG A;  4TQU Q;  2V25 A;  3FGS A;  4L17 A;  3TUS A;  2XX8 A;  3S4U A;  5CMB A;  3S9M C;  1XVY A;  5KDT B;  2OZZ A;  5KDT A;  1A99 A;  1QUL A;  1R6Z A;  4NED A;  3VVD A;  1I6Q A;  1SYH A;  1MDQ A;  5BUU A;  2V93 A;  3C4M A;  3PPQ A;  5I59 B;  1SW5 A;  3GBA A;  3T9H B;  4F2Q A;  5I59 A;  1FQE A;  3K00 A;  1POY 1;  1URD A;  3FXU A;  3H6U A;  1ATG A;  4YMB A;  3N6T A;  4WKM A;  1IEJ A;  2H5Y A;  1MPC A;  3SER A;  1B5J A;  1N76 A;  3O6G A;  3MW0 A;  2Q8J A;  2HFB A;  2P1S A;  1S7Y A;  4ZEF A;  3T22 A;  3O97 A;  1XC1 A;  3T93 B;  4OMB A;  3MP6 A;  1Y4T A;  2R6G E;  4QFK A;  1II5 A;  4RPO A;  4ZEI A;  4O3C A;  3PUY E;  5I56 B;  3HO7 A;  3MP8 A;  5I56 A;  1VR5 A;  5ISU A;  5CMK A;  4Q0C A;  1ZIU A;  2DXY A;  3LSX A;  4P11 A;  1M5E A;  4EQ7 A;  2X7Q A;  5K2X A;  4XXU A;  3B6W A;  1IXI A;  1B52 A;  4RPN A;  4AB5 A;  3OSQ A;  3UA8 A;  3RTF B;  4XKQ A;  4KQP A;  2XXI A;  4TLL B;  2V84 A;  4IO2 A;  3OEL A;  2B65 A;  4DLD A;  4PET A;  1MPB A;  4IO7 A;  3PMW A;  3HCQ A;  2O1M A;  5DTB A;  3CSB A;  2DE2 A;  3OD7 A;  3N5L A;  4N13 A;  3F11 A;  3K6X A;  1NH8 A;  3TTL A;  5JK4 A;  1MXZ A;  1MRP A;  5AA3 A;  2REG A;  1FTL A;  2QMX A;  1D9Y A;  2RCA A;  3UGW A;  1MDP 1;  2GFE A;  2I4B A;  3UIF A;  4HW8 A;  4FOR A;  4KHZ E;  3OSR A;  1R9Q A;  4ELP A;  4KYE A;  4YIC A;  1ZBM A;  3IO4 A;  3N94 A;  3PPR A;  5FHM A;  1DMB A;  4QFL A;  5CMC A;  1WVJ A;  4YB7 A;  1OLA A;  1ZLQ A;  4GRK A;  1N3W A;  3UOR A;  3SET A;  4XKP A;  1Y1M A;  4OFL A;  1P1Q A;  4OES A;  1JVX A;  2XX7 A;  1BLF A;  3VLU A;  2YLN A;  1LAH E;  4P0I A;  4F39 A;  5KCJ B;  2BJJ X;  4JXI A;  3P7I A;  3VLV A;  5KCJ A;  4RA1 A;  2I0B A;  4LA9 A;  4F19 A;  2QS4 A;  3MJN A;  4GL0 A;  1XT8 A;  3U92 A;  1DTG A;  1HSL A;  3PUW E;  4H8J A;  1B2H A;  4H1X A;  3PU5 A;  2Q88 A;  1JNF A;  3IB2 A;  2B3B A;  4Q30 B;  1A54 A;  1IXH A;  5F7V A;  3EQ1 A;  3MUQ A;  1MY2 A;  5FHN A;  3ZS6 A;  1HSE A;  3TQL A;  4PFU A;  4ELO A;  2ONK E;  4UAC A;  4GFR A;  2F35 A;  2D5W A;  4R75 A;  2QS1 A;  2O68 A;  3KG2 A;  3AXF A;  3C34 A;  5EHM A;  4FAT A;  4OER A;  1N84 A;  1SQY A;  1H44 A;  1LBB A;  3C36 A;  1P99 A;  5DT6 A;  4E0W A;  4H6D A;  1URG A;  3K1N A;  2Y7K A;  1NNF A;  1B9J A;  2DQV A;  4G8N A;  4Q5T A;  3ILT B;  4OVJ A;  5I58 B;  2Q9T A;  3MVX A;  5I58 A;  5CI5 A;  2ZMB A;  2DYX A;  1LB9 A;  2F34 A;  1URS A;  4HCW A;  4OWD A;  4ZEB A;  1JW1 A;  3IB1 A;  5J1D A;  2VP1 A;  3HV1 A;  4ZS9 A;  4BDL A;  1KWH A;  1B51 A;  1UIU A;  4EXL A;  1Y9U A;  4OHN A;  2O7I A;  2A5T B;  1SD3 A;  2QMW A;  1VE4 A;  4YMA A;  3T66 A;  4X48 A;  3Q26 A;  2A5T A;  3IOV A;  4PP0 A;  3THI A;  3IK6 B;  3JYR A;  3RLF E;  1MQH A;  2OWS A;  3OMB A;  2I3V A;  1DTZ A;  4U2R A;  3A3C A;  1MS7 A;  2ALU A;  2I6E A;  5ICQ A;  3M8U A;  1TWY A;  2VD3 A;  3LBS A;  2XXR A;  3FZV A;  3QYT A;  4X1D A;  2HCA A;  5H8F B;  5ITO A;  3ONM A;  2GHA A;  5H8F A;  1QUK A;  4OET A;  4I1D A;  4H5F A;  4GD5 A;  2THI A;  2Y7P A;  1H43 A;  2I58 A;  4ND9 A;  1SDX A;  4NTL A;  1MM7 A;  2ONS A;  3KSX A;  3RT8 A;  1FQC A;  4EDP A;  4OTE A;  2YJP A;  3DP6 A;  2DWA A;  1IIW A;  4JSO A;  4DXU A;  3MVZ A;  3ZSF A;  4YB5 A;  3SKP A;  2RKM A;  2AYS A;  2ONR A;  4LZ8 A;  1LCF A;  3TMG A;  3IAZ A;  4ZE9 A;  4N07 A;  4ZEC A;  4G2Z A;  1XS5 A;  1B32 A;  4I9D A;  1M5D A;  2QJE A;  4KYD A;  2G93 A;  1NFT A;  4MBP A;  1NL5 A;  1RKM A;  3RNN A;  1B7U A;  2P2A A;  3OEN A;  3OO8 A;  1IUD A;  4TLM B;  3TEP A;  3W9W A;  3SDF A;  4H5G A;  1LFH A;  4Z0I A;  2QPQ A;  5K2Y A;  3VVE A;  3VE1 B;  3MZ9 A;  2Y7I A;  4GXA A;  2GRV A;  1USY E;  4JWO A;  1L5T A;  4R2F A;  1R9L A;  2UVI A;  5I57 B;  1SI1 A;  3H3G A;  3ZKL A;  4GLI A;  4IO3 A;  5I57 A;  2ZYN A;  1O7T A;  3T96 B;  3TTK A;  2RC9 A;  3RT6 B;  2ZYO A;  4POX A;  1MY4 A;  1FTJ A;  1J1N A;  1M5F A;  3H4Z A;  3C9H A;  2NOO A;  3T9V A;  1P1U A;  2NWJ A;  2VD2 A;  4NWD A;  2RC7 A;  3OOA A;  1SW4 A;  4RYA A;  4X1B A;  5FHO A;  4G8M A;  1CE2 A;  1DOT A;  3CFZ A;  1SYI A;  3K1M A;  1HSJ A;  5M2V A;  3SEV A;  3LC8 A;  2DE3 A;  3IOU A;  3IB0 A;  3CFX A;  5IKB A;  4GOT A;  1PB8 A;  2DOJ A;  3T9X B;  2F8D A;  4F3S A;  3U72 A;  4IGT A;  2ZXT A;  3PUV E;  4BDN A;  3H06 B;  1QUI A;  2H25 A;  1Y3N A;  3K4U A;  1ZU0 A;  2I3W A;  3MBP A;  3PUX E;  2ANJ A;  2DWH A;  1MM6 A;  2FYI A;  2Z23 A;  1LAF E;  1IIT A;  4N6P A;  2I4C A;  3K01 A;  2NXO A;  3KOT A;  3SES A;  1O63 A;  4NF8 B;  5JTY B;  2V3T A;  2KLF A;  4LAT A;  4NF8 A;  5JTY A;  2F36 A;  2I49 A;  1RYX A;  4PE5 B;  3E13 X;  3G3J A;  1ZMG A;  1B7Z A;  5L9M A;  3QSL A;  4PFW A;  4R2B A;  2UVH A;  1B7H A;  1B58 A;  2O51 A;  1MH4 A;  3G3I A;  4I8C A;  5TPA B;  3KSJ A;  5TPA A;  4ZED A;  5AA4 B;  1JW5 A;  5CMM A;  5AA4 A;  1GR2 A;  4JSD A;  2XD2 A;  3U1O A;  2XXV A;  1BIY A;  3H03 A;  3BKI B;  3LSW A;  3M3L A;  1N7W A;  3Q25 A;  5DVI A;  3VFJ A;  1MXY A;  5H8Q B;  4LZ5 A;  1LLS A;  3G3F A;  1SW1 A;  3FIR A;  5H8Q A;  2X7P A;  1Y1Z A;  2HXW A;  1B4H A;  3QK6 A;  3KZG A;  2QL3 A;  2HAV A;  2RF1 A;  4IO4 A;  3OEK A;  4LON B;  2M8C A;  2UVG A;  1FW0 A;  1MXV A;  2RIN A;  1B3L A;  1B6H A;  3R6U A;  2OCU A;  3Q27 A;  5H8H B;  4YU0 A;  1A40 A;  5H8H A;  1B1H A;  4GF8 A;  4C0R A;  5HM4 B;  1BKA A;  1F9B A;  3B6Q A;  4I62 A;  3TQW A;  3FAT A;  1LCT A;  1PB9 A;  3T9U A;  3HST A;  4EF2 A;  4MFI A;  1POT A;  2QSX A;  3E9X A;  4QSD A;  4OFO A;  3LUY A;  5B7D A;  1SW2 A;  2PYY A;  5AE4 A;  4F2O A;  4BDM A;  3KN7 A;  3GXA A;  4QFN A;  3CIJ A;  4F1U A;  3G3H A;  1BP5 A;  3KOS A;  1NKX A;  2AIX A;  2F78 A;  1TT1 A;  1SBP A;  2UVJ A;  3C31 A;  3IO6 A;  4Q8R A;  1PBP A;  3MP1 A;  2REJ A;  1MQD A;  4Z7E A;  2XXW A;  4XTC Q;  3IOR A;  2F97 A;  1A8E A;  1T0K A;  1OQH A;  3VV5 A;  4C1T A;  2HEU A;  3K6V A;  4DXC A;  2VHA A;  4QFO A;  3MVY A;  1P1O A;  4LZ7 A;  1Q1K A;  2DP8 A;  1P1W A;  1AL3 A;  4PFT A;  5H8S A;  3FV1 A;  2D3I A;  1OVB A;  1AOV A;  2O7U A;  4YKP A;  4ZEK A;  4U1O A;  1RYO A;  2HQ0 A;  4FE8 A;  4KPT A;  1UTH B;  2DXR A;  1B1X A;  4THI A;  1UTH A;  4OYV A;  2FA7 A;  1FQA A;  3HN0 A;  1WOD A;  4GL8 A;  3MWB A;  4F3P A;  3CSG A;  1YTV A;  2I48 A;  3TEL A;  1M5B A;  3C32 A;  2Y84 A;  3IJX B;  4GWO A;  5L9S A;  3PD8 A;  1LAG E;  3OO7 A;  4M4G A;  5L8D A;  1FQB A;  3FVN A;  2R9J A;  4TOZ A;  3DLN A;  4F3B A;  1H76 A;  2X26 A;  4IY5 A;  4LP2 B;  3VXB A;  1QW0 A;  4ZDM A;  4RJZ A;  3M3K A;  1Z7M E;  5CBR A;  4BDO A;  3G3K A;  2NUV A;  5B70 A;  1LB8 A;  3OEM A;  3OXN A;  1LFG A;  3RPW A;  2QS2 A;  1IXC A;  1EZ9 A;  1MXX A;  3L6G A;  1D4N A;  5JEI A;  4HTG A;  1MXW A;  5I2K B;  1TFA A;  5I2K A;  2FNC A;  1B40 A;  3C33 A;  3EHT A;  3S9E A;  4LVQ A;  2PVU A;  5CRY A;  4JDF A;  3FUZ A;  1QUJ A;  5HPQ A;  1JQF A;  4KCD A;  2UYE A;  3TCG A;  1MQG A;  1LFI A;  4G4P A;  3PD9 A;  2OLB A;  3GBB A;  3G3G A;  3B7D A;  3I3V A;  3FVG A;  4FEC A;  2HZK A;  1Y4C A;  1WDN A;  4M1V A;  3HHG A;  4ELQ A;  3MZ1 A;  2ZYK A;  4WEP A;  4DCX A;  5ITP A;  4QSC A;  1Y3P A;  4OEV A;  3N6U A;  3TPA A;  5CBS A;  2DWI A;  4IO6 A;  1I6A A;  4IGR A;  4NF4 B;  1B0H A;  4F18 A;  3KJT A;  4NF4 A;  2F5X A;  5IAI A;  3H7M A;  5L9O A;  2F7A A;  1PBQ A;  3TTR A;  1IXG A;  1N04 A;  2UYF A;  2O69 A;  1PC3 A;  4X9T A;  2DE4 A;  1US4 A;  5DVF A;  3HHF A;  2LAO A;  1S9T A;  4E0X A;  1XHY A;  1A55 A;  3SEX A;  4NF6 B;  3QAX A;  3BFU A;  1QKB A;  4NF6 A;  4YZZ A;  4PQJ A;  1B3G A;  1SVX B;  3R7X A;  4KD5 A;  1US5 A;  3MQ9 A;  3TAJ A;  4RK2 A;  5I84 A;  3EHS A;  2XXU A;  4G68 B;  3IOW A;  4ZE8 A;  4G68 A;  3D4C A;  3B6T A;  3PPN A;  1N3X A;  3S9N C;  3K6W A;  2O6A A;  1B05 A;  3TOD A;  2XXX A;  3CRB A;  1I6B A;  1MH3 A;  2H4I A;  4K3F A;  1A7L A;  1MQJ A;  1MQI A;  1M5C A;  4LQ2 A;  3BFT A;  4IY6 A;  1OQG A;  1MXU A;  1B3E A;  3O66 A;  4H67 A;  4F31 B;  3V83 A;  4IB2 A;  3VXC A;  4FEB A;  4POW A;  3PMV A;  4RXL A;  3CG1 A;  3IL1 B;  4KFQ A;  3OO6 A;  3E3K A;  2QRY A;  3EPE A;  4XKR A;  4ESX A;  1JVY A;  3U8Q A;  5ELV A;  4NMY A;  4GVO A;  4LUB A;  4BDQ A;  4FAJ A;  4FIM A;  3OO9 A;  2OK2 A;  2XXT A;  1B4Z A;  1ZJL A;  2YPN A;  1ANF A;  2WKY A;  1VFD A;  4R6Y A;  4R6K A;  1TXF A;  1I69 A;  4YB6 A;  1GVC A;  3C35 A;  1JET A;  3MPL A;  3U94 A;  4U1Z A;  4U21 A;  3ECR A;  1IQ7 A;  3H6V A;  2RCB A;  3UP9 A;  5EHS A;  2O84 X;  4G68 C;  3Q29 A;  1VSO A;  5DEX B;  4RY1 A;  1B5I A;  4NF5 B;  5DEX A;  2F7B A;  4NF5 A;  1R1N A;  4DCY A;  4C1U A;  2XX9 A;  3EF7 A;  4KR5 A;  2CZL A;  2XXY A;  3L6H A;  4WXJ A;  2HAU A;  1PDA A;  1BTJ A;  4BDR A;  4XKN A;  3E4R A;  1ELJ A;  4GQO A;  2Z8D A;  5TP9 B;  4KYS A;  3JV9 A;  5TP9 A;  2VGQ A;  1VFE A;  1NMU A;  2B3F A;  5FTH A;  2Q89 A;  1LGB C;  3VVF A;  3KGC A;  4FJP A;  3QXM A;  4EQB A;  1EZO A;  4F29 A;  1AH5 A;  2R71 A;  4R9F A;  3PGF A;  4O3B A;  2PT2 A;  2OJT A;  2IEE A;  3MVW A;  3KFM A;  4YKK A;  3EHU A;  2PX1 A;  3S9L C;  4QRZ A;  2VOZ A;  2P0S A;  3FJG A;  3DM0 A;  1LST A;  2I0C A;  3EN3 A;  4DDD A;  4KI0 E;  3CG3 A;  4JB7 A;  5CC2 A;  4F3G A;  4G8H A;  3HPI A;  2AL5 A;  4H8I A;  4OEU A;  3CVG A;  4R73 A;  1CB6 A;  1ZKB A;  3PMX A;  4H65 A;  3IR1 A;  4G77 A;  3S2V A;  1O64 A;  3GZG A;  5EYF A;  3O9P A;  1Q35 A;  5AA2 D;  2F7C A;  3K02 A;  2ZNT A;  4AB6 A;  4MH5 A;  3A3U A;  3VLW A;  4ISU A;  3JZJ A;  2H99 A;  3O6H A;  2Y7R A;  1LBC A;  1FQF A;  3Q28 A;  4R74 A;  3RY3 A;  1XVX A;  2OWT A;  3TCF A;  2O1L A;  2E0S A;  4GIZ A;  1FCK A;  5BWJ A;  3I6V A;  5LOM A;  3TDJ A;  4EQ9 A;  4PFY A;  1S50 A;  1FTM A;  4EF1 A;  1QVS A;  3FXR A;  4RK9 A;  1B5H A;  3TTM A;  4R72 A;  3H6W A;  3RTW B;  5DYH A;  3DEL B;  1JW4 A;  4YAH X;  3TCH A;  4HCY A;  2RC8 A;  2Z22 A;  3W9V A;  3WAE A;  3FJM A;  2XD3 A;  4QF9 A;  3USD A;  3O2A A;  3G7W A;  3O6I A;  2A5S A;  3M3F A;  3QIM A;  2DS9 A;  4MF3 A;  3TKD A;  3V89 B;  1B3F A;  2ZNS A;  5I2N B;  2DWJ A;  2H98 A;  5I2N A;  2V3Q A;  1QKA A;  4YKI A;  3RQT A;  1LAX A;  2XXP A;  1B46 A;  3ILU B;  5KZT A;  1OIB A;  4DE8 A;  4H0W A;  1GV8 A;  1D9V A;  2D21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...