3JYRA

Crystal structures of the gach receptor of streptomyces glaucescens gla.o in the unliganded form and in complex with acarbose and an acarbose homolog. comparison with acarbose-loaded maltose binding protein of salmonella typhimurium.
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
370
structure length
370
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEQDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEVTPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLVPNPPKTWEEIPALDKELKVKGKSAIMFNLQEPYFTWPLIAADGGYAFKFENGKYDVKDVGVDNAGAKAGLTFLIDMIKNKNMSADTDYSIAEAAFNKGETAMTINGPWAWSNIDKSKVNYGVTLLPTFKGKPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDQGLEAVNKDKPLGAVALKSFQEQLAKDPRIAATMDNAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALKDAQSRITK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Solute Receptor GacH of Streptomyces glaucescens in Complex with Acarbose and an Acarbose Homolog: Comparison with the Acarbose-Loaded Maltose-Binding Protein of Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 124
structure length 370
sequence length 370
ec nomenclature
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3jyrA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3jyrA01
3FV1A 3IL1B 1AL3A 4QHQA 4R6KA 1B5IA 3KN7A 3LUYA 2VD2A 1M5BA 1B3LA 4Q30B 1OVTA 2XXQA 3RT8A 4DXUA 1MY4A 1OLAA 1P1QA 1S50A 1I69A 1MM6A 2XXYA 2NOOA 3H7MA 3O9PA 4I8CA 1MH4A 4R74A 4RK2A 1ZU0A 1JW4A 4H8JA 4DLDA 1JW5A 5CBSA 5I2NA 5FHNA 4RY1A 5CMBA 1SW5A 1MQIA 3EN3A 1P1UA 1R6ZA 4BDMA 3SETA 3TMGA 1DPPA 1SD3A 3GBBA 1URSA 1KWHA 1UQWA 2DP8A 1GTKA 2G93A 3OXNA 4GRKA 2XD3A 4NE4A 2THIA 3MBPA 4OETA 4POXA 4RPNA 3W9WA 1FQEA 3MPLA 3VXBA 1M5DA 3IOTA 4IGRA 1MY3A 2KLFA 3E13X 1AMFA 1B7HA 3HN0A 2DWIA 1SW4A 1XT8A 2HAVA 2W7YA 4GF8A 4KYEA 5F1QA 3Q26A 3OEKA 4OFOA 3O28A 1OLCA 3UP9A 5H8FA 1I6AA 2OK2A 3SEYA 1NL5A 3H6VA 4KQPA 1BIYA 4JB7A 4RA1A 3ZSFA 1MG1A 3BBRA 4F1YA 4WKMA 1A99A 2DS9A 3VE1B 5M2VA 1JEVA 4GXSB 1SQYA 1VFEA 4FEDA 5JEIA 4ZZAA 2F7CA 1HSLA 1N04A 1B9JA 3A09A 3BFUA 3IB1A 1MXXA 3O6HA 4H65A 3O2AA 4ND9A 4LZ8A 4DCYA 2O6AA 4C1UA 1B7UA 3T9HB 1P1OA 4JXIA 1OVBA 3C33A 1QJMA 2OCUA 3QUJA 1DPEA 2QL3A 4IO5A 3FV2A 3SEXA 4BDNA 5ITPA 2FA7A 4OFJA 3JYRA 1N3XA 1NH8A 4OZ9A 4P0IA 2XX9A 3H03A 3TFLA 5I57B 3VVDA 4Q0CA 5CI5A 3RQTA 5DEXB 3IB2A 1Z7NE 2D5WA 2UVJA 3CFZA 4IB2A 4DDDA 2ONKE 2I6EA 2YJPA 4F3SA 4G77A 3DP8A 3EHSA 4G8MA 1TFDA 1A8EA 1YPNA 1PB9A 3TTNA 3OMBA 3SESA 2V84A 4H67A 4HS7A 5FTIA 4FIMA 1B3EA 1B51A 1SYIA 2ESNA 2HZKA 4MFIA 3QAXA 3FJMA 2ANJA 1XS5A 2DE2A 4PQJA 4THIA 3KSXA 3M3FA 3GZGA 2HXWA 4O3CA 3GLBA 4YZZA 4ESXA 3FVOA 2RC7A 3B6WA 2D3IA 3LC8A 2ONRA 4EQBA 2Y84A 1BKAA 1N7XA 3FGSA 4NF5B 4X1BA 1NMUA 1P99A 1RKMA 3ZS6A 4GIZA 2UVGA 1MXUA 3KOSA 1A7LA 2AIXA 4LQ5A 1II5A 5F7VA 1H3DA 2QSXA 3DM0A 3OEMA 3TQWA 2Y7RA 3H6UA 1OQGA 3H6WA 2RF1A 1YTVA 3UIFA 1B05A 2XXIA 3PPQA 2CMOA 4MBPA 3FXUA 4OWDA 1BLFA 2QPQA 1Q1KA 2UYFA 1MY1A 1SI1A 2ZNUA 3HPIA 4U22A 3TTRA 3ZKKA 1B0LA 4H8IA 5AA3A 4JWXA 4PETA 3PUVE 1IITA 1B5JA 4RK9A 4LATA 4N6PA 4ZEIA 3FASA 3K4UA 1BTJA 3UA8A 3MVWA 2HAUA 1GV8A 5JK4A 1IIWA 1UIVA 1LAGE 5FTHA 5BUUA 4JWYA 3G7WA 1D9YA 1UTHA 3HV1A 3B7DA 5A5XA 2VP1A 3N6UA 5HM4B 1FQDA 3IAZA 3O97A 4ISUA 4TLLB 3N5LA 3PU5A 4YKPA 3CSGA 4NTLA 1EU8A 3QK6A 5I2NB 4LQ2A 2DE3A 3R26A 4X48A 3U72A 1NH7A 1URGA 2DWAA 3HHGA 2NXOA 2ZYMA 1B5HA 3MW0A 2ABHA 2ZYNA 4I62A 3OSRA 5H8NA 1B7ZA 2F34A 4XTCQ 4R9GA 3TQLA 1L5TA 4U4XA 2NVUB 1XVYA 2P2AA 1D4NA 2F35A 2I0BA 2F5XA 2PMSA 4G68C 1MDQA 4R73A 4UACA 3KGCA 4XIGQ 1FQAA 5BWJA 2ZNSA 2PX1A 4AB6A 2Y7KA 4EQ7A 1XHYA 1B0HA 1IZ1A 2I0CA 3C32A 3PUYE 3TCFA 5ISUA 4ONYA 2DVZA 3I5OA 3JV9A 5I57A 1Y9UA 2RC8A 4ECFA 1RYXA 1USYH 3K1PA 1QVSA 1FTLA 2CZLA 2XXWA 4I1DA 4IO7A 4GQOA 2XXRA 5AA2B 3S9EA 4YB7A 3PUZE 5HPQA 2REGA 4R2BA 1XVXA 3RUMA 4X1DA 1M5EA 3TDJA 3SEVA 4NF4B 1MQJA 4PE5B 1LFGA 2QS2A 4H5GA 5H8QA 2ZYKA 4XXUA 2ZNTA 4G8NA 3OENA 2I48A 4ZE9A 5DYHA 2QRYA 3BFTA 3FXQA 2B3FA 4O3AA 3OO8A 1DSNA 4G8HA 5H8QB 3CSBA 1I6QA 3OD7A 5JTYA 4P0GA 1MDP1 1LB9A 2DXYA 3ECRA 2F6GA 3KZGA 1O7TA 1SVXB 2XX7A 3PUWE 2HZLA 1Y20A 2Z8EA 4KD5A 2O69A 3V5AA 5EYFA 1JVYA 4F3GA 1JQFA 3W15C 3TUSA 3DP4A 3LSLA 2UXAA 4G68B 1MY2A 3IB0A 3K6UA 3N94A 4DXCA 5EHMA 2LAOA 4LZ7A 1XC1A 3PPNA 2I4CA 2GH9A 3R7XA 1A8FA 4NF8B 3DELB 3TAJA 5CRYA 4EXLA 2AYSA 1GGGA 2QS1A 1MXYA 2DYXA 3KJ7A 4PFTA 4KYSA 3RPWA 3L6GA 4RPOA 5L9SA 3H6TA 1HSEA 3TKDA 3FIRA 4PFWA 1LCFA 1LBCA 4OESA 2ALUA 3FVGA 1NNFA 2OZZA 2XD2A 3P7IA 1F9BA 3K1NA 5K2YA 4HCYA 4FECA 2YLNA 1QKAA 1LAXA 2H99A 3EPEA 3N6TA 4H6DA 3VDFA 4R2FA 5I56B 5I84A 5DT6A 3KN3A 4KCDA 2OLBA 3H4ZA 2ONSA 3CVGA 3TTKA 5I58B 1ELJA 3MVYA 3C36A 4GD5A 2P0SA 4MH5A 2Q2AA 1FCKA 1NNTA 3RT6B 3T22A 4YKIA 1LAFE 3G3KA 1GR2A 2Q88A 1AH5A 3V83A 3E3KA 4POWA 3VXCA 3T9UA 1OMPA 3T9XB 4OHNA 4AQ4A 4QFLA 2HEUA 1MQGA 2I3WA 4H5FA 4KPTA 1EH3A 2NWJA 4X9TA 4HTGA 4GOTA 1N76A 2VD3A 4YKJA 4R72A 1Y4TA 2X7PA 5AA2D 3MVZA 1TXFA 4F22A 3F11A 4GL8A 1B1XA 1US5A 5ICTA 4YU0A 2O84X 2Y7WA 1LB8A 3FD3A 5TU0A 1R9LA 4ZEFA 4F31B 1B40A 1H76A 1POTA 3CIJA 1FQCA 3RTWB 4ZS9A 1IXIA 5KDTA 4F18A 3AXFA 2GHBA 4IO6A 5ITOA 1SI0A 2RINA 2A5SA 2O1MA 3KG2A 3IK6B 2XXUA 2DVCA 5KCJA 3MVXA 5B70A 3TZAA 2H25A 3W9VA 3G3JA 1PB8A 5EHSA 5I2KA 2Y7IA 2Q89A 2D21A 2ZMBA 4EF1A 2V93A 5CMMA 2F7AA 4F1VA 5CMKA 4C1TA 4PFYA 2RCBA 2UVHA 4TOZA 3VLUA 4DXBA 3G3GA 1ATGA 5L9MA 4BDLA 4NMYA 4OTEA 3K0VA 1A55A 1J1NA 4RNSA 3S2VA 4DIGA 4EDPA 4BDRA 4GVOA 1ZIUA 3OSQA 3B6TA 1USYE 3VLVA 3U92A 2F7BA 3RTFB 3Q27A 4MLVA 4OEVA 5FHOA 1YCJA 4QRZA 4F2OA 1EZOA 4R9FA 1MQHA 2AL5A 3U94A 3G3FA 4GXAA 4BDOA 3CG3A 2HFBA 3VFJA 4GFRA 5K2XA 3U93A 4ZEDA 3LSWA 1D9VA 3TEPA 3G3IA 2I58A 3ZKLA 5I59A 2VGQA 1N3WA 1MXWA 2FYIA 4U1ZA 3FZVA 3IO4A 4OFLA 3U1OA 1XOCA 3GBAA 3OELA 4M4GA 1SW2A 4N07A 2Z8DA 3EQ1A 1N7WA 3DLNA 4LUBA 2PT1A 1FQBA 3EHUA 4NF6B 1NFTA 3KOTA 3PUXE 1JEUA 3TODA 2REJA 5AA4B 1B32A 3QXMA 5H8HB 5I58A 4WEDA 4IY5A 4FATA 1H45A 3THIA 1FTMA 2F6PA 2F8DA 3FVKA 4PP0A 4FEBA 1QKBA 2G29A 1JVXA 3SERA 1UTBA 2UVIA 4WEPA 1OIBA 1IXCA 2Q9TA 2GFEA 1LAHE 2O68A 3D4GA 1ZJLA 2O51A 4JSOA 3TTLA 3JZJA 4XKNA 2FNCA 4ZEKA 4QFOA 4YKKA 1JNFA 3LR1A 4Q5TA 4Z7EA 3WAEA 3O6GA 3TELA 4DCXA 4XKQA 1WDNA 3MQ9A 2QMWA 4RJZA 4ZECA 2X7QA 1POY1 3IJOB 1PC3A 1B3HA 1Y3PA 2RCAA 3PD9A 3C9HA 1ZLQA 4GWOA 3T66A 2I49A 3IR1A 3MJNA 4L17A 4R6YA 4KCCA 1P1NA 1TWYA 1QUIA 3K02A 1FTKA 1LSTA 3RLFE 3RNNA 1T0KA 1MM7A 2VOZA 3FXRA 2I3VA 1PBPA 2R9JA 2XXXA 3VLWA 3I6VA 4YMBA 3MAMA 2OWSA 4QSEA 4R6HA 2PYYA 3V8XB 3KEIA 4NF4A 4AB5A 3C34A 3KFMA 3M3LA 4FORA 2M8CA 5KZTA 3UK4A 1TT1A 4N13A 1US4A 1SBPA 4U2RA 5B7DA 4I9DA 4G4PA 4ESWA 3Q25A 1PB7A 1WODA 1Q35A 2Y7PA 4WXJA 5DTBA 4GL0A 2V3QA 3I3VA 4FAJA 3MP1A 3VVFA 4OEUA 1TFAA 1Y3QA 1VE4A 1QW0A 3L6HA 4TLMB 2DWHA 5IKBA 1VR5A 1ZKBA 4M1VA 1LFHA 2QS4A 4MF3A 3OOAA 3MPKA 3ILUB 3K6WA 1VSOA 4G68A 4LONB 1LCTA 1O63A 1PBQA 2OBGA 3QSLA 3RN8A 5H8NB 3Q28A 3PMXA 2P1SA 3O66A 3USDA 1NNPA 2GRVA 5DVFA 4NF8A 1IXGA 2O7IA 3IX1A 1AIVA 3QIMA 2PBWA 4NWDA 3BKIB 3IOVA 3KJTA 4JDFA 1UTHB 5LOMA 2XXTA 3PPRA 3PPPA 2Z22A 4H0WA 4IO3A 4KHZE 1DOTA 4TQUQ 4YB5A 4FE8A 3TTMA 2H9BA 3VV5A 3VVEA 2XX8A 2ZYOA 1Y3NA 3KBRA 1DTGA 1O64A 4YB6A 3S9NC 1H43A 4U21A 1Y1ZA 1P1WA 4FJPA 2O7UA 4YAHX 1QULA 2HCAA 5H8FB 3TCHA 1B4HA 2YPNA 4NWCA 3K6XA 2R6GE 5H8HA 1B4ZA 2IA4A 4JWOA 5TPAA 3V89B 4XKPA 2DQVA 3PMVA 3CI8A 5I59B 1A40A 4OENA 1FQFA 3PPOA 3FUZA 3UN6A 4IGTA 5AA1A 3E4RA 5TP9B 3KN8A 4Q8RA 3K1MA 2DOJA 3IOWA 4K3FA 4ELPA 1N0TA 4LA9A 3ILTB 5L8DA 5J1DA 2A5TA 1S9TA 2DSFA 1B3FA 3ONMA 3T96B 4ZE8A 1MPCA 3U8QA 5ELVA 3OO7A 3B6QA 2PT2A 4OVJA 4OMBA 5AA4A 2DE4A 5DEXA 1GVCA 1LFIA 3T93B 1ANFA 1MPDA 1PEBA 1UTBB 3OO9A 1CB6A 4U23A 3MP8A 5TPAB 3C31A 4H1XA 2XXHA 1QUJA 3SEWA 2F36A 3A3CA 3IJXB 3PV0E 5DVJA 3E9XA 1NNKA 4EXKA 5AA2A 2UYEA 5H8SA 4DZ1A 5KCJB 3EHTA 5JTYB 1SYHA 5IAIA 4BDQA 3PMWA 1RYOA 4QF9A 1IXHA 4E0XA 1HSJA 1JW1A 1IUDA 1LBBA 3FATA 3IOUA 4OQOA 4C0RA 3K00A 1M5FA 4EUOA 1QUKA 3D4CA 2V25A 4O3BA 3S9MC 3CR9A 5I56A 1EZ9A 2XXVA 3TCGA 4QFPA 2B65A 4KYDA 4E0WA 1VFDA 3UGWA 3RY3A 1BP5A 4ELOA 1H44A 4UA8A 3DP6A 4IY6A 1FTOA 3WAFA 4OXVA 5CC2A 1A54A 3SDFA 3CFLA 5CMCA 1S7YA 2IEEA 3MZBA 3Q29A 3MUQA 1SW1A 1SDXA 2O1LA 1JETA 2B3BA 1B52A 1B46A 2QMXA 3OO6A 4U4SA 3RGYA 4HW8A 4YMAA 3MWBA 2E1SA 1MQDA 3HO7A 4ELQA 3R6UA 2NUVA 1CE2A 3FJGA 2GHAA 2R71A 1MXVA 4F29A 1URDA 5CM6A 3A3UA 4F19A 3K6VA 1MRPA 2XHDA 4HCWA 2F97A 2PVUA 3K2DA 5AE4A 2BJJX 2Q2CA 3O29A 3MC2A 1OQHA 1Y1MA 3MZ1A 4ZZEA 4JSDA 1AOVA 2E0SA 2V3UA 3M3KA 2Q8JA 3FVNA 4IO2A 1N84A 4LVQA 4OYVA 3TYHA 2ZXTA 1NKXA 1R1NA 1Z7ME 4QFNA 3PGFA 3T9VA 4F39A 3G3HA 2HQ0A 2H5YA 2XXPA 2I4BA 3C4MA 5CBRA 2X26A 1B6HA 4RXLA 4NEDA 5DVIA 3LSXA 1DTZA 3MZ9A 3TPAA 2OWTA 4RYAA 4XKRA 2DWJA 1ZTYA 1PDAA 2QS3A 1B1HA 3FJ7A 3HHFA 4LP2B 5I2KB 1MXZA 1EZPA 3CFXA 2H4IA 1FW0A 2F78A 1UIUA 1I6BA 4IO4A 3IORA 2QJEA 4MLQA 4F3BA 3MP6A 1FTJA 1Y4CA 3KSJA 2Z23A 1MY0A 1DMBA 3LSFB 3LBSA 4ZEBA 4DE8A 4F1UA 4KR5A 1LLSA 1ZMGA 4EF2A 5A5XB 4QSDA 1YAEA 4QFKA 2V3TA 3C35A 1B58A 3CRBA 4Z0IA 1D3KA 3GXAA 4P11A 4ELRA 4F2QA 4ZDMA 5KDTB 5L9OA 4QSCA 5FHMA 3K01A 3M8UA 2OJTA 3S4UA 2AL4A 3ODBA 4KFQA 1B3GA 3EF7A 1MH3A 3HCQA 1IEJA 4U1OA 4EQ9A 1IQ7A 4JBZA 2WKYA 3H3GA 3QYTA 2RKMA 1MS7A 3HSTA 5TP9A 4OERA 3PD8A 1WVJA 1R9QA 4PFUA 3SKPA 4YICA 5ICQA 4LZ5A 2RC9A 3S9LC 1LGBC 3H06B 3SEUA 3IO6A 4R75A 3O6IA 3UORA 2A5TB 2DXRA 2VHAA 3QUFA 1B2HA 4GLIA 5HBCA 4NF5A 3CG1A 4F3PA 3N26A 4G2ZA 2Z8FA 4BLAA 1ZBMA 2H98A 1MPBA 1M5CA 4NF6A 4KI0E
chains in the Genus database with same CATH superfamily
3IL1B 1AL3A 5KZTA 4I3EA 1OVTA 2XXQA 1MY4A 1P1QA 1S50A 3O9PA 2NOOA 4R74A 4E0XA 1IMFA 4P56A 4RY1A 1MQIA 1R6ZA 3TMGA 1DPPA 1SD3A 3GBBA 4MHFA 4OVPA 2THIA 1M5DA 2L5VA 2KLFA 4F3SA 2DWIA 1XT8A 4GF8A 2HAVA 4OFOA 4KQPA 1BIYA 4JB7A 4PFRA 1A99A 4FEDA 2CEYA 1YYZA 3A09A 1HSLA 3BFUA 3T9HB 4O7IA 1NV4A 3C33A 3SEXA 4N8GA 3JYRA 4P0IA 5DW8A 3VVDA 5CI5A 3RQTA 4DDDA 2YJPA 1LBZA 3EHSA 1A8EA 3SESA 2HZKA 4PQJA 3QAXA 4GWWA 1XS5A 4O3CA 4JVIA 1BKAA 3FGSA 3ZS6A 1P99A 1RKMA 4GIZA 3KOSA 1II5A 3TQWA 1YTVA 2XXIA 5IGAA 1NI9A 4IR8A 1Q1KA 3HPIA 1B0LA 5AA3A 4GX6A 1B5JA 4N6PA 1BTJA 5JK4A 5FTHA 4JWYA 4MJOA 1D9YA 3HV1A 5A5XA 4ISUA 3N5LA 3PU5A 3CSGA 1EU8A 1VDWA 4LQ2A 2HXRA 4I62A 4XTCQ 1XVYA 2P2AA 1D4NA 2I0BA 1MDQA 3KGCA 2PX1A 4AB6A 3C32A 2VPOA 1Y9UA 2RC8A 1RYXA 3K1PA 1FTLA 4HXVA 2XXWA 2XXRA 3HFUA 1FBEA 3PUZE 4X1DA 3SEVA 4NF4B 2ZYKA 4G8NA 2I48A 5DYHA 3B8BA 2B3FA 3ECRA 1JVYA 2B4LA 3W15C 3TUSA 2UXAA 4DXCA 4PC9A 4LN5A 1XC1A 1NUXA 2AYSA 2PCRA 1MXYA 2DYXA 4RPOA 3H6TA 1LCFA 1LBCA 3P7IA 1F9BA 4FECA 1KA1A 3N6TA 4H6DA 5DT6A 2OLBA 3CVGA 3TTKA 5I58B 2VPNA 2P0SA 2Q2AA 1AH5A 1MQGA 4X9TA 4GOTA 4YKJA 2X7PA 5AA2D 1TXFA 4GL8A 1B1XA 5ICTA 5TU0A 4F31B 1FQCA 1IXIA 2GHBA 2FIXA 1SI0A 2DVCA 5B70A 3G3JA 2Q89A 2V93A 4C1TA 2UVHA 4BDLA 3S2VA 3B6TA 4MLVA 1G0IA 3RYDA 5FHOA 4GXAA 4BDOA 3VFJA 3LSWA 1N3WA 4N91A 4MCOA 5EYHA 3U1OA 3OELA 1YZ0A 4OA4A 4NF6B 3PUXE 3QXMA 5H8HB 5I58A 4FATA 1H45A 2Q8MA 2CZHA 1UTBA 2UVIA 1IXCA 1LAHE 2FNCA 4QFOA 4Z7EA 3WAEA 3O6GA 4RJZA 5EQAA 3PD9A 4L17A 3K02A 3RNNA 3CHGA 3FXRA 1PBPA 4YMBA 4R6HA 3V8XB 4N13A 4U2RA 1NV2A 4ESWA 1DBZA 1WODA 1PB7A 1Q35A 3PTYA 4OVSA 4QXDA 1TFAA 1VE4A 1QW0A 3L6HA 1LFHA 1ZKBA 4M1VA 4AS5A 4PGNA 3K6WA 4G68A 3RN8A 2OBGA 3USDA 1KZ8A 1AIVA 3QIMA 1LBYA 2PBWA 4GX4A 1UTHB 2XXTA 3PPPA 4TQUQ 2H9BA 4MEVA 2XX8A 1NUWA 1DTGA 3S9NC 4U21A 4FJPA 1P1WA 2YPNA 2OX3A 1B4ZA 2DQVA 3PMVA 4AS4A 1A40A 1FQFA 3PPOA 5TP9B 4MIJA 3KN8A 2DOJA 3IOWA 1SPIA 1MPCA 2DE4A 1GVCA 1LFIA 3T93B 1ANFA 1FBFA 2QFLA 3MP8A 2XXHA 2F36A 3A3CA 5AA2A 2UYEA 1HSJA 1JW1A 1LBBA 5ET8A 1FJ6A 3S9MC 3CR9A 4E0WA 4QFPA 5EQ8A 1BP5A 1H44A 4PFBA 3WAFA 4OXVA 3SDFA 3CFLA 1S7YA 2IEEA 3RGYA 1B52A 4U4SA 1Q9DA 3FJGA 2GHAA 4F29A 2PVUA 3K2DA 3O29A 1RDXA 3MC2A 1Y1MA 4ZZEA 4JSDA 4OVTA 2V3UA 2Q8JA 3TYHA 4LVQA 4OYVA 4QFNA 4JVCA 2WX9A 1FBHA 2H5YA 5CBRA 2WEFA 4P9KA 5EQ7A 2QS3A 3HHFA 4LP2B 4O8MA 1EZPA 4OVQA 1I6BA 4IO4A 4O7MA 4EF2A 5A5XB 4JVDA 1YAEA 1D3KA 3GXAA 4ZDMA 4EQ9A 2WKYA 3QYTA 2RKMA 3LV0A 3HSTA 4PF6A 2VHAA 3QUFA 1AWBA 3N26A 4G2ZA 1ZBMA 3FV1A 1NV1A 2WYPA 3T9UA 3LUYA 1M5BA 3H7MA 4ZZAA 1MM6A 4RK2A 1MH4A 5CBSA 1ZU0A 1JW5A 5CMBA 3QMFA 1URSA 4OETA 3MBPA 1FQEA 3MPLA 4IGRA 3TCFA 1AMFA 2W7YA 4KYEA 3Q26A 3O28A 1OLCA 1I6AA 2OK2A 3SEYA 1NL5A 3B50A 1IMBA 1FBCA 5M2VA 1JEVA 3O6HA 1B9JA 4H65A 3O2AA 2O6AA 1B7UA 2QL3A 5ITPA 2FA7A 1NH8A 1Z7NE 4IB2A 4HE0A 1PB9A 3OMBA 2V84A 4FIMA 5CMMA 4MFIA 3FJMA 2ANJA 4ESXA 3GZGA 2HXWA 3GLBA 4XF5A 2RC7A 4EQBA 2D3IA 2Y84A 1FPGA 2CZIA 3DM0A 2Y7RA 3KC0A 1OQGA 2RF1A 3UIFA 3PPQA 2CMOA 1BLFA 1MY1A 2ZNUA 4U22A 4H8IA 4PETA 3PUVE 1IITA 4PDHA 2HAUA 1IIWA 1LAGE 1UTHA 4N6KA 1FQDA 4TLLB 5I2NB 3R26A 4X48A 3HHGA 2ZYMA 1B5HA 2F34A 3TQLA 4U4XA 1FPIA 2F35A 2PMSA 2F5XA 5BWJA 1FQAA 2Y7KA 4EQ7A 1XHYA 1IZ1A 3PUYE 2MKZA 3I5OA 3JV9A 1QVSA 4I1DA 4XFEA 4IO7A 4GQOA 5AA2B 3S9EA 5HPQA 2REGA 4R2BA 4PE5B 5H8QA 5IZZA 4XXUA 5A5LA 3OENA 4ZE9A 2QRYA 3FXQA 4O3AA 1DSNA 4G8HA 3CSBA 3PUWE 1O7TA 2XX7A 2HZLA 4KD5A 1JQFA 3DP4A 3LSLA 4G68B 3IB0A 1JP4A 2I4CA 3R7XA 3KJ7A 1NV0A 3RPWA 2FBPA 2XWKA 1HSEA 3TKDA 4PFWA 5FBPA 3K1NA 2YLNA 1QKAA 1LAXA 3VDFA 3EPEA 3H4ZA 3MVYA 4MH5A 1FCKA 3ISPA 4N81A 3RT6B 1LAFE 2Q88A 3VXCA 4POWA 2WBBA 4QFLA 2HEUA 4H5FA 1EH3A 4HTGA 3F11A 4G61A 2O84X 1LB8A 1R9LA 3RTWB 3CIJA 4ZS9A 3AXFA 2A5SA 2O1MA 3KG2A 3IK6B 5KCJA 4P8BA 2H25A 2B4MA 5EHSA 5I2KA 3GYYA 2D21A 2ZMBA 4EF1A 1EYIA 2RCBA 3VLUA 4DXBA 3G3GA 5L9MA 1A55A 1J1NA 4DIGA 4EDPA 4BDRA 3RTFB 3Q27A 4OEVA 1EZOA 4NAPA 4P47A 2HFBA 4GFRA 5K2XA 3G3IA 2FYIA 2Q74A 3FZVA 3IO4A 1SW2A 4GWZA 2PT1A 3EHUA 3KC1A 5LTCA 3TODA 4GX3A 5AA4B 4IY5A 3THIA 4PP0A 1JVXA 1YXIA 1OIBA 3D4GA 1ZJLA 3JZJA 2BJIA 4YKKA 1JNFA 4Q5TA 4PAFA 4DCXA 2JJKA 2X7QA 1POY1 1NUZA 2RCAA 3C9HA 4GWOA 3T66A 3MJNA 4KCCA 1P1NA 1QUIA 1FTKA 3RLFE 4NF0A 2XXXA 2R9JA 3VLWA 3I6VA 2GQ1A 4AB5A 3KEIA 4PTKA 4FORA 2M8CA 5B7DA 5DTBA 2Y7PA 4PDDA 4GL0A 4FAJA 1Y3QA 4NX1A 2DWHA 2QS4A 1FSAA 4LONB 3QSLA 5H8NB 4NF8A 1IXGA 3IX1A 2WYKA 3BKIB 4I3YA 1FPLA 4H0WA 3TTMA 3VVEA 4O94A 3KBRA 1NV5A 1O64A 1H43A 1Y1ZA 2R6GE 5TPAA 3V89B 4PBHA 5I59B 3FUZA 3E4RA 2R8TA 4ELPA 2DSFA 3ONMA 3T96B 5ET6A 2P3VA 2PT2A 4OVJA 1MPDA 4U23A 3C31A 1QUJA 3SEWA 3PV0E 1NNKA 2QVRA 4EXKA 5H8SA 5JTYB 3IOUA 1M5FA 4EUOA 3D4CA 2XXKA 2XXVA 2B65A 4ELOA 4IY6A 3ROJA 5CC2A 1A54A 4N17A 3Q29A 2E1SA 4ELQA 1CE2A 1MXVA 4F19A 3K6VA 2XHDA 2F97A 1DK4A 1NKXA 4F39A 3PGFA 2XXPA 1B6HA 4RXLA 4MX6A 1PDAA 4XEQA 5I2KB 1MXZA 3CFXA 2F78A 3LUZA 4MLQA 3MP6A 1FTJA 2Z23A 1MY0A 3LBSA 4ZEBA 1ZMGA 3A29A 4QSDA 1BK4A 2V3TA 1B58A 4ELRA 5KDTB 5L9OA 4QSCA 2XA5A 4KFQA 3EF7A 1IEJA 1MS7A 4OERA 4LZ5A 1LGBC 3H06B 4GWXA 3IO6A 4PGPA 4R75A 3O6IA 2DXRA 1FPDA 1B2HA 3CG1A 3FBPA 2Z8FA 1MPBA 3H6WA 4QHQA 3RT8A 4Q30B 1IMAA 1OLAA 3MSTA 5FHNA 1SW5A 1P1UA 4BDMA 3OXNA 2DP8A 2G93A 3W9WA 2XD3A 2ZZXA 3VXBA 4H45A 1MY3A 3E13X 3HN0A 1B7HA 5F1QA 5FHMA 3OEKA 3H6VA 4RA1A 3ZSFA 1MG1A 3BBRA 2DS9A 4PCDA 1N04A 3IB1A 3TFLA 4LZ8A 1K9ZA 1P1OA 4JXIA 1QJMA 1DPEA 4BDNA 3FV2A 1NV7A 4OZ9A 1D9QA 2XX9A 5DEXB 3IB2A 3RPLA 2UVJA 2ONKE 4DI3D 4G77A 1TFDA 4HS7A 2ESNA 1FBDA 4THIA 3KSXA 3M3FA 3B6WA 3LC8A 2ONRA 4X1BA 1NMUA 1IMEA 1MXUA 1A7LA 2AIXA 4LQ5A 2QSXA 3OEMA 3H6UA 1B05A 4NHBA 4OWDA 1SI1A 3ZKKA 4LATA 3FASA 3K4UA 3MVWA 1UIVA 1LBVA 5HM4B 3N6UA 4HE2A 4YKPA 2DE3A 1NH7A 2DWAA 2ABHA 2ZYNA 5H8NA 4R9GA 1L5TA 5IZ3A 4R73A 1B0HA 2I0CA 5ISUA 4ONYA 2DVZA 5I57A 4ECFA 1USYH 3T0JA 2CZLA 4YB7A 1XVXA 3RUMA 3TDJA 1LFGA 2WBDA 1EYJA 2ZNTA 3BFTA 2QVVA 5JTYA 3OD7A 1NUYA 1MDP1 1LB9A 2DXYA 4PFIA 2F6GA 4I40A 1SVXB 1Y20A 2Z8EA 2O69A 3V5AA 4F3GA 4UABA 1MY2A 3K6UA 3N94A 3PPNA 3TAJA 5CRYA 4EXLA 1GGGA 5L9SA 4OESA 2ALUA 1NNFA 2XD2A 5I84A 3V83A 4R2FA 3KN3A 4MMPA 1ELJA 4GD5A 1NNTA 3T22A 1FPJA 4YKIA 1GR2A 3T9XB 4OHNA 3U65A 2I3WA 4PAIA 2NWJA 2VD3A 4F22A 2Y7WA 1B40A 1H76A 2HHMA 5KDTA 4IO6A 2RINA 3TZAA 2Y7IA 1FPKA 2F7AA 5CMKA 4PFYA 1M5CA 4P1EA 1LBXA 1ATGA 4NMYA 4OTEA 3K0VA 4RNSA 4GWSA 4GVOA 3OSQA 3U92A 2F7BA 4GBVA 1YCJA 4F2OA 4R9FA 2AL5A 3U94A 3G3FA 3CG3A 3U93A 1D9VA 3TEPA 1MXWA 1FPEA 1XOCA 3GBAA 4M4GA 4N07A 2Z8DA 1N7WA 3DLNA 3RPLB 1FQBA 1NFTA 1JEUA 2REJA 4WEDA 1FTMA 2F6PA 2F8DA 2XWVA 3FVKA 5I3SA 1QKBA 2G29A 3SERA 2O68A 4NQ8A 4JSOA 3TTLA 4QBAA 3TELA 4XKQA 2QMWA 2HPGA 4MAGA 1PC3A 2I49A 3IR1A 1MM7A 2OWSA 2PYYA 3C34A 4N4UA 1SBPA 4I9DA 4WXJA 3I3VA 3MP1A 4MF3A 3ILUB 1VSOA 4MNPA 1LCTA 1PBQA 1IMCA 3PMXA 5LDZA 5DVFA 2O7IA 4JDFA 3PPRA 2Z22A 4IO3A 4YB5A 4YB6A 2FVZA 3TCHA 4YAHX 1QULA 3K6XA 2IA4A 2QVUA 3CI8A 4Q8RA 5AA1A 3K1MA 4K3FA 4LA9A 3ILTB 5L8DA 5J1DA 1FPBA 1XI6A 3OO7A 4OMBA 5DEXA 1PEBA 3OO9A 3BIGA 5DVJA 4DZ1A 3EHTA 5IAIA 4BDQA 4QF9A 1IUDA 5ET5A 3K00A 4O3BA 3E79A 3TCGA 4KYDA 1VFDA 2F3DA 4X04A 3DP6A 1SW1A 1SDXA 3OO6A 1JETA 2QMXA 2OWZA 3HO7A 1MQDA 2NUVA 3IFCA 4HCWA 5AE4A 2BJJX 1OQHA 3MZ1A 2E0SA 1N84A 2ZXTA 1Z7ME 3T9VA 3G3HA 2HQ0A 2DDKA 3C4MA 1DTZA 4RYAA 2OWTA 1QGXA 1ZTYA 3FJ7A 1FJ9A 2V4CA 1FW0A 4KXPA 1UIUA 3IORA 4F3BA 1Y4CA 3KSJA 3LSFB 4KR5A 5ET7A 4QFKA 3CRBA 5EQ9A 3K01A 3M8UA 3S4UA 2AL4A 3ODBA 1B3GA 4U1OA 1MH3A 1IQ7A 3EKIA 3H3GA 1WVJA 1R9QA 2CZKA 4P3LA 4OVRA 3SEUA 3UORA 2A5TB 2Y5KA 5HBCA 4NF5A 2VT5A 3NOHA 3SKPA 4R6KA 1B5IA 3KN7A 4DXUA 2VD2A 1B3LA 1I69A 2XXYA 4I8CA 1JW4A 4H8JA 4DLDA 5I2NA 2CEXA 3EN3A 3SETA 1KWHA 1UQWA 4GRKA 1GTKA 4NE4A 4RPNA 4POXA 4N15A 1G0HA 3IOTA 5BUUA 1SW4A 3UP9A 5H8FA 4F1YA 4WKMA 3VE1B 4GXSB 1SQYA 1VFEA 5JEIA 5I7IA 2F7CA 3SZPA 4ND9A 4DCYA 1MXXA 4C1UA 5F24A 1OVBA 2Y5LA 2OCUA 3QUJA 4IO5A 4OFJA 1N3XA 3H03A 5I57B 4Q0CA 4X8RA 2D5WA 3CFZA 4PBQA 2I6EA 3DP8A 4G8MA 1NV3A 1YPNA 3TTNA 4H67A 5FTIA 1B3EA 1B51A 1SYIA 5F7VA 5T3JA 2DE2A 4YZZA 3FVOA 4NF5B 1N7XA 2UVGA 1LBWA 1H3DA 4MBPA 3FXUA 2QPQA 2UYFA 3TTRA 1FBGA 3FXBA 4JWXA 4RK9A 4NN3A 4GWYA 4ZEIA 3UA8A 1GV8A 3G7WA 3B7DA 2VP1A 3IAZA 3O97A 4NTLA 3QK6A 3U72A 1URGA 2NXOA 3D1RA 3OSRA 1B7ZA 2NVUB 2F3BA 4G68C 4UACA 4XIGQ 2ZNSA 5IM2A 2KQZA 1M5EA 5ESYA 1MQJA 2QS2A 4H5GA 4H46A 5H8QB 3OO8A 5IZ3B 1I6QA 4P0GA 3KZGA 5EYFA 5EHMA 2LAOA 4LZ7A 1LEVA 2ZZWA 2GH9A 1A8FA 4NF8B 3DELB 2QS1A 4PFTA 4KYSA 3L6GA 3FIRA 3FVGA 2OZZA 1CNQA 1EYKA 5K2YA 4HCYA 3MYUA 2H99A 5I56B 4KCDA 2ONSA 4P1LA 3C36A 1RDYA 4MNIA 3G3KA 1FRPA 3E3KA 1OMPA 4AQ4A 4KPTA 3T1BA 1N76A 4R72A 1Y4TA 3MVZA 1US5A 4YU0A 3FD3A 2PFYA 4ZEFA 1POTA 4OANA 4F18A 5ITOA 1FPFA 2FIEA 2XXUA 3E78A 3MVXA 3W9VA 1PB8A 4F1VA 4TOZA 1ZIUA 3VLVA 1USYE 4QRZA 1MQHA 4PE3A 4ZEDA 5I59A 2I58A 3ZKLA 2VGQA 4DI4B 2FHYA 4U1ZA 3KBZA 4OFLA 2ZZVA 3EQ1A 4LUBA 3KOTA 1B32A 2XWOA 4FEBA 4WEPA 2Q9TA 2GFEA 2O51A 4XKNA 4ZEKA 3LR1A 1RDZA 1WDNA 3MQ9A 4ZECA 3IJOB 1Y3PA 1B3HA 4MNCA 1ZLQA 4R6YA 1TWYA 1T0KA 1IMDA 1LSTA 2VOZA 2I3VA 3MAMA 4QSEA 4NF4A 3KFMA 3M3LA 4N6DA 3UK4A 1TT1A 1US4A 4G4PA 1FTAA 3Q25A 2V3QA 3VVFA 4OEUA 5IKBA 4TLMB 1VR5A 3OOAA 3MPKA 1O63A 3Q28A 2P1SA 3O66A 1NNPA 2GRVA 4NWDA 3IOVA 3KJTA 5LOMA 4KHZE 1DOTA 3VV5A 4FE8A 2ZYOA 1Y3NA 5H8FB 2O7UA 2HCAA 1B4HA 4NWCA 5H8HA 4JWOA 4XKPA 4OENA 3UN6A 4IGTA 4NGUA 1N0TA 2A5TA 1S9TA 1B3FA 4ZE8A 2P3NA 3U8QA 5ELVA 3B6QA 5AA4A 4N8YA 1UTBB 1CB6A 5TPAB 2XWIA 4H1XA 5J16A 3IJXB 5KCJB 3E9XA 4HE1A 1SYHA 3PMWA 1RYOA 5I5PA 1IXHA 3FATA 4OQOA 4C0RA 1QUKA 2V25A 1INPA 5I56A 1EZ9A 3UGWA 3RY3A 1K9YA 4UA8A 1FTOA 4PAKA 1NV6A 4PF8A 5CMCA 5IZ1A 3MZBA 3MUQA 2O1LA 2B3BA 1B46A 4HW8A 4YMAA 3MWBA 2KR0A 3R6UA 4FBPA 2R71A 1URDA 5CM6A 3A3UA 1MRPA 2Q2CA 1AOVA 3M3KA 3FVNA 4IO2A 1FBPA 4GWUA 1R1NA 3BIHA 2I4BA 2X26A 4NEDA 5DVIA 3LSXA 3MZ9A 3TPAA 4XKRA 2DWJA 1B1HA 2H4IA 2QJEA 4NG7A 1DMBA 4DE8A 4F1UA 1DCUA 1LLSA 3C35A 4Z0IA 4P11A 4F2QA 5EYGA 2OJTA 3HCQA 3IFAA 4GBWA 4JBZA 5TP9A 4PFUA 3PD8A 4YICA 2PFZA 5ICQA 2RC9A 3S9LC 1KA0A 4GLIA 4F3PA 4BLAA 2H98A 3MW0A 4NF6A 4KI0E
chains in the Genus database with same CATH topology
3FV1A 3IL1B 1AL3A 4QHQA 4R6KA 1B5IA 3KN7A 3LUYA 2VD2A 1M5BA 1B3LA 4Q30B 1OVTA 2XXQA 3RT8A 4DXUA 1MY4A 1OLAA 1P1QA 1S50A 1I69A 1MM6A 2XXYA 2NOOA 3H7MA 3O9PA 4I8CA 1MH4A 4R74A 4RK2A 1ZU0A 1JW4A 4H8JA 4DLDA 1JW5A 5CBSA 5I2NA 5FHNA 4RY1A 5CMBA 1SW5A 1MQIA 3EN3A 1P1UA 1R6ZA 4BDMA 3SETA 3TMGA 1DPPA 1SD3A 3GBBA 1URSA 1KWHA 1UQWA 2DP8A 1GTKA 2G93A 3OXNA 4GRKA 2XD3A 4NE4A 2THIA 3MBPA 4OETA 4POXA 4RPNA 3W9WA 1FQEA 3MPLA 3VXBA 1M5DA 3IOTA 4IGRA 1MY3A 2KLFA 3E13X 1AMFA 1B7HA 3HN0A 2DWIA 1SW4A 1XT8A 2HAVA 2W7YA 4GF8A 4KYEA 5F1QA 3Q26A 3OEKA 4OFOA 3O28A 1OLCA 3UP9A 5H8FA 1I6AA 2OK2A 3SEYA 1NL5A 3H6VA 4KQPA 1BIYA 4JB7A 4RA1A 3ZSFA 1MG1A 3BBRA 4F1YA 4WKMA 1A99A 2DS9A 3VE1B 5M2VA 1JEVA 4GXSB 1SQYA 1VFEA 4FEDA 5JEIA 4ZZAA 2F7CA 1HSLA 1N04A 1B9JA 3A09A 3BFUA 3IB1A 1MXXA 3O6HA 4H65A 3O2AA 4ND9A 4LZ8A 4DCYA 2O6AA 4C1UA 1B7UA 3T9HB 1P1OA 4JXIA 1OVBA 3C33A 1QJMA 2OCUA 3QUJA 1DPEA 2QL3A 4IO5A 3FV2A 3SEXA 4BDNA 5ITPA 2FA7A 4OFJA 3JYRA 1N3XA 1NH8A 4OZ9A 4P0IA 2XX9A 3H03A 3TFLA 5I57B 3VVDA 4Q0CA 5CI5A 3RQTA 5DEXB 3IB2A 1Z7NE 2D5WA 2UVJA 3CFZA 4IB2A 4DDDA 2ONKE 2I6EA 2YJPA 4F3SA 4G77A 3DP8A 3EHSA 4G8MA 1TFDA 1A8EA 1YPNA 1PB9A 3TTNA 3OMBA 3SESA 2V84A 4H67A 4HS7A 5FTIA 4FIMA 1B3EA 1B51A 1SYIA 2ESNA 2HZKA 4MFIA 3QAXA 3FJMA 2ANJA 1XS5A 2DE2A 4PQJA 4THIA 3KSXA 3M3FA 3GZGA 2HXWA 4O3CA 3GLBA 4YZZA 4ESXA 3FVOA 2RC7A 3B6WA 2D3IA 3LC8A 2ONRA 4EQBA 2Y84A 1BKAA 1N7XA 3FGSA 4NF5B 4X1BA 1NMUA 1P99A 1RKMA 3ZS6A 4GIZA 2UVGA 1MXUA 3KOSA 1A7LA 2AIXA 4LQ5A 1II5A 5F7VA 1H3DA 2QSXA 3DM0A 3OEMA 3TQWA 2Y7RA 3H6UA 1OQGA 3H6WA 2RF1A 1YTVA 3UIFA 1B05A 2XXIA 3PPQA 2CMOA 4MBPA 3FXUA 4OWDA 1BLFA 2QPQA 1Q1KA 2UYFA 1MY1A 1SI1A 2ZNUA 3HPIA 4U22A 3TTRA 3ZKKA 1B0LA 4H8IA 5AA3A 4JWXA 4PETA 3PUVE 1IITA 1B5JA 4RK9A 4LATA 4N6PA 4ZEIA 3FASA 3K4UA 1BTJA 3UA8A 3MVWA 2HAUA 1GV8A 5JK4A 1IIWA 1UIVA 1LAGE 5FTHA 5BUUA 4JWYA 3G7WA 1D9YA 1UTHA 3HV1A 3B7DA 5A5XA 2VP1A 3N6UA 5HM4B 1FQDA 3IAZA 3O97A 4ISUA 4TLLB 3N5LA 3PU5A 4YKPA 3CSGA 4NTLA 1EU8A 3QK6A 5I2NB 4LQ2A 2DE3A 3R26A 4X48A 3U72A 1NH7A 1URGA 2DWAA 3HHGA 2NXOA 2ZYMA 1B5HA 3MW0A 2ABHA 2ZYNA 4I62A 3OSRA 5H8NA 1B7ZA 2F34A 4XTCQ 4R9GA 3TQLA 1L5TA 4U4XA 2NVUB 1XVYA 2P2AA 1D4NA 2F35A 2I0BA 2F5XA 2PMSA 4G68C 1MDQA 4R73A 4UACA 3KGCA 4XIGQ 1FQAA 5BWJA 2ZNSA 2PX1A 4AB6A 2Y7KA 4EQ7A 1XHYA 1B0HA 1IZ1A 2I0CA 3C32A 3PUYE 3TCFA 5ISUA 4ONYA 2DVZA 3I5OA 3JV9A 5I57A 1Y9UA 2RC8A 4ECFA 1RYXA 1USYH 3K1PA 1QVSA 1FTLA 2CZLA 2XXWA 4I1DA 4IO7A 4GQOA 2XXRA 5AA2B 3S9EA 4YB7A 3PUZE 5HPQA 2REGA 4R2BA 1XVXA 3RUMA 4X1DA 1M5EA 3TDJA 3SEVA 4NF4B 1MQJA 4PE5B 1LFGA 2QS2A 4H5GA 5H8QA 2ZYKA 4XXUA 2ZNTA 4G8NA 3OENA 2I48A 4ZE9A 5DYHA 2QRYA 3BFTA 3FXQA 2B3FA 4O3AA 3OO8A 1DSNA 4G8HA 5H8QB 3CSBA 1I6QA 3OD7A 5JTYA 4P0GA 1MDP1 1LB9A 2DXYA 3ECRA 2F6GA 3KZGA 1O7TA 1SVXB 2XX7A 3PUWE 2HZLA 1Y20A 2Z8EA 4KD5A 2O69A 3V5AA 5EYFA 1JVYA 4F3GA 1JQFA 3W15C 3TUSA 3DP4A 3LSLA 2UXAA 4G68B 1MY2A 3IB0A 3K6UA 3N94A 4DXCA 5EHMA 2LAOA 4LZ7A 1XC1A 3PPNA 2I4CA 2GH9A 3R7XA 1A8FA 4NF8B 3DELB 3TAJA 5CRYA 4EXLA 2AYSA 1GGGA 2QS1A 1MXYA 2DYXA 3KJ7A 4PFTA 4KYSA 3RPWA 3L6GA 4RPOA 5L9SA 3H6TA 1HSEA 3TKDA 3FIRA 4PFWA 1LCFA 1LBCA 4OESA 2ALUA 3FVGA 1NNFA 2OZZA 2XD2A 3P7IA 1F9BA 3K1NA 5K2YA 4HCYA 4FECA 2YLNA 1QKAA 1LAXA 2H99A 3EPEA 3N6TA 4H6DA 3VDFA 4R2FA 5I56B 5I84A 5DT6A 3KN3A 4KCDA 2OLBA 3H4ZA 2ONSA 3CVGA 3TTKA 5I58B 1ELJA 3MVYA 3C36A 4GD5A 2P0SA 4MH5A 2Q2AA 1FCKA 1NNTA 3RT6B 3T22A 4YKIA 1LAFE 3G3KA 1GR2A 2Q88A 1AH5A 3V83A 3E3KA 4POWA 3VXCA 3T9UA 1OMPA 3T9XB 4OHNA 4AQ4A 4QFLA 2HEUA 1MQGA 2I3WA 4H5FA 4KPTA 1EH3A 2NWJA 4X9TA 4HTGA 4GOTA 1N76A 2VD3A 4YKJA 4R72A 1Y4TA 2X7PA 5AA2D 3MVZA 1TXFA 4F22A 3F11A 4GL8A 1B1XA 1US5A 5ICTA 4YU0A 2O84X 2Y7WA 1LB8A 3FD3A 5TU0A 1R9LA 4ZEFA 4F31B 1B40A 1H76A 1POTA 3CIJA 1FQCA 3RTWB 4ZS9A 1IXIA 5KDTA 4F18A 3AXFA 2GHBA 4IO6A 5ITOA 1SI0A 2RINA 2A5SA 2O1MA 3KG2A 3IK6B 2XXUA 2DVCA 5KCJA 3MVXA 5B70A 3TZAA 2H25A 3W9VA 3G3JA 1PB8A 5EHSA 5I2KA 2Y7IA 2Q89A 2D21A 2ZMBA 4EF1A 2V93A 5CMMA 2F7AA 4F1VA 5CMKA 4C1TA 4PFYA 2RCBA 2UVHA 4TOZA 3VLUA 4DXBA 3G3GA 1ATGA 5L9MA 4BDLA 4NMYA 4OTEA 3K0VA 1A55A 1J1NA 4RNSA 3S2VA 4DIGA 4EDPA 4BDRA 4GVOA 1ZIUA 3OSQA 3B6TA 1USYE 3VLVA 3U92A 2F7BA 3RTFB 3Q27A 4MLVA 4OEVA 5FHOA 1YCJA 4QRZA 4F2OA 1EZOA 4R9FA 1MQHA 2AL5A 3U94A 3G3FA 4GXAA 4BDOA 3CG3A 2HFBA 3VFJA 4GFRA 5K2XA 3U93A 4ZEDA 3LSWA 1D9VA 3TEPA 3G3IA 2I58A 3ZKLA 5I59A 2VGQA 1N3WA 1MXWA 2FYIA 4U1ZA 3FZVA 3IO4A 4OFLA 3U1OA 1XOCA 3GBAA 3OELA 4M4GA 1SW2A 4N07A 2Z8DA 3EQ1A 1N7WA 3DLNA 4LUBA 2PT1A 1FQBA 3EHUA 4NF6B 1NFTA 3KOTA 3PUXE 1JEUA 3TODA 2REJA 5AA4B 1B32A 3QXMA 5H8HB 5I58A 4WEDA 4IY5A 4FATA 1H45A 3THIA 1FTMA 2F6PA 2F8DA 3FVKA 4PP0A 4FEBA 1QKBA 2G29A 1JVXA 3SERA 1UTBA 2UVIA 4WEPA 1OIBA 1IXCA 2Q9TA 2GFEA 1LAHE 2O68A 3D4GA 1ZJLA 2O51A 4JSOA 3TTLA 3JZJA 4XKNA 2FNCA 4ZEKA 4QFOA 4YKKA 1JNFA 3LR1A 4Q5TA 4Z7EA 3WAEA 3O6GA 3TELA 4DCXA 4XKQA 1WDNA 3MQ9A 2QMWA 4RJZA 4ZECA 2X7QA 1POY1 3IJOB 1PC3A 1B3HA 1Y3PA 2RCAA 3PD9A 3C9HA 1ZLQA 4GWOA 3T66A 2I49A 3IR1A 3MJNA 4L17A 4R6YA 4KCCA 1P1NA 1TWYA 1QUIA 3K02A 1FTKA 1LSTA 3RLFE 3RNNA 1T0KA 1MM7A 2VOZA 3FXRA 2I3VA 1PBPA 2R9JA 2XXXA 3VLWA 3I6VA 4YMBA 3MAMA 2OWSA 4QSEA 4R6HA 2PYYA 3V8XB 3KEIA 4NF4A 4AB5A 3C34A 3KFMA 3M3LA 4FORA 2M8CA 5KZTA 3UK4A 1TT1A 4N13A 1US4A 1SBPA 4U2RA 5B7DA 4I9DA 4G4PA 4ESWA 3Q25A 1PB7A 1WODA 1Q35A 2Y7PA 4WXJA 5DTBA 4GL0A 2V3QA 3I3VA 4FAJA 3MP1A 3VVFA 4OEUA 1TFAA 1Y3QA 1VE4A 1QW0A 3L6HA 4TLMB 2DWHA 5IKBA 1VR5A 1ZKBA 4M1VA 1LFHA 2QS4A 4MF3A 3OOAA 3MPKA 3ILUB 3K6WA 1VSOA 4G68A 4LONB 1LCTA 1O63A 1PBQA 2OBGA 3QSLA 3RN8A 5H8NB 3Q28A 3PMXA 2P1SA 3O66A 3USDA 1NNPA 2GRVA 5DVFA 4NF8A 1IXGA 2O7IA 3IX1A 1AIVA 3QIMA 2PBWA 4NWDA 3BKIB 3IOVA 3KJTA 4JDFA 1UTHB 5LOMA 2XXTA 3PPRA 3PPPA 2Z22A 4H0WA 4IO3A 4KHZE 1DOTA 4TQUQ 4YB5A 4FE8A 3TTMA 2H9BA 3VV5A 3VVEA 2XX8A 2ZYOA 1Y3NA 3KBRA 1DTGA 1O64A 4YB6A 3S9NC 1H43A 4U21A 1Y1ZA 1P1WA 4FJPA 2O7UA 4YAHX 1QULA 2HCAA 5H8FB 3TCHA 1B4HA 2YPNA 4NWCA 3K6XA 2R6GE 5H8HA 1B4ZA 2IA4A 4JWOA 5TPAA 3V89B 4XKPA 2DQVA 3PMVA 3CI8A 5I59B 1A40A 4OENA 1FQFA 3PPOA 3FUZA 3UN6A 4IGTA 5AA1A 3E4RA 5TP9B 3KN8A 4Q8RA 3K1MA 2DOJA 3IOWA 4K3FA 4ELPA 1N0TA 4LA9A 3ILTB 5L8DA 5J1DA 2A5TA 1S9TA 2DSFA 1B3FA 3ONMA 3T96B 4ZE8A 1MPCA 3U8QA 5ELVA 3OO7A 3B6QA 2PT2A 4OVJA 4OMBA 5AA4A 2DE4A 5DEXA 1GVCA 1LFIA 3T93B 1ANFA 1MPDA 1PEBA 1UTBB 3OO9A 1CB6A 4U23A 3MP8A 5TPAB 3C31A 4H1XA 2XXHA 1QUJA 3SEWA 2F36A 3A3CA 3IJXB 3PV0E 5DVJA 3E9XA 1NNKA 4EXKA 5AA2A 2UYEA 5H8SA 4DZ1A 5KCJB 3EHTA 5JTYB 1SYHA 5IAIA 4BDQA 3PMWA 1RYOA 4QF9A 1IXHA 4E0XA 1HSJA 1JW1A 1IUDA 1LBBA 3FATA 3IOUA 4OQOA 4C0RA 3K00A 1M5FA 4EUOA 1QUKA 3D4CA 2V25A 4O3BA 3S9MC 3CR9A 5I56A 1EZ9A 2XXVA 3TCGA 4QFPA 2B65A 4KYDA 4E0WA 1VFDA 3UGWA 3RY3A 1BP5A 4ELOA 1H44A 4UA8A 3DP6A 4IY6A 1FTOA 3WAFA 4OXVA 5CC2A 1A54A 3SDFA 3CFLA 5CMCA 1S7YA 2IEEA 3MZBA 3Q29A 3MUQA 1SW1A 1SDXA 2O1LA 1JETA 2B3BA 1B52A 1B46A 2QMXA 3OO6A 4U4SA 3RGYA 4HW8A 4YMAA 3MWBA 2E1SA 1MQDA 3HO7A 4ELQA 3R6UA 2NUVA 1CE2A 3FJGA 2GHAA 2R71A 1MXVA 4F29A 1URDA 5CM6A 3A3UA 4F19A 3K6VA 1MRPA 2XHDA 4HCWA 2F97A 2PVUA 3K2DA 5AE4A 2BJJX 2Q2CA 3O29A 3MC2A 1OQHA 1Y1MA 3MZ1A 4ZZEA 4JSDA 1AOVA 2E0SA 2V3UA 3M3KA 2Q8JA 3FVNA 4IO2A 1N84A 4LVQA 4OYVA 3TYHA 2ZXTA 1NKXA 1R1NA 1Z7ME 4QFNA 3PGFA 3T9VA 4F39A 3G3HA 2HQ0A 2H5YA 2XXPA 2I4BA 3C4MA 5CBRA 2X26A 1B6HA 4RXLA 4NEDA 5DVIA 3LSXA 1DTZA 3MZ9A 3TPAA 2OWTA 4RYAA 4XKRA 2DWJA 1ZTYA 1PDAA 2QS3A 1B1HA 3FJ7A 3HHFA 4LP2B 5I2KB 1MXZA 1EZPA 3CFXA 2H4IA 1FW0A 2F78A 1UIUA 1I6BA 4IO4A 3IORA 2QJEA 4MLQA 4F3BA 3MP6A 1FTJA 1Y4CA 3KSJA 2Z23A 1MY0A 1DMBA 3LSFB 3LBSA 4ZEBA 4DE8A 4F1UA 4KR5A 1LLSA 1ZMGA 4EF2A 5A5XB 4QSDA 1YAEA 4QFKA 2V3TA 3C35A 1B58A 3CRBA 4Z0IA 1D3KA 3GXAA 4P11A 4ELRA 4F2QA 4ZDMA 5KDTB 5L9OA 4QSCA 5FHMA 3K01A 3M8UA 2OJTA 3S4UA 2AL4A 3ODBA 4KFQA 1B3GA 3EF7A 1MH3A 3HCQA 1IEJA 4U1OA 4EQ9A 1IQ7A 4JBZA 2WKYA 3H3GA 3QYTA 2RKMA 1MS7A 3HSTA 5TP9A 4OERA 3PD8A 1WVJA 1R9QA 4PFUA 3SKPA 4YICA 5ICQA 4LZ5A 2RC9A 3S9LC 1LGBC 3H06B 3SEUA 3IO6A 4R75A 3O6IA 3UORA 2A5TB 2DXRA 2VHAA 3QUFA 1B2HA 4GLIA 5HBCA 4NF5A 3CG1A 4F3PA 3N26A 4G2ZA 2Z8FA 4BLAA 1ZBMA 2H98A 1MPBA 1M5CA 4NF6A 4KI0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FV1 A;  3IL1 B;  1AL3 A;  4QHQ A;  4R6K A;  1B5I A;  3KN7 A;  3LUY A;  2VD2 A;  1M5B A;  1B3L A;  4Q30 B;  1OVT A;  2XXQ A;  3RT8 A;  4DXU A;  1MY4 A;  1OLA A;  1P1Q A;  1S50 A;  1I69 A;  1MM6 A;  2XXY A;  2NOO A;  3H7M A;  3O9P A;  4I8C A;  1MH4 A;  4R74 A;  4RK2 A;  1ZU0 A;  1JW4 A;  4H8J A;  4DLD A;  1JW5 A;  5CBS A;  5I2N A;  5FHN A;  4RY1 A;  5CMB A;  1SW5 A;  1MQI A;  3EN3 A;  1P1U A;  1R6Z A;  4BDM A;  3SET A;  3TMG A;  1DPP A;  1SD3 A;  3GBB A;  1URS A;  1KWH A;  1UQW A;  2DP8 A;  1GTK A;  2G93 A;  3OXN A;  4GRK A;  2XD3 A;  4NE4 A;  2THI A;  3MBP A;  4OET A;  4POX A;  4RPN A;  3W9W A;  1FQE A;  3MPL A;  3VXB A;  1M5D A;  3IOT A;  4IGR A;  1MY3 A;  2KLF A;  3E13 X;  1AMF A;  1B7H A;  3HN0 A;  2DWI A;  1SW4 A;  1XT8 A;  2HAV A;  2W7Y A;  4GF8 A;  4KYE A;  5F1Q A;  3Q26 A;  3OEK A;  4OFO A;  3O28 A;  1OLC A;  3UP9 A;  5H8F A;  1I6A A;  2OK2 A;  3SEY A;  1NL5 A;  3H6V A;  4KQP A;  1BIY A;  4JB7 A;  4RA1 A;  3ZSF A;  1MG1 A;  3BBR A;  4F1Y A;  4WKM A;  1A99 A;  2DS9 A;  3VE1 B;  5M2V A;  1JEV A;  4GXS B;  1SQY A;  1VFE A;  4FED A;  5JEI A;  4ZZA A;  2F7C A;  1HSL A;  1N04 A;  1B9J A;  3A09 A;  3BFU A;  3IB1 A;  1MXX A;  3O6H A;  4H65 A;  3O2A A;  4ND9 A;  4LZ8 A;  4DCY A;  2O6A A;  4C1U A;  1B7U A;  3T9H B;  1P1O A;  4JXI A;  1OVB A;  3C33 A;  1QJM A;  2OCU A;  3QUJ A;  1DPE A;  2QL3 A;  4IO5 A;  3FV2 A;  3SEX A;  4BDN A;  5ITP A;  2FA7 A;  4OFJ A;  3JYR A;  1N3X A;  1NH8 A;  4OZ9 A;  4P0I A;  2XX9 A;  3H03 A;  3TFL A;  5I57 B;  3VVD A;  4Q0C A;  5CI5 A;  3RQT A;  5DEX B;  3IB2 A;  1Z7N E;  2D5W A;  2UVJ A;  3CFZ A;  4IB2 A;  4DDD A;  2ONK E;  2I6E A;  2YJP A;  4F3S A;  4G77 A;  3DP8 A;  3EHS A;  4G8M A;  1TFD A;  1A8E A;  1YPN A;  1PB9 A;  3TTN A;  3OMB A;  3SES A;  2V84 A;  4H67 A;  4HS7 A;  5FTI A;  4FIM A;  1B3E A;  1B51 A;  1SYI A;  2ESN A;  2HZK A;  4MFI A;  3QAX A;  3FJM A;  2ANJ A;  1XS5 A;  2DE2 A;  4PQJ A;  4THI A;  3KSX A;  3M3F A;  3GZG A;  2HXW A;  4O3C A;  3GLB A;  4YZZ A;  4ESX A;  3FVO A;  2RC7 A;  3B6W A;  2D3I A;  3LC8 A;  2ONR A;  4EQB A;  2Y84 A;  1BKA A;  1N7X A;  3FGS A;  4NF5 B;  4X1B A;  1NMU A;  1P99 A;  1RKM A;  3ZS6 A;  4GIZ A;  2UVG A;  1MXU A;  3KOS A;  1A7L A;  2AIX A;  4LQ5 A;  1II5 A;  5F7V A;  1H3D A;  2QSX A;  3DM0 A;  3OEM A;  3TQW A;  2Y7R A;  3H6U A;  1OQG A;  3H6W A;  2RF1 A;  1YTV A;  3UIF A;  1B05 A;  2XXI A;  3PPQ A;  2CMO A;  4MBP A;  3FXU A;  4OWD A;  1BLF A;  2QPQ A;  1Q1K A;  2UYF A;  1MY1 A;  1SI1 A;  2ZNU A;  3HPI A;  4U22 A;  3TTR A;  3ZKK A;  1B0L A;  4H8I A;  5AA3 A;  4JWX A;  4PET A;  3PUV E;  1IIT A;  1B5J A;  4RK9 A;  4LAT A;  4N6P A;  4ZEI A;  3FAS A;  3K4U A;  1BTJ A;  3UA8 A;  3MVW A;  2HAU A;  1GV8 A;  5JK4 A;  1IIW A;  1UIV A;  1LAG E;  5FTH A;  5BUU A;  4JWY A;  3G7W A;  1D9Y A;  1UTH A;  3HV1 A;  3B7D A;  5A5X A;  2VP1 A;  3N6U A;  5HM4 B;  1FQD A;  3IAZ A;  3O97 A;  4ISU A;  4TLL B;  3N5L A;  3PU5 A;  4YKP A;  3CSG A;  4NTL A;  1EU8 A;  3QK6 A;  5I2N B;  4LQ2 A;  2DE3 A;  3R26 A;  4X48 A;  3U72 A;  1NH7 A;  1URG A;  2DWA A;  3HHG A;  2NXO A;  2ZYM A;  1B5H A;  3MW0 A;  2ABH A;  2ZYN A;  4I62 A;  3OSR A;  5H8N A;  1B7Z A;  2F34 A;  4XTC Q;  4R9G A;  3TQL A;  1L5T A;  4U4X A;  2NVU B;  1XVY A;  2P2A A;  1D4N A;  2F35 A;  2I0B A;  2F5X A;  2PMS A;  4G68 C;  1MDQ A;  4R73 A;  4UAC A;  3KGC A;  4XIG Q;  1FQA A;  5BWJ A;  2ZNS A;  2PX1 A;  4AB6 A;  2Y7K A;  4EQ7 A;  1XHY A;  1B0H A;  1IZ1 A;  2I0C A;  3C32 A;  3PUY E;  3TCF A;  5ISU A;  4ONY A;  2DVZ A;  3I5O A;  3JV9 A;  5I57 A;  1Y9U A;  2RC8 A;  4ECF A;  1RYX A;  1USY H;  3K1P A;  1QVS A;  1FTL A;  2CZL A;  2XXW A;  4I1D A;  4IO7 A;  4GQO A;  2XXR A;  5AA2 B;  3S9E A;  4YB7 A;  3PUZ E;  5HPQ A;  2REG A;  4R2B A;  1XVX A;  3RUM A;  4X1D A;  1M5E A;  3TDJ A;  3SEV A;  4NF4 B;  1MQJ A;  4PE5 B;  1LFG A;  2QS2 A;  4H5G A;  5H8Q A;  2ZYK A;  4XXU A;  2ZNT A;  4G8N A;  3OEN A;  2I48 A;  4ZE9 A;  5DYH A;  2QRY A;  3BFT A;  3FXQ A;  2B3F A;  4O3A A;  3OO8 A;  1DSN A;  4G8H A;  5H8Q B;  3CSB A;  1I6Q A;  3OD7 A;  5JTY A;  4P0G A;  1MDP 1;  1LB9 A;  2DXY A;  3ECR A;  2F6G A;  3KZG A;  1O7T A;  1SVX B;  2XX7 A;  3PUW E;  2HZL A;  1Y20 A;  2Z8E A;  4KD5 A;  2O69 A;  3V5A A;  5EYF A;  1JVY A;  4F3G A;  1JQF A;  3W15 C;  3TUS A;  3DP4 A;  3LSL A;  2UXA A;  4G68 B;  1MY2 A;  3IB0 A;  3K6U A;  3N94 A;  4DXC A;  5EHM A;  2LAO A;  4LZ7 A;  1XC1 A;  3PPN A;  2I4C A;  2GH9 A;  3R7X A;  1A8F A;  4NF8 B;  3DEL B;  3TAJ A;  5CRY A;  4EXL A;  2AYS A;  1GGG A;  2QS1 A;  1MXY A;  2DYX A;  3KJ7 A;  4PFT A;  4KYS A;  3RPW A;  3L6G A;  4RPO A;  5L9S A;  3H6T A;  1HSE A;  3TKD A;  3FIR A;  4PFW A;  1LCF A;  1LBC A;  4OES A;  2ALU A;  3FVG A;  1NNF A;  2OZZ A;  2XD2 A;  3P7I A;  1F9B A;  3K1N A;  5K2Y A;  4HCY A;  4FEC A;  2YLN A;  1QKA A;  1LAX A;  2H99 A;  3EPE A;  3N6T A;  4H6D A;  3VDF A;  4R2F A;  5I56 B;  5I84 A;  5DT6 A;  3KN3 A;  4KCD A;  2OLB A;  3H4Z A;  2ONS A;  3CVG A;  3TTK A;  5I58 B;  1ELJ A;  3MVY A;  3C36 A;  4GD5 A;  2P0S A;  4MH5 A;  2Q2A A;  1FCK A;  1NNT A;  3RT6 B;  3T22 A;  4YKI A;  1LAF E;  3G3K A;  1GR2 A;  2Q88 A;  1AH5 A;  3V83 A;  3E3K A;  4POW A;  3VXC A;  3T9U A;  1OMP A;  3T9X B;  4OHN A;  4AQ4 A;  4QFL A;  2HEU A;  1MQG A;  2I3W A;  4H5F A;  4KPT A;  1EH3 A;  2NWJ A;  4X9T A;  4HTG A;  4GOT A;  1N76 A;  2VD3 A;  4YKJ A;  4R72 A;  1Y4T A;  2X7P A;  5AA2 D;  3MVZ A;  1TXF A;  4F22 A;  3F11 A;  4GL8 A;  1B1X A;  1US5 A;  5ICT A;  4YU0 A;  2O84 X;  2Y7W A;  1LB8 A;  3FD3 A;  5TU0 A;  1R9L A;  4ZEF A;  4F31 B;  1B40 A;  1H76 A;  1POT A;  3CIJ A;  1FQC A;  3RTW B;  4ZS9 A;  1IXI A;  5KDT A;  4F18 A;  3AXF A;  2GHB A;  4IO6 A;  5ITO A;  1SI0 A;  2RIN A;  2A5S A;  2O1M A;  3KG2 A;  3IK6 B;  2XXU A;  2DVC A;  5KCJ A;  3MVX A;  5B70 A;  3TZA A;  2H25 A;  3W9V A;  3G3J A;  1PB8 A;  5EHS A;  5I2K A;  2Y7I A;  2Q89 A;  2D21 A;  2ZMB A;  4EF1 A;  2V93 A;  5CMM A;  2F7A A;  4F1V A;  5CMK A;  4C1T A;  4PFY A;  2RCB A;  2UVH A;  4TOZ A;  3VLU A;  4DXB A;  3G3G A;  1ATG A;  5L9M A;  4BDL A;  4NMY A;  4OTE A;  3K0V A;  1A55 A;  1J1N A;  4RNS A;  3S2V A;  4DIG A;  4EDP A;  4BDR A;  4GVO A;  1ZIU A;  3OSQ A;  3B6T A;  1USY E;  3VLV A;  3U92 A;  2F7B A;  3RTF B;  3Q27 A;  4MLV A;  4OEV A;  5FHO A;  1YCJ A;  4QRZ A;  4F2O A;  1EZO A;  4R9F A;  1MQH A;  2AL5 A;  3U94 A;  3G3F A;  4GXA A;  4BDO A;  3CG3 A;  2HFB A;  3VFJ A;  4GFR A;  5K2X A;  3U93 A;  4ZED A;  3LSW A;  1D9V A;  3TEP A;  3G3I A;  2I58 A;  3ZKL A;  5I59 A;  2VGQ A;  1N3W A;  1MXW A;  2FYI A;  4U1Z A;  3FZV A;  3IO4 A;  4OFL A;  3U1O A;  1XOC A;  3GBA A;  3OEL A;  4M4G A;  1SW2 A;  4N07 A;  2Z8D A;  3EQ1 A;  1N7W A;  3DLN A;  4LUB A;  2PT1 A;  1FQB A;  3EHU A;  4NF6 B;  1NFT A;  3KOT A;  3PUX E;  1JEU A;  3TOD A;  2REJ A;  5AA4 B;  1B32 A;  3QXM A;  5H8H B;  5I58 A;  4WED A;  4IY5 A;  4FAT A;  1H45 A;  3THI A;  1FTM A;  2F6P A;  2F8D A;  3FVK A;  4PP0 A;  4FEB A;  1QKB A;  2G29 A;  1JVX A;  3SER A;  1UTB A;  2UVI A;  4WEP A;  1OIB A;  1IXC A;  2Q9T A;  2GFE A;  1LAH E;  2O68 A;  3D4G A;  1ZJL A;  2O51 A;  4JSO A;  3TTL A;  3JZJ A;  4XKN A;  2FNC A;  4ZEK A;  4QFO A;  4YKK A;  1JNF A;  3LR1 A;  4Q5T A;  4Z7E A;  3WAE A;  3O6G A;  3TEL A;  4DCX A;  4XKQ A;  1WDN A;  3MQ9 A;  2QMW A;  4RJZ A;  4ZEC A;  2X7Q A;  1POY 1;  3IJO B;  1PC3 A;  1B3H A;  1Y3P A;  2RCA A;  3PD9 A;  3C9H A;  1ZLQ A;  4GWO A;  3T66 A;  2I49 A;  3IR1 A;  3MJN A;  4L17 A;  4R6Y A;  4KCC A;  1P1N A;  1TWY A;  1QUI A;  3K02 A;  1FTK A;  1LST A;  3RLF E;  3RNN A;  1T0K A;  1MM7 A;  2VOZ A;  3FXR A;  2I3V A;  1PBP A;  2R9J A;  2XXX A;  3VLW A;  3I6V A;  4YMB A;  3MAM A;  2OWS A;  4QSE A;  4R6H A;  2PYY A;  3V8X B;  3KEI A;  4NF4 A;  4AB5 A;  3C34 A;  3KFM A;  3M3L A;  4FOR A;  2M8C A;  5KZT A;  3UK4 A;  1TT1 A;  4N13 A;  1US4 A;  1SBP A;  4U2R A;  5B7D A;  4I9D A;  4G4P A;  4ESW A;  3Q25 A;  1PB7 A;  1WOD A;  1Q35 A;  2Y7P A;  4WXJ A;  5DTB A;  4GL0 A;  2V3Q A;  3I3V A;  4FAJ A;  3MP1 A;  3VVF A;  4OEU A;  1TFA A;  1Y3Q A;  1VE4 A;  1QW0 A;  3L6H A;  4TLM B;  2DWH A;  5IKB A;  1VR5 A;  1ZKB A;  4M1V A;  1LFH A;  2QS4 A;  4MF3 A;  3OOA A;  3MPK A;  3ILU B;  3K6W A;  1VSO A;  4G68 A;  4LON B;  1LCT A;  1O63 A;  1PBQ A;  2OBG A;  3QSL A;  3RN8 A;  5H8N B;  3Q28 A;  3PMX A;  2P1S A;  3O66 A;  3USD A;  1NNP A;  2GRV A;  5DVF A;  4NF8 A;  1IXG A;  2O7I A;  3IX1 A;  1AIV A;  3QIM A;  2PBW A;  4NWD A;  3BKI B;  3IOV A;  3KJT A;  4JDF A;  1UTH B;  5LOM A;  2XXT A;  3PPR A;  3PPP A;  2Z22 A;  4H0W A;  4IO3 A;  4KHZ E;  1DOT A;  4TQU Q;  4YB5 A;  4FE8 A;  3TTM A;  2H9B A;  3VV5 A;  3VVE A;  2XX8 A;  2ZYO A;  1Y3N A;  3KBR A;  1DTG A;  1O64 A;  4YB6 A;  3S9N C;  1H43 A;  4U21 A;  1Y1Z A;  1P1W A;  4FJP A;  2O7U A;  4YAH X;  1QUL A;  2HCA A;  5H8F B;  3TCH A;  1B4H A;  2YPN A;  4NWC A;  3K6X A;  2R6G E;  5H8H A;  1B4Z A;  2IA4 A;  4JWO A;  5TPA A;  3V89 B;  4XKP A;  2DQV A;  3PMV A;  3CI8 A;  5I59 B;  1A40 A;  4OEN A;  1FQF A;  3PPO A;  3FUZ A;  3UN6 A;  4IGT A;  5AA1 A;  3E4R A;  5TP9 B;  3KN8 A;  4Q8R A;  3K1M A;  2DOJ A;  3IOW A;  4K3F A;  4ELP A;  1N0T A;  4LA9 A;  3ILT B;  5L8D A;  5J1D A;  2A5T A;  1S9T A;  2DSF A;  1B3F A;  3ONM A;  3T96 B;  4ZE8 A;  1MPC A;  3U8Q A;  5ELV A;  3OO7 A;  3B6Q A;  2PT2 A;  4OVJ A;  4OMB A;  5AA4 A;  2DE4 A;  5DEX A;  1GVC A;  1LFI A;  3T93 B;  1ANF A;  1MPD A;  1PEB A;  1UTB B;  3OO9 A;  1CB6 A;  4U23 A;  3MP8 A;  5TPA B;  3C31 A;  4H1X A;  2XXH A;  1QUJ A;  3SEW A;  2F36 A;  3A3C A;  3IJX B;  3PV0 E;  5DVJ A;  3E9X A;  1NNK A;  4EXK A;  5AA2 A;  2UYE A;  5H8S A;  4DZ1 A;  5KCJ B;  3EHT A;  5JTY B;  1SYH A;  5IAI A;  4BDQ A;  3PMW A;  1RYO A;  4QF9 A;  1IXH A;  4E0X A;  1HSJ A;  1JW1 A;  1IUD A;  1LBB A;  3FAT A;  3IOU A;  4OQO A;  4C0R A;  3K00 A;  1M5F A;  4EUO A;  1QUK A;  3D4C A;  2V25 A;  4O3B A;  3S9M C;  3CR9 A;  5I56 A;  1EZ9 A;  2XXV A;  3TCG A;  4QFP A;  2B65 A;  4KYD A;  4E0W A;  1VFD A;  3UGW A;  3RY3 A;  1BP5 A;  4ELO A;  1H44 A;  4UA8 A;  3DP6 A;  4IY6 A;  1FTO A;  3WAF A;  4OXV A;  5CC2 A;  1A54 A;  3SDF A;  3CFL A;  5CMC A;  1S7Y A;  2IEE A;  3MZB A;  3Q29 A;  3MUQ A;  1SW1 A;  1SDX A;  2O1L A;  1JET A;  2B3B A;  1B52 A;  1B46 A;  2QMX A;  3OO6 A;  4U4S A;  3RGY A;  4HW8 A;  4YMA A;  3MWB A;  2E1S A;  1MQD A;  3HO7 A;  4ELQ A;  3R6U A;  2NUV A;  1CE2 A;  3FJG A;  2GHA A;  2R71 A;  1MXV A;  4F29 A;  1URD A;  5CM6 A;  3A3U A;  4F19 A;  3K6V A;  1MRP A;  2XHD A;  4HCW A;  2F97 A;  2PVU A;  3K2D A;  5AE4 A;  2BJJ X;  2Q2C A;  3O29 A;  3MC2 A;  1OQH A;  1Y1M A;  3MZ1 A;  4ZZE A;  4JSD A;  1AOV A;  2E0S A;  2V3U A;  3M3K A;  2Q8J A;  3FVN A;  4IO2 A;  1N84 A;  4LVQ A;  4OYV A;  3TYH A;  2ZXT A;  1NKX A;  1R1N A;  1Z7M E;  4QFN A;  3PGF A;  3T9V A;  4F39 A;  3G3H A;  2HQ0 A;  2H5Y A;  2XXP A;  2I4B A;  3C4M A;  5CBR A;  2X26 A;  1B6H A;  4RXL A;  4NED A;  5DVI A;  3LSX A;  1DTZ A;  3MZ9 A;  3TPA A;  2OWT A;  4RYA A;  4XKR A;  2DWJ A;  1ZTY A;  1PDA A;  2QS3 A;  1B1H A;  3FJ7 A;  3HHF A;  4LP2 B;  5I2K B;  1MXZ A;  1EZP A;  3CFX A;  2H4I A;  1FW0 A;  2F78 A;  1UIU A;  1I6B A;  4IO4 A;  3IOR A;  2QJE A;  4MLQ A;  4F3B A;  3MP6 A;  1FTJ A;  1Y4C A;  3KSJ A;  2Z23 A;  1MY0 A;  1DMB A;  3LSF B;  3LBS A;  4ZEB A;  4DE8 A;  4F1U A;  4KR5 A;  1LLS A;  1ZMG A;  4EF2 A;  5A5X B;  4QSD A;  1YAE A;  4QFK A;  2V3T A;  3C35 A;  1B58 A;  3CRB A;  4Z0I A;  1D3K A;  3GXA A;  4P11 A;  4ELR A;  4F2Q A;  4ZDM A;  5KDT B;  5L9O A;  4QSC A;  5FHM A;  3K01 A;  3M8U A;  2OJT A;  3S4U A;  2AL4 A;  3ODB A;  4KFQ A;  1B3G A;  3EF7 A;  1MH3 A;  3HCQ A;  1IEJ A;  4U1O A;  4EQ9 A;  1IQ7 A;  4JBZ A;  2WKY A;  3H3G A;  3QYT A;  2RKM A;  1MS7 A;  3HST A;  5TP9 A;  4OER A;  3PD8 A;  1WVJ A;  1R9Q A;  4PFU A;  3SKP A;  4YIC A;  5ICQ A;  4LZ5 A;  2RC9 A;  3S9L C;  1LGB C;  3H06 B;  3SEU A;  3IO6 A;  4R75 A;  3O6I A;  3UOR A;  2A5T B;  2DXR A;  2VHA A;  3QUF A;  1B2H A;  4GLI A;  5HBC A;  4NF5 A;  3CG1 A;  4F3P A;  3N26 A;  4G2Z A;  2Z8F A;  4BLA A;  1ZBM A;  2H98 A;  1MPB A;  1M5C A;  4NF6 A;  4KI0 E; 
#chains in the Genus database with same CATH topology
 3IL1 B;  1AL3 A;  5KZT A;  4I3E A;  1OVT A;  2XXQ A;  1MY4 A;  1P1Q A;  1S50 A;  3O9P A;  2NOO A;  4R74 A;  4E0X A;  1IMF A;  4P56 A;  4RY1 A;  1MQI A;  1R6Z A;  3TMG A;  1DPP A;  1SD3 A;  3GBB A;  4MHF A;  4OVP A;  2THI A;  1M5D A;  2L5V A;  2KLF A;  4F3S A;  2DWI A;  1XT8 A;  4GF8 A;  2HAV A;  4OFO A;  4KQP A;  1BIY A;  4JB7 A;  4PFR A;  1A99 A;  4FED A;  2CEY A;  1YYZ A;  3A09 A;  1HSL A;  3BFU A;  3T9H B;  4O7I A;  1NV4 A;  3C33 A;  3SEX A;  4N8G A;  3JYR A;  4P0I A;  5DW8 A;  3VVD A;  5CI5 A;  3RQT A;  4DDD A;  2YJP A;  1LBZ A;  3EHS A;  1A8E A;  3SES A;  2HZK A;  4PQJ A;  3QAX A;  4GWW A;  1XS5 A;  4O3C A;  4JVI A;  1BKA A;  3FGS A;  3ZS6 A;  1P99 A;  1RKM A;  4GIZ A;  3KOS A;  1II5 A;  3TQW A;  1YTV A;  2XXI A;  5IGA A;  1NI9 A;  4IR8 A;  1Q1K A;  3HPI A;  1B0L A;  5AA3 A;  4GX6 A;  1B5J A;  4N6P A;  1BTJ A;  5JK4 A;  5FTH A;  4JWY A;  4MJO A;  1D9Y A;  3HV1 A;  5A5X A;  4ISU A;  3N5L A;  3PU5 A;  3CSG A;  1EU8 A;  1VDW A;  4LQ2 A;  2HXR A;  4I62 A;  4XTC Q;  1XVY A;  2P2A A;  1D4N A;  2I0B A;  1MDQ A;  3KGC A;  2PX1 A;  4AB6 A;  3C32 A;  2VPO A;  1Y9U A;  2RC8 A;  1RYX A;  3K1P A;  1FTL A;  4HXV A;  2XXW A;  2XXR A;  3HFU A;  1FBE A;  3PUZ E;  4X1D A;  3SEV A;  4NF4 B;  2ZYK A;  4G8N A;  2I48 A;  5DYH A;  3B8B A;  2B3F A;  3ECR A;  1JVY A;  2B4L A;  3W15 C;  3TUS A;  2UXA A;  4DXC A;  4PC9 A;  4LN5 A;  1XC1 A;  1NUX A;  2AYS A;  2PCR A;  1MXY A;  2DYX A;  4RPO A;  3H6T A;  1LCF A;  1LBC A;  3P7I A;  1F9B A;  4FEC A;  1KA1 A;  3N6T A;  4H6D A;  5DT6 A;  2OLB A;  3CVG A;  3TTK A;  5I58 B;  2VPN A;  2P0S A;  2Q2A A;  1AH5 A;  1MQG A;  4X9T A;  4GOT A;  4YKJ A;  2X7P A;  5AA2 D;  1TXF A;  4GL8 A;  1B1X A;  5ICT A;  5TU0 A;  4F31 B;  1FQC A;  1IXI A;  2GHB A;  2FIX A;  1SI0 A;  2DVC A;  5B70 A;  3G3J A;  2Q89 A;  2V93 A;  4C1T A;  2UVH A;  4BDL A;  3S2V A;  3B6T A;  4MLV A;  1G0I A;  3RYD A;  5FHO A;  4GXA A;  4BDO A;  3VFJ A;  3LSW A;  1N3W A;  4N91 A;  4MCO A;  5EYH A;  3U1O A;  3OEL A;  1YZ0 A;  4OA4 A;  4NF6 B;  3PUX E;  3QXM A;  5H8H B;  5I58 A;  4FAT A;  1H45 A;  2Q8M A;  2CZH A;  1UTB A;  2UVI A;  1IXC A;  1LAH E;  2FNC A;  4QFO A;  4Z7E A;  3WAE A;  3O6G A;  4RJZ A;  5EQA A;  3PD9 A;  4L17 A;  3K02 A;  3RNN A;  3CHG A;  3FXR A;  1PBP A;  4YMB A;  4R6H A;  3V8X B;  4N13 A;  4U2R A;  1NV2 A;  4ESW A;  1DBZ A;  1WOD A;  1PB7 A;  1Q35 A;  3PTY A;  4OVS A;  4QXD A;  1TFA A;  1VE4 A;  1QW0 A;  3L6H A;  1LFH A;  1ZKB A;  4M1V A;  4AS5 A;  4PGN A;  3K6W A;  4G68 A;  3RN8 A;  2OBG A;  3USD A;  1KZ8 A;  1AIV A;  3QIM A;  1LBY A;  2PBW A;  4GX4 A;  1UTH B;  2XXT A;  3PPP A;  4TQU Q;  2H9B A;  4MEV A;  2XX8 A;  1NUW A;  1DTG A;  3S9N C;  4U21 A;  4FJP A;  1P1W A;  2YPN A;  2OX3 A;  1B4Z A;  2DQV A;  3PMV A;  4AS4 A;  1A40 A;  1FQF A;  3PPO A;  5TP9 B;  4MIJ A;  3KN8 A;  2DOJ A;  3IOW A;  1SPI A;  1MPC A;  2DE4 A;  1GVC A;  1LFI A;  3T93 B;  1ANF A;  1FBF A;  2QFL A;  3MP8 A;  2XXH A;  2F36 A;  3A3C A;  5AA2 A;  2UYE A;  1HSJ A;  1JW1 A;  1LBB A;  5ET8 A;  1FJ6 A;  3S9M C;  3CR9 A;  4E0W A;  4QFP A;  5EQ8 A;  1BP5 A;  1H44 A;  4PFB A;  3WAF A;  4OXV A;  3SDF A;  3CFL A;  1S7Y A;  2IEE A;  3RGY A;  1B52 A;  4U4S A;  1Q9D A;  3FJG A;  2GHA A;  4F29 A;  2PVU A;  3K2D A;  3O29 A;  1RDX A;  3MC2 A;  1Y1M A;  4ZZE A;  4JSD A;  4OVT A;  2V3U A;  2Q8J A;  3TYH A;  4LVQ A;  4OYV A;  4QFN A;  4JVC A;  2WX9 A;  1FBH A;  2H5Y A;  5CBR A;  2WEF A;  4P9K A;  5EQ7 A;  2QS3 A;  3HHF A;  4LP2 B;  4O8M A;  1EZP A;  4OVQ A;  1I6B A;  4IO4 A;  4O7M A;  4EF2 A;  5A5X B;  4JVD A;  1YAE A;  1D3K A;  3GXA A;  4ZDM A;  4EQ9 A;  2WKY A;  3QYT A;  2RKM A;  3LV0 A;  3HST A;  4PF6 A;  2VHA A;  3QUF A;  1AWB A;  3N26 A;  4G2Z A;  1ZBM A;  3FV1 A;  1NV1 A;  2WYP A;  3T9U A;  3LUY A;  1M5B A;  3H7M A;  4ZZA A;  1MM6 A;  4RK2 A;  1MH4 A;  5CBS A;  1ZU0 A;  1JW5 A;  5CMB A;  3QMF A;  1URS A;  4OET A;  3MBP A;  1FQE A;  3MPL A;  4IGR A;  3TCF A;  1AMF A;  2W7Y A;  4KYE A;  3Q26 A;  3O28 A;  1OLC A;  1I6A A;  2OK2 A;  3SEY A;  1NL5 A;  3B50 A;  1IMB A;  1FBC A;  5M2V A;  1JEV A;  3O6H A;  1B9J A;  4H65 A;  3O2A A;  2O6A A;  1B7U A;  2QL3 A;  5ITP A;  2FA7 A;  1NH8 A;  1Z7N E;  4IB2 A;  4HE0 A;  1PB9 A;  3OMB A;  2V84 A;  4FIM A;  5CMM A;  4MFI A;  3FJM A;  2ANJ A;  4ESX A;  3GZG A;  2HXW A;  3GLB A;  4XF5 A;  2RC7 A;  4EQB A;  2D3I A;  2Y84 A;  1FPG A;  2CZI A;  3DM0 A;  2Y7R A;  3KC0 A;  1OQG A;  2RF1 A;  3UIF A;  3PPQ A;  2CMO A;  1BLF A;  1MY1 A;  2ZNU A;  4U22 A;  4H8I A;  4PET A;  3PUV E;  1IIT A;  4PDH A;  2HAU A;  1IIW A;  1LAG E;  1UTH A;  4N6K A;  1FQD A;  4TLL B;  5I2N B;  3R26 A;  4X48 A;  3HHG A;  2ZYM A;  1B5H A;  2F34 A;  3TQL A;  4U4X A;  1FPI A;  2F35 A;  2PMS A;  2F5X A;  5BWJ A;  1FQA A;  2Y7K A;  4EQ7 A;  1XHY A;  1IZ1 A;  3PUY E;  2MKZ A;  3I5O A;  3JV9 A;  1QVS A;  4I1D A;  4XFE A;  4IO7 A;  4GQO A;  5AA2 B;  3S9E A;  5HPQ A;  2REG A;  4R2B A;  4PE5 B;  5H8Q A;  5IZZ A;  4XXU A;  5A5L A;  3OEN A;  4ZE9 A;  2QRY A;  3FXQ A;  4O3A A;  1DSN A;  4G8H A;  3CSB A;  3PUW E;  1O7T A;  2XX7 A;  2HZL A;  4KD5 A;  1JQF A;  3DP4 A;  3LSL A;  4G68 B;  3IB0 A;  1JP4 A;  2I4C A;  3R7X A;  3KJ7 A;  1NV0 A;  3RPW A;  2FBP A;  2XWK A;  1HSE A;  3TKD A;  4PFW A;  5FBP A;  3K1N A;  2YLN A;  1QKA A;  1LAX A;  3VDF A;  3EPE A;  3H4Z A;  3MVY A;  4MH5 A;  1FCK A;  3ISP A;  4N81 A;  3RT6 B;  1LAF E;  2Q88 A;  3VXC A;  4POW A;  2WBB A;  4QFL A;  2HEU A;  4H5F A;  1EH3 A;  4HTG A;  3F11 A;  4G61 A;  2O84 X;  1LB8 A;  1R9L A;  3RTW B;  3CIJ A;  4ZS9 A;  3AXF A;  2A5S A;  2O1M A;  3KG2 A;  3IK6 B;  5KCJ A;  4P8B A;  2H25 A;  2B4M A;  5EHS A;  5I2K A;  3GYY A;  2D21 A;  2ZMB A;  4EF1 A;  1EYI A;  2RCB A;  3VLU A;  4DXB A;  3G3G A;  5L9M A;  1A55 A;  1J1N A;  4DIG A;  4EDP A;  4BDR A;  3RTF B;  3Q27 A;  4OEV A;  1EZO A;  4NAP A;  4P47 A;  2HFB A;  4GFR A;  5K2X A;  3G3I A;  2FYI A;  2Q74 A;  3FZV A;  3IO4 A;  1SW2 A;  4GWZ A;  2PT1 A;  3EHU A;  3KC1 A;  5LTC A;  3TOD A;  4GX3 A;  5AA4 B;  4IY5 A;  3THI A;  4PP0 A;  1JVX A;  1YXI A;  1OIB A;  3D4G A;  1ZJL A;  3JZJ A;  2BJI A;  4YKK A;  1JNF A;  4Q5T A;  4PAF A;  4DCX A;  2JJK A;  2X7Q A;  1POY 1;  1NUZ A;  2RCA A;  3C9H A;  4GWO A;  3T66 A;  3MJN A;  4KCC A;  1P1N A;  1QUI A;  1FTK A;  3RLF E;  4NF0 A;  2XXX A;  2R9J A;  3VLW A;  3I6V A;  2GQ1 A;  4AB5 A;  3KEI A;  4PTK A;  4FOR A;  2M8C A;  5B7D A;  5DTB A;  2Y7P A;  4PDD A;  4GL0 A;  4FAJ A;  1Y3Q A;  4NX1 A;  2DWH A;  2QS4 A;  1FSA A;  4LON B;  3QSL A;  5H8N B;  4NF8 A;  1IXG A;  3IX1 A;  2WYK A;  3BKI B;  4I3Y A;  1FPL A;  4H0W A;  3TTM A;  3VVE A;  4O94 A;  3KBR A;  1NV5 A;  1O64 A;  1H43 A;  1Y1Z A;  2R6G E;  5TPA A;  3V89 B;  4PBH A;  5I59 B;  3FUZ A;  3E4R A;  2R8T A;  4ELP A;  2DSF A;  3ONM A;  3T96 B;  5ET6 A;  2P3V A;  2PT2 A;  4OVJ A;  1MPD A;  4U23 A;  3C31 A;  1QUJ A;  3SEW A;  3PV0 E;  1NNK A;  2QVR A;  4EXK A;  5H8S A;  5JTY B;  3IOU A;  1M5F A;  4EUO A;  3D4C A;  2XXK A;  2XXV A;  2B65 A;  4ELO A;  4IY6 A;  3ROJ A;  5CC2 A;  1A54 A;  4N17 A;  3Q29 A;  2E1S A;  4ELQ A;  1CE2 A;  1MXV A;  4F19 A;  3K6V A;  2XHD A;  2F97 A;  1DK4 A;  1NKX A;  4F39 A;  3PGF A;  2XXP A;  1B6H A;  4RXL A;  4MX6 A;  1PDA A;  4XEQ A;  5I2K B;  1MXZ A;  3CFX A;  2F78 A;  3LUZ A;  4MLQ A;  3MP6 A;  1FTJ A;  2Z23 A;  1MY0 A;  3LBS A;  4ZEB A;  1ZMG A;  3A29 A;  4QSD A;  1BK4 A;  2V3T A;  1B58 A;  4ELR A;  5KDT B;  5L9O A;  4QSC A;  2XA5 A;  4KFQ A;  3EF7 A;  1IEJ A;  1MS7 A;  4OER A;  4LZ5 A;  1LGB C;  3H06 B;  4GWX A;  3IO6 A;  4PGP A;  4R75 A;  3O6I A;  2DXR A;  1FPD A;  1B2H A;  3CG1 A;  3FBP A;  2Z8F A;  1MPB A;  3H6W A;  4QHQ A;  3RT8 A;  4Q30 B;  1IMA A;  1OLA A;  3MST A;  5FHN A;  1SW5 A;  1P1U A;  4BDM A;  3OXN A;  2DP8 A;  2G93 A;  3W9W A;  2XD3 A;  2ZZX A;  3VXB A;  4H45 A;  1MY3 A;  3E13 X;  3HN0 A;  1B7H A;  5F1Q A;  5FHM A;  3OEK A;  3H6V A;  4RA1 A;  3ZSF A;  1MG1 A;  3BBR A;  2DS9 A;  4PCD A;  1N04 A;  3IB1 A;  3TFL A;  4LZ8 A;  1K9Z A;  1P1O A;  4JXI A;  1QJM A;  1DPE A;  4BDN A;  3FV2 A;  1NV7 A;  4OZ9 A;  1D9Q A;  2XX9 A;  5DEX B;  3IB2 A;  3RPL A;  2UVJ A;  2ONK E;  4DI3 D;  4G77 A;  1TFD A;  4HS7 A;  2ESN A;  1FBD A;  4THI A;  3KSX A;  3M3F A;  3B6W A;  3LC8 A;  2ONR A;  4X1B A;  1NMU A;  1IME A;  1MXU A;  1A7L A;  2AIX A;  4LQ5 A;  2QSX A;  3OEM A;  3H6U A;  1B05 A;  4NHB A;  4OWD A;  1SI1 A;  3ZKK A;  4LAT A;  3FAS A;  3K4U A;  3MVW A;  1UIV A;  1LBV A;  5HM4 B;  3N6U A;  4HE2 A;  4YKP A;  2DE3 A;  1NH7 A;  2DWA A;  2ABH A;  2ZYN A;  5H8N A;  4R9G A;  1L5T A;  5IZ3 A;  4R73 A;  1B0H A;  2I0C A;  5ISU A;  4ONY A;  2DVZ A;  5I57 A;  4ECF A;  1USY H;  3T0J A;  2CZL A;  4YB7 A;  1XVX A;  3RUM A;  3TDJ A;  1LFG A;  2WBD A;  1EYJ A;  2ZNT A;  3BFT A;  2QVV A;  5JTY A;  3OD7 A;  1NUY A;  1MDP 1;  1LB9 A;  2DXY A;  4PFI A;  2F6G A;  4I40 A;  1SVX B;  1Y20 A;  2Z8E A;  2O69 A;  3V5A A;  4F3G A;  4UAB A;  1MY2 A;  3K6U A;  3N94 A;  3PPN A;  3TAJ A;  5CRY A;  4EXL A;  1GGG A;  5L9S A;  4OES A;  2ALU A;  1NNF A;  2XD2 A;  5I84 A;  3V83 A;  4R2F A;  3KN3 A;  4MMP A;  1ELJ A;  4GD5 A;  1NNT A;  3T22 A;  1FPJ A;  4YKI A;  1GR2 A;  3T9X B;  4OHN A;  3U65 A;  2I3W A;  4PAI A;  2NWJ A;  2VD3 A;  4F22 A;  2Y7W A;  1B40 A;  1H76 A;  2HHM A;  5KDT A;  4IO6 A;  2RIN A;  3TZA A;  2Y7I A;  1FPK A;  2F7A A;  5CMK A;  4PFY A;  1M5C A;  4P1E A;  1LBX A;  1ATG A;  4NMY A;  4OTE A;  3K0V A;  4RNS A;  4GWS A;  4GVO A;  3OSQ A;  3U92 A;  2F7B A;  4GBV A;  1YCJ A;  4F2O A;  4R9F A;  2AL5 A;  3U94 A;  3G3F A;  3CG3 A;  3U93 A;  1D9V A;  3TEP A;  1MXW A;  1FPE A;  1XOC A;  3GBA A;  4M4G A;  4N07 A;  2Z8D A;  1N7W A;  3DLN A;  3RPL B;  1FQB A;  1NFT A;  1JEU A;  2REJ A;  4WED A;  1FTM A;  2F6P A;  2F8D A;  2XWV A;  3FVK A;  5I3S A;  1QKB A;  2G29 A;  3SER A;  2O68 A;  4NQ8 A;  4JSO A;  3TTL A;  4QBA A;  3TEL A;  4XKQ A;  2QMW A;  2HPG A;  4MAG A;  1PC3 A;  2I49 A;  3IR1 A;  1MM7 A;  2OWS A;  2PYY A;  3C34 A;  4N4U A;  1SBP A;  4I9D A;  4WXJ A;  3I3V A;  3MP1 A;  4MF3 A;  3ILU B;  1VSO A;  4MNP A;  1LCT A;  1PBQ A;  1IMC A;  3PMX A;  5LDZ A;  5DVF A;  2O7I A;  4JDF A;  3PPR A;  2Z22 A;  4IO3 A;  4YB5 A;  4YB6 A;  2FVZ A;  3TCH A;  4YAH X;  1QUL A;  3K6X A;  2IA4 A;  2QVU A;  3CI8 A;  4Q8R A;  5AA1 A;  3K1M A;  4K3F A;  4LA9 A;  3ILT B;  5L8D A;  5J1D A;  1FPB A;  1XI6 A;  3OO7 A;  4OMB A;  5DEX A;  1PEB A;  3OO9 A;  3BIG A;  5DVJ A;  4DZ1 A;  3EHT A;  5IAI A;  4BDQ A;  4QF9 A;  1IUD A;  5ET5 A;  3K00 A;  4O3B A;  3E79 A;  3TCG A;  4KYD A;  1VFD A;  2F3D A;  4X04 A;  3DP6 A;  1SW1 A;  1SDX A;  3OO6 A;  1JET A;  2QMX A;  2OWZ A;  3HO7 A;  1MQD A;  2NUV A;  3IFC A;  4HCW A;  5AE4 A;  2BJJ X;  1OQH A;  3MZ1 A;  2E0S A;  1N84 A;  2ZXT A;  1Z7M E;  3T9V A;  3G3H A;  2HQ0 A;  2DDK A;  3C4M A;  1DTZ A;  4RYA A;  2OWT A;  1QGX A;  1ZTY A;  3FJ7 A;  1FJ9 A;  2V4C A;  1FW0 A;  4KXP A;  1UIU A;  3IOR A;  4F3B A;  1Y4C A;  3KSJ A;  3LSF B;  4KR5 A;  5ET7 A;  4QFK A;  3CRB A;  5EQ9 A;  3K01 A;  3M8U A;  3S4U A;  2AL4 A;  3ODB A;  1B3G A;  4U1O A;  1MH3 A;  1IQ7 A;  3EKI A;  3H3G A;  1WVJ A;  1R9Q A;  2CZK A;  4P3L A;  4OVR A;  3SEU A;  3UOR A;  2A5T B;  2Y5K A;  5HBC A;  4NF5 A;  2VT5 A;  3NOH A;  3SKP A;  4R6K A;  1B5I A;  3KN7 A;  4DXU A;  2VD2 A;  1B3L A;  1I69 A;  2XXY A;  4I8C A;  1JW4 A;  4H8J A;  4DLD A;  5I2N A;  2CEX A;  3EN3 A;  3SET A;  1KWH A;  1UQW A;  4GRK A;  1GTK A;  4NE4 A;  4RPN A;  4POX A;  4N15 A;  1G0H A;  3IOT A;  5BUU A;  1SW4 A;  3UP9 A;  5H8F A;  4F1Y A;  4WKM A;  3VE1 B;  4GXS B;  1SQY A;  1VFE A;  5JEI A;  5I7I A;  2F7C A;  3SZP A;  4ND9 A;  4DCY A;  1MXX A;  4C1U A;  5F24 A;  1OVB A;  2Y5L A;  2OCU A;  3QUJ A;  4IO5 A;  4OFJ A;  1N3X A;  3H03 A;  5I57 B;  4Q0C A;  4X8R A;  2D5W A;  3CFZ A;  4PBQ A;  2I6E A;  3DP8 A;  4G8M A;  1NV3 A;  1YPN A;  3TTN A;  4H67 A;  5FTI A;  1B3E A;  1B51 A;  1SYI A;  5F7V A;  5T3J A;  2DE2 A;  4YZZ A;  3FVO A;  4NF5 B;  1N7X A;  2UVG A;  1LBW A;  1H3D A;  4MBP A;  3FXU A;  2QPQ A;  2UYF A;  3TTR A;  1FBG A;  3FXB A;  4JWX A;  4RK9 A;  4NN3 A;  4GWY A;  4ZEI A;  3UA8 A;  1GV8 A;  3G7W A;  3B7D A;  2VP1 A;  3IAZ A;  3O97 A;  4NTL A;  3QK6 A;  3U72 A;  1URG A;  2NXO A;  3D1R A;  3OSR A;  1B7Z A;  2NVU B;  2F3B A;  4G68 C;  4UAC A;  4XIG Q;  2ZNS A;  5IM2 A;  2KQZ A;  1M5E A;  5ESY A;  1MQJ A;  2QS2 A;  4H5G A;  4H46 A;  5H8Q B;  3OO8 A;  5IZ3 B;  1I6Q A;  4P0G A;  3KZG A;  5EYF A;  5EHM A;  2LAO A;  4LZ7 A;  1LEV A;  2ZZW A;  2GH9 A;  1A8F A;  4NF8 B;  3DEL B;  2QS1 A;  4PFT A;  4KYS A;  3L6G A;  3FIR A;  3FVG A;  2OZZ A;  1CNQ A;  1EYK A;  5K2Y A;  4HCY A;  3MYU A;  2H99 A;  5I56 B;  4KCD A;  2ONS A;  4P1L A;  3C36 A;  1RDY A;  4MNI A;  3G3K A;  1FRP A;  3E3K A;  1OMP A;  4AQ4 A;  4KPT A;  3T1B A;  1N76 A;  4R72 A;  1Y4T A;  3MVZ A;  1US5 A;  4YU0 A;  3FD3 A;  2PFY A;  4ZEF A;  1POT A;  4OAN A;  4F18 A;  5ITO A;  1FPF A;  2FIE A;  2XXU A;  3E78 A;  3MVX A;  3W9V A;  1PB8 A;  4F1V A;  4TOZ A;  1ZIU A;  3VLV A;  1USY E;  4QRZ A;  1MQH A;  4PE3 A;  4ZED A;  5I59 A;  2I58 A;  3ZKL A;  2VGQ A;  4DI4 B;  2FHY A;  4U1Z A;  3KBZ A;  4OFL A;  2ZZV A;  3EQ1 A;  4LUB A;  3KOT A;  1B32 A;  2XWO A;  4FEB A;  4WEP A;  2Q9T A;  2GFE A;  2O51 A;  4XKN A;  4ZEK A;  3LR1 A;  1RDZ A;  1WDN A;  3MQ9 A;  4ZEC A;  3IJO B;  1Y3P A;  1B3H A;  4MNC A;  1ZLQ A;  4R6Y A;  1TWY A;  1T0K A;  1IMD A;  1LST A;  2VOZ A;  2I3V A;  3MAM A;  4QSE A;  4NF4 A;  3KFM A;  3M3L A;  4N6D A;  3UK4 A;  1TT1 A;  1US4 A;  4G4P A;  1FTA A;  3Q25 A;  2V3Q A;  3VVF A;  4OEU A;  5IKB A;  4TLM B;  1VR5 A;  3OOA A;  3MPK A;  1O63 A;  3Q28 A;  2P1S A;  3O66 A;  1NNP A;  2GRV A;  4NWD A;  3IOV A;  3KJT A;  5LOM A;  4KHZ E;  1DOT A;  3VV5 A;  4FE8 A;  2ZYO A;  1Y3N A;  5H8F B;  2O7U A;  2HCA A;  1B4H A;  4NWC A;  5H8H A;  4JWO A;  4XKP A;  4OEN A;  3UN6 A;  4IGT A;  4NGU A;  1N0T A;  2A5T A;  1S9T A;  1B3F A;  4ZE8 A;  2P3N A;  3U8Q A;  5ELV A;  3B6Q A;  5AA4 A;  4N8Y A;  1UTB B;  1CB6 A;  5TPA B;  2XWI A;  4H1X A;  5J16 A;  3IJX B;  5KCJ B;  3E9X A;  4HE1 A;  1SYH A;  3PMW A;  1RYO A;  5I5P A;  1IXH A;  3FAT A;  4OQO A;  4C0R A;  1QUK A;  2V25 A;  1INP A;  5I56 A;  1EZ9 A;  3UGW A;  3RY3 A;  1K9Y A;  4UA8 A;  1FTO A;  4PAK A;  1NV6 A;  4PF8 A;  5CMC A;  5IZ1 A;  3MZB A;  3MUQ A;  2O1L A;  2B3B A;  1B46 A;  4HW8 A;  4YMA A;  3MWB A;  2KR0 A;  3R6U A;  4FBP A;  2R71 A;  1URD A;  5CM6 A;  3A3U A;  1MRP A;  2Q2C A;  1AOV A;  3M3K A;  3FVN A;  4IO2 A;  1FBP A;  4GWU A;  1R1N A;  3BIH A;  2I4B A;  2X26 A;  4NED A;  5DVI A;  3LSX A;  3MZ9 A;  3TPA A;  4XKR A;  2DWJ A;  1B1H A;  2H4I A;  2QJE A;  4NG7 A;  1DMB A;  4DE8 A;  4F1U A;  1DCU A;  1LLS A;  3C35 A;  4Z0I A;  4P11 A;  4F2Q A;  5EYG A;  2OJT A;  3HCQ A;  3IFA A;  4GBW A;  4JBZ A;  5TP9 A;  4PFU A;  3PD8 A;  4YIC A;  2PFZ A;  5ICQ A;  2RC9 A;  3S9L C;  1KA0 A;  4GLI A;  4F3P A;  4BLA A;  2H98 A;  3MW0 A;  4NF6 A;  4KI0 E; 
#chains in the Genus database with same CATH homology
 3FV1 A;  3IL1 B;  1AL3 A;  4QHQ A;  4R6K A;  1B5I A;  3KN7 A;  3LUY A;  2VD2 A;  1M5B A;  1B3L A;  4Q30 B;  1OVT A;  2XXQ A;  3RT8 A;  4DXU A;  1MY4 A;  1OLA A;  1P1Q A;  1S50 A;  1I69 A;  1MM6 A;  2XXY A;  2NOO A;  3H7M A;  3O9P A;  4I8C A;  1MH4 A;  4R74 A;  4RK2 A;  1ZU0 A;  1JW4 A;  4H8J A;  4DLD A;  1JW5 A;  5CBS A;  5I2N A;  5FHN A;  4RY1 A;  5CMB A;  1SW5 A;  1MQI A;  3EN3 A;  1P1U A;  1R6Z A;  4BDM A;  3SET A;  3TMG A;  1DPP A;  1SD3 A;  3GBB A;  1URS A;  1KWH A;  1UQW A;  2DP8 A;  1GTK A;  2G93 A;  3OXN A;  4GRK A;  2XD3 A;  4NE4 A;  2THI A;  3MBP A;  4OET A;  4POX A;  4RPN A;  3W9W A;  1FQE A;  3MPL A;  3VXB A;  1M5D A;  3IOT A;  4IGR A;  1MY3 A;  2KLF A;  3E13 X;  1AMF A;  1B7H A;  3HN0 A;  2DWI A;  1SW4 A;  1XT8 A;  2HAV A;  2W7Y A;  4GF8 A;  4KYE A;  5F1Q A;  3Q26 A;  3OEK A;  4OFO A;  3O28 A;  1OLC A;  3UP9 A;  5H8F A;  1I6A A;  2OK2 A;  3SEY A;  1NL5 A;  3H6V A;  4KQP A;  1BIY A;  4JB7 A;  4RA1 A;  3ZSF A;  1MG1 A;  3BBR A;  4F1Y A;  4WKM A;  1A99 A;  2DS9 A;  3VE1 B;  5M2V A;  1JEV A;  4GXS B;  1SQY A;  1VFE A;  4FED A;  5JEI A;  4ZZA A;  2F7C A;  1HSL A;  1N04 A;  1B9J A;  3A09 A;  3BFU A;  3IB1 A;  1MXX A;  3O6H A;  4H65 A;  3O2A A;  4ND9 A;  4LZ8 A;  4DCY A;  2O6A A;  4C1U A;  1B7U A;  3T9H B;  1P1O A;  4JXI A;  1OVB A;  3C33 A;  1QJM A;  2OCU A;  3QUJ A;  1DPE A;  2QL3 A;  4IO5 A;  3FV2 A;  3SEX A;  4BDN A;  5ITP A;  2FA7 A;  4OFJ A;  3JYR A;  1N3X A;  1NH8 A;  4OZ9 A;  4P0I A;  2XX9 A;  3H03 A;  3TFL A;  5I57 B;  3VVD A;  4Q0C A;  5CI5 A;  3RQT A;  5DEX B;  3IB2 A;  1Z7N E;  2D5W A;  2UVJ A;  3CFZ A;  4IB2 A;  4DDD A;  2ONK E;  2I6E A;  2YJP A;  4F3S A;  4G77 A;  3DP8 A;  3EHS A;  4G8M A;  1TFD A;  1A8E A;  1YPN A;  1PB9 A;  3TTN A;  3OMB A;  3SES A;  2V84 A;  4H67 A;  4HS7 A;  5FTI A;  4FIM A;  1B3E A;  1B51 A;  1SYI A;  2ESN A;  2HZK A;  4MFI A;  3QAX A;  3FJM A;  2ANJ A;  1XS5 A;  2DE2 A;  4PQJ A;  4THI A;  3KSX A;  3M3F A;  3GZG A;  2HXW A;  4O3C A;  3GLB A;  4YZZ A;  4ESX A;  3FVO A;  2RC7 A;  3B6W A;  2D3I A;  3LC8 A;  2ONR A;  4EQB A;  2Y84 A;  1BKA A;  1N7X A;  3FGS A;  4NF5 B;  4X1B A;  1NMU A;  1P99 A;  1RKM A;  3ZS6 A;  4GIZ A;  2UVG A;  1MXU A;  3KOS A;  1A7L A;  2AIX A;  4LQ5 A;  1II5 A;  5F7V A;  1H3D A;  2QSX A;  3DM0 A;  3OEM A;  3TQW A;  2Y7R A;  3H6U A;  1OQG A;  3H6W A;  2RF1 A;  1YTV A;  3UIF A;  1B05 A;  2XXI A;  3PPQ A;  2CMO A;  4MBP A;  3FXU A;  4OWD A;  1BLF A;  2QPQ A;  1Q1K A;  2UYF A;  1MY1 A;  1SI1 A;  2ZNU A;  3HPI A;  4U22 A;  3TTR A;  3ZKK A;  1B0L A;  4H8I A;  5AA3 A;  4JWX A;  4PET A;  3PUV E;  1IIT A;  1B5J A;  4RK9 A;  4LAT A;  4N6P A;  4ZEI A;  3FAS A;  3K4U A;  1BTJ A;  3UA8 A;  3MVW A;  2HAU A;  1GV8 A;  5JK4 A;  1IIW A;  1UIV A;  1LAG E;  5FTH A;  5BUU A;  4JWY A;  3G7W A;  1D9Y A;  1UTH A;  3HV1 A;  3B7D A;  5A5X A;  2VP1 A;  3N6U A;  5HM4 B;  1FQD A;  3IAZ A;  3O97 A;  4ISU A;  4TLL B;  3N5L A;  3PU5 A;  4YKP A;  3CSG A;  4NTL A;  1EU8 A;  3QK6 A;  5I2N B;  4LQ2 A;  2DE3 A;  3R26 A;  4X48 A;  3U72 A;  1NH7 A;  1URG A;  2DWA A;  3HHG A;  2NXO A;  2ZYM A;  1B5H A;  3MW0 A;  2ABH A;  2ZYN A;  4I62 A;  3OSR A;  5H8N A;  1B7Z A;  2F34 A;  4XTC Q;  4R9G A;  3TQL A;  1L5T A;  4U4X A;  2NVU B;  1XVY A;  2P2A A;  1D4N A;  2F35 A;  2I0B A;  2F5X A;  2PMS A;  4G68 C;  1MDQ A;  4R73 A;  4UAC A;  3KGC A;  4XIG Q;  1FQA A;  5BWJ A;  2ZNS A;  2PX1 A;  4AB6 A;  2Y7K A;  4EQ7 A;  1XHY A;  1B0H A;  1IZ1 A;  2I0C A;  3C32 A;  3PUY E;  3TCF A;  5ISU A;  4ONY A;  2DVZ A;  3I5O A;  3JV9 A;  5I57 A;  1Y9U A;  2RC8 A;  4ECF A;  1RYX A;  1USY H;  3K1P A;  1QVS A;  1FTL A;  2CZL A;  2XXW A;  4I1D A;  4IO7 A;  4GQO A;  2XXR A;  5AA2 B;  3S9E A;  4YB7 A;  3PUZ E;  5HPQ A;  2REG A;  4R2B A;  1XVX A;  3RUM A;  4X1D A;  1M5E A;  3TDJ A;  3SEV A;  4NF4 B;  1MQJ A;  4PE5 B;  1LFG A;  2QS2 A;  4H5G A;  5H8Q A;  2ZYK A;  4XXU A;  2ZNT A;  4G8N A;  3OEN A;  2I48 A;  4ZE9 A;  5DYH A;  2QRY A;  3BFT A;  3FXQ A;  2B3F A;  4O3A A;  3OO8 A;  1DSN A;  4G8H A;  5H8Q B;  3CSB A;  1I6Q A;  3OD7 A;  5JTY A;  4P0G A;  1MDP 1;  1LB9 A;  2DXY A;  3ECR A;  2F6G A;  3KZG A;  1O7T A;  1SVX B;  2XX7 A;  3PUW E;  2HZL A;  1Y20 A;  2Z8E A;  4KD5 A;  2O69 A;  3V5A A;  5EYF A;  1JVY A;  4F3G A;  1JQF A;  3W15 C;  3TUS A;  3DP4 A;  3LSL A;  2UXA A;  4G68 B;  1MY2 A;  3IB0 A;  3K6U A;  3N94 A;  4DXC A;  5EHM A;  2LAO A;  4LZ7 A;  1XC1 A;  3PPN A;  2I4C A;  2GH9 A;  3R7X A;  1A8F A;  4NF8 B;  3DEL B;  3TAJ A;  5CRY A;  4EXL A;  2AYS A;  1GGG A;  2QS1 A;  1MXY A;  2DYX A;  3KJ7 A;  4PFT A;  4KYS A;  3RPW A;  3L6G A;  4RPO A;  5L9S A;  3H6T A;  1HSE A;  3TKD A;  3FIR A;  4PFW A;  1LCF A;  1LBC A;  4OES A;  2ALU A;  3FVG A;  1NNF A;  2OZZ A;  2XD2 A;  3P7I A;  1F9B A;  3K1N A;  5K2Y A;  4HCY A;  4FEC A;  2YLN A;  1QKA A;  1LAX A;  2H99 A;  3EPE A;  3N6T A;  4H6D A;  3VDF A;  4R2F A;  5I56 B;  5I84 A;  5DT6 A;  3KN3 A;  4KCD A;  2OLB A;  3H4Z A;  2ONS A;  3CVG A;  3TTK A;  5I58 B;  1ELJ A;  3MVY A;  3C36 A;  4GD5 A;  2P0S A;  4MH5 A;  2Q2A A;  1FCK A;  1NNT A;  3RT6 B;  3T22 A;  4YKI A;  1LAF E;  3G3K A;  1GR2 A;  2Q88 A;  1AH5 A;  3V83 A;  3E3K A;  4POW A;  3VXC A;  3T9U A;  1OMP A;  3T9X B;  4OHN A;  4AQ4 A;  4QFL A;  2HEU A;  1MQG A;  2I3W A;  4H5F A;  4KPT A;  1EH3 A;  2NWJ A;  4X9T A;  4HTG A;  4GOT A;  1N76 A;  2VD3 A;  4YKJ A;  4R72 A;  1Y4T A;  2X7P A;  5AA2 D;  3MVZ A;  1TXF A;  4F22 A;  3F11 A;  4GL8 A;  1B1X A;  1US5 A;  5ICT A;  4YU0 A;  2O84 X;  2Y7W A;  1LB8 A;  3FD3 A;  5TU0 A;  1R9L A;  4ZEF A;  4F31 B;  1B40 A;  1H76 A;  1POT A;  3CIJ A;  1FQC A;  3RTW B;  4ZS9 A;  1IXI A;  5KDT A;  4F18 A;  3AXF A;  2GHB A;  4IO6 A;  5ITO A;  1SI0 A;  2RIN A;  2A5S A;  2O1M A;  3KG2 A;  3IK6 B;  2XXU A;  2DVC A;  5KCJ A;  3MVX A;  5B70 A;  3TZA A;  2H25 A;  3W9V A;  3G3J A;  1PB8 A;  5EHS A;  5I2K A;  2Y7I A;  2Q89 A;  2D21 A;  2ZMB A;  4EF1 A;  2V93 A;  5CMM A;  2F7A A;  4F1V A;  5CMK A;  4C1T A;  4PFY A;  2RCB A;  2UVH A;  4TOZ A;  3VLU A;  4DXB A;  3G3G A;  1ATG A;  5L9M A;  4BDL A;  4NMY A;  4OTE A;  3K0V A;  1A55 A;  1J1N A;  4RNS A;  3S2V A;  4DIG A;  4EDP A;  4BDR A;  4GVO A;  1ZIU A;  3OSQ A;  3B6T A;  1USY E;  3VLV A;  3U92 A;  2F7B A;  3RTF B;  3Q27 A;  4MLV A;  4OEV A;  5FHO A;  1YCJ A;  4QRZ A;  4F2O A;  1EZO A;  4R9F A;  1MQH A;  2AL5 A;  3U94 A;  3G3F A;  4GXA A;  4BDO A;  3CG3 A;  2HFB A;  3VFJ A;  4GFR A;  5K2X A;  3U93 A;  4ZED A;  3LSW A;  1D9V A;  3TEP A;  3G3I A;  2I58 A;  3ZKL A;  5I59 A;  2VGQ A;  1N3W A;  1MXW A;  2FYI A;  4U1Z A;  3FZV A;  3IO4 A;  4OFL A;  3U1O A;  1XOC A;  3GBA A;  3OEL A;  4M4G A;  1SW2 A;  4N07 A;  2Z8D A;  3EQ1 A;  1N7W A;  3DLN A;  4LUB A;  2PT1 A;  1FQB A;  3EHU A;  4NF6 B;  1NFT A;  3KOT A;  3PUX E;  1JEU A;  3TOD A;  2REJ A;  5AA4 B;  1B32 A;  3QXM A;  5H8H B;  5I58 A;  4WED A;  4IY5 A;  4FAT A;  1H45 A;  3THI A;  1FTM A;  2F6P A;  2F8D A;  3FVK A;  4PP0 A;  4FEB A;  1QKB A;  2G29 A;  1JVX A;  3SER A;  1UTB A;  2UVI A;  4WEP A;  1OIB A;  1IXC A;  2Q9T A;  2GFE A;  1LAH E;  2O68 A;  3D4G A;  1ZJL A;  2O51 A;  4JSO A;  3TTL A;  3JZJ A;  4XKN A;  2FNC A;  4ZEK A;  4QFO A;  4YKK A;  1JNF A;  3LR1 A;  4Q5T A;  4Z7E A;  3WAE A;  3O6G A;  3TEL A;  4DCX A;  4XKQ A;  1WDN A;  3MQ9 A;  2QMW A;  4RJZ A;  4ZEC A;  2X7Q A;  1POY 1;  3IJO B;  1PC3 A;  1B3H A;  1Y3P A;  2RCA A;  3PD9 A;  3C9H A;  1ZLQ A;  4GWO A;  3T66 A;  2I49 A;  3IR1 A;  3MJN A;  4L17 A;  4R6Y A;  4KCC A;  1P1N A;  1TWY A;  1QUI A;  3K02 A;  1FTK A;  1LST A;  3RLF E;  3RNN A;  1T0K A;  1MM7 A;  2VOZ A;  3FXR A;  2I3V A;  1PBP A;  2R9J A;  2XXX A;  3VLW A;  3I6V A;  4YMB A;  3MAM A;  2OWS A;  4QSE A;  4R6H A;  2PYY A;  3V8X B;  3KEI A;  4NF4 A;  4AB5 A;  3C34 A;  3KFM A;  3M3L A;  4FOR A;  2M8C A;  5KZT A;  3UK4 A;  1TT1 A;  4N13 A;  1US4 A;  1SBP A;  4U2R A;  5B7D A;  4I9D A;  4G4P A;  4ESW A;  3Q25 A;  1PB7 A;  1WOD A;  1Q35 A;  2Y7P A;  4WXJ A;  5DTB A;  4GL0 A;  2V3Q A;  3I3V A;  4FAJ A;  3MP1 A;  3VVF A;  4OEU A;  1TFA A;  1Y3Q A;  1VE4 A;  1QW0 A;  3L6H A;  4TLM B;  2DWH A;  5IKB A;  1VR5 A;  1ZKB A;  4M1V A;  1LFH A;  2QS4 A;  4MF3 A;  3OOA A;  3MPK A;  3ILU B;  3K6W A;  1VSO A;  4G68 A;  4LON B;  1LCT A;  1O63 A;  1PBQ A;  2OBG A;  3QSL A;  3RN8 A;  5H8N B;  3Q28 A;  3PMX A;  2P1S A;  3O66 A;  3USD A;  1NNP A;  2GRV A;  5DVF A;  4NF8 A;  1IXG A;  2O7I A;  3IX1 A;  1AIV A;  3QIM A;  2PBW A;  4NWD A;  3BKI B;  3IOV A;  3KJT A;  4JDF A;  1UTH B;  5LOM A;  2XXT A;  3PPR A;  3PPP A;  2Z22 A;  4H0W A;  4IO3 A;  4KHZ E;  1DOT A;  4TQU Q;  4YB5 A;  4FE8 A;  3TTM A;  2H9B A;  3VV5 A;  3VVE A;  2XX8 A;  2ZYO A;  1Y3N A;  3KBR A;  1DTG A;  1O64 A;  4YB6 A;  3S9N C;  1H43 A;  4U21 A;  1Y1Z A;  1P1W A;  4FJP A;  2O7U A;  4YAH X;  1QUL A;  2HCA A;  5H8F B;  3TCH A;  1B4H A;  2YPN A;  4NWC A;  3K6X A;  2R6G E;  5H8H A;  1B4Z A;  2IA4 A;  4JWO A;  5TPA A;  3V89 B;  4XKP A;  2DQV A;  3PMV A;  3CI8 A;  5I59 B;  1A40 A;  4OEN A;  1FQF A;  3PPO A;  3FUZ A;  3UN6 A;  4IGT A;  5AA1 A;  3E4R A;  5TP9 B;  3KN8 A;  4Q8R A;  3K1M A;  2DOJ A;  3IOW A;  4K3F A;  4ELP A;  1N0T A;  4LA9 A;  3ILT B;  5L8D A;  5J1D A;  2A5T A;  1S9T A;  2DSF A;  1B3F A;  3ONM A;  3T96 B;  4ZE8 A;  1MPC A;  3U8Q A;  5ELV A;  3OO7 A;  3B6Q A;  2PT2 A;  4OVJ A;  4OMB A;  5AA4 A;  2DE4 A;  5DEX A;  1GVC A;  1LFI A;  3T93 B;  1ANF A;  1MPD A;  1PEB A;  1UTB B;  3OO9 A;  1CB6 A;  4U23 A;  3MP8 A;  5TPA B;  3C31 A;  4H1X A;  2XXH A;  1QUJ A;  3SEW A;  2F36 A;  3A3C A;  3IJX B;  3PV0 E;  5DVJ A;  3E9X A;  1NNK A;  4EXK A;  5AA2 A;  2UYE A;  5H8S A;  4DZ1 A;  5KCJ B;  3EHT A;  5JTY B;  1SYH A;  5IAI A;  4BDQ A;  3PMW A;  1RYO A;  4QF9 A;  1IXH A;  4E0X A;  1HSJ A;  1JW1 A;  1IUD A;  1LBB A;  3FAT A;  3IOU A;  4OQO A;  4C0R A;  3K00 A;  1M5F A;  4EUO A;  1QUK A;  3D4C A;  2V25 A;  4O3B A;  3S9M C;  3CR9 A;  5I56 A;  1EZ9 A;  2XXV A;  3TCG A;  4QFP A;  2B65 A;  4KYD A;  4E0W A;  1VFD A;  3UGW A;  3RY3 A;  1BP5 A;  4ELO A;  1H44 A;  4UA8 A;  3DP6 A;  4IY6 A;  1FTO A;  3WAF A;  4OXV A;  5CC2 A;  1A54 A;  3SDF A;  3CFL A;  5CMC A;  1S7Y A;  2IEE A;  3MZB A;  3Q29 A;  3MUQ A;  1SW1 A;  1SDX A;  2O1L A;  1JET A;  2B3B A;  1B52 A;  1B46 A;  2QMX A;  3OO6 A;  4U4S A;  3RGY A;  4HW8 A;  4YMA A;  3MWB A;  2E1S A;  1MQD A;  3HO7 A;  4ELQ A;  3R6U A;  2NUV A;  1CE2 A;  3FJG A;  2GHA A;  2R71 A;  1MXV A;  4F29 A;  1URD A;  5CM6 A;  3A3U A;  4F19 A;  3K6V A;  1MRP A;  2XHD A;  4HCW A;  2F97 A;  2PVU A;  3K2D A;  5AE4 A;  2BJJ X;  2Q2C A;  3O29 A;  3MC2 A;  1OQH A;  1Y1M A;  3MZ1 A;  4ZZE A;  4JSD A;  1AOV A;  2E0S A;  2V3U A;  3M3K A;  2Q8J A;  3FVN A;  4IO2 A;  1N84 A;  4LVQ A;  4OYV A;  3TYH A;  2ZXT A;  1NKX A;  1R1N A;  1Z7M E;  4QFN A;  3PGF A;  3T9V A;  4F39 A;  3G3H A;  2HQ0 A;  2H5Y A;  2XXP A;  2I4B A;  3C4M A;  5CBR A;  2X26 A;  1B6H A;  4RXL A;  4NED A;  5DVI A;  3LSX A;  1DTZ A;  3MZ9 A;  3TPA A;  2OWT A;  4RYA A;  4XKR A;  2DWJ A;  1ZTY A;  1PDA A;  2QS3 A;  1B1H A;  3FJ7 A;  3HHF A;  4LP2 B;  5I2K B;  1MXZ A;  1EZP A;  3CFX A;  2H4I A;  1FW0 A;  2F78 A;  1UIU A;  1I6B A;  4IO4 A;  3IOR A;  2QJE A;  4MLQ A;  4F3B A;  3MP6 A;  1FTJ A;  1Y4C A;  3KSJ A;  2Z23 A;  1MY0 A;  1DMB A;  3LSF B;  3LBS A;  4ZEB A;  4DE8 A;  4F1U A;  4KR5 A;  1LLS A;  1ZMG A;  4EF2 A;  5A5X B;  4QSD A;  1YAE A;  4QFK A;  2V3T A;  3C35 A;  1B58 A;  3CRB A;  4Z0I A;  1D3K A;  3GXA A;  4P11 A;  4ELR A;  4F2Q A;  4ZDM A;  5KDT B;  5L9O A;  4QSC A;  5FHM A;  3K01 A;  3M8U A;  2OJT A;  3S4U A;  2AL4 A;  3ODB A;  4KFQ A;  1B3G A;  3EF7 A;  1MH3 A;  3HCQ A;  1IEJ A;  4U1O A;  4EQ9 A;  1IQ7 A;  4JBZ A;  2WKY A;  3H3G A;  3QYT A;  2RKM A;  1MS7 A;  3HST A;  5TP9 A;  4OER A;  3PD8 A;  1WVJ A;  1R9Q A;  4PFU A;  3SKP A;  4YIC A;  5ICQ A;  4LZ5 A;  2RC9 A;  3S9L C;  1LGB C;  3H06 B;  3SEU A;  3IO6 A;  4R75 A;  3O6I A;  3UOR A;  2A5T B;  2DXR A;  2VHA A;  3QUF A;  1B2H A;  4GLI A;  5HBC A;  4NF5 A;  3CG1 A;  4F3P A;  3N26 A;  4G2Z A;  2Z8F A;  4BLA A;  1ZBM A;  2H98 A;  1MPB A;  1M5C A;  4NF6 A;  4KI0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...