5A5XA

Crystal structure of se-met mltf from pseudomonas aeruginosa
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
420
structure length
420
Chain Sequence
RVQKEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFTQHLQQRLPRYESHFKQSGKQKDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE F
publication title Activation by Allostery in Cell-Wall Remodeling by a Modular Membrane-Bound Lytic Transglycosylase from Pseudomonas aeruginosa.
pubmed doi rcsb
total genus 138
structure length 420
sequence length 420
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5a5xA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5a5xA02
1OQGA 4OZ9A 1O7TA 4U1ZA 4ZZEA 1IXIA 4M1VA 3TEPA 1SW1A 4OYVA 2PYYA 3USDA 1PDAA 1N7XA 1D9YA 2DQVA 1M5BA 3IORA 1M5DA 3V83A 1SQYA 2IEEA 3OO6A 3RGYA 3H7MA 4BDLA 3TTLA 3MPKA 1NNKA 3PPOA 1PB9A 1ELJA 4O3CA 3DP8A 3RTWB 3OELA 2UXAA 1MXWA 4GF8A 2AL4A 4OQOA 5K2XA 2O69A 4IO7A 3SESA 3JYRA 3IJOB 4IO2A 3PV0E 2V93A 1YCJA 1I6AA 1DOTA 4UA8A 4BDNA 1EZ9A 3OEKA 2UVHA 5FHMA 3KEIA 1S7YA 3FATA 4G2ZA 2D21A 1AH5A 1SYIA 1M5CA 1IUDA 4NWCA 1XC1A 4NF5A 1P1WA 1B3LA 1ANFA 1B0HA 3HHGA 3O66A 3R26A 5H8QB 2A5TA 1JVXA 4EQBA 3IB2A 3QSLA 2ABHA 4DXUA 4F1UA 1OVBA 4FEDA 2O6AA 1RYXA 4ELPA 4NF8A 4C1TA 1IZ1A 3EPEA 4RNSA 2XXHA 5L8DA 4LATA 1QUJA 5I2NB 4PQJA 2D3IA 4G8HA 3O6HA 3HPIA 1HSLA 3FUZA 1MY3A 1FQCA 3K6UA 3LSWA 3RY3A 3SEUA 2XX7A 3UORA 3VLUA 1DTZA 4LVQA 5F7VA 2ZNTA 3KN8A 3IX1A 4RPOA 4NF4B 2HAVA 4FECA 3TYHA 1VE4A 4OFLA 3V5AA 3TQWA 5L9SA 4MFIA 1EU8A 5HM4B 3B6WA 3BKIB 2X7PA 1BLFA 2REJA 3T66A 4P0GA 4ZZAA 1S9TA 1UTBA 1FTOA 3CSBA 5TPAA 2XXXA 4YKPA 4QFOA 2UYEA 1A55A 2HEUA 3BBRA 2RC8A 1POY1 3S9EA 2ZYOA 1OMPA 4GOTA 3KFMA 5I2KB 5I59B 1MG1A 5AA1A 5DVFA 2M8CA 2RINA 3DP4A 4H0WA 3HHFA 1MQGA 1D3KA 3HSTA 2NUVA 3MJNA 4K3FA 3BFTA 4QRZA 3H6WA 1IEJA 4LP2B 1HSEA 4R75A 4EQ9A 1MQHA 4BDRA 3SEYA 1MH3A 5TP9B 3SEVA 2OLBA 3ZKLA 2UVGA 2IA4A 3KN3A 4ZE8A 1PB8A 3G3GA 3CFZA 2RF1A 5DVJA 3CG1A 3TCFA 5IAIA 4R73A 5CM6A 4LZ5A 3W9VA 3HN0A 1UIVA 3CIJA 1OLAA 4XKQA 3TKDA 4E0XA 4WKMA 3KZGA 4OENA 4KYSA 3C32A 1QULA 3ODBA 3TDJA 5B70A 3PUXE 2XX8A 3KSXA 1SW4A 2O51A 2LAOA 3LBSA 4G68B 1SI1A 4DE8A 3UK4A 1B5JA 1LAXA 3M3FA 1FQAA 2ESNA 2ONSA 2HZKA 3A3CA 1ZJLA 4YB6A 4X1BA 4XTCQ 3OO9A 3RN8A 1B7HA 4ZDMA 1T0KA 1USYE 1LAFE 2DE4A 4BDMA 1R9QA 3K00A 2HFBA 1A8FA 4ZECA 2QS4A 4KI0E 3PUYE 3O28A 4O3AA 3H6VA 3VXBA 1H43A 1AIVA 2DXYA 4IB2A 1AOVA 3KN7A 1MXVA 4EF2A 3U8QA 5IKBA 2I4CA 2VHAA 4IO3A 4DZ1A 1UTHA 4LUBA 1Q1KA 1R6ZA 3OO7A 2PVUA 1FCKA 2H25A 3TTRA 4H65A 3N6UA 2UVIA 1P1QA 4JWOA 5CC2A 5CBRA 4KYDA 3IB0A 3UIFA 4GIZA 1FTMA 3FIRA 5EHMA 4NE4A 1US4A 3FJMA 2YPNA 3GBBA 4R9GA 3CVGA 3K4UA 1Y3PA 3PD9A 2BJJX 1WODA 5H8NB 3PPQA 5KDTA 3THIA 1NH8A 1LBBA 3IOWA 3DELB 1A7LA 3FZVA 1MPDA 3N6TA 1JQFA 1TFAA 4KD5A 5AA2D 5ELVA 5DYHA 2DVZA 5CMKA 3KSJA 3FV1A 2CZLA 1MDP1 4ND9A 4QF9A 3E9XA 1MY0A 2O7UA 3Q26A 4OETA 5ICTA 1NH7A 2GHAA 3T93B 2O7IA 1MQJA 3UN6A 4JDFA 4ISUA 3MAMA 2QRYA 2VOZA 4KCCA 3C35A 4TLLB 3PMVA 2P1SA 3D4GA 3M8UA 1I69A 3B6TA 2QL3A 3CSGA 3S9LC 4U21A 5KCJA 4OHNA 2OBGA 3K1PA 3RLFE 4JBZA 2H99A 3E3KA 2ZMBA 4DCYA 3MPLA 1GTKA 4NTLA 4H1XA 5JTYB 2Z23A 4G68C 4R9FA 2A5TB 2XXYA 4MLVA 1Y1MA 4F1VA 2Y7WA 3OD7A 2YJPA 3VLWA 3TQLA 4C0RA 3FV2A 4BDOA 1N3WA 4H6DA 3EN3A 4GRKA 4C1UA 3D4CA 3Q27A 2OWTA 4KQPA 2YLNA 3TODA 3O2AA 3O97A 3FVOA 1R1NA 1MRPA 1A54A 2PX1A 2GH9A 1A8EA 2DVCA 4UACA 4YKJA 1O64A 1SYHA 2ZYNA 1POTA 3ZSFA 4PFTA 4MLQA 4BLAA 4FJPA 2FA7A 4OTEA 1N84A 4EQ7A 3HV1A 3HO7A 3H3GA 5JEIA 2I6EA 2KLFA 3FVNA 4HCYA 2CMOA 2Y7RA 2Q8JA 2XD2A 3PPPA 3PGFA 4F19A 5DT6A 1MM6A 4ELRA 3FASA 3W9WA 1MPBA 4Q5TA 1FW0A 3N5LA 1Y20A 2I3WA 1B4ZA 4PFUA 3VXCA 1B0LA 5TPAB 2A5SA 1P1UA 4RA1A 2QPQA 3R7XA 4THIA 1XVXA 1EZPA 4F29A 4YMBA 1N3XA 1LAHE 4FE8A 3TTNA 1QJMA 4X1DA 2NXOA 1D9VA 1DPPA 3QIMA 5H8HA 3PPRA 3S9NC 2I58A 3WAEA 1LB9A 4JSDA 4OEUA 1OLCA 3S2VA 1LB8A 1PB7A 3OO8A 3QUJA 1OQHA 2XXPA 4GXSB 3UA8A 2H9BA 5H8FA 3IAZA 1P99A 1B3EA 1L5TA 3OSQA 1MXZA 1XHYA 3SETA 1Y4TA 4JB7A 2RCAA 2H4IA 2XXUA 5A5XA 4XXUA 1P1OA 4U2RA 2Q88A 3CFXA 1MXXA 4PP0A 5I57A 4IO5A 4U4XA 5HPQA 5I56A 4N07A 1ZU0A 2Z8FA 4U23A 3S4UA 1LSTA 2DYXA 2VGQA 5M2VA 4OEVA 2XXRA 4OERA 4DDDA 3K02A 1RKMA 2W7YA 3FXRA 2V25A 4GWOA 3MZBA 4JWYA 2G29A 1IXHA 4YB5A 3RTFB 3MP6A 3E4RA 3V89B 4LQ5A 1IXCA 3U93A 3LUYA 2NWJA 4EXLA 2VD3A 5AA4B 2AL5A 3G7WA 3TAJA 4LZ8A 5I58A 1Y3QA 2XXIA 1JW4A 3LR1A 4MF3A 3OEMA 1UQWA 1VFEA 2OWSA 1B5HA 3OSRA 2GFEA 3PUVE 1LLSA 1B51A 1B2HA 3QK6A 3MVZA 1B52A 3G3HA 4GLIA 1B3GA 1B7UA 4P0IA 1LFIA 1JVYA 3IR1A 2O84X 1PBPA 5I84A 4GQOA 1SD3A 5DEXB 3LSLA 3MP8A 1N04A 2F6PA 2DE3A 1NKXA 3K6VA 2XXWA 4NMYA 2Z8EA 2FNCA 1ZBMA 2F7CA 3KOTA 1XOCA 3VV5A 3TPAA 1IIWA 1JETA 2DWAA 2F78A 1XS5A 1MY1A 4ZS9A 3RNNA 1N76A 4GD5A 4H5GA 4U4SA 5KDTB 2V84A 3GXAA 3K1MA 2ZXTA 2XX9A 2P2AA 3E13X 3T9HB 1DMBA 3G3KA 2O1LA 4ELOA 1II5A 1MY4A 1ZMGA 3IO4A 1QVSA 5FHNA 1H45A 2P0SA 3ONMA 4M4GA 4OESA 2Q2CA 1XT8A 5F1QA 2FYIA 2R71A 4HS7A 2H98A 2G93A 1MQIA 2Y7IA 1FTKA 4MBPA 1B46A 3ILTB 2DXRA 1CB6A 1JW5A 3KJTA 4OMBA 1MM7A 2ONKE 4H67A 1F9BA 1TFDA 4WEPA 3K2DA 4ONYA 3MBPA 1GVCA 2DWHA 2Z22A 1B3FA 2Z8DA 4RY1A 2GRVA 1JNFA 1URGA 3L6GA 2Y7PA 5KCJB 3TCHA 3MWBA 1B05A 4WEDA 2I48A 3Q25A 1MDQA 3TTKA 2RCBA 4YZZA 3MC2A 4JXIA 4IY5A 5ICQA 1MXUA 4LONB 3MVYA 5J1DA 3U72A 3TELA 5EHSA 1QW0A 4YU0A 3I3VA 2OK2A 3OMBA 4DIGA 1SDXA 3TTMA 1QKAA 1SVXB 2R9JA 1N0TA 3VE1B 2ZYMA 4XKNA 3RPWA 1BTJA 3O6IA 2D5WA 1DPEA 4PETA 2F5XA 4ECFA 2PT1A 3ILUB 4RYAA 3IL1B 4G68A 1B1XA 1RYOA 4MH5A 2E0SA 1SI0A 2I4BA 4R74A 1Q35A 2RC9A 3PU5A 3FVKA 3VDFA 3LC8A 2ZNSA 2E1SA 4ZEFA 1IITA 5AA2A 3EHSA 1JEUA 1B1HA 3CG3A 1AMFA 2X7QA 4N6PA 1US5A 3U94A 1EH3A 4LZ7A 3MW0A 1NMUA 4XKRA 4R6YA 2PBWA 4RJZA 1Y3NA 1LFGA 3T9VA 2PMSA 1M5FA 4F2OA 1B3HA 3ZKKA 5DVIA 3MVWA 4NF5B 1OIBA 4H8JA 2I3VA 1SW5A 4KCDA 2HXWA 3C31A 4RPNA 1TWYA 1B58A 1FQFA 3DP6A 2QSXA 1USYH 2Q9TA 3PUZE 3VVDA 2XXQA 4Z7EA 4NF8B 1HSJA 1WDNA 4ELQA 1AL3A 4IGRA 5BWJA 2NOOA 4F31B 2AIXA 2Q2AA 5H8HB 3MZ9A 1ATGA 2F8DA 1MXYA 3FD3A 4F1YA 4G4PA 3RT6B 5H8NA 3I5OA 5L9OA 3QXMA 1FQBA 1OVTA 1Z7ME 2QJEA 5H8FB 4KHZE 4TLMB 4OWDA 2DWIA 4ESXA 1Z7NE 3OENA 4IO4A 4FIMA 4YB7A 5CI5A 1DSNA 1DTGA 4I8CA 2O1MA 3PMXA 1FTJA 2F7BA 3MUQA 5ITOA 2XHDA 1XVYA 2REGA 4ZEDA 4ESWA 5A5XB 4EUOA 3PUWE 5AE4A 4NF6A 1GV8A 3UP9A 5I57B 3G3FA 1LCFA 5I56B 1Y1ZA 1BKAA 1UTBB 2UYFA 4BDQA 3EF7A 3C33A 3Q28A 4AB6A 1QKBA 2UVJA 1B5IA 1MY2A 1ZLQA 1B4HA 3K01A 4QFLA 5AA3A 4X48A 3C34A 4TOZA 1SW2A 1QUIA 1ZIUA 1I6BA 4R2BA 3H6TA 4F3SA 3IOTA 1NNFA 4L17A 5JTYA 1O63A 1LFHA 3I6VA 2F34A 3AXFA 1FQDA 4ZEKA 4E0WA 3S9MC 5K2YA 4IY6A 4QSCA 3O9PA 3IOVA 4I9DA 4QFKA 4DXCA 3A3UA 5I58B 5CMBA 2QMWA 4JSOA 3SKPA 1BP5A 1UIUA 1PBQA 2B65A 3JV9A 4X9TA 4Z0IA 1ZTYA 3MVXA 4KPTA 3W15C 2R6GE 4QHQA 5L9MA 2X26A 3N94A 4FORA 2NVUB 3OOAA 4Q0CA 4F3GA 5KZTA 3JZJA 4YKKA 2V3UA 3O6GA 2ALUA 3SERA 1WVJA 3T9UA 3MP1A 4QFNA 4KFQA 4OVJA 4ZEBA 4G8MA 4G77A 3ECRA 2DS9A 3SEXA 4GXAA 3DM0A 1JEVA 3KG2A 3GBAA 3T96B 5CMMA 4FAJA 5FHOA 3IO6A 3FVGA 4OFJA 3H03A 2PT2A 1GGGA 3C36A 3M3KA 2OCUA 3FXQA 3KOSA 3IB1A 4OFOA 3K0VA 4G8NA 5FTIA 1IXGA 4F22A 4Q8RA 5H8QA 3KGCA 4HCWA 1FTLA 2RC7A 5CMCA 3H6UA 2XD3A 3A09A 3F11A 3QUFA 4EXKA 1TXFA 5EYFA 1IQ7A 4ZE9A 3EQ1A 3WAFA 2ZNUA 4I62A 4Q30B 4F2QA 3FGSA 3DLNA 2QS3A 5I2NA 2I49A 4RK9A 3CRBA 4QSDA 2F7AA 1S50A 1VR5A 2QS2A 3BFUA 2ZYKA 3TCGA 3TUSA 4KR5A 1CE2A 2DE2A 3Q29A 1MQDA 1URSA 4GVOA 2AYSA 4YMAA 1UTHB 3H06B 1NFTA 4FEBA 2B3FA 2WKYA 1LCTA 2F36A 2OZZA 1SBPA 4U22A 5CRYA 4PFYA 4NF4A 3O29A 3VVEA 4EDPA 1TT1A 3VVFA 3K1NA 4XKPA 3PD8A 4H5FA 3QAXA 1JW1A 3B7DA 3MZ1A 4RK2A 3H4ZA 2OJTA 5FTHA 1H3DA 2I0BA 2O68A 3SEWA 4U1OA 3FJGA 3CFLA 4R2FA 4I1DA 5CBSA 2VP1A 4XIGQ 5H8SA 2VD2A 4WXJA 4YKIA 2HQ0A 3RT8A 1A40A 3RQTA 2B3BA 1KWHA 3K6XA 3G3JA 4AB5A 4GL0A 4KYEA 4DXBA 1MPCA 3R6UA 1R9LA 4F3BA 4POWA 2ANJA 4HTGA 4IO6A 5I2KA 3C9HA 3HCQA 5I59A 2HAUA 1BIYA 1I6QA 5AA2B 2Y7KA 3IJXB 4P11A 2XXTA 5AA4A 4EF1A 4TQUQ 4NEDA 4QFPA 3KJ7A 1B32A 1LGBC 3GZGA 3C4MA 2H5YA 3LSXA 2DOJA 1M5EA 2HCAA 3PMWA 1Y4CA 5TP9A 4R6HA 3FXUA 2F97A 1YTVA 3GLBA 4F3PA 5B7DA 5TU0A 3LSFB 3VLVA 4DLDA 1VFDA 1QUKA 3MQ9A 4R72A 3G3IA 4AQ4A 1PC3A 4JWXA 4O3BA 4YAHX 4DCXA 2THIA 4QSEA 5DEXA 1PEBA 3OXNA 3EHTA 3CI8A 5BUUA 2Y84A 3TZAA 2Q89A 4NWDA 1MS7A 2DWJA 1H44A 3V8XB 1B7ZA 1YPNA 2DSFA 1URDA 3IOUA 1H76A 1NNTA 4PE5B 1D4NA 2F6GA 4HW8A 3IK6B 4LQ2A 1MH4A 1J1NA 1YAEA 1LAGE 3SDFA 3KBRA 2GHBA 2ONRA 5ISUA 4PFWA 4GL8A 1Y9UA 2F35A 3ZS6A 4F39A 2V3TA 1GR2A 3P7IA 3FJ7A 4R6KA 1ZKBA 4FATA 1EZOA 4H8IA 1VSOA 2RKMA 1B9JA 1FQEA 2DP8A 3TMGA 2HZLA 3L6HA 4NF6B 3U1OA 5HBCA 3PPNA 1NL5A 3T9XB 1B40A 4LA9A 5ITPA 3B6QA 2QMXA 4IGTA 3CR9A 5DTBA 3N26A 3EHUA 2XXVA 3K6WA 4GFRA 5JK4A 3T22A 1NNPA 4POXA 1B6HA 2I0CA 3M3LA 4N13A 1P1NA 2V3QA 2QS1A 3RUMA 3VFJA 5LOMA 1N7WA 4YICA 1A99A 4ZEIA 3TFLA 3QYTA 1LBCA 4OXVA 4RXLA 3UGWA 3U92A 4F18A
chains in the Genus database with same CATH superfamily
1FBFA 1OQGA 4OZ9A 1O7TA 4U1ZA 4ZZEA 1IXIA 4M1VA 1D9QA 2QVRA 1FPLA 2DDKA 3TEPA 2Q8MA 1SW1A 1IMEA 4OYVA 2PYYA 3USDA 1PDAA 1N7XA 1D9YA 2DQVA 3LV0A 4MHFA 1M5BA 4P1EA 3IORA 1M5DA 3V83A 1SQYA 2IEEA 3OO6A 3RGYA 3H7MA 4BDLA 3TTLA 4PBQA 3MPKA 1NNKA 3PPOA 1PB9A 1ELJA 3B8BA 4O3CA 3DP8A 3RTWB 3OELA 2UXAA 1MXWA 4GF8A 2AL4A 4OQOA 5K2XA 2O69A 4IO7A 3SESA 3JYRA 3IJOB 4IO2A 3PV0E 2V93A 1YCJA 4MMPA 1I6AA 1DOTA 4UA8A 3QMFA 4BDNA 1EZ9A 3OEKA 2UVHA 5FHMA 3KEIA 1S7YA 3FATA 4G2ZA 2D21A 1AH5A 1SYIA 1M5CA 1IUDA 4NWCA 3IFAA 1XC1A 4NF5A 1P1WA 1B3LA 5EYGA 1ANFA 1FPIA 1B0HA 3HHGA 1YYZA 3O66A 3R26A 5H8QB 2A5TA 1JVXA 4EQBA 4XF5A 5IM2A 3IB2A 3QSLA 2ABHA 4DXUA 4F1UA 1OVBA 4FEDA 2O6AA 1RYXA 4ELPA 4NF8A 1IZ1A 4C1TA 3EPEA 4RNSA 2XXHA 5L8DA 4LATA 2B4MA 1QUJA 3E78A 5I2NB 4PQJA 2D3IA 4G8HA 3O6HA 3HPIA 1HSLA 3FUZA 1MY3A 2L5VA 1FQCA 3D1RA 3K6UA 3LSWA 3RY3A 1FBEA 3SEUA 2QVVA 2XX7A 3UORA 3VLUA 2B4LA 1DTZA 4LVQA 5F7VA 2ZNTA 3KN8A 3IX1A 4RPOA 4NF4B 2HAVA 5EQ7A 4FECA 3TYHA 1VE4A 4OFLA 3V5AA 2BJIA 3TQWA 5L9SA 4MFIA 1EU8A 5HM4B 3B6WA 3BKIB 2X7PA 1BLFA 2REJA 3T66A 4P0GA 4ZZAA 1S9TA 1UTBA 1FTOA 3CSBA 4PDDA 1NV6A 5TPAA 4KXPA 2XXXA 4YKPA 4QFOA 4H46A 2UYEA 4N8GA 1A55A 2FBPA 2HEUA 3BBRA 2RC8A 1POY1 3S9EA 2ZYOA 1OMPA 4JVCA 4GOTA 3KFMA 5I2KB 5I59B 1MG1A 5ET8A 5AA1A 5DVFA 2M8CA 2RINA 4OVTA 3DP4A 4H0WA 4N17A 3HHFA 1MQGA 1D3KA 3HSTA 2NUVA 3MJNA 4K3FA 3BFTA 4QRZA 3H6WA 1IEJA 4LP2B 1HSEA 4R75A 4EQ9A 1G0HA 1MQHA 4BDRA 4OANA 1RDZA 3SEYA 1MH3A 5TP9B 3SEVA 2OLBA 3ZKLA 2UVGA 2IA4A 2HHMA 3KN3A 4ZE8A 1PB8A 3G3GA 1RDYA 3CFZA 2RF1A 5DVJA 3CG1A 3TCFA 5IAIA 3CHGA 4R73A 5CM6A 4LZ5A 3W9VA 3HN0A 1UIVA 3CIJA 2XWOA 5DW8A 1OLAA 4XKQA 3TKDA 4E0XA 4WKMA 3KZGA 4OENA 4KYSA 3C32A 1QULA 3ODBA 3TDJA 5B70A 3PUXE 2XX8A 3KSXA 4PC9A 1FBPA 1SW4A 2O51A 2LAOA 3LBSA 4G68B 1SI1A 4PAKA 4O8MA 4DE8A 3UK4A 1B5JA 1LAXA 3M3FA 5I5PA 1FQAA 2ESNA 2ONSA 2HZKA 2F3BA 3A3CA 1ZJLA 4MNPA 4YB6A 4OVRA 2CEXA 4X1BA 4XTCQ 3OO9A 3RN8A 2FVZA 1LBWA 1B7HA 4ZDMA 1T0KA 1USYE 1LAFE 2DE4A 4BDMA 1R9QA 4NX1A 3K00A 3MYUA 2HFBA 4GWSA 1A8FA 4ZECA 3RPLB 2QS4A 4KI0E 3PUYE 3O28A 4O3AA 3H6VA 3VXBA 1H43A 1AIVA 5I7IA 1JP4A 2DXYA 4IB2A 1AOVA 3KN7A 1MXVA 4EF2A 1EYIA 1XI6A 3U8QA 5IKBA 2I4CA 2VHAA 4IO3A 4DZ1A 1UTHA 1NUZA 4LUBA 1Q1KA 1R6ZA 3OO7A 2FHYA 2PVUA 1FCKA 2H25A 3TTRA 4H65A 3N6UA 2UVIA 1P1QA 4JWOA 5CC2A 5CBRA 4KYDA 3IB0A 3UIFA 4GIZA 1FTMA 3FIRA 5EHMA 4N6KA 2P3NA 4NE4A 1US4A 3FJMA 2YPNA 1DBZA 3GBBA 4R9GA 3CVGA 3K4UA 1Y3PA 3PD9A 2BJJX 3BIHA 1WODA 5IGAA 5H8NB 3PPQA 5KDTA 3THIA 1NH8A 1LBBA 3IOWA 3DELB 1A7LA 3FZVA 1MPDA 3N6TA 2ZZVA 1JQFA 1TFAA 1FBHA 3KC1A 4KD5A 5AA2D 5ELVA 5DYHA 2DVZA 5CMKA 3KSJA 3FV1A 2CZLA 1MDP1 4ND9A 4QF9A 3E9XA 1MY0A 2O7UA 3Q26A 4OETA 4PFBA 5ICTA 1NH7A 2GHAA 4JVIA 3T93B 2O7IA 1MQJA 3UN6A 4JDFA 4ISUA 3MAMA 2QRYA 2VOZA 4KCCA 3C35A 4TLLB 3PMVA 2P1SA 4MNIA 3D4GA 3M8UA 4N6DA 1I69A 4GWYA 3B6TA 2QL3A 3CSGA 3S9LC 4U21A 5KCJA 4OHNA 4GBWA 2OBGA 3K1PA 3RLFE 4JBZA 3LUZA 2H99A 3E3KA 2PFYA 2ZMBA 4DCYA 3MPLA 1GTKA 4NTLA 4H1XA 5JTYB 2Z23A 4G68C 4R9FA 2A5TB 5A5LA 4AS5A 2XXYA 4MLVA 1Y1MA 4F1VA 2Y7WA 3OD7A 2YJPA 3VLWA 3TQLA 4HE1A 4C0RA 3FV2A 4BDOA 1N3WA 4H6DA 3EN3A 4GRKA 4C1UA 3D4CA 3Q27A 2OWTA 4KQPA 2YLNA 3TODA 3O2AA 3O97A 3FVOA 1R1NA 1MRPA 4MJOA 1A54A 2PX1A 2HXRA 2GH9A 1A8EA 2DVCA 4UACA 4YKJA 1O64A 1SYHA 2ZYNA 1POTA 3ZSFA 4PFTA 2PFZA 4MLQA 4BLAA 4FJPA 2FA7A 3EKIA 4OTEA 1N84A 4EQ7A 3HV1A 4NQ8A 1YZ0A 3H3GA 3HO7A 5JEIA 2I6EA 5T3JA 2KLFA 3FVNA 1DCUA 4HCYA 2CMOA 2Y7RA 2Q8JA 2XD2A 1LBYA 3PPPA 3PGFA 2XWIA 4F19A 5DT6A 1MM6A 4ELRA 3FASA 3W9WA 1NV1A 1MPBA 4Q5TA 4QXDA 1FW0A 3N5LA 1NI9A 1Y20A 2I3WA 1CNQA 1B4ZA 4PFUA 5IZ3B 3VXCA 2MKZA 1B0LA 5TPAB 2A5SA 1P1UA 4RA1A 2QPQA 3R7XA 4THIA 1XVXA 1EZPA 4F29A 3ROJA 4YMBA 1N3XA 1LAHE 4FE8A 3TTNA 4NG7A 1QJMA 4X1DA 2NXOA 1D9VA 1DPPA 3QIMA 4G61A 5H8HA 3PPRA 3S9NC 2I58A 3WAEA 3GYYA 1LB9A 1FJ9A 4FBPA 5ESYA 4JSDA 3NOHA 4OEUA 1OLCA 3S2VA 1LB8A 1PB7A 3OO8A 4O7IA 3QUJA 1OQHA 2XXPA 1VDWA 4GXSB 3UA8A 4GX4A 2GQ1A 2H9BA 5H8FA 3IAZA 2Y5KA 1P99A 1B3EA 1L5TA 3OSQA 1MXZA 1XHYA 3SETA 2FIEA 1Y4TA 3HFUA 4JB7A 2RCAA 2H4IA 2XXUA 5A5XA 4XXUA 1P1OA 4U2RA 2Q88A 3CFXA 1MXXA 4PP0A 1FPGA 5I57A 4IO5A 1LBZA 4U4XA 5HPQA 5I56A 2Q74A 4N07A 4XEQA 1INPA 1ZU0A 2Z8FA 4PBHA 4U23A 3S4UA 1LBXA 1LSTA 1IMDA 2DYXA 2VGQA 5M2VA 4OEVA 2XXRA 4OERA 4DDDA 3K02A 1RKMA 2W7YA 3FXRA 2V25A 4GWOA 3MZBA 4JWYA 2G29A 1IXHA 4YB5A 2CEYA 3RTFB 3MP6A 4NN3A 3E4RA 4LQ5A 3V89B 1IXCA 3U93A 3LUYA 2CZKA 2NWJA 4EXLA 2VD3A 5AA4B 2AL5A 3G7WA 3TAJA 2XWKA 4LZ8A 5I58A 4P56A 1Y3QA 4JVDA 4PAFA 2XXIA 1JW4A 3LR1A 4MF3A 3OEMA 1UQWA 1VFEA 2OWSA 3FBPA 1B5HA 3OSRA 2GFEA 3PUVE 1LLSA 1B51A 1B2HA 3QK6A 3MVZA 1B52A 3G3HA 4GLIA 1B3GA 1B7UA 4P0IA 1LFIA 1JVYA 5EQAA 3IR1A 2O84X 1PBPA 5I84A 4GQOA 1SD3A 5DEXB 3LSLA 3MP8A 1N04A 2F6PA 2DE3A 1NKXA 1AWBA 3K6VA 2XXWA 2ZZXA 4NMYA 2Z8EA 2FNCA 1ZBMA 2F7CA 3KOTA 4HE2A 1XOCA 5EQ8A 3VV5A 3TPAA 1IIWA 1JETA 2WEFA 2DWAA 2F78A 1LBVA 1XS5A 1MY1A 4ZS9A 3RNNA 1FBDA 1N76A 4GD5A 4H5GA 4U4SA 5KDTB 1RDXA 2V84A 3GXAA 3K1MA 2ZXTA 2XX9A 1FPFA 2P2AA 4N4UA 3E13X 3T9HB 1DMBA 3G3KA 2JJKA 2O1LA 4ELOA 1II5A 1MY4A 1ZMGA 3IO4A 1QVSA 2XXKA 1KA0A 5FHNA 1H45A 2P0SA 3ONMA 4M4GA 1NUXA 4P9KA 4OESA 1BK4A 2Q2CA 1XT8A 5F1QA 2FYIA 2R71A 4HS7A 2H98A 2G93A 1MQIA 2Y7IA 1FTKA 4MBPA 1B46A 3ILTB 2DXRA 1CB6A 1JW5A 3KJTA 4OMBA 1MM7A 2ONKE 4H67A 1F9BA 1TFDA 4WEPA 3U65A 4I40A 3K2DA 4ONYA 3MBPA 1GVCA 2DWHA 2Z22A 1B3FA 2Z8DA 4RY1A 2GRVA 1JNFA 4HE0A 1URGA 3L6GA 2Y7PA 5KCJB 3TCHA 3MWBA 1B05A 4WEDA 2I48A 3Q25A 1MDQA 3TTKA 2RCBA 4YZZA 3MC2A 4JXIA 4IY5A 4NAPA 4X8RA 4O94A 5ICQA 1MXUA 4N8YA 4LONB 3MVYA 5J1DA 3U72A 3TELA 5EHSA 2WYKA 1SPIA 1QW0A 4YU0A 2V4CA 4PGPA 4PTKA 3I3VA 2OK2A 3OMBA 4DIGA 1SDXA 3TTMA 1QKAA 1SVXB 2R9JA 1N0TA 3VE1B 2CZIA 2ZYMA 4XKNA 4X04A 3RPWA 1BTJA 3O6IA 2D5WA 1DPEA 4PETA 2F5XA 4ECFA 2PT1A 3ILUB 4RYAA 3IL1B 4G68A 1B1XA 1RYOA 2XWVA 4N91A 4GWWA 4MH5A 2E0SA 1SI0A 1FPBA 2I4BA 4PAIA 4R74A 1Q35A 2RC9A 3PU5A 3FVKA 3VDFA 3B50A 3LC8A 2ZZWA 2ZNSA 2E1SA 4ZEFA 1IITA 5AA2A 4DI4B 3EHSA 1JEUA 1B1HA 3CG3A 1AMFA 2X7QA 4N6PA 1US5A 3U94A 1EH3A 5ET7A 4LZ7A 3MW0A 1NMUA 4XKRA 4R6YA 2PBWA 5F24A 3A29A 4RJZA 1Y3NA 1LFGA 1NV4A 3T9VA 2PMSA 1EYJA 1M5FA 4F2OA 1B3HA 2QFLA 3ZKKA 5DVIA 3MVWA 3PTYA 1OIBA 4NF5B 4H8JA 2I3VA 5LDZA 1SW5A 4KCDA 2HXWA 4H45A 3C31A 4RPNA 1IMAA 1TWYA 1B58A 1FQFA 3DP6A 2QSXA 1USYH 2Q9TA 3PUZE 3VVDA 2XXQA 4Z7EA 4NF8B 1HSJA 1WDNA 4ELQA 1AL3A 4IGRA 5BWJA 2NOOA 4F31B 2AIXA 2Q2AA 5H8HB 1NV3A 3MZ9A 1ATGA 2F8DA 1MXYA 3FD3A 4F1YA 4G4PA 3RT6B 5H8NA 1Q9DA 2VPNA 3I5OA 5L9OA 3QXMA 5EYHA 4PE3A 1KZ8A 3KC0A 1FQBA 1OVTA 5ET6A 1Z7ME 2QJEA 5H8FB 4KHZE 4TLMB 4OWDA 1FJ6A 1IMBA 2DWIA 4ESXA 1Z7NE 3OENA 4IO4A 4PCDA 4FIMA 4YB7A 5CI5A 1DSNA 1DTGA 2QVUA 1FPJA 4I8CA 2O1MA 3PMXA 1FTJA 2F7BA 3MUQA 5ITOA 2XHDA 4PGNA 1XVYA 2REGA 4ZEDA 4ESWA 4GWUA 5A5XB 4AS4A 3PUWE 4EUOA 5AE4A 4NF6A 1GV8A 3UP9A 5I57B 3G3FA 1LCFA 4P1LA 5I56B 1Y1ZA 1BKAA 1UTBB 2UYFA 4BDQA 3EF7A 3C33A 3Q28A 4AB6A 1QKBA 2UVJA 1B5IA 4DI3D 1MY2A 1ZLQA 1B4HA 3K01A 4QFLA 5AA3A 4X48A 3C34A 4TOZA 1SW2A 1QUIA 2FIXA 1ZIUA 1I6BA 4R2BA 4NGUA 3H6TA 4F3SA 3IOTA 1NNFA 4L17A 1QGXA 1YXIA 5JTYA 1IMCA 1O63A 1LFHA 3I6VA 2F34A 3AXFA 1FQDA 4ZEKA 4E0WA 3S9MC 5K2YA 3RYDA 4IY6A 4QSCA 3T0JA 3O9PA 3IOVA 4I9DA 4QFKA 4DXCA 3A3UA 5I58B 4QBAA 2QMWA 5CMBA 4JSOA 3SKPA 1BP5A 1UIUA 1PBQA 2B65A 3JV9A 4X9TA 4Z0IA 1ZTYA 1FPKA 3MVXA 4KPTA 3W15C 5IZZA 4LN5A 2R6GE 4QHQA 5L9MA 2X26A 3N94A 5FBPA 4FORA 2NVUB 3OOAA 4Q0CA 4F3GA 5KZTA 3JZJA 4YKKA 2V3UA 3O6GA 2ALUA 3SERA 1K9ZA 1WVJA 3T9UA 3MP1A 4QFNA 1FPDA 4KFQA 4OVJA 4OA4A 4ZEBA 4G8MA 4G77A 3ECRA 2DS9A 3SEXA 4GXAA 3DM0A 1JEVA 3KG2A 4MAGA 3GBAA 3T96B 5CMMA 4FAJA 2WYPA 5FHOA 3IO6A 2P3VA 3FVGA 4OFJA 3H03A 2VPOA 2PT2A 3MSTA 1GGGA 3C36A 5ET5A 2VT5A 1NV0A 3M3KA 2OCUA 5IZ3A 3FXQA 3KOSA 3IB1A 4OFOA 3K0VA 4G8NA 1NV5A 5FTIA 1IXGA 4F22A 4Q8RA 5H8QA 4OVSA 3KGCA 4HCWA 4PDHA 1FTLA 2RC7A 5CMCA 5IZ1A 3H6UA 2XD3A 1IMFA 3A09A 3F11A 3QUFA 5EQ9A 4EXKA 1DK4A 1TXFA 5EYFA 1IQ7A 4ZE9A 3EQ1A 3WAFA 2ZNUA 2WBBA 4I62A 4Q30B 4F2QA 3FGSA 3DLNA 4I3EA 1NUWA 1G0IA 1LEVA 2QS3A 5I2NA 2I49A 4RK9A 3CRBA 4QSDA 2F7AA 1S50A 1VR5A 4PFRA 4MIJA 1FRPA 2QS2A 3BFUA 2F3DA 2ZYKA 3TCGA 3TUSA 4KR5A 1CE2A 1NV7A 2DE2A 3Q29A 1MQDA 1URSA 4GVOA 2AYSA 4YMAA 1UTHB 3FXBA 4MNCA 3H06B 1NFTA 3T1BA 4FEBA 4XFEA 1FSAA 2B3FA 2WKYA 1LCTA 2F36A 2OZZA 1SBPA 2WX9A 4HXVA 4U22A 5CRYA 4PFIA 4PFYA 4NF4A 3O29A 3VVEA 4EDPA 1TT1A 3VVFA 4P8BA 2KQZA 3K1NA 4XKPA 3PD8A 4H5FA 5J16A 3QAXA 1JW1A 3B7DA 3MZ1A 4RK2A 3H4ZA 2OJTA 5FTHA 1H3DA 2I0BA 2O68A 3SEWA 4U1OA 3FJGA 2KR0A 3CFLA 4R2FA 4I1DA 5CBSA 3ISPA 2VP1A 4XIGQ 5H8SA 2VD2A 4WXJA 4YKIA 2HQ0A 3RT8A 1A40A 3RQTA 2B3BA 1KWHA 3K6XA 3G3JA 4GBVA 4AB5A 4GL0A 4KYEA 4P47A 4DXBA 2WBDA 1MPCA 3R6UA 1R9LA 4F3BA 4POWA 2ANJA 4HTGA 4IO6A 5I2KA 3C9HA 3HCQA 5I59A 2HAUA 1BIYA 3BIGA 1I6QA 1NUYA 5AA2B 4GWZA 2Y7KA 3IJXB 4P11A 2XXTA 5AA4A 4EF1A 1FBCA 4P3LA 4TQUQ 2CZHA 4NEDA 4QFPA 3KBZA 3KJ7A 1B32A 1LGBC 3GZGA 4OVQA 3C4MA 4OVPA 2H5YA 2Y5LA 3LSXA 1FPEA 2DOJA 1M5EA 4PF6A 2HCAA 3PMWA 1Y4CA 5TP9A 4R6HA 3FXUA 2F97A 1YTVA 3GLBA 4F3PA 5B7DA 5TU0A 3LSFB 2OX3A 4PF8A 3VLVA 4DLDA 1KA1A 4N81A 1VFDA 1QUKA 2R8TA 3MQ9A 4R72A 3G3IA 4AQ4A 1PC3A 4JWXA 4O3BA 4YAHX 4DCXA 2THIA 4QSEA 5DEXA 1PEBA 3OXNA 4O7MA 3EHTA 3CI8A 5BUUA 2PCRA 2Y84A 3TZAA 2Q89A 4GX3A 4NWDA 1MS7A 3E79A 2DWJA 1H44A 3V8XB 1B7ZA 1YPNA 2DSFA 1URDA 3IOUA 1H76A 1NNTA 4PE5B 1D4NA 2F6GA 4HW8A 3IK6B 4LQ2A 1MH4A 1J1NA 1YAEA 1LAGE 3SDFA 4NHBA 3KBRA 2XA5A 2GHBA 2ONRA 5ISUA 4PFWA 4GL8A 4MX6A 4NF0A 1Y9UA 4MCOA 2F35A 4GX6A 3ZS6A 1EYKA 4F39A 1K9YA 2V3TA 4N15A 1GR2A 3P7IA 3FJ7A 1FBGA 4R6KA 4IR8A 1ZKBA 4FATA 1EZOA 4H8IA 3RPLA 1VSOA 5I3SA 5LTCA 2RKMA 3SZPA 2OWZA 4MEVA 1B9JA 1FQEA 2DP8A 3TMGA 2HZLA 3L6HA 4NF6B 3U1OA 3IFCA 5HBCA 3PPNA 1NL5A 3T9XB 1B40A 4LA9A 5ITPA 3B6QA 2QMXA 2HPGA 4IGTA 3CR9A 5DTBA 3N26A 3EHUA 4GWXA 2XXVA 3K6WA 4GFRA 5JK4A 3T22A 1NNPA 4POXA 4UABA 1B6HA 2I0CA 3M3LA 4N13A 1P1NA 1FTAA 2V3QA 2QS1A 3RUMA 3VFJA 5LOMA 1N7WA 4YICA 1A99A 4ZEIA 3TFLA 3QYTA 1NV2A 1LBCA 4I3YA 4OXVA 4RXLA 3UGWA 3U92A 4F18A
chains in the Genus database with same CATH topology
1OQGA 4OZ9A 1O7TA 4U1ZA 4ZZEA 1IXIA 4M1VA 3TEPA 1SW1A 4OYVA 2PYYA 3USDA 1PDAA 1N7XA 1D9YA 2DQVA 1M5BA 3IORA 1M5DA 3V83A 1SQYA 2IEEA 3OO6A 3RGYA 3H7MA 4BDLA 3TTLA 3MPKA 1NNKA 3PPOA 1PB9A 1ELJA 4O3CA 3DP8A 3RTWB 3OELA 2UXAA 1MXWA 4GF8A 2AL4A 4OQOA 5K2XA 2O69A 4IO7A 3SESA 3JYRA 3IJOB 4IO2A 3PV0E 2V93A 1YCJA 1I6AA 1DOTA 4UA8A 4BDNA 1EZ9A 3OEKA 2UVHA 5FHMA 3KEIA 1S7YA 3FATA 4G2ZA 2D21A 1AH5A 1SYIA 1M5CA 1IUDA 4NWCA 1XC1A 4NF5A 1P1WA 1B3LA 1ANFA 1B0HA 3HHGA 3O66A 3R26A 5H8QB 2A5TA 1JVXA 4EQBA 3IB2A 3QSLA 2ABHA 4DXUA 4F1UA 1OVBA 4FEDA 2O6AA 1RYXA 4ELPA 4NF8A 4C1TA 1IZ1A 3EPEA 4RNSA 2XXHA 5L8DA 4LATA 1QUJA 5I2NB 4PQJA 2D3IA 4G8HA 3O6HA 3HPIA 1HSLA 3FUZA 1MY3A 1FQCA 3K6UA 3LSWA 3RY3A 3SEUA 2XX7A 3UORA 3VLUA 1DTZA 4LVQA 5F7VA 2ZNTA 3KN8A 3IX1A 4RPOA 4NF4B 2HAVA 4FECA 3TYHA 1VE4A 4OFLA 3V5AA 3TQWA 5L9SA 4MFIA 1EU8A 5HM4B 3B6WA 3BKIB 2X7PA 1BLFA 2REJA 3T66A 4P0GA 4ZZAA 1S9TA 1UTBA 1FTOA 3CSBA 5TPAA 2XXXA 4YKPA 4QFOA 2UYEA 1A55A 2HEUA 3BBRA 2RC8A 1POY1 3S9EA 2ZYOA 1OMPA 4GOTA 3KFMA 5I2KB 5I59B 1MG1A 5AA1A 5DVFA 2M8CA 2RINA 3DP4A 4H0WA 3HHFA 1MQGA 1D3KA 3HSTA 2NUVA 3MJNA 4K3FA 3BFTA 4QRZA 3H6WA 1IEJA 4LP2B 1HSEA 4R75A 4EQ9A 1MQHA 4BDRA 3SEYA 1MH3A 5TP9B 3SEVA 2OLBA 3ZKLA 2UVGA 2IA4A 3KN3A 4ZE8A 1PB8A 3G3GA 3CFZA 2RF1A 5DVJA 3CG1A 3TCFA 5IAIA 4R73A 5CM6A 4LZ5A 3W9VA 3HN0A 1UIVA 3CIJA 1OLAA 4XKQA 3TKDA 4E0XA 4WKMA 3KZGA 4OENA 4KYSA 3C32A 1QULA 3ODBA 3TDJA 5B70A 3PUXE 2XX8A 3KSXA 1SW4A 2O51A 2LAOA 3LBSA 4G68B 1SI1A 4DE8A 3UK4A 1B5JA 1LAXA 3M3FA 1FQAA 2ESNA 2ONSA 2HZKA 3A3CA 1ZJLA 4YB6A 4X1BA 4XTCQ 3OO9A 3RN8A 1B7HA 4ZDMA 1T0KA 1USYE 1LAFE 2DE4A 4BDMA 1R9QA 3K00A 2HFBA 1A8FA 4ZECA 2QS4A 4KI0E 3PUYE 3O28A 4O3AA 3H6VA 3VXBA 1H43A 1AIVA 2DXYA 4IB2A 1AOVA 3KN7A 1MXVA 4EF2A 3U8QA 5IKBA 2I4CA 2VHAA 4IO3A 4DZ1A 1UTHA 4LUBA 1Q1KA 1R6ZA 3OO7A 2PVUA 1FCKA 2H25A 3TTRA 4H65A 3N6UA 2UVIA 1P1QA 4JWOA 5CC2A 5CBRA 4KYDA 3IB0A 3UIFA 4GIZA 1FTMA 3FIRA 5EHMA 4NE4A 1US4A 3FJMA 2YPNA 3GBBA 4R9GA 3CVGA 3K4UA 1Y3PA 3PD9A 2BJJX 1WODA 5H8NB 3PPQA 5KDTA 3THIA 1NH8A 1LBBA 3IOWA 3DELB 1A7LA 3FZVA 1MPDA 3N6TA 1JQFA 1TFAA 4KD5A 5AA2D 5ELVA 5DYHA 2DVZA 5CMKA 3KSJA 3FV1A 2CZLA 1MDP1 4ND9A 4QF9A 3E9XA 1MY0A 2O7UA 3Q26A 4OETA 5ICTA 1NH7A 2GHAA 3T93B 2O7IA 1MQJA 3UN6A 4JDFA 4ISUA 3MAMA 2QRYA 2VOZA 4KCCA 3C35A 4TLLB 3PMVA 2P1SA 3D4GA 3M8UA 1I69A 3B6TA 2QL3A 3CSGA 3S9LC 4U21A 5KCJA 4OHNA 2OBGA 3K1PA 3RLFE 4JBZA 2H99A 3E3KA 2ZMBA 4DCYA 3MPLA 1GTKA 4NTLA 4H1XA 5JTYB 2Z23A 4G68C 4R9FA 2A5TB 2XXYA 4MLVA 1Y1MA 4F1VA 2Y7WA 3OD7A 2YJPA 3VLWA 3TQLA 4C0RA 3FV2A 4BDOA 1N3WA 4H6DA 3EN3A 4GRKA 4C1UA 3D4CA 3Q27A 2OWTA 4KQPA 2YLNA 3TODA 3O2AA 3O97A 3FVOA 1R1NA 1MRPA 1A54A 2PX1A 2GH9A 1A8EA 2DVCA 4UACA 4YKJA 1O64A 1SYHA 2ZYNA 1POTA 3ZSFA 4PFTA 4MLQA 4BLAA 4FJPA 2FA7A 4OTEA 1N84A 4EQ7A 3HV1A 3HO7A 3H3GA 5JEIA 2I6EA 2KLFA 3FVNA 4HCYA 2CMOA 2Y7RA 2Q8JA 2XD2A 3PPPA 3PGFA 4F19A 5DT6A 1MM6A 4ELRA 3FASA 3W9WA 1MPBA 4Q5TA 1FW0A 3N5LA 1Y20A 2I3WA 1B4ZA 4PFUA 3VXCA 1B0LA 5TPAB 2A5SA 1P1UA 4RA1A 2QPQA 3R7XA 4THIA 1XVXA 1EZPA 4F29A 4YMBA 1N3XA 1LAHE 4FE8A 3TTNA 1QJMA 4X1DA 2NXOA 1D9VA 1DPPA 3QIMA 5H8HA 3PPRA 3S9NC 2I58A 3WAEA 1LB9A 4JSDA 4OEUA 1OLCA 3S2VA 1LB8A 1PB7A 3OO8A 3QUJA 1OQHA 2XXPA 4GXSB 3UA8A 2H9BA 5H8FA 3IAZA 1P99A 1B3EA 1L5TA 3OSQA 1MXZA 1XHYA 3SETA 1Y4TA 4JB7A 2RCAA 2H4IA 2XXUA 5A5XA 4XXUA 1P1OA 4U2RA 2Q88A 3CFXA 1MXXA 4PP0A 5I57A 4IO5A 4U4XA 5HPQA 5I56A 4N07A 1ZU0A 2Z8FA 4U23A 3S4UA 1LSTA 2DYXA 2VGQA 5M2VA 4OEVA 2XXRA 4OERA 4DDDA 3K02A 1RKMA 2W7YA 3FXRA 2V25A 4GWOA 3MZBA 4JWYA 2G29A 1IXHA 4YB5A 3RTFB 3MP6A 3E4RA 3V89B 4LQ5A 1IXCA 3U93A 3LUYA 2NWJA 4EXLA 2VD3A 5AA4B 2AL5A 3G7WA 3TAJA 4LZ8A 5I58A 1Y3QA 2XXIA 1JW4A 3LR1A 4MF3A 3OEMA 1UQWA 1VFEA 2OWSA 1B5HA 3OSRA 2GFEA 3PUVE 1LLSA 1B51A 1B2HA 3QK6A 3MVZA 1B52A 3G3HA 4GLIA 1B3GA 1B7UA 4P0IA 1LFIA 1JVYA 3IR1A 2O84X 1PBPA 5I84A 4GQOA 1SD3A 5DEXB 3LSLA 3MP8A 1N04A 2F6PA 2DE3A 1NKXA 3K6VA 2XXWA 4NMYA 2Z8EA 2FNCA 1ZBMA 2F7CA 3KOTA 1XOCA 3VV5A 3TPAA 1IIWA 1JETA 2DWAA 2F78A 1XS5A 1MY1A 4ZS9A 3RNNA 1N76A 4GD5A 4H5GA 4U4SA 5KDTB 2V84A 3GXAA 3K1MA 2ZXTA 2XX9A 2P2AA 3E13X 3T9HB 1DMBA 3G3KA 2O1LA 4ELOA 1II5A 1MY4A 1ZMGA 3IO4A 1QVSA 5FHNA 1H45A 2P0SA 3ONMA 4M4GA 4OESA 2Q2CA 1XT8A 5F1QA 2FYIA 2R71A 4HS7A 2H98A 2G93A 1MQIA 2Y7IA 1FTKA 4MBPA 1B46A 3ILTB 2DXRA 1CB6A 1JW5A 3KJTA 4OMBA 1MM7A 2ONKE 4H67A 1F9BA 1TFDA 4WEPA 3K2DA 4ONYA 3MBPA 1GVCA 2DWHA 2Z22A 1B3FA 2Z8DA 4RY1A 2GRVA 1JNFA 1URGA 3L6GA 2Y7PA 5KCJB 3TCHA 3MWBA 1B05A 4WEDA 2I48A 3Q25A 1MDQA 3TTKA 2RCBA 4YZZA 3MC2A 4JXIA 4IY5A 5ICQA 1MXUA 4LONB 3MVYA 5J1DA 3U72A 3TELA 5EHSA 1QW0A 4YU0A 3I3VA 2OK2A 3OMBA 4DIGA 1SDXA 3TTMA 1QKAA 1SVXB 2R9JA 1N0TA 3VE1B 2ZYMA 4XKNA 3RPWA 1BTJA 3O6IA 2D5WA 1DPEA 4PETA 2F5XA 4ECFA 2PT1A 3ILUB 4RYAA 3IL1B 4G68A 1B1XA 1RYOA 4MH5A 2E0SA 1SI0A 2I4BA 4R74A 1Q35A 2RC9A 3PU5A 3FVKA 3VDFA 3LC8A 2ZNSA 2E1SA 4ZEFA 1IITA 5AA2A 3EHSA 1JEUA 1B1HA 3CG3A 1AMFA 2X7QA 4N6PA 1US5A 3U94A 1EH3A 4LZ7A 3MW0A 1NMUA 4XKRA 4R6YA 2PBWA 4RJZA 1Y3NA 1LFGA 3T9VA 2PMSA 1M5FA 4F2OA 1B3HA 3ZKKA 5DVIA 3MVWA 4NF5B 1OIBA 4H8JA 2I3VA 1SW5A 4KCDA 2HXWA 3C31A 4RPNA 1TWYA 1B58A 1FQFA 3DP6A 2QSXA 1USYH 2Q9TA 3PUZE 3VVDA 2XXQA 4Z7EA 4NF8B 1HSJA 1WDNA 4ELQA 1AL3A 4IGRA 5BWJA 2NOOA 4F31B 2AIXA 2Q2AA 5H8HB 3MZ9A 1ATGA 2F8DA 1MXYA 3FD3A 4F1YA 4G4PA 3RT6B 5H8NA 3I5OA 5L9OA 3QXMA 1FQBA 1OVTA 1Z7ME 2QJEA 5H8FB 4KHZE 4TLMB 4OWDA 2DWIA 4ESXA 1Z7NE 3OENA 4IO4A 4FIMA 4YB7A 5CI5A 1DSNA 1DTGA 4I8CA 2O1MA 3PMXA 1FTJA 2F7BA 3MUQA 5ITOA 2XHDA 1XVYA 2REGA 4ZEDA 4ESWA 5A5XB 4EUOA 3PUWE 5AE4A 4NF6A 1GV8A 3UP9A 5I57B 3G3FA 1LCFA 5I56B 1Y1ZA 1BKAA 1UTBB 2UYFA 4BDQA 3EF7A 3C33A 3Q28A 4AB6A 1QKBA 2UVJA 1B5IA 1MY2A 1ZLQA 1B4HA 3K01A 4QFLA 5AA3A 4X48A 3C34A 4TOZA 1SW2A 1QUIA 1ZIUA 1I6BA 4R2BA 3H6TA 4F3SA 3IOTA 1NNFA 4L17A 5JTYA 1O63A 1LFHA 3I6VA 2F34A 3AXFA 1FQDA 4ZEKA 4E0WA 3S9MC 5K2YA 4IY6A 4QSCA 3O9PA 3IOVA 4I9DA 4QFKA 4DXCA 3A3UA 5I58B 5CMBA 2QMWA 4JSOA 3SKPA 1BP5A 1UIUA 1PBQA 2B65A 3JV9A 4X9TA 4Z0IA 1ZTYA 3MVXA 4KPTA 3W15C 2R6GE 4QHQA 5L9MA 2X26A 3N94A 4FORA 2NVUB 3OOAA 4Q0CA 4F3GA 5KZTA 3JZJA 4YKKA 2V3UA 3O6GA 2ALUA 3SERA 1WVJA 3T9UA 3MP1A 4QFNA 4KFQA 4OVJA 4ZEBA 4G8MA 4G77A 3ECRA 2DS9A 3SEXA 4GXAA 3DM0A 1JEVA 3KG2A 3GBAA 3T96B 5CMMA 4FAJA 5FHOA 3IO6A 3FVGA 4OFJA 3H03A 2PT2A 1GGGA 3C36A 3M3KA 2OCUA 3FXQA 3KOSA 3IB1A 4OFOA 3K0VA 4G8NA 5FTIA 1IXGA 4F22A 4Q8RA 5H8QA 3KGCA 4HCWA 1FTLA 2RC7A 5CMCA 3H6UA 2XD3A 3A09A 3F11A 3QUFA 4EXKA 1TXFA 5EYFA 1IQ7A 4ZE9A 3EQ1A 3WAFA 2ZNUA 4I62A 4Q30B 4F2QA 3FGSA 3DLNA 2QS3A 5I2NA 2I49A 4RK9A 3CRBA 4QSDA 2F7AA 1S50A 1VR5A 2QS2A 3BFUA 2ZYKA 3TCGA 3TUSA 4KR5A 1CE2A 2DE2A 3Q29A 1MQDA 1URSA 4GVOA 2AYSA 4YMAA 1UTHB 3H06B 1NFTA 4FEBA 2B3FA 2WKYA 1LCTA 2F36A 2OZZA 1SBPA 4U22A 5CRYA 4PFYA 4NF4A 3O29A 3VVEA 4EDPA 1TT1A 3VVFA 3K1NA 4XKPA 3PD8A 4H5FA 3QAXA 1JW1A 3B7DA 3MZ1A 4RK2A 3H4ZA 2OJTA 5FTHA 1H3DA 2I0BA 2O68A 3SEWA 4U1OA 3FJGA 3CFLA 4R2FA 4I1DA 5CBSA 2VP1A 4XIGQ 5H8SA 2VD2A 4WXJA 4YKIA 2HQ0A 3RT8A 1A40A 3RQTA 2B3BA 1KWHA 3K6XA 3G3JA 4AB5A 4GL0A 4KYEA 4DXBA 1MPCA 3R6UA 1R9LA 4F3BA 4POWA 2ANJA 4HTGA 4IO6A 5I2KA 3C9HA 3HCQA 5I59A 2HAUA 1BIYA 1I6QA 5AA2B 2Y7KA 3IJXB 4P11A 2XXTA 5AA4A 4EF1A 4TQUQ 4NEDA 4QFPA 3KJ7A 1B32A 1LGBC 3GZGA 3C4MA 2H5YA 3LSXA 2DOJA 1M5EA 2HCAA 3PMWA 1Y4CA 5TP9A 4R6HA 3FXUA 2F97A 1YTVA 3GLBA 4F3PA 5B7DA 5TU0A 3LSFB 3VLVA 4DLDA 1VFDA 1QUKA 3MQ9A 4R72A 3G3IA 4AQ4A 1PC3A 4JWXA 4O3BA 4YAHX 4DCXA 2THIA 4QSEA 5DEXA 1PEBA 3OXNA 3EHTA 3CI8A 5BUUA 2Y84A 3TZAA 2Q89A 4NWDA 1MS7A 2DWJA 1H44A 3V8XB 1B7ZA 1YPNA 2DSFA 1URDA 3IOUA 1H76A 1NNTA 4PE5B 1D4NA 2F6GA 4HW8A 3IK6B 4LQ2A 1MH4A 1J1NA 1YAEA 1LAGE 3SDFA 3KBRA 2GHBA 2ONRA 5ISUA 4PFWA 4GL8A 1Y9UA 2F35A 3ZS6A 4F39A 2V3TA 1GR2A 3P7IA 3FJ7A 4R6KA 1ZKBA 4FATA 1EZOA 4H8IA 1VSOA 2RKMA 1B9JA 1FQEA 2DP8A 3TMGA 2HZLA 3L6HA 4NF6B 3U1OA 5HBCA 3PPNA 1NL5A 3T9XB 1B40A 4LA9A 5ITPA 3B6QA 2QMXA 4IGTA 3CR9A 5DTBA 3N26A 3EHUA 2XXVA 3K6WA 4GFRA 5JK4A 3T22A 1NNPA 4POXA 1B6HA 2I0CA 3M3LA 4N13A 1P1NA 2V3QA 2QS1A 3RUMA 3VFJA 5LOMA 1N7WA 4YICA 1A99A 4ZEIA 3TFLA 3QYTA 1LBCA 4OXVA 4RXLA 3UGWA 3U92A 4F18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQG A;  4OZ9 A;  1O7T A;  4U1Z A;  4ZZE A;  1IXI A;  4M1V A;  3TEP A;  1SW1 A;  4OYV A;  2PYY A;  3USD A;  1PDA A;  1N7X A;  1D9Y A;  2DQV A;  1M5B A;  3IOR A;  1M5D A;  3V83 A;  1SQY A;  2IEE A;  3OO6 A;  3RGY A;  3H7M A;  4BDL A;  3TTL A;  3MPK A;  1NNK A;  3PPO A;  1PB9 A;  1ELJ A;  4O3C A;  3DP8 A;  3RTW B;  3OEL A;  2UXA A;  1MXW A;  4GF8 A;  2AL4 A;  4OQO A;  5K2X A;  2O69 A;  4IO7 A;  3SES A;  3JYR A;  3IJO B;  4IO2 A;  3PV0 E;  2V93 A;  1YCJ A;  1I6A A;  1DOT A;  4UA8 A;  4BDN A;  1EZ9 A;  3OEK A;  2UVH A;  5FHM A;  3KEI A;  1S7Y A;  3FAT A;  4G2Z A;  2D21 A;  1AH5 A;  1SYI A;  1M5C A;  1IUD A;  4NWC A;  1XC1 A;  4NF5 A;  1P1W A;  1B3L A;  1ANF A;  1B0H A;  3HHG A;  3O66 A;  3R26 A;  5H8Q B;  2A5T A;  1JVX A;  4EQB A;  3IB2 A;  3QSL A;  2ABH A;  4DXU A;  4F1U A;  1OVB A;  4FED A;  2O6A A;  1RYX A;  4ELP A;  4NF8 A;  4C1T A;  1IZ1 A;  3EPE A;  4RNS A;  2XXH A;  5L8D A;  4LAT A;  1QUJ A;  5I2N B;  4PQJ A;  2D3I A;  4G8H A;  3O6H A;  3HPI A;  1HSL A;  3FUZ A;  1MY3 A;  1FQC A;  3K6U A;  3LSW A;  3RY3 A;  3SEU A;  2XX7 A;  3UOR A;  3VLU A;  1DTZ A;  4LVQ A;  5F7V A;  2ZNT A;  3KN8 A;  3IX1 A;  4RPO A;  4NF4 B;  2HAV A;  4FEC A;  3TYH A;  1VE4 A;  4OFL A;  3V5A A;  3TQW A;  5L9S A;  4MFI A;  1EU8 A;  5HM4 B;  3B6W A;  3BKI B;  2X7P A;  1BLF A;  2REJ A;  3T66 A;  4P0G A;  4ZZA A;  1S9T A;  1UTB A;  1FTO A;  3CSB A;  5TPA A;  2XXX A;  4YKP A;  4QFO A;  2UYE A;  1A55 A;  2HEU A;  3BBR A;  2RC8 A;  1POY 1;  3S9E A;  2ZYO A;  1OMP A;  4GOT A;  3KFM A;  5I2K B;  5I59 B;  1MG1 A;  5AA1 A;  5DVF A;  2M8C A;  2RIN A;  3DP4 A;  4H0W A;  3HHF A;  1MQG A;  1D3K A;  3HST A;  2NUV A;  3MJN A;  4K3F A;  3BFT A;  4QRZ A;  3H6W A;  1IEJ A;  4LP2 B;  1HSE A;  4R75 A;  4EQ9 A;  1MQH A;  4BDR A;  3SEY A;  1MH3 A;  5TP9 B;  3SEV A;  2OLB A;  3ZKL A;  2UVG A;  2IA4 A;  3KN3 A;  4ZE8 A;  1PB8 A;  3G3G A;  3CFZ A;  2RF1 A;  5DVJ A;  3CG1 A;  3TCF A;  5IAI A;  4R73 A;  5CM6 A;  4LZ5 A;  3W9V A;  3HN0 A;  1UIV A;  3CIJ A;  1OLA A;  4XKQ A;  3TKD A;  4E0X A;  4WKM A;  3KZG A;  4OEN A;  4KYS A;  3C32 A;  1QUL A;  3ODB A;  3TDJ A;  5B70 A;  3PUX E;  2XX8 A;  3KSX A;  1SW4 A;  2O51 A;  2LAO A;  3LBS A;  4G68 B;  1SI1 A;  4DE8 A;  3UK4 A;  1B5J A;  1LAX A;  3M3F A;  1FQA A;  2ESN A;  2ONS A;  2HZK A;  3A3C A;  1ZJL A;  4YB6 A;  4X1B A;  4XTC Q;  3OO9 A;  3RN8 A;  1B7H A;  4ZDM A;  1T0K A;  1USY E;  1LAF E;  2DE4 A;  4BDM A;  1R9Q A;  3K00 A;  2HFB A;  1A8F A;  4ZEC A;  2QS4 A;  4KI0 E;  3PUY E;  3O28 A;  4O3A A;  3H6V A;  3VXB A;  1H43 A;  1AIV A;  2DXY A;  4IB2 A;  1AOV A;  3KN7 A;  1MXV A;  4EF2 A;  3U8Q A;  5IKB A;  2I4C A;  2VHA A;  4IO3 A;  4DZ1 A;  1UTH A;  4LUB A;  1Q1K A;  1R6Z A;  3OO7 A;  2PVU A;  1FCK A;  2H25 A;  3TTR A;  4H65 A;  3N6U A;  2UVI A;  1P1Q A;  4JWO A;  5CC2 A;  5CBR A;  4KYD A;  3IB0 A;  3UIF A;  4GIZ A;  1FTM A;  3FIR A;  5EHM A;  4NE4 A;  1US4 A;  3FJM A;  2YPN A;  3GBB A;  4R9G A;  3CVG A;  3K4U A;  1Y3P A;  3PD9 A;  2BJJ X;  1WOD A;  5H8N B;  3PPQ A;  5KDT A;  3THI A;  1NH8 A;  1LBB A;  3IOW A;  3DEL B;  1A7L A;  3FZV A;  1MPD A;  3N6T A;  1JQF A;  1TFA A;  4KD5 A;  5AA2 D;  5ELV A;  5DYH A;  2DVZ A;  5CMK A;  3KSJ A;  3FV1 A;  2CZL A;  1MDP 1;  4ND9 A;  4QF9 A;  3E9X A;  1MY0 A;  2O7U A;  3Q26 A;  4OET A;  5ICT A;  1NH7 A;  2GHA A;  3T93 B;  2O7I A;  1MQJ A;  3UN6 A;  4JDF A;  4ISU A;  3MAM A;  2QRY A;  2VOZ A;  4KCC A;  3C35 A;  4TLL B;  3PMV A;  2P1S A;  3D4G A;  3M8U A;  1I69 A;  3B6T A;  2QL3 A;  3CSG A;  3S9L C;  4U21 A;  5KCJ A;  4OHN A;  2OBG A;  3K1P A;  3RLF E;  4JBZ A;  2H99 A;  3E3K A;  2ZMB A;  4DCY A;  3MPL A;  1GTK A;  4NTL A;  4H1X A;  5JTY B;  2Z23 A;  4G68 C;  4R9F A;  2A5T B;  2XXY A;  4MLV A;  1Y1M A;  4F1V A;  2Y7W A;  3OD7 A;  2YJP A;  3VLW A;  3TQL A;  4C0R A;  3FV2 A;  4BDO A;  1N3W A;  4H6D A;  3EN3 A;  4GRK A;  4C1U A;  3D4C A;  3Q27 A;  2OWT A;  4KQP A;  2YLN A;  3TOD A;  3O2A A;  3O97 A;  3FVO A;  1R1N A;  1MRP A;  1A54 A;  2PX1 A;  2GH9 A;  1A8E A;  2DVC A;  4UAC A;  4YKJ A;  1O64 A;  1SYH A;  2ZYN A;  1POT A;  3ZSF A;  4PFT A;  4MLQ A;  4BLA A;  4FJP A;  2FA7 A;  4OTE A;  1N84 A;  4EQ7 A;  3HV1 A;  3HO7 A;  3H3G A;  5JEI A;  2I6E A;  2KLF A;  3FVN A;  4HCY A;  2CMO A;  2Y7R A;  2Q8J A;  2XD2 A;  3PPP A;  3PGF A;  4F19 A;  5DT6 A;  1MM6 A;  4ELR A;  3FAS A;  3W9W A;  1MPB A;  4Q5T A;  1FW0 A;  3N5L A;  1Y20 A;  2I3W A;  1B4Z A;  4PFU A;  3VXC A;  1B0L A;  5TPA B;  2A5S A;  1P1U A;  4RA1 A;  2QPQ A;  3R7X A;  4THI A;  1XVX A;  1EZP A;  4F29 A;  4YMB A;  1N3X A;  1LAH E;  4FE8 A;  3TTN A;  1QJM A;  4X1D A;  2NXO A;  1D9V A;  1DPP A;  3QIM A;  5H8H A;  3PPR A;  3S9N C;  2I58 A;  3WAE A;  1LB9 A;  4JSD A;  4OEU A;  1OLC A;  3S2V A;  1LB8 A;  1PB7 A;  3OO8 A;  3QUJ A;  1OQH A;  2XXP A;  4GXS B;  3UA8 A;  2H9B A;  5H8F A;  3IAZ A;  1P99 A;  1B3E A;  1L5T A;  3OSQ A;  1MXZ A;  1XHY A;  3SET A;  1Y4T A;  4JB7 A;  2RCA A;  2H4I A;  2XXU A;  5A5X A;  4XXU A;  1P1O A;  4U2R A;  2Q88 A;  3CFX A;  1MXX A;  4PP0 A;  5I57 A;  4IO5 A;  4U4X A;  5HPQ A;  5I56 A;  4N07 A;  1ZU0 A;  2Z8F A;  4U23 A;  3S4U A;  1LST A;  2DYX A;  2VGQ A;  5M2V A;  4OEV A;  2XXR A;  4OER A;  4DDD A;  3K02 A;  1RKM A;  2W7Y A;  3FXR A;  2V25 A;  4GWO A;  3MZB A;  4JWY A;  2G29 A;  1IXH A;  4YB5 A;  3RTF B;  3MP6 A;  3E4R A;  3V89 B;  4LQ5 A;  1IXC A;  3U93 A;  3LUY A;  2NWJ A;  4EXL A;  2VD3 A;  5AA4 B;  2AL5 A;  3G7W A;  3TAJ A;  4LZ8 A;  5I58 A;  1Y3Q A;  2XXI A;  1JW4 A;  3LR1 A;  4MF3 A;  3OEM A;  1UQW A;  1VFE A;  2OWS A;  1B5H A;  3OSR A;  2GFE A;  3PUV E;  1LLS A;  1B51 A;  1B2H A;  3QK6 A;  3MVZ A;  1B52 A;  3G3H A;  4GLI A;  1B3G A;  1B7U A;  4P0I A;  1LFI A;  1JVY A;  3IR1 A;  2O84 X;  1PBP A;  5I84 A;  4GQO A;  1SD3 A;  5DEX B;  3LSL A;  3MP8 A;  1N04 A;  2F6P A;  2DE3 A;  1NKX A;  3K6V A;  2XXW A;  4NMY A;  2Z8E A;  2FNC A;  1ZBM A;  2F7C A;  3KOT A;  1XOC A;  3VV5 A;  3TPA A;  1IIW A;  1JET A;  2DWA A;  2F78 A;  1XS5 A;  1MY1 A;  4ZS9 A;  3RNN A;  1N76 A;  4GD5 A;  4H5G A;  4U4S A;  5KDT B;  2V84 A;  3GXA A;  3K1M A;  2ZXT A;  2XX9 A;  2P2A A;  3E13 X;  3T9H B;  1DMB A;  3G3K A;  2O1L A;  4ELO A;  1II5 A;  1MY4 A;  1ZMG A;  3IO4 A;  1QVS A;  5FHN A;  1H45 A;  2P0S A;  3ONM A;  4M4G A;  4OES A;  2Q2C A;  1XT8 A;  5F1Q A;  2FYI A;  2R71 A;  4HS7 A;  2H98 A;  2G93 A;  1MQI A;  2Y7I A;  1FTK A;  4MBP A;  1B46 A;  3ILT B;  2DXR A;  1CB6 A;  1JW5 A;  3KJT A;  4OMB A;  1MM7 A;  2ONK E;  4H67 A;  1F9B A;  1TFD A;  4WEP A;  3K2D A;  4ONY A;  3MBP A;  1GVC A;  2DWH A;  2Z22 A;  1B3F A;  2Z8D A;  4RY1 A;  2GRV A;  1JNF A;  1URG A;  3L6G A;  2Y7P A;  5KCJ B;  3TCH A;  3MWB A;  1B05 A;  4WED A;  2I48 A;  3Q25 A;  1MDQ A;  3TTK A;  2RCB A;  4YZZ A;  3MC2 A;  4JXI A;  4IY5 A;  5ICQ A;  1MXU A;  4LON B;  3MVY A;  5J1D A;  3U72 A;  3TEL A;  5EHS A;  1QW0 A;  4YU0 A;  3I3V A;  2OK2 A;  3OMB A;  4DIG A;  1SDX A;  3TTM A;  1QKA A;  1SVX B;  2R9J A;  1N0T A;  3VE1 B;  2ZYM A;  4XKN A;  3RPW A;  1BTJ A;  3O6I A;  2D5W A;  1DPE A;  4PET A;  2F5X A;  4ECF A;  2PT1 A;  3ILU B;  4RYA A;  3IL1 B;  4G68 A;  1B1X A;  1RYO A;  4MH5 A;  2E0S A;  1SI0 A;  2I4B A;  4R74 A;  1Q35 A;  2RC9 A;  3PU5 A;  3FVK A;  3VDF A;  3LC8 A;  2ZNS A;  2E1S A;  4ZEF A;  1IIT A;  5AA2 A;  3EHS A;  1JEU A;  1B1H A;  3CG3 A;  1AMF A;  2X7Q A;  4N6P A;  1US5 A;  3U94 A;  1EH3 A;  4LZ7 A;  3MW0 A;  1NMU A;  4XKR A;  4R6Y A;  2PBW A;  4RJZ A;  1Y3N A;  1LFG A;  3T9V A;  2PMS A;  1M5F A;  4F2O A;  1B3H A;  3ZKK A;  5DVI A;  3MVW A;  4NF5 B;  1OIB A;  4H8J A;  2I3V A;  1SW5 A;  4KCD A;  2HXW A;  3C31 A;  4RPN A;  1TWY A;  1B58 A;  1FQF A;  3DP6 A;  2QSX A;  1USY H;  2Q9T A;  3PUZ E;  3VVD A;  2XXQ A;  4Z7E A;  4NF8 B;  1HSJ A;  1WDN A;  4ELQ A;  1AL3 A;  4IGR A;  5BWJ A;  2NOO A;  4F31 B;  2AIX A;  2Q2A A;  5H8H B;  3MZ9 A;  1ATG A;  2F8D A;  1MXY A;  3FD3 A;  4F1Y A;  4G4P A;  3RT6 B;  5H8N A;  3I5O A;  5L9O A;  3QXM A;  1FQB A;  1OVT A;  1Z7M E;  2QJE A;  5H8F B;  4KHZ E;  4TLM B;  4OWD A;  2DWI A;  4ESX A;  1Z7N E;  3OEN A;  4IO4 A;  4FIM A;  4YB7 A;  5CI5 A;  1DSN A;  1DTG A;  4I8C A;  2O1M A;  3PMX A;  1FTJ A;  2F7B A;  3MUQ A;  5ITO A;  2XHD A;  1XVY A;  2REG A;  4ZED A;  4ESW A;  5A5X B;  4EUO A;  3PUW E;  5AE4 A;  4NF6 A;  1GV8 A;  3UP9 A;  5I57 B;  3G3F A;  1LCF A;  5I56 B;  1Y1Z A;  1BKA A;  1UTB B;  2UYF A;  4BDQ A;  3EF7 A;  3C33 A;  3Q28 A;  4AB6 A;  1QKB A;  2UVJ A;  1B5I A;  1MY2 A;  1ZLQ A;  1B4H A;  3K01 A;  4QFL A;  5AA3 A;  4X48 A;  3C34 A;  4TOZ A;  1SW2 A;  1QUI A;  1ZIU A;  1I6B A;  4R2B A;  3H6T A;  4F3S A;  3IOT A;  1NNF A;  4L17 A;  5JTY A;  1O63 A;  1LFH A;  3I6V A;  2F34 A;  3AXF A;  1FQD A;  4ZEK A;  4E0W A;  3S9M C;  5K2Y A;  4IY6 A;  4QSC A;  3O9P A;  3IOV A;  4I9D A;  4QFK A;  4DXC A;  3A3U A;  5I58 B;  5CMB A;  2QMW A;  4JSO A;  3SKP A;  1BP5 A;  1UIU A;  1PBQ A;  2B65 A;  3JV9 A;  4X9T A;  4Z0I A;  1ZTY A;  3MVX A;  4KPT A;  3W15 C;  2R6G E;  4QHQ A;  5L9M A;  2X26 A;  3N94 A;  4FOR A;  2NVU B;  3OOA A;  4Q0C A;  4F3G A;  5KZT A;  3JZJ A;  4YKK A;  2V3U A;  3O6G A;  2ALU A;  3SER A;  1WVJ A;  3T9U A;  3MP1 A;  4QFN A;  4KFQ A;  4OVJ A;  4ZEB A;  4G8M A;  4G77 A;  3ECR A;  2DS9 A;  3SEX A;  4GXA A;  3DM0 A;  1JEV A;  3KG2 A;  3GBA A;  3T96 B;  5CMM A;  4FAJ A;  5FHO A;  3IO6 A;  3FVG A;  4OFJ A;  3H03 A;  2PT2 A;  1GGG A;  3C36 A;  3M3K A;  2OCU A;  3FXQ A;  3KOS A;  3IB1 A;  4OFO A;  3K0V A;  4G8N A;  5FTI A;  1IXG A;  4F22 A;  4Q8R A;  5H8Q A;  3KGC A;  4HCW A;  1FTL A;  2RC7 A;  5CMC A;  3H6U A;  2XD3 A;  3A09 A;  3F11 A;  3QUF A;  4EXK A;  1TXF A;  5EYF A;  1IQ7 A;  4ZE9 A;  3EQ1 A;  3WAF A;  2ZNU A;  4I62 A;  4Q30 B;  4F2Q A;  3FGS A;  3DLN A;  2QS3 A;  5I2N A;  2I49 A;  4RK9 A;  3CRB A;  4QSD A;  2F7A A;  1S50 A;  1VR5 A;  2QS2 A;  3BFU A;  2ZYK A;  3TCG A;  3TUS A;  4KR5 A;  1CE2 A;  2DE2 A;  3Q29 A;  1MQD A;  1URS A;  4GVO A;  2AYS A;  4YMA A;  1UTH B;  3H06 B;  1NFT A;  4FEB A;  2B3F A;  2WKY A;  1LCT A;  2F36 A;  2OZZ A;  1SBP A;  4U22 A;  5CRY A;  4PFY A;  4NF4 A;  3O29 A;  3VVE A;  4EDP A;  1TT1 A;  3VVF A;  3K1N A;  4XKP A;  3PD8 A;  4H5F A;  3QAX A;  1JW1 A;  3B7D A;  3MZ1 A;  4RK2 A;  3H4Z A;  2OJT A;  5FTH A;  1H3D A;  2I0B A;  2O68 A;  3SEW A;  4U1O A;  3FJG A;  3CFL A;  4R2F A;  4I1D A;  5CBS A;  2VP1 A;  4XIG Q;  5H8S A;  2VD2 A;  4WXJ A;  4YKI A;  2HQ0 A;  3RT8 A;  1A40 A;  3RQT A;  2B3B A;  1KWH A;  3K6X A;  3G3J A;  4AB5 A;  4GL0 A;  4KYE A;  4DXB A;  1MPC A;  3R6U A;  1R9L A;  4F3B A;  4POW A;  2ANJ A;  4HTG A;  4IO6 A;  5I2K A;  3C9H A;  3HCQ A;  5I59 A;  2HAU A;  1BIY A;  1I6Q A;  5AA2 B;  2Y7K A;  3IJX B;  4P11 A;  2XXT A;  5AA4 A;  4EF1 A;  4TQU Q;  4NED A;  4QFP A;  3KJ7 A;  1B32 A;  1LGB C;  3GZG A;  3C4M A;  2H5Y A;  3LSX A;  2DOJ A;  1M5E A;  2HCA A;  3PMW A;  1Y4C A;  5TP9 A;  4R6H A;  3FXU A;  2F97 A;  1YTV A;  3GLB A;  4F3P A;  5B7D A;  5TU0 A;  3LSF B;  3VLV A;  4DLD A;  1VFD A;  1QUK A;  3MQ9 A;  4R72 A;  3G3I A;  4AQ4 A;  1PC3 A;  4JWX A;  4O3B A;  4YAH X;  4DCX A;  2THI A;  4QSE A;  5DEX A;  1PEB A;  3OXN A;  3EHT A;  3CI8 A;  5BUU A;  2Y84 A;  3TZA A;  2Q89 A;  4NWD A;  1MS7 A;  2DWJ A;  1H44 A;  3V8X B;  1B7Z A;  1YPN A;  2DSF A;  1URD A;  3IOU A;  1H76 A;  1NNT A;  4PE5 B;  1D4N A;  2F6G A;  4HW8 A;  3IK6 B;  4LQ2 A;  1MH4 A;  1J1N A;  1YAE A;  1LAG E;  3SDF A;  3KBR A;  2GHB A;  2ONR A;  5ISU A;  4PFW A;  4GL8 A;  1Y9U A;  2F35 A;  3ZS6 A;  4F39 A;  2V3T A;  1GR2 A;  3P7I A;  3FJ7 A;  4R6K A;  1ZKB A;  4FAT A;  1EZO A;  4H8I A;  1VSO A;  2RKM A;  1B9J A;  1FQE A;  2DP8 A;  3TMG A;  2HZL A;  3L6H A;  4NF6 B;  3U1O A;  5HBC A;  3PPN A;  1NL5 A;  3T9X B;  1B40 A;  4LA9 A;  5ITP A;  3B6Q A;  2QMX A;  4IGT A;  3CR9 A;  5DTB A;  3N26 A;  3EHU A;  2XXV A;  3K6W A;  4GFR A;  5JK4 A;  3T22 A;  1NNP A;  4POX A;  1B6H A;  2I0C A;  3M3L A;  4N13 A;  1P1N A;  2V3Q A;  2QS1 A;  3RUM A;  3VFJ A;  5LOM A;  1N7W A;  4YIC A;  1A99 A;  4ZEI A;  3TFL A;  3QYT A;  1LBC A;  4OXV A;  4RXL A;  3UGW A;  3U92 A;  4F18 A; 
#chains in the Genus database with same CATH topology
 1FBF A;  1OQG A;  4OZ9 A;  1O7T A;  4U1Z A;  4ZZE A;  1IXI A;  4M1V A;  1D9Q A;  2QVR A;  1FPL A;  2DDK A;  3TEP A;  2Q8M A;  1SW1 A;  1IME A;  4OYV A;  2PYY A;  3USD A;  1PDA A;  1N7X A;  1D9Y A;  2DQV A;  3LV0 A;  4MHF A;  1M5B A;  4P1E A;  3IOR A;  1M5D A;  3V83 A;  1SQY A;  2IEE A;  3OO6 A;  3RGY A;  3H7M A;  4BDL A;  3TTL A;  4PBQ A;  3MPK A;  1NNK A;  3PPO A;  1PB9 A;  1ELJ A;  3B8B A;  4O3C A;  3DP8 A;  3RTW B;  3OEL A;  2UXA A;  1MXW A;  4GF8 A;  2AL4 A;  4OQO A;  5K2X A;  2O69 A;  4IO7 A;  3SES A;  3JYR A;  3IJO B;  4IO2 A;  3PV0 E;  2V93 A;  1YCJ A;  4MMP A;  1I6A A;  1DOT A;  4UA8 A;  3QMF A;  4BDN A;  1EZ9 A;  3OEK A;  2UVH A;  5FHM A;  3KEI A;  1S7Y A;  3FAT A;  4G2Z A;  2D21 A;  1AH5 A;  1SYI A;  1M5C A;  1IUD A;  4NWC A;  3IFA A;  1XC1 A;  4NF5 A;  1P1W A;  1B3L A;  5EYG A;  1ANF A;  1FPI A;  1B0H A;  3HHG A;  1YYZ A;  3O66 A;  3R26 A;  5H8Q B;  2A5T A;  1JVX A;  4EQB A;  4XF5 A;  5IM2 A;  3IB2 A;  3QSL A;  2ABH A;  4DXU A;  4F1U A;  1OVB A;  4FED A;  2O6A A;  1RYX A;  4ELP A;  4NF8 A;  1IZ1 A;  4C1T A;  3EPE A;  4RNS A;  2XXH A;  5L8D A;  4LAT A;  2B4M A;  1QUJ A;  3E78 A;  5I2N B;  4PQJ A;  2D3I A;  4G8H A;  3O6H A;  3HPI A;  1HSL A;  3FUZ A;  1MY3 A;  2L5V A;  1FQC A;  3D1R A;  3K6U A;  3LSW A;  3RY3 A;  1FBE A;  3SEU A;  2QVV A;  2XX7 A;  3UOR A;  3VLU A;  2B4L A;  1DTZ A;  4LVQ A;  5F7V A;  2ZNT A;  3KN8 A;  3IX1 A;  4RPO A;  4NF4 B;  2HAV A;  5EQ7 A;  4FEC A;  3TYH A;  1VE4 A;  4OFL A;  3V5A A;  2BJI A;  3TQW A;  5L9S A;  4MFI A;  1EU8 A;  5HM4 B;  3B6W A;  3BKI B;  2X7P A;  1BLF A;  2REJ A;  3T66 A;  4P0G A;  4ZZA A;  1S9T A;  1UTB A;  1FTO A;  3CSB A;  4PDD A;  1NV6 A;  5TPA A;  4KXP A;  2XXX A;  4YKP A;  4QFO A;  4H46 A;  2UYE A;  4N8G A;  1A55 A;  2FBP A;  2HEU A;  3BBR A;  2RC8 A;  1POY 1;  3S9E A;  2ZYO A;  1OMP A;  4JVC A;  4GOT A;  3KFM A;  5I2K B;  5I59 B;  1MG1 A;  5ET8 A;  5AA1 A;  5DVF A;  2M8C A;  2RIN A;  4OVT A;  3DP4 A;  4H0W A;  4N17 A;  3HHF A;  1MQG A;  1D3K A;  3HST A;  2NUV A;  3MJN A;  4K3F A;  3BFT A;  4QRZ A;  3H6W A;  1IEJ A;  4LP2 B;  1HSE A;  4R75 A;  4EQ9 A;  1G0H A;  1MQH A;  4BDR A;  4OAN A;  1RDZ A;  3SEY A;  1MH3 A;  5TP9 B;  3SEV A;  2OLB A;  3ZKL A;  2UVG A;  2IA4 A;  2HHM A;  3KN3 A;  4ZE8 A;  1PB8 A;  3G3G A;  1RDY A;  3CFZ A;  2RF1 A;  5DVJ A;  3CG1 A;  3TCF A;  5IAI A;  3CHG A;  4R73 A;  5CM6 A;  4LZ5 A;  3W9V A;  3HN0 A;  1UIV A;  3CIJ A;  2XWO A;  5DW8 A;  1OLA A;  4XKQ A;  3TKD A;  4E0X A;  4WKM A;  3KZG A;  4OEN A;  4KYS A;  3C32 A;  1QUL A;  3ODB A;  3TDJ A;  5B70 A;  3PUX E;  2XX8 A;  3KSX A;  4PC9 A;  1FBP A;  1SW4 A;  2O51 A;  2LAO A;  3LBS A;  4G68 B;  1SI1 A;  4PAK A;  4O8M A;  4DE8 A;  3UK4 A;  1B5J A;  1LAX A;  3M3F A;  5I5P A;  1FQA A;  2ESN A;  2ONS A;  2HZK A;  2F3B A;  3A3C A;  1ZJL A;  4MNP A;  4YB6 A;  4OVR A;  2CEX A;  4X1B A;  4XTC Q;  3OO9 A;  3RN8 A;  2FVZ A;  1LBW A;  1B7H A;  4ZDM A;  1T0K A;  1USY E;  1LAF E;  2DE4 A;  4BDM A;  1R9Q A;  4NX1 A;  3K00 A;  3MYU A;  2HFB A;  4GWS A;  1A8F A;  4ZEC A;  3RPL B;  2QS4 A;  4KI0 E;  3PUY E;  3O28 A;  4O3A A;  3H6V A;  3VXB A;  1H43 A;  1AIV A;  5I7I A;  1JP4 A;  2DXY A;  4IB2 A;  1AOV A;  3KN7 A;  1MXV A;  4EF2 A;  1EYI A;  1XI6 A;  3U8Q A;  5IKB A;  2I4C A;  2VHA A;  4IO3 A;  4DZ1 A;  1UTH A;  1NUZ A;  4LUB A;  1Q1K A;  1R6Z A;  3OO7 A;  2FHY A;  2PVU A;  1FCK A;  2H25 A;  3TTR A;  4H65 A;  3N6U A;  2UVI A;  1P1Q A;  4JWO A;  5CC2 A;  5CBR A;  4KYD A;  3IB0 A;  3UIF A;  4GIZ A;  1FTM A;  3FIR A;  5EHM A;  4N6K A;  2P3N A;  4NE4 A;  1US4 A;  3FJM A;  2YPN A;  1DBZ A;  3GBB A;  4R9G A;  3CVG A;  3K4U A;  1Y3P A;  3PD9 A;  2BJJ X;  3BIH A;  1WOD A;  5IGA A;  5H8N B;  3PPQ A;  5KDT A;  3THI A;  1NH8 A;  1LBB A;  3IOW A;  3DEL B;  1A7L A;  3FZV A;  1MPD A;  3N6T A;  2ZZV A;  1JQF A;  1TFA A;  1FBH A;  3KC1 A;  4KD5 A;  5AA2 D;  5ELV A;  5DYH A;  2DVZ A;  5CMK A;  3KSJ A;  3FV1 A;  2CZL A;  1MDP 1;  4ND9 A;  4QF9 A;  3E9X A;  1MY0 A;  2O7U A;  3Q26 A;  4OET A;  4PFB A;  5ICT A;  1NH7 A;  2GHA A;  4JVI A;  3T93 B;  2O7I A;  1MQJ A;  3UN6 A;  4JDF A;  4ISU A;  3MAM A;  2QRY A;  2VOZ A;  4KCC A;  3C35 A;  4TLL B;  3PMV A;  2P1S A;  4MNI A;  3D4G A;  3M8U A;  4N6D A;  1I69 A;  4GWY A;  3B6T A;  2QL3 A;  3CSG A;  3S9L C;  4U21 A;  5KCJ A;  4OHN A;  4GBW A;  2OBG A;  3K1P A;  3RLF E;  4JBZ A;  3LUZ A;  2H99 A;  3E3K A;  2PFY A;  2ZMB A;  4DCY A;  3MPL A;  1GTK A;  4NTL A;  4H1X A;  5JTY B;  2Z23 A;  4G68 C;  4R9F A;  2A5T B;  5A5L A;  4AS5 A;  2XXY A;  4MLV A;  1Y1M A;  4F1V A;  2Y7W A;  3OD7 A;  2YJP A;  3VLW A;  3TQL A;  4HE1 A;  4C0R A;  3FV2 A;  4BDO A;  1N3W A;  4H6D A;  3EN3 A;  4GRK A;  4C1U A;  3D4C A;  3Q27 A;  2OWT A;  4KQP A;  2YLN A;  3TOD A;  3O2A A;  3O97 A;  3FVO A;  1R1N A;  1MRP A;  4MJO A;  1A54 A;  2PX1 A;  2HXR A;  2GH9 A;  1A8E A;  2DVC A;  4UAC A;  4YKJ A;  1O64 A;  1SYH A;  2ZYN A;  1POT A;  3ZSF A;  4PFT A;  2PFZ A;  4MLQ A;  4BLA A;  4FJP A;  2FA7 A;  3EKI A;  4OTE A;  1N84 A;  4EQ7 A;  3HV1 A;  4NQ8 A;  1YZ0 A;  3H3G A;  3HO7 A;  5JEI A;  2I6E A;  5T3J A;  2KLF A;  3FVN A;  1DCU A;  4HCY A;  2CMO A;  2Y7R A;  2Q8J A;  2XD2 A;  1LBY A;  3PPP A;  3PGF A;  2XWI A;  4F19 A;  5DT6 A;  1MM6 A;  4ELR A;  3FAS A;  3W9W A;  1NV1 A;  1MPB A;  4Q5T A;  4QXD A;  1FW0 A;  3N5L A;  1NI9 A;  1Y20 A;  2I3W A;  1CNQ A;  1B4Z A;  4PFU A;  5IZ3 B;  3VXC A;  2MKZ A;  1B0L A;  5TPA B;  2A5S A;  1P1U A;  4RA1 A;  2QPQ A;  3R7X A;  4THI A;  1XVX A;  1EZP A;  4F29 A;  3ROJ A;  4YMB A;  1N3X A;  1LAH E;  4FE8 A;  3TTN A;  4NG7 A;  1QJM A;  4X1D A;  2NXO A;  1D9V A;  1DPP A;  3QIM A;  4G61 A;  5H8H A;  3PPR A;  3S9N C;  2I58 A;  3WAE A;  3GYY A;  1LB9 A;  1FJ9 A;  4FBP A;  5ESY A;  4JSD A;  3NOH A;  4OEU A;  1OLC A;  3S2V A;  1LB8 A;  1PB7 A;  3OO8 A;  4O7I A;  3QUJ A;  1OQH A;  2XXP A;  1VDW A;  4GXS B;  3UA8 A;  4GX4 A;  2GQ1 A;  2H9B A;  5H8F A;  3IAZ A;  2Y5K A;  1P99 A;  1B3E A;  1L5T A;  3OSQ A;  1MXZ A;  1XHY A;  3SET A;  2FIE A;  1Y4T A;  3HFU A;  4JB7 A;  2RCA A;  2H4I A;  2XXU A;  5A5X A;  4XXU A;  1P1O A;  4U2R A;  2Q88 A;  3CFX A;  1MXX A;  4PP0 A;  1FPG A;  5I57 A;  4IO5 A;  1LBZ A;  4U4X A;  5HPQ A;  5I56 A;  2Q74 A;  4N07 A;  4XEQ A;  1INP A;  1ZU0 A;  2Z8F A;  4PBH A;  4U23 A;  3S4U A;  1LBX A;  1LST A;  1IMD A;  2DYX A;  2VGQ A;  5M2V A;  4OEV A;  2XXR A;  4OER A;  4DDD A;  3K02 A;  1RKM A;  2W7Y A;  3FXR A;  2V25 A;  4GWO A;  3MZB A;  4JWY A;  2G29 A;  1IXH A;  4YB5 A;  2CEY A;  3RTF B;  3MP6 A;  4NN3 A;  3E4R A;  4LQ5 A;  3V89 B;  1IXC A;  3U93 A;  3LUY A;  2CZK A;  2NWJ A;  4EXL A;  2VD3 A;  5AA4 B;  2AL5 A;  3G7W A;  3TAJ A;  2XWK A;  4LZ8 A;  5I58 A;  4P56 A;  1Y3Q A;  4JVD A;  4PAF A;  2XXI A;  1JW4 A;  3LR1 A;  4MF3 A;  3OEM A;  1UQW A;  1VFE A;  2OWS A;  3FBP A;  1B5H A;  3OSR A;  2GFE A;  3PUV E;  1LLS A;  1B51 A;  1B2H A;  3QK6 A;  3MVZ A;  1B52 A;  3G3H A;  4GLI A;  1B3G A;  1B7U A;  4P0I A;  1LFI A;  1JVY A;  5EQA A;  3IR1 A;  2O84 X;  1PBP A;  5I84 A;  4GQO A;  1SD3 A;  5DEX B;  3LSL A;  3MP8 A;  1N04 A;  2F6P A;  2DE3 A;  1NKX A;  1AWB A;  3K6V A;  2XXW A;  2ZZX A;  4NMY A;  2Z8E A;  2FNC A;  1ZBM A;  2F7C A;  3KOT A;  4HE2 A;  1XOC A;  5EQ8 A;  3VV5 A;  3TPA A;  1IIW A;  1JET A;  2WEF A;  2DWA A;  2F78 A;  1LBV A;  1XS5 A;  1MY1 A;  4ZS9 A;  3RNN A;  1FBD A;  1N76 A;  4GD5 A;  4H5G A;  4U4S A;  5KDT B;  1RDX A;  2V84 A;  3GXA A;  3K1M A;  2ZXT A;  2XX9 A;  1FPF A;  2P2A A;  4N4U A;  3E13 X;  3T9H B;  1DMB A;  3G3K A;  2JJK A;  2O1L A;  4ELO A;  1II5 A;  1MY4 A;  1ZMG A;  3IO4 A;  1QVS A;  2XXK A;  1KA0 A;  5FHN A;  1H45 A;  2P0S A;  3ONM A;  4M4G A;  1NUX A;  4P9K A;  4OES A;  1BK4 A;  2Q2C A;  1XT8 A;  5F1Q A;  2FYI A;  2R71 A;  4HS7 A;  2H98 A;  2G93 A;  1MQI A;  2Y7I A;  1FTK A;  4MBP A;  1B46 A;  3ILT B;  2DXR A;  1CB6 A;  1JW5 A;  3KJT A;  4OMB A;  1MM7 A;  2ONK E;  4H67 A;  1F9B A;  1TFD A;  4WEP A;  3U65 A;  4I40 A;  3K2D A;  4ONY A;  3MBP A;  1GVC A;  2DWH A;  2Z22 A;  1B3F A;  2Z8D A;  4RY1 A;  2GRV A;  1JNF A;  4HE0 A;  1URG A;  3L6G A;  2Y7P A;  5KCJ B;  3TCH A;  3MWB A;  1B05 A;  4WED A;  2I48 A;  3Q25 A;  1MDQ A;  3TTK A;  2RCB A;  4YZZ A;  3MC2 A;  4JXI A;  4IY5 A;  4NAP A;  4X8R A;  4O94 A;  5ICQ A;  1MXU A;  4N8Y A;  4LON B;  3MVY A;  5J1D A;  3U72 A;  3TEL A;  5EHS A;  2WYK A;  1SPI A;  1QW0 A;  4YU0 A;  2V4C A;  4PGP A;  4PTK A;  3I3V A;  2OK2 A;  3OMB A;  4DIG A;  1SDX A;  3TTM A;  1QKA A;  1SVX B;  2R9J A;  1N0T A;  3VE1 B;  2CZI A;  2ZYM A;  4XKN A;  4X04 A;  3RPW A;  1BTJ A;  3O6I A;  2D5W A;  1DPE A;  4PET A;  2F5X A;  4ECF A;  2PT1 A;  3ILU B;  4RYA A;  3IL1 B;  4G68 A;  1B1X A;  1RYO A;  2XWV A;  4N91 A;  4GWW A;  4MH5 A;  2E0S A;  1SI0 A;  1FPB A;  2I4B A;  4PAI A;  4R74 A;  1Q35 A;  2RC9 A;  3PU5 A;  3FVK A;  3VDF A;  3B50 A;  3LC8 A;  2ZZW A;  2ZNS A;  2E1S A;  4ZEF A;  1IIT A;  5AA2 A;  4DI4 B;  3EHS A;  1JEU A;  1B1H A;  3CG3 A;  1AMF A;  2X7Q A;  4N6P A;  1US5 A;  3U94 A;  1EH3 A;  5ET7 A;  4LZ7 A;  3MW0 A;  1NMU A;  4XKR A;  4R6Y A;  2PBW A;  5F24 A;  3A29 A;  4RJZ A;  1Y3N A;  1LFG A;  1NV4 A;  3T9V A;  2PMS A;  1EYJ A;  1M5F A;  4F2O A;  1B3H A;  2QFL A;  3ZKK A;  5DVI A;  3MVW A;  3PTY A;  1OIB A;  4NF5 B;  4H8J A;  2I3V A;  5LDZ A;  1SW5 A;  4KCD A;  2HXW A;  4H45 A;  3C31 A;  4RPN A;  1IMA A;  1TWY A;  1B58 A;  1FQF A;  3DP6 A;  2QSX A;  1USY H;  2Q9T A;  3PUZ E;  3VVD A;  2XXQ A;  4Z7E A;  4NF8 B;  1HSJ A;  1WDN A;  4ELQ A;  1AL3 A;  4IGR A;  5BWJ A;  2NOO A;  4F31 B;  2AIX A;  2Q2A A;  5H8H B;  1NV3 A;  3MZ9 A;  1ATG A;  2F8D A;  1MXY A;  3FD3 A;  4F1Y A;  4G4P A;  3RT6 B;  5H8N A;  1Q9D A;  2VPN A;  3I5O A;  5L9O A;  3QXM A;  5EYH A;  4PE3 A;  1KZ8 A;  3KC0 A;  1FQB A;  1OVT A;  5ET6 A;  1Z7M E;  2QJE A;  5H8F B;  4KHZ E;  4TLM B;  4OWD A;  1FJ6 A;  1IMB A;  2DWI A;  4ESX A;  1Z7N E;  3OEN A;  4IO4 A;  4PCD A;  4FIM A;  4YB7 A;  5CI5 A;  1DSN A;  1DTG A;  2QVU A;  1FPJ A;  4I8C A;  2O1M A;  3PMX A;  1FTJ A;  2F7B A;  3MUQ A;  5ITO A;  2XHD A;  4PGN A;  1XVY A;  2REG A;  4ZED A;  4ESW A;  4GWU A;  5A5X B;  4AS4 A;  3PUW E;  4EUO A;  5AE4 A;  4NF6 A;  1GV8 A;  3UP9 A;  5I57 B;  3G3F A;  1LCF A;  4P1L A;  5I56 B;  1Y1Z A;  1BKA A;  1UTB B;  2UYF A;  4BDQ A;  3EF7 A;  3C33 A;  3Q28 A;  4AB6 A;  1QKB A;  2UVJ A;  1B5I A;  4DI3 D;  1MY2 A;  1ZLQ A;  1B4H A;  3K01 A;  4QFL A;  5AA3 A;  4X48 A;  3C34 A;  4TOZ A;  1SW2 A;  1QUI A;  2FIX A;  1ZIU A;  1I6B A;  4R2B A;  4NGU A;  3H6T A;  4F3S A;  3IOT A;  1NNF A;  4L17 A;  1QGX A;  1YXI A;  5JTY A;  1IMC A;  1O63 A;  1LFH A;  3I6V A;  2F34 A;  3AXF A;  1FQD A;  4ZEK A;  4E0W A;  3S9M C;  5K2Y A;  3RYD A;  4IY6 A;  4QSC A;  3T0J A;  3O9P A;  3IOV A;  4I9D A;  4QFK A;  4DXC A;  3A3U A;  5I58 B;  4QBA A;  2QMW A;  5CMB A;  4JSO A;  3SKP A;  1BP5 A;  1UIU A;  1PBQ A;  2B65 A;  3JV9 A;  4X9T A;  4Z0I A;  1ZTY A;  1FPK A;  3MVX A;  4KPT A;  3W15 C;  5IZZ A;  4LN5 A;  2R6G E;  4QHQ A;  5L9M A;  2X26 A;  3N94 A;  5FBP A;  4FOR A;  2NVU B;  3OOA A;  4Q0C A;  4F3G A;  5KZT A;  3JZJ A;  4YKK A;  2V3U A;  3O6G A;  2ALU A;  3SER A;  1K9Z A;  1WVJ A;  3T9U A;  3MP1 A;  4QFN A;  1FPD A;  4KFQ A;  4OVJ A;  4OA4 A;  4ZEB A;  4G8M A;  4G77 A;  3ECR A;  2DS9 A;  3SEX A;  4GXA A;  3DM0 A;  1JEV A;  3KG2 A;  4MAG A;  3GBA A;  3T96 B;  5CMM A;  4FAJ A;  2WYP A;  5FHO A;  3IO6 A;  2P3V A;  3FVG A;  4OFJ A;  3H03 A;  2VPO A;  2PT2 A;  3MST A;  1GGG A;  3C36 A;  5ET5 A;  2VT5 A;  1NV0 A;  3M3K A;  2OCU A;  5IZ3 A;  3FXQ A;  3KOS A;  3IB1 A;  4OFO A;  3K0V A;  4G8N A;  1NV5 A;  5FTI A;  1IXG A;  4F22 A;  4Q8R A;  5H8Q A;  4OVS A;  3KGC A;  4HCW A;  4PDH A;  1FTL A;  2RC7 A;  5CMC A;  5IZ1 A;  3H6U A;  2XD3 A;  1IMF A;  3A09 A;  3F11 A;  3QUF A;  5EQ9 A;  4EXK A;  1DK4 A;  1TXF A;  5EYF A;  1IQ7 A;  4ZE9 A;  3EQ1 A;  3WAF A;  2ZNU A;  2WBB A;  4I62 A;  4Q30 B;  4F2Q A;  3FGS A;  3DLN A;  4I3E A;  1NUW A;  1G0I A;  1LEV A;  2QS3 A;  5I2N A;  2I49 A;  4RK9 A;  3CRB A;  4QSD A;  2F7A A;  1S50 A;  1VR5 A;  4PFR A;  4MIJ A;  1FRP A;  2QS2 A;  3BFU A;  2F3D A;  2ZYK A;  3TCG A;  3TUS A;  4KR5 A;  1CE2 A;  1NV7 A;  2DE2 A;  3Q29 A;  1MQD A;  1URS A;  4GVO A;  2AYS A;  4YMA A;  1UTH B;  3FXB A;  4MNC A;  3H06 B;  1NFT A;  3T1B A;  4FEB A;  4XFE A;  1FSA A;  2B3F A;  2WKY A;  1LCT A;  2F36 A;  2OZZ A;  1SBP A;  2WX9 A;  4HXV A;  4U22 A;  5CRY A;  4PFI A;  4PFY A;  4NF4 A;  3O29 A;  3VVE A;  4EDP A;  1TT1 A;  3VVF A;  4P8B A;  2KQZ A;  3K1N A;  4XKP A;  3PD8 A;  4H5F A;  5J16 A;  3QAX A;  1JW1 A;  3B7D A;  3MZ1 A;  4RK2 A;  3H4Z A;  2OJT A;  5FTH A;  1H3D A;  2I0B A;  2O68 A;  3SEW A;  4U1O A;  3FJG A;  2KR0 A;  3CFL A;  4R2F A;  4I1D A;  5CBS A;  3ISP A;  2VP1 A;  4XIG Q;  5H8S A;  2VD2 A;  4WXJ A;  4YKI A;  2HQ0 A;  3RT8 A;  1A40 A;  3RQT A;  2B3B A;  1KWH A;  3K6X A;  3G3J A;  4GBV A;  4AB5 A;  4GL0 A;  4KYE A;  4P47 A;  4DXB A;  2WBD A;  1MPC A;  3R6U A;  1R9L A;  4F3B A;  4POW A;  2ANJ A;  4HTG A;  4IO6 A;  5I2K A;  3C9H A;  3HCQ A;  5I59 A;  2HAU A;  1BIY A;  3BIG A;  1I6Q A;  1NUY A;  5AA2 B;  4GWZ A;  2Y7K A;  3IJX B;  4P11 A;  2XXT A;  5AA4 A;  4EF1 A;  1FBC A;  4P3L A;  4TQU Q;  2CZH A;  4NED A;  4QFP A;  3KBZ A;  3KJ7 A;  1B32 A;  1LGB C;  3GZG A;  4OVQ A;  3C4M A;  4OVP A;  2H5Y A;  2Y5L A;  3LSX A;  1FPE A;  2DOJ A;  1M5E A;  4PF6 A;  2HCA A;  3PMW A;  1Y4C A;  5TP9 A;  4R6H A;  3FXU A;  2F97 A;  1YTV A;  3GLB A;  4F3P A;  5B7D A;  5TU0 A;  3LSF B;  2OX3 A;  4PF8 A;  3VLV A;  4DLD A;  1KA1 A;  4N81 A;  1VFD A;  1QUK A;  2R8T A;  3MQ9 A;  4R72 A;  3G3I A;  4AQ4 A;  1PC3 A;  4JWX A;  4O3B A;  4YAH X;  4DCX A;  2THI A;  4QSE A;  5DEX A;  1PEB A;  3OXN A;  4O7M A;  3EHT A;  3CI8 A;  5BUU A;  2PCR A;  2Y84 A;  3TZA A;  2Q89 A;  4GX3 A;  4NWD A;  1MS7 A;  3E79 A;  2DWJ A;  1H44 A;  3V8X B;  1B7Z A;  1YPN A;  2DSF A;  1URD A;  3IOU A;  1H76 A;  1NNT A;  4PE5 B;  1D4N A;  2F6G A;  4HW8 A;  3IK6 B;  4LQ2 A;  1MH4 A;  1J1N A;  1YAE A;  1LAG E;  3SDF A;  4NHB A;  3KBR A;  2XA5 A;  2GHB A;  2ONR A;  5ISU A;  4PFW A;  4GL8 A;  4MX6 A;  4NF0 A;  1Y9U A;  4MCO A;  2F35 A;  4GX6 A;  3ZS6 A;  1EYK A;  4F39 A;  1K9Y A;  2V3T A;  4N15 A;  1GR2 A;  3P7I A;  3FJ7 A;  1FBG A;  4R6K A;  4IR8 A;  1ZKB A;  4FAT A;  1EZO A;  4H8I A;  3RPL A;  1VSO A;  5I3S A;  5LTC A;  2RKM A;  3SZP A;  2OWZ A;  4MEV A;  1B9J A;  1FQE A;  2DP8 A;  3TMG A;  2HZL A;  3L6H A;  4NF6 B;  3U1O A;  3IFC A;  5HBC A;  3PPN A;  1NL5 A;  3T9X B;  1B40 A;  4LA9 A;  5ITP A;  3B6Q A;  2QMX A;  2HPG A;  4IGT A;  3CR9 A;  5DTB A;  3N26 A;  3EHU A;  4GWX A;  2XXV A;  3K6W A;  4GFR A;  5JK4 A;  3T22 A;  1NNP A;  4POX A;  4UAB A;  1B6H A;  2I0C A;  3M3L A;  4N13 A;  1P1N A;  1FTA A;  2V3Q A;  2QS1 A;  3RUM A;  3VFJ A;  5LOM A;  1N7W A;  4YIC A;  1A99 A;  4ZEI A;  3TFL A;  3QYT A;  1NV2 A;  1LBC A;  4I3Y A;  4OXV A;  4RXL A;  3UGW A;  3U92 A;  4F18 A; 
#chains in the Genus database with same CATH homology
 1OQG A;  4OZ9 A;  1O7T A;  4U1Z A;  4ZZE A;  1IXI A;  4M1V A;  3TEP A;  1SW1 A;  4OYV A;  2PYY A;  3USD A;  1PDA A;  1N7X A;  1D9Y A;  2DQV A;  1M5B A;  3IOR A;  1M5D A;  3V83 A;  1SQY A;  2IEE A;  3OO6 A;  3RGY A;  3H7M A;  4BDL A;  3TTL A;  3MPK A;  1NNK A;  3PPO A;  1PB9 A;  1ELJ A;  4O3C A;  3DP8 A;  3RTW B;  3OEL A;  2UXA A;  1MXW A;  4GF8 A;  2AL4 A;  4OQO A;  5K2X A;  2O69 A;  4IO7 A;  3SES A;  3JYR A;  3IJO B;  4IO2 A;  3PV0 E;  2V93 A;  1YCJ A;  1I6A A;  1DOT A;  4UA8 A;  4BDN A;  1EZ9 A;  3OEK A;  2UVH A;  5FHM A;  3KEI A;  1S7Y A;  3FAT A;  4G2Z A;  2D21 A;  1AH5 A;  1SYI A;  1M5C A;  1IUD A;  4NWC A;  1XC1 A;  4NF5 A;  1P1W A;  1B3L A;  1ANF A;  1B0H A;  3HHG A;  3O66 A;  3R26 A;  5H8Q B;  2A5T A;  1JVX A;  4EQB A;  3IB2 A;  3QSL A;  2ABH A;  4DXU A;  4F1U A;  1OVB A;  4FED A;  2O6A A;  1RYX A;  4ELP A;  4NF8 A;  4C1T A;  1IZ1 A;  3EPE A;  4RNS A;  2XXH A;  5L8D A;  4LAT A;  1QUJ A;  5I2N B;  4PQJ A;  2D3I A;  4G8H A;  3O6H A;  3HPI A;  1HSL A;  3FUZ A;  1MY3 A;  1FQC A;  3K6U A;  3LSW A;  3RY3 A;  3SEU A;  2XX7 A;  3UOR A;  3VLU A;  1DTZ A;  4LVQ A;  5F7V A;  2ZNT A;  3KN8 A;  3IX1 A;  4RPO A;  4NF4 B;  2HAV A;  4FEC A;  3TYH A;  1VE4 A;  4OFL A;  3V5A A;  3TQW A;  5L9S A;  4MFI A;  1EU8 A;  5HM4 B;  3B6W A;  3BKI B;  2X7P A;  1BLF A;  2REJ A;  3T66 A;  4P0G A;  4ZZA A;  1S9T A;  1UTB A;  1FTO A;  3CSB A;  5TPA A;  2XXX A;  4YKP A;  4QFO A;  2UYE A;  1A55 A;  2HEU A;  3BBR A;  2RC8 A;  1POY 1;  3S9E A;  2ZYO A;  1OMP A;  4GOT A;  3KFM A;  5I2K B;  5I59 B;  1MG1 A;  5AA1 A;  5DVF A;  2M8C A;  2RIN A;  3DP4 A;  4H0W A;  3HHF A;  1MQG A;  1D3K A;  3HST A;  2NUV A;  3MJN A;  4K3F A;  3BFT A;  4QRZ A;  3H6W A;  1IEJ A;  4LP2 B;  1HSE A;  4R75 A;  4EQ9 A;  1MQH A;  4BDR A;  3SEY A;  1MH3 A;  5TP9 B;  3SEV A;  2OLB A;  3ZKL A;  2UVG A;  2IA4 A;  3KN3 A;  4ZE8 A;  1PB8 A;  3G3G A;  3CFZ A;  2RF1 A;  5DVJ A;  3CG1 A;  3TCF A;  5IAI A;  4R73 A;  5CM6 A;  4LZ5 A;  3W9V A;  3HN0 A;  1UIV A;  3CIJ A;  1OLA A;  4XKQ A;  3TKD A;  4E0X A;  4WKM A;  3KZG A;  4OEN A;  4KYS A;  3C32 A;  1QUL A;  3ODB A;  3TDJ A;  5B70 A;  3PUX E;  2XX8 A;  3KSX A;  1SW4 A;  2O51 A;  2LAO A;  3LBS A;  4G68 B;  1SI1 A;  4DE8 A;  3UK4 A;  1B5J A;  1LAX A;  3M3F A;  1FQA A;  2ESN A;  2ONS A;  2HZK A;  3A3C A;  1ZJL A;  4YB6 A;  4X1B A;  4XTC Q;  3OO9 A;  3RN8 A;  1B7H A;  4ZDM A;  1T0K A;  1USY E;  1LAF E;  2DE4 A;  4BDM A;  1R9Q A;  3K00 A;  2HFB A;  1A8F A;  4ZEC A;  2QS4 A;  4KI0 E;  3PUY E;  3O28 A;  4O3A A;  3H6V A;  3VXB A;  1H43 A;  1AIV A;  2DXY A;  4IB2 A;  1AOV A;  3KN7 A;  1MXV A;  4EF2 A;  3U8Q A;  5IKB A;  2I4C A;  2VHA A;  4IO3 A;  4DZ1 A;  1UTH A;  4LUB A;  1Q1K A;  1R6Z A;  3OO7 A;  2PVU A;  1FCK A;  2H25 A;  3TTR A;  4H65 A;  3N6U A;  2UVI A;  1P1Q A;  4JWO A;  5CC2 A;  5CBR A;  4KYD A;  3IB0 A;  3UIF A;  4GIZ A;  1FTM A;  3FIR A;  5EHM A;  4NE4 A;  1US4 A;  3FJM A;  2YPN A;  3GBB A;  4R9G A;  3CVG A;  3K4U A;  1Y3P A;  3PD9 A;  2BJJ X;  1WOD A;  5H8N B;  3PPQ A;  5KDT A;  3THI A;  1NH8 A;  1LBB A;  3IOW A;  3DEL B;  1A7L A;  3FZV A;  1MPD A;  3N6T A;  1JQF A;  1TFA A;  4KD5 A;  5AA2 D;  5ELV A;  5DYH A;  2DVZ A;  5CMK A;  3KSJ A;  3FV1 A;  2CZL A;  1MDP 1;  4ND9 A;  4QF9 A;  3E9X A;  1MY0 A;  2O7U A;  3Q26 A;  4OET A;  5ICT A;  1NH7 A;  2GHA A;  3T93 B;  2O7I A;  1MQJ A;  3UN6 A;  4JDF A;  4ISU A;  3MAM A;  2QRY A;  2VOZ A;  4KCC A;  3C35 A;  4TLL B;  3PMV A;  2P1S A;  3D4G A;  3M8U A;  1I69 A;  3B6T A;  2QL3 A;  3CSG A;  3S9L C;  4U21 A;  5KCJ A;  4OHN A;  2OBG A;  3K1P A;  3RLF E;  4JBZ A;  2H99 A;  3E3K A;  2ZMB A;  4DCY A;  3MPL A;  1GTK A;  4NTL A;  4H1X A;  5JTY B;  2Z23 A;  4G68 C;  4R9F A;  2A5T B;  2XXY A;  4MLV A;  1Y1M A;  4F1V A;  2Y7W A;  3OD7 A;  2YJP A;  3VLW A;  3TQL A;  4C0R A;  3FV2 A;  4BDO A;  1N3W A;  4H6D A;  3EN3 A;  4GRK A;  4C1U A;  3D4C A;  3Q27 A;  2OWT A;  4KQP A;  2YLN A;  3TOD A;  3O2A A;  3O97 A;  3FVO A;  1R1N A;  1MRP A;  1A54 A;  2PX1 A;  2GH9 A;  1A8E A;  2DVC A;  4UAC A;  4YKJ A;  1O64 A;  1SYH A;  2ZYN A;  1POT A;  3ZSF A;  4PFT A;  4MLQ A;  4BLA A;  4FJP A;  2FA7 A;  4OTE A;  1N84 A;  4EQ7 A;  3HV1 A;  3HO7 A;  3H3G A;  5JEI A;  2I6E A;  2KLF A;  3FVN A;  4HCY A;  2CMO A;  2Y7R A;  2Q8J A;  2XD2 A;  3PPP A;  3PGF A;  4F19 A;  5DT6 A;  1MM6 A;  4ELR A;  3FAS A;  3W9W A;  1MPB A;  4Q5T A;  1FW0 A;  3N5L A;  1Y20 A;  2I3W A;  1B4Z A;  4PFU A;  3VXC A;  1B0L A;  5TPA B;  2A5S A;  1P1U A;  4RA1 A;  2QPQ A;  3R7X A;  4THI A;  1XVX A;  1EZP A;  4F29 A;  4YMB A;  1N3X A;  1LAH E;  4FE8 A;  3TTN A;  1QJM A;  4X1D A;  2NXO A;  1D9V A;  1DPP A;  3QIM A;  5H8H A;  3PPR A;  3S9N C;  2I58 A;  3WAE A;  1LB9 A;  4JSD A;  4OEU A;  1OLC A;  3S2V A;  1LB8 A;  1PB7 A;  3OO8 A;  3QUJ A;  1OQH A;  2XXP A;  4GXS B;  3UA8 A;  2H9B A;  5H8F A;  3IAZ A;  1P99 A;  1B3E A;  1L5T A;  3OSQ A;  1MXZ A;  1XHY A;  3SET A;  1Y4T A;  4JB7 A;  2RCA A;  2H4I A;  2XXU A;  5A5X A;  4XXU A;  1P1O A;  4U2R A;  2Q88 A;  3CFX A;  1MXX A;  4PP0 A;  5I57 A;  4IO5 A;  4U4X A;  5HPQ A;  5I56 A;  4N07 A;  1ZU0 A;  2Z8F A;  4U23 A;  3S4U A;  1LST A;  2DYX A;  2VGQ A;  5M2V A;  4OEV A;  2XXR A;  4OER A;  4DDD A;  3K02 A;  1RKM A;  2W7Y A;  3FXR A;  2V25 A;  4GWO A;  3MZB A;  4JWY A;  2G29 A;  1IXH A;  4YB5 A;  3RTF B;  3MP6 A;  3E4R A;  3V89 B;  4LQ5 A;  1IXC A;  3U93 A;  3LUY A;  2NWJ A;  4EXL A;  2VD3 A;  5AA4 B;  2AL5 A;  3G7W A;  3TAJ A;  4LZ8 A;  5I58 A;  1Y3Q A;  2XXI A;  1JW4 A;  3LR1 A;  4MF3 A;  3OEM A;  1UQW A;  1VFE A;  2OWS A;  1B5H A;  3OSR A;  2GFE A;  3PUV E;  1LLS A;  1B51 A;  1B2H A;  3QK6 A;  3MVZ A;  1B52 A;  3G3H A;  4GLI A;  1B3G A;  1B7U A;  4P0I A;  1LFI A;  1JVY A;  3IR1 A;  2O84 X;  1PBP A;  5I84 A;  4GQO A;  1SD3 A;  5DEX B;  3LSL A;  3MP8 A;  1N04 A;  2F6P A;  2DE3 A;  1NKX A;  3K6V A;  2XXW A;  4NMY A;  2Z8E A;  2FNC A;  1ZBM A;  2F7C A;  3KOT A;  1XOC A;  3VV5 A;  3TPA A;  1IIW A;  1JET A;  2DWA A;  2F78 A;  1XS5 A;  1MY1 A;  4ZS9 A;  3RNN A;  1N76 A;  4GD5 A;  4H5G A;  4U4S A;  5KDT B;  2V84 A;  3GXA A;  3K1M A;  2ZXT A;  2XX9 A;  2P2A A;  3E13 X;  3T9H B;  1DMB A;  3G3K A;  2O1L A;  4ELO A;  1II5 A;  1MY4 A;  1ZMG A;  3IO4 A;  1QVS A;  5FHN A;  1H45 A;  2P0S A;  3ONM A;  4M4G A;  4OES A;  2Q2C A;  1XT8 A;  5F1Q A;  2FYI A;  2R71 A;  4HS7 A;  2H98 A;  2G93 A;  1MQI A;  2Y7I A;  1FTK A;  4MBP A;  1B46 A;  3ILT B;  2DXR A;  1CB6 A;  1JW5 A;  3KJT A;  4OMB A;  1MM7 A;  2ONK E;  4H67 A;  1F9B A;  1TFD A;  4WEP A;  3K2D A;  4ONY A;  3MBP A;  1GVC A;  2DWH A;  2Z22 A;  1B3F A;  2Z8D A;  4RY1 A;  2GRV A;  1JNF A;  1URG A;  3L6G A;  2Y7P A;  5KCJ B;  3TCH A;  3MWB A;  1B05 A;  4WED A;  2I48 A;  3Q25 A;  1MDQ A;  3TTK A;  2RCB A;  4YZZ A;  3MC2 A;  4JXI A;  4IY5 A;  5ICQ A;  1MXU A;  4LON B;  3MVY A;  5J1D A;  3U72 A;  3TEL A;  5EHS A;  1QW0 A;  4YU0 A;  3I3V A;  2OK2 A;  3OMB A;  4DIG A;  1SDX A;  3TTM A;  1QKA A;  1SVX B;  2R9J A;  1N0T A;  3VE1 B;  2ZYM A;  4XKN A;  3RPW A;  1BTJ A;  3O6I A;  2D5W A;  1DPE A;  4PET A;  2F5X A;  4ECF A;  2PT1 A;  3ILU B;  4RYA A;  3IL1 B;  4G68 A;  1B1X A;  1RYO A;  4MH5 A;  2E0S A;  1SI0 A;  2I4B A;  4R74 A;  1Q35 A;  2RC9 A;  3PU5 A;  3FVK A;  3VDF A;  3LC8 A;  2ZNS A;  2E1S A;  4ZEF A;  1IIT A;  5AA2 A;  3EHS A;  1JEU A;  1B1H A;  3CG3 A;  1AMF A;  2X7Q A;  4N6P A;  1US5 A;  3U94 A;  1EH3 A;  4LZ7 A;  3MW0 A;  1NMU A;  4XKR A;  4R6Y A;  2PBW A;  4RJZ A;  1Y3N A;  1LFG A;  3T9V A;  2PMS A;  1M5F A;  4F2O A;  1B3H A;  3ZKK A;  5DVI A;  3MVW A;  4NF5 B;  1OIB A;  4H8J A;  2I3V A;  1SW5 A;  4KCD A;  2HXW A;  3C31 A;  4RPN A;  1TWY A;  1B58 A;  1FQF A;  3DP6 A;  2QSX A;  1USY H;  2Q9T A;  3PUZ E;  3VVD A;  2XXQ A;  4Z7E A;  4NF8 B;  1HSJ A;  1WDN A;  4ELQ A;  1AL3 A;  4IGR A;  5BWJ A;  2NOO A;  4F31 B;  2AIX A;  2Q2A A;  5H8H B;  3MZ9 A;  1ATG A;  2F8D A;  1MXY A;  3FD3 A;  4F1Y A;  4G4P A;  3RT6 B;  5H8N A;  3I5O A;  5L9O A;  3QXM A;  1FQB A;  1OVT A;  1Z7M E;  2QJE A;  5H8F B;  4KHZ E;  4TLM B;  4OWD A;  2DWI A;  4ESX A;  1Z7N E;  3OEN A;  4IO4 A;  4FIM A;  4YB7 A;  5CI5 A;  1DSN A;  1DTG A;  4I8C A;  2O1M A;  3PMX A;  1FTJ A;  2F7B A;  3MUQ A;  5ITO A;  2XHD A;  1XVY A;  2REG A;  4ZED A;  4ESW A;  5A5X B;  4EUO A;  3PUW E;  5AE4 A;  4NF6 A;  1GV8 A;  3UP9 A;  5I57 B;  3G3F A;  1LCF A;  5I56 B;  1Y1Z A;  1BKA A;  1UTB B;  2UYF A;  4BDQ A;  3EF7 A;  3C33 A;  3Q28 A;  4AB6 A;  1QKB A;  2UVJ A;  1B5I A;  1MY2 A;  1ZLQ A;  1B4H A;  3K01 A;  4QFL A;  5AA3 A;  4X48 A;  3C34 A;  4TOZ A;  1SW2 A;  1QUI A;  1ZIU A;  1I6B A;  4R2B A;  3H6T A;  4F3S A;  3IOT A;  1NNF A;  4L17 A;  5JTY A;  1O63 A;  1LFH A;  3I6V A;  2F34 A;  3AXF A;  1FQD A;  4ZEK A;  4E0W A;  3S9M C;  5K2Y A;  4IY6 A;  4QSC A;  3O9P A;  3IOV A;  4I9D A;  4QFK A;  4DXC A;  3A3U A;  5I58 B;  5CMB A;  2QMW A;  4JSO A;  3SKP A;  1BP5 A;  1UIU A;  1PBQ A;  2B65 A;  3JV9 A;  4X9T A;  4Z0I A;  1ZTY A;  3MVX A;  4KPT A;  3W15 C;  2R6G E;  4QHQ A;  5L9M A;  2X26 A;  3N94 A;  4FOR A;  2NVU B;  3OOA A;  4Q0C A;  4F3G A;  5KZT A;  3JZJ A;  4YKK A;  2V3U A;  3O6G A;  2ALU A;  3SER A;  1WVJ A;  3T9U A;  3MP1 A;  4QFN A;  4KFQ A;  4OVJ A;  4ZEB A;  4G8M A;  4G77 A;  3ECR A;  2DS9 A;  3SEX A;  4GXA A;  3DM0 A;  1JEV A;  3KG2 A;  3GBA A;  3T96 B;  5CMM A;  4FAJ A;  5FHO A;  3IO6 A;  3FVG A;  4OFJ A;  3H03 A;  2PT2 A;  1GGG A;  3C36 A;  3M3K A;  2OCU A;  3FXQ A;  3KOS A;  3IB1 A;  4OFO A;  3K0V A;  4G8N A;  5FTI A;  1IXG A;  4F22 A;  4Q8R A;  5H8Q A;  3KGC A;  4HCW A;  1FTL A;  2RC7 A;  5CMC A;  3H6U A;  2XD3 A;  3A09 A;  3F11 A;  3QUF A;  4EXK A;  1TXF A;  5EYF A;  1IQ7 A;  4ZE9 A;  3EQ1 A;  3WAF A;  2ZNU A;  4I62 A;  4Q30 B;  4F2Q A;  3FGS A;  3DLN A;  2QS3 A;  5I2N A;  2I49 A;  4RK9 A;  3CRB A;  4QSD A;  2F7A A;  1S50 A;  1VR5 A;  2QS2 A;  3BFU A;  2ZYK A;  3TCG A;  3TUS A;  4KR5 A;  1CE2 A;  2DE2 A;  3Q29 A;  1MQD A;  1URS A;  4GVO A;  2AYS A;  4YMA A;  1UTH B;  3H06 B;  1NFT A;  4FEB A;  2B3F A;  2WKY A;  1LCT A;  2F36 A;  2OZZ A;  1SBP A;  4U22 A;  5CRY A;  4PFY A;  4NF4 A;  3O29 A;  3VVE A;  4EDP A;  1TT1 A;  3VVF A;  3K1N A;  4XKP A;  3PD8 A;  4H5F A;  3QAX A;  1JW1 A;  3B7D A;  3MZ1 A;  4RK2 A;  3H4Z A;  2OJT A;  5FTH A;  1H3D A;  2I0B A;  2O68 A;  3SEW A;  4U1O A;  3FJG A;  3CFL A;  4R2F A;  4I1D A;  5CBS A;  2VP1 A;  4XIG Q;  5H8S A;  2VD2 A;  4WXJ A;  4YKI A;  2HQ0 A;  3RT8 A;  1A40 A;  3RQT A;  2B3B A;  1KWH A;  3K6X A;  3G3J A;  4AB5 A;  4GL0 A;  4KYE A;  4DXB A;  1MPC A;  3R6U A;  1R9L A;  4F3B A;  4POW A;  2ANJ A;  4HTG A;  4IO6 A;  5I2K A;  3C9H A;  3HCQ A;  5I59 A;  2HAU A;  1BIY A;  1I6Q A;  5AA2 B;  2Y7K A;  3IJX B;  4P11 A;  2XXT A;  5AA4 A;  4EF1 A;  4TQU Q;  4NED A;  4QFP A;  3KJ7 A;  1B32 A;  1LGB C;  3GZG A;  3C4M A;  2H5Y A;  3LSX A;  2DOJ A;  1M5E A;  2HCA A;  3PMW A;  1Y4C A;  5TP9 A;  4R6H A;  3FXU A;  2F97 A;  1YTV A;  3GLB A;  4F3P A;  5B7D A;  5TU0 A;  3LSF B;  3VLV A;  4DLD A;  1VFD A;  1QUK A;  3MQ9 A;  4R72 A;  3G3I A;  4AQ4 A;  1PC3 A;  4JWX A;  4O3B A;  4YAH X;  4DCX A;  2THI A;  4QSE A;  5DEX A;  1PEB A;  3OXN A;  3EHT A;  3CI8 A;  5BUU A;  2Y84 A;  3TZA A;  2Q89 A;  4NWD A;  1MS7 A;  2DWJ A;  1H44 A;  3V8X B;  1B7Z A;  1YPN A;  2DSF A;  1URD A;  3IOU A;  1H76 A;  1NNT A;  4PE5 B;  1D4N A;  2F6G A;  4HW8 A;  3IK6 B;  4LQ2 A;  1MH4 A;  1J1N A;  1YAE A;  1LAG E;  3SDF A;  3KBR A;  2GHB A;  2ONR A;  5ISU A;  4PFW A;  4GL8 A;  1Y9U A;  2F35 A;  3ZS6 A;  4F39 A;  2V3T A;  1GR2 A;  3P7I A;  3FJ7 A;  4R6K A;  1ZKB A;  4FAT A;  1EZO A;  4H8I A;  1VSO A;  2RKM A;  1B9J A;  1FQE A;  2DP8 A;  3TMG A;  2HZL A;  3L6H A;  4NF6 B;  3U1O A;  5HBC A;  3PPN A;  1NL5 A;  3T9X B;  1B40 A;  4LA9 A;  5ITP A;  3B6Q A;  2QMX A;  4IGT A;  3CR9 A;  5DTB A;  3N26 A;  3EHU A;  2XXV A;  3K6W A;  4GFR A;  5JK4 A;  3T22 A;  1NNP A;  4POX A;  1B6H A;  2I0C A;  3M3L A;  4N13 A;  1P1N A;  2V3Q A;  2QS1 A;  3RUM A;  3VFJ A;  5LOM A;  1N7W A;  4YIC A;  1A99 A;  4ZEI A;  3TFL A;  3QYT A;  1LBC A;  4OXV A;  4RXL A;  3UGW A;  3U92 A;  4F18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...