5A5XA

Crystal structure of se-met mltf from pseudomonas aeruginosa
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
420
structure length
420
Chain Sequence
RVQKEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFTQHLQQRLPRYESHFKQSGKQKDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE F
publication title Activation by Allostery in Cell-Wall Remodeling by a Modular Membrane-Bound Lytic Transglycosylase from Pseudomonas aeruginosa.
pubmed doi rcsb
molecule tags Hydrolase
total genus 138
structure length 420
sequence length 420
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5a5xA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5a5xA02
1BKAA 2D3IA 2O1LA 1OQGA 2ONKE 3RUMA 1FQCA 3TTLA 4RPOA 5I2KA 3FD3A 1URDA 3IB0A 2I49A 1H44A 4ZEIA 3PD8A 2RCBA 1SI0A 1LLSA 5EHSA 3MBPA 4NF8B 2F6PA 2G93A 4HTGA 2ALUA 3QYTA 4WKMA 2XD3A 3RN8A 2B3FA 3ONMA 3N94A 1MQHA 3V83A 1MXZA 3RGYA 2HQ0A 3MP6A 2B65A 1VFEA 5JTYA 3QAXA 4O3AA 3LR1A 5I56B 4DDDA 1B9JA 4KYEA 2RKMA 4E0XA 1FTJA 4IO7A 4R2FA 3FVNA 4NEDA 1N7XA 1JQFA 3C31A 5DYHA 1SYHA 4RK2A 1ZU0A 5ISUA 1A55A 2H25A 3DLNA 1M5CA 3H6VA 2UVHA 4IB2A 1A54A 4FORA 1FTLA 1PBQA 3OSQA 4ZE9A 5ITPA 4THIA 2I4CA 3PMXA 4BDRA 1Y4CA 1B7UA 1POY1 2P0SA 3HN0A 2RC7A 3A3CA 4I1DA 1VSOA 2ZNSA 5CMBA 3EQ1A 1MXXA 3FVKA 3JZJA 3VFJA 2UYEA 1TT1A 1ZIUA 3M3LA 4EDPA 2PT2A 3FVGA 1MPDA 1MPCA 3GZGA 1B5JA 4L17A 1XC1A 3GXAA 2F8DA 5K2YA 4R2BA 3FV2A 3MPLA 3RQTA 1MRPA 2DE4A 3DELB 3H06B 4FECA 4LVQA 1UTBB 1I6BA 2O7UA 4H5FA 2X26A 4F31B 2GFEA 3HSTA 1YPNA 3V8XB 4X9TA 1FTKA 4NF6A 4R74A 4QFLA 3PPNA 3IJXB 3IOTA 1Y20A 1NKXA 4I8CA 2O7IA 4F29A 2WKYA 2QL3A 1H3DA 3U93A 4JWXA 1Q1KA 3RT6B 1SD3A 2V93A 4MFIA 3LUYA 2RC8A 2F35A 3TZAA 2Q88A 4YMAA 4EQ9A 5DVJA 1QUKA 3K6VA 1FQEA 3K1PA 1JW4A 1YTVA 1LGBC 4H8JA 5AE4A 4BLAA 5I84A 1OQHA 1Q35A 1ZLQA 2PMSA 4ZECA 3B6WA 4IGTA 2NOOA 2XX7A 1MM7A 3U8QA 3TKDA 4DCYA 4OWDA 3TPAA 3E3KA 3UP9A 3T9VA 1JVYA 2UVJA 4XKNA 4BDOA 2IEEA 1SW2A 2HXWA 4X48A 1F9BA 3L6HA 4LP2B 4KPTA 4BDQA 1B3HA 3K1NA 3OXNA 3EHUA 5HBCA 1MS7A 3MAMA 4R6YA 1AIVA 3PV0E 4NF4A 5FHOA 1M5EA 3H4ZA 3TUSA 4PQJA 3IOVA 3IK6B 3RY3A 2I48A 1SW4A 3OO6A 2O84X 3UIFA 1GV8A 5L8DA 4ZEDA 4G77A 3OD7A 4EXLA 3S9LC 1HSJA 1EZOA 4HS7A 3LC8A 3IR1A 2OK2A 5I2NA 2GH9A 1Z7ME 4POWA 1DPPA 1PEBA 4ESWA 2E1SA 4F18A 1B7HA 3KN3A 3OEKA 3QSLA 1MDQA 3CSGA 5AA2A 3IB1A 3TCGA 1JEUA 3CSBA 5ELVA 2IA4A 5KCJA 3FVOA 4P0GA 1B52A 3IX1A 3CI8A 5I58A 2XD2A 4GF8A 3UORA 1R1NA 2HCAA 1BP5A 3WAEA 4U21A 4H8IA 3MUQA 4YB5A 5H8FB 4TLLB 1M5DA 5KZTA 3KSXA 2CMOA 5DTBA 4KD5A 3TTKA 2XXIA 5AA4B 1MQGA 4IY5A 1LAFE 1II5A 3HV1A 5DT6A 5DVIA 2NWJA 5CC2A 3T93B 4G2ZA 4H1XA 4F22A 3PPQA 5H8NA 4HW8A 3M3KA 3PU5A 2Y7RA 3CR9A 2PYYA 1LCTA 4PFUA 4MLQA 1D4NA 2V3UA 5CMMA 4F39A 3G3KA 5CBSA 1MY0A 5AA2D 4ESXA 5LOMA 3N5LA 3K01A 1IITA 4GXAA 1BIYA 1TFDA 3PUXE 4WXJA 1UQWA 1VE4A 2QS2A 4LZ5A 2R71A 3Q29A 2ZNUA 3PUZE 3MWBA 4FIMA 1B5IA 3O6GA 4POXA 1B1HA 5BWJA 5I59A 2Y84A 3TQLA 4YU0A 4NF5A 1OMPA 3RTFB 3IO4A 4GQOA 5H8HA 1USYE 3OOAA 4AB5A 4ZZAA 1QUIA 3FJGA 3M8UA 1B0HA 3TMGA 2F97A 4N07A 4U4XA 2DWHA 3C35A 5ICQA 4H67A 2FYIA 4JWYA 4KHZE 2E0SA 4M4GA 1B5HA 2DVCA 2Q89A 3KOTA 2XXPA 1OVTA 1SI1A 3O6HA 4WEDA 3VV5A 3FZVA 2XXUA 3ECRA 4JB7A 2BJJX 2QS3A 4PFTA 2QPQA 2W7YA 4QFNA 2RCAA 4WEPA 3ILTB 2I0CA 3VVEA 4U2RA 2UYFA 4OETA 1JNFA 1A40A 4MLVA 1NMUA 2PVUA 3FV1A 5KDTB 1ATGA 3C9HA 3HHFA 3IO6A 3PUWE 4G8HA 3TCHA 4G68C 4BDNA 3KG2A 1A8EA 3HCQA 5M2VA 3MW0A 4F1YA 5CBRA 3H7MA 2Q9TA 4OEVA 1IEJA 2XX9A 3DP6A 4PFWA 2F7BA 1R9LA 4HCYA 1B1XA 2XXXA 2I0BA 1LFIA 1MM6A 2XXQA 4LONB 3QK6A 3U72A 3MVZA 4JDFA 3A09A 1DPEA 1B6HA 5L9OA 4LQ2A 2A5TB 4GXSB 1LAGE 1PB8A 3VVFA 2F6GA 3UN6A 5DEXB 1GGGA 4KCDA 1VFDA 1MXVA 4ND9A 4IO3A 2VHAA 5CRYA 3TODA 1USYH 4MF3A 3MVXA 4GL8A 1FQDA 4KR5A 4PETA 4EF2A 3G3GA 4YKKA 4G8MA 3T96B 1KWHA 4OXVA 1I6AA 2OBGA 5FTHA 4QFOA 5I2KB 3O6IA 5FTIA 3LSFB 5F1QA 2Q2AA 1A99A 1SVXB 4QRZA 1MDP1 4DCXA 1RKMA 1H43A 4EQ7A 2YJPA 4NMYA 1XT8A 2ZMBA 3G3HA 5TP9B 4ELRA 1SW1A 3RPWA 4RNSA 3T9UA 3CFLA 3DP8A 3RTWB 1T0KA 1IXGA 3KEIA 4LQ5A 3MP8A 5B7DA 1QJMA 3PPRA 1LBCA 3SEUA 3DP4A 3S4UA 1B58A 3O28A 1MXWA 2ESNA 3ZKLA 3QIMA 2RF1A 1XHYA 3MP1A 1QULA 3EN3A 2GRVA 5TPAA 4GD5A 5B70A 3S9EA 5K2XA 2DVZA 4ELQA 5HPQA 3SERA 3CFXA 1M5BA 3A3UA 4MBPA 3IOUA 3B6TA 5DVFA 2AL5A 3OSRA 1EZ9A 4OYVA 1Y1MA 1Y9UA 3T9HB 3OELA 3V89B 4YKIA 3KGCA 1LBBA 1TXFA 1XS5A 2VD2A 2THIA 3ZSFA 3K6XA 1P99A 1QVSA 2DS9A 3SDFA 4ZE8A 2RINA 3RT8A 5FHNA 3LSXA 3CVGA 1P1QA 2HFBA 2F7CA 3KBRA 1AMFA 1O64A 2V25A 3FJ7A 4M1VA 1N7WA 3TAJA 4KCCA 4LA9A 1JETA 3O2AA 3MC2A 1FTMA 4N13A 4ZEFA 3AXFA 2OJTA 2Q2CA 3VE1B 4P0IA 2ZYNA 1LAHE 1PBPA 1B32A 2I4BA 1NNKA 2QSXA 3E9XA 3U92A 1SYIA 3O66A 3GBBA 4OFOA 1B0LA 1DTGA 4PP0A 3TQWA 4P11A 1DTZA 1MH4A 3ODBA 4TOZA 4F3GA 3VDFA 1MPBA 4Q0CA 4F1VA 3ZKKA 2CZLA 2Z8FA 1POTA 4QSEA 2XHDA 1NH7A 1TFAA 1S7YA 4ZDMA 2F5XA 2DYXA 1N3XA 3LBSA 3GBAA 2KLFA 4F1UA 3EF7A 2DSFA 5H8FA 3G3FA 2XXYA 2O6AA 3UA8A 2H98A 4JSDA 4H6DA 4ONYA 3K2DA 4G8NA 4DXCA 2HZKA 1EH3A 1I69A 3D4GA 5IKBA 3RNNA 3FATA 3OO9A 4FEBA 3SEWA 4LUBA 1OLCA 4JXIA 1MQIA 3QUFA 5HM4B 1GTKA 4GWOA 2I3VA 4YMBA 4PFYA 3PUYE 3H6UA 3FXQA 5AA3A 2Q8JA 3FIRA 3S2VA 5A5XB 4NF4B 1SBPA 2R9JA 1XVXA 4U4SA 4C1UA 4Z7EA 3I3VA 3DM0A 3IORA 2YLNA 2M8CA 4R6KA 3R6UA 4ZS9A 2O1MA 2VP1A 3TTNA 2VOZA 1HSLA 1YCJA 4ZEBA 2DQVA 1EZPA 4AB6A 3V5AA 3T66A 3I5OA 4R9FA 3O29A 4C0RA 3SEVA 4RA1A 4XKQA 1IUDA 1FQBA 4GOTA 3CG1A 4ELPA 1GR2A 1B46A 1YAEA 2D5WA 3KSJA 2V3TA 1D9VA 5KCJB 3K02A 3TDJA 2OZZA 4F3BA 4OZ9A 1O7TA 3K0VA 1MH3A 1MY3A 3TEPA 1DOTA 4O3CA 5H8QB 3TTMA 2REJA 1B40A 3MVWA 5CMCA 2OWTA 3H03A 3TYHA 4H65A 2G29A 1JW5A 5CM6A 2NUVA 1PDAA 3EHSA 1RYOA 2DWJA 3MPKA 3OENA 1TWYA 3QXMA 1UTHA 5H8NB 1ZTYA 1US4A 4TQUQ 4KQPA 3BFUA 4IO2A 3CIJA 1PC3A 2FA7A 4NWCA 1NNTA 1MY1A 3FXRA 1CE2A 2PBWA 4F3PA 4IO6A 2DE3A 3MVYA 3IB2A 1Y1ZA 2X7QA 1OVBA 5CMKA 1BLFA 1SDXA 4TLMB 3TCFA 4NF8A 2AIXA 3E13X 4U1ZA 5J1DA 2ZNTA 1FW0A 4OMBA 1CB6A 3O97A 2VD3A 2XXWA 3OMBA 3F11A 1DSNA 2DWAA 4F2QA 4F2OA 3MJNA 2Y7KA 5H8HB 4GRKA 3UGWA 5I56A 3N26A 2R6GE 4GL0A 4YAHX 3G7WA 1B51A 2HEUA 1ZJLA 4OESA 2I58A 4Q8RA 4BDLA 3SEYA 3OEMA 4ISUA 4XXUA 1XOCA 2F78A 1R9QA 5JEIA 3N6TA 1UIVA 3Q28A 3FGSA 2XX8A 1IXCA 5I57B 5EHMA 4R75A 3MQ9A 4R6HA 5EYFA 5FHMA 4F3SA 5ICTA 4G68B 2H4IA 4YICA 3MZBA 4HCWA 3S9NC 3PD9A 2HZLA 3VXCA 2OCUA 4H5GA 3K4UA 1H76A 3CG3A 4YZZA 1SW5A 4DZ1A 4OEUA 4Z0IA 4Q5TA 4FAJA 2LAOA 4G4PA 3RLFE 5BUUA 3W9VA 3UK4A 1IZ1A 1MY2A 4YB7A 3PMVA 3H6TA 5TP9A 4X1BA 1D3KA 2UVIA 1IXHA 3IAZA 2Y7IA 3W9WA 1Y3NA 2QRYA 1QW0A 3PPPA 3Q27A 1Y3PA 2Y7PA 2ZXTA 4GIZA 1WDNA 1Y3QA 4DXUA 4IO4A 4U23A 3THIA 3VLUA 4PE5B 1QKBA 1ZMGA 2ABHA 2HAVA 3FASA 3IL1B 1UTBA 3K6UA 4QSCA 1NNFA 5JTYB 4ZEKA 2O68A 2Z22A 5H8SA 1H45A 2QMWA 2V84A 1R6ZA 4QSDA 4H0WA 3HO7A 1P1WA 4YKJA 1A7LA 1MQDA 5AA1A 1UIUA 4F19A 2DOJA 3PPOA 5TU0A 2ONSA 2P2AA 4C1TA 3JYRA 3MZ1A 3K00A 3HHGA 4FE8A 1QUJA 5L9MA 2PX1A 2NVUB 4RYAA 1S9TA 1S50A 2D21A 3L6GA 4OTEA 3E4RA 4GFRA 1MXYA 3FJMA 4OERA 2ANJA 3CRBA 2Z8DA 4AQ4A 3EHTA 4DE8A 2H5YA 2NXOA 4NE4A 3C4MA 3BBRA 1B3GA 2ZYMA 2O69A 4FJPA 3H3GA 2H9BA 4ECFA 1ELJA 3KN8A 4XIGQ 2P1SA 4UA8A 3G3IA 2F7AA 2OLBA 3QUJA 3FUZA 2O51A 1NH8A 1IIWA 2F36A 2F34A 1JW1A 2XXTA 3HPIA 4DIGA 3GLBA 2XXHA 2RC9A 4XTCQ 1N3WA 3VVDA 2ZYOA 4QFKA 4EQBA 2DXRA 3T22A 3M3FA 3G3JA 3IOWA 4FEDA 5CI5A 5TPAB 3SEXA 2DXYA 1MXUA 3ZS6A 5ITOA 2QS1A 3OO8A 1AH5A 3MZ9A 1FTOA 1N76A 2XXVA 4NF6B 3T9XB 1FQAA 3FXUA 4OENA 2A5SA 4EF1A 1P1OA 2QS4A 2VGQA 4ELOA 3I6VA 3K6WA 1AL3A 3U94A 2FNCA 1A8FA 4I9DA 1SQYA 1JEVA 1Y4TA 1D9YA 1MQJA 4R72A 4DLDA 1B4HA 3S9MC 1AOVA 1IQ7A 5A5XA 4EXKA 3D4CA 4OHNA 1P1UA 1US5A 4IY6A 1FCKA 4YKPA 3SESA 5AA4A 3K1MA 4JSOA 3BFTA 4KFQA 4R73A 3B6QA 4KYDA 2QMXA 3PGFA 1B05A 2REGA 3VXBA 1LAXA 3ILUB 1WVJA 4XKPA 4Q30B 4GLIA 4JWOA 3TFLA 1B3EA 4E0WA 3KZGA 3W15C 2DP8A 1LFGA 4NTLA 1B4ZA 1NFTA 5F7VA 4QHQA 1N0TA 5JK4A 3Q25A 1QKAA 4RY1A 3H6WA 3SETA 1N04A 3U1OA 4OFLA 3O9PA 3PMWA 3KFMA 4RJZA 3KJTA 2YPNA 3LSLA 3IJOB 4RXLA 5H8QA 1RYXA 2AYSA 4OVJA 1B3LA 1ZBMA 3CFZA 1L5TA 1MY4A 3SKPA 5I2NB 3BKIB 4KYSA 3N6UA 4OQOA 5L9SA 1BTJA 1PB7A 5AA2B 3VLVA 4IO5A 4EUOA 1FQFA 2ONRA 2QJEA 1DMBA 2DWIA 2XXRA 4DXBA 5I58B 4LATA 1MG1A 1PB9A 3VLWA 1LFHA 2OWSA 1J1NA 4FATA 2GHAA 4LZ8A 4MH5A 2B3BA 3KJ7A 2ZYKA 3JV9A 1XVYA 4GVOA 4QFPA 4KI0E 3TTRA 3OO7A 4U1OA 1JVXA 2PT1A 4XKRA 1NL5A 1LSTA 1M5FA 1P1NA 1URGA 4UACA 1IXIA 2AL4A 2GHBA 1LB9A 3TELA 2X7PA 3Q26A 3WAFA 1LCFA 1LB8A 1O63A 5KDTA 4R9GA 4BDMA 4RPNA 3R7XA 4NWDA 3USDA 1OIBA 2Z8EA 4X1DA 3P7IA 1B7ZA 2V3QA 2Z23A 3C32A 3B7DA 3KOSA 5IAIA 4LZ7A 2I6EA 3C36A 3LSWA 5I57A 3R26A 4K3FA 4I62A 3EPEA 4O3BA 1I6QA 1Z7NE 1OLAA 2UVGA 1B2HA 5I59B 4YB6A 4G68A 4IGRA 2I3WA 4QF9A 2Y7WA 2HAUA 4NF5B 4U22A 3C33A 4JBZA 1GVCA 2A5TA 1B3FA 2UXAA 1ZKBA 3C34A 4ZZEA 1N84A 3PUVE 1ANFA 5DEXA 1NNPA 1UTHB 3KN7A 2H99A 1URSA 4RK9A 1VR5A 2DE2A 1EU8A 1WODA 1HSEA 4OFJA 4N6PA
chains in the Genus database with same CATH superfamily
1NUZA 1BKAA 2D3IA 4DI4B 2O1LA 1OQGA 2ONKE 3RUMA 1FQCA 3TTLA 4PDHA 4RPOA 5I2KA 3FD3A 1URDA 1KA1A 3IB0A 2I49A 1H44A 4ZEIA 3PD8A 2RCBA 1SI0A 2HHMA 1LLSA 4NGUA 5EHSA 3MBPA 4NF8B 2F6PA 2G93A 4PF8A 4HTGA 2ALUA 3QYTA 4WKMA 2XD3A 3RN8A 1DCUA 2B3FA 3ONMA 2ZZXA 1MQHA 3N94A 3V83A 1MXZA 3RGYA 2HQ0A 3MP6A 4MAGA 2B65A 1VFEA 4MNCA 3QAXA 5JTYA 4O3AA 3LR1A 2QVRA 5I56B 4DDDA 1B9JA 4KYEA 2RKMA 4E0XA 1FTJA 4IO7A 4R2FA 3FVNA 4NEDA 1N7XA 1JQFA 3C31A 5DYHA 1D9QA 1SYHA 4RK2A 1ZU0A 5ISUA 1A55A 2H25A 3DLNA 1M5CA 3H6VA 4HXVA 2UVHA 5A5LA 4IB2A 1A54A 4FORA 1FTLA 1PBQA 3OSQA 4ZE9A 5ITPA 4THIA 4JVCA 2I4CA 3PMXA 4N81A 4BDRA 1Y4CA 1B7UA 1POY1 2P0SA 3KC0A 3HN0A 2RC7A 3A3CA 4I1DA 1VSOA 2ZNSA 5CMBA 3EQ1A 1MXXA 4GWSA 3FVKA 3JZJA 4MJOA 3VFJA 2UYEA 4OA4A 1TT1A 1ZIUA 3M3LA 4EDPA 2PT2A 3FVGA 1MPDA 2V4CA 1MPCA 3GZGA 1B5JA 4GBVA 4L17A 4PTKA 1XC1A 4GWXA 3GXAA 2F8DA 5K2YA 1FBDA 2B4LA 4R2BA 3FV2A 3MPLA 3RQTA 1MRPA 2DE4A 2CZKA 3DELB 3H06B 4FECA 4DI3D 4LVQA 1UTBB 1I6BA 2O7UA 4H5FA 2X26A 4F31B 2GFEA 3HSTA 4GWYA 2R8TA 1YPNA 3V8XB 4X9TA 1FTKA 4NF6A 1NUWA 4R74A 4QFLA 3PPNA 3IJXB 2F3BA 3IOTA 1Y20A 1NKXA 4I8CA 2O7IA 2Q74A 4F29A 2WKYA 2QL3A 1H3DA 3U93A 4JWXA 1Q1KA 4MIJA 3RT6B 1SD3A 2V93A 1FBCA 4MFIA 3LUYA 2RC8A 2F35A 3TZAA 2Q88A 4YMAA 4EQ9A 5DVJA 4P3LA 1QUKA 3RPLA 3K6VA 1FQEA 3K1PA 1JW4A 4N4UA 1YTVA 1LGBC 4H8JA 5AE4A 4BLAA 5I84A 1OQHA 3RYDA 1FPFA 1Q35A 1ZLQA 2L5VA 2PMSA 5EQ8A 4ZECA 3B6WA 4IGTA 2NOOA 2XX7A 1MM7A 3U8QA 3TKDA 4DCYA 4OWDA 3TPAA 3E3KA 3UP9A 3T9VA 1JVYA 2UVJA 4XKNA 4BDOA 2IEEA 1BK4A 1SW2A 2HXWA 4X48A 1F9BA 3L6HA 4X8RA 4LP2B 4KPTA 4BDQA 1B3HA 3K1NA 4PC9A 4NN3A 4MX6A 1FRPA 3OXNA 3EHUA 4H45A 5HBCA 1MS7A 3MAMA 4R6YA 1AIVA 3PV0E 4NF4A 5FHOA 1M5EA 3H4ZA 4P9KA 3TUSA 4PQJA 3IOVA 3IK6B 3RY3A 2I48A 1SW4A 3OO6A 2O84X 3UIFA 4JVDA 5L8DA 1GV8A 4ZEDA 4G77A 3OD7A 4EXLA 3S9LC 1HSJA 1EZOA 4HS7A 4MMPA 3LC8A 3IR1A 1FPGA 2OK2A 5I2NA 2GH9A 1Z7ME 4POWA 1DPPA 1FPLA 1PEBA 4ESWA 2E1SA 4F18A 1B7HA 5IM2A 3FBPA 3KN3A 1EYJA 3OEKA 3QSLA 1MDQA 3CSGA 5AA2A 3IB1A 3TCGA 1JEUA 3CSBA 2WBBA 5ELVA 2IA4A 5KCJA 3FVOA 4P0GA 1B52A 3IX1A 3CI8A 5I58A 2XD2A 4GF8A 3UORA 1R1NA 2HCAA 1BP5A 5EQ9A 3WAEA 3ISPA 1LBWA 4U21A 4H8IA 1LBXA 3MUQA 4IR8A 1IMDA 4YB5A 5H8FB 4OVPA 4TLLB 1M5DA 5KZTA 3KSXA 2CMOA 5DTBA 4KD5A 3TTKA 2XXIA 1LEVA 5AA4B 1MQGA 4IY5A 1LAFE 1II5A 3HV1A 5DT6A 5DVIA 2NWJA 5CC2A 3T93B 4G2ZA 4H1XA 2QVUA 1SPIA 4I3EA 4F22A 3PPQA 5H8NA 1RDXA 4PFBA 4HE2A 4HW8A 3M3KA 3PU5A 2Y7RA 4PFIA 3CR9A 4P56A 2PYYA 1LCTA 4PFUA 4MLQA 1D4NA 2V3UA 5CMMA 4F39A 3G3KA 5CBSA 1MY0A 2QFLA 5AA2D 4ESXA 2PFZA 5LOMA 3N5LA 3K01A 1IITA 4GXAA 1BIYA 1TFDA 3PUXE 4WXJA 1UQWA 1VE4A 4NF0A 2QS2A 4LZ5A 2R71A 3Q29A 5EYHA 2ZNUA 3PUZE 3MWBA 4FIMA 1B5IA 3O6GA 4POXA 1B1HA 5BWJA 5I59A 2Y84A 3TQLA 5EQ7A 4YU0A 4NF5A 1OMPA 3RTFB 1NUYA 3IO4A 5IZ3B 4GQOA 5EYGA 5H8HA 1USYE 3OOAA 4AB5A 4ZZAA 4X04A 1QUIA 3FJGA 3M8UA 1B0HA 3TMGA 2F97A 2B4MA 4N07A 4U4XA 1IMEA 2DWHA 4PGPA 2FHYA 4OVRA 3C35A 5ICQA 4GWZA 5I3SA 4H67A 3IFCA 2FYIA 4JWYA 4KHZE 2E0SA 4M4GA 1B5HA 2DVCA 2Q89A 3KOTA 2XXPA 4I3YA 1OVTA 1SI1A 3O6HA 4HE1A 4WEDA 4MNIA 3VV5A 3FZVA 2XXUA 3ECRA 2XWIA 5ET6A 4JB7A 2BJJX 2QS3A 4PFTA 2QPQA 2W7YA 4QFNA 2RCAA 5EQAA 4WEPA 3ILTB 2I0CA 3VVEA 4U2RA 1NV1A 2UYFA 4OETA 1JNFA 1A40A 4MLVA 1NMUA 4O8MA 1QGXA 2PVUA 3FV1A 5KDTB 1ATGA 3C9HA 3HHFA 3IO6A 3PUWE 4G8HA 3TCHA 2CEXA 4G68C 4BDNA 3KG2A 1A8EA 3HCQA 5M2VA 1LBYA 3MW0A 4F1YA 5CBRA 4NG7A 3H7MA 2Q9TA 4OEVA 1IEJA 2XX9A 3DP6A 4PFWA 2F7BA 1R9LA 3FXBA 4HCYA 1B1XA 2XXXA 2I0BA 1LFIA 1MM6A 2FVZA 2XXQA 4LONB 3QK6A 3U72A 1G0HA 3MVZA 4JDFA 3A09A 1DPEA 1B6HA 5L9OA 4NQ8A 4LQ2A 1IMCA 2A5TB 4GXSB 1LAGE 1PB8A 3VVFA 2F6GA 4NHBA 3UN6A 5DEXB 1GGGA 4KCDA 1VFDA 1MXVA 4ND9A 1NI9A 4IO3A 2VHAA 5CRYA 3TODA 1USYH 4MF3A 4P47A 1FTAA 3MVXA 4GL8A 2FIXA 1FQDA 4KR5A 4PETA 3EKIA 4EF2A 3G3GA 4YKKA 3KC1A 4G8MA 2XWKA 3T96B 1KWHA 4OXVA 1I6AA 2OBGA 5FTHA 4QFOA 1JP4A 5I2KB 3O6IA 1NUXA 5FTIA 3LSFB 5F1QA 4QBAA 2Q2AA 1A99A 1SVXB 4QRZA 4HE0A 1MDP1 4DCXA 5I5PA 1RKMA 1H43A 4GBWA 1DK4A 4PBQA 2GQ1A 4EQ7A 2YJPA 4NMYA 1XT8A 2P3NA 2ZMBA 3G3HA 5TP9B 4ELRA 1K9ZA 1SW1A 3RPWA 4RNSA 3T9UA 3CFLA 3DP8A 3RTWB 1T0KA 1IXGA 3KEIA 4LQ5A 3MP8A 5B7DA 1QJMA 3PPRA 2OWZA 1LBCA 3SEUA 3DP4A 4N8GA 3S4UA 1B58A 3O28A 1MXWA 2ESNA 3ZKLA 3QIMA 2RF1A 1XHYA 3MP1A 1QULA 4PBHA 3EN3A 2GRVA 1FPEA 5TPAA 4GD5A 1CNQA 5B70A 3S9EA 5K2XA 2DVZA 4ELQA 5HPQA 3SERA 3CFXA 1M5BA 3A3UA 4MBPA 3IOUA 3B6TA 1KA0A 5DVFA 2AL5A 3OSRA 1EZ9A 4OYVA 4OVSA 3U65A 1Y1MA 5DW8A 1Y9UA 1NV5A 3T9HB 3OELA 1INPA 3V89B 4YKIA 3KGCA 1YZ0A 1LBBA 1TXFA 1XS5A 4N91A 2VD2A 2WEFA 2THIA 3ZSFA 3K6XA 1P99A 1QVSA 4MNPA 2DS9A 3SDFA 4ZE8A 2RINA 3RT8A 4NX1A 5FHNA 3LSXA 4N6KA 3CVGA 1P1QA 1FPDA 2HFBA 3KBRA 2F7CA 1AMFA 1O64A 2V25A 3FJ7A 4M1VA 1KZ8A 1N7WA 3TAJA 4KCCA 4LA9A 1JETA 2VPNA 3O2AA 3MC2A 1FTMA 4N13A 4ZEFA 3AXFA 2OJTA 2Q2CA 3VE1B 1FBGA 4P0IA 1FJ6A 2ZYNA 1LAHE 1PBPA 1B32A 2QVVA 2I4BA 1NNKA 2QSXA 3E9XA 3O66A 1SYIA 3U92A 3GBBA 4OFOA 1B0LA 1DTGA 4PP0A 3TQWA 1IMFA 4P11A 1DTZA 1MH4A 3ODBA 4TOZA 4F3GA 3VDFA 1MPBA 4Q0CA 2DDKA 4F1VA 3ZKKA 1FPIA 2CZLA 2Z8FA 1POTA 4QSEA 2XHDA 1NH7A 1TFAA 1S7YA 4ZDMA 3PTYA 2F5XA 1FBFA 2DYXA 1N3XA 3LBSA 3GBAA 2KLFA 4F1UA 2FBPA 3EF7A 2DSFA 5H8FA 3G3FA 1NV3A 2XXYA 2O6AA 3UA8A 2H98A 3IFAA 4JSDA 4H6DA 4ONYA 3K2DA 4G8NA 4DXCA 4GWUA 2HZKA 1EH3A 1I69A 3D4GA 5IKBA 4N6DA 3RNNA 3FATA 1FSAA 3OO9A 5ESYA 4FEBA 3SEWA 4LUBA 4XEQA 1OLCA 4JXIA 1MQIA 3A29A 3QUFA 3NOHA 5HM4B 3BIGA 1GTKA 4GWOA 2I3VA 4YMBA 4PFYA 3PUYE 3H6UA 3FXQA 4N17A 5AA3A 1NV2A 3KBZA 2Q8JA 1NV4A 3FIRA 4GX4A 3S2VA 5A5XB 4NF4B 1SBPA 2R9JA 1XVXA 4U4SA 4C1UA 4Z7EA 3I3VA 3DM0A 3IORA 2YLNA 2M8CA 4R6KA 3R6UA 4ZS9A 2O1MA 2VP1A 3TTNA 2VOZA 1LBVA 2WYPA 1HSLA 1YCJA 5F24A 2DQVA 4ZEBA 1EZPA 4AB6A 3V5AA 1NV0A 3T66A 5IZ3A 3I5OA 4R9FA 3O29A 2CZIA 4C0RA 3SEVA 2Y5KA 4RA1A 4XKQA 1IUDA 3E79A 4I40A 1FQBA 2PFYA 4GOTA 3CG1A 4ELPA 1GR2A 1B46A 1YAEA 2D5WA 1XI6A 3KSJA 2V3TA 1D9VA 5KCJB 3K02A 3TDJA 2OZZA 4F3BA 4OZ9A 1O7TA 3K0VA 1MH3A 1MY3A 3MYUA 3TEPA 1DOTA 2Q8MA 4O3CA 1LBZA 5H8QB 3TTMA 2REJA 1B40A 3MVWA 5CMCA 2OWTA 3H03A 3TYHA 4H65A 2G29A 4KXPA 3T0JA 1JW5A 5CM6A 2NUVA 1PDAA 3HFUA 3EHSA 1RYOA 2DWJA 3MPKA 3OENA 1TWYA 3QXMA 5IGAA 2JJKA 2KQZA 1UTHA 5H8NB 1FPJA 1ZTYA 1US4A 4TQUQ 4KQPA 4AS5A 4O7MA 3BFUA 4IO2A 3CIJA 1PC3A 2FA7A 4NWCA 3CHGA 1NNTA 5I7IA 1MY1A 3FXRA 1CE2A 2PBWA 4OVQA 4F3PA 4IO6A 2DE3A 3MVYA 3IB2A 1Y1ZA 2X7QA 1OVBA 5CMKA 1BLFA 2MKZA 1SDXA 4TLMB 3TCFA 4MEVA 1DBZA 4NF8A 2AIXA 3E13X 4U1ZA 5J1DA 2ZNTA 1FW0A 4OMBA 1CB6A 3O97A 2VD3A 2XXWA 3OMBA 3F11A 1IMBA 1DSNA 2DWAA 4F2QA 4F2OA 3MJNA 2Y7KA 5H8HB 5ET7A 4GRKA 3UGWA 5I56A 3N26A 2R6GE 4GL0A 4YAHX 3G7WA 1B51A 2HEUA 1ZJLA 4OESA 2I58A 1RDYA 4Q8RA 4BDLA 3SEYA 3OEMA 4ISUA 4O94A 4XXUA 1XOCA 2F78A 1R9QA 5JEIA 3N6TA 1UIVA 3Q28A 3FGSA 2XX8A 1IXCA 3D1RA 5I57B 5EHMA 4PCDA 3MQ9A 4R75A 4R6HA 5EYFA 5FHMA 4F3SA 5ICTA 2PCRA 2VT5A 4G68B 2H4IA 4YICA 3MZBA 4HCWA 1YYZA 3S9NC 3PD9A 2HZLA 3VXCA 2OCUA 2XA5A 4GX6A 3K4UA 4H5GA 1H76A 3CG3A 4YZZA 1SW5A 4DZ1A 4OEUA 1K9YA 4Z0IA 4Q5TA 1NV7A 4FAJA 2LAOA 4G4PA 4OVTA 3RLFE 2P3VA 5BUUA 3W9VA 3UK4A 1IZ1A 1MY2A 4YB7A 3PMVA 1EYKA 3H6TA 4QXDA 4X1BA 5TP9A 1D3KA 1FPBA 2UVIA 1IXHA 3IAZA 2Y7IA 1AWBA 3W9WA 1Y3NA 2QRYA 1QW0A 3PPPA 3Q27A 1Y3PA 4UABA 4PE3A 4PAKA 2Y7PA 2ZXTA 4GIZA 1WDNA 1Y3QA 4DXUA 2ZZWA 4IO4A 4U23A 3THIA 3VLUA 4PE5B 1QKBA 1ZMGA 2ABHA 2HAVA 5ET5A 3B50A 3FASA 3IL1B 1UTBA 3K6UA 4QSCA 1NNFA 5JTYB 4ZEKA 2O68A 1FBPA 2Z22A 5H8SA 1YXIA 1H45A 2QMWA 2V84A 1R6ZA 4P8BA 4QSDA 4H0WA 3HO7A 1P1WA 4YKJA 1A7LA 1MQDA 5AA1A 1UIUA 4F19A 2DOJA 3PPOA 5TU0A 2ONSA 2P2AA 2VPOA 4C1TA 4NAPA 3JYRA 3MZ1A 3K00A 3HHGA 1VDWA 4FE8A 2WBDA 5T3JA 1QUJA 4PFRA 5L9MA 2PX1A 1FPKA 2NVUB 4RYAA 1S9TA 2WYKA 4P1EA 1S50A 2BJIA 2F3DA 4PGNA 2D21A 3L6GA 4OTEA 3E4RA 4GFRA 1MXYA 3FJMA 4OERA 2ANJA 4AS4A 3CRBA 2Z8DA 4AQ4A 3EHTA 4LN5A 4DE8A 2H5YA 2NXOA 4XFEA 4NE4A 3C4MA 3BBRA 1B3GA 2ZYMA 2O69A 4FJPA 3H3GA 2H9BA 4ECFA 4MHFA 1ELJA 3KN8A 4XIGQ 2P1SA 4UA8A 3G3IA 2F7AA 2OLBA 3QUJA 3FUZA 2O51A 1NH8A 3T1BA 1IIWA 2F36A 2F34A 1JW1A 2ZZVA 2XXTA 1FJ9A 1IMAA 3HPIA 4DIGA 3GLBA 2XXHA 2RC9A 4XTCQ 1N3WA 3VVDA 2ZYOA 4QFKA 4EQBA 2DXRA 2KR0A 3T22A 3M3FA 3G3JA 3IOWA 4FEDA 5CI5A 5TPAB 3SEXA 2DXYA 4PDDA 1MXUA 3ZS6A 5ITOA 2FIEA 2QS1A 3OO8A 1FBHA 1AH5A 3MZ9A 3ROJA 1FTOA 1N76A 2XXVA 4NF6B 3T9XB 1FQAA 3FXUA 4O7IA 4OENA 2A5SA 4EF1A 1P1OA 2QS4A 2VGQA 4ELOA 3I6VA 3K6WA 4PAFA 1AL3A 3U94A 2FNCA 1A8FA 4I9DA 1SQYA 1JEVA 1Y4TA 1D9YA 3RPLB 1MQJA 4R72A 4DLDA 1B4HA 3S9MC 1AOVA 3SZPA 1IQ7A 5A5XA 3GYYA 4EXKA 2CEYA 3D4CA 4OHNA 1P1UA 1US5A 4IY6A 1FCKA 4YKPA 3SESA 5AA4A 3K1MA 4JSOA 2XXKA 3BFTA 3B8BA 4KFQA 4R73A 3B6QA 4KYDA 2QMXA 2OX3A 3PGFA 1B05A 2REGA 3VXBA 1LAXA 3ILUB 1WVJA 2HXRA 4XKPA 4Q30B 4GLIA 4JWOA 3LV0A 3TFLA 1B3EA 5ET8A 3MSTA 1Q9DA 4E0WA 3KZGA 3W15C 2DP8A 1LFGA 4NTLA 1B4ZA 2Y5LA 1NFTA 5F7VA 4QHQA 4GWWA 1N0TA 5JK4A 3Q25A 1QKAA 4RY1A 3H6WA 3SETA 1N04A 3U1OA 4OFLA 3O9PA 3PMWA 3KFMA 4RJZA 3KJTA 2YPNA 3LSLA 3IJOB 1RDZA 4RXLA 5H8QA 1RYXA 2AYSA 5LTCA 4OVJA 1B3LA 1ZBMA 4OANA 3CFZA 1L5TA 5IZZA 1MY4A 3SKPA 5I2NB 2HPGA 1EYIA 3BKIB 4KYSA 3N6UA 4OQOA 3E78A 4PF6A 5L9SA 1BTJA 1PB7A 4JVIA 5AA2B 3VLVA 4GX3A 4IO5A 2XWOA 4EUOA 1FQFA 2ONRA 4G61A 2QJEA 1DMBA 2DWIA 2XXRA 4DXBA 5I58B 4LATA 1MG1A 1PB9A 4H46A 5LDZA 3VLWA 1LFHA 2OWSA 1J1NA 4FATA 2GHAA 5FBPA 4LZ8A 4MH5A 2B3BA 4XF5A 3KJ7A 2ZYKA 3JV9A 1XVYA 4GVOA 4QFPA 4KI0E 3TTRA 3OO7A 4U1OA 1JVXA 2PT1A 4XKRA 1NL5A 1LSTA 5J16A 2WX9A 1M5FA 3LUZA 3BIHA 1P1NA 1URGA 4UACA 1IXIA 2AL4A 2GHBA 1LB9A 4PAIA 3TELA 2X7PA 3Q26A 3WAFA 1LCFA 1LB8A 1O63A 5KDTA 4N8YA 4R9GA 1FBEA 4BDMA 4RPNA 3R7XA 4P1LA 1NV6A 4NWDA 3USDA 1OIBA 2Z8EA 4X1DA 3P7IA 1B7ZA 3QMFA 2V3QA 2Z23A 3C32A 3B7DA 3KOSA 5IAIA 4LZ7A 2I6EA 3C36A 3LSWA 5I57A 3R26A 4K3FA 4I62A 3EPEA 4O3BA 1I6QA 1Z7NE 5IZ1A 1OLAA 2UVGA 1B2HA 5I59B 4YB6A 4G68A 4IGRA 2I3WA 4QF9A 2Y7WA 2HAUA 4NF5B 4U22A 3C33A 1G0IA 4FBPA 4JBZA 1GVCA 2A5TA 1B3FA 2UXAA 1ZKBA 4MCOA 3C34A 3PUVE 4N15A 1N84A 1ANFA 4ZZEA 5DEXA 1NNPA 2CZHA 1UTHB 3KN7A 2H99A 1URSA 4RK9A 1VR5A 2DE2A 1EU8A 1WODA 1HSEA 4OFJA 2XWVA 4N6PA
chains in the Genus database with same CATH topology
1BKAA 2D3IA 2O1LA 1OQGA 2ONKE 3RUMA 1FQCA 3TTLA 4RPOA 5I2KA 3FD3A 1URDA 3IB0A 2I49A 1H44A 4ZEIA 3PD8A 2RCBA 1SI0A 1LLSA 5EHSA 3MBPA 4NF8B 2F6PA 2G93A 4HTGA 2ALUA 3QYTA 4WKMA 2XD3A 3RN8A 2B3FA 3ONMA 3N94A 1MQHA 3V83A 1MXZA 3RGYA 2HQ0A 3MP6A 2B65A 1VFEA 5JTYA 3QAXA 4O3AA 3LR1A 5I56B 4DDDA 1B9JA 4KYEA 2RKMA 4E0XA 1FTJA 4IO7A 4R2FA 3FVNA 4NEDA 1N7XA 1JQFA 3C31A 5DYHA 1SYHA 4RK2A 1ZU0A 5ISUA 1A55A 2H25A 3DLNA 1M5CA 3H6VA 2UVHA 4IB2A 1A54A 4FORA 1FTLA 1PBQA 3OSQA 4ZE9A 5ITPA 4THIA 2I4CA 3PMXA 4BDRA 1Y4CA 1B7UA 1POY1 2P0SA 3HN0A 2RC7A 3A3CA 4I1DA 1VSOA 2ZNSA 5CMBA 3EQ1A 1MXXA 3FVKA 3JZJA 3VFJA 2UYEA 1TT1A 1ZIUA 3M3LA 4EDPA 2PT2A 3FVGA 1MPDA 1MPCA 3GZGA 1B5JA 4L17A 1XC1A 3GXAA 2F8DA 5K2YA 4R2BA 3FV2A 3MPLA 3RQTA 1MRPA 2DE4A 3DELB 3H06B 4FECA 4LVQA 1UTBB 1I6BA 2O7UA 4H5FA 2X26A 4F31B 2GFEA 3HSTA 1YPNA 3V8XB 4X9TA 1FTKA 4NF6A 4R74A 4QFLA 3PPNA 3IJXB 3IOTA 1Y20A 1NKXA 4I8CA 2O7IA 4F29A 2WKYA 2QL3A 1H3DA 3U93A 4JWXA 1Q1KA 3RT6B 1SD3A 2V93A 4MFIA 3LUYA 2RC8A 2F35A 3TZAA 2Q88A 4YMAA 4EQ9A 5DVJA 1QUKA 3K6VA 1FQEA 3K1PA 1JW4A 1YTVA 1LGBC 4H8JA 5AE4A 4BLAA 5I84A 1OQHA 1Q35A 1ZLQA 2PMSA 4ZECA 3B6WA 4IGTA 2NOOA 2XX7A 1MM7A 3U8QA 3TKDA 4DCYA 4OWDA 3TPAA 3E3KA 3UP9A 3T9VA 1JVYA 2UVJA 4XKNA 4BDOA 2IEEA 1SW2A 2HXWA 4X48A 1F9BA 3L6HA 4LP2B 4KPTA 4BDQA 1B3HA 3K1NA 3OXNA 3EHUA 5HBCA 1MS7A 3MAMA 4R6YA 1AIVA 3PV0E 4NF4A 5FHOA 1M5EA 3H4ZA 3TUSA 4PQJA 3IOVA 3IK6B 3RY3A 2I48A 1SW4A 3OO6A 2O84X 3UIFA 1GV8A 5L8DA 4ZEDA 4G77A 3OD7A 4EXLA 3S9LC 1HSJA 1EZOA 4HS7A 3LC8A 3IR1A 2OK2A 5I2NA 2GH9A 1Z7ME 4POWA 1DPPA 1PEBA 4ESWA 2E1SA 4F18A 1B7HA 3KN3A 3OEKA 3QSLA 1MDQA 3CSGA 5AA2A 3IB1A 3TCGA 1JEUA 3CSBA 5ELVA 2IA4A 5KCJA 3FVOA 4P0GA 1B52A 3IX1A 3CI8A 5I58A 2XD2A 4GF8A 3UORA 1R1NA 2HCAA 1BP5A 3WAEA 4U21A 4H8IA 3MUQA 4YB5A 5H8FB 4TLLB 1M5DA 5KZTA 3KSXA 2CMOA 5DTBA 4KD5A 3TTKA 2XXIA 5AA4B 1MQGA 4IY5A 1LAFE 1II5A 3HV1A 5DT6A 5DVIA 2NWJA 5CC2A 3T93B 4G2ZA 4H1XA 4F22A 3PPQA 5H8NA 4HW8A 3M3KA 3PU5A 2Y7RA 3CR9A 2PYYA 1LCTA 4PFUA 4MLQA 1D4NA 2V3UA 5CMMA 4F39A 3G3KA 5CBSA 1MY0A 5AA2D 4ESXA 5LOMA 3N5LA 3K01A 1IITA 4GXAA 1BIYA 1TFDA 3PUXE 4WXJA 1UQWA 1VE4A 2QS2A 4LZ5A 2R71A 3Q29A 2ZNUA 3PUZE 3MWBA 4FIMA 1B5IA 3O6GA 4POXA 1B1HA 5BWJA 5I59A 2Y84A 3TQLA 4YU0A 4NF5A 1OMPA 3RTFB 3IO4A 4GQOA 5H8HA 1USYE 3OOAA 4AB5A 4ZZAA 1QUIA 3FJGA 3M8UA 1B0HA 3TMGA 2F97A 4N07A 4U4XA 2DWHA 3C35A 5ICQA 4H67A 2FYIA 4JWYA 4KHZE 2E0SA 4M4GA 1B5HA 2DVCA 2Q89A 3KOTA 2XXPA 1OVTA 1SI1A 3O6HA 4WEDA 3VV5A 3FZVA 2XXUA 3ECRA 4JB7A 2BJJX 2QS3A 4PFTA 2QPQA 2W7YA 4QFNA 2RCAA 4WEPA 3ILTB 2I0CA 3VVEA 4U2RA 2UYFA 4OETA 1JNFA 1A40A 4MLVA 1NMUA 2PVUA 3FV1A 5KDTB 1ATGA 3C9HA 3HHFA 3IO6A 3PUWE 4G8HA 3TCHA 4G68C 4BDNA 3KG2A 1A8EA 3HCQA 5M2VA 3MW0A 4F1YA 5CBRA 3H7MA 2Q9TA 4OEVA 1IEJA 2XX9A 3DP6A 4PFWA 2F7BA 1R9LA 4HCYA 1B1XA 2XXXA 2I0BA 1LFIA 1MM6A 2XXQA 4LONB 3QK6A 3U72A 3MVZA 4JDFA 3A09A 1DPEA 1B6HA 5L9OA 4LQ2A 2A5TB 4GXSB 1LAGE 1PB8A 3VVFA 2F6GA 3UN6A 5DEXB 1GGGA 4KCDA 1VFDA 1MXVA 4ND9A 4IO3A 2VHAA 5CRYA 3TODA 1USYH 4MF3A 3MVXA 4GL8A 1FQDA 4KR5A 4PETA 4EF2A 3G3GA 4YKKA 4G8MA 3T96B 1KWHA 4OXVA 1I6AA 2OBGA 5FTHA 4QFOA 5I2KB 3O6IA 5FTIA 3LSFB 5F1QA 2Q2AA 1A99A 1SVXB 4QRZA 1MDP1 4DCXA 1RKMA 1H43A 4EQ7A 2YJPA 4NMYA 1XT8A 2ZMBA 3G3HA 5TP9B 4ELRA 1SW1A 3RPWA 4RNSA 3T9UA 3CFLA 3DP8A 3RTWB 1T0KA 1IXGA 3KEIA 4LQ5A 3MP8A 5B7DA 1QJMA 3PPRA 1LBCA 3SEUA 3DP4A 3S4UA 1B58A 3O28A 1MXWA 2ESNA 3ZKLA 3QIMA 2RF1A 1XHYA 3MP1A 1QULA 3EN3A 2GRVA 5TPAA 4GD5A 5B70A 3S9EA 5K2XA 2DVZA 4ELQA 5HPQA 3SERA 3CFXA 1M5BA 3A3UA 4MBPA 3IOUA 3B6TA 5DVFA 2AL5A 3OSRA 1EZ9A 4OYVA 1Y1MA 1Y9UA 3T9HB 3OELA 3V89B 4YKIA 3KGCA 1LBBA 1TXFA 1XS5A 2VD2A 2THIA 3ZSFA 3K6XA 1P99A 1QVSA 2DS9A 3SDFA 4ZE8A 2RINA 3RT8A 5FHNA 3LSXA 3CVGA 1P1QA 2HFBA 2F7CA 3KBRA 1AMFA 1O64A 2V25A 3FJ7A 4M1VA 1N7WA 3TAJA 4KCCA 4LA9A 1JETA 3O2AA 3MC2A 1FTMA 4N13A 4ZEFA 3AXFA 2OJTA 2Q2CA 3VE1B 4P0IA 2ZYNA 1LAHE 1PBPA 1B32A 2I4BA 1NNKA 2QSXA 3E9XA 3U92A 1SYIA 3O66A 3GBBA 4OFOA 1B0LA 1DTGA 4PP0A 3TQWA 4P11A 1DTZA 1MH4A 3ODBA 4TOZA 4F3GA 3VDFA 1MPBA 4Q0CA 4F1VA 3ZKKA 2CZLA 2Z8FA 1POTA 4QSEA 2XHDA 1NH7A 1TFAA 1S7YA 4ZDMA 2F5XA 2DYXA 1N3XA 3LBSA 3GBAA 2KLFA 4F1UA 3EF7A 2DSFA 5H8FA 3G3FA 2XXYA 2O6AA 3UA8A 2H98A 4JSDA 4H6DA 4ONYA 3K2DA 4G8NA 4DXCA 2HZKA 1EH3A 1I69A 3D4GA 5IKBA 3RNNA 3FATA 3OO9A 4FEBA 3SEWA 4LUBA 1OLCA 4JXIA 1MQIA 3QUFA 5HM4B 1GTKA 4GWOA 2I3VA 4YMBA 4PFYA 3PUYE 3H6UA 3FXQA 5AA3A 2Q8JA 3FIRA 3S2VA 5A5XB 4NF4B 1SBPA 2R9JA 1XVXA 4U4SA 4C1UA 4Z7EA 3I3VA 3DM0A 3IORA 2YLNA 2M8CA 4R6KA 3R6UA 4ZS9A 2O1MA 2VP1A 3TTNA 2VOZA 1HSLA 1YCJA 4ZEBA 2DQVA 1EZPA 4AB6A 3V5AA 3T66A 3I5OA 4R9FA 3O29A 4C0RA 3SEVA 4RA1A 4XKQA 1IUDA 1FQBA 4GOTA 3CG1A 4ELPA 1GR2A 1B46A 1YAEA 2D5WA 3KSJA 2V3TA 1D9VA 5KCJB 3K02A 3TDJA 2OZZA 4F3BA 4OZ9A 1O7TA 3K0VA 1MH3A 1MY3A 3TEPA 1DOTA 4O3CA 5H8QB 3TTMA 2REJA 1B40A 3MVWA 5CMCA 2OWTA 3H03A 3TYHA 4H65A 2G29A 1JW5A 5CM6A 2NUVA 1PDAA 3EHSA 1RYOA 2DWJA 3MPKA 3OENA 1TWYA 3QXMA 1UTHA 5H8NB 1ZTYA 1US4A 4TQUQ 4KQPA 3BFUA 4IO2A 3CIJA 1PC3A 2FA7A 4NWCA 1NNTA 1MY1A 3FXRA 1CE2A 2PBWA 4F3PA 4IO6A 2DE3A 3MVYA 3IB2A 1Y1ZA 2X7QA 1OVBA 5CMKA 1BLFA 1SDXA 4TLMB 3TCFA 4NF8A 2AIXA 3E13X 4U1ZA 5J1DA 2ZNTA 1FW0A 4OMBA 1CB6A 3O97A 2VD3A 2XXWA 3OMBA 3F11A 1DSNA 2DWAA 4F2QA 4F2OA 3MJNA 2Y7KA 5H8HB 4GRKA 3UGWA 5I56A 3N26A 2R6GE 4GL0A 4YAHX 3G7WA 1B51A 2HEUA 1ZJLA 4OESA 2I58A 4Q8RA 4BDLA 3SEYA 3OEMA 4ISUA 4XXUA 1XOCA 2F78A 1R9QA 5JEIA 3N6TA 1UIVA 3Q28A 3FGSA 2XX8A 1IXCA 5I57B 5EHMA 4R75A 3MQ9A 4R6HA 5EYFA 5FHMA 4F3SA 5ICTA 4G68B 2H4IA 4YICA 3MZBA 4HCWA 3S9NC 3PD9A 2HZLA 3VXCA 2OCUA 4H5GA 3K4UA 1H76A 3CG3A 4YZZA 1SW5A 4DZ1A 4OEUA 4Z0IA 4Q5TA 4FAJA 2LAOA 4G4PA 3RLFE 5BUUA 3W9VA 3UK4A 1IZ1A 1MY2A 4YB7A 3PMVA 3H6TA 5TP9A 4X1BA 1D3KA 2UVIA 1IXHA 3IAZA 2Y7IA 3W9WA 1Y3NA 2QRYA 1QW0A 3PPPA 3Q27A 1Y3PA 2Y7PA 2ZXTA 4GIZA 1WDNA 1Y3QA 4DXUA 4IO4A 4U23A 3THIA 3VLUA 4PE5B 1QKBA 1ZMGA 2ABHA 2HAVA 3FASA 3IL1B 1UTBA 3K6UA 4QSCA 1NNFA 5JTYB 4ZEKA 2O68A 2Z22A 5H8SA 1H45A 2QMWA 2V84A 1R6ZA 4QSDA 4H0WA 3HO7A 1P1WA 4YKJA 1A7LA 1MQDA 5AA1A 1UIUA 4F19A 2DOJA 3PPOA 5TU0A 2ONSA 2P2AA 4C1TA 3JYRA 3MZ1A 3K00A 3HHGA 4FE8A 1QUJA 5L9MA 2PX1A 2NVUB 4RYAA 1S9TA 1S50A 2D21A 3L6GA 4OTEA 3E4RA 4GFRA 1MXYA 3FJMA 4OERA 2ANJA 3CRBA 2Z8DA 4AQ4A 3EHTA 4DE8A 2H5YA 2NXOA 4NE4A 3C4MA 3BBRA 1B3GA 2ZYMA 2O69A 4FJPA 3H3GA 2H9BA 4ECFA 1ELJA 3KN8A 4XIGQ 2P1SA 4UA8A 3G3IA 2F7AA 2OLBA 3QUJA 3FUZA 2O51A 1NH8A 1IIWA 2F36A 2F34A 1JW1A 2XXTA 3HPIA 4DIGA 3GLBA 2XXHA 2RC9A 4XTCQ 1N3WA 3VVDA 2ZYOA 4QFKA 4EQBA 2DXRA 3T22A 3M3FA 3G3JA 3IOWA 4FEDA 5CI5A 5TPAB 3SEXA 2DXYA 1MXUA 3ZS6A 5ITOA 2QS1A 3OO8A 1AH5A 3MZ9A 1FTOA 1N76A 2XXVA 4NF6B 3T9XB 1FQAA 3FXUA 4OENA 2A5SA 4EF1A 1P1OA 2QS4A 2VGQA 4ELOA 3I6VA 3K6WA 1AL3A 3U94A 2FNCA 1A8FA 4I9DA 1SQYA 1JEVA 1Y4TA 1D9YA 1MQJA 4R72A 4DLDA 1B4HA 3S9MC 1AOVA 1IQ7A 5A5XA 4EXKA 3D4CA 4OHNA 1P1UA 1US5A 4IY6A 1FCKA 4YKPA 3SESA 5AA4A 3K1MA 4JSOA 3BFTA 4KFQA 4R73A 3B6QA 4KYDA 2QMXA 3PGFA 1B05A 2REGA 3VXBA 1LAXA 3ILUB 1WVJA 4XKPA 4Q30B 4GLIA 4JWOA 3TFLA 1B3EA 4E0WA 3KZGA 3W15C 2DP8A 1LFGA 4NTLA 1B4ZA 1NFTA 5F7VA 4QHQA 1N0TA 5JK4A 3Q25A 1QKAA 4RY1A 3H6WA 3SETA 1N04A 3U1OA 4OFLA 3O9PA 3PMWA 3KFMA 4RJZA 3KJTA 2YPNA 3LSLA 3IJOB 4RXLA 5H8QA 1RYXA 2AYSA 4OVJA 1B3LA 1ZBMA 3CFZA 1L5TA 1MY4A 3SKPA 5I2NB 3BKIB 4KYSA 3N6UA 4OQOA 5L9SA 1BTJA 1PB7A 5AA2B 3VLVA 4IO5A 4EUOA 1FQFA 2ONRA 2QJEA 1DMBA 2DWIA 2XXRA 4DXBA 5I58B 4LATA 1MG1A 1PB9A 3VLWA 1LFHA 2OWSA 1J1NA 4FATA 2GHAA 4LZ8A 4MH5A 2B3BA 3KJ7A 2ZYKA 3JV9A 1XVYA 4GVOA 4QFPA 4KI0E 3TTRA 3OO7A 4U1OA 1JVXA 2PT1A 4XKRA 1NL5A 1LSTA 1M5FA 1P1NA 1URGA 4UACA 1IXIA 2AL4A 2GHBA 1LB9A 3TELA 2X7PA 3Q26A 3WAFA 1LCFA 1LB8A 1O63A 5KDTA 4R9GA 4BDMA 4RPNA 3R7XA 4NWDA 3USDA 1OIBA 2Z8EA 4X1DA 3P7IA 1B7ZA 2V3QA 2Z23A 3C32A 3B7DA 3KOSA 5IAIA 4LZ7A 2I6EA 3C36A 3LSWA 5I57A 3R26A 4K3FA 4I62A 3EPEA 4O3BA 1I6QA 1Z7NE 1OLAA 2UVGA 1B2HA 5I59B 4YB6A 4G68A 4IGRA 2I3WA 4QF9A 2Y7WA 2HAUA 4NF5B 4U22A 3C33A 4JBZA 1GVCA 2A5TA 1B3FA 2UXAA 1ZKBA 3C34A 4ZZEA 1N84A 3PUVE 1ANFA 5DEXA 1NNPA 1UTHB 3KN7A 2H99A 1URSA 4RK9A 1VR5A 2DE2A 1EU8A 1WODA 1HSEA 4OFJA 4N6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BKA A;  2D3I A;  2O1L A;  1OQG A;  2ONK E;  3RUM A;  1FQC A;  3TTL A;  4RPO A;  5I2K A;  3FD3 A;  1URD A;  3IB0 A;  2I49 A;  1H44 A;  4ZEI A;  3PD8 A;  2RCB A;  1SI0 A;  1LLS A;  5EHS A;  3MBP A;  4NF8 B;  2F6P A;  2G93 A;  4HTG A;  2ALU A;  3QYT A;  4WKM A;  2XD3 A;  3RN8 A;  2B3F A;  3ONM A;  3N94 A;  1MQH A;  3V83 A;  1MXZ A;  3RGY A;  2HQ0 A;  3MP6 A;  2B65 A;  1VFE A;  5JTY A;  3QAX A;  4O3A A;  3LR1 A;  5I56 B;  4DDD A;  1B9J A;  4KYE A;  2RKM A;  4E0X A;  1FTJ A;  4IO7 A;  4R2F A;  3FVN A;  4NED A;  1N7X A;  1JQF A;  3C31 A;  5DYH A;  1SYH A;  4RK2 A;  1ZU0 A;  5ISU A;  1A55 A;  2H25 A;  3DLN A;  1M5C A;  3H6V A;  2UVH A;  4IB2 A;  1A54 A;  4FOR A;  1FTL A;  1PBQ A;  3OSQ A;  4ZE9 A;  5ITP A;  4THI A;  2I4C A;  3PMX A;  4BDR A;  1Y4C A;  1B7U A;  1POY 1;  2P0S A;  3HN0 A;  2RC7 A;  3A3C A;  4I1D A;  1VSO A;  2ZNS A;  5CMB A;  3EQ1 A;  1MXX A;  3FVK A;  3JZJ A;  3VFJ A;  2UYE A;  1TT1 A;  1ZIU A;  3M3L A;  4EDP A;  2PT2 A;  3FVG A;  1MPD A;  1MPC A;  3GZG A;  1B5J A;  4L17 A;  1XC1 A;  3GXA A;  2F8D A;  5K2Y A;  4R2B A;  3FV2 A;  3MPL A;  3RQT A;  1MRP A;  2DE4 A;  3DEL B;  3H06 B;  4FEC A;  4LVQ A;  1UTB B;  1I6B A;  2O7U A;  4H5F A;  2X26 A;  4F31 B;  2GFE A;  3HST A;  1YPN A;  3V8X B;  4X9T A;  1FTK A;  4NF6 A;  4R74 A;  4QFL A;  3PPN A;  3IJX B;  3IOT A;  1Y20 A;  1NKX A;  4I8C A;  2O7I A;  4F29 A;  2WKY A;  2QL3 A;  1H3D A;  3U93 A;  4JWX A;  1Q1K A;  3RT6 B;  1SD3 A;  2V93 A;  4MFI A;  3LUY A;  2RC8 A;  2F35 A;  3TZA A;  2Q88 A;  4YMA A;  4EQ9 A;  5DVJ A;  1QUK A;  3K6V A;  1FQE A;  3K1P A;  1JW4 A;  1YTV A;  1LGB C;  4H8J A;  5AE4 A;  4BLA A;  5I84 A;  1OQH A;  1Q35 A;  1ZLQ A;  2PMS A;  4ZEC A;  3B6W A;  4IGT A;  2NOO A;  2XX7 A;  1MM7 A;  3U8Q A;  3TKD A;  4DCY A;  4OWD A;  3TPA A;  3E3K A;  3UP9 A;  3T9V A;  1JVY A;  2UVJ A;  4XKN A;  4BDO A;  2IEE A;  1SW2 A;  2HXW A;  4X48 A;  1F9B A;  3L6H A;  4LP2 B;  4KPT A;  4BDQ A;  1B3H A;  3K1N A;  3OXN A;  3EHU A;  5HBC A;  1MS7 A;  3MAM A;  4R6Y A;  1AIV A;  3PV0 E;  4NF4 A;  5FHO A;  1M5E A;  3H4Z A;  3TUS A;  4PQJ A;  3IOV A;  3IK6 B;  3RY3 A;  2I48 A;  1SW4 A;  3OO6 A;  2O84 X;  3UIF A;  1GV8 A;  5L8D A;  4ZED A;  4G77 A;  3OD7 A;  4EXL A;  3S9L C;  1HSJ A;  1EZO A;  4HS7 A;  3LC8 A;  3IR1 A;  2OK2 A;  5I2N A;  2GH9 A;  1Z7M E;  4POW A;  1DPP A;  1PEB A;  4ESW A;  2E1S A;  4F18 A;  1B7H A;  3KN3 A;  3OEK A;  3QSL A;  1MDQ A;  3CSG A;  5AA2 A;  3IB1 A;  3TCG A;  1JEU A;  3CSB A;  5ELV A;  2IA4 A;  5KCJ A;  3FVO A;  4P0G A;  1B52 A;  3IX1 A;  3CI8 A;  5I58 A;  2XD2 A;  4GF8 A;  3UOR A;  1R1N A;  2HCA A;  1BP5 A;  3WAE A;  4U21 A;  4H8I A;  3MUQ A;  4YB5 A;  5H8F B;  4TLL B;  1M5D A;  5KZT A;  3KSX A;  2CMO A;  5DTB A;  4KD5 A;  3TTK A;  2XXI A;  5AA4 B;  1MQG A;  4IY5 A;  1LAF E;  1II5 A;  3HV1 A;  5DT6 A;  5DVI A;  2NWJ A;  5CC2 A;  3T93 B;  4G2Z A;  4H1X A;  4F22 A;  3PPQ A;  5H8N A;  4HW8 A;  3M3K A;  3PU5 A;  2Y7R A;  3CR9 A;  2PYY A;  1LCT A;  4PFU A;  4MLQ A;  1D4N A;  2V3U A;  5CMM A;  4F39 A;  3G3K A;  5CBS A;  1MY0 A;  5AA2 D;  4ESX A;  5LOM A;  3N5L A;  3K01 A;  1IIT A;  4GXA A;  1BIY A;  1TFD A;  3PUX E;  4WXJ A;  1UQW A;  1VE4 A;  2QS2 A;  4LZ5 A;  2R71 A;  3Q29 A;  2ZNU A;  3PUZ E;  3MWB A;  4FIM A;  1B5I A;  3O6G A;  4POX A;  1B1H A;  5BWJ A;  5I59 A;  2Y84 A;  3TQL A;  4YU0 A;  4NF5 A;  1OMP A;  3RTF B;  3IO4 A;  4GQO A;  5H8H A;  1USY E;  3OOA A;  4AB5 A;  4ZZA A;  1QUI A;  3FJG A;  3M8U A;  1B0H A;  3TMG A;  2F97 A;  4N07 A;  4U4X A;  2DWH A;  3C35 A;  5ICQ A;  4H67 A;  2FYI A;  4JWY A;  4KHZ E;  2E0S A;  4M4G A;  1B5H A;  2DVC A;  2Q89 A;  3KOT A;  2XXP A;  1OVT A;  1SI1 A;  3O6H A;  4WED A;  3VV5 A;  3FZV A;  2XXU A;  3ECR A;  4JB7 A;  2BJJ X;  2QS3 A;  4PFT A;  2QPQ A;  2W7Y A;  4QFN A;  2RCA A;  4WEP A;  3ILT B;  2I0C A;  3VVE A;  4U2R A;  2UYF A;  4OET A;  1JNF A;  1A40 A;  4MLV A;  1NMU A;  2PVU A;  3FV1 A;  5KDT B;  1ATG A;  3C9H A;  3HHF A;  3IO6 A;  3PUW E;  4G8H A;  3TCH A;  4G68 C;  4BDN A;  3KG2 A;  1A8E A;  3HCQ A;  5M2V A;  3MW0 A;  4F1Y A;  5CBR A;  3H7M A;  2Q9T A;  4OEV A;  1IEJ A;  2XX9 A;  3DP6 A;  4PFW A;  2F7B A;  1R9L A;  4HCY A;  1B1X A;  2XXX A;  2I0B A;  1LFI A;  1MM6 A;  2XXQ A;  4LON B;  3QK6 A;  3U72 A;  3MVZ A;  4JDF A;  3A09 A;  1DPE A;  1B6H A;  5L9O A;  4LQ2 A;  2A5T B;  4GXS B;  1LAG E;  1PB8 A;  3VVF A;  2F6G A;  3UN6 A;  5DEX B;  1GGG A;  4KCD A;  1VFD A;  1MXV A;  4ND9 A;  4IO3 A;  2VHA A;  5CRY A;  3TOD A;  1USY H;  4MF3 A;  3MVX A;  4GL8 A;  1FQD A;  4KR5 A;  4PET A;  4EF2 A;  3G3G A;  4YKK A;  4G8M A;  3T96 B;  1KWH A;  4OXV A;  1I6A A;  2OBG A;  5FTH A;  4QFO A;  5I2K B;  3O6I A;  5FTI A;  3LSF B;  5F1Q A;  2Q2A A;  1A99 A;  1SVX B;  4QRZ A;  1MDP 1;  4DCX A;  1RKM A;  1H43 A;  4EQ7 A;  2YJP A;  4NMY A;  1XT8 A;  2ZMB A;  3G3H A;  5TP9 B;  4ELR A;  1SW1 A;  3RPW A;  4RNS A;  3T9U A;  3CFL A;  3DP8 A;  3RTW B;  1T0K A;  1IXG A;  3KEI A;  4LQ5 A;  3MP8 A;  5B7D A;  1QJM A;  3PPR A;  1LBC A;  3SEU A;  3DP4 A;  3S4U A;  1B58 A;  3O28 A;  1MXW A;  2ESN A;  3ZKL A;  3QIM A;  2RF1 A;  1XHY A;  3MP1 A;  1QUL A;  3EN3 A;  2GRV A;  5TPA A;  4GD5 A;  5B70 A;  3S9E A;  5K2X A;  2DVZ A;  4ELQ A;  5HPQ A;  3SER A;  3CFX A;  1M5B A;  3A3U A;  4MBP A;  3IOU A;  3B6T A;  5DVF A;  2AL5 A;  3OSR A;  1EZ9 A;  4OYV A;  1Y1M A;  1Y9U A;  3T9H B;  3OEL A;  3V89 B;  4YKI A;  3KGC A;  1LBB A;  1TXF A;  1XS5 A;  2VD2 A;  2THI A;  3ZSF A;  3K6X A;  1P99 A;  1QVS A;  2DS9 A;  3SDF A;  4ZE8 A;  2RIN A;  3RT8 A;  5FHN A;  3LSX A;  3CVG A;  1P1Q A;  2HFB A;  2F7C A;  3KBR A;  1AMF A;  1O64 A;  2V25 A;  3FJ7 A;  4M1V A;  1N7W A;  3TAJ A;  4KCC A;  4LA9 A;  1JET A;  3O2A A;  3MC2 A;  1FTM A;  4N13 A;  4ZEF A;  3AXF A;  2OJT A;  2Q2C A;  3VE1 B;  4P0I A;  2ZYN A;  1LAH E;  1PBP A;  1B32 A;  2I4B A;  1NNK A;  2QSX A;  3E9X A;  3U92 A;  1SYI A;  3O66 A;  3GBB A;  4OFO A;  1B0L A;  1DTG A;  4PP0 A;  3TQW A;  4P11 A;  1DTZ A;  1MH4 A;  3ODB A;  4TOZ A;  4F3G A;  3VDF A;  1MPB A;  4Q0C A;  4F1V A;  3ZKK A;  2CZL A;  2Z8F A;  1POT A;  4QSE A;  2XHD A;  1NH7 A;  1TFA A;  1S7Y A;  4ZDM A;  2F5X A;  2DYX A;  1N3X A;  3LBS A;  3GBA A;  2KLF A;  4F1U A;  3EF7 A;  2DSF A;  5H8F A;  3G3F A;  2XXY A;  2O6A A;  3UA8 A;  2H98 A;  4JSD A;  4H6D A;  4ONY A;  3K2D A;  4G8N A;  4DXC A;  2HZK A;  1EH3 A;  1I69 A;  3D4G A;  5IKB A;  3RNN A;  3FAT A;  3OO9 A;  4FEB A;  3SEW A;  4LUB A;  1OLC A;  4JXI A;  1MQI A;  3QUF A;  5HM4 B;  1GTK A;  4GWO A;  2I3V A;  4YMB A;  4PFY A;  3PUY E;  3H6U A;  3FXQ A;  5AA3 A;  2Q8J A;  3FIR A;  3S2V A;  5A5X B;  4NF4 B;  1SBP A;  2R9J A;  1XVX A;  4U4S A;  4C1U A;  4Z7E A;  3I3V A;  3DM0 A;  3IOR A;  2YLN A;  2M8C A;  4R6K A;  3R6U A;  4ZS9 A;  2O1M A;  2VP1 A;  3TTN A;  2VOZ A;  1HSL A;  1YCJ A;  4ZEB A;  2DQV A;  1EZP A;  4AB6 A;  3V5A A;  3T66 A;  3I5O A;  4R9F A;  3O29 A;  4C0R A;  3SEV A;  4RA1 A;  4XKQ A;  1IUD A;  1FQB A;  4GOT A;  3CG1 A;  4ELP A;  1GR2 A;  1B46 A;  1YAE A;  2D5W A;  3KSJ A;  2V3T A;  1D9V A;  5KCJ B;  3K02 A;  3TDJ A;  2OZZ A;  4F3B A;  4OZ9 A;  1O7T A;  3K0V A;  1MH3 A;  1MY3 A;  3TEP A;  1DOT A;  4O3C A;  5H8Q B;  3TTM A;  2REJ A;  1B40 A;  3MVW A;  5CMC A;  2OWT A;  3H03 A;  3TYH A;  4H65 A;  2G29 A;  1JW5 A;  5CM6 A;  2NUV A;  1PDA A;  3EHS A;  1RYO A;  2DWJ A;  3MPK A;  3OEN A;  1TWY A;  3QXM A;  1UTH A;  5H8N B;  1ZTY A;  1US4 A;  4TQU Q;  4KQP A;  3BFU A;  4IO2 A;  3CIJ A;  1PC3 A;  2FA7 A;  4NWC A;  1NNT A;  1MY1 A;  3FXR A;  1CE2 A;  2PBW A;  4F3P A;  4IO6 A;  2DE3 A;  3MVY A;  3IB2 A;  1Y1Z A;  2X7Q A;  1OVB A;  5CMK A;  1BLF A;  1SDX A;  4TLM B;  3TCF A;  4NF8 A;  2AIX A;  3E13 X;  4U1Z A;  5J1D A;  2ZNT A;  1FW0 A;  4OMB A;  1CB6 A;  3O97 A;  2VD3 A;  2XXW A;  3OMB A;  3F11 A;  1DSN A;  2DWA A;  4F2Q A;  4F2O A;  3MJN A;  2Y7K A;  5H8H B;  4GRK A;  3UGW A;  5I56 A;  3N26 A;  2R6G E;  4GL0 A;  4YAH X;  3G7W A;  1B51 A;  2HEU A;  1ZJL A;  4OES A;  2I58 A;  4Q8R A;  4BDL A;  3SEY A;  3OEM A;  4ISU A;  4XXU A;  1XOC A;  2F78 A;  1R9Q A;  5JEI A;  3N6T A;  1UIV A;  3Q28 A;  3FGS A;  2XX8 A;  1IXC A;  5I57 B;  5EHM A;  4R75 A;  3MQ9 A;  4R6H A;  5EYF A;  5FHM A;  4F3S A;  5ICT A;  4G68 B;  2H4I A;  4YIC A;  3MZB A;  4HCW A;  3S9N C;  3PD9 A;  2HZL A;  3VXC A;  2OCU A;  4H5G A;  3K4U A;  1H76 A;  3CG3 A;  4YZZ A;  1SW5 A;  4DZ1 A;  4OEU A;  4Z0I A;  4Q5T A;  4FAJ A;  2LAO A;  4G4P A;  3RLF E;  5BUU A;  3W9V A;  3UK4 A;  1IZ1 A;  1MY2 A;  4YB7 A;  3PMV A;  3H6T A;  5TP9 A;  4X1B A;  1D3K A;  2UVI A;  1IXH A;  3IAZ A;  2Y7I A;  3W9W A;  1Y3N A;  2QRY A;  1QW0 A;  3PPP A;  3Q27 A;  1Y3P A;  2Y7P A;  2ZXT A;  4GIZ A;  1WDN A;  1Y3Q A;  4DXU A;  4IO4 A;  4U23 A;  3THI A;  3VLU A;  4PE5 B;  1QKB A;  1ZMG A;  2ABH A;  2HAV A;  3FAS A;  3IL1 B;  1UTB A;  3K6U A;  4QSC A;  1NNF A;  5JTY B;  4ZEK A;  2O68 A;  2Z22 A;  5H8S A;  1H45 A;  2QMW A;  2V84 A;  1R6Z A;  4QSD A;  4H0W A;  3HO7 A;  1P1W A;  4YKJ A;  1A7L A;  1MQD A;  5AA1 A;  1UIU A;  4F19 A;  2DOJ A;  3PPO A;  5TU0 A;  2ONS A;  2P2A A;  4C1T A;  3JYR A;  3MZ1 A;  3K00 A;  3HHG A;  4FE8 A;  1QUJ A;  5L9M A;  2PX1 A;  2NVU B;  4RYA A;  1S9T A;  1S50 A;  2D21 A;  3L6G A;  4OTE A;  3E4R A;  4GFR A;  1MXY A;  3FJM A;  4OER A;  2ANJ A;  3CRB A;  2Z8D A;  4AQ4 A;  3EHT A;  4DE8 A;  2H5Y A;  2NXO A;  4NE4 A;  3C4M A;  3BBR A;  1B3G A;  2ZYM A;  2O69 A;  4FJP A;  3H3G A;  2H9B A;  4ECF A;  1ELJ A;  3KN8 A;  4XIG Q;  2P1S A;  4UA8 A;  3G3I A;  2F7A A;  2OLB A;  3QUJ A;  3FUZ A;  2O51 A;  1NH8 A;  1IIW A;  2F36 A;  2F34 A;  1JW1 A;  2XXT A;  3HPI A;  4DIG A;  3GLB A;  2XXH A;  2RC9 A;  4XTC Q;  1N3W A;  3VVD A;  2ZYO A;  4QFK A;  4EQB A;  2DXR A;  3T22 A;  3M3F A;  3G3J A;  3IOW A;  4FED A;  5CI5 A;  5TPA B;  3SEX A;  2DXY A;  1MXU A;  3ZS6 A;  5ITO A;  2QS1 A;  3OO8 A;  1AH5 A;  3MZ9 A;  1FTO A;  1N76 A;  2XXV A;  4NF6 B;  3T9X B;  1FQA A;  3FXU A;  4OEN A;  2A5S A;  4EF1 A;  1P1O A;  2QS4 A;  2VGQ A;  4ELO A;  3I6V A;  3K6W A;  1AL3 A;  3U94 A;  2FNC A;  1A8F A;  4I9D A;  1SQY A;  1JEV A;  1Y4T A;  1D9Y A;  1MQJ A;  4R72 A;  4DLD A;  1B4H A;  3S9M C;  1AOV A;  1IQ7 A;  5A5X A;  4EXK A;  3D4C A;  4OHN A;  1P1U A;  1US5 A;  4IY6 A;  1FCK A;  4YKP A;  3SES A;  5AA4 A;  3K1M A;  4JSO A;  3BFT A;  4KFQ A;  4R73 A;  3B6Q A;  4KYD A;  2QMX A;  3PGF A;  1B05 A;  2REG A;  3VXB A;  1LAX A;  3ILU B;  1WVJ A;  4XKP A;  4Q30 B;  4GLI A;  4JWO A;  3TFL A;  1B3E A;  4E0W A;  3KZG A;  3W15 C;  2DP8 A;  1LFG A;  4NTL A;  1B4Z A;  1NFT A;  5F7V A;  4QHQ A;  1N0T A;  5JK4 A;  3Q25 A;  1QKA A;  4RY1 A;  3H6W A;  3SET A;  1N04 A;  3U1O A;  4OFL A;  3O9P A;  3PMW A;  3KFM A;  4RJZ A;  3KJT A;  2YPN A;  3LSL A;  3IJO B;  4RXL A;  5H8Q A;  1RYX A;  2AYS A;  4OVJ A;  1B3L A;  1ZBM A;  3CFZ A;  1L5T A;  1MY4 A;  3SKP A;  5I2N B;  3BKI B;  4KYS A;  3N6U A;  4OQO A;  5L9S A;  1BTJ A;  1PB7 A;  5AA2 B;  3VLV A;  4IO5 A;  4EUO A;  1FQF A;  2ONR A;  2QJE A;  1DMB A;  2DWI A;  2XXR A;  4DXB A;  5I58 B;  4LAT A;  1MG1 A;  1PB9 A;  3VLW A;  1LFH A;  2OWS A;  1J1N A;  4FAT A;  2GHA A;  4LZ8 A;  4MH5 A;  2B3B A;  3KJ7 A;  2ZYK A;  3JV9 A;  1XVY A;  4GVO A;  4QFP A;  4KI0 E;  3TTR A;  3OO7 A;  4U1O A;  1JVX A;  2PT1 A;  4XKR A;  1NL5 A;  1LST A;  1M5F A;  1P1N A;  1URG A;  4UAC A;  1IXI A;  2AL4 A;  2GHB A;  1LB9 A;  3TEL A;  2X7P A;  3Q26 A;  3WAF A;  1LCF A;  1LB8 A;  1O63 A;  5KDT A;  4R9G A;  4BDM A;  4RPN A;  3R7X A;  4NWD A;  3USD A;  1OIB A;  2Z8E A;  4X1D A;  3P7I A;  1B7Z A;  2V3Q A;  2Z23 A;  3C32 A;  3B7D A;  3KOS A;  5IAI A;  4LZ7 A;  2I6E A;  3C36 A;  3LSW A;  5I57 A;  3R26 A;  4K3F A;  4I62 A;  3EPE A;  4O3B A;  1I6Q A;  1Z7N E;  1OLA A;  2UVG A;  1B2H A;  5I59 B;  4YB6 A;  4G68 A;  4IGR A;  2I3W A;  4QF9 A;  2Y7W A;  2HAU A;  4NF5 B;  4U22 A;  3C33 A;  4JBZ A;  1GVC A;  2A5T A;  1B3F A;  2UXA A;  1ZKB A;  3C34 A;  4ZZE A;  1N84 A;  3PUV E;  1ANF A;  5DEX A;  1NNP A;  1UTH B;  3KN7 A;  2H99 A;  1URS A;  4RK9 A;  1VR5 A;  2DE2 A;  1EU8 A;  1WOD A;  1HSE A;  4OFJ A;  4N6P A; 
#chains in the Genus database with same CATH topology
 1NUZ A;  1BKA A;  2D3I A;  4DI4 B;  2O1L A;  1OQG A;  2ONK E;  3RUM A;  1FQC A;  3TTL A;  4PDH A;  4RPO A;  5I2K A;  3FD3 A;  1URD A;  1KA1 A;  3IB0 A;  2I49 A;  1H44 A;  4ZEI A;  3PD8 A;  2RCB A;  1SI0 A;  2HHM A;  1LLS A;  4NGU A;  5EHS A;  3MBP A;  4NF8 B;  2F6P A;  2G93 A;  4PF8 A;  4HTG A;  2ALU A;  3QYT A;  4WKM A;  2XD3 A;  3RN8 A;  1DCU A;  2B3F A;  3ONM A;  2ZZX A;  1MQH A;  3N94 A;  3V83 A;  1MXZ A;  3RGY A;  2HQ0 A;  3MP6 A;  4MAG A;  2B65 A;  1VFE A;  4MNC A;  3QAX A;  5JTY A;  4O3A A;  3LR1 A;  2QVR A;  5I56 B;  4DDD A;  1B9J A;  4KYE A;  2RKM A;  4E0X A;  1FTJ A;  4IO7 A;  4R2F A;  3FVN A;  4NED A;  1N7X A;  1JQF A;  3C31 A;  5DYH A;  1D9Q A;  1SYH A;  4RK2 A;  1ZU0 A;  5ISU A;  1A55 A;  2H25 A;  3DLN A;  1M5C A;  3H6V A;  4HXV A;  2UVH A;  5A5L A;  4IB2 A;  1A54 A;  4FOR A;  1FTL A;  1PBQ A;  3OSQ A;  4ZE9 A;  5ITP A;  4THI A;  4JVC A;  2I4C A;  3PMX A;  4N81 A;  4BDR A;  1Y4C A;  1B7U A;  1POY 1;  2P0S A;  3KC0 A;  3HN0 A;  2RC7 A;  3A3C A;  4I1D A;  1VSO A;  2ZNS A;  5CMB A;  3EQ1 A;  1MXX A;  4GWS A;  3FVK A;  3JZJ A;  4MJO A;  3VFJ A;  2UYE A;  4OA4 A;  1TT1 A;  1ZIU A;  3M3L A;  4EDP A;  2PT2 A;  3FVG A;  1MPD A;  2V4C A;  1MPC A;  3GZG A;  1B5J A;  4GBV A;  4L17 A;  4PTK A;  1XC1 A;  4GWX A;  3GXA A;  2F8D A;  5K2Y A;  1FBD A;  2B4L A;  4R2B A;  3FV2 A;  3MPL A;  3RQT A;  1MRP A;  2DE4 A;  2CZK A;  3DEL B;  3H06 B;  4FEC A;  4DI3 D;  4LVQ A;  1UTB B;  1I6B A;  2O7U A;  4H5F A;  2X26 A;  4F31 B;  2GFE A;  3HST A;  4GWY A;  2R8T A;  1YPN A;  3V8X B;  4X9T A;  1FTK A;  4NF6 A;  1NUW A;  4R74 A;  4QFL A;  3PPN A;  3IJX B;  2F3B A;  3IOT A;  1Y20 A;  1NKX A;  4I8C A;  2O7I A;  2Q74 A;  4F29 A;  2WKY A;  2QL3 A;  1H3D A;  3U93 A;  4JWX A;  1Q1K A;  4MIJ A;  3RT6 B;  1SD3 A;  2V93 A;  1FBC A;  4MFI A;  3LUY A;  2RC8 A;  2F35 A;  3TZA A;  2Q88 A;  4YMA A;  4EQ9 A;  5DVJ A;  4P3L A;  1QUK A;  3RPL A;  3K6V A;  1FQE A;  3K1P A;  1JW4 A;  4N4U A;  1YTV A;  1LGB C;  4H8J A;  5AE4 A;  4BLA A;  5I84 A;  1OQH A;  3RYD A;  1FPF A;  1Q35 A;  1ZLQ A;  2L5V A;  2PMS A;  5EQ8 A;  4ZEC A;  3B6W A;  4IGT A;  2NOO A;  2XX7 A;  1MM7 A;  3U8Q A;  3TKD A;  4DCY A;  4OWD A;  3TPA A;  3E3K A;  3UP9 A;  3T9V A;  1JVY A;  2UVJ A;  4XKN A;  4BDO A;  2IEE A;  1BK4 A;  1SW2 A;  2HXW A;  4X48 A;  1F9B A;  3L6H A;  4X8R A;  4LP2 B;  4KPT A;  4BDQ A;  1B3H A;  3K1N A;  4PC9 A;  4NN3 A;  4MX6 A;  1FRP A;  3OXN A;  3EHU A;  4H45 A;  5HBC A;  1MS7 A;  3MAM A;  4R6Y A;  1AIV A;  3PV0 E;  4NF4 A;  5FHO A;  1M5E A;  3H4Z A;  4P9K A;  3TUS A;  4PQJ A;  3IOV A;  3IK6 B;  3RY3 A;  2I48 A;  1SW4 A;  3OO6 A;  2O84 X;  3UIF A;  4JVD A;  5L8D A;  1GV8 A;  4ZED A;  4G77 A;  3OD7 A;  4EXL A;  3S9L C;  1HSJ A;  1EZO A;  4HS7 A;  4MMP A;  3LC8 A;  3IR1 A;  1FPG A;  2OK2 A;  5I2N A;  2GH9 A;  1Z7M E;  4POW A;  1DPP A;  1FPL A;  1PEB A;  4ESW A;  2E1S A;  4F18 A;  1B7H A;  5IM2 A;  3FBP A;  3KN3 A;  1EYJ A;  3OEK A;  3QSL A;  1MDQ A;  3CSG A;  5AA2 A;  3IB1 A;  3TCG A;  1JEU A;  3CSB A;  2WBB A;  5ELV A;  2IA4 A;  5KCJ A;  3FVO A;  4P0G A;  1B52 A;  3IX1 A;  3CI8 A;  5I58 A;  2XD2 A;  4GF8 A;  3UOR A;  1R1N A;  2HCA A;  1BP5 A;  5EQ9 A;  3WAE A;  3ISP A;  1LBW A;  4U21 A;  4H8I A;  1LBX A;  3MUQ A;  4IR8 A;  1IMD A;  4YB5 A;  5H8F B;  4OVP A;  4TLL B;  1M5D A;  5KZT A;  3KSX A;  2CMO A;  5DTB A;  4KD5 A;  3TTK A;  2XXI A;  1LEV A;  5AA4 B;  1MQG A;  4IY5 A;  1LAF E;  1II5 A;  3HV1 A;  5DT6 A;  5DVI A;  2NWJ A;  5CC2 A;  3T93 B;  4G2Z A;  4H1X A;  2QVU A;  1SPI A;  4I3E A;  4F22 A;  3PPQ A;  5H8N A;  1RDX A;  4PFB A;  4HE2 A;  4HW8 A;  3M3K A;  3PU5 A;  2Y7R A;  4PFI A;  3CR9 A;  4P56 A;  2PYY A;  1LCT A;  4PFU A;  4MLQ A;  1D4N A;  2V3U A;  5CMM A;  4F39 A;  3G3K A;  5CBS A;  1MY0 A;  2QFL A;  5AA2 D;  4ESX A;  2PFZ A;  5LOM A;  3N5L A;  3K01 A;  1IIT A;  4GXA A;  1BIY A;  1TFD A;  3PUX E;  4WXJ A;  1UQW A;  1VE4 A;  4NF0 A;  2QS2 A;  4LZ5 A;  2R71 A;  3Q29 A;  5EYH A;  2ZNU A;  3PUZ E;  3MWB A;  4FIM A;  1B5I A;  3O6G A;  4POX A;  1B1H A;  5BWJ A;  5I59 A;  2Y84 A;  3TQL A;  5EQ7 A;  4YU0 A;  4NF5 A;  1OMP A;  3RTF B;  1NUY A;  3IO4 A;  5IZ3 B;  4GQO A;  5EYG A;  5H8H A;  1USY E;  3OOA A;  4AB5 A;  4ZZA A;  4X04 A;  1QUI A;  3FJG A;  3M8U A;  1B0H A;  3TMG A;  2F97 A;  2B4M A;  4N07 A;  4U4X A;  1IME A;  2DWH A;  4PGP A;  2FHY A;  4OVR A;  3C35 A;  5ICQ A;  4GWZ A;  5I3S A;  4H67 A;  3IFC A;  2FYI A;  4JWY A;  4KHZ E;  2E0S A;  4M4G A;  1B5H A;  2DVC A;  2Q89 A;  3KOT A;  2XXP A;  4I3Y A;  1OVT A;  1SI1 A;  3O6H A;  4HE1 A;  4WED A;  4MNI A;  3VV5 A;  3FZV A;  2XXU A;  3ECR A;  2XWI A;  5ET6 A;  4JB7 A;  2BJJ X;  2QS3 A;  4PFT A;  2QPQ A;  2W7Y A;  4QFN A;  2RCA A;  5EQA A;  4WEP A;  3ILT B;  2I0C A;  3VVE A;  4U2R A;  1NV1 A;  2UYF A;  4OET A;  1JNF A;  1A40 A;  4MLV A;  1NMU A;  4O8M A;  1QGX A;  2PVU A;  3FV1 A;  5KDT B;  1ATG A;  3C9H A;  3HHF A;  3IO6 A;  3PUW E;  4G8H A;  3TCH A;  2CEX A;  4G68 C;  4BDN A;  3KG2 A;  1A8E A;  3HCQ A;  5M2V A;  1LBY A;  3MW0 A;  4F1Y A;  5CBR A;  4NG7 A;  3H7M A;  2Q9T A;  4OEV A;  1IEJ A;  2XX9 A;  3DP6 A;  4PFW A;  2F7B A;  1R9L A;  3FXB A;  4HCY A;  1B1X A;  2XXX A;  2I0B A;  1LFI A;  1MM6 A;  2FVZ A;  2XXQ A;  4LON B;  3QK6 A;  3U72 A;  1G0H A;  3MVZ A;  4JDF A;  3A09 A;  1DPE A;  1B6H A;  5L9O A;  4NQ8 A;  4LQ2 A;  1IMC A;  2A5T B;  4GXS B;  1LAG E;  1PB8 A;  3VVF A;  2F6G A;  4NHB A;  3UN6 A;  5DEX B;  1GGG A;  4KCD A;  1VFD A;  1MXV A;  4ND9 A;  1NI9 A;  4IO3 A;  2VHA A;  5CRY A;  3TOD A;  1USY H;  4MF3 A;  4P47 A;  1FTA A;  3MVX A;  4GL8 A;  2FIX A;  1FQD A;  4KR5 A;  4PET A;  3EKI A;  4EF2 A;  3G3G A;  4YKK A;  3KC1 A;  4G8M A;  2XWK A;  3T96 B;  1KWH A;  4OXV A;  1I6A A;  2OBG A;  5FTH A;  4QFO A;  1JP4 A;  5I2K B;  3O6I A;  1NUX A;  5FTI A;  3LSF B;  5F1Q A;  4QBA A;  2Q2A A;  1A99 A;  1SVX B;  4QRZ A;  4HE0 A;  1MDP 1;  4DCX A;  5I5P A;  1RKM A;  1H43 A;  4GBW A;  1DK4 A;  4PBQ A;  2GQ1 A;  4EQ7 A;  2YJP A;  4NMY A;  1XT8 A;  2P3N A;  2ZMB A;  3G3H A;  5TP9 B;  4ELR A;  1K9Z A;  1SW1 A;  3RPW A;  4RNS A;  3T9U A;  3CFL A;  3DP8 A;  3RTW B;  1T0K A;  1IXG A;  3KEI A;  4LQ5 A;  3MP8 A;  5B7D A;  1QJM A;  3PPR A;  2OWZ A;  1LBC A;  3SEU A;  3DP4 A;  4N8G A;  3S4U A;  1B58 A;  3O28 A;  1MXW A;  2ESN A;  3ZKL A;  3QIM A;  2RF1 A;  1XHY A;  3MP1 A;  1QUL A;  4PBH A;  3EN3 A;  2GRV A;  1FPE A;  5TPA A;  4GD5 A;  1CNQ A;  5B70 A;  3S9E A;  5K2X A;  2DVZ A;  4ELQ A;  5HPQ A;  3SER A;  3CFX A;  1M5B A;  3A3U A;  4MBP A;  3IOU A;  3B6T A;  1KA0 A;  5DVF A;  2AL5 A;  3OSR A;  1EZ9 A;  4OYV A;  4OVS A;  3U65 A;  1Y1M A;  5DW8 A;  1Y9U A;  1NV5 A;  3T9H B;  3OEL A;  1INP A;  3V89 B;  4YKI A;  3KGC A;  1YZ0 A;  1LBB A;  1TXF A;  1XS5 A;  4N91 A;  2VD2 A;  2WEF A;  2THI A;  3ZSF A;  3K6X A;  1P99 A;  1QVS A;  4MNP A;  2DS9 A;  3SDF A;  4ZE8 A;  2RIN A;  3RT8 A;  4NX1 A;  5FHN A;  3LSX A;  4N6K A;  3CVG A;  1P1Q A;  1FPD A;  2HFB A;  3KBR A;  2F7C A;  1AMF A;  1O64 A;  2V25 A;  3FJ7 A;  4M1V A;  1KZ8 A;  1N7W A;  3TAJ A;  4KCC A;  4LA9 A;  1JET A;  2VPN A;  3O2A A;  3MC2 A;  1FTM A;  4N13 A;  4ZEF A;  3AXF A;  2OJT A;  2Q2C A;  3VE1 B;  1FBG A;  4P0I A;  1FJ6 A;  2ZYN A;  1LAH E;  1PBP A;  1B32 A;  2QVV A;  2I4B A;  1NNK A;  2QSX A;  3E9X A;  3O66 A;  1SYI A;  3U92 A;  3GBB A;  4OFO A;  1B0L A;  1DTG A;  4PP0 A;  3TQW A;  1IMF A;  4P11 A;  1DTZ A;  1MH4 A;  3ODB A;  4TOZ A;  4F3G A;  3VDF A;  1MPB A;  4Q0C A;  2DDK A;  4F1V A;  3ZKK A;  1FPI A;  2CZL A;  2Z8F A;  1POT A;  4QSE A;  2XHD A;  1NH7 A;  1TFA A;  1S7Y A;  4ZDM A;  3PTY A;  2F5X A;  1FBF A;  2DYX A;  1N3X A;  3LBS A;  3GBA A;  2KLF A;  4F1U A;  2FBP A;  3EF7 A;  2DSF A;  5H8F A;  3G3F A;  1NV3 A;  2XXY A;  2O6A A;  3UA8 A;  2H98 A;  3IFA A;  4JSD A;  4H6D A;  4ONY A;  3K2D A;  4G8N A;  4DXC A;  4GWU A;  2HZK A;  1EH3 A;  1I69 A;  3D4G A;  5IKB A;  4N6D A;  3RNN A;  3FAT A;  1FSA A;  3OO9 A;  5ESY A;  4FEB A;  3SEW A;  4LUB A;  4XEQ A;  1OLC A;  4JXI A;  1MQI A;  3A29 A;  3QUF A;  3NOH A;  5HM4 B;  3BIG A;  1GTK A;  4GWO A;  2I3V A;  4YMB A;  4PFY A;  3PUY E;  3H6U A;  3FXQ A;  4N17 A;  5AA3 A;  1NV2 A;  3KBZ A;  2Q8J A;  1NV4 A;  3FIR A;  4GX4 A;  3S2V A;  5A5X B;  4NF4 B;  1SBP A;  2R9J A;  1XVX A;  4U4S A;  4C1U A;  4Z7E A;  3I3V A;  3DM0 A;  3IOR A;  2YLN A;  2M8C A;  4R6K A;  3R6U A;  4ZS9 A;  2O1M A;  2VP1 A;  3TTN A;  2VOZ A;  1LBV A;  2WYP A;  1HSL A;  1YCJ A;  5F24 A;  2DQV A;  4ZEB A;  1EZP A;  4AB6 A;  3V5A A;  1NV0 A;  3T66 A;  5IZ3 A;  3I5O A;  4R9F A;  3O29 A;  2CZI A;  4C0R A;  3SEV A;  2Y5K A;  4RA1 A;  4XKQ A;  1IUD A;  3E79 A;  4I40 A;  1FQB A;  2PFY A;  4GOT A;  3CG1 A;  4ELP A;  1GR2 A;  1B46 A;  1YAE A;  2D5W A;  1XI6 A;  3KSJ A;  2V3T A;  1D9V A;  5KCJ B;  3K02 A;  3TDJ A;  2OZZ A;  4F3B A;  4OZ9 A;  1O7T A;  3K0V A;  1MH3 A;  1MY3 A;  3MYU A;  3TEP A;  1DOT A;  2Q8M A;  4O3C A;  1LBZ A;  5H8Q B;  3TTM A;  2REJ A;  1B40 A;  3MVW A;  5CMC A;  2OWT A;  3H03 A;  3TYH A;  4H65 A;  2G29 A;  4KXP A;  3T0J A;  1JW5 A;  5CM6 A;  2NUV A;  1PDA A;  3HFU A;  3EHS A;  1RYO A;  2DWJ A;  3MPK A;  3OEN A;  1TWY A;  3QXM A;  5IGA A;  2JJK A;  2KQZ A;  1UTH A;  5H8N B;  1FPJ A;  1ZTY A;  1US4 A;  4TQU Q;  4KQP A;  4AS5 A;  4O7M A;  3BFU A;  4IO2 A;  3CIJ A;  1PC3 A;  2FA7 A;  4NWC A;  3CHG A;  1NNT A;  5I7I A;  1MY1 A;  3FXR A;  1CE2 A;  2PBW A;  4OVQ A;  4F3P A;  4IO6 A;  2DE3 A;  3MVY A;  3IB2 A;  1Y1Z A;  2X7Q A;  1OVB A;  5CMK A;  1BLF A;  2MKZ A;  1SDX A;  4TLM B;  3TCF A;  4MEV A;  1DBZ A;  4NF8 A;  2AIX A;  3E13 X;  4U1Z A;  5J1D A;  2ZNT A;  1FW0 A;  4OMB A;  1CB6 A;  3O97 A;  2VD3 A;  2XXW A;  3OMB A;  3F11 A;  1IMB A;  1DSN A;  2DWA A;  4F2Q A;  4F2O A;  3MJN A;  2Y7K A;  5H8H B;  5ET7 A;  4GRK A;  3UGW A;  5I56 A;  3N26 A;  2R6G E;  4GL0 A;  4YAH X;  3G7W A;  1B51 A;  2HEU A;  1ZJL A;  4OES A;  2I58 A;  1RDY A;  4Q8R A;  4BDL A;  3SEY A;  3OEM A;  4ISU A;  4O94 A;  4XXU A;  1XOC A;  2F78 A;  1R9Q A;  5JEI A;  3N6T A;  1UIV A;  3Q28 A;  3FGS A;  2XX8 A;  1IXC A;  3D1R A;  5I57 B;  5EHM A;  4PCD A;  3MQ9 A;  4R75 A;  4R6H A;  5EYF A;  5FHM A;  4F3S A;  5ICT A;  2PCR A;  2VT5 A;  4G68 B;  2H4I A;  4YIC A;  3MZB A;  4HCW A;  1YYZ A;  3S9N C;  3PD9 A;  2HZL A;  3VXC A;  2OCU A;  2XA5 A;  4GX6 A;  3K4U A;  4H5G A;  1H76 A;  3CG3 A;  4YZZ A;  1SW5 A;  4DZ1 A;  4OEU A;  1K9Y A;  4Z0I A;  4Q5T A;  1NV7 A;  4FAJ A;  2LAO A;  4G4P A;  4OVT A;  3RLF E;  2P3V A;  5BUU A;  3W9V A;  3UK4 A;  1IZ1 A;  1MY2 A;  4YB7 A;  3PMV A;  1EYK A;  3H6T A;  4QXD A;  4X1B A;  5TP9 A;  1D3K A;  1FPB A;  2UVI A;  1IXH A;  3IAZ A;  2Y7I A;  1AWB A;  3W9W A;  1Y3N A;  2QRY A;  1QW0 A;  3PPP A;  3Q27 A;  1Y3P A;  4UAB A;  4PE3 A;  4PAK A;  2Y7P A;  2ZXT A;  4GIZ A;  1WDN A;  1Y3Q A;  4DXU A;  2ZZW A;  4IO4 A;  4U23 A;  3THI A;  3VLU A;  4PE5 B;  1QKB A;  1ZMG A;  2ABH A;  2HAV A;  5ET5 A;  3B50 A;  3FAS A;  3IL1 B;  1UTB A;  3K6U A;  4QSC A;  1NNF A;  5JTY B;  4ZEK A;  2O68 A;  1FBP A;  2Z22 A;  5H8S A;  1YXI A;  1H45 A;  2QMW A;  2V84 A;  1R6Z A;  4P8B A;  4QSD A;  4H0W A;  3HO7 A;  1P1W A;  4YKJ A;  1A7L A;  1MQD A;  5AA1 A;  1UIU A;  4F19 A;  2DOJ A;  3PPO A;  5TU0 A;  2ONS A;  2P2A A;  2VPO A;  4C1T A;  4NAP A;  3JYR A;  3MZ1 A;  3K00 A;  3HHG A;  1VDW A;  4FE8 A;  2WBD A;  5T3J A;  1QUJ A;  4PFR A;  5L9M A;  2PX1 A;  1FPK A;  2NVU B;  4RYA A;  1S9T A;  2WYK A;  4P1E A;  1S50 A;  2BJI A;  2F3D A;  4PGN A;  2D21 A;  3L6G A;  4OTE A;  3E4R A;  4GFR A;  1MXY A;  3FJM A;  4OER A;  2ANJ A;  4AS4 A;  3CRB A;  2Z8D A;  4AQ4 A;  3EHT A;  4LN5 A;  4DE8 A;  2H5Y A;  2NXO A;  4XFE A;  4NE4 A;  3C4M A;  3BBR A;  1B3G A;  2ZYM A;  2O69 A;  4FJP A;  3H3G A;  2H9B A;  4ECF A;  4MHF A;  1ELJ A;  3KN8 A;  4XIG Q;  2P1S A;  4UA8 A;  3G3I A;  2F7A A;  2OLB A;  3QUJ A;  3FUZ A;  2O51 A;  1NH8 A;  3T1B A;  1IIW A;  2F36 A;  2F34 A;  1JW1 A;  2ZZV A;  2XXT A;  1FJ9 A;  1IMA A;  3HPI A;  4DIG A;  3GLB A;  2XXH A;  2RC9 A;  4XTC Q;  1N3W A;  3VVD A;  2ZYO A;  4QFK A;  4EQB A;  2DXR A;  2KR0 A;  3T22 A;  3M3F A;  3G3J A;  3IOW A;  4FED A;  5CI5 A;  5TPA B;  3SEX A;  2DXY A;  4PDD A;  1MXU A;  3ZS6 A;  5ITO A;  2FIE A;  2QS1 A;  3OO8 A;  1FBH A;  1AH5 A;  3MZ9 A;  3ROJ A;  1FTO A;  1N76 A;  2XXV A;  4NF6 B;  3T9X B;  1FQA A;  3FXU A;  4O7I A;  4OEN A;  2A5S A;  4EF1 A;  1P1O A;  2QS4 A;  2VGQ A;  4ELO A;  3I6V A;  3K6W A;  4PAF A;  1AL3 A;  3U94 A;  2FNC A;  1A8F A;  4I9D A;  1SQY A;  1JEV A;  1Y4T A;  1D9Y A;  3RPL B;  1MQJ A;  4R72 A;  4DLD A;  1B4H A;  3S9M C;  1AOV A;  3SZP A;  1IQ7 A;  5A5X A;  3GYY A;  4EXK A;  2CEY A;  3D4C A;  4OHN A;  1P1U A;  1US5 A;  4IY6 A;  1FCK A;  4YKP A;  3SES A;  5AA4 A;  3K1M A;  4JSO A;  2XXK A;  3BFT A;  3B8B A;  4KFQ A;  4R73 A;  3B6Q A;  4KYD A;  2QMX A;  2OX3 A;  3PGF A;  1B05 A;  2REG A;  3VXB A;  1LAX A;  3ILU B;  1WVJ A;  2HXR A;  4XKP A;  4Q30 B;  4GLI A;  4JWO A;  3LV0 A;  3TFL A;  1B3E A;  5ET8 A;  3MST A;  1Q9D A;  4E0W A;  3KZG A;  3W15 C;  2DP8 A;  1LFG A;  4NTL A;  1B4Z A;  2Y5L A;  1NFT A;  5F7V A;  4QHQ A;  4GWW A;  1N0T A;  5JK4 A;  3Q25 A;  1QKA A;  4RY1 A;  3H6W A;  3SET A;  1N04 A;  3U1O A;  4OFL A;  3O9P A;  3PMW A;  3KFM A;  4RJZ A;  3KJT A;  2YPN A;  3LSL A;  3IJO B;  1RDZ A;  4RXL A;  5H8Q A;  1RYX A;  2AYS A;  5LTC A;  4OVJ A;  1B3L A;  1ZBM A;  4OAN A;  3CFZ A;  1L5T A;  5IZZ A;  1MY4 A;  3SKP A;  5I2N B;  2HPG A;  1EYI A;  3BKI B;  4KYS A;  3N6U A;  4OQO A;  3E78 A;  4PF6 A;  5L9S A;  1BTJ A;  1PB7 A;  4JVI A;  5AA2 B;  3VLV A;  4GX3 A;  4IO5 A;  2XWO A;  4EUO A;  1FQF A;  2ONR A;  4G61 A;  2QJE A;  1DMB A;  2DWI A;  2XXR A;  4DXB A;  5I58 B;  4LAT A;  1MG1 A;  1PB9 A;  4H46 A;  5LDZ A;  3VLW A;  1LFH A;  2OWS A;  1J1N A;  4FAT A;  2GHA A;  5FBP A;  4LZ8 A;  4MH5 A;  2B3B A;  4XF5 A;  3KJ7 A;  2ZYK A;  3JV9 A;  1XVY A;  4GVO A;  4QFP A;  4KI0 E;  3TTR A;  3OO7 A;  4U1O A;  1JVX A;  2PT1 A;  4XKR A;  1NL5 A;  1LST A;  5J16 A;  2WX9 A;  1M5F A;  3LUZ A;  3BIH A;  1P1N A;  1URG A;  4UAC A;  1IXI A;  2AL4 A;  2GHB A;  1LB9 A;  4PAI A;  3TEL A;  2X7P A;  3Q26 A;  3WAF A;  1LCF A;  1LB8 A;  1O63 A;  5KDT A;  4N8Y A;  4R9G A;  1FBE A;  4BDM A;  4RPN A;  3R7X A;  4P1L A;  1NV6 A;  4NWD A;  3USD A;  1OIB A;  2Z8E A;  4X1D A;  3P7I A;  1B7Z A;  3QMF A;  2V3Q A;  2Z23 A;  3C32 A;  3B7D A;  3KOS A;  5IAI A;  4LZ7 A;  2I6E A;  3C36 A;  3LSW A;  5I57 A;  3R26 A;  4K3F A;  4I62 A;  3EPE A;  4O3B A;  1I6Q A;  1Z7N E;  5IZ1 A;  1OLA A;  2UVG A;  1B2H A;  5I59 B;  4YB6 A;  4G68 A;  4IGR A;  2I3W A;  4QF9 A;  2Y7W A;  2HAU A;  4NF5 B;  4U22 A;  3C33 A;  1G0I A;  4FBP A;  4JBZ A;  1GVC A;  2A5T A;  1B3F A;  2UXA A;  1ZKB A;  4MCO A;  3C34 A;  3PUV E;  4N15 A;  1N84 A;  1ANF A;  4ZZE A;  5DEX A;  1NNP A;  2CZH A;  1UTH B;  3KN7 A;  2H99 A;  1URS A;  4RK9 A;  1VR5 A;  2DE2 A;  1EU8 A;  1WOD A;  1HSE A;  4OFJ A;  2XWV A;  4N6P A; 
#chains in the Genus database with same CATH homology
 1BKA A;  2D3I A;  2O1L A;  1OQG A;  2ONK E;  3RUM A;  1FQC A;  3TTL A;  4RPO A;  5I2K A;  3FD3 A;  1URD A;  3IB0 A;  2I49 A;  1H44 A;  4ZEI A;  3PD8 A;  2RCB A;  1SI0 A;  1LLS A;  5EHS A;  3MBP A;  4NF8 B;  2F6P A;  2G93 A;  4HTG A;  2ALU A;  3QYT A;  4WKM A;  2XD3 A;  3RN8 A;  2B3F A;  3ONM A;  3N94 A;  1MQH A;  3V83 A;  1MXZ A;  3RGY A;  2HQ0 A;  3MP6 A;  2B65 A;  1VFE A;  5JTY A;  3QAX A;  4O3A A;  3LR1 A;  5I56 B;  4DDD A;  1B9J A;  4KYE A;  2RKM A;  4E0X A;  1FTJ A;  4IO7 A;  4R2F A;  3FVN A;  4NED A;  1N7X A;  1JQF A;  3C31 A;  5DYH A;  1SYH A;  4RK2 A;  1ZU0 A;  5ISU A;  1A55 A;  2H25 A;  3DLN A;  1M5C A;  3H6V A;  2UVH A;  4IB2 A;  1A54 A;  4FOR A;  1FTL A;  1PBQ A;  3OSQ A;  4ZE9 A;  5ITP A;  4THI A;  2I4C A;  3PMX A;  4BDR A;  1Y4C A;  1B7U A;  1POY 1;  2P0S A;  3HN0 A;  2RC7 A;  3A3C A;  4I1D A;  1VSO A;  2ZNS A;  5CMB A;  3EQ1 A;  1MXX A;  3FVK A;  3JZJ A;  3VFJ A;  2UYE A;  1TT1 A;  1ZIU A;  3M3L A;  4EDP A;  2PT2 A;  3FVG A;  1MPD A;  1MPC A;  3GZG A;  1B5J A;  4L17 A;  1XC1 A;  3GXA A;  2F8D A;  5K2Y A;  4R2B A;  3FV2 A;  3MPL A;  3RQT A;  1MRP A;  2DE4 A;  3DEL B;  3H06 B;  4FEC A;  4LVQ A;  1UTB B;  1I6B A;  2O7U A;  4H5F A;  2X26 A;  4F31 B;  2GFE A;  3HST A;  1YPN A;  3V8X B;  4X9T A;  1FTK A;  4NF6 A;  4R74 A;  4QFL A;  3PPN A;  3IJX B;  3IOT A;  1Y20 A;  1NKX A;  4I8C A;  2O7I A;  4F29 A;  2WKY A;  2QL3 A;  1H3D A;  3U93 A;  4JWX A;  1Q1K A;  3RT6 B;  1SD3 A;  2V93 A;  4MFI A;  3LUY A;  2RC8 A;  2F35 A;  3TZA A;  2Q88 A;  4YMA A;  4EQ9 A;  5DVJ A;  1QUK A;  3K6V A;  1FQE A;  3K1P A;  1JW4 A;  1YTV A;  1LGB C;  4H8J A;  5AE4 A;  4BLA A;  5I84 A;  1OQH A;  1Q35 A;  1ZLQ A;  2PMS A;  4ZEC A;  3B6W A;  4IGT A;  2NOO A;  2XX7 A;  1MM7 A;  3U8Q A;  3TKD A;  4DCY A;  4OWD A;  3TPA A;  3E3K A;  3UP9 A;  3T9V A;  1JVY A;  2UVJ A;  4XKN A;  4BDO A;  2IEE A;  1SW2 A;  2HXW A;  4X48 A;  1F9B A;  3L6H A;  4LP2 B;  4KPT A;  4BDQ A;  1B3H A;  3K1N A;  3OXN A;  3EHU A;  5HBC A;  1MS7 A;  3MAM A;  4R6Y A;  1AIV A;  3PV0 E;  4NF4 A;  5FHO A;  1M5E A;  3H4Z A;  3TUS A;  4PQJ A;  3IOV A;  3IK6 B;  3RY3 A;  2I48 A;  1SW4 A;  3OO6 A;  2O84 X;  3UIF A;  1GV8 A;  5L8D A;  4ZED A;  4G77 A;  3OD7 A;  4EXL A;  3S9L C;  1HSJ A;  1EZO A;  4HS7 A;  3LC8 A;  3IR1 A;  2OK2 A;  5I2N A;  2GH9 A;  1Z7M E;  4POW A;  1DPP A;  1PEB A;  4ESW A;  2E1S A;  4F18 A;  1B7H A;  3KN3 A;  3OEK A;  3QSL A;  1MDQ A;  3CSG A;  5AA2 A;  3IB1 A;  3TCG A;  1JEU A;  3CSB A;  5ELV A;  2IA4 A;  5KCJ A;  3FVO A;  4P0G A;  1B52 A;  3IX1 A;  3CI8 A;  5I58 A;  2XD2 A;  4GF8 A;  3UOR A;  1R1N A;  2HCA A;  1BP5 A;  3WAE A;  4U21 A;  4H8I A;  3MUQ A;  4YB5 A;  5H8F B;  4TLL B;  1M5D A;  5KZT A;  3KSX A;  2CMO A;  5DTB A;  4KD5 A;  3TTK A;  2XXI A;  5AA4 B;  1MQG A;  4IY5 A;  1LAF E;  1II5 A;  3HV1 A;  5DT6 A;  5DVI A;  2NWJ A;  5CC2 A;  3T93 B;  4G2Z A;  4H1X A;  4F22 A;  3PPQ A;  5H8N A;  4HW8 A;  3M3K A;  3PU5 A;  2Y7R A;  3CR9 A;  2PYY A;  1LCT A;  4PFU A;  4MLQ A;  1D4N A;  2V3U A;  5CMM A;  4F39 A;  3G3K A;  5CBS A;  1MY0 A;  5AA2 D;  4ESX A;  5LOM A;  3N5L A;  3K01 A;  1IIT A;  4GXA A;  1BIY A;  1TFD A;  3PUX E;  4WXJ A;  1UQW A;  1VE4 A;  2QS2 A;  4LZ5 A;  2R71 A;  3Q29 A;  2ZNU A;  3PUZ E;  3MWB A;  4FIM A;  1B5I A;  3O6G A;  4POX A;  1B1H A;  5BWJ A;  5I59 A;  2Y84 A;  3TQL A;  4YU0 A;  4NF5 A;  1OMP A;  3RTF B;  3IO4 A;  4GQO A;  5H8H A;  1USY E;  3OOA A;  4AB5 A;  4ZZA A;  1QUI A;  3FJG A;  3M8U A;  1B0H A;  3TMG A;  2F97 A;  4N07 A;  4U4X A;  2DWH A;  3C35 A;  5ICQ A;  4H67 A;  2FYI A;  4JWY A;  4KHZ E;  2E0S A;  4M4G A;  1B5H A;  2DVC A;  2Q89 A;  3KOT A;  2XXP A;  1OVT A;  1SI1 A;  3O6H A;  4WED A;  3VV5 A;  3FZV A;  2XXU A;  3ECR A;  4JB7 A;  2BJJ X;  2QS3 A;  4PFT A;  2QPQ A;  2W7Y A;  4QFN A;  2RCA A;  4WEP A;  3ILT B;  2I0C A;  3VVE A;  4U2R A;  2UYF A;  4OET A;  1JNF A;  1A40 A;  4MLV A;  1NMU A;  2PVU A;  3FV1 A;  5KDT B;  1ATG A;  3C9H A;  3HHF A;  3IO6 A;  3PUW E;  4G8H A;  3TCH A;  4G68 C;  4BDN A;  3KG2 A;  1A8E A;  3HCQ A;  5M2V A;  3MW0 A;  4F1Y A;  5CBR A;  3H7M A;  2Q9T A;  4OEV A;  1IEJ A;  2XX9 A;  3DP6 A;  4PFW A;  2F7B A;  1R9L A;  4HCY A;  1B1X A;  2XXX A;  2I0B A;  1LFI A;  1MM6 A;  2XXQ A;  4LON B;  3QK6 A;  3U72 A;  3MVZ A;  4JDF A;  3A09 A;  1DPE A;  1B6H A;  5L9O A;  4LQ2 A;  2A5T B;  4GXS B;  1LAG E;  1PB8 A;  3VVF A;  2F6G A;  3UN6 A;  5DEX B;  1GGG A;  4KCD A;  1VFD A;  1MXV A;  4ND9 A;  4IO3 A;  2VHA A;  5CRY A;  3TOD A;  1USY H;  4MF3 A;  3MVX A;  4GL8 A;  1FQD A;  4KR5 A;  4PET A;  4EF2 A;  3G3G A;  4YKK A;  4G8M A;  3T96 B;  1KWH A;  4OXV A;  1I6A A;  2OBG A;  5FTH A;  4QFO A;  5I2K B;  3O6I A;  5FTI A;  3LSF B;  5F1Q A;  2Q2A A;  1A99 A;  1SVX B;  4QRZ A;  1MDP 1;  4DCX A;  1RKM A;  1H43 A;  4EQ7 A;  2YJP A;  4NMY A;  1XT8 A;  2ZMB A;  3G3H A;  5TP9 B;  4ELR A;  1SW1 A;  3RPW A;  4RNS A;  3T9U A;  3CFL A;  3DP8 A;  3RTW B;  1T0K A;  1IXG A;  3KEI A;  4LQ5 A;  3MP8 A;  5B7D A;  1QJM A;  3PPR A;  1LBC A;  3SEU A;  3DP4 A;  3S4U A;  1B58 A;  3O28 A;  1MXW A;  2ESN A;  3ZKL A;  3QIM A;  2RF1 A;  1XHY A;  3MP1 A;  1QUL A;  3EN3 A;  2GRV A;  5TPA A;  4GD5 A;  5B70 A;  3S9E A;  5K2X A;  2DVZ A;  4ELQ A;  5HPQ A;  3SER A;  3CFX A;  1M5B A;  3A3U A;  4MBP A;  3IOU A;  3B6T A;  5DVF A;  2AL5 A;  3OSR A;  1EZ9 A;  4OYV A;  1Y1M A;  1Y9U A;  3T9H B;  3OEL A;  3V89 B;  4YKI A;  3KGC A;  1LBB A;  1TXF A;  1XS5 A;  2VD2 A;  2THI A;  3ZSF A;  3K6X A;  1P99 A;  1QVS A;  2DS9 A;  3SDF A;  4ZE8 A;  2RIN A;  3RT8 A;  5FHN A;  3LSX A;  3CVG A;  1P1Q A;  2HFB A;  2F7C A;  3KBR A;  1AMF A;  1O64 A;  2V25 A;  3FJ7 A;  4M1V A;  1N7W A;  3TAJ A;  4KCC A;  4LA9 A;  1JET A;  3O2A A;  3MC2 A;  1FTM A;  4N13 A;  4ZEF A;  3AXF A;  2OJT A;  2Q2C A;  3VE1 B;  4P0I A;  2ZYN A;  1LAH E;  1PBP A;  1B32 A;  2I4B A;  1NNK A;  2QSX A;  3E9X A;  3U92 A;  1SYI A;  3O66 A;  3GBB A;  4OFO A;  1B0L A;  1DTG A;  4PP0 A;  3TQW A;  4P11 A;  1DTZ A;  1MH4 A;  3ODB A;  4TOZ A;  4F3G A;  3VDF A;  1MPB A;  4Q0C A;  4F1V A;  3ZKK A;  2CZL A;  2Z8F A;  1POT A;  4QSE A;  2XHD A;  1NH7 A;  1TFA A;  1S7Y A;  4ZDM A;  2F5X A;  2DYX A;  1N3X A;  3LBS A;  3GBA A;  2KLF A;  4F1U A;  3EF7 A;  2DSF A;  5H8F A;  3G3F A;  2XXY A;  2O6A A;  3UA8 A;  2H98 A;  4JSD A;  4H6D A;  4ONY A;  3K2D A;  4G8N A;  4DXC A;  2HZK A;  1EH3 A;  1I69 A;  3D4G A;  5IKB A;  3RNN A;  3FAT A;  3OO9 A;  4FEB A;  3SEW A;  4LUB A;  1OLC A;  4JXI A;  1MQI A;  3QUF A;  5HM4 B;  1GTK A;  4GWO A;  2I3V A;  4YMB A;  4PFY A;  3PUY E;  3H6U A;  3FXQ A;  5AA3 A;  2Q8J A;  3FIR A;  3S2V A;  5A5X B;  4NF4 B;  1SBP A;  2R9J A;  1XVX A;  4U4S A;  4C1U A;  4Z7E A;  3I3V A;  3DM0 A;  3IOR A;  2YLN A;  2M8C A;  4R6K A;  3R6U A;  4ZS9 A;  2O1M A;  2VP1 A;  3TTN A;  2VOZ A;  1HSL A;  1YCJ A;  4ZEB A;  2DQV A;  1EZP A;  4AB6 A;  3V5A A;  3T66 A;  3I5O A;  4R9F A;  3O29 A;  4C0R A;  3SEV A;  4RA1 A;  4XKQ A;  1IUD A;  1FQB A;  4GOT A;  3CG1 A;  4ELP A;  1GR2 A;  1B46 A;  1YAE A;  2D5W A;  3KSJ A;  2V3T A;  1D9V A;  5KCJ B;  3K02 A;  3TDJ A;  2OZZ A;  4F3B A;  4OZ9 A;  1O7T A;  3K0V A;  1MH3 A;  1MY3 A;  3TEP A;  1DOT A;  4O3C A;  5H8Q B;  3TTM A;  2REJ A;  1B40 A;  3MVW A;  5CMC A;  2OWT A;  3H03 A;  3TYH A;  4H65 A;  2G29 A;  1JW5 A;  5CM6 A;  2NUV A;  1PDA A;  3EHS A;  1RYO A;  2DWJ A;  3MPK A;  3OEN A;  1TWY A;  3QXM A;  1UTH A;  5H8N B;  1ZTY A;  1US4 A;  4TQU Q;  4KQP A;  3BFU A;  4IO2 A;  3CIJ A;  1PC3 A;  2FA7 A;  4NWC A;  1NNT A;  1MY1 A;  3FXR A;  1CE2 A;  2PBW A;  4F3P A;  4IO6 A;  2DE3 A;  3MVY A;  3IB2 A;  1Y1Z A;  2X7Q A;  1OVB A;  5CMK A;  1BLF A;  1SDX A;  4TLM B;  3TCF A;  4NF8 A;  2AIX A;  3E13 X;  4U1Z A;  5J1D A;  2ZNT A;  1FW0 A;  4OMB A;  1CB6 A;  3O97 A;  2VD3 A;  2XXW A;  3OMB A;  3F11 A;  1DSN A;  2DWA A;  4F2Q A;  4F2O A;  3MJN A;  2Y7K A;  5H8H B;  4GRK A;  3UGW A;  5I56 A;  3N26 A;  2R6G E;  4GL0 A;  4YAH X;  3G7W A;  1B51 A;  2HEU A;  1ZJL A;  4OES A;  2I58 A;  4Q8R A;  4BDL A;  3SEY A;  3OEM A;  4ISU A;  4XXU A;  1XOC A;  2F78 A;  1R9Q A;  5JEI A;  3N6T A;  1UIV A;  3Q28 A;  3FGS A;  2XX8 A;  1IXC A;  5I57 B;  5EHM A;  4R75 A;  3MQ9 A;  4R6H A;  5EYF A;  5FHM A;  4F3S A;  5ICT A;  4G68 B;  2H4I A;  4YIC A;  3MZB A;  4HCW A;  3S9N C;  3PD9 A;  2HZL A;  3VXC A;  2OCU A;  4H5G A;  3K4U A;  1H76 A;  3CG3 A;  4YZZ A;  1SW5 A;  4DZ1 A;  4OEU A;  4Z0I A;  4Q5T A;  4FAJ A;  2LAO A;  4G4P A;  3RLF E;  5BUU A;  3W9V A;  3UK4 A;  1IZ1 A;  1MY2 A;  4YB7 A;  3PMV A;  3H6T A;  5TP9 A;  4X1B A;  1D3K A;  2UVI A;  1IXH A;  3IAZ A;  2Y7I A;  3W9W A;  1Y3N A;  2QRY A;  1QW0 A;  3PPP A;  3Q27 A;  1Y3P A;  2Y7P A;  2ZXT A;  4GIZ A;  1WDN A;  1Y3Q A;  4DXU A;  4IO4 A;  4U23 A;  3THI A;  3VLU A;  4PE5 B;  1QKB A;  1ZMG A;  2ABH A;  2HAV A;  3FAS A;  3IL1 B;  1UTB A;  3K6U A;  4QSC A;  1NNF A;  5JTY B;  4ZEK A;  2O68 A;  2Z22 A;  5H8S A;  1H45 A;  2QMW A;  2V84 A;  1R6Z A;  4QSD A;  4H0W A;  3HO7 A;  1P1W A;  4YKJ A;  1A7L A;  1MQD A;  5AA1 A;  1UIU A;  4F19 A;  2DOJ A;  3PPO A;  5TU0 A;  2ONS A;  2P2A A;  4C1T A;  3JYR A;  3MZ1 A;  3K00 A;  3HHG A;  4FE8 A;  1QUJ A;  5L9M A;  2PX1 A;  2NVU B;  4RYA A;  1S9T A;  1S50 A;  2D21 A;  3L6G A;  4OTE A;  3E4R A;  4GFR A;  1MXY A;  3FJM A;  4OER A;  2ANJ A;  3CRB A;  2Z8D A;  4AQ4 A;  3EHT A;  4DE8 A;  2H5Y A;  2NXO A;  4NE4 A;  3C4M A;  3BBR A;  1B3G A;  2ZYM A;  2O69 A;  4FJP A;  3H3G A;  2H9B A;  4ECF A;  1ELJ A;  3KN8 A;  4XIG Q;  2P1S A;  4UA8 A;  3G3I A;  2F7A A;  2OLB A;  3QUJ A;  3FUZ A;  2O51 A;  1NH8 A;  1IIW A;  2F36 A;  2F34 A;  1JW1 A;  2XXT A;  3HPI A;  4DIG A;  3GLB A;  2XXH A;  2RC9 A;  4XTC Q;  1N3W A;  3VVD A;  2ZYO A;  4QFK A;  4EQB A;  2DXR A;  3T22 A;  3M3F A;  3G3J A;  3IOW A;  4FED A;  5CI5 A;  5TPA B;  3SEX A;  2DXY A;  1MXU A;  3ZS6 A;  5ITO A;  2QS1 A;  3OO8 A;  1AH5 A;  3MZ9 A;  1FTO A;  1N76 A;  2XXV A;  4NF6 B;  3T9X B;  1FQA A;  3FXU A;  4OEN A;  2A5S A;  4EF1 A;  1P1O A;  2QS4 A;  2VGQ A;  4ELO A;  3I6V A;  3K6W A;  1AL3 A;  3U94 A;  2FNC A;  1A8F A;  4I9D A;  1SQY A;  1JEV A;  1Y4T A;  1D9Y A;  1MQJ A;  4R72 A;  4DLD A;  1B4H A;  3S9M C;  1AOV A;  1IQ7 A;  5A5X A;  4EXK A;  3D4C A;  4OHN A;  1P1U A;  1US5 A;  4IY6 A;  1FCK A;  4YKP A;  3SES A;  5AA4 A;  3K1M A;  4JSO A;  3BFT A;  4KFQ A;  4R73 A;  3B6Q A;  4KYD A;  2QMX A;  3PGF A;  1B05 A;  2REG A;  3VXB A;  1LAX A;  3ILU B;  1WVJ A;  4XKP A;  4Q30 B;  4GLI A;  4JWO A;  3TFL A;  1B3E A;  4E0W A;  3KZG A;  3W15 C;  2DP8 A;  1LFG A;  4NTL A;  1B4Z A;  1NFT A;  5F7V A;  4QHQ A;  1N0T A;  5JK4 A;  3Q25 A;  1QKA A;  4RY1 A;  3H6W A;  3SET A;  1N04 A;  3U1O A;  4OFL A;  3O9P A;  3PMW A;  3KFM A;  4RJZ A;  3KJT A;  2YPN A;  3LSL A;  3IJO B;  4RXL A;  5H8Q A;  1RYX A;  2AYS A;  4OVJ A;  1B3L A;  1ZBM A;  3CFZ A;  1L5T A;  1MY4 A;  3SKP A;  5I2N B;  3BKI B;  4KYS A;  3N6U A;  4OQO A;  5L9S A;  1BTJ A;  1PB7 A;  5AA2 B;  3VLV A;  4IO5 A;  4EUO A;  1FQF A;  2ONR A;  2QJE A;  1DMB A;  2DWI A;  2XXR A;  4DXB A;  5I58 B;  4LAT A;  1MG1 A;  1PB9 A;  3VLW A;  1LFH A;  2OWS A;  1J1N A;  4FAT A;  2GHA A;  4LZ8 A;  4MH5 A;  2B3B A;  3KJ7 A;  2ZYK A;  3JV9 A;  1XVY A;  4GVO A;  4QFP A;  4KI0 E;  3TTR A;  3OO7 A;  4U1O A;  1JVX A;  2PT1 A;  4XKR A;  1NL5 A;  1LST A;  1M5F A;  1P1N A;  1URG A;  4UAC A;  1IXI A;  2AL4 A;  2GHB A;  1LB9 A;  3TEL A;  2X7P A;  3Q26 A;  3WAF A;  1LCF A;  1LB8 A;  1O63 A;  5KDT A;  4R9G A;  4BDM A;  4RPN A;  3R7X A;  4NWD A;  3USD A;  1OIB A;  2Z8E A;  4X1D A;  3P7I A;  1B7Z A;  2V3Q A;  2Z23 A;  3C32 A;  3B7D A;  3KOS A;  5IAI A;  4LZ7 A;  2I6E A;  3C36 A;  3LSW A;  5I57 A;  3R26 A;  4K3F A;  4I62 A;  3EPE A;  4O3B A;  1I6Q A;  1Z7N E;  1OLA A;  2UVG A;  1B2H A;  5I59 B;  4YB6 A;  4G68 A;  4IGR A;  2I3W A;  4QF9 A;  2Y7W A;  2HAU A;  4NF5 B;  4U22 A;  3C33 A;  4JBZ A;  1GVC A;  2A5T A;  1B3F A;  2UXA A;  1ZKB A;  3C34 A;  4ZZE A;  1N84 A;  3PUV E;  1ANF A;  5DEX A;  1NNP A;  1UTH B;  3KN7 A;  2H99 A;  1URS A;  4RK9 A;  1VR5 A;  2DE2 A;  1EU8 A;  1WOD A;  1HSE A;  4OFJ A;  4N6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...