3Q28A

Cyrstal structure of human alpha-synuclein (58-79) fused to maltose binding protein (mbp)
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
386
structure length
386
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSKTKEQVTNVGGAVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein, protein fibril
molecule keywords Maltose-binding periplasmic protein/alpha-synuclein chimeric
publication title Structures of segments of alpha-synuclein fused to maltose-binding protein suggest intermediate states during amyloid formation
pubmed doi rcsb
source organism Escherichia coli
total genus 123
structure length 386
sequence length 386
ec nomenclature
pdb deposition date 2010-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3q28A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3q28A01
1B3LA 2WKYA 4NEDA 1B1XA 1QULA 4ZEDA 1IIWA 4KD5A 4P11A 3K02A 1BLFA 2ZXTA 3L6HA 4R75A 4ELPA 3TZAA 1PBPA 3V83A 4YAHX 1XOCA 4ELOA 2XXIA 1J1NA 1USYE 1POTA 2QS3A 2O6AA 1P99A 3PMXA 3UIFA 1VR5A 3OD7A 1DOTA 2FA7A 1MY4A 3CG1A 4R6HA 1A54A 1MXUA 4YKIA 1IXCA 1TFAA 1WODA 3B6TA 5HBCA 2RC8A 4PFTA 5F7VA 2R71A 4DCXA 3KBRA 3PUXE 2CZLA 5H8FA 2ZMBA 3K6UA 3T66A 4FIMA 4OFOA 2GH9A 3SEYA 4X48A 2Y7WA 1N7XA 4NWDA 1HSEA 1N76A 1Y4TA 3DELB 3EHSA 2ZYKA 2I6EA 2DWAA 2XHDA 2QMXA 4QRZA 3VXCA 1II5A 5TPAB 4QF9A 1MRPA 2PVUA 3KGCA 4R6YA 5I56A 3TELA 3T9XB 4M1VA 4N13A 2Z8DA 3G3FA 4DE8A 2ANJA 1IXHA 4O3AA 4M4GA 3CI8A 5AA4B 1QUIA 3EPEA 3BFTA 3K6WA 3ECRA 5ISUA 3Q25A 1JEUA 4XTCQ 1FQDA 1MXYA 1B58A 2P2AA 3SKPA 1EU8A 4H67A 2DE2A 2H98A 4U22A 2O7IA 3L6GA 3CVGA 2RCBA 3LSLA 1MM6A 1PC3A 4I1DA 4K3FA 1AMFA 3CFZA 4GRKA 1I6QA 3QUJA 4IB2A 4HW8A 2F78A 1M5BA 1B4ZA 1YCJA 2P0SA 1URDA 1BTJA 4HCYA 2FYIA 3FZVA 3PPPA 4R6KA 3K4UA 1GTKA 4O3CA 4R2FA 3HPIA 1IXGA 4WXJA 2BJJX 3TDJA 2Z22A 3GBBA 4LQ2A 1SDXA 3MP8A 4H6DA 3QXMA 4POWA 5H8QA 2DOJA 1A40A 1M5EA 4H1XA 1GR2A 2A5SA 3ODBA 3QSLA 2VGQA 1SW4A 3E4RA 1O63A 2V3QA 1NH8A 3Q26A 4NF4A 1ZMGA 4OESA 4RA1A 3ZSFA 1NNTA 1MXVA 1MY0A 2XD2A 1MQDA 3GBAA 3K1MA 4DIGA 1TFDA 4GFRA 4ISUA 3IAZA 3C33A 1CE2A 2HZLA 4H8IA 2HQ0A 3B6QA 2R9JA 1TWYA 3QAXA 4U1ZA 2HAUA 3PD8A 4F3SA 5ITPA 1MXXA 5KCJA 5H8NB 4G68B 1B32A 3O28A 3UK4A 2D3IA 1S9TA 1SW5A 1B7UA 1M5FA 2UVGA 4YB6A 3OO6A 2F5XA 1YAEA 4TQUQ 3KFMA 3W9WA 1LGBC 5IAIA 2NWJA 3RGYA 1Y3NA 2O69A 5FTIA 4DXUA 4R72A 2DWIA 4YKKA 1P1WA 2Y7PA 1Q1KA 4Q30B 2F8DA 3EF7A 3DP6A 1B52A 1ZKBA 5JTYA 3PPOA 3TTNA 3G3HA 3R7XA 3TFLA 3F11A 1D3KA 4THIA 3IO4A 3ONMA 1RYXA 2NXOA 4UA8A 4E0XA 4PQJA 3N5LA 4F3GA 4PP0A 3MZ9A 1MH3A 3E3KA 4H5FA 3PD9A 5I58B 4QSCA 5CMMA 2QS2A 4AB6A 4LZ5A 2P1SA 1DPPA 4OWDA 2PBWA 2Y7KA 3THIA 2PMSA 4G68C 5K2YA 5AA2D 5AE4A 1PB9A 2NUVA 3G3KA 3G3IA 3FXRA 2UYEA 5AA3A 1ANFA 1T0KA 4U4SA 5I2NB 2DWJA 3A3UA 3SEUA 1B3EA 5L9MA 2XX7A 4OEVA 4TLLB 5L8DA 4G4PA 1P1UA 5EHSA 2HXWA 1B9JA 4G77A 2Q9TA 1SQYA 1FTKA 3KZGA 3C34A 1UIUA 1ZU0A 1I6AA 3LSWA 5I84A 1FW0A 3TTKA 4F1YA 2XXVA 3TTRA 4TLMB 4IO4A 1BP5A 3FJMA 3T9HB 5KDTB 1NKXA 3PUWE 4I62A 1OQGA 1A55A 2VP1A 1HSJA 5IKBA 5CM6A 3VLVA 1R9LA 2G93A 3BBRA 3OMBA 4JB7A 2H5YA 3JYRA 2H9BA 1Y1MA 4KPTA 1FTOA 1IXIA 3I6VA 4OVJA 3RQTA 2ZYNA 1UQWA 4YKJA 2REJA 4GLIA 2A5TA 2XX9A 3HCQA 3U8QA 4RK9A 4RPOA 5H8HA 1ZTYA 5JK4A 4U23A 4YMBA 4OFLA 1RKMA 4I8CA 2Z8FA 3ILUB 1MDQA 3O6IA 4EXLA 4KYSA 4WEDA 4BDRA 1B7ZA 4N07A 4G8NA 2R6GE 1S50A 3KJTA 3MZBA 1LB9A 1M5DA 3KOTA 1RYOA 2V93A 3UP9A 5BWJA 3PUYE 1BKAA 3AXFA 1OIBA 3T9UA 2UVHA 4R74A 3T93B 1P1OA 4F18A 3LSXA 1QKAA 3LBSA 4XIGQ 3N6UA 4BDQA 1JNFA 3TCFA 1ZIUA 2HZKA 3CSGA 2I3WA 3H4ZA 1US4A 1B51A 1MY1A 2XXWA 1M5CA 1FTJA 2X7PA 3C4MA 1SI0A 1FTLA 4F19A 2ONSA 4LUBA 4F1UA 1NL5A 1A8FA 1B3GA 3T22A 2Z23A 1JW4A 4KYEA 2HCAA 3TKDA 5AA2B 4ZEKA 4ZE8A 2XD3A 1LAHE 1OLAA 1XVYA 4U21A 1MY3A 3U72A 3SERA 2H4IA 3HN0A 2XXHA 5DEXB 2M8CA 1DPEA 1DTGA 2X7QA 1YTVA 1A8EA 1SD3A 4GL0A 1Y4CA 5DTBA 1SI1A 1N0TA 1ZJLA 5EHMA 4FEDA 3Q28A 2DQVA 4PETA 2D21A 2RCAA 3C32A 3FASA 1LAXA 3FATA 2REGA 1D9YA 2HAVA 4NMYA 3G3JA 1R9QA 1URGA 4F3BA 5TPAA 3OO8A 3CFXA 5HM4B 3JZJA 3MUQA 4ECFA 3TCGA 3BFUA 3GXAA 5L9OA 1MQJA 3IORA 4EDPA 2XXUA 4H5GA 5AA4A 1UTHB 4ZZEA 2ZNUA 1H44A 4H0WA 4UACA 3E13X 2F7AA 4F3PA 2G29A 2Q2CA 1UTBB 3TQWA 1QVSA 4RXLA 2OWSA 3RUMA 4U1OA 3PMVA 2FNCA 2LAOA 3WAEA 3LSFB 4GD5A 1LB8A 5CRYA 4PFWA 5DVFA 4EF2A 1N7WA 4YICA 1QJMA 4OERA 5L9SA 1LCTA 2F7BA 5K2XA 2Q2AA 2PT2A 1B5JA 1TT1A 3PPQA 3MC2A 3OO9A 1MQGA 4JWYA 3UGWA 1OMPA 2IEEA 1P1QA 3DLNA 4QSEA 1H3DA 1PEBA 3RLFE 2XX8A 4FE8A 1DSNA 3RPWA 1LCFA 4GXSB 4NF6B 1LAGE 3K6XA 3VLUA 4ESXA 4JWXA 3FGSA 5BUUA 5ICQA 2I4BA 5DVIA 3FXUA 2I3VA 4F2QA 1B4HA 3O97A 5JEIA 1O7TA 1B40A 4HTGA 3B7DA 4XKPA 2RF1A 2VHAA 1IITA 4G8HA 4DXBA 1LSTA 4POXA 3W15C 1A7LA 1QKBA 4Q5TA 2PT1A 1SYIA 4P0IA 4RJZA 3MVZA 3IO6A 2YPNA 2QSXA 4NF5B 4JSOA 5H8NA 4G68A 4F31B 1B05A 4PFUA 3I5OA 2GRVA 5I2KB 3DP4A 2F35A 4H65A 5B70A 3MAMA 1MDP1 3TCHA 3IOTA 3TAJA 3O2AA 3RTWB 3VXBA 3CIJA 3ZKLA 3H6WA 5CMKA 1NNFA 1O64A 4NF8B 1MS7A 3FV1A 4IY6A 1ATGA 2O1LA 3OSQA 2O51A 1UIVA 4JSDA 4N6PA 1LBBA 3IL1B 4ZECA 4YU0A 3DP8A 3HO7A 1S7YA 4LVQA 1MXWA 2VOZA 2DWHA 2E1SA 1L5TA 1MXZA 5ELVA 1JW1A 4F22A 1JEVA 3C9HA 5I58A 4FEBA 4JBZA 2YLNA 3GLBA 4C0RA 4NWCA 3KN3A 2KLFA 3RY3A 5I57B 4LONB 2DE4A 3MZ1A 3N26A 4WKMA 3CRBA 3T96B 4NE4A 3IX1A 3RN8A 4P0GA 3K0VA 1USYH 2ABHA 2DVCA 1B46A 3QUFA 1WVJA 3KEIA 4R9GA 2DS9A 5I2NA 4O3BA 4MF3A 4JDFA 2AIXA 3EQ1A 4U2RA 3PGFA 1GGGA 1VE4A 4BDNA 2X26A 3DM0A 3VVDA 3N6TA 4YKPA 1FQEA 1LLSA 3Q27A 3FUZA 5I59B 2DXRA 4PFYA 3QIMA 3D4GA 5CBRA 4KYDA 4XKRA 3SEVA 3IJXB 1NNPA 5A5XB 4HCWA 4QFPA 1VFDA 3M3FA 4Q0CA 2RC7A 5EYFA 3WAFA 4OMBA 1LAFE 3UN6A 4DLDA 5M2VA 2DYXA 2QS1A 2OJTA 5KDTA 1B1HA 1Y20A 3PUVE 3KJ7A 1HSLA 3C35A 4DXCA 4KQPA 3S2VA 2D5WA 3P7IA 3LR1A 1Y3QA 5FHOA 3MQ9A 3IJOB 2OBGA 1N04A 4OTEA 4GWOA 4ND9A 4U4XA 2THIA 3VVEA 4IO3A 2QRYA 4ELRA 3O6GA 1H76A 3PV0E 3SEXA 2F7CA 4G2ZA 4OFJA 2XXRA 2Y84A 3QYTA 3K01A 2GHAA 3IK6B 1OVBA 1SBPA 3EN3A 2QS4A 2AL4A 1ELJA 3VFJA 4FAJA 4OEUA 4C1TA 1B0HA 2O68A 3H6UA 1GV8A 1OLCA 2CMOA 3CSBA 3TTMA 3LUYA 3TYHA 3IOUA 2XXXA 2V84A 1PB8A 1EZ9A 2VD3A 4RY1A 5HPQA 5CI5A 3FJGA 2UVJA 3IR1A 2UYFA 1QW0A 3KSJA 4YMAA 5TP9B 2ZNSA 4GOTA 2QMWA 3ILTB 3FV2A 4X1DA 4F1VA 3VVFA 3GZGA 4QFNA 1FQCA 4DDDA 1YPNA 4ZEFA 4TOZA 1B6HA 3SESA 1NMUA 1SW2A 4I9DA 2RC9A 4ZEIA 2F6GA 1OVTA 5KZTA 1IUDA 1N84A 4MFIA 3OENA 3TODA 1LFHA 1NH7A 2ZYMA 2Q88A 4LA9A 4MLQA 3BKIB 4X1BA 3OSRA 3HHFA 1AL3A 4EF1A 1LBCA 5FTHA 1VSOA 2HEUA 4BDMA 1B3FA 5H8FB 5B7DA 2XXTA 3K6VA 3FJ7A 4F2OA 1A99A 4DZ1A 1ZBMA 3MVWA 4QFLA 4ZDMA 4EQBA 5AA2A 1Q35A 3OEMA 3OEKA 4IO6A 4QFKA 4LATA 5DEXA 1B3HA 1IEJA 2ZYOA 4PE5B 2O84X 5I56B 3MVXA 3RNNA 4Z0IA 4QSDA 3V89B 1MQIA 1D4NA 2OK2A 4KHZE 3H6TA 2DXYA 1B5HA 4X9TA 4R9FA 1QUJA 4JWOA 3Q29A 1JVXA 4YZZA 1B7HA 4LQ5A 3FVKA 1XHYA 1URSA 3T9VA 1Y9UA 3HV1A 4RYAA 2QJEA 3K2DA 4HS7A 1LFGA 2XXQA 3M3KA 1OQHA 2DE3A 2ESNA 4QHQA 2Q8JA 4LZ8A 3PUZE 3C36A 1MM7A 1PDAA 3PU5A 3RTFB 2OWTA 2I4CA 1IZ1A 1FCKA 1UTHA 4RNSA 4E0WA 1DMBA 4KCDA 3TMGA 3OELA 1AIVA 2DVZA 2AL5A 5FHNA 2B3BA 1UTBA 2XXPA 3MJNA 2O1MA 3HHGA 4OQOA 3W9VA 4G8MA 2AYSA 3UORA 1AOVA 5H8QB 5AA1A 2PX1A 2UVIA 4GVOA 4ELQA 4R2BA 4XXUA 3VV5A 3SETA 1FQFA 1FQBA 3KN7A 2ONKE 4FECA 1JQFA 3MW0A 4EQ9A 4MBPA 2O7UA 3U93A 4NF4B 1POY1 1JVYA 1N3XA 3MPKA 3RT8A 1XT8A 3SDFA 2F97A 2QL3A 4F29A 2Y7IA 1QUKA 3O66A 1PBQA 3H6VA 3S9LC 3CG3A 4NF6A 1LFIA 2F34A 1FTMA 3EHUA 4C1UA 2VD2A 2GHBA 3FVNA 1F9BA 4IY5A 4GXAA 3S9MC 5KCJB 3A09A 4YB7A 3FVGA 3K1PA 1Z7NE 2B65A 1NFTA 3PPRA 1KWHA 4FJPA 3OXNA 3V8XB 3MP1A 4ESWA 2B3FA 1WDNA 2W7YA 2V25A 3SEWA 3VLWA 5H8SA 3UA8A 3PPNA 3M8UA 1ZLQA 3U1OA 2I49A 5J1DA 4NF5A 3RT6B 4IO5A 2QPQA 3FD3A 1P1NA 1MG1A 4IO2A 4ZZAA 1I6BA 3O6HA 5JTYB 5ITOA 5I2KA 3G7WA 4KI0E 3IB2A 2F6PA 2ONRA 1JW5A 2Y7RA 4AB5A 3QK6A 1CB6A 4ZE9A 1I69A 3R6UA 5CC2A 4OXVA 4OYVA 3USDA 2OZZA 2E0SA 4EXKA 1EZOA 4OHNA 3KOSA 1H45A 1NNKA 4OZ9A 4NF8A 1EH3A 3MVYA 3V5AA 3TEPA 3U94A 1SW1A 3S4UA 3TPAA 1BIYA 3E9XA 2I0BA 3ZS6A 2PYYA 3B6WA 4FORA 4EUOA 4OETA 4AQ4A 4H8JA 1AH5A 2H99A 3KSXA 5DVJA 4DCYA 5F1QA 5LOMA 3CR9A 3CFLA 3R26A 3H7MA 4ZEBA 4JXIA 2H25A 2UXAA 3FVOA 4BLAA 1B0LA 3O9PA 4R73A 3MPLA 5I57A 4BDOA 5TU0A 3EHTA 3JV9A 2GFEA 1D9VA 4WEPA 4YB5A 4L17A 3TTLA 3O29A 1XVXA 4BDLA 2HFBA 1VFEA 1SYHA 4LZ7A 3N94A 2Z8EA 5DT6A 3LC8A 4RK2A 5CBSA 1TXFA 2IA4A 1B5IA 2ALUA 2OCUA 1MY2A 1Y1ZA 4IGRA 3FIRA 1FQAA 3U92A 4F39A 1MPDA 4Z7EA 3VE1B 2I48A 4GQOA 3I3VA 4Q8RA 4FATA 1XS5A 3S9NC 3K1NA 4IO7A 5I59A 2OLBA 3IOWA 1EZPA 2DP8A 3MWBA 1MPCA 3PMWA 3MBPA 4ZS9A 3OO7A 5CMCA 2NVUB 4KR5A 3H3GA 1R1NA 5A5XA 4RPNA 1MPBA 1B2HA 2DSFA 3TQLA 4QFOA 1PB7A 3KN8A 2RINA 3H03A 2ZNTA 1R6ZA 1DTZA 4NTLA 2A5TB 5FHMA 4GIZA 3IOVA 3G3GA 3KG2A 3H06B 1H43A 5H8HB 2V3TA 4KCCA 2V3UA 4ONYA 1MQHA 3FXQA 4XKQA 3VDFA 2XXYA 1SVXB 4LP2B 4GF8A 5DYHA 4IGTA 3OOAA 1IQ7A 3IB0A 3M3LA 3IB1A 2I0CA 2Q89A 4EQ7A 1GVCA 4OENA 4MH5A 2I58A 1JETA 2YJPA 2RKMA 3D4CA 3C31A 2NOOA 5CMBA 3K00A 1Z7ME 1Y3PA 1XC1A 3MP6A 4GL8A 4MLVA 5ICTA 3TUSA 1N3WA 1MH4A 5TP9A 1US5A 3A3CA 2F36A 4KFQA 3HSTA 3ZKKA 3S9EA 4XKNA
chains in the Genus database with same CATH superfamily
4HE0A 1B3LA 2WKYA 4NEDA 1B1XA 1QULA 2BJIA 4ZEDA 1IIWA 4KD5A 4P11A 3K02A 1BLFA 2ZXTA 3L6HA 4R75A 4ELPA 3TZAA 1PBPA 3V83A 4YAHX 1XOCA 4ELOA 2XXIA 1J1NA 1NV0A 1USYE 4P8BA 1POTA 2QS3A 2O6AA 5ET8A 1P99A 3PMXA 3UIFA 4PDHA 1VR5A 3OD7A 5EQ7A 1LBXA 2CEYA 1DOTA 1EYJA 2FA7A 1MY4A 3B50A 3CG1A 5IZ3A 4R6HA 1A54A 1MXUA 4YKIA 1NV4A 1IXCA 1TFAA 1WODA 3B6TA 5HBCA 2RC8A 4PFTA 5F7VA 2R71A 4DCXA 3KBRA 2L5VA 3PUXE 2CZLA 5H8FA 2ZMBA 3K6UA 3T66A 4FIMA 4OFOA 2GH9A 3SEYA 4X48A 2Y7WA 3ISPA 1N7XA 4NWDA 1HSEA 1NV1A 1N76A 1Y4TA 3DELB 3EHSA 2ZYKA 2I6EA 5IZZA 2DWAA 2XHDA 2QMXA 4QRZA 3VXCA 4GWSA 1II5A 5TPAB 4QF9A 1MRPA 2PVUA 3KGCA 3T1BA 4R6YA 5I56A 3TELA 3T9XB 2HPGA 4M1VA 4N13A 2Z8DA 1FPJA 3G3FA 3PTYA 4DE8A 2ANJA 1IXHA 4O3AA 4M4GA 3CI8A 5AA4B 1QUIA 3EPEA 3BFTA 3K6WA 3ECRA 5ISUA 3Q25A 1JEUA 4XTCQ 1FQDA 1MXYA 1B58A 2P2AA 2HHMA 3SKPA 3LV0A 1EU8A 4H67A 2DE2A 2H98A 4U22A 2O7IA 3L6GA 4MEVA 3CVGA 4OVTA 2RCBA 3LSLA 1MM6A 1NV2A 1PC3A 1FBHA 4I1DA 4K3FA 2V4CA 1AMFA 3CFZA 4GRKA 1I6QA 3QUJA 4IB2A 4HW8A 4UABA 2F78A 3QMFA 1M5BA 1B4ZA 1YCJA 5LDZA 1NI9A 2P0SA 2P3NA 1URDA 1BTJA 4HCYA 2FYIA 3FZVA 3PPPA 4R6KA 3K4UA 1GTKA 1YXIA 4O3CA 4R2FA 3HPIA 1IXGA 4WXJA 1FJ9A 2BJJX 1FBCA 1KZ8A 3TDJA 2Z22A 3GBBA 4LQ2A 2FBPA 1K9YA 1SDXA 3MP8A 4N6DA 4H6DA 3QXMA 4MMPA 4POWA 2F3DA 5H8QA 2DOJA 1A40A 1M5EA 4DI3D 4H1XA 1GR2A 2A5SA 3ODBA 4X04A 3QSLA 2VGQA 1SW4A 2VPOA 3E4RA 1O63A 2V3QA 1NH8A 3Q26A 4NF4A 4O7IA 1ZMGA 4OESA 4RA1A 3ZSFA 1NNTA 1MXVA 1MY0A 3MSTA 2XD2A 1MQDA 3GBAA 3K1MA 4PAFA 4DIGA 1TFDA 4GFRA 4ISUA 4NGUA 2ZZVA 3IAZA 3C33A 4XFEA 1CE2A 2HZLA 3IFCA 4H8IA 2HQ0A 3B6QA 2R9JA 1TWYA 4IR8A 3QAXA 4U1ZA 2HAUA 3PD8A 4F3SA 5ITPA 1MXXA 5KCJA 5H8NB 4G68B 1B32A 2PCRA 3O28A 3HFUA 3UK4A 2D3IA 1DK4A 1S9TA 1SW5A 1B7UA 1M5FA 2UVGA 4YB6A 3OO6A 2F5XA 1YAEA 4TQUQ 3KFMA 3W9WA 1LGBC 5IAIA 2NWJA 3RGYA 1Y3NA 2O69A 5FTIA 4DXUA 4R72A 2DWIA 4YKKA 1P1WA 2Y7PA 1Q1KA 4Q30B 2F8DA 3EF7A 3DP6A 1IMAA 1B52A 1ZKBA 5JTYA 3PPOA 3TTNA 3KC1A 1IMBA 3G3HA 3R7XA 3TFLA 3F11A 1D3KA 4THIA 3IO4A 3ONMA 1RYXA 2NXOA 4UA8A 1LEVA 4E0XA 4PQJA 3N5LA 4F3GA 4PP0A 3MZ9A 1MH3A 3E3KA 4H5FA 3PD9A 5I58B 4QSCA 5CMMA 2QS2A 1NV3A 4AB6A 2GQ1A 4LZ5A 2P1SA 1DPPA 4OWDA 2PBWA 2Y7KA 3THIA 1KA1A 2PMSA 4GBVA 4G68C 5K2YA 5AA2D 4H46A 4MCOA 5A5LA 5AE4A 2B4MA 1PB9A 5EQAA 2NUVA 3G3KA 3G3IA 4N8YA 1FTAA 3FXRA 2UYEA 5AA3A 1ANFA 1T0KA 4U4SA 5I2NB 2DWJA 3A3UA 3SEUA 1B3EA 5L9MA 2XX7A 4FBPA 4OEVA 3T0JA 4TLLB 5L8DA 4G4PA 1P1UA 3SZPA 4P9KA 4N6KA 5EHSA 2HXWA 1B9JA 1FPGA 4MJOA 4G77A 2Q9TA 1SQYA 1FTKA 3KZGA 3C34A 1UIUA 1ZU0A 1I6AA 3LSWA 5I84A 3GYYA 1FRPA 1FW0A 3TTKA 4F1YA 2XXVA 3TTRA 4TLMB 4IO4A 1BP5A 3FJMA 3T9HB 5KDTB 1NKXA 2KQZA 3PUWE 4I62A 4PCDA 1OQGA 3E78A 1A55A 5I3SA 2CZKA 2VP1A 4GWXA 3RPLB 1HSJA 5IKBA 5CM6A 2FIEA 3VLVA 1R9LA 2G93A 3BBRA 3OMBA 4JB7A 2H5YA 3JYRA 2H9BA 1Y1MA 4KPTA 1FTOA 4OVQA 4N91A 1IXIA 3I6VA 4OVJA 4GX3A 3RQTA 2ZYNA 1UQWA 4YKJA 2REJA 4GLIA 2A5TA 1VDWA 2XX9A 3HCQA 3U8QA 1Q9DA 4RK9A 1FPLA 4RPOA 5H8HA 1ZTYA 4N4UA 5JK4A 4U23A 4YMBA 2XA5A 1CNQA 4OFLA 1RKMA 4I8CA 2Z8FA 4P1EA 3ILUB 1MDQA 3O6IA 4EXLA 4KYSA 4WEDA 4BDRA 1B7ZA 4N07A 1NUWA 4G8NA 2R6GE 1S50A 2MKZA 3KJTA 1LBYA 3MZBA 1LB9A 1M5DA 3KOTA 4NX1A 1RYOA 2V93A 3UP9A 5BWJA 3PUYE 1BKAA 3AXFA 1OIBA 3T9UA 2UVHA 4R74A 5T3JA 3T93B 1P1OA 4F18A 3LSXA 1QKAA 3LBSA 4XIGQ 1IMEA 3N6UA 4BDQA 5EYGA 1JNFA 3TCFA 1ZIUA 2HZKA 3CSGA 2I3WA 3H4ZA 1US4A 1B51A 1MY1A 4O94A 3IFAA 2XXWA 1M5CA 1FTJA 2X7PA 3C4MA 1SI0A 1FTLA 2F3BA 4F19A 2ONSA 4LUBA 1K9ZA 4PTKA 4F1UA 4HE1A 1NL5A 1A8FA 1B3GA 1DBZA 2QVRA 4GWWA 3T22A 4XF5A 5IZ3B 2Z23A 1JW4A 4KYEA 2HCAA 2FVZA 4O8MA 3TKDA 5AA2B 4ZEKA 4ZE8A 2XD3A 1LAHE 1OLAA 1XVYA 4GBWA 4U21A 1MY3A 3U72A 3SERA 2H4IA 3HN0A 2XXHA 5DEXB 2M8CA 1DPEA 1DTGA 2X7QA 1XI6A 1YTVA 1A8EA 1SD3A 5EQ8A 4GL0A 1Y4CA 5DTBA 1SI1A 1N0TA 1ZJLA 5EHMA 4FEDA 3Q28A 2DQVA 4PETA 1SPIA 2D21A 2RCAA 3C32A 3FASA 1LAXA 3FATA 2REGA 1RDYA 1D9YA 2HAVA 4NMYA 3D1RA 3G3JA 1R9QA 1URGA 4F3BA 5TPAA 3OO8A 3CFXA 5HM4B 3JZJA 3MUQA 4ECFA 3TCGA 3BFUA 3GXAA 5L9OA 4PGNA 1MQJA 3IORA 4EDPA 2XXUA 4H5GA 4MNPA 5EQ9A 3CHGA 5AA4A 1UTHB 4ZZEA 2ZNUA 1DCUA 1H44A 4H0WA 4UACA 3E13X 2F7AA 4F3PA 2G29A 2Q2CA 1UTBB 3TQWA 1QVSA 4RXLA 2OWSA 3RUMA 4U1OA 3PMVA 2FNCA 2LAOA 3WAEA 3LSFB 4GD5A 1LB8A 5CRYA 4PFWA 2FIXA 5DVFA 4EF2A 5LTCA 1N7WA 4YICA 1QJMA 4OERA 5L9SA 1LCTA 2F7BA 5K2XA 1RDXA 2Q2AA 2PT2A 2OX3A 2CEXA 5ET5A 1B5JA 1TT1A 2FHYA 4NAPA 3PPQA 3MC2A 3OO9A 1MQGA 4JWYA 3UGWA 1OMPA 2IEEA 1P1QA 3DLNA 4QSEA 3B8BA 1H3DA 1PEBA 3RLFE 4LN5A 2XX8A 4FE8A 4OVRA 1DSNA 2DDKA 3RPWA 1LCFA 4GXSB 4NF6B 1LAGE 3K6XA 3VLUA 4ESXA 4JWXA 3FGSA 5BUUA 4GWUA 5ICQA 2I4BA 5DVIA 2PFYA 3KBZA 3FXUA 1FPBA 2I3VA 1B4HA 4F2QA 3O97A 5JEIA 1O7TA 1IMCA 1EYKA 1B40A 4HTGA 3B7DA 4XKPA 2RF1A 2VHAA 1IITA 4G8HA 4DXBA 1LSTA 3BIGA 4POXA 3W15C 1A7LA 1QKBA 4Q5TA 2PT1A 1SYIA 4P0IA 2HXRA 4RJZA 2P3VA 3MVZA 3IO6A 2YPNA 2QSXA 4NF5B 2XWIA 1FBGA 4JSOA 5H8NA 4G68A 4F31B 1B05A 4PFUA 4GX6A 3I5OA 2GRVA 5I2KB 3DP4A 4G61A 2F35A 4H65A 5B70A 3MAMA 1MDP1 3TCHA 3IOTA 3TAJA 3O2AA 3RTWB 4PGPA 3VXBA 3CIJA 3ZKLA 3H6WA 5CMKA 1NNFA 4KXPA 1O64A 4NF8B 1MS7A 1NUYA 4HXVA 2ZZWA 3FV1A 2Q74A 4IY6A 1ATGA 2O1LA 3OSQA 2O51A 1UIVA 4JSDA 4N6PA 1LBBA 3IL1B 4ZECA 4YU0A 3DP8A 3HO7A 1S7YA 4GWYA 4LVQA 1MXWA 2VOZA 2DWHA 2E1SA 1L5TA 1MXZA 5ELVA 2WYPA 1JW1A 4F22A 1JEVA 3C9HA 4PAIA 5I58A 4FEBA 4JBZA 2YLNA 4N15A 3GLBA 4C0RA 4NWCA 3KN3A 2KLFA 3RY3A 5I57B 4LONB 2DE4A 1NV6A 3EKIA 3MZ1A 3FBPA 4MIJA 1KA0A 3N26A 4WKMA 3CRBA 3T96B 4NE4A 3IX1A 2WBBA 3RN8A 4P0GA 3K0VA 1USYH 2ABHA 2DVCA 1B46A 3QUFA 1WVJA 3KEIA 4R9GA 3BIHA 2DS9A 5I2NA 4O3BA 2CZHA 4MF3A 4JDFA 2AIXA 3EQ1A 4U2RA 2VPNA 3PGFA 4N8GA 1GGGA 1VE4A 4BDNA 2X26A 3DM0A 5FBPA 3VVDA 3N6TA 4YKPA 3NOHA 1FQEA 1LLSA 3Q27A 1IMDA 3FUZA 5I59B 2DXRA 4PFYA 3QIMA 2XWOA 3D4GA 5CBRA 4KYDA 4XKRA 1IMFA 3SEVA 3IJXB 1NNPA 5A5XB 2WX9A 4HCWA 4QXDA 4P56A 4QFPA 1VFDA 3M3FA 4Q0CA 2RC7A 5EYFA 3WAFA 4OMBA 1LAFE 3UN6A 4DLDA 5M2VA 2XXKA 2DYXA 4MX6A 2QS1A 2OJTA 4PFIA 1G0HA 5KDTA 1B1HA 1Y20A 3PUVE 4PAKA 3KJ7A 1HSLA 3C35A 4DXCA 4KQPA 3S2VA 2D5WA 3P7IA 4AS5A 3LR1A 3RPLA 1Y3QA 5FHOA 3MQ9A 3IJOB 2OBGA 1N04A 4OTEA 4GWOA 4ND9A 4U4XA 1EYIA 2THIA 1QGXA 3VVEA 2VT5A 4IO3A 2QRYA 4ELRA 3O6GA 1H76A 1G0IA 3PV0E 3SEXA 2F7CA 4G2ZA 4OFJA 2XXRA 2Y84A 3QYTA 3K01A 2GHAA 4JVDA 3IK6B 1OVBA 1SBPA 3EN3A 2QS4A 2AL4A 4OANA 5IZ1A 1ELJA 3VFJA 4FAJA 1NV7A 4OEUA 1B0HA 2O68A 4C1TA 3H6UA 1GV8A 1OLCA 2CMOA 3CSBA 3TTMA 3LUYA 3TYHA 3IOUA 2XXXA 2V84A 1PB8A 1EZ9A 2VD3A 4RY1A 5HPQA 1FSAA 5CI5A 3FJGA 2UVJA 3IR1A 2UYFA 1QW0A 3KSJA 4YMAA 5TP9B 2ZNSA 4GOTA 2QMWA 3ILTB 3FV2A 4X1DA 4F1VA 1YZ0A 3VVFA 4NQ8A 3GZGA 4QFNA 1FQCA 4DDDA 4P1LA 1YPNA 4ZEFA 4TOZA 1B6HA 3SESA 1NMUA 1SW2A 4I9DA 2RC9A 4ZEIA 2F6GA 4MHFA 1OVTA 5KZTA 1IUDA 1N84A 4MFIA 2WBDA 3OENA 3TODA 1LFHA 1NH7A 2ZYMA 2Q88A 4LA9A 4MLQA 3BKIB 4X1BA 3OSRA 3HHFA 1AL3A 4EF1A 5ET6A 1LBCA 5FTHA 2Y5LA 1VSOA 1FJ6A 2HEUA 3KC0A 4BDMA 1B3FA 5H8FB 4AS4A 5B7DA 2XXTA 3K6VA 3FJ7A 4F2OA 1A99A 4DZ1A 1ZBMA 3MVWA 4QFLA 4PBHA 4ZDMA 1FBPA 2QVVA 4EQBA 5AA2A 5ESYA 1Q35A 3OEMA 3OEKA 4PBQA 1AWBA 4IO6A 4QFKA 4LATA 5DEXA 1B3HA 1IEJA 2ZYOA 4PE5B 2XWKA 2O84X 5I56B 1LBVA 3MVXA 2Y5KA 3RNNA 4Z0IA 4QSDA 3V89B 1MQIA 1D4NA 2OK2A 4KHZE 3H6TA 2DXYA 1B5HA 2ZZXA 4X9TA 4R9FA 1QUJA 4JWOA 3Q29A 1JVXA 4YZZA 1B7HA 4LQ5A 3FVKA 1XHYA 1URSA 3T9VA 1Y9UA 1FPFA 3HV1A 4RYAA 2QJEA 3K2DA 4HS7A 1LFGA 2XXQA 3M3KA 1OQHA 1LBZA 2DE3A 2ESNA 4QHQA 2Q8JA 4LZ8A 3PUZE 3C36A 1MM7A 4PFBA 1PDAA 3PU5A 3RTFB 2OWTA 2I4CA 1IZ1A 4OA4A 1FCKA 1UTHA 2QFLA 4NG7A 4RNSA 1FPEA 1DMBA 4E0WA 4PFRA 4KCDA 3TMGA 3OELA 5I5PA 1AIVA 2DVZA 2AL5A 5FHNA 1FBDA 2B3BA 1UTBA 2XXPA 3MJNA 2O1MA 4NF0A 3HHGA 4OQOA 3W9VA 4G8MA 2AYSA 3UORA 3LUZA 1AOVA 5H8QB 5AA1A 2PX1A 2UVIA 1NV5A 2Q8MA 4GVOA 4ELQA 4R2BA 2JJKA 4XXUA 3VV5A 3SETA 1FQFA 1FQBA 3KN7A 2ONKE 4FECA 1JQFA 3MW0A 4EQ9A 2KR0A 5F24A 4MBPA 2O7UA 4NN3A 3U93A 4NF4B 1POY1 5IM2A 4DI4B 1JVYA 1N3XA 1D9QA 3MPKA 3RT8A 1XT8A 3SDFA 1FPKA 2F97A 2QL3A 4F29A 2Y7IA 1QUKA 3O66A 1PBQA 3H6VA 4OVPA 3S9LC 3CG3A 4NF6A 1LFIA 2F34A 1FTMA 3EHUA 4C1UA 2VD2A 2GHBA 4MNIA 3FVNA 1F9BA 2B4LA 4IY5A 4GXAA 3S9MC 5KCJB 3A09A 4YB7A 4GWZA 3FVGA 3K1PA 1Z7NE 2B65A 1NFTA 3PPRA 1KWHA 4FJPA 3OXNA 3V8XB 4MNCA 4QBAA 3MP1A 4ESWA 2B3FA 1WDNA 2W7YA 2V25A 3SEWA 3VLWA 5H8SA 3UA8A 3PPNA 3M8UA 1ZLQA 3U1OA 2I49A 5J1DA 4NF5A 2WEFA 3RT6B 4IO5A 1LBWA 4PC9A 2QPQA 3FD3A 3ROJA 1P1NA 1MG1A 4IO2A 4ZZAA 1I6BA 4HE2A 3O6HA 5JTYB 5ITOA 5I2KA 3G7WA 4I40A 4KI0E 3IB2A 2F6PA 2ONRA 1JW5A 2Y7RA 4AB5A 3QK6A 1CB6A 4ZE9A 1I69A 3R6UA 5CC2A 1INPA 4OXVA 4OYVA 4PE3A 3USDA 2OZZA 2E0SA 4EXKA 1EZOA 4OHNA 3KOSA 5ET7A 1H45A 1NNKA 4OZ9A 4NF8A 1EH3A 3MVYA 3V5AA 3TEPA 3U94A 1SW1A 3S4UA 4XEQA 3TPAA 1BIYA 3E9XA 2I0BA 3ZS6A 2PYYA 3B6WA 4FORA 1JP4A 4EUOA 4OETA 1YYZA 4PF8A 4AQ4A 4H8JA 4P47A 2WYKA 2R8TA 1AH5A 2H99A 3KSXA 5DVJA 4H45A 5F1QA 4DCYA 4PF6A 4NHBA 2OWZA 5DW8A 2QVUA 5LOMA 3CR9A 3CFLA 3R26A 3H7MA 4ZEBA 4JXIA 2H25A 1NUZA 2UXAA 3FVOA 1RDZA 4BLAA 1B0LA 3O9PA 4R73A 3MPLA 3U65A 5I57A 4BDOA 5TU0A 5I7IA 3EHTA 3JV9A 2GFEA 1D9VA 4WEPA 4YB5A 4L17A 3TTLA 3MYUA 3O29A 1XVXA 4BDLA 2HFBA 1VFEA 4X8RA 1SYHA 4LZ7A 3N94A 2Z8EA 4MAGA 5DT6A 1FBFA 3LC8A 4RK2A 5CBSA 1TXFA 2CZIA 1BK4A 4PDDA 2IA4A 1B5IA 2ALUA 2OCUA 1MY2A 1Y1ZA 4IGRA 4P3LA 3FIRA 1FQAA 3U92A 1FBEA 4F39A 1MPDA 4Z7EA 3VE1B 2I48A 4GQOA 3I3VA 4Q8RA 4N17A 4FATA 2PFZA 1XS5A 3S9NC 3K1NA 4IO7A 5I59A 2OLBA 3IOWA 1EZPA 2DP8A 3FXBA 3MWBA 1MPCA 4JVIA 3PMWA 3MBPA 4ZS9A 3OO7A 5CMCA 2NVUB 4KR5A 3H3GA 1R1NA 5A5XA 4RPNA 1MPBA 1B2HA 2DSFA 3TQLA 4QFOA 1PB7A 3KN8A 2RINA 3H03A 4JVCA 2ZNTA 1R6ZA 1NUXA 1DTZA 3E79A 4NTLA 2A5TB 5FHMA 4GIZA 3IOVA 4OVSA 3G3GA 3KG2A 3H06B 1H43A 5H8HB 2V3TA 4KCCA 2V3UA 4ONYA 1MQHA 3FXQA 4XKQA 2XWVA 3VDFA 4GX4A 3A29A 2XXYA 5EYHA 1SVXB 4LP2B 4GF8A 5DYHA 4IGTA 3OOAA 1IQ7A 3IB0A 3M3LA 3IB1A 4N81A 2I0CA 2Q89A 4EQ7A 1GVCA 4OENA 4MH5A 2I58A 1JETA 2YJPA 2RKMA 3D4CA 3C31A 2NOOA 5CMBA 3K00A 4I3EA 1Z7ME 1Y3PA 1XC1A 3MP6A 4GL8A 4MLVA 5ICTA 5IGAA 4I3YA 1N3WA 3TUSA 1FPIA 5J16A 1MH4A 3RYDA 5TP9A 1US5A 3A3CA 2F36A 4KFQA 3HSTA 3ZKKA 3S9EA 4O7MA 1FPDA 4XKNA
chains in the Genus database with same CATH topology
1B3LA 2WKYA 4NEDA 1B1XA 1QULA 4ZEDA 1IIWA 4KD5A 4P11A 3K02A 1BLFA 2ZXTA 3L6HA 4R75A 4ELPA 3TZAA 1PBPA 3V83A 4YAHX 1XOCA 4ELOA 2XXIA 1J1NA 1USYE 1POTA 2QS3A 2O6AA 1P99A 3PMXA 3UIFA 1VR5A 3OD7A 1DOTA 2FA7A 1MY4A 3CG1A 4R6HA 1A54A 1MXUA 4YKIA 1IXCA 1TFAA 1WODA 3B6TA 5HBCA 2RC8A 4PFTA 5F7VA 2R71A 4DCXA 3KBRA 3PUXE 2CZLA 5H8FA 2ZMBA 3K6UA 3T66A 4FIMA 4OFOA 2GH9A 3SEYA 4X48A 2Y7WA 1N7XA 4NWDA 1HSEA 1N76A 1Y4TA 3DELB 3EHSA 2ZYKA 2I6EA 2DWAA 2XHDA 2QMXA 4QRZA 3VXCA 1II5A 5TPAB 4QF9A 1MRPA 2PVUA 3KGCA 4R6YA 5I56A 3TELA 3T9XB 4M1VA 4N13A 2Z8DA 3G3FA 4DE8A 2ANJA 1IXHA 4O3AA 4M4GA 3CI8A 5AA4B 1QUIA 3EPEA 3BFTA 3K6WA 3ECRA 5ISUA 3Q25A 1JEUA 4XTCQ 1FQDA 1MXYA 1B58A 2P2AA 3SKPA 1EU8A 4H67A 2DE2A 2H98A 4U22A 2O7IA 3L6GA 3CVGA 2RCBA 3LSLA 1MM6A 1PC3A 4I1DA 4K3FA 1AMFA 3CFZA 4GRKA 1I6QA 3QUJA 4IB2A 4HW8A 2F78A 1M5BA 1B4ZA 1YCJA 2P0SA 1URDA 1BTJA 4HCYA 2FYIA 3FZVA 3PPPA 4R6KA 3K4UA 1GTKA 4O3CA 4R2FA 3HPIA 1IXGA 4WXJA 2BJJX 3TDJA 2Z22A 3GBBA 4LQ2A 1SDXA 3MP8A 4H6DA 3QXMA 4POWA 5H8QA 2DOJA 1A40A 1M5EA 4H1XA 1GR2A 2A5SA 3ODBA 3QSLA 2VGQA 1SW4A 3E4RA 1O63A 2V3QA 1NH8A 3Q26A 4NF4A 1ZMGA 4OESA 4RA1A 3ZSFA 1NNTA 1MXVA 1MY0A 2XD2A 1MQDA 3GBAA 3K1MA 4DIGA 1TFDA 4GFRA 4ISUA 3IAZA 3C33A 1CE2A 2HZLA 4H8IA 2HQ0A 3B6QA 2R9JA 1TWYA 3QAXA 4U1ZA 2HAUA 3PD8A 4F3SA 5ITPA 1MXXA 5KCJA 5H8NB 4G68B 1B32A 3O28A 3UK4A 2D3IA 1S9TA 1SW5A 1B7UA 1M5FA 2UVGA 4YB6A 3OO6A 2F5XA 1YAEA 4TQUQ 3KFMA 3W9WA 1LGBC 5IAIA 2NWJA 3RGYA 1Y3NA 2O69A 5FTIA 4DXUA 4R72A 2DWIA 4YKKA 1P1WA 2Y7PA 1Q1KA 4Q30B 2F8DA 3EF7A 3DP6A 1B52A 1ZKBA 5JTYA 3PPOA 3TTNA 3G3HA 3R7XA 3TFLA 3F11A 1D3KA 4THIA 3IO4A 3ONMA 1RYXA 2NXOA 4UA8A 4E0XA 4PQJA 3N5LA 4F3GA 4PP0A 3MZ9A 1MH3A 3E3KA 4H5FA 3PD9A 5I58B 4QSCA 5CMMA 2QS2A 4AB6A 4LZ5A 2P1SA 1DPPA 4OWDA 2PBWA 2Y7KA 3THIA 2PMSA 4G68C 5K2YA 5AA2D 5AE4A 1PB9A 2NUVA 3G3KA 3G3IA 3FXRA 2UYEA 5AA3A 1ANFA 1T0KA 4U4SA 5I2NB 2DWJA 3A3UA 3SEUA 1B3EA 5L9MA 2XX7A 4OEVA 4TLLB 5L8DA 4G4PA 1P1UA 5EHSA 2HXWA 1B9JA 4G77A 2Q9TA 1SQYA 1FTKA 3KZGA 3C34A 1UIUA 1ZU0A 1I6AA 3LSWA 5I84A 1FW0A 3TTKA 4F1YA 2XXVA 3TTRA 4TLMB 4IO4A 1BP5A 3FJMA 3T9HB 5KDTB 1NKXA 3PUWE 4I62A 1OQGA 1A55A 2VP1A 1HSJA 5IKBA 5CM6A 3VLVA 1R9LA 2G93A 3BBRA 3OMBA 4JB7A 2H5YA 3JYRA 2H9BA 1Y1MA 4KPTA 1FTOA 1IXIA 3I6VA 4OVJA 3RQTA 2ZYNA 1UQWA 4YKJA 2REJA 4GLIA 2A5TA 2XX9A 3HCQA 3U8QA 4RK9A 4RPOA 5H8HA 1ZTYA 5JK4A 4U23A 4YMBA 4OFLA 1RKMA 4I8CA 2Z8FA 3ILUB 1MDQA 3O6IA 4EXLA 4KYSA 4WEDA 4BDRA 1B7ZA 4N07A 4G8NA 2R6GE 1S50A 3KJTA 3MZBA 1LB9A 1M5DA 3KOTA 1RYOA 2V93A 3UP9A 5BWJA 3PUYE 1BKAA 3AXFA 1OIBA 3T9UA 2UVHA 4R74A 3T93B 1P1OA 4F18A 3LSXA 1QKAA 3LBSA 4XIGQ 3N6UA 4BDQA 1JNFA 3TCFA 1ZIUA 2HZKA 3CSGA 2I3WA 3H4ZA 1US4A 1B51A 1MY1A 2XXWA 1M5CA 1FTJA 2X7PA 3C4MA 1SI0A 1FTLA 4F19A 2ONSA 4LUBA 4F1UA 1NL5A 1A8FA 1B3GA 3T22A 2Z23A 1JW4A 4KYEA 2HCAA 3TKDA 5AA2B 4ZEKA 4ZE8A 2XD3A 1LAHE 1OLAA 1XVYA 4U21A 1MY3A 3U72A 3SERA 2H4IA 3HN0A 2XXHA 5DEXB 2M8CA 1DPEA 1DTGA 2X7QA 1YTVA 1A8EA 1SD3A 4GL0A 1Y4CA 5DTBA 1SI1A 1N0TA 1ZJLA 5EHMA 4FEDA 3Q28A 2DQVA 4PETA 2D21A 2RCAA 3C32A 3FASA 1LAXA 3FATA 2REGA 1D9YA 2HAVA 4NMYA 3G3JA 1R9QA 1URGA 4F3BA 5TPAA 3OO8A 3CFXA 5HM4B 3JZJA 3MUQA 4ECFA 3TCGA 3BFUA 3GXAA 5L9OA 1MQJA 3IORA 4EDPA 2XXUA 4H5GA 5AA4A 1UTHB 4ZZEA 2ZNUA 1H44A 4H0WA 4UACA 3E13X 2F7AA 4F3PA 2G29A 2Q2CA 1UTBB 3TQWA 1QVSA 4RXLA 2OWSA 3RUMA 4U1OA 3PMVA 2FNCA 2LAOA 3WAEA 3LSFB 4GD5A 1LB8A 5CRYA 4PFWA 5DVFA 4EF2A 1N7WA 4YICA 1QJMA 4OERA 5L9SA 1LCTA 2F7BA 5K2XA 2Q2AA 2PT2A 1B5JA 1TT1A 3PPQA 3MC2A 3OO9A 1MQGA 4JWYA 3UGWA 1OMPA 2IEEA 1P1QA 3DLNA 4QSEA 1H3DA 1PEBA 3RLFE 2XX8A 4FE8A 1DSNA 3RPWA 1LCFA 4GXSB 4NF6B 1LAGE 3K6XA 3VLUA 4ESXA 4JWXA 3FGSA 5BUUA 5ICQA 2I4BA 5DVIA 3FXUA 2I3VA 4F2QA 1B4HA 3O97A 5JEIA 1O7TA 1B40A 4HTGA 3B7DA 4XKPA 2RF1A 2VHAA 1IITA 4G8HA 4DXBA 1LSTA 4POXA 3W15C 1A7LA 1QKBA 4Q5TA 2PT1A 1SYIA 4P0IA 4RJZA 3MVZA 3IO6A 2YPNA 2QSXA 4NF5B 4JSOA 5H8NA 4G68A 4F31B 1B05A 4PFUA 3I5OA 2GRVA 5I2KB 3DP4A 2F35A 4H65A 5B70A 3MAMA 1MDP1 3TCHA 3IOTA 3TAJA 3O2AA 3RTWB 3VXBA 3CIJA 3ZKLA 3H6WA 5CMKA 1NNFA 1O64A 4NF8B 1MS7A 3FV1A 4IY6A 1ATGA 2O1LA 3OSQA 2O51A 1UIVA 4JSDA 4N6PA 1LBBA 3IL1B 4ZECA 4YU0A 3DP8A 3HO7A 1S7YA 4LVQA 1MXWA 2VOZA 2DWHA 2E1SA 1L5TA 1MXZA 5ELVA 1JW1A 4F22A 1JEVA 3C9HA 5I58A 4FEBA 4JBZA 2YLNA 3GLBA 4C0RA 4NWCA 3KN3A 2KLFA 3RY3A 5I57B 4LONB 2DE4A 3MZ1A 3N26A 4WKMA 3CRBA 3T96B 4NE4A 3IX1A 3RN8A 4P0GA 3K0VA 1USYH 2ABHA 2DVCA 1B46A 3QUFA 1WVJA 3KEIA 4R9GA 2DS9A 5I2NA 4O3BA 4MF3A 4JDFA 2AIXA 3EQ1A 4U2RA 3PGFA 1GGGA 1VE4A 4BDNA 2X26A 3DM0A 3VVDA 3N6TA 4YKPA 1FQEA 1LLSA 3Q27A 3FUZA 5I59B 2DXRA 4PFYA 3QIMA 3D4GA 5CBRA 4KYDA 4XKRA 3SEVA 3IJXB 1NNPA 5A5XB 4HCWA 4QFPA 1VFDA 3M3FA 4Q0CA 2RC7A 5EYFA 3WAFA 4OMBA 1LAFE 3UN6A 4DLDA 5M2VA 2DYXA 2QS1A 2OJTA 5KDTA 1B1HA 1Y20A 3PUVE 3KJ7A 1HSLA 3C35A 4DXCA 4KQPA 3S2VA 2D5WA 3P7IA 3LR1A 1Y3QA 5FHOA 3MQ9A 3IJOB 2OBGA 1N04A 4OTEA 4GWOA 4ND9A 4U4XA 2THIA 3VVEA 4IO3A 2QRYA 4ELRA 3O6GA 1H76A 3PV0E 3SEXA 2F7CA 4G2ZA 4OFJA 2XXRA 2Y84A 3QYTA 3K01A 2GHAA 3IK6B 1OVBA 1SBPA 3EN3A 2QS4A 2AL4A 1ELJA 3VFJA 4FAJA 4OEUA 4C1TA 1B0HA 2O68A 3H6UA 1GV8A 1OLCA 2CMOA 3CSBA 3TTMA 3LUYA 3TYHA 3IOUA 2XXXA 2V84A 1PB8A 1EZ9A 2VD3A 4RY1A 5HPQA 5CI5A 3FJGA 2UVJA 3IR1A 2UYFA 1QW0A 3KSJA 4YMAA 5TP9B 2ZNSA 4GOTA 2QMWA 3ILTB 3FV2A 4X1DA 4F1VA 3VVFA 3GZGA 4QFNA 1FQCA 4DDDA 1YPNA 4ZEFA 4TOZA 1B6HA 3SESA 1NMUA 1SW2A 4I9DA 2RC9A 4ZEIA 2F6GA 1OVTA 5KZTA 1IUDA 1N84A 4MFIA 3OENA 3TODA 1LFHA 1NH7A 2ZYMA 2Q88A 4LA9A 4MLQA 3BKIB 4X1BA 3OSRA 3HHFA 1AL3A 4EF1A 1LBCA 5FTHA 1VSOA 2HEUA 4BDMA 1B3FA 5H8FB 5B7DA 2XXTA 3K6VA 3FJ7A 4F2OA 1A99A 4DZ1A 1ZBMA 3MVWA 4QFLA 4ZDMA 4EQBA 5AA2A 1Q35A 3OEMA 3OEKA 4IO6A 4QFKA 4LATA 5DEXA 1B3HA 1IEJA 2ZYOA 4PE5B 2O84X 5I56B 3MVXA 3RNNA 4Z0IA 4QSDA 3V89B 1MQIA 1D4NA 2OK2A 4KHZE 3H6TA 2DXYA 1B5HA 4X9TA 4R9FA 1QUJA 4JWOA 3Q29A 1JVXA 4YZZA 1B7HA 4LQ5A 3FVKA 1XHYA 1URSA 3T9VA 1Y9UA 3HV1A 4RYAA 2QJEA 3K2DA 4HS7A 1LFGA 2XXQA 3M3KA 1OQHA 2DE3A 2ESNA 4QHQA 2Q8JA 4LZ8A 3PUZE 3C36A 1MM7A 1PDAA 3PU5A 3RTFB 2OWTA 2I4CA 1IZ1A 1FCKA 1UTHA 4RNSA 4E0WA 1DMBA 4KCDA 3TMGA 3OELA 1AIVA 2DVZA 2AL5A 5FHNA 2B3BA 1UTBA 2XXPA 3MJNA 2O1MA 3HHGA 4OQOA 3W9VA 4G8MA 2AYSA 3UORA 1AOVA 5H8QB 5AA1A 2PX1A 2UVIA 4GVOA 4ELQA 4R2BA 4XXUA 3VV5A 3SETA 1FQFA 1FQBA 3KN7A 2ONKE 4FECA 1JQFA 3MW0A 4EQ9A 4MBPA 2O7UA 3U93A 4NF4B 1POY1 1JVYA 1N3XA 3MPKA 3RT8A 1XT8A 3SDFA 2F97A 2QL3A 4F29A 2Y7IA 1QUKA 3O66A 1PBQA 3H6VA 3S9LC 3CG3A 4NF6A 1LFIA 2F34A 1FTMA 3EHUA 4C1UA 2VD2A 2GHBA 3FVNA 1F9BA 4IY5A 4GXAA 3S9MC 5KCJB 3A09A 4YB7A 3FVGA 3K1PA 1Z7NE 2B65A 1NFTA 3PPRA 1KWHA 4FJPA 3OXNA 3V8XB 3MP1A 4ESWA 2B3FA 1WDNA 2W7YA 2V25A 3SEWA 3VLWA 5H8SA 3UA8A 3PPNA 3M8UA 1ZLQA 3U1OA 2I49A 5J1DA 4NF5A 3RT6B 4IO5A 2QPQA 3FD3A 1P1NA 1MG1A 4IO2A 4ZZAA 1I6BA 3O6HA 5JTYB 5ITOA 5I2KA 3G7WA 4KI0E 3IB2A 2F6PA 2ONRA 1JW5A 2Y7RA 4AB5A 3QK6A 1CB6A 4ZE9A 1I69A 3R6UA 5CC2A 4OXVA 4OYVA 3USDA 2OZZA 2E0SA 4EXKA 1EZOA 4OHNA 3KOSA 1H45A 1NNKA 4OZ9A 4NF8A 1EH3A 3MVYA 3V5AA 3TEPA 3U94A 1SW1A 3S4UA 3TPAA 1BIYA 3E9XA 2I0BA 3ZS6A 2PYYA 3B6WA 4FORA 4EUOA 4OETA 4AQ4A 4H8JA 1AH5A 2H99A 3KSXA 5DVJA 4DCYA 5F1QA 5LOMA 3CR9A 3CFLA 3R26A 3H7MA 4ZEBA 4JXIA 2H25A 2UXAA 3FVOA 4BLAA 1B0LA 3O9PA 4R73A 3MPLA 5I57A 4BDOA 5TU0A 3EHTA 3JV9A 2GFEA 1D9VA 4WEPA 4YB5A 4L17A 3TTLA 3O29A 1XVXA 4BDLA 2HFBA 1VFEA 1SYHA 4LZ7A 3N94A 2Z8EA 5DT6A 3LC8A 4RK2A 5CBSA 1TXFA 2IA4A 1B5IA 2ALUA 2OCUA 1MY2A 1Y1ZA 4IGRA 3FIRA 1FQAA 3U92A 4F39A 1MPDA 4Z7EA 3VE1B 2I48A 4GQOA 3I3VA 4Q8RA 4FATA 1XS5A 3S9NC 3K1NA 4IO7A 5I59A 2OLBA 3IOWA 1EZPA 2DP8A 3MWBA 1MPCA 3PMWA 3MBPA 4ZS9A 3OO7A 5CMCA 2NVUB 4KR5A 3H3GA 1R1NA 5A5XA 4RPNA 1MPBA 1B2HA 2DSFA 3TQLA 4QFOA 1PB7A 3KN8A 2RINA 3H03A 2ZNTA 1R6ZA 1DTZA 4NTLA 2A5TB 5FHMA 4GIZA 3IOVA 3G3GA 3KG2A 3H06B 1H43A 5H8HB 2V3TA 4KCCA 2V3UA 4ONYA 1MQHA 3FXQA 4XKQA 3VDFA 2XXYA 1SVXB 4LP2B 4GF8A 5DYHA 4IGTA 3OOAA 1IQ7A 3IB0A 3M3LA 3IB1A 2I0CA 2Q89A 4EQ7A 1GVCA 4OENA 4MH5A 2I58A 1JETA 2YJPA 2RKMA 3D4CA 3C31A 2NOOA 5CMBA 3K00A 1Z7ME 1Y3PA 1XC1A 3MP6A 4GL8A 4MLVA 5ICTA 3TUSA 1N3WA 1MH4A 5TP9A 1US5A 3A3CA 2F36A 4KFQA 3HSTA 3ZKKA 3S9EA 4XKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3L A;  2WKY A;  4NED A;  1B1X A;  1QUL A;  4ZED A;  1IIW A;  4KD5 A;  4P11 A;  3K02 A;  1BLF A;  2ZXT A;  3L6H A;  4R75 A;  4ELP A;  3TZA A;  1PBP A;  3V83 A;  4YAH X;  1XOC A;  4ELO A;  2XXI A;  1J1N A;  1USY E;  1POT A;  2QS3 A;  2O6A A;  1P99 A;  3PMX A;  3UIF A;  1VR5 A;  3OD7 A;  1DOT A;  2FA7 A;  1MY4 A;  3CG1 A;  4R6H A;  1A54 A;  1MXU A;  4YKI A;  1IXC A;  1TFA A;  1WOD A;  3B6T A;  5HBC A;  2RC8 A;  4PFT A;  5F7V A;  2R71 A;  4DCX A;  3KBR A;  3PUX E;  2CZL A;  5H8F A;  2ZMB A;  3K6U A;  3T66 A;  4FIM A;  4OFO A;  2GH9 A;  3SEY A;  4X48 A;  2Y7W A;  1N7X A;  4NWD A;  1HSE A;  1N76 A;  1Y4T A;  3DEL B;  3EHS A;  2ZYK A;  2I6E A;  2DWA A;  2XHD A;  2QMX A;  4QRZ A;  3VXC A;  1II5 A;  5TPA B;  4QF9 A;  1MRP A;  2PVU A;  3KGC A;  4R6Y A;  5I56 A;  3TEL A;  3T9X B;  4M1V A;  4N13 A;  2Z8D A;  3G3F A;  4DE8 A;  2ANJ A;  1IXH A;  4O3A A;  4M4G A;  3CI8 A;  5AA4 B;  1QUI A;  3EPE A;  3BFT A;  3K6W A;  3ECR A;  5ISU A;  3Q25 A;  1JEU A;  4XTC Q;  1FQD A;  1MXY A;  1B58 A;  2P2A A;  3SKP A;  1EU8 A;  4H67 A;  2DE2 A;  2H98 A;  4U22 A;  2O7I A;  3L6G A;  3CVG A;  2RCB A;  3LSL A;  1MM6 A;  1PC3 A;  4I1D A;  4K3F A;  1AMF A;  3CFZ A;  4GRK A;  1I6Q A;  3QUJ A;  4IB2 A;  4HW8 A;  2F78 A;  1M5B A;  1B4Z A;  1YCJ A;  2P0S A;  1URD A;  1BTJ A;  4HCY A;  2FYI A;  3FZV A;  3PPP A;  4R6K A;  3K4U A;  1GTK A;  4O3C A;  4R2F A;  3HPI A;  1IXG A;  4WXJ A;  2BJJ X;  3TDJ A;  2Z22 A;  3GBB A;  4LQ2 A;  1SDX A;  3MP8 A;  4H6D A;  3QXM A;  4POW A;  5H8Q A;  2DOJ A;  1A40 A;  1M5E A;  4H1X A;  1GR2 A;  2A5S A;  3ODB A;  3QSL A;  2VGQ A;  1SW4 A;  3E4R A;  1O63 A;  2V3Q A;  1NH8 A;  3Q26 A;  4NF4 A;  1ZMG A;  4OES A;  4RA1 A;  3ZSF A;  1NNT A;  1MXV A;  1MY0 A;  2XD2 A;  1MQD A;  3GBA A;  3K1M A;  4DIG A;  1TFD A;  4GFR A;  4ISU A;  3IAZ A;  3C33 A;  1CE2 A;  2HZL A;  4H8I A;  2HQ0 A;  3B6Q A;  2R9J A;  1TWY A;  3QAX A;  4U1Z A;  2HAU A;  3PD8 A;  4F3S A;  5ITP A;  1MXX A;  5KCJ A;  5H8N B;  4G68 B;  1B32 A;  3O28 A;  3UK4 A;  2D3I A;  1S9T A;  1SW5 A;  1B7U A;  1M5F A;  2UVG A;  4YB6 A;  3OO6 A;  2F5X A;  1YAE A;  4TQU Q;  3KFM A;  3W9W A;  1LGB C;  5IAI A;  2NWJ A;  3RGY A;  1Y3N A;  2O69 A;  5FTI A;  4DXU A;  4R72 A;  2DWI A;  4YKK A;  1P1W A;  2Y7P A;  1Q1K A;  4Q30 B;  2F8D A;  3EF7 A;  3DP6 A;  1B52 A;  1ZKB A;  5JTY A;  3PPO A;  3TTN A;  3G3H A;  3R7X A;  3TFL A;  3F11 A;  1D3K A;  4THI A;  3IO4 A;  3ONM A;  1RYX A;  2NXO A;  4UA8 A;  4E0X A;  4PQJ A;  3N5L A;  4F3G A;  4PP0 A;  3MZ9 A;  1MH3 A;  3E3K A;  4H5F A;  3PD9 A;  5I58 B;  4QSC A;  5CMM A;  2QS2 A;  4AB6 A;  4LZ5 A;  2P1S A;  1DPP A;  4OWD A;  2PBW A;  2Y7K A;  3THI A;  2PMS A;  4G68 C;  5K2Y A;  5AA2 D;  5AE4 A;  1PB9 A;  2NUV A;  3G3K A;  3G3I A;  3FXR A;  2UYE A;  5AA3 A;  1ANF A;  1T0K A;  4U4S A;  5I2N B;  2DWJ A;  3A3U A;  3SEU A;  1B3E A;  5L9M A;  2XX7 A;  4OEV A;  4TLL B;  5L8D A;  4G4P A;  1P1U A;  5EHS A;  2HXW A;  1B9J A;  4G77 A;  2Q9T A;  1SQY A;  1FTK A;  3KZG A;  3C34 A;  1UIU A;  1ZU0 A;  1I6A A;  3LSW A;  5I84 A;  1FW0 A;  3TTK A;  4F1Y A;  2XXV A;  3TTR A;  4TLM B;  4IO4 A;  1BP5 A;  3FJM A;  3T9H B;  5KDT B;  1NKX A;  3PUW E;  4I62 A;  1OQG A;  1A55 A;  2VP1 A;  1HSJ A;  5IKB A;  5CM6 A;  3VLV A;  1R9L A;  2G93 A;  3BBR A;  3OMB A;  4JB7 A;  2H5Y A;  3JYR A;  2H9B A;  1Y1M A;  4KPT A;  1FTO A;  1IXI A;  3I6V A;  4OVJ A;  3RQT A;  2ZYN A;  1UQW A;  4YKJ A;  2REJ A;  4GLI A;  2A5T A;  2XX9 A;  3HCQ A;  3U8Q A;  4RK9 A;  4RPO A;  5H8H A;  1ZTY A;  5JK4 A;  4U23 A;  4YMB A;  4OFL A;  1RKM A;  4I8C A;  2Z8F A;  3ILU B;  1MDQ A;  3O6I A;  4EXL A;  4KYS A;  4WED A;  4BDR A;  1B7Z A;  4N07 A;  4G8N A;  2R6G E;  1S50 A;  3KJT A;  3MZB A;  1LB9 A;  1M5D A;  3KOT A;  1RYO A;  2V93 A;  3UP9 A;  5BWJ A;  3PUY E;  1BKA A;  3AXF A;  1OIB A;  3T9U A;  2UVH A;  4R74 A;  3T93 B;  1P1O A;  4F18 A;  3LSX A;  1QKA A;  3LBS A;  4XIG Q;  3N6U A;  4BDQ A;  1JNF A;  3TCF A;  1ZIU A;  2HZK A;  3CSG A;  2I3W A;  3H4Z A;  1US4 A;  1B51 A;  1MY1 A;  2XXW A;  1M5C A;  1FTJ A;  2X7P A;  3C4M A;  1SI0 A;  1FTL A;  4F19 A;  2ONS A;  4LUB A;  4F1U A;  1NL5 A;  1A8F A;  1B3G A;  3T22 A;  2Z23 A;  1JW4 A;  4KYE A;  2HCA A;  3TKD A;  5AA2 B;  4ZEK A;  4ZE8 A;  2XD3 A;  1LAH E;  1OLA A;  1XVY A;  4U21 A;  1MY3 A;  3U72 A;  3SER A;  2H4I A;  3HN0 A;  2XXH A;  5DEX B;  2M8C A;  1DPE A;  1DTG A;  2X7Q A;  1YTV A;  1A8E A;  1SD3 A;  4GL0 A;  1Y4C A;  5DTB A;  1SI1 A;  1N0T A;  1ZJL A;  5EHM A;  4FED A;  3Q28 A;  2DQV A;  4PET A;  2D21 A;  2RCA A;  3C32 A;  3FAS A;  1LAX A;  3FAT A;  2REG A;  1D9Y A;  2HAV A;  4NMY A;  3G3J A;  1R9Q A;  1URG A;  4F3B A;  5TPA A;  3OO8 A;  3CFX A;  5HM4 B;  3JZJ A;  3MUQ A;  4ECF A;  3TCG A;  3BFU A;  3GXA A;  5L9O A;  1MQJ A;  3IOR A;  4EDP A;  2XXU A;  4H5G A;  5AA4 A;  1UTH B;  4ZZE A;  2ZNU A;  1H44 A;  4H0W A;  4UAC A;  3E13 X;  2F7A A;  4F3P A;  2G29 A;  2Q2C A;  1UTB B;  3TQW A;  1QVS A;  4RXL A;  2OWS A;  3RUM A;  4U1O A;  3PMV A;  2FNC A;  2LAO A;  3WAE A;  3LSF B;  4GD5 A;  1LB8 A;  5CRY A;  4PFW A;  5DVF A;  4EF2 A;  1N7W A;  4YIC A;  1QJM A;  4OER A;  5L9S A;  1LCT A;  2F7B A;  5K2X A;  2Q2A A;  2PT2 A;  1B5J A;  1TT1 A;  3PPQ A;  3MC2 A;  3OO9 A;  1MQG A;  4JWY A;  3UGW A;  1OMP A;  2IEE A;  1P1Q A;  3DLN A;  4QSE A;  1H3D A;  1PEB A;  3RLF E;  2XX8 A;  4FE8 A;  1DSN A;  3RPW A;  1LCF A;  4GXS B;  4NF6 B;  1LAG E;  3K6X A;  3VLU A;  4ESX A;  4JWX A;  3FGS A;  5BUU A;  5ICQ A;  2I4B A;  5DVI A;  3FXU A;  2I3V A;  4F2Q A;  1B4H A;  3O97 A;  5JEI A;  1O7T A;  1B40 A;  4HTG A;  3B7D A;  4XKP A;  2RF1 A;  2VHA A;  1IIT A;  4G8H A;  4DXB A;  1LST A;  4POX A;  3W15 C;  1A7L A;  1QKB A;  4Q5T A;  2PT1 A;  1SYI A;  4P0I A;  4RJZ A;  3MVZ A;  3IO6 A;  2YPN A;  2QSX A;  4NF5 B;  4JSO A;  5H8N A;  4G68 A;  4F31 B;  1B05 A;  4PFU A;  3I5O A;  2GRV A;  5I2K B;  3DP4 A;  2F35 A;  4H65 A;  5B70 A;  3MAM A;  1MDP 1;  3TCH A;  3IOT A;  3TAJ A;  3O2A A;  3RTW B;  3VXB A;  3CIJ A;  3ZKL A;  3H6W A;  5CMK A;  1NNF A;  1O64 A;  4NF8 B;  1MS7 A;  3FV1 A;  4IY6 A;  1ATG A;  2O1L A;  3OSQ A;  2O51 A;  1UIV A;  4JSD A;  4N6P A;  1LBB A;  3IL1 B;  4ZEC A;  4YU0 A;  3DP8 A;  3HO7 A;  1S7Y A;  4LVQ A;  1MXW A;  2VOZ A;  2DWH A;  2E1S A;  1L5T A;  1MXZ A;  5ELV A;  1JW1 A;  4F22 A;  1JEV A;  3C9H A;  5I58 A;  4FEB A;  4JBZ A;  2YLN A;  3GLB A;  4C0R A;  4NWC A;  3KN3 A;  2KLF A;  3RY3 A;  5I57 B;  4LON B;  2DE4 A;  3MZ1 A;  3N26 A;  4WKM A;  3CRB A;  3T96 B;  4NE4 A;  3IX1 A;  3RN8 A;  4P0G A;  3K0V A;  1USY H;  2ABH A;  2DVC A;  1B46 A;  3QUF A;  1WVJ A;  3KEI A;  4R9G A;  2DS9 A;  5I2N A;  4O3B A;  4MF3 A;  4JDF A;  2AIX A;  3EQ1 A;  4U2R A;  3PGF A;  1GGG A;  1VE4 A;  4BDN A;  2X26 A;  3DM0 A;  3VVD A;  3N6T A;  4YKP A;  1FQE A;  1LLS A;  3Q27 A;  3FUZ A;  5I59 B;  2DXR A;  4PFY A;  3QIM A;  3D4G A;  5CBR A;  4KYD A;  4XKR A;  3SEV A;  3IJX B;  1NNP A;  5A5X B;  4HCW A;  4QFP A;  1VFD A;  3M3F A;  4Q0C A;  2RC7 A;  5EYF A;  3WAF A;  4OMB A;  1LAF E;  3UN6 A;  4DLD A;  5M2V A;  2DYX A;  2QS1 A;  2OJT A;  5KDT A;  1B1H A;  1Y20 A;  3PUV E;  3KJ7 A;  1HSL A;  3C35 A;  4DXC A;  4KQP A;  3S2V A;  2D5W A;  3P7I A;  3LR1 A;  1Y3Q A;  5FHO A;  3MQ9 A;  3IJO B;  2OBG A;  1N04 A;  4OTE A;  4GWO A;  4ND9 A;  4U4X A;  2THI A;  3VVE A;  4IO3 A;  2QRY A;  4ELR A;  3O6G A;  1H76 A;  3PV0 E;  3SEX A;  2F7C A;  4G2Z A;  4OFJ A;  2XXR A;  2Y84 A;  3QYT A;  3K01 A;  2GHA A;  3IK6 B;  1OVB A;  1SBP A;  3EN3 A;  2QS4 A;  2AL4 A;  1ELJ A;  3VFJ A;  4FAJ A;  4OEU A;  4C1T A;  1B0H A;  2O68 A;  3H6U A;  1GV8 A;  1OLC A;  2CMO A;  3CSB A;  3TTM A;  3LUY A;  3TYH A;  3IOU A;  2XXX A;  2V84 A;  1PB8 A;  1EZ9 A;  2VD3 A;  4RY1 A;  5HPQ A;  5CI5 A;  3FJG A;  2UVJ A;  3IR1 A;  2UYF A;  1QW0 A;  3KSJ A;  4YMA A;  5TP9 B;  2ZNS A;  4GOT A;  2QMW A;  3ILT B;  3FV2 A;  4X1D A;  4F1V A;  3VVF A;  3GZG A;  4QFN A;  1FQC A;  4DDD A;  1YPN A;  4ZEF A;  4TOZ A;  1B6H A;  3SES A;  1NMU A;  1SW2 A;  4I9D A;  2RC9 A;  4ZEI A;  2F6G A;  1OVT A;  5KZT A;  1IUD A;  1N84 A;  4MFI A;  3OEN A;  3TOD A;  1LFH A;  1NH7 A;  2ZYM A;  2Q88 A;  4LA9 A;  4MLQ A;  3BKI B;  4X1B A;  3OSR A;  3HHF A;  1AL3 A;  4EF1 A;  1LBC A;  5FTH A;  1VSO A;  2HEU A;  4BDM A;  1B3F A;  5H8F B;  5B7D A;  2XXT A;  3K6V A;  3FJ7 A;  4F2O A;  1A99 A;  4DZ1 A;  1ZBM A;  3MVW A;  4QFL A;  4ZDM A;  4EQB A;  5AA2 A;  1Q35 A;  3OEM A;  3OEK A;  4IO6 A;  4QFK A;  4LAT A;  5DEX A;  1B3H A;  1IEJ A;  2ZYO A;  4PE5 B;  2O84 X;  5I56 B;  3MVX A;  3RNN A;  4Z0I A;  4QSD A;  3V89 B;  1MQI A;  1D4N A;  2OK2 A;  4KHZ E;  3H6T A;  2DXY A;  1B5H A;  4X9T A;  4R9F A;  1QUJ A;  4JWO A;  3Q29 A;  1JVX A;  4YZZ A;  1B7H A;  4LQ5 A;  3FVK A;  1XHY A;  1URS A;  3T9V A;  1Y9U A;  3HV1 A;  4RYA A;  2QJE A;  3K2D A;  4HS7 A;  1LFG A;  2XXQ A;  3M3K A;  1OQH A;  2DE3 A;  2ESN A;  4QHQ A;  2Q8J A;  4LZ8 A;  3PUZ E;  3C36 A;  1MM7 A;  1PDA A;  3PU5 A;  3RTF B;  2OWT A;  2I4C A;  1IZ1 A;  1FCK A;  1UTH A;  4RNS A;  4E0W A;  1DMB A;  4KCD A;  3TMG A;  3OEL A;  1AIV A;  2DVZ A;  2AL5 A;  5FHN A;  2B3B A;  1UTB A;  2XXP A;  3MJN A;  2O1M A;  3HHG A;  4OQO A;  3W9V A;  4G8M A;  2AYS A;  3UOR A;  1AOV A;  5H8Q B;  5AA1 A;  2PX1 A;  2UVI A;  4GVO A;  4ELQ A;  4R2B A;  4XXU A;  3VV5 A;  3SET A;  1FQF A;  1FQB A;  3KN7 A;  2ONK E;  4FEC A;  1JQF A;  3MW0 A;  4EQ9 A;  4MBP A;  2O7U A;  3U93 A;  4NF4 B;  1POY 1;  1JVY A;  1N3X A;  3MPK A;  3RT8 A;  1XT8 A;  3SDF A;  2F97 A;  2QL3 A;  4F29 A;  2Y7I A;  1QUK A;  3O66 A;  1PBQ A;  3H6V A;  3S9L C;  3CG3 A;  4NF6 A;  1LFI A;  2F34 A;  1FTM A;  3EHU A;  4C1U A;  2VD2 A;  2GHB A;  3FVN A;  1F9B A;  4IY5 A;  4GXA A;  3S9M C;  5KCJ B;  3A09 A;  4YB7 A;  3FVG A;  3K1P A;  1Z7N E;  2B65 A;  1NFT A;  3PPR A;  1KWH A;  4FJP A;  3OXN A;  3V8X B;  3MP1 A;  4ESW A;  2B3F A;  1WDN A;  2W7Y A;  2V25 A;  3SEW A;  3VLW A;  5H8S A;  3UA8 A;  3PPN A;  3M8U A;  1ZLQ A;  3U1O A;  2I49 A;  5J1D A;  4NF5 A;  3RT6 B;  4IO5 A;  2QPQ A;  3FD3 A;  1P1N A;  1MG1 A;  4IO2 A;  4ZZA A;  1I6B A;  3O6H A;  5JTY B;  5ITO A;  5I2K A;  3G7W A;  4KI0 E;  3IB2 A;  2F6P A;  2ONR A;  1JW5 A;  2Y7R A;  4AB5 A;  3QK6 A;  1CB6 A;  4ZE9 A;  1I69 A;  3R6U A;  5CC2 A;  4OXV A;  4OYV A;  3USD A;  2OZZ A;  2E0S A;  4EXK A;  1EZO A;  4OHN A;  3KOS A;  1H45 A;  1NNK A;  4OZ9 A;  4NF8 A;  1EH3 A;  3MVY A;  3V5A A;  3TEP A;  3U94 A;  1SW1 A;  3S4U A;  3TPA A;  1BIY A;  3E9X A;  2I0B A;  3ZS6 A;  2PYY A;  3B6W A;  4FOR A;  4EUO A;  4OET A;  4AQ4 A;  4H8J A;  1AH5 A;  2H99 A;  3KSX A;  5DVJ A;  4DCY A;  5F1Q A;  5LOM A;  3CR9 A;  3CFL A;  3R26 A;  3H7M A;  4ZEB A;  4JXI A;  2H25 A;  2UXA A;  3FVO A;  4BLA A;  1B0L A;  3O9P A;  4R73 A;  3MPL A;  5I57 A;  4BDO A;  5TU0 A;  3EHT A;  3JV9 A;  2GFE A;  1D9V A;  4WEP A;  4YB5 A;  4L17 A;  3TTL A;  3O29 A;  1XVX A;  4BDL A;  2HFB A;  1VFE A;  1SYH A;  4LZ7 A;  3N94 A;  2Z8E A;  5DT6 A;  3LC8 A;  4RK2 A;  5CBS A;  1TXF A;  2IA4 A;  1B5I A;  2ALU A;  2OCU A;  1MY2 A;  1Y1Z A;  4IGR A;  3FIR A;  1FQA A;  3U92 A;  4F39 A;  1MPD A;  4Z7E A;  3VE1 B;  2I48 A;  4GQO A;  3I3V A;  4Q8R A;  4FAT A;  1XS5 A;  3S9N C;  3K1N A;  4IO7 A;  5I59 A;  2OLB A;  3IOW A;  1EZP A;  2DP8 A;  3MWB A;  1MPC A;  3PMW A;  3MBP A;  4ZS9 A;  3OO7 A;  5CMC A;  2NVU B;  4KR5 A;  3H3G A;  1R1N A;  5A5X A;  4RPN A;  1MPB A;  1B2H A;  2DSF A;  3TQL A;  4QFO A;  1PB7 A;  3KN8 A;  2RIN A;  3H03 A;  2ZNT A;  1R6Z A;  1DTZ A;  4NTL A;  2A5T B;  5FHM A;  4GIZ A;  3IOV A;  3G3G A;  3KG2 A;  3H06 B;  1H43 A;  5H8H B;  2V3T A;  4KCC A;  2V3U A;  4ONY A;  1MQH A;  3FXQ A;  4XKQ A;  3VDF A;  2XXY A;  1SVX B;  4LP2 B;  4GF8 A;  5DYH A;  4IGT A;  3OOA A;  1IQ7 A;  3IB0 A;  3M3L A;  3IB1 A;  2I0C A;  2Q89 A;  4EQ7 A;  1GVC A;  4OEN A;  4MH5 A;  2I58 A;  1JET A;  2YJP A;  2RKM A;  3D4C A;  3C31 A;  2NOO A;  5CMB A;  3K00 A;  1Z7M E;  1Y3P A;  1XC1 A;  3MP6 A;  4GL8 A;  4MLV A;  5ICT A;  3TUS A;  1N3W A;  1MH4 A;  5TP9 A;  1US5 A;  3A3C A;  2F36 A;  4KFQ A;  3HST A;  3ZKK A;  3S9E A;  4XKN A; 
#chains in the Genus database with same CATH topology
 4HE0 A;  1B3L A;  2WKY A;  4NED A;  1B1X A;  1QUL A;  2BJI A;  4ZED A;  1IIW A;  4KD5 A;  4P11 A;  3K02 A;  1BLF A;  2ZXT A;  3L6H A;  4R75 A;  4ELP A;  3TZA A;  1PBP A;  3V83 A;  4YAH X;  1XOC A;  4ELO A;  2XXI A;  1J1N A;  1NV0 A;  1USY E;  4P8B A;  1POT A;  2QS3 A;  2O6A A;  5ET8 A;  1P99 A;  3PMX A;  3UIF A;  4PDH A;  1VR5 A;  3OD7 A;  5EQ7 A;  1LBX A;  2CEY A;  1DOT A;  1EYJ A;  2FA7 A;  1MY4 A;  3B50 A;  3CG1 A;  5IZ3 A;  4R6H A;  1A54 A;  1MXU A;  4YKI A;  1NV4 A;  1IXC A;  1TFA A;  1WOD A;  3B6T A;  5HBC A;  2RC8 A;  4PFT A;  5F7V A;  2R71 A;  4DCX A;  3KBR A;  2L5V A;  3PUX E;  2CZL A;  5H8F A;  2ZMB A;  3K6U A;  3T66 A;  4FIM A;  4OFO A;  2GH9 A;  3SEY A;  4X48 A;  2Y7W A;  3ISP A;  1N7X A;  4NWD A;  1HSE A;  1NV1 A;  1N76 A;  1Y4T A;  3DEL B;  3EHS A;  2ZYK A;  2I6E A;  5IZZ A;  2DWA A;  2XHD A;  2QMX A;  4QRZ A;  3VXC A;  4GWS A;  1II5 A;  5TPA B;  4QF9 A;  1MRP A;  2PVU A;  3KGC A;  3T1B A;  4R6Y A;  5I56 A;  3TEL A;  3T9X B;  2HPG A;  4M1V A;  4N13 A;  2Z8D A;  1FPJ A;  3G3F A;  3PTY A;  4DE8 A;  2ANJ A;  1IXH A;  4O3A A;  4M4G A;  3CI8 A;  5AA4 B;  1QUI A;  3EPE A;  3BFT A;  3K6W A;  3ECR A;  5ISU A;  3Q25 A;  1JEU A;  4XTC Q;  1FQD A;  1MXY A;  1B58 A;  2P2A A;  2HHM A;  3SKP A;  3LV0 A;  1EU8 A;  4H67 A;  2DE2 A;  2H98 A;  4U22 A;  2O7I A;  3L6G A;  4MEV A;  3CVG A;  4OVT A;  2RCB A;  3LSL A;  1MM6 A;  1NV2 A;  1PC3 A;  1FBH A;  4I1D A;  4K3F A;  2V4C A;  1AMF A;  3CFZ A;  4GRK A;  1I6Q A;  3QUJ A;  4IB2 A;  4HW8 A;  4UAB A;  2F78 A;  3QMF A;  1M5B A;  1B4Z A;  1YCJ A;  5LDZ A;  1NI9 A;  2P0S A;  2P3N A;  1URD A;  1BTJ A;  4HCY A;  2FYI A;  3FZV A;  3PPP A;  4R6K A;  3K4U A;  1GTK A;  1YXI A;  4O3C A;  4R2F A;  3HPI A;  1IXG A;  4WXJ A;  1FJ9 A;  2BJJ X;  1FBC A;  1KZ8 A;  3TDJ A;  2Z22 A;  3GBB A;  4LQ2 A;  2FBP A;  1K9Y A;  1SDX A;  3MP8 A;  4N6D A;  4H6D A;  3QXM A;  4MMP A;  4POW A;  2F3D A;  5H8Q A;  2DOJ A;  1A40 A;  1M5E A;  4DI3 D;  4H1X A;  1GR2 A;  2A5S A;  3ODB A;  4X04 A;  3QSL A;  2VGQ A;  1SW4 A;  2VPO A;  3E4R A;  1O63 A;  2V3Q A;  1NH8 A;  3Q26 A;  4NF4 A;  4O7I A;  1ZMG A;  4OES A;  4RA1 A;  3ZSF A;  1NNT A;  1MXV A;  1MY0 A;  3MST A;  2XD2 A;  1MQD A;  3GBA A;  3K1M A;  4PAF A;  4DIG A;  1TFD A;  4GFR A;  4ISU A;  4NGU A;  2ZZV A;  3IAZ A;  3C33 A;  4XFE A;  1CE2 A;  2HZL A;  3IFC A;  4H8I A;  2HQ0 A;  3B6Q A;  2R9J A;  1TWY A;  4IR8 A;  3QAX A;  4U1Z A;  2HAU A;  3PD8 A;  4F3S A;  5ITP A;  1MXX A;  5KCJ A;  5H8N B;  4G68 B;  1B32 A;  2PCR A;  3O28 A;  3HFU A;  3UK4 A;  2D3I A;  1DK4 A;  1S9T A;  1SW5 A;  1B7U A;  1M5F A;  2UVG A;  4YB6 A;  3OO6 A;  2F5X A;  1YAE A;  4TQU Q;  3KFM A;  3W9W A;  1LGB C;  5IAI A;  2NWJ A;  3RGY A;  1Y3N A;  2O69 A;  5FTI A;  4DXU A;  4R72 A;  2DWI A;  4YKK A;  1P1W A;  2Y7P A;  1Q1K A;  4Q30 B;  2F8D A;  3EF7 A;  3DP6 A;  1IMA A;  1B52 A;  1ZKB A;  5JTY A;  3PPO A;  3TTN A;  3KC1 A;  1IMB A;  3G3H A;  3R7X A;  3TFL A;  3F11 A;  1D3K A;  4THI A;  3IO4 A;  3ONM A;  1RYX A;  2NXO A;  4UA8 A;  1LEV A;  4E0X A;  4PQJ A;  3N5L A;  4F3G A;  4PP0 A;  3MZ9 A;  1MH3 A;  3E3K A;  4H5F A;  3PD9 A;  5I58 B;  4QSC A;  5CMM A;  2QS2 A;  1NV3 A;  4AB6 A;  2GQ1 A;  4LZ5 A;  2P1S A;  1DPP A;  4OWD A;  2PBW A;  2Y7K A;  3THI A;  1KA1 A;  2PMS A;  4GBV A;  4G68 C;  5K2Y A;  5AA2 D;  4H46 A;  4MCO A;  5A5L A;  5AE4 A;  2B4M A;  1PB9 A;  5EQA A;  2NUV A;  3G3K A;  3G3I A;  4N8Y A;  1FTA A;  3FXR A;  2UYE A;  5AA3 A;  1ANF A;  1T0K A;  4U4S A;  5I2N B;  2DWJ A;  3A3U A;  3SEU A;  1B3E A;  5L9M A;  2XX7 A;  4FBP A;  4OEV A;  3T0J A;  4TLL B;  5L8D A;  4G4P A;  1P1U A;  3SZP A;  4P9K A;  4N6K A;  5EHS A;  2HXW A;  1B9J A;  1FPG A;  4MJO A;  4G77 A;  2Q9T A;  1SQY A;  1FTK A;  3KZG A;  3C34 A;  1UIU A;  1ZU0 A;  1I6A A;  3LSW A;  5I84 A;  3GYY A;  1FRP A;  1FW0 A;  3TTK A;  4F1Y A;  2XXV A;  3TTR A;  4TLM B;  4IO4 A;  1BP5 A;  3FJM A;  3T9H B;  5KDT B;  1NKX A;  2KQZ A;  3PUW E;  4I62 A;  4PCD A;  1OQG A;  3E78 A;  1A55 A;  5I3S A;  2CZK A;  2VP1 A;  4GWX A;  3RPL B;  1HSJ A;  5IKB A;  5CM6 A;  2FIE A;  3VLV A;  1R9L A;  2G93 A;  3BBR A;  3OMB A;  4JB7 A;  2H5Y A;  3JYR A;  2H9B A;  1Y1M A;  4KPT A;  1FTO A;  4OVQ A;  4N91 A;  1IXI A;  3I6V A;  4OVJ A;  4GX3 A;  3RQT A;  2ZYN A;  1UQW A;  4YKJ A;  2REJ A;  4GLI A;  2A5T A;  1VDW A;  2XX9 A;  3HCQ A;  3U8Q A;  1Q9D A;  4RK9 A;  1FPL A;  4RPO A;  5H8H A;  1ZTY A;  4N4U A;  5JK4 A;  4U23 A;  4YMB A;  2XA5 A;  1CNQ A;  4OFL A;  1RKM A;  4I8C A;  2Z8F A;  4P1E A;  3ILU B;  1MDQ A;  3O6I A;  4EXL A;  4KYS A;  4WED A;  4BDR A;  1B7Z A;  4N07 A;  1NUW A;  4G8N A;  2R6G E;  1S50 A;  2MKZ A;  3KJT A;  1LBY A;  3MZB A;  1LB9 A;  1M5D A;  3KOT A;  4NX1 A;  1RYO A;  2V93 A;  3UP9 A;  5BWJ A;  3PUY E;  1BKA A;  3AXF A;  1OIB A;  3T9U A;  2UVH A;  4R74 A;  5T3J A;  3T93 B;  1P1O A;  4F18 A;  3LSX A;  1QKA A;  3LBS A;  4XIG Q;  1IME A;  3N6U A;  4BDQ A;  5EYG A;  1JNF A;  3TCF A;  1ZIU A;  2HZK A;  3CSG A;  2I3W A;  3H4Z A;  1US4 A;  1B51 A;  1MY1 A;  4O94 A;  3IFA A;  2XXW A;  1M5C A;  1FTJ A;  2X7P A;  3C4M A;  1SI0 A;  1FTL A;  2F3B A;  4F19 A;  2ONS A;  4LUB A;  1K9Z A;  4PTK A;  4F1U A;  4HE1 A;  1NL5 A;  1A8F A;  1B3G A;  1DBZ A;  2QVR A;  4GWW A;  3T22 A;  4XF5 A;  5IZ3 B;  2Z23 A;  1JW4 A;  4KYE A;  2HCA A;  2FVZ A;  4O8M A;  3TKD A;  5AA2 B;  4ZEK A;  4ZE8 A;  2XD3 A;  1LAH E;  1OLA A;  1XVY A;  4GBW A;  4U21 A;  1MY3 A;  3U72 A;  3SER A;  2H4I A;  3HN0 A;  2XXH A;  5DEX B;  2M8C A;  1DPE A;  1DTG A;  2X7Q A;  1XI6 A;  1YTV A;  1A8E A;  1SD3 A;  5EQ8 A;  4GL0 A;  1Y4C A;  5DTB A;  1SI1 A;  1N0T A;  1ZJL A;  5EHM A;  4FED A;  3Q28 A;  2DQV A;  4PET A;  1SPI A;  2D21 A;  2RCA A;  3C32 A;  3FAS A;  1LAX A;  3FAT A;  2REG A;  1RDY A;  1D9Y A;  2HAV A;  4NMY A;  3D1R A;  3G3J A;  1R9Q A;  1URG A;  4F3B A;  5TPA A;  3OO8 A;  3CFX A;  5HM4 B;  3JZJ A;  3MUQ A;  4ECF A;  3TCG A;  3BFU A;  3GXA A;  5L9O A;  4PGN A;  1MQJ A;  3IOR A;  4EDP A;  2XXU A;  4H5G A;  4MNP A;  5EQ9 A;  3CHG A;  5AA4 A;  1UTH B;  4ZZE A;  2ZNU A;  1DCU A;  1H44 A;  4H0W A;  4UAC A;  3E13 X;  2F7A A;  4F3P A;  2G29 A;  2Q2C A;  1UTB B;  3TQW A;  1QVS A;  4RXL A;  2OWS A;  3RUM A;  4U1O A;  3PMV A;  2FNC A;  2LAO A;  3WAE A;  3LSF B;  4GD5 A;  1LB8 A;  5CRY A;  4PFW A;  2FIX A;  5DVF A;  4EF2 A;  5LTC A;  1N7W A;  4YIC A;  1QJM A;  4OER A;  5L9S A;  1LCT A;  2F7B A;  5K2X A;  1RDX A;  2Q2A A;  2PT2 A;  2OX3 A;  2CEX A;  5ET5 A;  1B5J A;  1TT1 A;  2FHY A;  4NAP A;  3PPQ A;  3MC2 A;  3OO9 A;  1MQG A;  4JWY A;  3UGW A;  1OMP A;  2IEE A;  1P1Q A;  3DLN A;  4QSE A;  3B8B A;  1H3D A;  1PEB A;  3RLF E;  4LN5 A;  2XX8 A;  4FE8 A;  4OVR A;  1DSN A;  2DDK A;  3RPW A;  1LCF A;  4GXS B;  4NF6 B;  1LAG E;  3K6X A;  3VLU A;  4ESX A;  4JWX A;  3FGS A;  5BUU A;  4GWU A;  5ICQ A;  2I4B A;  5DVI A;  2PFY A;  3KBZ A;  3FXU A;  1FPB A;  2I3V A;  1B4H A;  4F2Q A;  3O97 A;  5JEI A;  1O7T A;  1IMC A;  1EYK A;  1B40 A;  4HTG A;  3B7D A;  4XKP A;  2RF1 A;  2VHA A;  1IIT A;  4G8H A;  4DXB A;  1LST A;  3BIG A;  4POX A;  3W15 C;  1A7L A;  1QKB A;  4Q5T A;  2PT1 A;  1SYI A;  4P0I A;  2HXR A;  4RJZ A;  2P3V A;  3MVZ A;  3IO6 A;  2YPN A;  2QSX A;  4NF5 B;  2XWI A;  1FBG A;  4JSO A;  5H8N A;  4G68 A;  4F31 B;  1B05 A;  4PFU A;  4GX6 A;  3I5O A;  2GRV A;  5I2K B;  3DP4 A;  4G61 A;  2F35 A;  4H65 A;  5B70 A;  3MAM A;  1MDP 1;  3TCH A;  3IOT A;  3TAJ A;  3O2A A;  3RTW B;  4PGP A;  3VXB A;  3CIJ A;  3ZKL A;  3H6W A;  5CMK A;  1NNF A;  4KXP A;  1O64 A;  4NF8 B;  1MS7 A;  1NUY A;  4HXV A;  2ZZW A;  3FV1 A;  2Q74 A;  4IY6 A;  1ATG A;  2O1L A;  3OSQ A;  2O51 A;  1UIV A;  4JSD A;  4N6P A;  1LBB A;  3IL1 B;  4ZEC A;  4YU0 A;  3DP8 A;  3HO7 A;  1S7Y A;  4GWY A;  4LVQ A;  1MXW A;  2VOZ A;  2DWH A;  2E1S A;  1L5T A;  1MXZ A;  5ELV A;  2WYP A;  1JW1 A;  4F22 A;  1JEV A;  3C9H A;  4PAI A;  5I58 A;  4FEB A;  4JBZ A;  2YLN A;  4N15 A;  3GLB A;  4C0R A;  4NWC A;  3KN3 A;  2KLF A;  3RY3 A;  5I57 B;  4LON B;  2DE4 A;  1NV6 A;  3EKI A;  3MZ1 A;  3FBP A;  4MIJ A;  1KA0 A;  3N26 A;  4WKM A;  3CRB A;  3T96 B;  4NE4 A;  3IX1 A;  2WBB A;  3RN8 A;  4P0G A;  3K0V A;  1USY H;  2ABH A;  2DVC A;  1B46 A;  3QUF A;  1WVJ A;  3KEI A;  4R9G A;  3BIH A;  2DS9 A;  5I2N A;  4O3B A;  2CZH A;  4MF3 A;  4JDF A;  2AIX A;  3EQ1 A;  4U2R A;  2VPN A;  3PGF A;  4N8G A;  1GGG A;  1VE4 A;  4BDN A;  2X26 A;  3DM0 A;  5FBP A;  3VVD A;  3N6T A;  4YKP A;  3NOH A;  1FQE A;  1LLS A;  3Q27 A;  1IMD A;  3FUZ A;  5I59 B;  2DXR A;  4PFY A;  3QIM A;  2XWO A;  3D4G A;  5CBR A;  4KYD A;  4XKR A;  1IMF A;  3SEV A;  3IJX B;  1NNP A;  5A5X B;  2WX9 A;  4HCW A;  4QXD A;  4P56 A;  4QFP A;  1VFD A;  3M3F A;  4Q0C A;  2RC7 A;  5EYF A;  3WAF A;  4OMB A;  1LAF E;  3UN6 A;  4DLD A;  5M2V A;  2XXK A;  2DYX A;  4MX6 A;  2QS1 A;  2OJT A;  4PFI A;  1G0H A;  5KDT A;  1B1H A;  1Y20 A;  3PUV E;  4PAK A;  3KJ7 A;  1HSL A;  3C35 A;  4DXC A;  4KQP A;  3S2V A;  2D5W A;  3P7I A;  4AS5 A;  3LR1 A;  3RPL A;  1Y3Q A;  5FHO A;  3MQ9 A;  3IJO B;  2OBG A;  1N04 A;  4OTE A;  4GWO A;  4ND9 A;  4U4X A;  1EYI A;  2THI A;  1QGX A;  3VVE A;  2VT5 A;  4IO3 A;  2QRY A;  4ELR A;  3O6G A;  1H76 A;  1G0I A;  3PV0 E;  3SEX A;  2F7C A;  4G2Z A;  4OFJ A;  2XXR A;  2Y84 A;  3QYT A;  3K01 A;  2GHA A;  4JVD A;  3IK6 B;  1OVB A;  1SBP A;  3EN3 A;  2QS4 A;  2AL4 A;  4OAN A;  5IZ1 A;  1ELJ A;  3VFJ A;  4FAJ A;  1NV7 A;  4OEU A;  1B0H A;  2O68 A;  4C1T A;  3H6U A;  1GV8 A;  1OLC A;  2CMO A;  3CSB A;  3TTM A;  3LUY A;  3TYH A;  3IOU A;  2XXX A;  2V84 A;  1PB8 A;  1EZ9 A;  2VD3 A;  4RY1 A;  5HPQ A;  1FSA A;  5CI5 A;  3FJG A;  2UVJ A;  3IR1 A;  2UYF A;  1QW0 A;  3KSJ A;  4YMA A;  5TP9 B;  2ZNS A;  4GOT A;  2QMW A;  3ILT B;  3FV2 A;  4X1D A;  4F1V A;  1YZ0 A;  3VVF A;  4NQ8 A;  3GZG A;  4QFN A;  1FQC A;  4DDD A;  4P1L A;  1YPN A;  4ZEF A;  4TOZ A;  1B6H A;  3SES A;  1NMU A;  1SW2 A;  4I9D A;  2RC9 A;  4ZEI A;  2F6G A;  4MHF A;  1OVT A;  5KZT A;  1IUD A;  1N84 A;  4MFI A;  2WBD A;  3OEN A;  3TOD A;  1LFH A;  1NH7 A;  2ZYM A;  2Q88 A;  4LA9 A;  4MLQ A;  3BKI B;  4X1B A;  3OSR A;  3HHF A;  1AL3 A;  4EF1 A;  5ET6 A;  1LBC A;  5FTH A;  2Y5L A;  1VSO A;  1FJ6 A;  2HEU A;  3KC0 A;  4BDM A;  1B3F A;  5H8F B;  4AS4 A;  5B7D A;  2XXT A;  3K6V A;  3FJ7 A;  4F2O A;  1A99 A;  4DZ1 A;  1ZBM A;  3MVW A;  4QFL A;  4PBH A;  4ZDM A;  1FBP A;  2QVV A;  4EQB A;  5AA2 A;  5ESY A;  1Q35 A;  3OEM A;  3OEK A;  4PBQ A;  1AWB A;  4IO6 A;  4QFK A;  4LAT A;  5DEX A;  1B3H A;  1IEJ A;  2ZYO A;  4PE5 B;  2XWK A;  2O84 X;  5I56 B;  1LBV A;  3MVX A;  2Y5K A;  3RNN A;  4Z0I A;  4QSD A;  3V89 B;  1MQI A;  1D4N A;  2OK2 A;  4KHZ E;  3H6T A;  2DXY A;  1B5H A;  2ZZX A;  4X9T A;  4R9F A;  1QUJ A;  4JWO A;  3Q29 A;  1JVX A;  4YZZ A;  1B7H A;  4LQ5 A;  3FVK A;  1XHY A;  1URS A;  3T9V A;  1Y9U A;  1FPF A;  3HV1 A;  4RYA A;  2QJE A;  3K2D A;  4HS7 A;  1LFG A;  2XXQ A;  3M3K A;  1OQH A;  1LBZ A;  2DE3 A;  2ESN A;  4QHQ A;  2Q8J A;  4LZ8 A;  3PUZ E;  3C36 A;  1MM7 A;  4PFB A;  1PDA A;  3PU5 A;  3RTF B;  2OWT A;  2I4C A;  1IZ1 A;  4OA4 A;  1FCK A;  1UTH A;  2QFL A;  4NG7 A;  4RNS A;  1FPE A;  1DMB A;  4E0W A;  4PFR A;  4KCD A;  3TMG A;  3OEL A;  5I5P A;  1AIV A;  2DVZ A;  2AL5 A;  5FHN A;  1FBD A;  2B3B A;  1UTB A;  2XXP A;  3MJN A;  2O1M A;  4NF0 A;  3HHG A;  4OQO A;  3W9V A;  4G8M A;  2AYS A;  3UOR A;  3LUZ A;  1AOV A;  5H8Q B;  5AA1 A;  2PX1 A;  2UVI A;  1NV5 A;  2Q8M A;  4GVO A;  4ELQ A;  4R2B A;  2JJK A;  4XXU A;  3VV5 A;  3SET A;  1FQF A;  1FQB A;  3KN7 A;  2ONK E;  4FEC A;  1JQF A;  3MW0 A;  4EQ9 A;  2KR0 A;  5F24 A;  4MBP A;  2O7U A;  4NN3 A;  3U93 A;  4NF4 B;  1POY 1;  5IM2 A;  4DI4 B;  1JVY A;  1N3X A;  1D9Q A;  3MPK A;  3RT8 A;  1XT8 A;  3SDF A;  1FPK A;  2F97 A;  2QL3 A;  4F29 A;  2Y7I A;  1QUK A;  3O66 A;  1PBQ A;  3H6V A;  4OVP A;  3S9L C;  3CG3 A;  4NF6 A;  1LFI A;  2F34 A;  1FTM A;  3EHU A;  4C1U A;  2VD2 A;  2GHB A;  4MNI A;  3FVN A;  1F9B A;  2B4L A;  4IY5 A;  4GXA A;  3S9M C;  5KCJ B;  3A09 A;  4YB7 A;  4GWZ A;  3FVG A;  3K1P A;  1Z7N E;  2B65 A;  1NFT A;  3PPR A;  1KWH A;  4FJP A;  3OXN A;  3V8X B;  4MNC A;  4QBA A;  3MP1 A;  4ESW A;  2B3F A;  1WDN A;  2W7Y A;  2V25 A;  3SEW A;  3VLW A;  5H8S A;  3UA8 A;  3PPN A;  3M8U A;  1ZLQ A;  3U1O A;  2I49 A;  5J1D A;  4NF5 A;  2WEF A;  3RT6 B;  4IO5 A;  1LBW A;  4PC9 A;  2QPQ A;  3FD3 A;  3ROJ A;  1P1N A;  1MG1 A;  4IO2 A;  4ZZA A;  1I6B A;  4HE2 A;  3O6H A;  5JTY B;  5ITO A;  5I2K A;  3G7W A;  4I40 A;  4KI0 E;  3IB2 A;  2F6P A;  2ONR A;  1JW5 A;  2Y7R A;  4AB5 A;  3QK6 A;  1CB6 A;  4ZE9 A;  1I69 A;  3R6U A;  5CC2 A;  1INP A;  4OXV A;  4OYV A;  4PE3 A;  3USD A;  2OZZ A;  2E0S A;  4EXK A;  1EZO A;  4OHN A;  3KOS A;  5ET7 A;  1H45 A;  1NNK A;  4OZ9 A;  4NF8 A;  1EH3 A;  3MVY A;  3V5A A;  3TEP A;  3U94 A;  1SW1 A;  3S4U A;  4XEQ A;  3TPA A;  1BIY A;  3E9X A;  2I0B A;  3ZS6 A;  2PYY A;  3B6W A;  4FOR A;  1JP4 A;  4EUO A;  4OET A;  1YYZ A;  4PF8 A;  4AQ4 A;  4H8J A;  4P47 A;  2WYK A;  2R8T A;  1AH5 A;  2H99 A;  3KSX A;  5DVJ A;  4H45 A;  5F1Q A;  4DCY A;  4PF6 A;  4NHB A;  2OWZ A;  5DW8 A;  2QVU A;  5LOM A;  3CR9 A;  3CFL A;  3R26 A;  3H7M A;  4ZEB A;  4JXI A;  2H25 A;  1NUZ A;  2UXA A;  3FVO A;  1RDZ A;  4BLA A;  1B0L A;  3O9P A;  4R73 A;  3MPL A;  3U65 A;  5I57 A;  4BDO A;  5TU0 A;  5I7I A;  3EHT A;  3JV9 A;  2GFE A;  1D9V A;  4WEP A;  4YB5 A;  4L17 A;  3TTL A;  3MYU A;  3O29 A;  1XVX A;  4BDL A;  2HFB A;  1VFE A;  4X8R A;  1SYH A;  4LZ7 A;  3N94 A;  2Z8E A;  4MAG A;  5DT6 A;  1FBF A;  3LC8 A;  4RK2 A;  5CBS A;  1TXF A;  2CZI A;  1BK4 A;  4PDD A;  2IA4 A;  1B5I A;  2ALU A;  2OCU A;  1MY2 A;  1Y1Z A;  4IGR A;  4P3L A;  3FIR A;  1FQA A;  3U92 A;  1FBE A;  4F39 A;  1MPD A;  4Z7E A;  3VE1 B;  2I48 A;  4GQO A;  3I3V A;  4Q8R A;  4N17 A;  4FAT A;  2PFZ A;  1XS5 A;  3S9N C;  3K1N A;  4IO7 A;  5I59 A;  2OLB A;  3IOW A;  1EZP A;  2DP8 A;  3FXB A;  3MWB A;  1MPC A;  4JVI A;  3PMW A;  3MBP A;  4ZS9 A;  3OO7 A;  5CMC A;  2NVU B;  4KR5 A;  3H3G A;  1R1N A;  5A5X A;  4RPN A;  1MPB A;  1B2H A;  2DSF A;  3TQL A;  4QFO A;  1PB7 A;  3KN8 A;  2RIN A;  3H03 A;  4JVC A;  2ZNT A;  1R6Z A;  1NUX A;  1DTZ A;  3E79 A;  4NTL A;  2A5T B;  5FHM A;  4GIZ A;  3IOV A;  4OVS A;  3G3G A;  3KG2 A;  3H06 B;  1H43 A;  5H8H B;  2V3T A;  4KCC A;  2V3U A;  4ONY A;  1MQH A;  3FXQ A;  4XKQ A;  2XWV A;  3VDF A;  4GX4 A;  3A29 A;  2XXY A;  5EYH A;  1SVX B;  4LP2 B;  4GF8 A;  5DYH A;  4IGT A;  3OOA A;  1IQ7 A;  3IB0 A;  3M3L A;  3IB1 A;  4N81 A;  2I0C A;  2Q89 A;  4EQ7 A;  1GVC A;  4OEN A;  4MH5 A;  2I58 A;  1JET A;  2YJP A;  2RKM A;  3D4C A;  3C31 A;  2NOO A;  5CMB A;  3K00 A;  4I3E A;  1Z7M E;  1Y3P A;  1XC1 A;  3MP6 A;  4GL8 A;  4MLV A;  5ICT A;  5IGA A;  4I3Y A;  1N3W A;  3TUS A;  1FPI A;  5J16 A;  1MH4 A;  3RYD A;  5TP9 A;  1US5 A;  3A3C A;  2F36 A;  4KFQ A;  3HST A;  3ZKK A;  3S9E A;  4O7M A;  1FPD A;  4XKN A; 
#chains in the Genus database with same CATH homology
 1B3L A;  2WKY A;  4NED A;  1B1X A;  1QUL A;  4ZED A;  1IIW A;  4KD5 A;  4P11 A;  3K02 A;  1BLF A;  2ZXT A;  3L6H A;  4R75 A;  4ELP A;  3TZA A;  1PBP A;  3V83 A;  4YAH X;  1XOC A;  4ELO A;  2XXI A;  1J1N A;  1USY E;  1POT A;  2QS3 A;  2O6A A;  1P99 A;  3PMX A;  3UIF A;  1VR5 A;  3OD7 A;  1DOT A;  2FA7 A;  1MY4 A;  3CG1 A;  4R6H A;  1A54 A;  1MXU A;  4YKI A;  1IXC A;  1TFA A;  1WOD A;  3B6T A;  5HBC A;  2RC8 A;  4PFT A;  5F7V A;  2R71 A;  4DCX A;  3KBR A;  3PUX E;  2CZL A;  5H8F A;  2ZMB A;  3K6U A;  3T66 A;  4FIM A;  4OFO A;  2GH9 A;  3SEY A;  4X48 A;  2Y7W A;  1N7X A;  4NWD A;  1HSE A;  1N76 A;  1Y4T A;  3DEL B;  3EHS A;  2ZYK A;  2I6E A;  2DWA A;  2XHD A;  2QMX A;  4QRZ A;  3VXC A;  1II5 A;  5TPA B;  4QF9 A;  1MRP A;  2PVU A;  3KGC A;  4R6Y A;  5I56 A;  3TEL A;  3T9X B;  4M1V A;  4N13 A;  2Z8D A;  3G3F A;  4DE8 A;  2ANJ A;  1IXH A;  4O3A A;  4M4G A;  3CI8 A;  5AA4 B;  1QUI A;  3EPE A;  3BFT A;  3K6W A;  3ECR A;  5ISU A;  3Q25 A;  1JEU A;  4XTC Q;  1FQD A;  1MXY A;  1B58 A;  2P2A A;  3SKP A;  1EU8 A;  4H67 A;  2DE2 A;  2H98 A;  4U22 A;  2O7I A;  3L6G A;  3CVG A;  2RCB A;  3LSL A;  1MM6 A;  1PC3 A;  4I1D A;  4K3F A;  1AMF A;  3CFZ A;  4GRK A;  1I6Q A;  3QUJ A;  4IB2 A;  4HW8 A;  2F78 A;  1M5B A;  1B4Z A;  1YCJ A;  2P0S A;  1URD A;  1BTJ A;  4HCY A;  2FYI A;  3FZV A;  3PPP A;  4R6K A;  3K4U A;  1GTK A;  4O3C A;  4R2F A;  3HPI A;  1IXG A;  4WXJ A;  2BJJ X;  3TDJ A;  2Z22 A;  3GBB A;  4LQ2 A;  1SDX A;  3MP8 A;  4H6D A;  3QXM A;  4POW A;  5H8Q A;  2DOJ A;  1A40 A;  1M5E A;  4H1X A;  1GR2 A;  2A5S A;  3ODB A;  3QSL A;  2VGQ A;  1SW4 A;  3E4R A;  1O63 A;  2V3Q A;  1NH8 A;  3Q26 A;  4NF4 A;  1ZMG A;  4OES A;  4RA1 A;  3ZSF A;  1NNT A;  1MXV A;  1MY0 A;  2XD2 A;  1MQD A;  3GBA A;  3K1M A;  4DIG A;  1TFD A;  4GFR A;  4ISU A;  3IAZ A;  3C33 A;  1CE2 A;  2HZL A;  4H8I A;  2HQ0 A;  3B6Q A;  2R9J A;  1TWY A;  3QAX A;  4U1Z A;  2HAU A;  3PD8 A;  4F3S A;  5ITP A;  1MXX A;  5KCJ A;  5H8N B;  4G68 B;  1B32 A;  3O28 A;  3UK4 A;  2D3I A;  1S9T A;  1SW5 A;  1B7U A;  1M5F A;  2UVG A;  4YB6 A;  3OO6 A;  2F5X A;  1YAE A;  4TQU Q;  3KFM A;  3W9W A;  1LGB C;  5IAI A;  2NWJ A;  3RGY A;  1Y3N A;  2O69 A;  5FTI A;  4DXU A;  4R72 A;  2DWI A;  4YKK A;  1P1W A;  2Y7P A;  1Q1K A;  4Q30 B;  2F8D A;  3EF7 A;  3DP6 A;  1B52 A;  1ZKB A;  5JTY A;  3PPO A;  3TTN A;  3G3H A;  3R7X A;  3TFL A;  3F11 A;  1D3K A;  4THI A;  3IO4 A;  3ONM A;  1RYX A;  2NXO A;  4UA8 A;  4E0X A;  4PQJ A;  3N5L A;  4F3G A;  4PP0 A;  3MZ9 A;  1MH3 A;  3E3K A;  4H5F A;  3PD9 A;  5I58 B;  4QSC A;  5CMM A;  2QS2 A;  4AB6 A;  4LZ5 A;  2P1S A;  1DPP A;  4OWD A;  2PBW A;  2Y7K A;  3THI A;  2PMS A;  4G68 C;  5K2Y A;  5AA2 D;  5AE4 A;  1PB9 A;  2NUV A;  3G3K A;  3G3I A;  3FXR A;  2UYE A;  5AA3 A;  1ANF A;  1T0K A;  4U4S A;  5I2N B;  2DWJ A;  3A3U A;  3SEU A;  1B3E A;  5L9M A;  2XX7 A;  4OEV A;  4TLL B;  5L8D A;  4G4P A;  1P1U A;  5EHS A;  2HXW A;  1B9J A;  4G77 A;  2Q9T A;  1SQY A;  1FTK A;  3KZG A;  3C34 A;  1UIU A;  1ZU0 A;  1I6A A;  3LSW A;  5I84 A;  1FW0 A;  3TTK A;  4F1Y A;  2XXV A;  3TTR A;  4TLM B;  4IO4 A;  1BP5 A;  3FJM A;  3T9H B;  5KDT B;  1NKX A;  3PUW E;  4I62 A;  1OQG A;  1A55 A;  2VP1 A;  1HSJ A;  5IKB A;  5CM6 A;  3VLV A;  1R9L A;  2G93 A;  3BBR A;  3OMB A;  4JB7 A;  2H5Y A;  3JYR A;  2H9B A;  1Y1M A;  4KPT A;  1FTO A;  1IXI A;  3I6V A;  4OVJ A;  3RQT A;  2ZYN A;  1UQW A;  4YKJ A;  2REJ A;  4GLI A;  2A5T A;  2XX9 A;  3HCQ A;  3U8Q A;  4RK9 A;  4RPO A;  5H8H A;  1ZTY A;  5JK4 A;  4U23 A;  4YMB A;  4OFL A;  1RKM A;  4I8C A;  2Z8F A;  3ILU B;  1MDQ A;  3O6I A;  4EXL A;  4KYS A;  4WED A;  4BDR A;  1B7Z A;  4N07 A;  4G8N A;  2R6G E;  1S50 A;  3KJT A;  3MZB A;  1LB9 A;  1M5D A;  3KOT A;  1RYO A;  2V93 A;  3UP9 A;  5BWJ A;  3PUY E;  1BKA A;  3AXF A;  1OIB A;  3T9U A;  2UVH A;  4R74 A;  3T93 B;  1P1O A;  4F18 A;  3LSX A;  1QKA A;  3LBS A;  4XIG Q;  3N6U A;  4BDQ A;  1JNF A;  3TCF A;  1ZIU A;  2HZK A;  3CSG A;  2I3W A;  3H4Z A;  1US4 A;  1B51 A;  1MY1 A;  2XXW A;  1M5C A;  1FTJ A;  2X7P A;  3C4M A;  1SI0 A;  1FTL A;  4F19 A;  2ONS A;  4LUB A;  4F1U A;  1NL5 A;  1A8F A;  1B3G A;  3T22 A;  2Z23 A;  1JW4 A;  4KYE A;  2HCA A;  3TKD A;  5AA2 B;  4ZEK A;  4ZE8 A;  2XD3 A;  1LAH E;  1OLA A;  1XVY A;  4U21 A;  1MY3 A;  3U72 A;  3SER A;  2H4I A;  3HN0 A;  2XXH A;  5DEX B;  2M8C A;  1DPE A;  1DTG A;  2X7Q A;  1YTV A;  1A8E A;  1SD3 A;  4GL0 A;  1Y4C A;  5DTB A;  1SI1 A;  1N0T A;  1ZJL A;  5EHM A;  4FED A;  3Q28 A;  2DQV A;  4PET A;  2D21 A;  2RCA A;  3C32 A;  3FAS A;  1LAX A;  3FAT A;  2REG A;  1D9Y A;  2HAV A;  4NMY A;  3G3J A;  1R9Q A;  1URG A;  4F3B A;  5TPA A;  3OO8 A;  3CFX A;  5HM4 B;  3JZJ A;  3MUQ A;  4ECF A;  3TCG A;  3BFU A;  3GXA A;  5L9O A;  1MQJ A;  3IOR A;  4EDP A;  2XXU A;  4H5G A;  5AA4 A;  1UTH B;  4ZZE A;  2ZNU A;  1H44 A;  4H0W A;  4UAC A;  3E13 X;  2F7A A;  4F3P A;  2G29 A;  2Q2C A;  1UTB B;  3TQW A;  1QVS A;  4RXL A;  2OWS A;  3RUM A;  4U1O A;  3PMV A;  2FNC A;  2LAO A;  3WAE A;  3LSF B;  4GD5 A;  1LB8 A;  5CRY A;  4PFW A;  5DVF A;  4EF2 A;  1N7W A;  4YIC A;  1QJM A;  4OER A;  5L9S A;  1LCT A;  2F7B A;  5K2X A;  2Q2A A;  2PT2 A;  1B5J A;  1TT1 A;  3PPQ A;  3MC2 A;  3OO9 A;  1MQG A;  4JWY A;  3UGW A;  1OMP A;  2IEE A;  1P1Q A;  3DLN A;  4QSE A;  1H3D A;  1PEB A;  3RLF E;  2XX8 A;  4FE8 A;  1DSN A;  3RPW A;  1LCF A;  4GXS B;  4NF6 B;  1LAG E;  3K6X A;  3VLU A;  4ESX A;  4JWX A;  3FGS A;  5BUU A;  5ICQ A;  2I4B A;  5DVI A;  3FXU A;  2I3V A;  4F2Q A;  1B4H A;  3O97 A;  5JEI A;  1O7T A;  1B40 A;  4HTG A;  3B7D A;  4XKP A;  2RF1 A;  2VHA A;  1IIT A;  4G8H A;  4DXB A;  1LST A;  4POX A;  3W15 C;  1A7L A;  1QKB A;  4Q5T A;  2PT1 A;  1SYI A;  4P0I A;  4RJZ A;  3MVZ A;  3IO6 A;  2YPN A;  2QSX A;  4NF5 B;  4JSO A;  5H8N A;  4G68 A;  4F31 B;  1B05 A;  4PFU A;  3I5O A;  2GRV A;  5I2K B;  3DP4 A;  2F35 A;  4H65 A;  5B70 A;  3MAM A;  1MDP 1;  3TCH A;  3IOT A;  3TAJ A;  3O2A A;  3RTW B;  3VXB A;  3CIJ A;  3ZKL A;  3H6W A;  5CMK A;  1NNF A;  1O64 A;  4NF8 B;  1MS7 A;  3FV1 A;  4IY6 A;  1ATG A;  2O1L A;  3OSQ A;  2O51 A;  1UIV A;  4JSD A;  4N6P A;  1LBB A;  3IL1 B;  4ZEC A;  4YU0 A;  3DP8 A;  3HO7 A;  1S7Y A;  4LVQ A;  1MXW A;  2VOZ A;  2DWH A;  2E1S A;  1L5T A;  1MXZ A;  5ELV A;  1JW1 A;  4F22 A;  1JEV A;  3C9H A;  5I58 A;  4FEB A;  4JBZ A;  2YLN A;  3GLB A;  4C0R A;  4NWC A;  3KN3 A;  2KLF A;  3RY3 A;  5I57 B;  4LON B;  2DE4 A;  3MZ1 A;  3N26 A;  4WKM A;  3CRB A;  3T96 B;  4NE4 A;  3IX1 A;  3RN8 A;  4P0G A;  3K0V A;  1USY H;  2ABH A;  2DVC A;  1B46 A;  3QUF A;  1WVJ A;  3KEI A;  4R9G A;  2DS9 A;  5I2N A;  4O3B A;  4MF3 A;  4JDF A;  2AIX A;  3EQ1 A;  4U2R A;  3PGF A;  1GGG A;  1VE4 A;  4BDN A;  2X26 A;  3DM0 A;  3VVD A;  3N6T A;  4YKP A;  1FQE A;  1LLS A;  3Q27 A;  3FUZ A;  5I59 B;  2DXR A;  4PFY A;  3QIM A;  3D4G A;  5CBR A;  4KYD A;  4XKR A;  3SEV A;  3IJX B;  1NNP A;  5A5X B;  4HCW A;  4QFP A;  1VFD A;  3M3F A;  4Q0C A;  2RC7 A;  5EYF A;  3WAF A;  4OMB A;  1LAF E;  3UN6 A;  4DLD A;  5M2V A;  2DYX A;  2QS1 A;  2OJT A;  5KDT A;  1B1H A;  1Y20 A;  3PUV E;  3KJ7 A;  1HSL A;  3C35 A;  4DXC A;  4KQP A;  3S2V A;  2D5W A;  3P7I A;  3LR1 A;  1Y3Q A;  5FHO A;  3MQ9 A;  3IJO B;  2OBG A;  1N04 A;  4OTE A;  4GWO A;  4ND9 A;  4U4X A;  2THI A;  3VVE A;  4IO3 A;  2QRY A;  4ELR A;  3O6G A;  1H76 A;  3PV0 E;  3SEX A;  2F7C A;  4G2Z A;  4OFJ A;  2XXR A;  2Y84 A;  3QYT A;  3K01 A;  2GHA A;  3IK6 B;  1OVB A;  1SBP A;  3EN3 A;  2QS4 A;  2AL4 A;  1ELJ A;  3VFJ A;  4FAJ A;  4OEU A;  4C1T A;  1B0H A;  2O68 A;  3H6U A;  1GV8 A;  1OLC A;  2CMO A;  3CSB A;  3TTM A;  3LUY A;  3TYH A;  3IOU A;  2XXX A;  2V84 A;  1PB8 A;  1EZ9 A;  2VD3 A;  4RY1 A;  5HPQ A;  5CI5 A;  3FJG A;  2UVJ A;  3IR1 A;  2UYF A;  1QW0 A;  3KSJ A;  4YMA A;  5TP9 B;  2ZNS A;  4GOT A;  2QMW A;  3ILT B;  3FV2 A;  4X1D A;  4F1V A;  3VVF A;  3GZG A;  4QFN A;  1FQC A;  4DDD A;  1YPN A;  4ZEF A;  4TOZ A;  1B6H A;  3SES A;  1NMU A;  1SW2 A;  4I9D A;  2RC9 A;  4ZEI A;  2F6G A;  1OVT A;  5KZT A;  1IUD A;  1N84 A;  4MFI A;  3OEN A;  3TOD A;  1LFH A;  1NH7 A;  2ZYM A;  2Q88 A;  4LA9 A;  4MLQ A;  3BKI B;  4X1B A;  3OSR A;  3HHF A;  1AL3 A;  4EF1 A;  1LBC A;  5FTH A;  1VSO A;  2HEU A;  4BDM A;  1B3F A;  5H8F B;  5B7D A;  2XXT A;  3K6V A;  3FJ7 A;  4F2O A;  1A99 A;  4DZ1 A;  1ZBM A;  3MVW A;  4QFL A;  4ZDM A;  4EQB A;  5AA2 A;  1Q35 A;  3OEM A;  3OEK A;  4IO6 A;  4QFK A;  4LAT A;  5DEX A;  1B3H A;  1IEJ A;  2ZYO A;  4PE5 B;  2O84 X;  5I56 B;  3MVX A;  3RNN A;  4Z0I A;  4QSD A;  3V89 B;  1MQI A;  1D4N A;  2OK2 A;  4KHZ E;  3H6T A;  2DXY A;  1B5H A;  4X9T A;  4R9F A;  1QUJ A;  4JWO A;  3Q29 A;  1JVX A;  4YZZ A;  1B7H A;  4LQ5 A;  3FVK A;  1XHY A;  1URS A;  3T9V A;  1Y9U A;  3HV1 A;  4RYA A;  2QJE A;  3K2D A;  4HS7 A;  1LFG A;  2XXQ A;  3M3K A;  1OQH A;  2DE3 A;  2ESN A;  4QHQ A;  2Q8J A;  4LZ8 A;  3PUZ E;  3C36 A;  1MM7 A;  1PDA A;  3PU5 A;  3RTF B;  2OWT A;  2I4C A;  1IZ1 A;  1FCK A;  1UTH A;  4RNS A;  4E0W A;  1DMB A;  4KCD A;  3TMG A;  3OEL A;  1AIV A;  2DVZ A;  2AL5 A;  5FHN A;  2B3B A;  1UTB A;  2XXP A;  3MJN A;  2O1M A;  3HHG A;  4OQO A;  3W9V A;  4G8M A;  2AYS A;  3UOR A;  1AOV A;  5H8Q B;  5AA1 A;  2PX1 A;  2UVI A;  4GVO A;  4ELQ A;  4R2B A;  4XXU A;  3VV5 A;  3SET A;  1FQF A;  1FQB A;  3KN7 A;  2ONK E;  4FEC A;  1JQF A;  3MW0 A;  4EQ9 A;  4MBP A;  2O7U A;  3U93 A;  4NF4 B;  1POY 1;  1JVY A;  1N3X A;  3MPK A;  3RT8 A;  1XT8 A;  3SDF A;  2F97 A;  2QL3 A;  4F29 A;  2Y7I A;  1QUK A;  3O66 A;  1PBQ A;  3H6V A;  3S9L C;  3CG3 A;  4NF6 A;  1LFI A;  2F34 A;  1FTM A;  3EHU A;  4C1U A;  2VD2 A;  2GHB A;  3FVN A;  1F9B A;  4IY5 A;  4GXA A;  3S9M C;  5KCJ B;  3A09 A;  4YB7 A;  3FVG A;  3K1P A;  1Z7N E;  2B65 A;  1NFT A;  3PPR A;  1KWH A;  4FJP A;  3OXN A;  3V8X B;  3MP1 A;  4ESW A;  2B3F A;  1WDN A;  2W7Y A;  2V25 A;  3SEW A;  3VLW A;  5H8S A;  3UA8 A;  3PPN A;  3M8U A;  1ZLQ A;  3U1O A;  2I49 A;  5J1D A;  4NF5 A;  3RT6 B;  4IO5 A;  2QPQ A;  3FD3 A;  1P1N A;  1MG1 A;  4IO2 A;  4ZZA A;  1I6B A;  3O6H A;  5JTY B;  5ITO A;  5I2K A;  3G7W A;  4KI0 E;  3IB2 A;  2F6P A;  2ONR A;  1JW5 A;  2Y7R A;  4AB5 A;  3QK6 A;  1CB6 A;  4ZE9 A;  1I69 A;  3R6U A;  5CC2 A;  4OXV A;  4OYV A;  3USD A;  2OZZ A;  2E0S A;  4EXK A;  1EZO A;  4OHN A;  3KOS A;  1H45 A;  1NNK A;  4OZ9 A;  4NF8 A;  1EH3 A;  3MVY A;  3V5A A;  3TEP A;  3U94 A;  1SW1 A;  3S4U A;  3TPA A;  1BIY A;  3E9X A;  2I0B A;  3ZS6 A;  2PYY A;  3B6W A;  4FOR A;  4EUO A;  4OET A;  4AQ4 A;  4H8J A;  1AH5 A;  2H99 A;  3KSX A;  5DVJ A;  4DCY A;  5F1Q A;  5LOM A;  3CR9 A;  3CFL A;  3R26 A;  3H7M A;  4ZEB A;  4JXI A;  2H25 A;  2UXA A;  3FVO A;  4BLA A;  1B0L A;  3O9P A;  4R73 A;  3MPL A;  5I57 A;  4BDO A;  5TU0 A;  3EHT A;  3JV9 A;  2GFE A;  1D9V A;  4WEP A;  4YB5 A;  4L17 A;  3TTL A;  3O29 A;  1XVX A;  4BDL A;  2HFB A;  1VFE A;  1SYH A;  4LZ7 A;  3N94 A;  2Z8E A;  5DT6 A;  3LC8 A;  4RK2 A;  5CBS A;  1TXF A;  2IA4 A;  1B5I A;  2ALU A;  2OCU A;  1MY2 A;  1Y1Z A;  4IGR A;  3FIR A;  1FQA A;  3U92 A;  4F39 A;  1MPD A;  4Z7E A;  3VE1 B;  2I48 A;  4GQO A;  3I3V A;  4Q8R A;  4FAT A;  1XS5 A;  3S9N C;  3K1N A;  4IO7 A;  5I59 A;  2OLB A;  3IOW A;  1EZP A;  2DP8 A;  3MWB A;  1MPC A;  3PMW A;  3MBP A;  4ZS9 A;  3OO7 A;  5CMC A;  2NVU B;  4KR5 A;  3H3G A;  1R1N A;  5A5X A;  4RPN A;  1MPB A;  1B2H A;  2DSF A;  3TQL A;  4QFO A;  1PB7 A;  3KN8 A;  2RIN A;  3H03 A;  2ZNT A;  1R6Z A;  1DTZ A;  4NTL A;  2A5T B;  5FHM A;  4GIZ A;  3IOV A;  3G3G A;  3KG2 A;  3H06 B;  1H43 A;  5H8H B;  2V3T A;  4KCC A;  2V3U A;  4ONY A;  1MQH A;  3FXQ A;  4XKQ A;  3VDF A;  2XXY A;  1SVX B;  4LP2 B;  4GF8 A;  5DYH A;  4IGT A;  3OOA A;  1IQ7 A;  3IB0 A;  3M3L A;  3IB1 A;  2I0C A;  2Q89 A;  4EQ7 A;  1GVC A;  4OEN A;  4MH5 A;  2I58 A;  1JET A;  2YJP A;  2RKM A;  3D4C A;  3C31 A;  2NOO A;  5CMB A;  3K00 A;  1Z7M E;  1Y3P A;  1XC1 A;  3MP6 A;  4GL8 A;  4MLV A;  5ICT A;  3TUS A;  1N3W A;  1MH4 A;  5TP9 A;  1US5 A;  3A3C A;  2F36 A;  4KFQ A;  3HST A;  3ZKK A;  3S9E A;  4XKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...