4ZZEA

Raffinose and panose binding protein from bifidobacterium animalis subsp. lactis bl-04, bound with panose
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
384
structure length
377
Chain Sequence
QVTLDFFQFKAEAADWFKQAAQEFEKENPDIRININDLRTRFVKDRVPDVITFNGDYSFGTFAASGVFHDFTDDPLVSELNEGMVNIAKNLVQTSDPAKKRLYGLPFAGNASGYIYNKDLFRKVGLDPDNPPQTWDEFIAMLKKFRDAGINPVQATLADAWTTQAPLASLAGTLVPESEYAALKSGDTTFKQIWTEPIEKEIELFKYADSEKGVTYQQGTQNFAKGTAAIIPLGTYAIPQITMVNKDIDLGFAQMPATNDASKQILTAGDDVILTMGANSRHKEQSMRFIRFLMSKKQLENYADAQSAITPLKETYFGNKALEPVRPFFESNRVADFCDHYIPSSINIGGYLQSAIMSGNVNQFIDSMQNEWNKVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Sugar binding protein of ABC transporter system
publication title An ATP Binding Cassette Transporter Mediates the Uptake of alpha-(1,6)-Linked Dietary Oligosaccharides in Bifidobacterium and Correlates with Competitive Growth on These Substrates.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
total genus 134
structure length 377
sequence length 384
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4zzeA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4zzeA02
4C1UA 2G93A 1I6QA 2DVCA 5H8NA 1B2HA 4N07A 1ELJA 4YAHX 2O84X 4NEDA 2THIA 4DCYA 2ANJA 1Y1ZA 1CE2A 3KG2A 3CFZA 5DTBA 3PPNA 1P99A 3PUZE 4EXLA 4ZEBA 4FEDA 3O28A 1QKBA 1EH3A 1II5A 1SVXB 2ZXTA 3SKPA 2H99A 4WKMA 3VXCA 4MFIA 3LUYA 2AL5A 1Y3QA 3LSWA 4JB7A 2O69A 3UN6A 1FTOA 2DWIA 1LBCA 1B3EA 2O6AA 3CR9A 1IZ1A 5CRYA 1MS7A 3O6IA 3R7XA 3GXAA 3CFXA 1MPDA 2DE4A 1R9LA 3RLFE 4XKRA 4F1VA 1B3HA 3PU5A 3S9LC 1MQGA 2VGQA 5AA1A 2ABHA 4MBPA 5IKBA 5H8FB 4RXLA 1H3DA 2ZYKA 4F39A 3MPKA 1N84A 1S50A 1LAHE 3R6UA 5HM4B 4X1DA 3MVWA 3C32A 5L9MA 4RK2A 1MXVA 4NWDA 1I69A 3C33A 4H65A 1POY1 2NOOA 5L9SA 2H9BA 1SW4A 3PUVE 2G29A 1B58A 2RC7A 4BDRA 1LBBA 2DXYA 2RKMA 4I1DA 4ZS9A 2GRVA 4IY5A 3EN3A 5TP9B 2V25A 3MBPA 3QUJA 3TTRA 2OCUA 1IXGA 1N7WA 3BFUA 4E0WA 4OFJA 4JWOA 4QSCA 2VD2A 2PVUA 4OHNA 3IOVA 4BDOA 1N7XA 5H8FA 4R75A 2Q2AA 3ZS6A 2XXIA 3DP6A 1EU8A 3T93B 3UGWA 3C31A 4Q0CA 1A7LA 4OFOA 3U92A 4YKJA 5DEXB 1FQBA 5CMBA 1Y4TA 2XX8A 1PBQA 1PB8A 3TUSA 3KN8A 2PT1A 5TP9A 4GXSB 4EF2A 2UVIA 3VV5A 4LP2B 5HPQA 4G68B 3ZKKA 3DP4A 1B5JA 1VE4A 4TLLB 1US5A 2D3IA 2Z8DA 1R1NA 1TFDA 3TZAA 1IXHA 4IO4A 5ICTA 2OJTA 4XIGQ 5DEXA 4THIA 3HO7A 1D3KA 2VD3A 4U21A 1M5EA 2I6EA 3IOTA 3VFJA 1MY4A 4HW8A 2HAUA 1FQAA 3T9UA 1ZJLA 3VLVA 4QFOA 1SYIA 3WAEA 4U1OA 4ELPA 3PPQA 1BIYA 4MH5A 4EF1A 1NL5A 4LA9A 3HCQA 1PDAA 4R73A 3SEUA 1FQEA 1MPBA 2UVJA 3PPRA 3USDA 3T9HB 2ONKE 5DVJA 2GFEA 4BDLA 1MXXA 2RC9A 3TQWA 1WVJA 3SESA 3O97A 3FVNA 1RYXA 5L8DA 3N94A 4LZ7A 2ZYNA 4GFRA 4OQOA 4R72A 1RYOA 3IB2A 1FQCA 5I2NB 1S7YA 4LQ5A 1BKAA 4NF8A 3GZGA 3H3GA 1D9YA 4XTCQ 3ZSFA 3HV1A 3OEMA 1BP5A 3K6UA 4F3SA 3FIRA 4X9TA 4R6HA 4ECFA 3KGCA 1QKAA 3H6VA 2F35A 3TFLA 2Q8JA 4F22A 3IO6A 3HHGA 1ZBMA 2ZNUA 3LC8A 4GOTA 3L6GA 4NMYA 2CZLA 1J1NA 4YKKA 4TOZA 1ANFA 2RF1A 3DM0A 1BLFA 5ICQA 4M4GA 1TT1A 4JWXA 3MWBA 3TCGA 5I2NA 2DWAA 3KZGA 4OVJA 4POXA 3E9XA 4PFTA 3PGFA 3O2AA 1LB9A 2OWSA 3R26A 3O6HA 3T9VA 4P0GA 3HN0A 4NF4B 3U1OA 3K2DA 1EZ9A 3KJ7A 2ZYOA 3B6WA 5CMCA 4IO3A 4R2BA 2UVHA 3FJMA 4OENA 1Y20A 3QYTA 2UVGA 5JEIA 5LOMA 2OLBA 3C35A 2REJA 1M5FA 1MG1A 4QHQA 1USYE 3K6VA 4YMAA 3IB0A 3OELA 1ZTYA 3MVYA 2O1MA 2Y7IA 3IJOB 4LATA 5EYFA 1GTKA 2H5YA 4Q30B 2F7BA 4HTGA 1DMBA 1D4NA 4I9DA 3PV0E 4JBZA 4DXBA 5F1QA 3G3GA 1B1HA 4ZE9A 1B05A 4HS7A 3MJNA 2X7QA 1URDA 1M5CA 1B3FA 2OWTA 3A3UA 4E0XA 3OMBA 3QIMA 2XXWA 4F19A 4WEPA 3VLUA 1MQDA 1NH7A 1A40A 5FTIA 3QAXA 3C34A 1P1OA 4ND9A 1A8FA 1LSTA 4FECA 3IAZA 4F2QA 1YTVA 3KOTA 4FEBA 2RINA 1OVTA 3AXFA 4KYSA 2DOJA 2DS9A 2P1SA 1JNFA 5ELVA 1P1UA 1N0TA 5I56A 4GVOA 2O7UA 4DCXA 5H8SA 2RC8A 4QSEA 1FTKA 3S4UA 4YICA 3GBBA 3PMXA 2KLFA 4EUOA 1LFGA 4UACA 3VVFA 2UYFA 3U94A 1B5IA 1VFEA 2NUVA 1ZIUA 4XKPA 2DE3A 4ZEIA 4OWDA 3FV1A 1MDQA 1EZPA 2I3WA 4KPTA 1L5TA 5CI5A 4AQ4A 2B3FA 5K2YA 1AMFA 2V3TA 1HSEA 3VVDA 1JVYA 3THIA 2AL4A 3V83A 4KCDA 4O3CA 3TKDA 2R9JA 4RPOA 2A5TA 3LSXA 5I59A 2GH9A 1B7HA 2Y7PA 2REGA 3RT8A 1H45A 3C36A 3V8XB 4POWA 4U4XA 2UXAA 4KYDA 1JVXA 1B7UA 1VR5A 5AA2B 5BUUA 2QMWA 2XD2A 2V3UA 4H1XA 3VE1B 3TAJA 4Z7EA 4ZE8A 5ITPA 3UORA 1JETA 1QULA 5BWJA 5I2KB 4QFKA 2AIXA 2NVUB 4R9GA 1XHYA 4F2OA 1DSNA 2I0CA 3KSJA 4HCWA 3CI8A 3MVXA 1A54A 2E0SA 3KN3A 1PEBA 5CBRA 3S9MC 3ILTB 3T22A 3IK6B 4M1VA 3K02A 1PBPA 4IB2A 3M3LA 3MZ9A 4NTLA 3CVGA 3H06B 3OOAA 1Y3PA 3I3VA 1LLSA 1MH3A 5AA2A 1B32A 4XXUA 2UYEA 4O3AA 4QRZA 1A99A 1XVXA 5CMMA 2Z8FA 1QUKA 4YB5A 4GWOA 4GF8A 2WKYA 4IY6A 3K6XA 2F36A 1XT8A 2DWJA 3FJ7A 3TTLA 4DIGA 5I2KA 5KCJB 5FHOA 1HSLA 4OZ9A 1B4ZA 4ZECA 1A55A 4BDMA 1I6BA 1B3LA 1BTJA 3W9VA 1O63A 2GHBA 3ZKLA 3T66A 2XHDA 3EHSA 1IXIA 2H4IA 2O68A 4UA8A 2P0SA 1RKMA 1N76A 4KQPA 5H8QB 3OENA 2QPQA 1VFDA 1XVYA 5B7DA 2QSXA 1MXUA 3EHUA 1Z7NE 1YCJA 4G4PA 5ITOA 2Y7RA 2ONSA 3S9NC 3CIJA 4EQ9A 2QRYA 3FXQA 4U1ZA 2PYYA 1FCKA 4KD5A 3CSBA 3KN7A 3PMVA 3FV2A 1JQFA 1F9BA 2QJEA 2VOZA 2I0BA 3MPLA 1UIVA 3FVGA 1H43A 5H8QA 2XXTA 2XXXA 3IL1B 2I48A 4X48A 3SEXA 4IGRA 3DLNA 3Q28A 4G8NA 3K1PA 1JW1A 4PFWA 3OEKA 1Y1MA 4F1UA 3C4MA 1UIUA 1OQGA 4ISUA 2QS2A 2HFBA 3TMGA 4ESWA 3H03A 1PB9A 4X1BA 4OERA 2I58A 2ONRA 2QS1A 5CBSA 2M8CA 3TYHA 4GD5A 2X7PA 1JW4A 2I49A 4WEDA 1I6AA 2DP8A 2HZKA 4G2ZA 4QFPA 2W7YA 3QXMA 3ODBA 3LBSA 4OMBA 2DXRA 5TPAB 3CFLA 5H8HB 4ESXA 2O1LA 2OK2A 2FYIA 4G68A 1QVSA 1DTZA 1Y9UA 5J1DA 2GHAA 1HSJA 3MUQA 2ZNSA 3FXUA 1MDP1 2Y84A 2IEEA 1GGGA 3K4UA 3N5LA 2F8DA 5AE4A 1IIWA 3FXRA 2DVZA 3I5OA 5A5XB 3UK4A 2RCAA 3SERA 3MZ1A 4NWCA 4H0WA 2XXPA 4RJZA 1B5HA 3SDFA 3V89B 5TPAA 5H8HA 3G3JA 3PUWE 2QMXA 1QW0A 1GVCA 4ONYA 3FJGA 4BDQA 3CG1A 1DTGA 1OLCA 3G3HA 1P1WA 1TWYA 1SYHA 3H6WA 1SD3A 1SW2A 4P11A 2PBWA 1QUJA 3PMWA 1S9TA 4OEUA 2HQ0A 4KHZE 1SW5A 5TU0A 3B7DA 4I62A 3F11A 4XKQA 1Z7ME 2R71A 4R74A 3TCHA 1MXWA 3H4ZA 1M5DA 4F18A 3FATA 1T0KA 2FNCA 3U72A 3RTWB 2DSFA 3T96B 5CC2A 4QF9A 5FHNA 1URGA 3I6VA 3JV9A 5DT6A 3Q27A 4IO2A 4H5FA 5CMKA 1AIVA 1UTHB 1A8EA 4I8CA 3IO4A 3TQLA 4JSDA 5I58B 1WODA 2QS3A 3HSTA 3EPEA 2CMOA 3KBRA 1FW0A 4NF5B 3IJXB 1ZU0A 5AA3A 3G7WA 3A3CA 3E4RA 1IUDA 3QSLA 2DE2A 4XKNA 2I4CA 1OQHA 3N6UA 4H5GA 4U23A 1ZMGA 4G8MA 2ZNTA 1DOTA 5KZTA 4GLIA 3PPOA 1R6ZA 1GR2A 4NE4A 3CSGA 4K3FA 3OO6A 4NF4A 1EZOA 3MC2A 3IX1A 1UTHA 3S2VA 2D5WA 5I58A 2F7CA 3K1MA 1SI0A 2HZLA 4PE5B 3H7MA 2QS4A 4NF5A 2XXYA 4QSDA 2PT2A 3N6TA 2DYXA 5FHMA 3OSQA 1MXZA 4EDPA 1SBPA 2V3QA 4R9FA 5AA4B 1N04A 3VXBA 2O51A 2PX1A 4LVQA 1UTBB 1URSA 3MAMA 4ZZAA 3OO9A 5FTHA 4LZ5A 1MQIA 1FTMA 1SQYA 4F29A 1POTA 5I57B 1N3WA 1YAEA 2XXVA 4OXVA 1AL3A 3EQ1A 1JEUA 2DWHA 1MXYA 3KOSA 4C1TA 2ALUA 3TPAA 4DXUA 1TXFA 5DYHA 4Z0IA 3VLWA 4IO6A 4GRKA 1P1QA 1QUIA 4IO5A 5AA4A 1ATGA 3E13X 4OTEA 5I84A 4FATA 2HAVA 4ZZEA 1N3XA 1B4HA 2F6PA 4KYEA 4DLDA 1UTBA 1IEJA 3K0VA 4PETA 1SW1A 3LSLA 4G77A 4FORA 2H98A 4IGTA 3W9WA 4L17A 1AH5A 3W15C 5I57A 4AB6A 1B0HA 3QUFA 3H6UA 3TCFA 4BLAA 5ISUA 1B1XA 4RNSA 4U2RA 3GLBA 3LR1A 1NH8A 4DXCA 3FZVA 2H25A 4OETA 2ESNA 3RPWA 4N6PA 4O3BA 1USYH 3M3KA 2QL3A 4U4SA 4OEVA 3SEYA 4KCCA 2E1SA 3CRBA 2I4BA 1MM6A 2XXHA 2Z22A 1B0LA 3OXNA 3VVEA 3KFMA 1IITA 5JK4A 1M5BA 4EXKA 2FA7A 3SEVA 2BJJX 2VHAA 3SEWA 4ELOA 2V93A 2Q89A 4JXIA 3FVOA 3RQTA 4H8JA 2YLNA 4Q8RA 2Y7WA 4ZEDA 3TTKA 2F7AA 4PP0A 3N26A 1UQWA 4JDFA 4EQBA 4RYAA 4MLQA 1Y4CA 4LUBA 2XD3A 2NXOA 3KSXA 1D9VA 4OESA 3PPPA 5CM6A 3JZJA 3CG3A 3MVZA 3U93A 3PD9A 3K00A 3K6WA 4KI0E 3HHFA 3RTFB 3UA8A 3IOWA 3TELA 1NNPA 1SDXA 4OFLA 3D4GA 4ELRA 5K2XA 3WAFA 4KFQA 2AYSA 3DP8A 4HCYA 2R6GE 1WDNA 4MLVA 4LZ8A 1LFIA 5KCJA 2F5XA 1P1NA 4R2FA 3FVKA 4YKIA 2XX7A 4KR5A 2O7IA 3PUYE 1VSOA 4YZZA 3RN8A 3B6TA 3IOUA 3ONMA 4PFUA 3K1NA 2Q88A 3IR1A 3TODA 3TEPA 1OMPA 4RK9A 4FIMA 4F1YA 3P7IA 2HEUA 1B51A 2XXRA 2DQVA 4H67A 4GXAA 3VDFA 1LB8A 4YB7A 3HPIA 3D4CA 3V5AA 2RCBA 4R6KA 4N13A 1MY2A 1XOCA 1JW5A 1XS5A 2ZMBA 5AA2D 1KWHA 2XXUA 4RA1A 1ZLQA 4BDNA 2D21A 5EHSA 1R9QA 5JTYB 3O6GA 1B7ZA 1LFHA 3O66A 3UIFA 1NNTA 3KEIA 1LAGE 4GL0A 4NF6B 4RPNA 1JEVA 1LGBC 4QFLA 3TDJA 3MQ9A 4F3GA 1SI1A 3E3KA 4ELQA 3UP9A 5DVIA 3FASA 2Z8EA 3PD8A 1O7TA 2P2AA 4JWYA 4NF8B 2PMSA 2HXWA 3MP1A 3RGYA 1H44A 4H6DA 3MW0A 4FJPA 2A5SA 3MP6A 1ZKBA 1LCTA 5JTYA 2XXQA 1B40A 4YB6A 3M3FA 4NF6A 3IORA 1OVBA 2F6GA 3RY3A 5L9OA 4C0RA 4JSOA 2OZZA 3TTMA 2Z23A 2LAOA 3BBRA 3RUMA 3ILUB 3QK6A 4FE8A 5IAIA 3L6HA 2HCAA 3DELB 1NNFA 3Q26A 3OO8A 3OD7A 2Y7KA 4OYVA 3M8UA 1Q1KA 1MH4A 1MY1A 4WXJA 3OO7A 1OLAA 1MRPA 5KDTB 1YPNA 4ZEKA 5A5XA 3G3FA 1MQHA 2F34A 1NMUA 3PUXE 1FTJA 4H8IA 4EQ7A 1FQFA 4F3PA 4YU0A 3RT6B 3S9EA 3BFTA 1IXCA 4QFNA 1MY0A 3LSFB 2VP1A 1XC1A 1Y3NA 1MQJA 3FUZA 1FQDA 1OIBA 2Q9TA 2YPNA 3G3KA 3RNNA 2Q2CA 3KJTA 3FGSA 4RY1A 4F3BA 3T9XB 4AB5A 5KDTA 4U22A 2XX9A 3K01A 1NFTA 3BKIB 1MY3A 2OBGA 4G8HA 1B52A 4TQUQ 2I3VA 4GIZA 4DE8A 1LCFA 2NWJA 3SETA 4ZEFA 3EHTA 3JYRA 5EHMA 3A09A 3MZBA 3G3IA 4ZDMA 3C9HA 4LQ2A 4F31B 3OSRA 1QJMA 2V84A 3H6TA 4P0IA 1US4A 4GL8A 1B6HA 1B9JA 4YMBA 4R6YA 3O9PA 1PB7A 3ECRA 3EF7A 4IO7A 1LAFE 5HBCA 1Q35A 2ZYMA 5I56B 1LAXA 1MM7A 5B70A 4FAJA 2IA4A 3Q29A 5M2VA 4YKPA 5F7VA 1H76A 1O64A 2B65A 3IB1A 1B46A 5H8NB 4DDDA 1AOVA 1TFAA 4PFYA 3U8QA 1DPPA 1CB6A 2X26A 1MPCA 2B3BA 3FD3A 3MP8A 1GV8A 4Q5TA 1IQ7A 3O29A 1PC3A 3GBAA 4GQOA 3Q25A 4MF3A 3TTNA 2F97A 2A5TB 4G68C 4PQJA 1B3GA 5I59B 4DZ1A 5DVFA 3B6QA 1FTLA 1NNKA 2F78A 1DPEA 4LONB 1NKXA 4TLMB 2YJPA
chains in the Genus database with same CATH superfamily
4C1UA 2G93A 2OX3A 1I6QA 4N6DA 2DVCA 1KA0A 5H8NA 2FBPA 1B2HA 4N07A 1ELJA 5ET5A 4YAHX 2O84X 4PAIA 4NEDA 4XF5A 2THIA 4DCYA 2ANJA 1Y1ZA 4HE2A 1CE2A 2KR0A 3KG2A 2CZHA 3CFZA 5DTBA 1EYJA 3PPNA 1P99A 2HXRA 3PUZE 4EXLA 4ZEBA 4FEDA 3O28A 1QKBA 4MX6A 1IMEA 1EH3A 1II5A 4MNPA 4GWWA 3MSTA 4GWUA 1SVXB 2ZXTA 3SKPA 2H99A 4WKMA 3VXCA 4MFIA 3LUYA 2AL5A 1Y3QA 5DW8A 3LSWA 4GWZA 4JB7A 4NHBA 2O69A 3UN6A 1FTOA 2DWIA 1LBCA 1B3EA 3E79A 2O6AA 3CR9A 1IZ1A 5J16A 5CRYA 1MS7A 4QBAA 3O6IA 3R7XA 3GXAA 3CFXA 1G0IA 1MPDA 4N91A 2DE4A 1R9LA 3RLFE 1FRPA 4XKRA 4F1VA 1B3HA 3PU5A 3S9LC 1MQGA 2VGQA 5AA1A 2ABHA 3KC1A 4MBPA 5IKBA 5H8FB 4RXLA 1H3DA 2ZYKA 4F39A 3MPKA 1N84A 1S50A 1LAHE 3R6UA 5HM4B 4X1DA 3MVWA 3C32A 3D1RA 5L9MA 4RK2A 1MXVA 4NWDA 2DDKA 1I69A 3C33A 4H65A 1POY1 2NOOA 5L9SA 2H9BA 1SW4A 3PUVE 2G29A 1B58A 4OA4A 2RC7A 4BDRA 1NV4A 1LBBA 2DXYA 2RKMA 4I1DA 4ZS9A 2GRVA 4IY5A 3EN3A 5TP9B 2V25A 4N8YA 3MBPA 3QUJA 3TTRA 5IGAA 2OCUA 1IXGA 5IZ1A 1N7WA 3BFUA 4E0WA 3GYYA 4OFJA 4JWOA 2CEYA 4QSCA 2VD2A 2PVUA 4OHNA 3IOVA 4BDOA 5LTCA 1N7XA 1RDXA 5H8FA 4R75A 2Q2AA 4PGNA 3ZS6A 2XXIA 3DP6A 1EU8A 3T93B 3UGWA 3C31A 4Q0CA 5ET6A 1A7LA 4OFOA 3U92A 4YKJA 5DEXB 1FQBA 4P1EA 5CMBA 1Y4TA 4P8BA 2XX8A 1PBQA 1PB8A 3TUSA 3KN8A 2PT1A 5TP9A 1FBHA 4GXSB 4EF2A 2UVIA 3VV5A 4LP2B 2WYKA 5HPQA 4G68B 3ZKKA 3DP4A 1B5JA 1VE4A 3SZPA 4TLLB 1US5A 2D3IA 2Z8DA 1R1NA 1TFDA 3TZAA 1IXHA 4NX1A 4IO4A 1YZ0A 1RDYA 5ICTA 2OJTA 4XIGQ 5DEXA 3RPLB 4THIA 3HO7A 1D3KA 2VD3A 4U21A 1M5EA 2I6EA 3IOTA 3VFJA 1FBDA 1MY4A 4H45A 4HW8A 2HAUA 1FQAA 3T9UA 2QVUA 1ZJLA 3VLVA 4QFOA 2OWZA 4OVQA 1SYIA 4U1OA 3WAEA 1DK4A 4ELPA 3PPQA 1BIYA 4MH5A 2F3DA 4EF1A 1NL5A 4LA9A 3HCQA 1PDAA 2Q8MA 4R73A 3SEUA 1FQEA 1MPBA 2UVJA 3PPRA 3USDA 4KXPA 3T9HB 2ONKE 5DVJA 4N81A 2GFEA 4BDLA 1MXXA 4N4UA 2RC9A 3TQWA 3RPLA 1WVJA 3B8BA 2R8TA 3SESA 3O97A 3FVNA 1RYXA 5L8DA 3N94A 4LZ7A 2ZYNA 4GFRA 4GX6A 4OQOA 3IFAA 4R72A 1RYOA 3IB2A 1FQCA 5I2NB 1S7YA 4LQ5A 1BKAA 4NF8A 3GZGA 3H3GA 3T0JA 1D9YA 4XTCQ 3ZSFA 3HV1A 3OEMA 1BP5A 3K6UA 4F3SA 3FIRA 2QVRA 4X9TA 4R6HA 3KGCA 4ECFA 1QKAA 3H6VA 1LEVA 2F35A 4GX4A 3TFLA 2Q8JA 4F22A 3IO6A 3HHGA 1ZBMA 4P56A 2ZNUA 4NGUA 2BJIA 3LC8A 4GOTA 3L6GA 4NMYA 2CZLA 1FBCA 1FPEA 1J1NA 4YKKA 4TOZA 1ANFA 5I3SA 2RF1A 3DM0A 1BLFA 4I3EA 5ICQA 4M4GA 1TT1A 4JWXA 3MWBA 3TCGA 4P1LA 5I2NA 2DWAA 3KZGA 4OVJA 3CHGA 4POXA 1EYKA 3E9XA 4PFTA 3PGFA 3O2AA 1LB9A 4PAKA 2OWSA 3LUZA 3R26A 3O6HA 3T9VA 4P0GA 3HN0A 4NF4B 4PF8A 3U1OA 3K2DA 1EZ9A 3KJ7A 2ZYOA 4O7MA 3B6WA 5CMCA 4IO3A 4R2BA 2UVHA 3FJMA 4OENA 1Y20A 3QYTA 2UVGA 1D9QA 5JEIA 5LOMA 2OLBA 3C35A 4HE0A 2REJA 1LBWA 1M5FA 1MG1A 4GWXA 3PTYA 4QHQA 1USYE 3K6VA 4MCOA 4YMAA 4HE1A 3IB0A 3OELA 1ZTYA 3MVYA 2O1MA 2Y7IA 3IJOB 4LATA 5EYFA 1GTKA 3EKIA 3BIGA 4GBWA 2H5YA 4DI3D 4Q30B 2F7BA 4HTGA 1DMBA 1D4NA 4I9DA 4PF6A 3PV0E 4JBZA 4I3YA 4DXBA 5F1QA 3G3GA 4LN5A 1B1HA 4ZE9A 1B05A 4HS7A 4X8RA 3MJNA 2X7QA 1URDA 1M5CA 1B3FA 2OWTA 2WBDA 3A3UA 4E0XA 3OMBA 1NV2A 3QIMA 2XXWA 4F19A 4WEPA 3VLUA 2WEFA 1XI6A 1MQDA 1NH7A 1A40A 5FTIA 3QAXA 3C34A 1P1OA 4ND9A 1A8FA 1LSTA 4FECA 3IAZA 4F2QA 1YTVA 3KOTA 1FSAA 4FEBA 2RINA 1OVTA 3AXFA 4KYSA 2DOJA 2DS9A 2P1SA 1FTAA 1JNFA 1P1UA 5ELVA 1N0TA 1NV0A 5I56A 4GVOA 2O7UA 4DCXA 5H8SA 2RC8A 4MIJA 4QSEA 1FTKA 3S4UA 4YICA 2FVZA 3GBBA 3PMXA 4MMPA 2KLFA 4EUOA 1LFGA 2VT5A 4UACA 3VVFA 2UYFA 3U94A 1B5IA 1NV7A 1VFEA 4PGPA 2NUVA 1ZIUA 1FBFA 4XKPA 2DE3A 4ZEIA 3KBZA 4OWDA 3FV1A 1MDQA 1EZPA 2I3WA 4KPTA 1L5TA 5CI5A 4AQ4A 2B3FA 5K2YA 1AMFA 2V3TA 1HSEA 3VVDA 1JVYA 4MHFA 3THIA 4DI4B 2AL4A 3V83A 4KCDA 3BIHA 4O3CA 1NUWA 3TKDA 2R9JA 4RPOA 4JVCA 1CNQA 2A5TA 1KA1A 3LSXA 5I59A 2GH9A 1B7HA 2Y7PA 2REGA 5A5LA 3RT8A 1H45A 2VPOA 3C36A 3V8XB 4POWA 4U4XA 2XWIA 2UXAA 4KYDA 1JVXA 1B7UA 1VR5A 5AA2B 5BUUA 2QMWA 2XD2A 2V3UA 4H1XA 3VE1B 3TAJA 4Z7EA 4ZE8A 5ITPA 3UORA 1JETA 1QULA 2XXKA 1FPGA 5BWJA 2CZIA 5I2KB 4QFKA 2AIXA 2NVUB 4PFBA 4R9GA 1XHYA 4F2OA 1DSNA 2I0CA 3KSJA 5ET7A 2WBBA 3CI8A 3MVXA 1NV3A 4HCWA 1A54A 2E0SA 3KN3A 1PEBA 5CBRA 3S9MC 3ILTB 3T22A 3IK6B 4M1VA 3K02A 1PBPA 4IB2A 3M3LA 3MZ9A 4NTLA 3CVGA 3H06B 3OOAA 1Y3PA 3I3VA 4NN3A 1LLSA 1MH3A 5AA2A 1B32A 4XXUA 2UYEA 4O3AA 4QRZA 1A99A 1XVXA 5CMMA 2Z8FA 1QUKA 1FBGA 4YB5A 4GWOA 4GF8A 2WKYA 5T3JA 4IY6A 1FPBA 3K6XA 2F36A 1XT8A 2DWJA 3FJ7A 3TTLA 4DIGA 5I2KA 5KCJB 5FHOA 1HSLA 4OZ9A 1B4ZA 4ZECA 1A55A 4BDMA 1I6BA 1B3LA 1BTJA 3W9VA 1O63A 2GHBA 3ZKLA 3T66A 2XHDA 3EHSA 1IXIA 2H4IA 2O68A 4UA8A 2P0SA 1RKMA 1BK4A 1N76A 4KQPA 5H8QB 3OENA 2QPQA 1NUXA 4H46A 1VFDA 1XVYA 5B7DA 2QSXA 1MXUA 3EHUA 1Z7NE 4G61A 4N15A 1YCJA 4G4PA 5ITOA 1LBVA 4AS5A 4PAFA 2Y7RA 2ONSA 3S9NC 3CIJA 4EQ9A 2QRYA 3FXQA 4U1ZA 4IR8A 2PYYA 1FCKA 4KD5A 4PTKA 2WX9A 4AS4A 3CSBA 3KN7A 3PMVA 4OANA 5IZ3B 3FV2A 1JQFA 3NOHA 1F9BA 2QJEA 2GQ1A 2VOZA 2I0BA 3MPLA 1UIVA 3FVGA 2XWOA 1H43A 5H8QA 2XXTA 2XXXA 3IL1B 2I48A 4X48A 2QFLA 3SEXA 4IGRA 4PC9A 3DLNA 3Q28A 4G8NA 3K1PA 1JW1A 4PFWA 4P3LA 3OEKA 1Y1MA 4F1UA 2PCRA 3C4MA 1UIUA 1OQGA 4ISUA 2QS2A 1IMDA 2HFBA 3TMGA 2XWKA 4ESWA 3H03A 1PB9A 4X1BA 4OERA 2I58A 4NAPA 2ONRA 2QS1A 5EQAA 5CBSA 2M8CA 3TYHA 4GD5A 2X7PA 1JW4A 2I49A 3FBPA 2MKZA 4WEDA 5IZZA 1I6AA 2DP8A 2HZKA 4G2ZA 4QFPA 2W7YA 3QXMA 3ODBA 3LBSA 4OMBA 2DXRA 5TPAB 3CFLA 5H8HB 4ESXA 1FPKA 2O1LA 2OK2A 2FYIA 4G68A 1QVSA 1DTZA 1Y9UA 5J1DA 2GHAA 1HSJA 3MUQA 2ZNSA 3FXUA 1MDP1 2Y84A 2IEEA 1GGGA 3K4UA 3N5LA 2F8DA 2L5VA 5AE4A 1IIWA 3FXRA 4N6KA 2DVZA 1AWBA 3I5OA 5A5XB 3UK4A 2RCAA 4NQ8A 3SERA 3MZ1A 4NWCA 4H0WA 2XXPA 4N17A 4RJZA 1B5HA 3SDFA 1QGXA 3V89B 5TPAA 5H8HA 3G3JA 1FJ6A 3PUWE 2QMXA 1QW0A 1GVCA 4ONYA 1NV6A 3FJGA 4BDQA 3CG1A 4PE3A 1DTGA 1OLCA 2KQZA 3G3HA 2PFYA 1P1WA 1TWYA 1SYHA 3H6WA 1SD3A 2B4LA 1SW2A 4P11A 2PBWA 3ISPA 1QUJA 3PMWA 3A29A 1S9TA 4OEUA 2HQ0A 4KHZE 1SW5A 5TU0A 3B7DA 1DCUA 4I62A 3F11A 4XKQA 1Z7ME 2R71A 2ZZVA 4R74A 3TCHA 1MXWA 3H4ZA 1M5DA 4F18A 2JJKA 3FATA 1T0KA 2FNCA 3U72A 3RTWB 1YYZA 2DSFA 4XEQA 3T96B 5CC2A 4QF9A 5FHNA 1URGA 3I6VA 3JV9A 5DT6A 3Q27A 4IO2A 3ROJA 4H5FA 4MAGA 5CMKA 1NV1A 1AIVA 1UTHB 1A8EA 4I8CA 3IO4A 3TQLA 4JSDA 5I58B 1WODA 1LBXA 2QS3A 3HSTA 1FPLA 3EPEA 2CMOA 4GX3A 3KBRA 1FW0A 4NF5B 3IJXB 5ET8A 1ZU0A 5AA3A 3G7WA 3A3CA 3E4RA 1IUDA 5F24A 3QSLA 2DE2A 4XKNA 2I4CA 1OQHA 3N6UA 4H5GA 4U23A 4JVDA 1ZMGA 4G8MA 2ZNTA 1DOTA 5KZTA 4GLIA 3PPOA 1R6ZA 1GR2A 4NE4A 3CSGA 4K3FA 3OO6A 4NF4A 1EZOA 3MC2A 3IX1A 1UTHA 4P9KA 3S2VA 2D5WA 5I58A 2F7CA 3K1MA 1SI0A 1LBYA 1FPFA 3IFCA 5EYHA 2HZLA 4PE5B 3H7MA 1K9ZA 2QS4A 4NF5A 2XXYA 4QSDA 2PT2A 3N6TA 2DYXA 4NG7A 5FHMA 3OSQA 1FJ9A 1MXZA 4EDPA 4OVRA 1SBPA 2V3QA 4R9FA 5AA4B 4PCDA 1N04A 3VXBA 2O51A 2PX1A 4I40A 4LVQA 1UTBB 1URSA 1FBPA 3MAMA 4ZZAA 1SPIA 3OO9A 5FTHA 3U65A 4LZ5A 1MQIA 4X04A 1FTMA 1SQYA 4F29A 1POTA 5I57B 4XFEA 1N3WA 3RYDA 4MNIA 1YAEA 2XXVA 4OXVA 1AL3A 3EQ1A 2CEXA 1JEUA 1FBEA 2DWHA 1MXYA 3KOSA 4C1TA 2ALUA 3TPAA 4DXUA 1TXFA 5DYHA 4Z0IA 1RDZA 3VLWA 4IO6A 4GRKA 1P1QA 1QUIA 4IO5A 5AA4A 1ATGA 3E13X 4OTEA 5I84A 4FATA 2HAVA 4ZZEA 3B50A 1N3XA 1B4HA 2F6PA 5EQ7A 4KYEA 4DLDA 1UTBA 1IEJA 3K0VA 4PETA 4FBPA 2QVVA 1NUZA 1SW1A 3LSLA 4G77A 4FORA 2H98A 4IGTA 3W9WA 4L17A 2P3VA 1AH5A 3W15C 5I57A 4AB6A 1B0HA 1G0HA 3QUFA 5EYGA 3H6UA 3TCFA 3HFUA 4BLAA 1INPA 5ISUA 1B1XA 4RNSA 4U2RA 3GLBA 3E78A 4OVPA 3LR1A 1VDWA 1NH8A 4DXCA 3FZVA 1FPJA 2WYPA 2H25A 4OETA 2ESNA 3RPWA 4N6PA 4O3BA 1USYH 5I5PA 3M3KA 2QL3A 4U4SA 4OEVA 3SEYA 4KCCA 2E1SA 3CRBA 3T1BA 2I4BA 1MM6A 2XXHA 2VPNA 2Z22A 5FBPA 1B0LA 3OXNA 3VVEA 3KFMA 1IITA 5JK4A 1M5BA 4EXKA 2FA7A 3SEVA 2BJJX 2VHAA 3SEWA 4ELOA 5EQ9A 4NF0A 2V93A 2Q89A 4JXIA 3FVOA 3RQTA 4H8JA 2YLNA 4Q8RA 2Y7WA 4ZEDA 3KC0A 3TTKA 2F7AA 4PBHA 4PP0A 5ESYA 3N26A 1UQWA 4JDFA 4EQBA 1NUYA 4RYAA 4MLQA 1Y4CA 4LUBA 5EQ8A 2XD3A 4PDHA 2NXOA 3KSXA 1D9VA 4OESA 3PPPA 5CM6A 3JZJA 4MNCA 3CG3A 3MVZA 3U93A 3PD9A 3K00A 3K6WA 4KI0E 3HHFA 3RTFB 3UA8A 3IOWA 3TELA 1NNPA 1SDXA 4OFLA 3D4GA 4ELRA 5K2XA 1NI9A 2FIXA 3WAFA 4KFQA 2AYSA 3DP8A 4HCYA 2R6GE 1WDNA 4MLVA 4LZ8A 1LFIA 5KCJA 2F5XA 1P1NA 4R2FA 3FVKA 1KZ8A 4YKIA 2XA5A 2XX7A 4KR5A 2O7IA 3PUYE 2F3BA 4QXDA 1VSOA 4GWSA 4YZZA 1YXIA 1IMCA 3RN8A 3B6TA 3IOUA 4PFIA 1NV5A 3ONMA 4PFUA 3K1NA 2Q88A 3IR1A 3TODA 3TEPA 1OMPA 4RK9A 4FIMA 4F1YA 3P7IA 2HEUA 1B51A 2XXRA 2DQVA 3FXBA 4GXAA 4H67A 1JP4A 3VDFA 1LB8A 4YB7A 3HPIA 3D4CA 3V5AA 2HHMA 2RCBA 4R6KA 4N13A 1MY2A 1XOCA 1JW5A 1XS5A 2ZMBA 5AA2D 1KWHA 1K9YA 2XXUA 4RA1A 1ZLQA 4BDNA 2ZZXA 2D21A 5EHSA 1R9QA 5JTYB 3O6GA 1B7ZA 1LFHA 3O66A 3UIFA 5IZ3A 1NNTA 3KEIA 1LAGE 2Y5KA 4GL0A 4NF6B 4RPNA 1JEVA 1LGBC 4QFLA 3TDJA 3MQ9A 4OVTA 4F3GA 1IMFA 4JVIA 1SI1A 3E3KA 4ELQA 3UP9A 5DVIA 3FASA 2Z8EA 3PD8A 1O7TA 2P2AA 4JWYA 4NF8B 2PMSA 2HXWA 3MP1A 4O8MA 3RGYA 1H44A 4H6DA 3MW0A 4FJPA 4MEVA 2A5SA 2P3NA 1IMAA 4P47A 3MP6A 1ZKBA 1IMBA 1LCTA 5JTYA 2XXQA 1B40A 4YB6A 5LDZA 3M3FA 4NF6A 3IORA 1OVBA 2F6GA 3RY3A 5L9OA 4C0RA 4JSOA 2OZZA 1EYIA 3TTMA 2Z23A 2LAOA 3BBRA 3RUMA 3ILUB 3QK6A 4FE8A 4GBVA 5IAIA 3L6HA 2HCAA 3DELB 1NNFA 3Q26A 3OO8A 3OD7A 2Y7KA 4OYVA 3M8UA 1Q1KA 1MH4A 1MY1A 4WXJA 3OO7A 1OLAA 1MRPA 5KDTB 1YPNA 4ZEKA 5A5XA 3G3FA 1MQHA 2F34A 1NMUA 3PUXE 1FPDA 1FTJA 4H8IA 2FIEA 4EQ7A 1FQFA 4F3PA 4PDDA 1Q9DA 3MYUA 4YU0A 3RT6B 3S9EA 3BFTA 5I7IA 1IXCA 4QFNA 4O94A 1MY0A 4O7IA 3LSFB 2VP1A 2V4CA 1XC1A 1Y3NA 1MQJA 3FUZA 4PFRA 1FQDA 1OIBA 2Q9TA 4N8GA 4MJOA 2YPNA 3G3KA 3RNNA 2Q2CA 3KJTA 3FGSA 4RY1A 4F3BA 3T9XB 4AB5A 5KDTA 4U22A 2XX9A 3K01A 3LV0A 1NFTA 3BKIB 1MY3A 2OBGA 4G8HA 1B52A 4TQUQ 2I3VA 4GIZA 2B4MA 4DE8A 1LCFA 2NWJA 3SETA 4ZEFA 3EHTA 2Q74A 3JYRA 5EHMA 3A09A 3MZBA 3G3IA 4ZDMA 3C9HA 4LQ2A 4F31B 3OSRA 1QJMA 2V84A 4GWYA 3H6TA 4P0IA 5IM2A 1US4A 4GL8A 1B6HA 1B9JA 4YMBA 4R6YA 3O9PA 1PB7A 3ECRA 3EF7A 4IO7A 2ZZWA 4OVSA 1LAFE 5HBCA 1Q35A 4HXVA 2ZYMA 5I56B 1LAXA 1MM7A 5B70A 2PFZA 4FAJA 2IA4A 1DBZA 3Q29A 3QMFA 5M2VA 4YKPA 5F7VA 1H76A 2XWVA 1O64A 2B65A 3IB1A 2FHYA 2HPGA 1B46A 5H8NB 4DDDA 1LBZA 1AOVA 1TFAA 4PFYA 3U8QA 1DPPA 1CB6A 2X26A 1MPCA 4PBQA 2B3BA 4UABA 3FD3A 3MP8A 1GV8A 4Q5TA 1IQ7A 3O29A 1PC3A 3GBAA 4GQOA 3Q25A 4MF3A 3TTNA 2F97A 2A5TB 4G68C 1FPIA 4PQJA 1B3GA 5I59B 4DZ1A 3B6QA 5DVFA 1FTLA 1NNKA 2CZKA 2Y5LA 2F78A 1DPEA 4LONB 1NKXA 4TLMB 2YJPA
chains in the Genus database with same CATH topology
4C1UA 2G93A 1I6QA 2DVCA 5H8NA 1B2HA 4N07A 1ELJA 4YAHX 2O84X 4NEDA 2THIA 4DCYA 2ANJA 1Y1ZA 1CE2A 3KG2A 3CFZA 5DTBA 3PPNA 1P99A 3PUZE 4EXLA 4ZEBA 4FEDA 3O28A 1QKBA 1EH3A 1II5A 1SVXB 2ZXTA 3SKPA 2H99A 4WKMA 3VXCA 4MFIA 3LUYA 2AL5A 1Y3QA 3LSWA 4JB7A 2O69A 3UN6A 1FTOA 2DWIA 1LBCA 1B3EA 2O6AA 3CR9A 1IZ1A 5CRYA 1MS7A 3O6IA 3R7XA 3GXAA 3CFXA 1MPDA 2DE4A 1R9LA 3RLFE 4XKRA 4F1VA 1B3HA 3PU5A 3S9LC 1MQGA 2VGQA 5AA1A 2ABHA 4MBPA 5IKBA 5H8FB 4RXLA 1H3DA 2ZYKA 4F39A 3MPKA 1N84A 1S50A 1LAHE 3R6UA 5HM4B 4X1DA 3MVWA 3C32A 5L9MA 4RK2A 1MXVA 4NWDA 1I69A 3C33A 4H65A 1POY1 2NOOA 5L9SA 2H9BA 1SW4A 3PUVE 2G29A 1B58A 2RC7A 4BDRA 1LBBA 2DXYA 2RKMA 4I1DA 4ZS9A 2GRVA 4IY5A 3EN3A 5TP9B 2V25A 3MBPA 3QUJA 3TTRA 2OCUA 1IXGA 1N7WA 3BFUA 4E0WA 4OFJA 4JWOA 4QSCA 2VD2A 2PVUA 4OHNA 3IOVA 4BDOA 1N7XA 5H8FA 4R75A 2Q2AA 3ZS6A 2XXIA 3DP6A 1EU8A 3T93B 3UGWA 3C31A 4Q0CA 1A7LA 4OFOA 3U92A 4YKJA 5DEXB 1FQBA 5CMBA 1Y4TA 2XX8A 1PBQA 1PB8A 3TUSA 3KN8A 2PT1A 5TP9A 4GXSB 4EF2A 2UVIA 3VV5A 4LP2B 5HPQA 4G68B 3ZKKA 3DP4A 1B5JA 1VE4A 4TLLB 1US5A 2D3IA 2Z8DA 1R1NA 1TFDA 3TZAA 1IXHA 4IO4A 5ICTA 2OJTA 4XIGQ 5DEXA 4THIA 3HO7A 1D3KA 2VD3A 4U21A 1M5EA 2I6EA 3IOTA 3VFJA 1MY4A 4HW8A 2HAUA 1FQAA 3T9UA 1ZJLA 3VLVA 4QFOA 1SYIA 3WAEA 4U1OA 4ELPA 3PPQA 1BIYA 4MH5A 4EF1A 1NL5A 4LA9A 3HCQA 1PDAA 4R73A 3SEUA 1FQEA 1MPBA 2UVJA 3PPRA 3USDA 3T9HB 2ONKE 5DVJA 2GFEA 4BDLA 1MXXA 2RC9A 3TQWA 1WVJA 3SESA 3O97A 3FVNA 1RYXA 5L8DA 3N94A 4LZ7A 2ZYNA 4GFRA 4OQOA 4R72A 1RYOA 3IB2A 1FQCA 5I2NB 1S7YA 4LQ5A 1BKAA 4NF8A 3GZGA 3H3GA 1D9YA 4XTCQ 3ZSFA 3HV1A 3OEMA 1BP5A 3K6UA 4F3SA 3FIRA 4X9TA 4R6HA 4ECFA 3KGCA 1QKAA 3H6VA 2F35A 3TFLA 2Q8JA 4F22A 3IO6A 3HHGA 1ZBMA 2ZNUA 3LC8A 4GOTA 3L6GA 4NMYA 2CZLA 1J1NA 4YKKA 4TOZA 1ANFA 2RF1A 3DM0A 1BLFA 5ICQA 4M4GA 1TT1A 4JWXA 3MWBA 3TCGA 5I2NA 2DWAA 3KZGA 4OVJA 4POXA 3E9XA 4PFTA 3PGFA 3O2AA 1LB9A 2OWSA 3R26A 3O6HA 3T9VA 4P0GA 3HN0A 4NF4B 3U1OA 3K2DA 1EZ9A 3KJ7A 2ZYOA 3B6WA 5CMCA 4IO3A 4R2BA 2UVHA 3FJMA 4OENA 1Y20A 3QYTA 2UVGA 5JEIA 5LOMA 2OLBA 3C35A 2REJA 1M5FA 1MG1A 4QHQA 1USYE 3K6VA 4YMAA 3IB0A 3OELA 1ZTYA 3MVYA 2O1MA 2Y7IA 3IJOB 4LATA 5EYFA 1GTKA 2H5YA 4Q30B 2F7BA 4HTGA 1DMBA 1D4NA 4I9DA 3PV0E 4JBZA 4DXBA 5F1QA 3G3GA 1B1HA 4ZE9A 1B05A 4HS7A 3MJNA 2X7QA 1URDA 1M5CA 1B3FA 2OWTA 3A3UA 4E0XA 3OMBA 3QIMA 2XXWA 4F19A 4WEPA 3VLUA 1MQDA 1NH7A 1A40A 5FTIA 3QAXA 3C34A 1P1OA 4ND9A 1A8FA 1LSTA 4FECA 3IAZA 4F2QA 1YTVA 3KOTA 4FEBA 2RINA 1OVTA 3AXFA 4KYSA 2DOJA 2DS9A 2P1SA 1JNFA 5ELVA 1P1UA 1N0TA 5I56A 4GVOA 2O7UA 4DCXA 5H8SA 2RC8A 4QSEA 1FTKA 3S4UA 4YICA 3GBBA 3PMXA 2KLFA 4EUOA 1LFGA 4UACA 3VVFA 2UYFA 3U94A 1B5IA 1VFEA 2NUVA 1ZIUA 4XKPA 2DE3A 4ZEIA 4OWDA 3FV1A 1MDQA 1EZPA 2I3WA 4KPTA 1L5TA 5CI5A 4AQ4A 2B3FA 5K2YA 1AMFA 2V3TA 1HSEA 3VVDA 1JVYA 3THIA 2AL4A 3V83A 4KCDA 4O3CA 3TKDA 2R9JA 4RPOA 2A5TA 3LSXA 5I59A 2GH9A 1B7HA 2Y7PA 2REGA 3RT8A 1H45A 3C36A 3V8XB 4POWA 4U4XA 2UXAA 4KYDA 1JVXA 1B7UA 1VR5A 5AA2B 5BUUA 2QMWA 2XD2A 2V3UA 4H1XA 3VE1B 3TAJA 4Z7EA 4ZE8A 5ITPA 3UORA 1JETA 1QULA 5BWJA 5I2KB 4QFKA 2AIXA 2NVUB 4R9GA 1XHYA 4F2OA 1DSNA 2I0CA 3KSJA 4HCWA 3CI8A 3MVXA 1A54A 2E0SA 3KN3A 1PEBA 5CBRA 3S9MC 3ILTB 3T22A 3IK6B 4M1VA 3K02A 1PBPA 4IB2A 3M3LA 3MZ9A 4NTLA 3CVGA 3H06B 3OOAA 1Y3PA 3I3VA 1LLSA 1MH3A 5AA2A 1B32A 4XXUA 2UYEA 4O3AA 4QRZA 1A99A 1XVXA 5CMMA 2Z8FA 1QUKA 4YB5A 4GWOA 4GF8A 2WKYA 4IY6A 3K6XA 2F36A 1XT8A 2DWJA 3FJ7A 3TTLA 4DIGA 5I2KA 5KCJB 5FHOA 1HSLA 4OZ9A 1B4ZA 4ZECA 1A55A 4BDMA 1I6BA 1B3LA 1BTJA 3W9VA 1O63A 2GHBA 3ZKLA 3T66A 2XHDA 3EHSA 1IXIA 2H4IA 2O68A 4UA8A 2P0SA 1RKMA 1N76A 4KQPA 5H8QB 3OENA 2QPQA 1VFDA 1XVYA 5B7DA 2QSXA 1MXUA 3EHUA 1Z7NE 1YCJA 4G4PA 5ITOA 2Y7RA 2ONSA 3S9NC 3CIJA 4EQ9A 2QRYA 3FXQA 4U1ZA 2PYYA 1FCKA 4KD5A 3CSBA 3KN7A 3PMVA 3FV2A 1JQFA 1F9BA 2QJEA 2VOZA 2I0BA 3MPLA 1UIVA 3FVGA 1H43A 5H8QA 2XXTA 2XXXA 3IL1B 2I48A 4X48A 3SEXA 4IGRA 3DLNA 3Q28A 4G8NA 3K1PA 1JW1A 4PFWA 3OEKA 1Y1MA 4F1UA 3C4MA 1UIUA 1OQGA 4ISUA 2QS2A 2HFBA 3TMGA 4ESWA 3H03A 1PB9A 4X1BA 4OERA 2I58A 2ONRA 2QS1A 5CBSA 2M8CA 3TYHA 4GD5A 2X7PA 1JW4A 2I49A 4WEDA 1I6AA 2DP8A 2HZKA 4G2ZA 4QFPA 2W7YA 3QXMA 3ODBA 3LBSA 4OMBA 2DXRA 5TPAB 3CFLA 5H8HB 4ESXA 2O1LA 2OK2A 2FYIA 4G68A 1QVSA 1DTZA 1Y9UA 5J1DA 2GHAA 1HSJA 3MUQA 2ZNSA 3FXUA 1MDP1 2Y84A 2IEEA 1GGGA 3K4UA 3N5LA 2F8DA 5AE4A 1IIWA 3FXRA 2DVZA 3I5OA 5A5XB 3UK4A 2RCAA 3SERA 3MZ1A 4NWCA 4H0WA 2XXPA 4RJZA 1B5HA 3SDFA 3V89B 5TPAA 5H8HA 3G3JA 3PUWE 2QMXA 1QW0A 1GVCA 4ONYA 3FJGA 4BDQA 3CG1A 1DTGA 1OLCA 3G3HA 1P1WA 1TWYA 1SYHA 3H6WA 1SD3A 1SW2A 4P11A 2PBWA 1QUJA 3PMWA 1S9TA 4OEUA 2HQ0A 4KHZE 1SW5A 5TU0A 3B7DA 4I62A 3F11A 4XKQA 1Z7ME 2R71A 4R74A 3TCHA 1MXWA 3H4ZA 1M5DA 4F18A 3FATA 1T0KA 2FNCA 3U72A 3RTWB 2DSFA 3T96B 5CC2A 4QF9A 5FHNA 1URGA 3I6VA 3JV9A 5DT6A 3Q27A 4IO2A 4H5FA 5CMKA 1AIVA 1UTHB 1A8EA 4I8CA 3IO4A 3TQLA 4JSDA 5I58B 1WODA 2QS3A 3HSTA 3EPEA 2CMOA 3KBRA 1FW0A 4NF5B 3IJXB 1ZU0A 5AA3A 3G7WA 3A3CA 3E4RA 1IUDA 3QSLA 2DE2A 4XKNA 2I4CA 1OQHA 3N6UA 4H5GA 4U23A 1ZMGA 4G8MA 2ZNTA 1DOTA 5KZTA 4GLIA 3PPOA 1R6ZA 1GR2A 4NE4A 3CSGA 4K3FA 3OO6A 4NF4A 1EZOA 3MC2A 3IX1A 1UTHA 3S2VA 2D5WA 5I58A 2F7CA 3K1MA 1SI0A 2HZLA 4PE5B 3H7MA 2QS4A 4NF5A 2XXYA 4QSDA 2PT2A 3N6TA 2DYXA 5FHMA 3OSQA 1MXZA 4EDPA 1SBPA 2V3QA 4R9FA 5AA4B 1N04A 3VXBA 2O51A 2PX1A 4LVQA 1UTBB 1URSA 3MAMA 4ZZAA 3OO9A 5FTHA 4LZ5A 1MQIA 1FTMA 1SQYA 4F29A 1POTA 5I57B 1N3WA 1YAEA 2XXVA 4OXVA 1AL3A 3EQ1A 1JEUA 2DWHA 1MXYA 3KOSA 4C1TA 2ALUA 3TPAA 4DXUA 1TXFA 5DYHA 4Z0IA 3VLWA 4IO6A 4GRKA 1P1QA 1QUIA 4IO5A 5AA4A 1ATGA 3E13X 4OTEA 5I84A 4FATA 2HAVA 4ZZEA 1N3XA 1B4HA 2F6PA 4KYEA 4DLDA 1UTBA 1IEJA 3K0VA 4PETA 1SW1A 3LSLA 4G77A 4FORA 2H98A 4IGTA 3W9WA 4L17A 1AH5A 3W15C 5I57A 4AB6A 1B0HA 3QUFA 3H6UA 3TCFA 4BLAA 5ISUA 1B1XA 4RNSA 4U2RA 3GLBA 3LR1A 1NH8A 4DXCA 3FZVA 2H25A 4OETA 2ESNA 3RPWA 4N6PA 4O3BA 1USYH 3M3KA 2QL3A 4U4SA 4OEVA 3SEYA 4KCCA 2E1SA 3CRBA 2I4BA 1MM6A 2XXHA 2Z22A 1B0LA 3OXNA 3VVEA 3KFMA 1IITA 5JK4A 1M5BA 4EXKA 2FA7A 3SEVA 2BJJX 2VHAA 3SEWA 4ELOA 2V93A 2Q89A 4JXIA 3FVOA 3RQTA 4H8JA 2YLNA 4Q8RA 2Y7WA 4ZEDA 3TTKA 2F7AA 4PP0A 3N26A 1UQWA 4JDFA 4EQBA 4RYAA 4MLQA 1Y4CA 4LUBA 2XD3A 2NXOA 3KSXA 1D9VA 4OESA 3PPPA 5CM6A 3JZJA 3CG3A 3MVZA 3U93A 3PD9A 3K00A 3K6WA 4KI0E 3HHFA 3RTFB 3UA8A 3IOWA 3TELA 1NNPA 1SDXA 4OFLA 3D4GA 4ELRA 5K2XA 3WAFA 4KFQA 2AYSA 3DP8A 4HCYA 2R6GE 1WDNA 4MLVA 4LZ8A 1LFIA 5KCJA 2F5XA 1P1NA 4R2FA 3FVKA 4YKIA 2XX7A 4KR5A 2O7IA 3PUYE 1VSOA 4YZZA 3RN8A 3B6TA 3IOUA 3ONMA 4PFUA 3K1NA 2Q88A 3IR1A 3TODA 3TEPA 1OMPA 4RK9A 4FIMA 4F1YA 3P7IA 2HEUA 1B51A 2XXRA 2DQVA 4H67A 4GXAA 3VDFA 1LB8A 4YB7A 3HPIA 3D4CA 3V5AA 2RCBA 4R6KA 4N13A 1MY2A 1XOCA 1JW5A 1XS5A 2ZMBA 5AA2D 1KWHA 2XXUA 4RA1A 1ZLQA 4BDNA 2D21A 5EHSA 1R9QA 5JTYB 3O6GA 1B7ZA 1LFHA 3O66A 3UIFA 1NNTA 3KEIA 1LAGE 4GL0A 4NF6B 4RPNA 1JEVA 1LGBC 4QFLA 3TDJA 3MQ9A 4F3GA 1SI1A 3E3KA 4ELQA 3UP9A 5DVIA 3FASA 2Z8EA 3PD8A 1O7TA 2P2AA 4JWYA 4NF8B 2PMSA 2HXWA 3MP1A 3RGYA 1H44A 4H6DA 3MW0A 4FJPA 2A5SA 3MP6A 1ZKBA 1LCTA 5JTYA 2XXQA 1B40A 4YB6A 3M3FA 4NF6A 3IORA 1OVBA 2F6GA 3RY3A 5L9OA 4C0RA 4JSOA 2OZZA 3TTMA 2Z23A 2LAOA 3BBRA 3RUMA 3ILUB 3QK6A 4FE8A 5IAIA 3L6HA 2HCAA 3DELB 1NNFA 3Q26A 3OO8A 3OD7A 2Y7KA 4OYVA 3M8UA 1Q1KA 1MH4A 1MY1A 4WXJA 3OO7A 1OLAA 1MRPA 5KDTB 1YPNA 4ZEKA 5A5XA 3G3FA 1MQHA 2F34A 1NMUA 3PUXE 1FTJA 4H8IA 4EQ7A 1FQFA 4F3PA 4YU0A 3RT6B 3S9EA 3BFTA 1IXCA 4QFNA 1MY0A 3LSFB 2VP1A 1XC1A 1Y3NA 1MQJA 3FUZA 1FQDA 1OIBA 2Q9TA 2YPNA 3G3KA 3RNNA 2Q2CA 3KJTA 3FGSA 4RY1A 4F3BA 3T9XB 4AB5A 5KDTA 4U22A 2XX9A 3K01A 1NFTA 3BKIB 1MY3A 2OBGA 4G8HA 1B52A 4TQUQ 2I3VA 4GIZA 4DE8A 1LCFA 2NWJA 3SETA 4ZEFA 3EHTA 3JYRA 5EHMA 3A09A 3MZBA 3G3IA 4ZDMA 3C9HA 4LQ2A 4F31B 3OSRA 1QJMA 2V84A 3H6TA 4P0IA 1US4A 4GL8A 1B6HA 1B9JA 4YMBA 4R6YA 3O9PA 1PB7A 3ECRA 3EF7A 4IO7A 1LAFE 5HBCA 1Q35A 2ZYMA 5I56B 1LAXA 1MM7A 5B70A 4FAJA 2IA4A 3Q29A 5M2VA 4YKPA 5F7VA 1H76A 1O64A 2B65A 3IB1A 1B46A 5H8NB 4DDDA 1AOVA 1TFAA 4PFYA 3U8QA 1DPPA 1CB6A 2X26A 1MPCA 2B3BA 3FD3A 3MP8A 1GV8A 4Q5TA 1IQ7A 3O29A 1PC3A 3GBAA 4GQOA 3Q25A 4MF3A 3TTNA 2F97A 2A5TB 4G68C 4PQJA 1B3GA 5I59B 4DZ1A 5DVFA 3B6QA 1FTLA 1NNKA 2F78A 1DPEA 4LONB 1NKXA 4TLMB 2YJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C1U A;  2G93 A;  1I6Q A;  2DVC A;  5H8N A;  1B2H A;  4N07 A;  1ELJ A;  4YAH X;  2O84 X;  4NED A;  2THI A;  4DCY A;  2ANJ A;  1Y1Z A;  1CE2 A;  3KG2 A;  3CFZ A;  5DTB A;  3PPN A;  1P99 A;  3PUZ E;  4EXL A;  4ZEB A;  4FED A;  3O28 A;  1QKB A;  1EH3 A;  1II5 A;  1SVX B;  2ZXT A;  3SKP A;  2H99 A;  4WKM A;  3VXC A;  4MFI A;  3LUY A;  2AL5 A;  1Y3Q A;  3LSW A;  4JB7 A;  2O69 A;  3UN6 A;  1FTO A;  2DWI A;  1LBC A;  1B3E A;  2O6A A;  3CR9 A;  1IZ1 A;  5CRY A;  1MS7 A;  3O6I A;  3R7X A;  3GXA A;  3CFX A;  1MPD A;  2DE4 A;  1R9L A;  3RLF E;  4XKR A;  4F1V A;  1B3H A;  3PU5 A;  3S9L C;  1MQG A;  2VGQ A;  5AA1 A;  2ABH A;  4MBP A;  5IKB A;  5H8F B;  4RXL A;  1H3D A;  2ZYK A;  4F39 A;  3MPK A;  1N84 A;  1S50 A;  1LAH E;  3R6U A;  5HM4 B;  4X1D A;  3MVW A;  3C32 A;  5L9M A;  4RK2 A;  1MXV A;  4NWD A;  1I69 A;  3C33 A;  4H65 A;  1POY 1;  2NOO A;  5L9S A;  2H9B A;  1SW4 A;  3PUV E;  2G29 A;  1B58 A;  2RC7 A;  4BDR A;  1LBB A;  2DXY A;  2RKM A;  4I1D A;  4ZS9 A;  2GRV A;  4IY5 A;  3EN3 A;  5TP9 B;  2V25 A;  3MBP A;  3QUJ A;  3TTR A;  2OCU A;  1IXG A;  1N7W A;  3BFU A;  4E0W A;  4OFJ A;  4JWO A;  4QSC A;  2VD2 A;  2PVU A;  4OHN A;  3IOV A;  4BDO A;  1N7X A;  5H8F A;  4R75 A;  2Q2A A;  3ZS6 A;  2XXI A;  3DP6 A;  1EU8 A;  3T93 B;  3UGW A;  3C31 A;  4Q0C A;  1A7L A;  4OFO A;  3U92 A;  4YKJ A;  5DEX B;  1FQB A;  5CMB A;  1Y4T A;  2XX8 A;  1PBQ A;  1PB8 A;  3TUS A;  3KN8 A;  2PT1 A;  5TP9 A;  4GXS B;  4EF2 A;  2UVI A;  3VV5 A;  4LP2 B;  5HPQ A;  4G68 B;  3ZKK A;  3DP4 A;  1B5J A;  1VE4 A;  4TLL B;  1US5 A;  2D3I A;  2Z8D A;  1R1N A;  1TFD A;  3TZA A;  1IXH A;  4IO4 A;  5ICT A;  2OJT A;  4XIG Q;  5DEX A;  4THI A;  3HO7 A;  1D3K A;  2VD3 A;  4U21 A;  1M5E A;  2I6E A;  3IOT A;  3VFJ A;  1MY4 A;  4HW8 A;  2HAU A;  1FQA A;  3T9U A;  1ZJL A;  3VLV A;  4QFO A;  1SYI A;  3WAE A;  4U1O A;  4ELP A;  3PPQ A;  1BIY A;  4MH5 A;  4EF1 A;  1NL5 A;  4LA9 A;  3HCQ A;  1PDA A;  4R73 A;  3SEU A;  1FQE A;  1MPB A;  2UVJ A;  3PPR A;  3USD A;  3T9H B;  2ONK E;  5DVJ A;  2GFE A;  4BDL A;  1MXX A;  2RC9 A;  3TQW A;  1WVJ A;  3SES A;  3O97 A;  3FVN A;  1RYX A;  5L8D A;  3N94 A;  4LZ7 A;  2ZYN A;  4GFR A;  4OQO A;  4R72 A;  1RYO A;  3IB2 A;  1FQC A;  5I2N B;  1S7Y A;  4LQ5 A;  1BKA A;  4NF8 A;  3GZG A;  3H3G A;  1D9Y A;  4XTC Q;  3ZSF A;  3HV1 A;  3OEM A;  1BP5 A;  3K6U A;  4F3S A;  3FIR A;  4X9T A;  4R6H A;  4ECF A;  3KGC A;  1QKA A;  3H6V A;  2F35 A;  3TFL A;  2Q8J A;  4F22 A;  3IO6 A;  3HHG A;  1ZBM A;  2ZNU A;  3LC8 A;  4GOT A;  3L6G A;  4NMY A;  2CZL A;  1J1N A;  4YKK A;  4TOZ A;  1ANF A;  2RF1 A;  3DM0 A;  1BLF A;  5ICQ A;  4M4G A;  1TT1 A;  4JWX A;  3MWB A;  3TCG A;  5I2N A;  2DWA A;  3KZG A;  4OVJ A;  4POX A;  3E9X A;  4PFT A;  3PGF A;  3O2A A;  1LB9 A;  2OWS A;  3R26 A;  3O6H A;  3T9V A;  4P0G A;  3HN0 A;  4NF4 B;  3U1O A;  3K2D A;  1EZ9 A;  3KJ7 A;  2ZYO A;  3B6W A;  5CMC A;  4IO3 A;  4R2B A;  2UVH A;  3FJM A;  4OEN A;  1Y20 A;  3QYT A;  2UVG A;  5JEI A;  5LOM A;  2OLB A;  3C35 A;  2REJ A;  1M5F A;  1MG1 A;  4QHQ A;  1USY E;  3K6V A;  4YMA A;  3IB0 A;  3OEL A;  1ZTY A;  3MVY A;  2O1M A;  2Y7I A;  3IJO B;  4LAT A;  5EYF A;  1GTK A;  2H5Y A;  4Q30 B;  2F7B A;  4HTG A;  1DMB A;  1D4N A;  4I9D A;  3PV0 E;  4JBZ A;  4DXB A;  5F1Q A;  3G3G A;  1B1H A;  4ZE9 A;  1B05 A;  4HS7 A;  3MJN A;  2X7Q A;  1URD A;  1M5C A;  1B3F A;  2OWT A;  3A3U A;  4E0X A;  3OMB A;  3QIM A;  2XXW A;  4F19 A;  4WEP A;  3VLU A;  1MQD A;  1NH7 A;  1A40 A;  5FTI A;  3QAX A;  3C34 A;  1P1O A;  4ND9 A;  1A8F A;  1LST A;  4FEC A;  3IAZ A;  4F2Q A;  1YTV A;  3KOT A;  4FEB A;  2RIN A;  1OVT A;  3AXF A;  4KYS A;  2DOJ A;  2DS9 A;  2P1S A;  1JNF A;  5ELV A;  1P1U A;  1N0T A;  5I56 A;  4GVO A;  2O7U A;  4DCX A;  5H8S A;  2RC8 A;  4QSE A;  1FTK A;  3S4U A;  4YIC A;  3GBB A;  3PMX A;  2KLF A;  4EUO A;  1LFG A;  4UAC A;  3VVF A;  2UYF A;  3U94 A;  1B5I A;  1VFE A;  2NUV A;  1ZIU A;  4XKP A;  2DE3 A;  4ZEI A;  4OWD A;  3FV1 A;  1MDQ A;  1EZP A;  2I3W A;  4KPT A;  1L5T A;  5CI5 A;  4AQ4 A;  2B3F A;  5K2Y A;  1AMF A;  2V3T A;  1HSE A;  3VVD A;  1JVY A;  3THI A;  2AL4 A;  3V83 A;  4KCD A;  4O3C A;  3TKD A;  2R9J A;  4RPO A;  2A5T A;  3LSX A;  5I59 A;  2GH9 A;  1B7H A;  2Y7P A;  2REG A;  3RT8 A;  1H45 A;  3C36 A;  3V8X B;  4POW A;  4U4X A;  2UXA A;  4KYD A;  1JVX A;  1B7U A;  1VR5 A;  5AA2 B;  5BUU A;  2QMW A;  2XD2 A;  2V3U A;  4H1X A;  3VE1 B;  3TAJ A;  4Z7E A;  4ZE8 A;  5ITP A;  3UOR A;  1JET A;  1QUL A;  5BWJ A;  5I2K B;  4QFK A;  2AIX A;  2NVU B;  4R9G A;  1XHY A;  4F2O A;  1DSN A;  2I0C A;  3KSJ A;  4HCW A;  3CI8 A;  3MVX A;  1A54 A;  2E0S A;  3KN3 A;  1PEB A;  5CBR A;  3S9M C;  3ILT B;  3T22 A;  3IK6 B;  4M1V A;  3K02 A;  1PBP A;  4IB2 A;  3M3L A;  3MZ9 A;  4NTL A;  3CVG A;  3H06 B;  3OOA A;  1Y3P A;  3I3V A;  1LLS A;  1MH3 A;  5AA2 A;  1B32 A;  4XXU A;  2UYE A;  4O3A A;  4QRZ A;  1A99 A;  1XVX A;  5CMM A;  2Z8F A;  1QUK A;  4YB5 A;  4GWO A;  4GF8 A;  2WKY A;  4IY6 A;  3K6X A;  2F36 A;  1XT8 A;  2DWJ A;  3FJ7 A;  3TTL A;  4DIG A;  5I2K A;  5KCJ B;  5FHO A;  1HSL A;  4OZ9 A;  1B4Z A;  4ZEC A;  1A55 A;  4BDM A;  1I6B A;  1B3L A;  1BTJ A;  3W9V A;  1O63 A;  2GHB A;  3ZKL A;  3T66 A;  2XHD A;  3EHS A;  1IXI A;  2H4I A;  2O68 A;  4UA8 A;  2P0S A;  1RKM A;  1N76 A;  4KQP A;  5H8Q B;  3OEN A;  2QPQ A;  1VFD A;  1XVY A;  5B7D A;  2QSX A;  1MXU A;  3EHU A;  1Z7N E;  1YCJ A;  4G4P A;  5ITO A;  2Y7R A;  2ONS A;  3S9N C;  3CIJ A;  4EQ9 A;  2QRY A;  3FXQ A;  4U1Z A;  2PYY A;  1FCK A;  4KD5 A;  3CSB A;  3KN7 A;  3PMV A;  3FV2 A;  1JQF A;  1F9B A;  2QJE A;  2VOZ A;  2I0B A;  3MPL A;  1UIV A;  3FVG A;  1H43 A;  5H8Q A;  2XXT A;  2XXX A;  3IL1 B;  2I48 A;  4X48 A;  3SEX A;  4IGR A;  3DLN A;  3Q28 A;  4G8N A;  3K1P A;  1JW1 A;  4PFW A;  3OEK A;  1Y1M A;  4F1U A;  3C4M A;  1UIU A;  1OQG A;  4ISU A;  2QS2 A;  2HFB A;  3TMG A;  4ESW A;  3H03 A;  1PB9 A;  4X1B A;  4OER A;  2I58 A;  2ONR A;  2QS1 A;  5CBS A;  2M8C A;  3TYH A;  4GD5 A;  2X7P A;  1JW4 A;  2I49 A;  4WED A;  1I6A A;  2DP8 A;  2HZK A;  4G2Z A;  4QFP A;  2W7Y A;  3QXM A;  3ODB A;  3LBS A;  4OMB A;  2DXR A;  5TPA B;  3CFL A;  5H8H B;  4ESX A;  2O1L A;  2OK2 A;  2FYI A;  4G68 A;  1QVS A;  1DTZ A;  1Y9U A;  5J1D A;  2GHA A;  1HSJ A;  3MUQ A;  2ZNS A;  3FXU A;  1MDP 1;  2Y84 A;  2IEE A;  1GGG A;  3K4U A;  3N5L A;  2F8D A;  5AE4 A;  1IIW A;  3FXR A;  2DVZ A;  3I5O A;  5A5X B;  3UK4 A;  2RCA A;  3SER A;  3MZ1 A;  4NWC A;  4H0W A;  2XXP A;  4RJZ A;  1B5H A;  3SDF A;  3V89 B;  5TPA A;  5H8H A;  3G3J A;  3PUW E;  2QMX A;  1QW0 A;  1GVC A;  4ONY A;  3FJG A;  4BDQ A;  3CG1 A;  1DTG A;  1OLC A;  3G3H A;  1P1W A;  1TWY A;  1SYH A;  3H6W A;  1SD3 A;  1SW2 A;  4P11 A;  2PBW A;  1QUJ A;  3PMW A;  1S9T A;  4OEU A;  2HQ0 A;  4KHZ E;  1SW5 A;  5TU0 A;  3B7D A;  4I62 A;  3F11 A;  4XKQ A;  1Z7M E;  2R71 A;  4R74 A;  3TCH A;  1MXW A;  3H4Z A;  1M5D A;  4F18 A;  3FAT A;  1T0K A;  2FNC A;  3U72 A;  3RTW B;  2DSF A;  3T96 B;  5CC2 A;  4QF9 A;  5FHN A;  1URG A;  3I6V A;  3JV9 A;  5DT6 A;  3Q27 A;  4IO2 A;  4H5F A;  5CMK A;  1AIV A;  1UTH B;  1A8E A;  4I8C A;  3IO4 A;  3TQL A;  4JSD A;  5I58 B;  1WOD A;  2QS3 A;  3HST A;  3EPE A;  2CMO A;  3KBR A;  1FW0 A;  4NF5 B;  3IJX B;  1ZU0 A;  5AA3 A;  3G7W A;  3A3C A;  3E4R A;  1IUD A;  3QSL A;  2DE2 A;  4XKN A;  2I4C A;  1OQH A;  3N6U A;  4H5G A;  4U23 A;  1ZMG A;  4G8M A;  2ZNT A;  1DOT A;  5KZT A;  4GLI A;  3PPO A;  1R6Z A;  1GR2 A;  4NE4 A;  3CSG A;  4K3F A;  3OO6 A;  4NF4 A;  1EZO A;  3MC2 A;  3IX1 A;  1UTH A;  3S2V A;  2D5W A;  5I58 A;  2F7C A;  3K1M A;  1SI0 A;  2HZL A;  4PE5 B;  3H7M A;  2QS4 A;  4NF5 A;  2XXY A;  4QSD A;  2PT2 A;  3N6T A;  2DYX A;  5FHM A;  3OSQ A;  1MXZ A;  4EDP A;  1SBP A;  2V3Q A;  4R9F A;  5AA4 B;  1N04 A;  3VXB A;  2O51 A;  2PX1 A;  4LVQ A;  1UTB B;  1URS A;  3MAM A;  4ZZA A;  3OO9 A;  5FTH A;  4LZ5 A;  1MQI A;  1FTM A;  1SQY A;  4F29 A;  1POT A;  5I57 B;  1N3W A;  1YAE A;  2XXV A;  4OXV A;  1AL3 A;  3EQ1 A;  1JEU A;  2DWH A;  1MXY A;  3KOS A;  4C1T A;  2ALU A;  3TPA A;  4DXU A;  1TXF A;  5DYH A;  4Z0I A;  3VLW A;  4IO6 A;  4GRK A;  1P1Q A;  1QUI A;  4IO5 A;  5AA4 A;  1ATG A;  3E13 X;  4OTE A;  5I84 A;  4FAT A;  2HAV A;  4ZZE A;  1N3X A;  1B4H A;  2F6P A;  4KYE A;  4DLD A;  1UTB A;  1IEJ A;  3K0V A;  4PET A;  1SW1 A;  3LSL A;  4G77 A;  4FOR A;  2H98 A;  4IGT A;  3W9W A;  4L17 A;  1AH5 A;  3W15 C;  5I57 A;  4AB6 A;  1B0H A;  3QUF A;  3H6U A;  3TCF A;  4BLA A;  5ISU A;  1B1X A;  4RNS A;  4U2R A;  3GLB A;  3LR1 A;  1NH8 A;  4DXC A;  3FZV A;  2H25 A;  4OET A;  2ESN A;  3RPW A;  4N6P A;  4O3B A;  1USY H;  3M3K A;  2QL3 A;  4U4S A;  4OEV A;  3SEY A;  4KCC A;  2E1S A;  3CRB A;  2I4B A;  1MM6 A;  2XXH A;  2Z22 A;  1B0L A;  3OXN A;  3VVE A;  3KFM A;  1IIT A;  5JK4 A;  1M5B A;  4EXK A;  2FA7 A;  3SEV A;  2BJJ X;  2VHA A;  3SEW A;  4ELO A;  2V93 A;  2Q89 A;  4JXI A;  3FVO A;  3RQT A;  4H8J A;  2YLN A;  4Q8R A;  2Y7W A;  4ZED A;  3TTK A;  2F7A A;  4PP0 A;  3N26 A;  1UQW A;  4JDF A;  4EQB A;  4RYA A;  4MLQ A;  1Y4C A;  4LUB A;  2XD3 A;  2NXO A;  3KSX A;  1D9V A;  4OES A;  3PPP A;  5CM6 A;  3JZJ A;  3CG3 A;  3MVZ A;  3U93 A;  3PD9 A;  3K00 A;  3K6W A;  4KI0 E;  3HHF A;  3RTF B;  3UA8 A;  3IOW A;  3TEL A;  1NNP A;  1SDX A;  4OFL A;  3D4G A;  4ELR A;  5K2X A;  3WAF A;  4KFQ A;  2AYS A;  3DP8 A;  4HCY A;  2R6G E;  1WDN A;  4MLV A;  4LZ8 A;  1LFI A;  5KCJ A;  2F5X A;  1P1N A;  4R2F A;  3FVK A;  4YKI A;  2XX7 A;  4KR5 A;  2O7I A;  3PUY E;  1VSO A;  4YZZ A;  3RN8 A;  3B6T A;  3IOU A;  3ONM A;  4PFU A;  3K1N A;  2Q88 A;  3IR1 A;  3TOD A;  3TEP A;  1OMP A;  4RK9 A;  4FIM A;  4F1Y A;  3P7I A;  2HEU A;  1B51 A;  2XXR A;  2DQV A;  4H67 A;  4GXA A;  3VDF A;  1LB8 A;  4YB7 A;  3HPI A;  3D4C A;  3V5A A;  2RCB A;  4R6K A;  4N13 A;  1MY2 A;  1XOC A;  1JW5 A;  1XS5 A;  2ZMB A;  5AA2 D;  1KWH A;  2XXU A;  4RA1 A;  1ZLQ A;  4BDN A;  2D21 A;  5EHS A;  1R9Q A;  5JTY B;  3O6G A;  1B7Z A;  1LFH A;  3O66 A;  3UIF A;  1NNT A;  3KEI A;  1LAG E;  4GL0 A;  4NF6 B;  4RPN A;  1JEV A;  1LGB C;  4QFL A;  3TDJ A;  3MQ9 A;  4F3G A;  1SI1 A;  3E3K A;  4ELQ A;  3UP9 A;  5DVI A;  3FAS A;  2Z8E A;  3PD8 A;  1O7T A;  2P2A A;  4JWY A;  4NF8 B;  2PMS A;  2HXW A;  3MP1 A;  3RGY A;  1H44 A;  4H6D A;  3MW0 A;  4FJP A;  2A5S A;  3MP6 A;  1ZKB A;  1LCT A;  5JTY A;  2XXQ A;  1B40 A;  4YB6 A;  3M3F A;  4NF6 A;  3IOR A;  1OVB A;  2F6G A;  3RY3 A;  5L9O A;  4C0R A;  4JSO A;  2OZZ A;  3TTM A;  2Z23 A;  2LAO A;  3BBR A;  3RUM A;  3ILU B;  3QK6 A;  4FE8 A;  5IAI A;  3L6H A;  2HCA A;  3DEL B;  1NNF A;  3Q26 A;  3OO8 A;  3OD7 A;  2Y7K A;  4OYV A;  3M8U A;  1Q1K A;  1MH4 A;  1MY1 A;  4WXJ A;  3OO7 A;  1OLA A;  1MRP A;  5KDT B;  1YPN A;  4ZEK A;  5A5X A;  3G3F A;  1MQH A;  2F34 A;  1NMU A;  3PUX E;  1FTJ A;  4H8I A;  4EQ7 A;  1FQF A;  4F3P A;  4YU0 A;  3RT6 B;  3S9E A;  3BFT A;  1IXC A;  4QFN A;  1MY0 A;  3LSF B;  2VP1 A;  1XC1 A;  1Y3N A;  1MQJ A;  3FUZ A;  1FQD A;  1OIB A;  2Q9T A;  2YPN A;  3G3K A;  3RNN A;  2Q2C A;  3KJT A;  3FGS A;  4RY1 A;  4F3B A;  3T9X B;  4AB5 A;  5KDT A;  4U22 A;  2XX9 A;  3K01 A;  1NFT A;  3BKI B;  1MY3 A;  2OBG A;  4G8H A;  1B52 A;  4TQU Q;  2I3V A;  4GIZ A;  4DE8 A;  1LCF A;  2NWJ A;  3SET A;  4ZEF A;  3EHT A;  3JYR A;  5EHM A;  3A09 A;  3MZB A;  3G3I A;  4ZDM A;  3C9H A;  4LQ2 A;  4F31 B;  3OSR A;  1QJM A;  2V84 A;  3H6T A;  4P0I A;  1US4 A;  4GL8 A;  1B6H A;  1B9J A;  4YMB A;  4R6Y A;  3O9P A;  1PB7 A;  3ECR A;  3EF7 A;  4IO7 A;  1LAF E;  5HBC A;  1Q35 A;  2ZYM A;  5I56 B;  1LAX A;  1MM7 A;  5B70 A;  4FAJ A;  2IA4 A;  3Q29 A;  5M2V A;  4YKP A;  5F7V A;  1H76 A;  1O64 A;  2B65 A;  3IB1 A;  1B46 A;  5H8N B;  4DDD A;  1AOV A;  1TFA A;  4PFY A;  3U8Q A;  1DPP A;  1CB6 A;  2X26 A;  1MPC A;  2B3B A;  3FD3 A;  3MP8 A;  1GV8 A;  4Q5T A;  1IQ7 A;  3O29 A;  1PC3 A;  3GBA A;  4GQO A;  3Q25 A;  4MF3 A;  3TTN A;  2F97 A;  2A5T B;  4G68 C;  4PQJ A;  1B3G A;  5I59 B;  4DZ1 A;  5DVF A;  3B6Q A;  1FTL A;  1NNK A;  2F78 A;  1DPE A;  4LON B;  1NKX A;  4TLM B;  2YJP A; 
#chains in the Genus database with same CATH topology
 4C1U A;  2G93 A;  2OX3 A;  1I6Q A;  4N6D A;  2DVC A;  1KA0 A;  5H8N A;  2FBP A;  1B2H A;  4N07 A;  1ELJ A;  5ET5 A;  4YAH X;  2O84 X;  4PAI A;  4NED A;  4XF5 A;  2THI A;  4DCY A;  2ANJ A;  1Y1Z A;  4HE2 A;  1CE2 A;  2KR0 A;  3KG2 A;  2CZH A;  3CFZ A;  5DTB A;  1EYJ A;  3PPN A;  1P99 A;  2HXR A;  3PUZ E;  4EXL A;  4ZEB A;  4FED A;  3O28 A;  1QKB A;  4MX6 A;  1IME A;  1EH3 A;  1II5 A;  4MNP A;  4GWW A;  3MST A;  4GWU A;  1SVX B;  2ZXT A;  3SKP A;  2H99 A;  4WKM A;  3VXC A;  4MFI A;  3LUY A;  2AL5 A;  1Y3Q A;  5DW8 A;  3LSW A;  4GWZ A;  4JB7 A;  4NHB A;  2O69 A;  3UN6 A;  1FTO A;  2DWI A;  1LBC A;  1B3E A;  3E79 A;  2O6A A;  3CR9 A;  1IZ1 A;  5J16 A;  5CRY A;  1MS7 A;  4QBA A;  3O6I A;  3R7X A;  3GXA A;  3CFX A;  1G0I A;  1MPD A;  4N91 A;  2DE4 A;  1R9L A;  3RLF E;  1FRP A;  4XKR A;  4F1V A;  1B3H A;  3PU5 A;  3S9L C;  1MQG A;  2VGQ A;  5AA1 A;  2ABH A;  3KC1 A;  4MBP A;  5IKB A;  5H8F B;  4RXL A;  1H3D A;  2ZYK A;  4F39 A;  3MPK A;  1N84 A;  1S50 A;  1LAH E;  3R6U A;  5HM4 B;  4X1D A;  3MVW A;  3C32 A;  3D1R A;  5L9M A;  4RK2 A;  1MXV A;  4NWD A;  2DDK A;  1I69 A;  3C33 A;  4H65 A;  1POY 1;  2NOO A;  5L9S A;  2H9B A;  1SW4 A;  3PUV E;  2G29 A;  1B58 A;  4OA4 A;  2RC7 A;  4BDR A;  1NV4 A;  1LBB A;  2DXY A;  2RKM A;  4I1D A;  4ZS9 A;  2GRV A;  4IY5 A;  3EN3 A;  5TP9 B;  2V25 A;  4N8Y A;  3MBP A;  3QUJ A;  3TTR A;  5IGA A;  2OCU A;  1IXG A;  5IZ1 A;  1N7W A;  3BFU A;  4E0W A;  3GYY A;  4OFJ A;  4JWO A;  2CEY A;  4QSC A;  2VD2 A;  2PVU A;  4OHN A;  3IOV A;  4BDO A;  5LTC A;  1N7X A;  1RDX A;  5H8F A;  4R75 A;  2Q2A A;  4PGN A;  3ZS6 A;  2XXI A;  3DP6 A;  1EU8 A;  3T93 B;  3UGW A;  3C31 A;  4Q0C A;  5ET6 A;  1A7L A;  4OFO A;  3U92 A;  4YKJ A;  5DEX B;  1FQB A;  4P1E A;  5CMB A;  1Y4T A;  4P8B A;  2XX8 A;  1PBQ A;  1PB8 A;  3TUS A;  3KN8 A;  2PT1 A;  5TP9 A;  1FBH A;  4GXS B;  4EF2 A;  2UVI A;  3VV5 A;  4LP2 B;  2WYK A;  5HPQ A;  4G68 B;  3ZKK A;  3DP4 A;  1B5J A;  1VE4 A;  3SZP A;  4TLL B;  1US5 A;  2D3I A;  2Z8D A;  1R1N A;  1TFD A;  3TZA A;  1IXH A;  4NX1 A;  4IO4 A;  1YZ0 A;  1RDY A;  5ICT A;  2OJT A;  4XIG Q;  5DEX A;  3RPL B;  4THI A;  3HO7 A;  1D3K A;  2VD3 A;  4U21 A;  1M5E A;  2I6E A;  3IOT A;  3VFJ A;  1FBD A;  1MY4 A;  4H45 A;  4HW8 A;  2HAU A;  1FQA A;  3T9U A;  2QVU A;  1ZJL A;  3VLV A;  4QFO A;  2OWZ A;  4OVQ A;  1SYI A;  4U1O A;  3WAE A;  1DK4 A;  4ELP A;  3PPQ A;  1BIY A;  4MH5 A;  2F3D A;  4EF1 A;  1NL5 A;  4LA9 A;  3HCQ A;  1PDA A;  2Q8M A;  4R73 A;  3SEU A;  1FQE A;  1MPB A;  2UVJ A;  3PPR A;  3USD A;  4KXP A;  3T9H B;  2ONK E;  5DVJ A;  4N81 A;  2GFE A;  4BDL A;  1MXX A;  4N4U A;  2RC9 A;  3TQW A;  3RPL A;  1WVJ A;  3B8B A;  2R8T A;  3SES A;  3O97 A;  3FVN A;  1RYX A;  5L8D A;  3N94 A;  4LZ7 A;  2ZYN A;  4GFR A;  4GX6 A;  4OQO A;  3IFA A;  4R72 A;  1RYO A;  3IB2 A;  1FQC A;  5I2N B;  1S7Y A;  4LQ5 A;  1BKA A;  4NF8 A;  3GZG A;  3H3G A;  3T0J A;  1D9Y A;  4XTC Q;  3ZSF A;  3HV1 A;  3OEM A;  1BP5 A;  3K6U A;  4F3S A;  3FIR A;  2QVR A;  4X9T A;  4R6H A;  3KGC A;  4ECF A;  1QKA A;  3H6V A;  1LEV A;  2F35 A;  4GX4 A;  3TFL A;  2Q8J A;  4F22 A;  3IO6 A;  3HHG A;  1ZBM A;  4P56 A;  2ZNU A;  4NGU A;  2BJI A;  3LC8 A;  4GOT A;  3L6G A;  4NMY A;  2CZL A;  1FBC A;  1FPE A;  1J1N A;  4YKK A;  4TOZ A;  1ANF A;  5I3S A;  2RF1 A;  3DM0 A;  1BLF A;  4I3E A;  5ICQ A;  4M4G A;  1TT1 A;  4JWX A;  3MWB A;  3TCG A;  4P1L A;  5I2N A;  2DWA A;  3KZG A;  4OVJ A;  3CHG A;  4POX A;  1EYK A;  3E9X A;  4PFT A;  3PGF A;  3O2A A;  1LB9 A;  4PAK A;  2OWS A;  3LUZ A;  3R26 A;  3O6H A;  3T9V A;  4P0G A;  3HN0 A;  4NF4 B;  4PF8 A;  3U1O A;  3K2D A;  1EZ9 A;  3KJ7 A;  2ZYO A;  4O7M A;  3B6W A;  5CMC A;  4IO3 A;  4R2B A;  2UVH A;  3FJM A;  4OEN A;  1Y20 A;  3QYT A;  2UVG A;  1D9Q A;  5JEI A;  5LOM A;  2OLB A;  3C35 A;  4HE0 A;  2REJ A;  1LBW A;  1M5F A;  1MG1 A;  4GWX A;  3PTY A;  4QHQ A;  1USY E;  3K6V A;  4MCO A;  4YMA A;  4HE1 A;  3IB0 A;  3OEL A;  1ZTY A;  3MVY A;  2O1M A;  2Y7I A;  3IJO B;  4LAT A;  5EYF A;  1GTK A;  3EKI A;  3BIG A;  4GBW A;  2H5Y A;  4DI3 D;  4Q30 B;  2F7B A;  4HTG A;  1DMB A;  1D4N A;  4I9D A;  4PF6 A;  3PV0 E;  4JBZ A;  4I3Y A;  4DXB A;  5F1Q A;  3G3G A;  4LN5 A;  1B1H A;  4ZE9 A;  1B05 A;  4HS7 A;  4X8R A;  3MJN A;  2X7Q A;  1URD A;  1M5C A;  1B3F A;  2OWT A;  2WBD A;  3A3U A;  4E0X A;  3OMB A;  1NV2 A;  3QIM A;  2XXW A;  4F19 A;  4WEP A;  3VLU A;  2WEF A;  1XI6 A;  1MQD A;  1NH7 A;  1A40 A;  5FTI A;  3QAX A;  3C34 A;  1P1O A;  4ND9 A;  1A8F A;  1LST A;  4FEC A;  3IAZ A;  4F2Q A;  1YTV A;  3KOT A;  1FSA A;  4FEB A;  2RIN A;  1OVT A;  3AXF A;  4KYS A;  2DOJ A;  2DS9 A;  2P1S A;  1FTA A;  1JNF A;  1P1U A;  5ELV A;  1N0T A;  1NV0 A;  5I56 A;  4GVO A;  2O7U A;  4DCX A;  5H8S A;  2RC8 A;  4MIJ A;  4QSE A;  1FTK A;  3S4U A;  4YIC A;  2FVZ A;  3GBB A;  3PMX A;  4MMP A;  2KLF A;  4EUO A;  1LFG A;  2VT5 A;  4UAC A;  3VVF A;  2UYF A;  3U94 A;  1B5I A;  1NV7 A;  1VFE A;  4PGP A;  2NUV A;  1ZIU A;  1FBF A;  4XKP A;  2DE3 A;  4ZEI A;  3KBZ A;  4OWD A;  3FV1 A;  1MDQ A;  1EZP A;  2I3W A;  4KPT A;  1L5T A;  5CI5 A;  4AQ4 A;  2B3F A;  5K2Y A;  1AMF A;  2V3T A;  1HSE A;  3VVD A;  1JVY A;  4MHF A;  3THI A;  4DI4 B;  2AL4 A;  3V83 A;  4KCD A;  3BIH A;  4O3C A;  1NUW A;  3TKD A;  2R9J A;  4RPO A;  4JVC A;  1CNQ A;  2A5T A;  1KA1 A;  3LSX A;  5I59 A;  2GH9 A;  1B7H A;  2Y7P A;  2REG A;  5A5L A;  3RT8 A;  1H45 A;  2VPO A;  3C36 A;  3V8X B;  4POW A;  4U4X A;  2XWI A;  2UXA A;  4KYD A;  1JVX A;  1B7U A;  1VR5 A;  5AA2 B;  5BUU A;  2QMW A;  2XD2 A;  2V3U A;  4H1X A;  3VE1 B;  3TAJ A;  4Z7E A;  4ZE8 A;  5ITP A;  3UOR A;  1JET A;  1QUL A;  2XXK A;  1FPG A;  5BWJ A;  2CZI A;  5I2K B;  4QFK A;  2AIX A;  2NVU B;  4PFB A;  4R9G A;  1XHY A;  4F2O A;  1DSN A;  2I0C A;  3KSJ A;  5ET7 A;  2WBB A;  3CI8 A;  3MVX A;  1NV3 A;  4HCW A;  1A54 A;  2E0S A;  3KN3 A;  1PEB A;  5CBR A;  3S9M C;  3ILT B;  3T22 A;  3IK6 B;  4M1V A;  3K02 A;  1PBP A;  4IB2 A;  3M3L A;  3MZ9 A;  4NTL A;  3CVG A;  3H06 B;  3OOA A;  1Y3P A;  3I3V A;  4NN3 A;  1LLS A;  1MH3 A;  5AA2 A;  1B32 A;  4XXU A;  2UYE A;  4O3A A;  4QRZ A;  1A99 A;  1XVX A;  5CMM A;  2Z8F A;  1QUK A;  1FBG A;  4YB5 A;  4GWO A;  4GF8 A;  2WKY A;  5T3J A;  4IY6 A;  1FPB A;  3K6X A;  2F36 A;  1XT8 A;  2DWJ A;  3FJ7 A;  3TTL A;  4DIG A;  5I2K A;  5KCJ B;  5FHO A;  1HSL A;  4OZ9 A;  1B4Z A;  4ZEC A;  1A55 A;  4BDM A;  1I6B A;  1B3L A;  1BTJ A;  3W9V A;  1O63 A;  2GHB A;  3ZKL A;  3T66 A;  2XHD A;  3EHS A;  1IXI A;  2H4I A;  2O68 A;  4UA8 A;  2P0S A;  1RKM A;  1BK4 A;  1N76 A;  4KQP A;  5H8Q B;  3OEN A;  2QPQ A;  1NUX A;  4H46 A;  1VFD A;  1XVY A;  5B7D A;  2QSX A;  1MXU A;  3EHU A;  1Z7N E;  4G61 A;  4N15 A;  1YCJ A;  4G4P A;  5ITO A;  1LBV A;  4AS5 A;  4PAF A;  2Y7R A;  2ONS A;  3S9N C;  3CIJ A;  4EQ9 A;  2QRY A;  3FXQ A;  4U1Z A;  4IR8 A;  2PYY A;  1FCK A;  4KD5 A;  4PTK A;  2WX9 A;  4AS4 A;  3CSB A;  3KN7 A;  3PMV A;  4OAN A;  5IZ3 B;  3FV2 A;  1JQF A;  3NOH A;  1F9B A;  2QJE A;  2GQ1 A;  2VOZ A;  2I0B A;  3MPL A;  1UIV A;  3FVG A;  2XWO A;  1H43 A;  5H8Q A;  2XXT A;  2XXX A;  3IL1 B;  2I48 A;  4X48 A;  2QFL A;  3SEX A;  4IGR A;  4PC9 A;  3DLN A;  3Q28 A;  4G8N A;  3K1P A;  1JW1 A;  4PFW A;  4P3L A;  3OEK A;  1Y1M A;  4F1U A;  2PCR A;  3C4M A;  1UIU A;  1OQG A;  4ISU A;  2QS2 A;  1IMD A;  2HFB A;  3TMG A;  2XWK A;  4ESW A;  3H03 A;  1PB9 A;  4X1B A;  4OER A;  2I58 A;  4NAP A;  2ONR A;  2QS1 A;  5EQA A;  5CBS A;  2M8C A;  3TYH A;  4GD5 A;  2X7P A;  1JW4 A;  2I49 A;  3FBP A;  2MKZ A;  4WED A;  5IZZ A;  1I6A A;  2DP8 A;  2HZK A;  4G2Z A;  4QFP A;  2W7Y A;  3QXM A;  3ODB A;  3LBS A;  4OMB A;  2DXR A;  5TPA B;  3CFL A;  5H8H B;  4ESX A;  1FPK A;  2O1L A;  2OK2 A;  2FYI A;  4G68 A;  1QVS A;  1DTZ A;  1Y9U A;  5J1D A;  2GHA A;  1HSJ A;  3MUQ A;  2ZNS A;  3FXU A;  1MDP 1;  2Y84 A;  2IEE A;  1GGG A;  3K4U A;  3N5L A;  2F8D A;  2L5V A;  5AE4 A;  1IIW A;  3FXR A;  4N6K A;  2DVZ A;  1AWB A;  3I5O A;  5A5X B;  3UK4 A;  2RCA A;  4NQ8 A;  3SER A;  3MZ1 A;  4NWC A;  4H0W A;  2XXP A;  4N17 A;  4RJZ A;  1B5H A;  3SDF A;  1QGX A;  3V89 B;  5TPA A;  5H8H A;  3G3J A;  1FJ6 A;  3PUW E;  2QMX A;  1QW0 A;  1GVC A;  4ONY A;  1NV6 A;  3FJG A;  4BDQ A;  3CG1 A;  4PE3 A;  1DTG A;  1OLC A;  2KQZ A;  3G3H A;  2PFY A;  1P1W A;  1TWY A;  1SYH A;  3H6W A;  1SD3 A;  2B4L A;  1SW2 A;  4P11 A;  2PBW A;  3ISP A;  1QUJ A;  3PMW A;  3A29 A;  1S9T A;  4OEU A;  2HQ0 A;  4KHZ E;  1SW5 A;  5TU0 A;  3B7D A;  1DCU A;  4I62 A;  3F11 A;  4XKQ A;  1Z7M E;  2R71 A;  2ZZV A;  4R74 A;  3TCH A;  1MXW A;  3H4Z A;  1M5D A;  4F18 A;  2JJK A;  3FAT A;  1T0K A;  2FNC A;  3U72 A;  3RTW B;  1YYZ A;  2DSF A;  4XEQ A;  3T96 B;  5CC2 A;  4QF9 A;  5FHN A;  1URG A;  3I6V A;  3JV9 A;  5DT6 A;  3Q27 A;  4IO2 A;  3ROJ A;  4H5F A;  4MAG A;  5CMK A;  1NV1 A;  1AIV A;  1UTH B;  1A8E A;  4I8C A;  3IO4 A;  3TQL A;  4JSD A;  5I58 B;  1WOD A;  1LBX A;  2QS3 A;  3HST A;  1FPL A;  3EPE A;  2CMO A;  4GX3 A;  3KBR A;  1FW0 A;  4NF5 B;  3IJX B;  5ET8 A;  1ZU0 A;  5AA3 A;  3G7W A;  3A3C A;  3E4R A;  1IUD A;  5F24 A;  3QSL A;  2DE2 A;  4XKN A;  2I4C A;  1OQH A;  3N6U A;  4H5G A;  4U23 A;  4JVD A;  1ZMG A;  4G8M A;  2ZNT A;  1DOT A;  5KZT A;  4GLI A;  3PPO A;  1R6Z A;  1GR2 A;  4NE4 A;  3CSG A;  4K3F A;  3OO6 A;  4NF4 A;  1EZO A;  3MC2 A;  3IX1 A;  1UTH A;  4P9K A;  3S2V A;  2D5W A;  5I58 A;  2F7C A;  3K1M A;  1SI0 A;  1LBY A;  1FPF A;  3IFC A;  5EYH A;  2HZL A;  4PE5 B;  3H7M A;  1K9Z A;  2QS4 A;  4NF5 A;  2XXY A;  4QSD A;  2PT2 A;  3N6T A;  2DYX A;  4NG7 A;  5FHM A;  3OSQ A;  1FJ9 A;  1MXZ A;  4EDP A;  4OVR A;  1SBP A;  2V3Q A;  4R9F A;  5AA4 B;  4PCD A;  1N04 A;  3VXB A;  2O51 A;  2PX1 A;  4I40 A;  4LVQ A;  1UTB B;  1URS A;  1FBP A;  3MAM A;  4ZZA A;  1SPI A;  3OO9 A;  5FTH A;  3U65 A;  4LZ5 A;  1MQI A;  4X04 A;  1FTM A;  1SQY A;  4F29 A;  1POT A;  5I57 B;  4XFE A;  1N3W A;  3RYD A;  4MNI A;  1YAE A;  2XXV A;  4OXV A;  1AL3 A;  3EQ1 A;  2CEX A;  1JEU A;  1FBE A;  2DWH A;  1MXY A;  3KOS A;  4C1T A;  2ALU A;  3TPA A;  4DXU A;  1TXF A;  5DYH A;  4Z0I A;  1RDZ A;  3VLW A;  4IO6 A;  4GRK A;  1P1Q A;  1QUI A;  4IO5 A;  5AA4 A;  1ATG A;  3E13 X;  4OTE A;  5I84 A;  4FAT A;  2HAV A;  4ZZE A;  3B50 A;  1N3X A;  1B4H A;  2F6P A;  5EQ7 A;  4KYE A;  4DLD A;  1UTB A;  1IEJ A;  3K0V A;  4PET A;  4FBP A;  2QVV A;  1NUZ A;  1SW1 A;  3LSL A;  4G77 A;  4FOR A;  2H98 A;  4IGT A;  3W9W A;  4L17 A;  2P3V A;  1AH5 A;  3W15 C;  5I57 A;  4AB6 A;  1B0H A;  1G0H A;  3QUF A;  5EYG A;  3H6U A;  3TCF A;  3HFU A;  4BLA A;  1INP A;  5ISU A;  1B1X A;  4RNS A;  4U2R A;  3GLB A;  3E78 A;  4OVP A;  3LR1 A;  1VDW A;  1NH8 A;  4DXC A;  3FZV A;  1FPJ A;  2WYP A;  2H25 A;  4OET A;  2ESN A;  3RPW A;  4N6P A;  4O3B A;  1USY H;  5I5P A;  3M3K A;  2QL3 A;  4U4S A;  4OEV A;  3SEY A;  4KCC A;  2E1S A;  3CRB A;  3T1B A;  2I4B A;  1MM6 A;  2XXH A;  2VPN A;  2Z22 A;  5FBP A;  1B0L A;  3OXN A;  3VVE A;  3KFM A;  1IIT A;  5JK4 A;  1M5B A;  4EXK A;  2FA7 A;  3SEV A;  2BJJ X;  2VHA A;  3SEW A;  4ELO A;  5EQ9 A;  4NF0 A;  2V93 A;  2Q89 A;  4JXI A;  3FVO A;  3RQT A;  4H8J A;  2YLN A;  4Q8R A;  2Y7W A;  4ZED A;  3KC0 A;  3TTK A;  2F7A A;  4PBH A;  4PP0 A;  5ESY A;  3N26 A;  1UQW A;  4JDF A;  4EQB A;  1NUY A;  4RYA A;  4MLQ A;  1Y4C A;  4LUB A;  5EQ8 A;  2XD3 A;  4PDH A;  2NXO A;  3KSX A;  1D9V A;  4OES A;  3PPP A;  5CM6 A;  3JZJ A;  4MNC A;  3CG3 A;  3MVZ A;  3U93 A;  3PD9 A;  3K00 A;  3K6W A;  4KI0 E;  3HHF A;  3RTF B;  3UA8 A;  3IOW A;  3TEL A;  1NNP A;  1SDX A;  4OFL A;  3D4G A;  4ELR A;  5K2X A;  1NI9 A;  2FIX A;  3WAF A;  4KFQ A;  2AYS A;  3DP8 A;  4HCY A;  2R6G E;  1WDN A;  4MLV A;  4LZ8 A;  1LFI A;  5KCJ A;  2F5X A;  1P1N A;  4R2F A;  3FVK A;  1KZ8 A;  4YKI A;  2XA5 A;  2XX7 A;  4KR5 A;  2O7I A;  3PUY E;  2F3B A;  4QXD A;  1VSO A;  4GWS A;  4YZZ A;  1YXI A;  1IMC A;  3RN8 A;  3B6T A;  3IOU A;  4PFI A;  1NV5 A;  3ONM A;  4PFU A;  3K1N A;  2Q88 A;  3IR1 A;  3TOD A;  3TEP A;  1OMP A;  4RK9 A;  4FIM A;  4F1Y A;  3P7I A;  2HEU A;  1B51 A;  2XXR A;  2DQV A;  3FXB A;  4GXA A;  4H67 A;  1JP4 A;  3VDF A;  1LB8 A;  4YB7 A;  3HPI A;  3D4C A;  3V5A A;  2HHM A;  2RCB A;  4R6K A;  4N13 A;  1MY2 A;  1XOC A;  1JW5 A;  1XS5 A;  2ZMB A;  5AA2 D;  1KWH A;  1K9Y A;  2XXU A;  4RA1 A;  1ZLQ A;  4BDN A;  2ZZX A;  2D21 A;  5EHS A;  1R9Q A;  5JTY B;  3O6G A;  1B7Z A;  1LFH A;  3O66 A;  3UIF A;  5IZ3 A;  1NNT A;  3KEI A;  1LAG E;  2Y5K A;  4GL0 A;  4NF6 B;  4RPN A;  1JEV A;  1LGB C;  4QFL A;  3TDJ A;  3MQ9 A;  4OVT A;  4F3G A;  1IMF A;  4JVI A;  1SI1 A;  3E3K A;  4ELQ A;  3UP9 A;  5DVI A;  3FAS A;  2Z8E A;  3PD8 A;  1O7T A;  2P2A A;  4JWY A;  4NF8 B;  2PMS A;  2HXW A;  3MP1 A;  4O8M A;  3RGY A;  1H44 A;  4H6D A;  3MW0 A;  4FJP A;  4MEV A;  2A5S A;  2P3N A;  1IMA A;  4P47 A;  3MP6 A;  1ZKB A;  1IMB A;  1LCT A;  5JTY A;  2XXQ A;  1B40 A;  4YB6 A;  5LDZ A;  3M3F A;  4NF6 A;  3IOR A;  1OVB A;  2F6G A;  3RY3 A;  5L9O A;  4C0R A;  4JSO A;  2OZZ A;  1EYI A;  3TTM A;  2Z23 A;  2LAO A;  3BBR A;  3RUM A;  3ILU B;  3QK6 A;  4FE8 A;  4GBV A;  5IAI A;  3L6H A;  2HCA A;  3DEL B;  1NNF A;  3Q26 A;  3OO8 A;  3OD7 A;  2Y7K A;  4OYV A;  3M8U A;  1Q1K A;  1MH4 A;  1MY1 A;  4WXJ A;  3OO7 A;  1OLA A;  1MRP A;  5KDT B;  1YPN A;  4ZEK A;  5A5X A;  3G3F A;  1MQH A;  2F34 A;  1NMU A;  3PUX E;  1FPD A;  1FTJ A;  4H8I A;  2FIE A;  4EQ7 A;  1FQF A;  4F3P A;  4PDD A;  1Q9D A;  3MYU A;  4YU0 A;  3RT6 B;  3S9E A;  3BFT A;  5I7I A;  1IXC A;  4QFN A;  4O94 A;  1MY0 A;  4O7I A;  3LSF B;  2VP1 A;  2V4C A;  1XC1 A;  1Y3N A;  1MQJ A;  3FUZ A;  4PFR A;  1FQD A;  1OIB A;  2Q9T A;  4N8G A;  4MJO A;  2YPN A;  3G3K A;  3RNN A;  2Q2C A;  3KJT A;  3FGS A;  4RY1 A;  4F3B A;  3T9X B;  4AB5 A;  5KDT A;  4U22 A;  2XX9 A;  3K01 A;  3LV0 A;  1NFT A;  3BKI B;  1MY3 A;  2OBG A;  4G8H A;  1B52 A;  4TQU Q;  2I3V A;  4GIZ A;  2B4M A;  4DE8 A;  1LCF A;  2NWJ A;  3SET A;  4ZEF A;  3EHT A;  2Q74 A;  3JYR A;  5EHM A;  3A09 A;  3MZB A;  3G3I A;  4ZDM A;  3C9H A;  4LQ2 A;  4F31 B;  3OSR A;  1QJM A;  2V84 A;  4GWY A;  3H6T A;  4P0I A;  5IM2 A;  1US4 A;  4GL8 A;  1B6H A;  1B9J A;  4YMB A;  4R6Y A;  3O9P A;  1PB7 A;  3ECR A;  3EF7 A;  4IO7 A;  2ZZW A;  4OVS A;  1LAF E;  5HBC A;  1Q35 A;  4HXV A;  2ZYM A;  5I56 B;  1LAX A;  1MM7 A;  5B70 A;  2PFZ A;  4FAJ A;  2IA4 A;  1DBZ A;  3Q29 A;  3QMF A;  5M2V A;  4YKP A;  5F7V A;  1H76 A;  2XWV A;  1O64 A;  2B65 A;  3IB1 A;  2FHY A;  2HPG A;  1B46 A;  5H8N B;  4DDD A;  1LBZ A;  1AOV A;  1TFA A;  4PFY A;  3U8Q A;  1DPP A;  1CB6 A;  2X26 A;  1MPC A;  4PBQ A;  2B3B A;  4UAB A;  3FD3 A;  3MP8 A;  1GV8 A;  4Q5T A;  1IQ7 A;  3O29 A;  1PC3 A;  3GBA A;  4GQO A;  3Q25 A;  4MF3 A;  3TTN A;  2F97 A;  2A5T B;  4G68 C;  1FPI A;  4PQJ A;  1B3G A;  5I59 B;  4DZ1 A;  3B6Q A;  5DVF A;  1FTL A;  1NNK A;  2CZK A;  2Y5L A;  2F78 A;  1DPE A;  4LON B;  1NKX A;  4TLM B;  2YJP A; 
#chains in the Genus database with same CATH homology
 4C1U A;  2G93 A;  1I6Q A;  2DVC A;  5H8N A;  1B2H A;  4N07 A;  1ELJ A;  4YAH X;  2O84 X;  4NED A;  2THI A;  4DCY A;  2ANJ A;  1Y1Z A;  1CE2 A;  3KG2 A;  3CFZ A;  5DTB A;  3PPN A;  1P99 A;  3PUZ E;  4EXL A;  4ZEB A;  4FED A;  3O28 A;  1QKB A;  1EH3 A;  1II5 A;  1SVX B;  2ZXT A;  3SKP A;  2H99 A;  4WKM A;  3VXC A;  4MFI A;  3LUY A;  2AL5 A;  1Y3Q A;  3LSW A;  4JB7 A;  2O69 A;  3UN6 A;  1FTO A;  2DWI A;  1LBC A;  1B3E A;  2O6A A;  3CR9 A;  1IZ1 A;  5CRY A;  1MS7 A;  3O6I A;  3R7X A;  3GXA A;  3CFX A;  1MPD A;  2DE4 A;  1R9L A;  3RLF E;  4XKR A;  4F1V A;  1B3H A;  3PU5 A;  3S9L C;  1MQG A;  2VGQ A;  5AA1 A;  2ABH A;  4MBP A;  5IKB A;  5H8F B;  4RXL A;  1H3D A;  2ZYK A;  4F39 A;  3MPK A;  1N84 A;  1S50 A;  1LAH E;  3R6U A;  5HM4 B;  4X1D A;  3MVW A;  3C32 A;  5L9M A;  4RK2 A;  1MXV A;  4NWD A;  1I69 A;  3C33 A;  4H65 A;  1POY 1;  2NOO A;  5L9S A;  2H9B A;  1SW4 A;  3PUV E;  2G29 A;  1B58 A;  2RC7 A;  4BDR A;  1LBB A;  2DXY A;  2RKM A;  4I1D A;  4ZS9 A;  2GRV A;  4IY5 A;  3EN3 A;  5TP9 B;  2V25 A;  3MBP A;  3QUJ A;  3TTR A;  2OCU A;  1IXG A;  1N7W A;  3BFU A;  4E0W A;  4OFJ A;  4JWO A;  4QSC A;  2VD2 A;  2PVU A;  4OHN A;  3IOV A;  4BDO A;  1N7X A;  5H8F A;  4R75 A;  2Q2A A;  3ZS6 A;  2XXI A;  3DP6 A;  1EU8 A;  3T93 B;  3UGW A;  3C31 A;  4Q0C A;  1A7L A;  4OFO A;  3U92 A;  4YKJ A;  5DEX B;  1FQB A;  5CMB A;  1Y4T A;  2XX8 A;  1PBQ A;  1PB8 A;  3TUS A;  3KN8 A;  2PT1 A;  5TP9 A;  4GXS B;  4EF2 A;  2UVI A;  3VV5 A;  4LP2 B;  5HPQ A;  4G68 B;  3ZKK A;  3DP4 A;  1B5J A;  1VE4 A;  4TLL B;  1US5 A;  2D3I A;  2Z8D A;  1R1N A;  1TFD A;  3TZA A;  1IXH A;  4IO4 A;  5ICT A;  2OJT A;  4XIG Q;  5DEX A;  4THI A;  3HO7 A;  1D3K A;  2VD3 A;  4U21 A;  1M5E A;  2I6E A;  3IOT A;  3VFJ A;  1MY4 A;  4HW8 A;  2HAU A;  1FQA A;  3T9U A;  1ZJL A;  3VLV A;  4QFO A;  1SYI A;  3WAE A;  4U1O A;  4ELP A;  3PPQ A;  1BIY A;  4MH5 A;  4EF1 A;  1NL5 A;  4LA9 A;  3HCQ A;  1PDA A;  4R73 A;  3SEU A;  1FQE A;  1MPB A;  2UVJ A;  3PPR A;  3USD A;  3T9H B;  2ONK E;  5DVJ A;  2GFE A;  4BDL A;  1MXX A;  2RC9 A;  3TQW A;  1WVJ A;  3SES A;  3O97 A;  3FVN A;  1RYX A;  5L8D A;  3N94 A;  4LZ7 A;  2ZYN A;  4GFR A;  4OQO A;  4R72 A;  1RYO A;  3IB2 A;  1FQC A;  5I2N B;  1S7Y A;  4LQ5 A;  1BKA A;  4NF8 A;  3GZG A;  3H3G A;  1D9Y A;  4XTC Q;  3ZSF A;  3HV1 A;  3OEM A;  1BP5 A;  3K6U A;  4F3S A;  3FIR A;  4X9T A;  4R6H A;  4ECF A;  3KGC A;  1QKA A;  3H6V A;  2F35 A;  3TFL A;  2Q8J A;  4F22 A;  3IO6 A;  3HHG A;  1ZBM A;  2ZNU A;  3LC8 A;  4GOT A;  3L6G A;  4NMY A;  2CZL A;  1J1N A;  4YKK A;  4TOZ A;  1ANF A;  2RF1 A;  3DM0 A;  1BLF A;  5ICQ A;  4M4G A;  1TT1 A;  4JWX A;  3MWB A;  3TCG A;  5I2N A;  2DWA A;  3KZG A;  4OVJ A;  4POX A;  3E9X A;  4PFT A;  3PGF A;  3O2A A;  1LB9 A;  2OWS A;  3R26 A;  3O6H A;  3T9V A;  4P0G A;  3HN0 A;  4NF4 B;  3U1O A;  3K2D A;  1EZ9 A;  3KJ7 A;  2ZYO A;  3B6W A;  5CMC A;  4IO3 A;  4R2B A;  2UVH A;  3FJM A;  4OEN A;  1Y20 A;  3QYT A;  2UVG A;  5JEI A;  5LOM A;  2OLB A;  3C35 A;  2REJ A;  1M5F A;  1MG1 A;  4QHQ A;  1USY E;  3K6V A;  4YMA A;  3IB0 A;  3OEL A;  1ZTY A;  3MVY A;  2O1M A;  2Y7I A;  3IJO B;  4LAT A;  5EYF A;  1GTK A;  2H5Y A;  4Q30 B;  2F7B A;  4HTG A;  1DMB A;  1D4N A;  4I9D A;  3PV0 E;  4JBZ A;  4DXB A;  5F1Q A;  3G3G A;  1B1H A;  4ZE9 A;  1B05 A;  4HS7 A;  3MJN A;  2X7Q A;  1URD A;  1M5C A;  1B3F A;  2OWT A;  3A3U A;  4E0X A;  3OMB A;  3QIM A;  2XXW A;  4F19 A;  4WEP A;  3VLU A;  1MQD A;  1NH7 A;  1A40 A;  5FTI A;  3QAX A;  3C34 A;  1P1O A;  4ND9 A;  1A8F A;  1LST A;  4FEC A;  3IAZ A;  4F2Q A;  1YTV A;  3KOT A;  4FEB A;  2RIN A;  1OVT A;  3AXF A;  4KYS A;  2DOJ A;  2DS9 A;  2P1S A;  1JNF A;  5ELV A;  1P1U A;  1N0T A;  5I56 A;  4GVO A;  2O7U A;  4DCX A;  5H8S A;  2RC8 A;  4QSE A;  1FTK A;  3S4U A;  4YIC A;  3GBB A;  3PMX A;  2KLF A;  4EUO A;  1LFG A;  4UAC A;  3VVF A;  2UYF A;  3U94 A;  1B5I A;  1VFE A;  2NUV A;  1ZIU A;  4XKP A;  2DE3 A;  4ZEI A;  4OWD A;  3FV1 A;  1MDQ A;  1EZP A;  2I3W A;  4KPT A;  1L5T A;  5CI5 A;  4AQ4 A;  2B3F A;  5K2Y A;  1AMF A;  2V3T A;  1HSE A;  3VVD A;  1JVY A;  3THI A;  2AL4 A;  3V83 A;  4KCD A;  4O3C A;  3TKD A;  2R9J A;  4RPO A;  2A5T A;  3LSX A;  5I59 A;  2GH9 A;  1B7H A;  2Y7P A;  2REG A;  3RT8 A;  1H45 A;  3C36 A;  3V8X B;  4POW A;  4U4X A;  2UXA A;  4KYD A;  1JVX A;  1B7U A;  1VR5 A;  5AA2 B;  5BUU A;  2QMW A;  2XD2 A;  2V3U A;  4H1X A;  3VE1 B;  3TAJ A;  4Z7E A;  4ZE8 A;  5ITP A;  3UOR A;  1JET A;  1QUL A;  5BWJ A;  5I2K B;  4QFK A;  2AIX A;  2NVU B;  4R9G A;  1XHY A;  4F2O A;  1DSN A;  2I0C A;  3KSJ A;  4HCW A;  3CI8 A;  3MVX A;  1A54 A;  2E0S A;  3KN3 A;  1PEB A;  5CBR A;  3S9M C;  3ILT B;  3T22 A;  3IK6 B;  4M1V A;  3K02 A;  1PBP A;  4IB2 A;  3M3L A;  3MZ9 A;  4NTL A;  3CVG A;  3H06 B;  3OOA A;  1Y3P A;  3I3V A;  1LLS A;  1MH3 A;  5AA2 A;  1B32 A;  4XXU A;  2UYE A;  4O3A A;  4QRZ A;  1A99 A;  1XVX A;  5CMM A;  2Z8F A;  1QUK A;  4YB5 A;  4GWO A;  4GF8 A;  2WKY A;  4IY6 A;  3K6X A;  2F36 A;  1XT8 A;  2DWJ A;  3FJ7 A;  3TTL A;  4DIG A;  5I2K A;  5KCJ B;  5FHO A;  1HSL A;  4OZ9 A;  1B4Z A;  4ZEC A;  1A55 A;  4BDM A;  1I6B A;  1B3L A;  1BTJ A;  3W9V A;  1O63 A;  2GHB A;  3ZKL A;  3T66 A;  2XHD A;  3EHS A;  1IXI A;  2H4I A;  2O68 A;  4UA8 A;  2P0S A;  1RKM A;  1N76 A;  4KQP A;  5H8Q B;  3OEN A;  2QPQ A;  1VFD A;  1XVY A;  5B7D A;  2QSX A;  1MXU A;  3EHU A;  1Z7N E;  1YCJ A;  4G4P A;  5ITO A;  2Y7R A;  2ONS A;  3S9N C;  3CIJ A;  4EQ9 A;  2QRY A;  3FXQ A;  4U1Z A;  2PYY A;  1FCK A;  4KD5 A;  3CSB A;  3KN7 A;  3PMV A;  3FV2 A;  1JQF A;  1F9B A;  2QJE A;  2VOZ A;  2I0B A;  3MPL A;  1UIV A;  3FVG A;  1H43 A;  5H8Q A;  2XXT A;  2XXX A;  3IL1 B;  2I48 A;  4X48 A;  3SEX A;  4IGR A;  3DLN A;  3Q28 A;  4G8N A;  3K1P A;  1JW1 A;  4PFW A;  3OEK A;  1Y1M A;  4F1U A;  3C4M A;  1UIU A;  1OQG A;  4ISU A;  2QS2 A;  2HFB A;  3TMG A;  4ESW A;  3H03 A;  1PB9 A;  4X1B A;  4OER A;  2I58 A;  2ONR A;  2QS1 A;  5CBS A;  2M8C A;  3TYH A;  4GD5 A;  2X7P A;  1JW4 A;  2I49 A;  4WED A;  1I6A A;  2DP8 A;  2HZK A;  4G2Z A;  4QFP A;  2W7Y A;  3QXM A;  3ODB A;  3LBS A;  4OMB A;  2DXR A;  5TPA B;  3CFL A;  5H8H B;  4ESX A;  2O1L A;  2OK2 A;  2FYI A;  4G68 A;  1QVS A;  1DTZ A;  1Y9U A;  5J1D A;  2GHA A;  1HSJ A;  3MUQ A;  2ZNS A;  3FXU A;  1MDP 1;  2Y84 A;  2IEE A;  1GGG A;  3K4U A;  3N5L A;  2F8D A;  5AE4 A;  1IIW A;  3FXR A;  2DVZ A;  3I5O A;  5A5X B;  3UK4 A;  2RCA A;  3SER A;  3MZ1 A;  4NWC A;  4H0W A;  2XXP A;  4RJZ A;  1B5H A;  3SDF A;  3V89 B;  5TPA A;  5H8H A;  3G3J A;  3PUW E;  2QMX A;  1QW0 A;  1GVC A;  4ONY A;  3FJG A;  4BDQ A;  3CG1 A;  1DTG A;  1OLC A;  3G3H A;  1P1W A;  1TWY A;  1SYH A;  3H6W A;  1SD3 A;  1SW2 A;  4P11 A;  2PBW A;  1QUJ A;  3PMW A;  1S9T A;  4OEU A;  2HQ0 A;  4KHZ E;  1SW5 A;  5TU0 A;  3B7D A;  4I62 A;  3F11 A;  4XKQ A;  1Z7M E;  2R71 A;  4R74 A;  3TCH A;  1MXW A;  3H4Z A;  1M5D A;  4F18 A;  3FAT A;  1T0K A;  2FNC A;  3U72 A;  3RTW B;  2DSF A;  3T96 B;  5CC2 A;  4QF9 A;  5FHN A;  1URG A;  3I6V A;  3JV9 A;  5DT6 A;  3Q27 A;  4IO2 A;  4H5F A;  5CMK A;  1AIV A;  1UTH B;  1A8E A;  4I8C A;  3IO4 A;  3TQL A;  4JSD A;  5I58 B;  1WOD A;  2QS3 A;  3HST A;  3EPE A;  2CMO A;  3KBR A;  1FW0 A;  4NF5 B;  3IJX B;  1ZU0 A;  5AA3 A;  3G7W A;  3A3C A;  3E4R A;  1IUD A;  3QSL A;  2DE2 A;  4XKN A;  2I4C A;  1OQH A;  3N6U A;  4H5G A;  4U23 A;  1ZMG A;  4G8M A;  2ZNT A;  1DOT A;  5KZT A;  4GLI A;  3PPO A;  1R6Z A;  1GR2 A;  4NE4 A;  3CSG A;  4K3F A;  3OO6 A;  4NF4 A;  1EZO A;  3MC2 A;  3IX1 A;  1UTH A;  3S2V A;  2D5W A;  5I58 A;  2F7C A;  3K1M A;  1SI0 A;  2HZL A;  4PE5 B;  3H7M A;  2QS4 A;  4NF5 A;  2XXY A;  4QSD A;  2PT2 A;  3N6T A;  2DYX A;  5FHM A;  3OSQ A;  1MXZ A;  4EDP A;  1SBP A;  2V3Q A;  4R9F A;  5AA4 B;  1N04 A;  3VXB A;  2O51 A;  2PX1 A;  4LVQ A;  1UTB B;  1URS A;  3MAM A;  4ZZA A;  3OO9 A;  5FTH A;  4LZ5 A;  1MQI A;  1FTM A;  1SQY A;  4F29 A;  1POT A;  5I57 B;  1N3W A;  1YAE A;  2XXV A;  4OXV A;  1AL3 A;  3EQ1 A;  1JEU A;  2DWH A;  1MXY A;  3KOS A;  4C1T A;  2ALU A;  3TPA A;  4DXU A;  1TXF A;  5DYH A;  4Z0I A;  3VLW A;  4IO6 A;  4GRK A;  1P1Q A;  1QUI A;  4IO5 A;  5AA4 A;  1ATG A;  3E13 X;  4OTE A;  5I84 A;  4FAT A;  2HAV A;  4ZZE A;  1N3X A;  1B4H A;  2F6P A;  4KYE A;  4DLD A;  1UTB A;  1IEJ A;  3K0V A;  4PET A;  1SW1 A;  3LSL A;  4G77 A;  4FOR A;  2H98 A;  4IGT A;  3W9W A;  4L17 A;  1AH5 A;  3W15 C;  5I57 A;  4AB6 A;  1B0H A;  3QUF A;  3H6U A;  3TCF A;  4BLA A;  5ISU A;  1B1X A;  4RNS A;  4U2R A;  3GLB A;  3LR1 A;  1NH8 A;  4DXC A;  3FZV A;  2H25 A;  4OET A;  2ESN A;  3RPW A;  4N6P A;  4O3B A;  1USY H;  3M3K A;  2QL3 A;  4U4S A;  4OEV A;  3SEY A;  4KCC A;  2E1S A;  3CRB A;  2I4B A;  1MM6 A;  2XXH A;  2Z22 A;  1B0L A;  3OXN A;  3VVE A;  3KFM A;  1IIT A;  5JK4 A;  1M5B A;  4EXK A;  2FA7 A;  3SEV A;  2BJJ X;  2VHA A;  3SEW A;  4ELO A;  2V93 A;  2Q89 A;  4JXI A;  3FVO A;  3RQT A;  4H8J A;  2YLN A;  4Q8R A;  2Y7W A;  4ZED A;  3TTK A;  2F7A A;  4PP0 A;  3N26 A;  1UQW A;  4JDF A;  4EQB A;  4RYA A;  4MLQ A;  1Y4C A;  4LUB A;  2XD3 A;  2NXO A;  3KSX A;  1D9V A;  4OES A;  3PPP A;  5CM6 A;  3JZJ A;  3CG3 A;  3MVZ A;  3U93 A;  3PD9 A;  3K00 A;  3K6W A;  4KI0 E;  3HHF A;  3RTF B;  3UA8 A;  3IOW A;  3TEL A;  1NNP A;  1SDX A;  4OFL A;  3D4G A;  4ELR A;  5K2X A;  3WAF A;  4KFQ A;  2AYS A;  3DP8 A;  4HCY A;  2R6G E;  1WDN A;  4MLV A;  4LZ8 A;  1LFI A;  5KCJ A;  2F5X A;  1P1N A;  4R2F A;  3FVK A;  4YKI A;  2XX7 A;  4KR5 A;  2O7I A;  3PUY E;  1VSO A;  4YZZ A;  3RN8 A;  3B6T A;  3IOU A;  3ONM A;  4PFU A;  3K1N A;  2Q88 A;  3IR1 A;  3TOD A;  3TEP A;  1OMP A;  4RK9 A;  4FIM A;  4F1Y A;  3P7I A;  2HEU A;  1B51 A;  2XXR A;  2DQV A;  4H67 A;  4GXA A;  3VDF A;  1LB8 A;  4YB7 A;  3HPI A;  3D4C A;  3V5A A;  2RCB A;  4R6K A;  4N13 A;  1MY2 A;  1XOC A;  1JW5 A;  1XS5 A;  2ZMB A;  5AA2 D;  1KWH A;  2XXU A;  4RA1 A;  1ZLQ A;  4BDN A;  2D21 A;  5EHS A;  1R9Q A;  5JTY B;  3O6G A;  1B7Z A;  1LFH A;  3O66 A;  3UIF A;  1NNT A;  3KEI A;  1LAG E;  4GL0 A;  4NF6 B;  4RPN A;  1JEV A;  1LGB C;  4QFL A;  3TDJ A;  3MQ9 A;  4F3G A;  1SI1 A;  3E3K A;  4ELQ A;  3UP9 A;  5DVI A;  3FAS A;  2Z8E A;  3PD8 A;  1O7T A;  2P2A A;  4JWY A;  4NF8 B;  2PMS A;  2HXW A;  3MP1 A;  3RGY A;  1H44 A;  4H6D A;  3MW0 A;  4FJP A;  2A5S A;  3MP6 A;  1ZKB A;  1LCT A;  5JTY A;  2XXQ A;  1B40 A;  4YB6 A;  3M3F A;  4NF6 A;  3IOR A;  1OVB A;  2F6G A;  3RY3 A;  5L9O A;  4C0R A;  4JSO A;  2OZZ A;  3TTM A;  2Z23 A;  2LAO A;  3BBR A;  3RUM A;  3ILU B;  3QK6 A;  4FE8 A;  5IAI A;  3L6H A;  2HCA A;  3DEL B;  1NNF A;  3Q26 A;  3OO8 A;  3OD7 A;  2Y7K A;  4OYV A;  3M8U A;  1Q1K A;  1MH4 A;  1MY1 A;  4WXJ A;  3OO7 A;  1OLA A;  1MRP A;  5KDT B;  1YPN A;  4ZEK A;  5A5X A;  3G3F A;  1MQH A;  2F34 A;  1NMU A;  3PUX E;  1FTJ A;  4H8I A;  4EQ7 A;  1FQF A;  4F3P A;  4YU0 A;  3RT6 B;  3S9E A;  3BFT A;  1IXC A;  4QFN A;  1MY0 A;  3LSF B;  2VP1 A;  1XC1 A;  1Y3N A;  1MQJ A;  3FUZ A;  1FQD A;  1OIB A;  2Q9T A;  2YPN A;  3G3K A;  3RNN A;  2Q2C A;  3KJT A;  3FGS A;  4RY1 A;  4F3B A;  3T9X B;  4AB5 A;  5KDT A;  4U22 A;  2XX9 A;  3K01 A;  1NFT A;  3BKI B;  1MY3 A;  2OBG A;  4G8H A;  1B52 A;  4TQU Q;  2I3V A;  4GIZ A;  4DE8 A;  1LCF A;  2NWJ A;  3SET A;  4ZEF A;  3EHT A;  3JYR A;  5EHM A;  3A09 A;  3MZB A;  3G3I A;  4ZDM A;  3C9H A;  4LQ2 A;  4F31 B;  3OSR A;  1QJM A;  2V84 A;  3H6T A;  4P0I A;  1US4 A;  4GL8 A;  1B6H A;  1B9J A;  4YMB A;  4R6Y A;  3O9P A;  1PB7 A;  3ECR A;  3EF7 A;  4IO7 A;  1LAF E;  5HBC A;  1Q35 A;  2ZYM A;  5I56 B;  1LAX A;  1MM7 A;  5B70 A;  4FAJ A;  2IA4 A;  3Q29 A;  5M2V A;  4YKP A;  5F7V A;  1H76 A;  1O64 A;  2B65 A;  3IB1 A;  1B46 A;  5H8N B;  4DDD A;  1AOV A;  1TFA A;  4PFY A;  3U8Q A;  1DPP A;  1CB6 A;  2X26 A;  1MPC A;  2B3B A;  3FD3 A;  3MP8 A;  1GV8 A;  4Q5T A;  1IQ7 A;  3O29 A;  1PC3 A;  3GBA A;  4GQO A;  3Q25 A;  4MF3 A;  3TTN A;  2F97 A;  2A5T B;  4G68 C;  4PQJ A;  1B3G A;  5I59 B;  4DZ1 A;  5DVF A;  3B6Q A;  1FTL A;  1NNK A;  2F78 A;  1DPE A;  4LON B;  1NKX A;  4TLM B;  2YJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...