4ELOA

Ferric binding protein in apo form 1
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
308
structure length
308
Chain Sequence
TLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Iron ABC transporter, periplasmic iron-binding protein
publication title Crystal structure of the ferric binding protein A
rcsb
source organism Thermus thermophilus
total genus 110
structure length 308
sequence length 308
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4eloA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4eloA02
1WDNA 1YTVA 2XXIA 1FW0A 4ZDMA 4MF3A 4YZZA 4EF2A 3RQTA 5IKBA 2G93A 5ELVA 3S9LC 3CRBA 4F3PA 3MVYA 3O2AA 4KCCA 4R74A 2XX8A 5A5XA 3TYHA 2CMOA 3IAZA 3S9EA 1MH3A 2E0SA 4H6DA 1OQGA 4C0RA 5CMKA 1D3KA 1SBPA 2Q2AA 4TOZA 4KYDA 4LP2B 3PMVA 4H5FA 3SETA 1PB7A 3FJGA 5HM4B 5DT6A 3DP8A 1AH5A 5I57A 4P0IA 5I2NB 1MXXA 3TFLA 2V3QA 1DTGA 1D4NA 2IA4A 3MPKA 5I59B 3QUFA 4MLQA 3CFZA 5H8QB 2XHDA 2ONRA 1O7TA 2XXYA 1Z7ME 2ESNA 3LBSA 4F31B 2HAVA 3C36A 4RA1A 2Q89A 1DTZA 1SVXB 1H76A 1UQWA 3Q29A 3WAEA 1QULA 3B6WA 1P99A 3E4RA 1R1NA 2DWJA 1YPNA 3OENA 4UA8A 1LAHE 4YB7A 3LC8A 1Q1KA 3SEXA 4HS7A 1J1NA 1RYOA 1TFDA 3R26A 4PETA 4R9FA 4OERA 2Q9TA 4KCDA 4NF4B 3UA8A 4GRKA 3UIFA 1ZTYA 2RCBA 5CMBA 2ZNTA 2H4IA 1ZBMA 4QFPA 1NH7A 3C9HA 4G77A 3UP9A 1TXFA 2Y7WA 2WKYA 3SESA 2LAOA 3CIJA 5DEXA 3LR1A 2HEUA 1MG1A 3TDJA 1GTKA 1JVYA 2PYYA 4QFLA 2Q2CA 4E0XA 2UVJA 1P1QA 4YB6A 3M3LA 3LSLA 1FQBA 4YKIA 5B7DA 4NF5A 1HSEA 1KWHA 1QJMA 4R6KA 3PPPA 5DYHA 4AB5A 4ZZAA 2XX7A 4JDFA 1YAEA 3OO7A 1H3DA 4NF6A 1DSNA 1B2HA 2XD3A 2F36A 4F22A 3K1PA 4EUOA 4ESXA 2Z8EA 2X26A 1O64A 3KJ7A 1WVJA 1URSA 2P0SA 5JTYA 4IGRA 4G8HA 1SW5A 1MY1A 4ZS9A 1MXUA 5H8FA 4YB5A 3K6WA 4JWYA 3KN3A 1USYE 3RGYA 3FXUA 3BFUA 3FVKA 1MQDA 3MQ9A 3EHUA 4KD5A 4FJPA 4OEUA 3PUYE 5BWJA 4TLLB 1BKAA 3ILTB 4F3GA 1MY2A 4RY1A 5I2KA 1B3GA 5CI5A 4FORA 5H8HB 5ICTA 3MZ9A 4ELQA 3T9VA 1B0HA 4OQOA 5I58A 2I58A 3G3FA 1SQYA 1MY4A 4LVQA 1VE4A 3LSXA 5DVFA 4ZECA 1Z7NE 2RC7A 2QL3A 4PQJA 4X9TA 3O9PA 3IB1A 3A09A 4WEDA 3FV2A 2XXUA 1B4ZA 4OHNA 5FTIA 2DYXA 2OCUA 4DDDA 3KOSA 4P11A 2ZNSA 3JV9A 4R75A 4XKPA 4POXA 1NMUA 4OFOA 2YJPA 4X48A 2I49A 3VVFA 3TODA 5CMMA 2H25A 1XOCA 3IOWA 1MXZA 3OD7A 4NTLA 4GD5A 1IXGA 5HPQA 2DVCA 4Q8RA 3ODBA 5ICQA 1MM6A 3JZJA 1MQGA 2F6PA 1JW5A 3RT8A 3T9XB 5EHMA 3VVEA 2W7YA 2DP8A 4WXJA 1B9JA 3G3IA 4EXLA 5CM6A 1XC1A 2Q8JA 2FYIA 4F1YA 2I0BA 4QFNA 3T66A 1IQ7A 1MQJA 3OSQA 1GGGA 4XKQA 3I3VA 1B7ZA 3CI8A 4JWXA 1SW1A 3K6XA 2B65A 3C34A 4ZEKA 3OELA 4YMAA 3FV1A 2ZYKA 4GVOA 3T96B 5TP9A 2PX1A 2R9JA 3ZSFA 5TPAA 3PUVE 1MQIA 2GFEA 1A8FA 2F7AA 1JW4A 5ISUA 3TTMA 2F78A 1S7YA 4HCWA 1LGBC 2O51A 5IAIA 4JSDA 3QAXA 4ZE8A 3KBRA 4RPOA 3PGFA 3T93B 1LCFA 2OWSA 3K00A 4HTGA 4XTCQ 2QMWA 3DP6A 3TTLA 2Y7KA 3G7WA 4YMBA 1LB8A 1EH3A 3K1NA 3TTRA 3Q28A 2REJA 2FA7A 2I3VA 1N3XA 4LONB 1JW1A 3V5AA 4EDPA 1OMPA 1UTBA 3RN8A 1B6HA 3TCFA 3CVGA 3HPIA 4F19A 3C4MA 4NF8A 1UTHB 2B3BA 1B0LA 3U92A 3OO8A 5J1DA 3SEWA 1EZPA 3OO6A 3C32A 5I57B 4OFJA 4IO2A 3W9VA 1NFTA 1TWYA 4F1UA 4BDQA 1ATGA 2PT2A 3U1OA 3AXFA 4PFUA 1Y3PA 4U23A 4R2FA 2QS4A 2M8CA 1EZOA 3L6HA 4EQBA 4LUBA 2YPNA 1B3EA 3K02A 2AL5A 2DOJA 4Q5TA 1LFIA 4IY6A 4G68A 4ND9A 1I69A 3KN8A 3H4ZA 3TCGA 4OMBA 3VV5A 4FEDA 4THIA 3MAMA 5JEIA 4QSCA 3ZS6A 4DXCA 1A8EA 2HCAA 4IY5A 4NE4A 1Y20A 1LBCA 3IOUA 2O84X 2AIXA 3ZKLA 1VFEA 4FATA 1I6BA 4I9DA 2ZMBA 3HHFA 4RJZA 4U4XA 5KCJB 3DELB 2PBWA 3WAFA 4GQOA 3IOTA 4GIZA 5K2YA 1FTLA 4YU0A 1FQCA 4OYVA 2F7BA 2GHAA 3H6VA 2QPQA 1L5TA 3IORA 1IUDA 3S9MC 1N7XA 1USYH 3N6UA 3TZAA 2Y7IA 4H5GA 2H9BA 3H06B 1P1OA 4U1OA 1QVSA 2GHBA 2DS9A 3V8XB 1NNFA 4M4GA 1Q35A 2D5WA 3V83A 5ITOA 3PMWA 4WKMA 2E1SA 3C33A 4K3FA 4RK2A 4DZ1A 1FQFA 3MP1A 5AA4B 3HN0A 1OVBA 1MXWA 3THIA 1LFHA 1FQDA 4F29A 2OJTA 3UORA 3TTKA 4HCYA 3N26A 1LBBA 1PB8A 4F39A 5CBSA 2GRVA 4HW8A 2NWJA 1MPDA 3FVNA 4XKNA 1ZLQA 3SEYA 1SYIA 1M5EA 4AQ4A 4I62A 1US4A 1LFGA 5JTYB 4FAJA 2UYEA 4G4PA 2ABHA 1R6ZA 2NOOA 2DWIA 1EU8A 3KFMA 2ZYOA 4NEDA 1N0TA 2HXWA 4ECFA 3K6UA 2VOZA 3KEIA 2H5YA 4M1VA 5I59A 3LSFB 5CMCA 5H8QA 3PPQA 2ZXTA 3RNNA 4XKRA 2QS3A 2D21A 2IEEA 2Z8FA 4ZEDA 4RK9A 1LSTA 4I8CA 4WEPA 5L9OA 2KLFA 1PC3A 1B51A 5AA2B 4G8MA 1UIUA 1SW2A 3C35A 1OIBA 2F5XA 4QHQA 4RXLA 3OEMA 4GOTA 3ILUB 4PFYA 3CR9A 1P1WA 4E0WA 1FTOA 1LLSA 3JYRA 2OLBA 3Q27A 3G3KA 2XD2A 4OTEA 3FVGA 4G8NA 4DCYA 3B7DA 4LATA 4NF4A 3VLUA 4QSDA 4NWDA 3ECRA 3BBRA 4LA9A 5KDTB 3H6WA 1M5CA 3TELA 2PMSA 3QUJA 3MP6A 2VP1A 3S4UA 2DE4A 1LAFE 1N84A 5H8NA 3TQLA 4QFKA 1RKMA 2P1SA 4IO3A 2HFBA 1B5JA 5EHSA 3M3KA 3MVWA 1F9BA 1Y3QA 3HO7A 4MFIA 3CG1A 1M5BA 1IITA 4RNSA 3MVZA 4U2RA 3U93A 4TQUQ 3MZBA 4EQ9A 4RYAA 1B40A 1ZJLA 3RPWA 2ZYNA 3T9HB 3IO6A 4IGTA 2OZZA 4NWCA 3CFXA 2UVIA 3PPNA 3USDA 1B32A 1OVTA 4U21A 4R73A 3QSLA 2O1LA 4LZ7A 2A5TB 4I1DA 2QRYA 4OENA 2THIA 1AIVA 1BTJA 1IEJA 2I3WA 4OZ9A 2O69A 3HCQA 3RLFE 3FD3A 3QXMA 4ZE9A 4BDMA 4GWOA 1OQHA 4F2QA 4BDLA 3PV0E 3OEKA 2I4BA 2VGQA 2NXOA 3R6UA 2RINA 3M8UA 2Z8DA 4OVJA 2ZNUA 1M5DA 2O1MA 2OWTA 3VE1B 1ZMGA 4F18A 3SEVA 2DQVA 3HHGA 4H1XA 1MXVA 3OOAA 2XX9A 1QW0A 3Q25A 1T0KA 4Z0IA 1FQAA 3UK4A 3SKPA 3VXBA 1QKBA 2D3IA 5I56B 2O7UA 3DLNA 1PB9A 5H8HA 5FTHA 1JVXA 2DE3A 4R6HA 1GVCA 3GZGA 3KJTA 4JWOA 4Q30B 3EHTA 1FQEA 3E9XA 4Q0CA 3MP8A 4PFTA 3P7IA 3OXNA 1PDAA 4ELPA 4LZ8A 4PP0A 2V3UA 3VVDA 1QUJA 1Y3NA 2O6AA 4ZEIA 1NNKA 1XVXA 1O63A 3PUXE 1HSLA 2DWHA 3OO9A 3D4CA 2XXTA 4YKPA 4C1TA 4F2OA 4QFOA 3K1MA 1B05A 3K6VA 4KPTA 4OETA 3FXQA 4H0WA 3FJ7A 2ZYMA 3EHSA 1URDA 4EQ7A 1MRPA 4O3CA 5K2XA 2I4CA 4ESWA 3TCHA 2XXXA 4LQ5A 3FJMA 3PD9A 3IB0A 2ALUA 4ZZEA 3VFJA 1JEVA 2V25A 5BUUA 5A5XB 1AMFA 4GL0A 4N13A 1NNPA 2PVUA 1B1HA 2DXRA 3D4GA 2X7QA 4KYSA 3LUYA 3ONMA 1I6AA 3T22A 1B3LA 3O6IA 1B58A 3DM0A 5FHOA 3VDFA 3PUZE 2ONSA 4LZ5A 1UIVA 3E3KA 2AL4A 2V3TA 2OBGA 4R72A 1XT8A 5DTBA 1QUIA 3RTFB 3N5LA 4KR5A 4U22A 3U72A 3CSBA 4X1BA 3K01A 1Y4CA 5TU0A 1IXCA 1MY0A 1JEUA 4JB7A 2DVZA 3KOTA 1TFAA 1POY1 2BJJX 2XXHA 3T9UA 3SERA 2QS2A 4QF9A 1D9YA 5F7VA 1SD3A 3A3UA 1XHYA 4JXIA 2DSFA 3H03A 4OFLA 2H99A 1B46A 1DMBA 4EXKA 4YKKA 2GH9A 5JK4A 1AL3A 3CFLA 3G3HA 4POWA 5FHNA 1NNTA 3TMGA 1POTA 1NKXA 2Y7PA 3TQWA 4XIGQ 3DP4A 4H8IA 4KYEA 3MBPA 1JETA 2V93A 1A55A 3K4UA 4KFQA 3VXCA 3KGCA 1UTHA 2XXPA 1MPCA 1Y1ZA 1SW4A 2Y84A 3KSXA 2UXAA 3FATA 2O7IA 1SDXA 5DEXB 4L17A 1B1XA 1VSOA 3K0VA 5F1QA 1MH4A 4FIMA 4YKJA 5LOMA 1PBQA 1IZ1A 5H8SA 1ANFA 3GBBA 3V89B 3FGSA 4OEVA 4RPNA 2I48A 3TEPA 1QUKA 5CRYA 1BIYA 3KG2A 3SEUA 3O66A 1Y4TA 3N94A 4N6PA 1D9VA 2VHAA 1FCKA 2HZLA 3IO4A 1ZKBA 1VR5A 4NF5B 1H45A 3ZKKA 2F8DA 2YLNA 4IB2A 2ANJA 1OLCA 1H44A 5EYFA 5AE4A 1LAGE 3I6VA 4OESA 1MS7A 4MLVA 2H98A 2F6GA 1R9QA 4PFWA 3MJNA 1US5A 4NF6B 4ZEBA 1Y9UA 4ELOA 4KHZE 2HQ0A 3S9NC 3IB2A 2PT1A 2QMXA 3G3JA 3H6UA 3I5OA 1H43A 3PD8A 2XXWA 4QSEA 5KCJA 1XVYA 3EQ1A 3S2VA 5L9MA 2HAUA 3MWBA 1BP5A 3HV1A 3QK6A 3N6TA 1R9LA 2NVUB 5H8FB 5I2NA 1NL5A 5H8NB 2RCAA 1QKAA 4KQPA 3W15C 3MVXA 4IO6A 3G3GA 5I2KB 2QSXA 5FHMA 2AYSA 5I58B 2P2AA 2CZLA 1Y1MA 4YAHX 5DVJA 2Y7RA 5M2VA 1GR2A 3TUSA 4DXBA 1A40A 1NH8A 3IR1A 1I6QA 3KSJA 4MH5A 2G29A 2R71A 1LCTA 3QYTA 2F97A 4GXAA 3SDFA 3RUMA 4C1UA 3O6GA 2QS1A 3QIMA 3UN6A 1B7HA 4DCXA 2Z23A 1MDQA 1M5FA 5AA4A 1VFDA 3RY3A 3VLVA 4ZEFA 3EF7A 1ZU0A 4JBZA 2RC8A 1HSJA 3C31A 1ELJA 4AB6A 1N3WA 1MM7A 1YCJA 3FIRA 4P0GA 1IIWA 2B3FA 4IO7A 4GFRA 5L8DA 1EZ9A 2DE2A 4FE8A 2F35A 3IK6B 3LSWA 4QRZA 3CSGA 3GBAA 3IJXB 3VLWA 1WODA 3H3GA 4H65A 3FUZA 1N7WA 1S9TA 2REGA 2UVGA 4O3AA 4ISUA 4ELRA 1P1UA 3M3FA 4G2ZA 1B7UA 3TKDA 3E13X 1SI1A 2QJEA 1N04A 1II5A 3EPEA 3GXAA 3KZGA 5ITPA 4DLDA 1JQFA 2NUVA 4O3BA 5CBRA 3Q26A 5AA2A 3FZVA 2I0CA 1N76A 1LB9A 1FTMA 1MQHA 3PUWE 3RTWB 4GLIA 3O6HA 3OMBA 5AA1A 4DXUA 1JNFA 3FXRA 5TP9B 3MZ1A 2VD3A 3O28A 1BLFA 5AA2D 1DPEA 5TPAB 4BDRA 2A5SA 1P1NA 1MPBA 1TT1A 1S50A 2XXVA 5KDTA 1A7LA 4IO5A 2XXQA 4FECA 1IXHA 4H8JA 3U94A 3R7XA 1MY3A 3PU5A 1SI0A 2Q88A 4NMYA 4UACA 3MW0A 3BKIB 4DIGA 3PPRA 3IOVA 1CE2A 4JSOA 3HSTA 4GF8A 2O68A 4BDOA 1DPPA 4Z7EA 3EN3A 3KN7A 1UTBB 2XXRA 1FTJA 4F3SA 5CC2A 1LAXA 4NF8B 4R9GA 1ZIUA 3FASA 3K2DA 1IXIA 2RC9A 3IJOB 3MC2A 3TPAA 3B6QA 1CB6A 3IL1B 3CG3A 2R6GE 2X7PA 2OK2A 1OLAA 4ONYA 3H6TA 1SYHA 2A5TA 1MDP1 1MXYA 1DOTA 4U1ZA 1RYXA 5L9SA 1URGA 3L6GA 4IO4A 3UGWA 4G68B 2VD2A 3IX1A 1B3FA 4GXSB 1B5IA 2UVHA 3OSRA 4H67A 2DXYA 3MPLA 4DE8A 5B70A 3A3CA 5HBCA 5I84A 2V84A 1B52A 1A99A 1B3HA 4OXVA 2Z22A 3PMXA 4MBPA 3W9WA 4R6YA 5I56A 4BDNA 4F1VA 4BLAA 5AA3A 4LQ2A 4G68C 1B5HA 3B6TA 4U4SA 4X1DA 3O97A 3GLBA 4FEBA 4OWDA 2I6EA 1XS5A 1GV8A 3U8QA 5KZTA 2DWAA 5DVIA 4N07A 1PBPA 1FTKA 4EF1A 4R2BA 3BFTA 1B4HA 2RKMA 2ONKE 4PE5B 2FNCA 4YICA 4TLMB 2RF1A 3TTNA 3F11A 2UYFA 3O29A 1PEBA 4XXUA 1AOVA 2HZKA 2F7CA 3FVOA 3RT6B 3MUQA 4GL8A 4F3BA 4KI0E 3H7MA 3PPOA 1A54A 3TAJA 2F34A
chains in the Genus database with same CATH superfamily
1WDNA 1YTVA 2XXIA 1FW0A 4ZDMA 4O7MA 4MF3A 4YZZA 4EF2A 3RQTA 5IKBA 2G93A 5ELVA 3S9LC 3CRBA 4F3PA 3MVYA 3O2AA 1FPFA 4KCCA 4R74A 2XX8A 5A5XA 3TYHA 2CMOA 3IAZA 3S9EA 1MH3A 2E0SA 4H6DA 5LTCA 1OQGA 4C0RA 5CMKA 1D3KA 1SBPA 2Q2AA 4TOZA 4KYDA 4LP2B 3PMVA 4H5FA 3SETA 1PB7A 3FJGA 5HM4B 5DT6A 3DP8A 1AH5A 5I57A 4P0IA 5I2NB 4JVIA 3BIGA 1MXXA 3TFLA 2V3QA 1DTGA 1D4NA 2IA4A 3MPKA 5I59B 3QUFA 4X8RA 4MLQA 3CFZA 5H8QB 4JVCA 4I3EA 2XHDA 2ONRA 1Q9DA 1O7TA 2XXYA 1Z7ME 2ESNA 3LBSA 4F31B 2HAVA 3C36A 4RA1A 2Q89A 1DTZA 1SVXB 1H76A 1UQWA 3Q29A 3WAEA 1QULA 3B6WA 1P99A 3E4RA 1R1NA 2DWJA 1LBYA 4MIJA 1YPNA 3OENA 4UA8A 1LAHE 4YB7A 3LC8A 1Q1KA 3SEXA 1NV4A 4HS7A 1J1NA 1RYOA 1TFDA 3R26A 4PETA 4R9FA 4OERA 1IMCA 2Q9TA 4KCDA 4X04A 4NF4B 3UA8A 4DI3D 4GRKA 3UIFA 1ZTYA 2RCBA 5CMBA 4P47A 4MHFA 2ZNTA 2H4IA 3A29A 1ZBMA 4QFPA 1NH7A 3C9HA 4G77A 3UP9A 1TXFA 2Y7WA 2WKYA 4P3LA 3SESA 3RPLB 2LAOA 3CIJA 5DEXA 4NGUA 3LR1A 2HEUA 1MG1A 3TDJA 1GTKA 1JVYA 2PYYA 4QFLA 2Q2CA 4E0XA 2UVJA 1P1QA 1K9ZA 4YB6A 3M3LA 3LSLA 1IMEA 1FQBA 3LUZA 1FTAA 4YKIA 2WX9A 4PC9A 5B7DA 4OVTA 5ESYA 4NF5A 1HSEA 1KWHA 1QJMA 4R6KA 3PPPA 4GWSA 5DYHA 4AB5A 4ZZAA 2XX7A 4JDFA 1YAEA 3OO7A 1H3DA 4NF6A 1DSNA 1B2HA 4PFBA 1KA1A 2XD3A 2F36A 1EYJA 4F22A 1NV3A 3K1PA 4EUOA 4ESXA 2Y5LA 1LBVA 2Z8EA 2X26A 1O64A 3KJ7A 1WVJA 1URSA 2P0SA 5JTYA 4IGRA 4G8HA 1SW5A 1MY1A 4ZS9A 1MXUA 5H8FA 4YB5A 3K6WA 1XI6A 3SZPA 4JWYA 3KN3A 1USYE 3RGYA 3FXUA 3BFUA 2VPNA 3FVKA 5T3JA 3HFUA 1MQDA 3MQ9A 2QVVA 3EHUA 4OA4A 4KD5A 4OVRA 4FJPA 1IMDA 3PUYE 4OEUA 4PAIA 5BWJA 4TLLB 1BKAA 1KZ8A 5DW8A 3ILTB 4F3GA 2V4CA 1DCUA 1MY2A 4RY1A 5I2KA 1B3GA 5CI5A 4FORA 2KQZA 3IFAA 5H8HB 5ICTA 3MZ9A 4ELQA 3T9VA 1B0HA 4OQOA 5I58A 4H45A 2I58A 3G3FA 1SQYA 1MY4A 1FPLA 4LVQA 1VE4A 3LSXA 5DVFA 4ZECA 1Z7NE 2RC7A 4PQJA 2QL3A 4X9TA 3O9PA 2GQ1A 3IB1A 3A09A 4WEDA 3FV2A 2XXUA 1B4ZA 5ET8A 4OHNA 5FTIA 2DYXA 2OCUA 4DDDA 3KOSA 4P11A 2ZNSA 3JV9A 4R75A 4XKPA 3QMFA 4POXA 1NMUA 4OFOA 4GBWA 2YJPA 4X48A 2I49A 3VVFA 3TODA 5CMMA 2H25A 1XOCA 4PDHA 3IOWA 1MXZA 3OD7A 4NTLA 5IZ1A 4GD5A 1FPBA 1IXGA 1LBWA 5HPQA 2DVCA 4N4UA 4Q8RA 3ODBA 5ICQA 1MM6A 3FXBA 3JZJA 4O8MA 1MQGA 2F6PA 1JW5A 3RT8A 3T9XB 5EHMA 3VVEA 2W7YA 2DP8A 4WXJA 1B9JA 3G3IA 4EXLA 5CM6A 1XC1A 2Q8JA 2FYIA 1NV5A 4F1YA 2I0BA 4QFNA 3T66A 1IQ7A 1MQJA 3OSQA 4N6KA 1GGGA 4XKQA 3I3VA 4PGPA 1B7ZA 3CI8A 4JWXA 1SW1A 3K6XA 2B65A 3C34A 4ZEKA 3OELA 4QBAA 4YMAA 3FV1A 2ZYKA 4GVOA 5ET7A 3T96B 5TP9A 2PX1A 2R9JA 3ZSFA 5TPAA 3PUVE 1MQIA 4OANA 2GFEA 4O94A 1A8FA 2F7AA 1CNQA 1JW4A 5ISUA 4N81A 1LEVA 3TTMA 2F78A 1S7YA 4HCWA 1LGBC 2O51A 5IAIA 4JSDA 3QAXA 3T0JA 4PF8A 4PBHA 4ZE8A 3KBRA 4RPOA 3PGFA 2JJKA 3T93B 1LCFA 5A5LA 2OWSA 3K00A 4HTGA 4XTCQ 2QMWA 3DP6A 3TTLA 5I7IA 1IMFA 2Y7KA 3G7WA 1YYZA 4YMBA 1LB8A 1EH3A 3K1NA 3TTRA 3Q28A 2REJA 4MNPA 2FA7A 2I3VA 1N3XA 4LONB 1JW1A 3V5AA 4EDPA 1OMPA 2FIEA 1UTBA 3RN8A 1B6HA 3TCFA 3CVGA 3HPIA 5LDZA 4F19A 3C4MA 4NF8A 1UTHB 2B3BA 2VPOA 1B0LA 1SPIA 3U92A 4OVQA 1FBDA 3OO8A 5J1DA 2FIXA 3SEWA 1EZPA 3OO6A 3C32A 5I57B 4OFJA 4IO2A 3W9VA 1NFTA 1TWYA 4F1UA 4BDQA 1ATGA 2PT2A 3T1BA 4PFRA 1NV0A 2XWKA 3U1OA 3AXFA 3KBZA 4PFUA 1Y3PA 4U23A 4R2FA 2QS4A 1FPDA 2M8CA 1EZOA 3L6HA 4EQBA 4LUBA 2YPNA 1B3EA 3K02A 4JVDA 2AL5A 2DOJA 4Q5TA 2L5VA 1LFIA 1FBHA 4IY6A 4G68A 4MX6A 4ND9A 1I69A 1IMAA 3KN8A 3H4ZA 4GWYA 3TCGA 4OMBA 3VV5A 4FEDA 4THIA 3MAMA 5JEIA 2OWZA 4QSCA 3ZS6A 4DXCA 1A8EA 2HCAA 4IY5A 4NHBA 4NE4A 1Y20A 1LBCA 3IOUA 2O84X 1NV7A 2AIXA 5ET6A 3ZKLA 1VFEA 4FATA 1I6BA 4I9DA 2ZMBA 3HHFA 2XWVA 5EYGA 4RJZA 4U4XA 5KCJB 3DELB 2PBWA 3WAFA 4GQOA 4NF0A 3IOTA 4GIZA 5K2YA 1FTLA 3EKIA 4YU0A 1FQCA 4OYVA 4NG7A 2F7BA 2GHAA 3H6VA 2QPQA 1L5TA 3IORA 1IUDA 3S9MC 1N7XA 1USYH 1NUZA 3N6UA 2B4LA 3TZAA 2WYPA 2Y7IA 4H5GA 2H9BA 3H06B 4P8BA 1P1OA 4U1OA 5IZ3B 1QVSA 2GHBA 2DS9A 3V8XB 1NNFA 4M4GA 1Q35A 2D5WA 3V83A 5ITOA 3PMWA 4WKMA 2E1SA 3C33A 4K3FA 4RK2A 4DZ1A 1FQFA 3MP1A 5AA4B 4O7IA 3HN0A 4UABA 1OVBA 1MXWA 3THIA 1LFHA 4N8YA 1FQDA 4F29A 2OJTA 3UORA 3TTKA 3ISPA 4HCYA 3N26A 1LBBA 1NI9A 1PB8A 4F39A 5CBSA 2GRVA 4HW8A 4PDDA 2NWJA 1MPDA 3FVNA 4XKNA 1ZLQA 3SEYA 1SYIA 1M5EA 4AQ4A 4I62A 1US4A 1LFGA 5JTYB 4FAJA 2UYEA 4G4PA 1R6ZA 2ABHA 1NUXA 2NOOA 2CZHA 2DWIA 1EU8A 5IZZA 3KFMA 2ZYOA 4NEDA 1RDXA 1N0TA 2HXWA 4ECFA 3K6UA 2VOZA 3KEIA 2H5YA 3D1RA 4M1VA 5I59A 3LSFB 4HE1A 5CMCA 5H8QA 3PPQA 2ZXTA 3RNNA 4XKRA 2QS3A 2D21A 2IEEA 2Z8FA 4ZEDA 4RK9A 1LSTA 4I8CA 4WEPA 5L9OA 2KLFA 1PC3A 1B51A 4XEQA 5AA2B 3GYYA 4G8MA 1UIUA 1SW2A 3C35A 1OIBA 2F5XA 4P1LA 4QHQA 4RXLA 3OEMA 4GOTA 3ILUB 2BJIA 2OX3A 4PFYA 3CR9A 1P1WA 4E0WA 1FTOA 1LLSA 3JYRA 4FBPA 2OLBA 2ZZVA 3BIHA 3Q27A 3G3KA 2XD2A 4OTEA 3FVGA 2PCRA 2QFLA 4G8NA 4DCYA 3B7DA 3MYUA 4LATA 4NF4A 3VLUA 4QSDA 4NWDA 3ECRA 3BBRA 4LA9A 5KDTB 3H6WA 1M5CA 3TELA 2PMSA 3QUJA 3MP6A 4XF5A 1NV2A 2DDKA 2VP1A 3S4UA 2DE4A 1LAFE 1N84A 5H8NA 3TQLA 4QFKA 1RKMA 2P1SA 4IO3A 2HFBA 2MKZA 3RPLA 1B5JA 4NAPA 5EHSA 1KA0A 3M3KA 4HE0A 4GX4A 1FJ6A 3MVWA 1F9BA 1Y3QA 3HO7A 4MFIA 3CG1A 1M5BA 1IITA 4RNSA 2FBPA 3MVZA 4U2RA 4LN5A 3U93A 4N15A 4TQUQ 3MZBA 4EQ9A 4RYAA 1B40A 1ZJLA 5EQ9A 3RPWA 2ZYNA 3T9HB 4GWZA 3IO6A 4IGTA 2OZZA 4NWCA 3ROJA 3CFXA 4NQ8A 2UVIA 3PPNA 3USDA 2Q74A 1B32A 1OVTA 4U21A 1FBPA 4R73A 3QSLA 2O1LA 4LZ7A 2A5TB 4I1DA 2QRYA 4OENA 2THIA 1AIVA 1BTJA 1IEJA 2I3WA 4OZ9A 2O69A 3HCQA 1FBFA 3RLFE 3FD3A 3QXMA 4ZE9A 2F3BA 4BDMA 4GWOA 1OQHA 4F2QA 4BDLA 3PV0E 2CZKA 3OEKA 2I4BA 2VGQA 2NXOA 3R6UA 2RINA 3M8UA 2Z8DA 4OVJA 2ZNUA 1M5DA 2O1MA 2OWTA 3VE1B 1ZMGA 4F18A 2B4MA 3SEVA 2DQVA 3HHGA 4H1XA 1MXVA 3OOAA 2XX9A 1QW0A 3Q25A 1T0KA 4Z0IA 1FQAA 3UK4A 3SKPA 2WEFA 3VXBA 1QKBA 2D3IA 5EQ8A 5I56B 2O7UA 3DLNA 1PB9A 5H8HA 5FTHA 1NUYA 4G61A 4MAGA 1JVXA 2DE3A 4R6HA 1GVCA 3GZGA 3KJTA 4JWOA 4Q30B 3EHTA 1FQEA 3E9XA 4Q0CA 3MP8A 4PFTA 3P7IA 3OXNA 1PDAA 4ELPA 4LZ8A 4PP0A 2V3UA 3VVDA 1LBZA 1QUJA 4QXDA 1NV1A 1Y3NA 2O6AA 4ZEIA 1NNKA 1XVXA 1O63A 3PUXE 1HSLA 2DWHA 3OO9A 3D4CA 2XXTA 4PAFA 5EYHA 1D9QA 1FBGA 4YKPA 4C1TA 4F2OA 4QFOA 3K1MA 1B05A 3K6VA 4KPTA 4OETA 4OVSA 3FXQA 4H0WA 3FJ7A 2ZYMA 3FBPA 3EHSA 1URDA 4EQ7A 1MRPA 2FHYA 4O3CA 5K2XA 2HPGA 2I4CA 5I3SA 3KC1A 4ESWA 3TCHA 2XXXA 4LQ5A 3FJMA 3PD9A 3IB0A 2ALUA 4ZZEA 3U65A 3VFJA 1JEVA 1FJ9A 2V25A 5BUUA 4PAKA 5A5XB 1AMFA 4GL0A 4N13A 1NNPA 2PVUA 2ZZXA 1B1HA 4AS4A 2DXRA 3D4GA 2X7QA 4KYSA 3LUYA 3ONMA 1I6AA 2P3NA 3T22A 1B3LA 3O6IA 1B58A 3DM0A 5FHOA 4NN3A 3VDFA 3PUZE 2ONSA 4LZ5A 1UIVA 3E3KA 2AL4A 2V3TA 2OBGA 4R72A 1XT8A 2Y5KA 1FPEA 5DTBA 4GX3A 2PFYA 1QUIA 3RTFB 3N5LA 4KR5A 4MNIA 4U22A 3U72A 1EYIA 3CSBA 4X1BA 3K01A 1Y4CA 5TU0A 1DBZA 1IXCA 4MJOA 1MY0A 1JEUA 4JB7A 2DVZA 3KOTA 1TFAA 1POY1 2BJJX 2XXHA 4DI4B 3T9UA 3SERA 2VT5A 5FBPA 2QS2A 4QF9A 1D9YA 5F7VA 3PTYA 1SD3A 3A3UA 2WBBA 1NUWA 1XHYA 4JXIA 2DSFA 2XXKA 3H03A 4OFLA 2H99A 1B46A 1DMBA 4EXKA 4YKKA 2GH9A 5JK4A 1AL3A 3CFLA 3G3HA 4POWA 5FHNA 1NNTA 3TMGA 1POTA 5J16A 1NKXA 2Y7PA 2CEYA 3TQWA 4XIGQ 3DP4A 4H8IA 4KYEA 3MBPA 5IM2A 1JETA 5IGAA 2V93A 1A55A 3K4UA 4KFQA 3VXCA 1QGXA 3KGCA 1UTHA 2XXPA 1MPCA 1Y1ZA 1SW4A 2Y84A 3KSXA 2UXAA 3FATA 2O7IA 1SDXA 4HE2A 5DEXB 4L17A 1B1XA 1VSOA 4MMPA 3K0VA 5F1QA 1MH4A 4FIMA 4YKJA 5LOMA 1PBQA 1FPIA 1IZ1A 5H8SA 1JP4A 2FVZA 1FSAA 4N17A 1ANFA 3GBBA 3V89B 4P1EA 1BK4A 3FGSA 1G0IA 4OEVA 4RPNA 2I48A 3TEPA 1QUKA 5CRYA 1BIYA 3KG2A 3SEUA 3O66A 1Y4TA 4P9KA 3N94A 4N6PA 3KC0A 1D9VA 2VHAA 1FCKA 1VDWA 2HZLA 3IO4A 1ZKBA 1VR5A 2WBDA 4NF5B 1H45A 1AWBA 3ZKKA 2F8DA 2YLNA 4IB2A 2ANJA 1OLCA 1H44A 5EYFA 5AE4A 1LAGE 3I6VA 4OESA 1MS7A 4MLVA 2H98A 3CHGA 2F6GA 1R9QA 4PFWA 3MJNA 1US5A 4NF6B 1K9YA 4ZEBA 1Y9UA 4ELOA 4KHZE 2HQ0A 3S9NC 4MNCA 3IB2A 2PT1A 2QMXA 2XA5A 3G3JA 3H6UA 3I5OA 1H43A 3PD8A 2XXWA 4QSEA 5KCJA 1XVYA 3EQ1A 3S2VA 5L9MA 2HAUA 3MWBA 4I3YA 1LBXA 1BP5A 3HV1A 3QK6A 3N6TA 1R9LA 2NVUB 5H8FB 5I2NA 1NL5A 5H8NB 2RCAA 4PFIA 1QKAA 3E78A 4KQPA 2F3DA 3W15C 3MVXA 4IO6A 2CEXA 4H46A 3G3GA 5I2KB 4I40A 2QSXA 5FHMA 2AYSA 4PE3A 5I58B 2P2AA 2CZLA 1Y1MA 4YAHX 5DVJA 2Y7RA 4GWWA 5M2VA 1GR2A 3TUSA 4N6DA 4DXBA 1A40A 1NH8A 5IZ3A 3IR1A 1I6QA 3KSJA 4MH5A 2G29A 2R71A 1LCTA 2PFZA 3QYTA 2F97A 4GXAA 3SDFA 3RUMA 4C1UA 3O6GA 2QS1A 3E79A 3QIMA 3UN6A 1B7HA 4DCXA 2Z23A 1MDQA 1FPGA 1M5FA 5AA4A 1VFDA 3RY3A 1FPKA 2QVRA 3VLVA 5EQ7A 4ZEFA 4OVPA 3EF7A 1FBCA 1ZU0A 2P3VA 1G0HA 4JBZA 2RC8A 1HSJA 3C31A 1DK4A 4PCDA 1ELJA 4AB6A 1EYKA 1N3WA 1MM7A 1YCJA 3FIRA 4P0GA 2XWOA 1IIWA 2B3FA 4IO7A 4GFRA 5L8DA 1EZ9A 2DE2A 4FE8A 2F35A 1RDZA 4IR8A 3IK6B 4HXVA 5ET5A 3LSWA 4MCOA 4QRZA 3CSGA 3GBAA 3IJXB 3VLWA 1WODA 3H3GA 3NOHA 4H65A 1RDYA 3FUZA 1N7WA 1S9TA 4GBVA 4N91A 2REGA 2UVGA 4O3AA 4ISUA 4ELRA 1P1UA 3IFCA 3M3FA 4G2ZA 1B7UA 3TKDA 3E13X 1SI1A 2QJEA 1N04A 2Q8MA 1II5A 3EPEA 4N8GA 3GXAA 4MEVA 3KZGA 3MSTA 5ITPA 4DLDA 1JQFA 2NUVA 4O3BA 5CBRA 3Q26A 5AA2A 3FZVA 4AS5A 2I0CA 2CZIA 1N76A 1LB9A 1FTMA 1MQHA 3PUWE 3RTWB 4GLIA 3O6HA 3OMBA 5AA1A 4DXUA 1JNFA 3FXRA 5TP9B 3MZ1A 2VD3A 3O28A 1BLFA 3RYDA 5AA2D 1DPEA 5TPAB 4BDRA 2A5SA 1P1NA 3B50A 1MPBA 1TT1A 1S50A 2XXVA 5KDTA 1A7LA 4IO5A 4NX1A 2XXQA 4FECA 1IXHA 4H8JA 3U94A 3R7XA 2QVUA 1MY3A 3PU5A 1SI0A 2Q88A 2KR0A 4NMYA 1YZ0A 4GWUA 4UACA 3MW0A 5I5PA 3BKIB 4DIGA 3B8BA 3PPRA 3IOVA 1CE2A 4JSOA 2R8TA 3HSTA 4GF8A 2O68A 4BDOA 1DPPA 4Z7EA 3EN3A 3KN7A 1UTBB 2XXRA 1FTJA 4PTKA 4F3SA 5CC2A 1LAXA 4NF8B 4R9GA 1ZIUA 3FASA 3K2DA 1IXIA 4PBQA 2RC9A 3IJOB 3MC2A 3TPAA 3B6QA 1CB6A 3IL1B 3CG3A 2R6GE 2X7PA 2OK2A 1OLAA 4ONYA 1INPA 4KXPA 3H6TA 1SYHA 2A5TA 1MDP1 1MXYA 5F24A 4U1ZA 1DOTA 1RYXA 5L9SA 1URGA 3L6GA 4IO4A 1NV6A 3UGWA 4G68B 2HHMA 2VD2A 3IX1A 1B3FA 4GXSB 1B5IA 4P56A 2UVHA 1FRPA 3LV0A 3OSRA 4H67A 2DXYA 3MPLA 4GX6A 4DE8A 5B70A 3A3CA 5HBCA 1FBEA 5I84A 2V84A 1B52A 1A99A 1B3HA 4OXVA 2Z22A 3PMXA 4MBPA 3W9WA 4GWXA 4R6YA 5I56A 4BDNA 4F1VA 4BLAA 5AA3A 4LQ2A 4G68C 1B5HA 3B6TA 4U4SA 4X1DA 3O97A 3GLBA 4FEBA 4OWDA 2HXRA 2I6EA 1FPJA 1XS5A 1GV8A 2XWIA 3U8QA 5KZTA 1YXIA 2DWAA 5DVIA 1IMBA 4N07A 1PBPA 1FTKA 4EF1A 4R2BA 3BFTA 1B4HA 2RKMA 2ONKE 4PE5B 2FNCA 4YICA 5EQAA 4TLMB 4XFEA 2ZZWA 2RF1A 3TTNA 3F11A 2UYFA 3O29A 1PEBA 4XXUA 1AOVA 2HZKA 2F7CA 3FVOA 3RT6B 4PF6A 3MUQA 4GL8A 4F3BA 4PGNA 4KI0E 3H7MA 3PPOA 1A54A 3TAJA 2F34A 2WYKA
chains in the Genus database with same CATH topology
1WDNA 1YTVA 2XXIA 1FW0A 4ZDMA 4MF3A 4YZZA 4EF2A 3RQTA 5IKBA 2G93A 5ELVA 3S9LC 3CRBA 4F3PA 3MVYA 3O2AA 4KCCA 4R74A 2XX8A 5A5XA 3TYHA 2CMOA 3IAZA 3S9EA 1MH3A 2E0SA 4H6DA 1OQGA 4C0RA 5CMKA 1D3KA 1SBPA 2Q2AA 4TOZA 4KYDA 4LP2B 3PMVA 4H5FA 3SETA 1PB7A 3FJGA 5HM4B 5DT6A 3DP8A 1AH5A 5I57A 4P0IA 5I2NB 1MXXA 3TFLA 2V3QA 1DTGA 1D4NA 2IA4A 3MPKA 5I59B 3QUFA 4MLQA 3CFZA 5H8QB 2XHDA 2ONRA 1O7TA 2XXYA 1Z7ME 2ESNA 3LBSA 4F31B 2HAVA 3C36A 4RA1A 2Q89A 1DTZA 1SVXB 1H76A 1UQWA 3Q29A 3WAEA 1QULA 3B6WA 1P99A 3E4RA 1R1NA 2DWJA 1YPNA 3OENA 4UA8A 1LAHE 4YB7A 3LC8A 1Q1KA 3SEXA 4HS7A 1J1NA 1RYOA 1TFDA 3R26A 4PETA 4R9FA 4OERA 2Q9TA 4KCDA 4NF4B 3UA8A 4GRKA 3UIFA 1ZTYA 2RCBA 5CMBA 2ZNTA 2H4IA 1ZBMA 4QFPA 1NH7A 3C9HA 4G77A 3UP9A 1TXFA 2Y7WA 2WKYA 3SESA 2LAOA 3CIJA 5DEXA 3LR1A 2HEUA 1MG1A 3TDJA 1GTKA 1JVYA 2PYYA 4QFLA 2Q2CA 4E0XA 2UVJA 1P1QA 4YB6A 3M3LA 3LSLA 1FQBA 4YKIA 5B7DA 4NF5A 1HSEA 1KWHA 1QJMA 4R6KA 3PPPA 5DYHA 4AB5A 4ZZAA 2XX7A 4JDFA 1YAEA 3OO7A 1H3DA 4NF6A 1DSNA 1B2HA 2XD3A 2F36A 4F22A 3K1PA 4EUOA 4ESXA 2Z8EA 2X26A 1O64A 3KJ7A 1WVJA 1URSA 2P0SA 5JTYA 4IGRA 4G8HA 1SW5A 1MY1A 4ZS9A 1MXUA 5H8FA 4YB5A 3K6WA 4JWYA 3KN3A 1USYE 3RGYA 3FXUA 3BFUA 3FVKA 1MQDA 3MQ9A 3EHUA 4KD5A 4FJPA 4OEUA 3PUYE 5BWJA 4TLLB 1BKAA 3ILTB 4F3GA 1MY2A 4RY1A 5I2KA 1B3GA 5CI5A 4FORA 5H8HB 5ICTA 3MZ9A 4ELQA 3T9VA 1B0HA 4OQOA 5I58A 2I58A 3G3FA 1SQYA 1MY4A 4LVQA 1VE4A 3LSXA 5DVFA 4ZECA 1Z7NE 2RC7A 2QL3A 4PQJA 4X9TA 3O9PA 3IB1A 3A09A 4WEDA 3FV2A 2XXUA 1B4ZA 4OHNA 5FTIA 2DYXA 2OCUA 4DDDA 3KOSA 4P11A 2ZNSA 3JV9A 4R75A 4XKPA 4POXA 1NMUA 4OFOA 2YJPA 4X48A 2I49A 3VVFA 3TODA 5CMMA 2H25A 1XOCA 3IOWA 1MXZA 3OD7A 4NTLA 4GD5A 1IXGA 5HPQA 2DVCA 4Q8RA 3ODBA 5ICQA 1MM6A 3JZJA 1MQGA 2F6PA 1JW5A 3RT8A 3T9XB 5EHMA 3VVEA 2W7YA 2DP8A 4WXJA 1B9JA 3G3IA 4EXLA 5CM6A 1XC1A 2Q8JA 2FYIA 4F1YA 2I0BA 4QFNA 3T66A 1IQ7A 1MQJA 3OSQA 1GGGA 4XKQA 3I3VA 1B7ZA 3CI8A 4JWXA 1SW1A 3K6XA 2B65A 3C34A 4ZEKA 3OELA 4YMAA 3FV1A 2ZYKA 4GVOA 3T96B 5TP9A 2PX1A 2R9JA 3ZSFA 5TPAA 3PUVE 1MQIA 2GFEA 1A8FA 2F7AA 1JW4A 5ISUA 3TTMA 2F78A 1S7YA 4HCWA 1LGBC 2O51A 5IAIA 4JSDA 3QAXA 4ZE8A 3KBRA 4RPOA 3PGFA 3T93B 1LCFA 2OWSA 3K00A 4HTGA 4XTCQ 2QMWA 3DP6A 3TTLA 2Y7KA 3G7WA 4YMBA 1LB8A 1EH3A 3K1NA 3TTRA 3Q28A 2REJA 2FA7A 2I3VA 1N3XA 4LONB 1JW1A 3V5AA 4EDPA 1OMPA 1UTBA 3RN8A 1B6HA 3TCFA 3CVGA 3HPIA 4F19A 3C4MA 4NF8A 1UTHB 2B3BA 1B0LA 3U92A 3OO8A 5J1DA 3SEWA 1EZPA 3OO6A 3C32A 5I57B 4OFJA 4IO2A 3W9VA 1NFTA 1TWYA 4F1UA 4BDQA 1ATGA 2PT2A 3U1OA 3AXFA 4PFUA 1Y3PA 4U23A 4R2FA 2QS4A 2M8CA 1EZOA 3L6HA 4EQBA 4LUBA 2YPNA 1B3EA 3K02A 2AL5A 2DOJA 4Q5TA 1LFIA 4IY6A 4G68A 4ND9A 1I69A 3KN8A 3H4ZA 3TCGA 4OMBA 3VV5A 4FEDA 4THIA 3MAMA 5JEIA 4QSCA 3ZS6A 4DXCA 1A8EA 2HCAA 4IY5A 4NE4A 1Y20A 1LBCA 3IOUA 2O84X 2AIXA 3ZKLA 1VFEA 4FATA 1I6BA 4I9DA 2ZMBA 3HHFA 4RJZA 4U4XA 5KCJB 3DELB 2PBWA 3WAFA 4GQOA 3IOTA 4GIZA 5K2YA 1FTLA 4YU0A 1FQCA 4OYVA 2F7BA 2GHAA 3H6VA 2QPQA 1L5TA 3IORA 1IUDA 3S9MC 1N7XA 1USYH 3N6UA 3TZAA 2Y7IA 4H5GA 2H9BA 3H06B 1P1OA 4U1OA 1QVSA 2GHBA 2DS9A 3V8XB 1NNFA 4M4GA 1Q35A 2D5WA 3V83A 5ITOA 3PMWA 4WKMA 2E1SA 3C33A 4K3FA 4RK2A 4DZ1A 1FQFA 3MP1A 5AA4B 3HN0A 1OVBA 1MXWA 3THIA 1LFHA 1FQDA 4F29A 2OJTA 3UORA 3TTKA 4HCYA 3N26A 1LBBA 1PB8A 4F39A 5CBSA 2GRVA 4HW8A 2NWJA 1MPDA 3FVNA 4XKNA 1ZLQA 3SEYA 1SYIA 1M5EA 4AQ4A 4I62A 1US4A 1LFGA 5JTYB 4FAJA 2UYEA 4G4PA 2ABHA 1R6ZA 2NOOA 2DWIA 1EU8A 3KFMA 2ZYOA 4NEDA 1N0TA 2HXWA 4ECFA 3K6UA 2VOZA 3KEIA 2H5YA 4M1VA 5I59A 3LSFB 5CMCA 5H8QA 3PPQA 2ZXTA 3RNNA 4XKRA 2QS3A 2D21A 2IEEA 2Z8FA 4ZEDA 4RK9A 1LSTA 4I8CA 4WEPA 5L9OA 2KLFA 1PC3A 1B51A 5AA2B 4G8MA 1UIUA 1SW2A 3C35A 1OIBA 2F5XA 4QHQA 4RXLA 3OEMA 4GOTA 3ILUB 4PFYA 3CR9A 1P1WA 4E0WA 1FTOA 1LLSA 3JYRA 2OLBA 3Q27A 3G3KA 2XD2A 4OTEA 3FVGA 4G8NA 4DCYA 3B7DA 4LATA 4NF4A 3VLUA 4QSDA 4NWDA 3ECRA 3BBRA 4LA9A 5KDTB 3H6WA 1M5CA 3TELA 2PMSA 3QUJA 3MP6A 2VP1A 3S4UA 2DE4A 1LAFE 1N84A 5H8NA 3TQLA 4QFKA 1RKMA 2P1SA 4IO3A 2HFBA 1B5JA 5EHSA 3M3KA 3MVWA 1F9BA 1Y3QA 3HO7A 4MFIA 3CG1A 1M5BA 1IITA 4RNSA 3MVZA 4U2RA 3U93A 4TQUQ 3MZBA 4EQ9A 4RYAA 1B40A 1ZJLA 3RPWA 2ZYNA 3T9HB 3IO6A 4IGTA 2OZZA 4NWCA 3CFXA 2UVIA 3PPNA 3USDA 1B32A 1OVTA 4U21A 4R73A 3QSLA 2O1LA 4LZ7A 2A5TB 4I1DA 2QRYA 4OENA 2THIA 1AIVA 1BTJA 1IEJA 2I3WA 4OZ9A 2O69A 3HCQA 3RLFE 3FD3A 3QXMA 4ZE9A 4BDMA 4GWOA 1OQHA 4F2QA 4BDLA 3PV0E 3OEKA 2I4BA 2VGQA 2NXOA 3R6UA 2RINA 3M8UA 2Z8DA 4OVJA 2ZNUA 1M5DA 2O1MA 2OWTA 3VE1B 1ZMGA 4F18A 3SEVA 2DQVA 3HHGA 4H1XA 1MXVA 3OOAA 2XX9A 1QW0A 3Q25A 1T0KA 4Z0IA 1FQAA 3UK4A 3SKPA 3VXBA 1QKBA 2D3IA 5I56B 2O7UA 3DLNA 1PB9A 5H8HA 5FTHA 1JVXA 2DE3A 4R6HA 1GVCA 3GZGA 3KJTA 4JWOA 4Q30B 3EHTA 1FQEA 3E9XA 4Q0CA 3MP8A 4PFTA 3P7IA 3OXNA 1PDAA 4ELPA 4LZ8A 4PP0A 2V3UA 3VVDA 1QUJA 1Y3NA 2O6AA 4ZEIA 1NNKA 1XVXA 1O63A 3PUXE 1HSLA 2DWHA 3OO9A 3D4CA 2XXTA 4YKPA 4C1TA 4F2OA 4QFOA 3K1MA 1B05A 3K6VA 4KPTA 4OETA 3FXQA 4H0WA 3FJ7A 2ZYMA 3EHSA 1URDA 4EQ7A 1MRPA 4O3CA 5K2XA 2I4CA 4ESWA 3TCHA 2XXXA 4LQ5A 3FJMA 3PD9A 3IB0A 2ALUA 4ZZEA 3VFJA 1JEVA 2V25A 5BUUA 5A5XB 1AMFA 4GL0A 4N13A 1NNPA 2PVUA 1B1HA 2DXRA 3D4GA 2X7QA 4KYSA 3LUYA 3ONMA 1I6AA 3T22A 1B3LA 3O6IA 1B58A 3DM0A 5FHOA 3VDFA 3PUZE 2ONSA 4LZ5A 1UIVA 3E3KA 2AL4A 2V3TA 2OBGA 4R72A 1XT8A 5DTBA 1QUIA 3RTFB 3N5LA 4KR5A 4U22A 3U72A 3CSBA 4X1BA 3K01A 1Y4CA 5TU0A 1IXCA 1MY0A 1JEUA 4JB7A 2DVZA 3KOTA 1TFAA 1POY1 2BJJX 2XXHA 3T9UA 3SERA 2QS2A 4QF9A 1D9YA 5F7VA 1SD3A 3A3UA 1XHYA 4JXIA 2DSFA 3H03A 4OFLA 2H99A 1B46A 1DMBA 4EXKA 4YKKA 2GH9A 5JK4A 1AL3A 3CFLA 3G3HA 4POWA 5FHNA 1NNTA 3TMGA 1POTA 1NKXA 2Y7PA 3TQWA 4XIGQ 3DP4A 4H8IA 4KYEA 3MBPA 1JETA 2V93A 1A55A 3K4UA 4KFQA 3VXCA 3KGCA 1UTHA 2XXPA 1MPCA 1Y1ZA 1SW4A 2Y84A 3KSXA 2UXAA 3FATA 2O7IA 1SDXA 5DEXB 4L17A 1B1XA 1VSOA 3K0VA 5F1QA 1MH4A 4FIMA 4YKJA 5LOMA 1PBQA 1IZ1A 5H8SA 1ANFA 3GBBA 3V89B 3FGSA 4OEVA 4RPNA 2I48A 3TEPA 1QUKA 5CRYA 1BIYA 3KG2A 3SEUA 3O66A 1Y4TA 3N94A 4N6PA 1D9VA 2VHAA 1FCKA 2HZLA 3IO4A 1ZKBA 1VR5A 4NF5B 1H45A 3ZKKA 2F8DA 2YLNA 4IB2A 2ANJA 1OLCA 1H44A 5EYFA 5AE4A 1LAGE 3I6VA 4OESA 1MS7A 4MLVA 2H98A 2F6GA 1R9QA 4PFWA 3MJNA 1US5A 4NF6B 4ZEBA 1Y9UA 4ELOA 4KHZE 2HQ0A 3S9NC 3IB2A 2PT1A 2QMXA 3G3JA 3H6UA 3I5OA 1H43A 3PD8A 2XXWA 4QSEA 5KCJA 1XVYA 3EQ1A 3S2VA 5L9MA 2HAUA 3MWBA 1BP5A 3HV1A 3QK6A 3N6TA 1R9LA 2NVUB 5H8FB 5I2NA 1NL5A 5H8NB 2RCAA 1QKAA 4KQPA 3W15C 3MVXA 4IO6A 3G3GA 5I2KB 2QSXA 5FHMA 2AYSA 5I58B 2P2AA 2CZLA 1Y1MA 4YAHX 5DVJA 2Y7RA 5M2VA 1GR2A 3TUSA 4DXBA 1A40A 1NH8A 3IR1A 1I6QA 3KSJA 4MH5A 2G29A 2R71A 1LCTA 3QYTA 2F97A 4GXAA 3SDFA 3RUMA 4C1UA 3O6GA 2QS1A 3QIMA 3UN6A 1B7HA 4DCXA 2Z23A 1MDQA 1M5FA 5AA4A 1VFDA 3RY3A 3VLVA 4ZEFA 3EF7A 1ZU0A 4JBZA 2RC8A 1HSJA 3C31A 1ELJA 4AB6A 1N3WA 1MM7A 1YCJA 3FIRA 4P0GA 1IIWA 2B3FA 4IO7A 4GFRA 5L8DA 1EZ9A 2DE2A 4FE8A 2F35A 3IK6B 3LSWA 4QRZA 3CSGA 3GBAA 3IJXB 3VLWA 1WODA 3H3GA 4H65A 3FUZA 1N7WA 1S9TA 2REGA 2UVGA 4O3AA 4ISUA 4ELRA 1P1UA 3M3FA 4G2ZA 1B7UA 3TKDA 3E13X 1SI1A 2QJEA 1N04A 1II5A 3EPEA 3GXAA 3KZGA 5ITPA 4DLDA 1JQFA 2NUVA 4O3BA 5CBRA 3Q26A 5AA2A 3FZVA 2I0CA 1N76A 1LB9A 1FTMA 1MQHA 3PUWE 3RTWB 4GLIA 3O6HA 3OMBA 5AA1A 4DXUA 1JNFA 3FXRA 5TP9B 3MZ1A 2VD3A 3O28A 1BLFA 5AA2D 1DPEA 5TPAB 4BDRA 2A5SA 1P1NA 1MPBA 1TT1A 1S50A 2XXVA 5KDTA 1A7LA 4IO5A 2XXQA 4FECA 1IXHA 4H8JA 3U94A 3R7XA 1MY3A 3PU5A 1SI0A 2Q88A 4NMYA 4UACA 3MW0A 3BKIB 4DIGA 3PPRA 3IOVA 1CE2A 4JSOA 3HSTA 4GF8A 2O68A 4BDOA 1DPPA 4Z7EA 3EN3A 3KN7A 1UTBB 2XXRA 1FTJA 4F3SA 5CC2A 1LAXA 4NF8B 4R9GA 1ZIUA 3FASA 3K2DA 1IXIA 2RC9A 3IJOB 3MC2A 3TPAA 3B6QA 1CB6A 3IL1B 3CG3A 2R6GE 2X7PA 2OK2A 1OLAA 4ONYA 3H6TA 1SYHA 2A5TA 1MDP1 1MXYA 1DOTA 4U1ZA 1RYXA 5L9SA 1URGA 3L6GA 4IO4A 3UGWA 4G68B 2VD2A 3IX1A 1B3FA 4GXSB 1B5IA 2UVHA 3OSRA 4H67A 2DXYA 3MPLA 4DE8A 5B70A 3A3CA 5HBCA 5I84A 2V84A 1B52A 1A99A 1B3HA 4OXVA 2Z22A 3PMXA 4MBPA 3W9WA 4R6YA 5I56A 4BDNA 4F1VA 4BLAA 5AA3A 4LQ2A 4G68C 1B5HA 3B6TA 4U4SA 4X1DA 3O97A 3GLBA 4FEBA 4OWDA 2I6EA 1XS5A 1GV8A 3U8QA 5KZTA 2DWAA 5DVIA 4N07A 1PBPA 1FTKA 4EF1A 4R2BA 3BFTA 1B4HA 2RKMA 2ONKE 4PE5B 2FNCA 4YICA 4TLMB 2RF1A 3TTNA 3F11A 2UYFA 3O29A 1PEBA 4XXUA 1AOVA 2HZKA 2F7CA 3FVOA 3RT6B 3MUQA 4GL8A 4F3BA 4KI0E 3H7MA 3PPOA 1A54A 3TAJA 2F34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDN A;  1YTV A;  2XXI A;  1FW0 A;  4ZDM A;  4MF3 A;  4YZZ A;  4EF2 A;  3RQT A;  5IKB A;  2G93 A;  5ELV A;  3S9L C;  3CRB A;  4F3P A;  3MVY A;  3O2A A;  4KCC A;  4R74 A;  2XX8 A;  5A5X A;  3TYH A;  2CMO A;  3IAZ A;  3S9E A;  1MH3 A;  2E0S A;  4H6D A;  1OQG A;  4C0R A;  5CMK A;  1D3K A;  1SBP A;  2Q2A A;  4TOZ A;  4KYD A;  4LP2 B;  3PMV A;  4H5F A;  3SET A;  1PB7 A;  3FJG A;  5HM4 B;  5DT6 A;  3DP8 A;  1AH5 A;  5I57 A;  4P0I A;  5I2N B;  1MXX A;  3TFL A;  2V3Q A;  1DTG A;  1D4N A;  2IA4 A;  3MPK A;  5I59 B;  3QUF A;  4MLQ A;  3CFZ A;  5H8Q B;  2XHD A;  2ONR A;  1O7T A;  2XXY A;  1Z7M E;  2ESN A;  3LBS A;  4F31 B;  2HAV A;  3C36 A;  4RA1 A;  2Q89 A;  1DTZ A;  1SVX B;  1H76 A;  1UQW A;  3Q29 A;  3WAE A;  1QUL A;  3B6W A;  1P99 A;  3E4R A;  1R1N A;  2DWJ A;  1YPN A;  3OEN A;  4UA8 A;  1LAH E;  4YB7 A;  3LC8 A;  1Q1K A;  3SEX A;  4HS7 A;  1J1N A;  1RYO A;  1TFD A;  3R26 A;  4PET A;  4R9F A;  4OER A;  2Q9T A;  4KCD A;  4NF4 B;  3UA8 A;  4GRK A;  3UIF A;  1ZTY A;  2RCB A;  5CMB A;  2ZNT A;  2H4I A;  1ZBM A;  4QFP A;  1NH7 A;  3C9H A;  4G77 A;  3UP9 A;  1TXF A;  2Y7W A;  2WKY A;  3SES A;  2LAO A;  3CIJ A;  5DEX A;  3LR1 A;  2HEU A;  1MG1 A;  3TDJ A;  1GTK A;  1JVY A;  2PYY A;  4QFL A;  2Q2C A;  4E0X A;  2UVJ A;  1P1Q A;  4YB6 A;  3M3L A;  3LSL A;  1FQB A;  4YKI A;  5B7D A;  4NF5 A;  1HSE A;  1KWH A;  1QJM A;  4R6K A;  3PPP A;  5DYH A;  4AB5 A;  4ZZA A;  2XX7 A;  4JDF A;  1YAE A;  3OO7 A;  1H3D A;  4NF6 A;  1DSN A;  1B2H A;  2XD3 A;  2F36 A;  4F22 A;  3K1P A;  4EUO A;  4ESX A;  2Z8E A;  2X26 A;  1O64 A;  3KJ7 A;  1WVJ A;  1URS A;  2P0S A;  5JTY A;  4IGR A;  4G8H A;  1SW5 A;  1MY1 A;  4ZS9 A;  1MXU A;  5H8F A;  4YB5 A;  3K6W A;  4JWY A;  3KN3 A;  1USY E;  3RGY A;  3FXU A;  3BFU A;  3FVK A;  1MQD A;  3MQ9 A;  3EHU A;  4KD5 A;  4FJP A;  4OEU A;  3PUY E;  5BWJ A;  4TLL B;  1BKA A;  3ILT B;  4F3G A;  1MY2 A;  4RY1 A;  5I2K A;  1B3G A;  5CI5 A;  4FOR A;  5H8H B;  5ICT A;  3MZ9 A;  4ELQ A;  3T9V A;  1B0H A;  4OQO A;  5I58 A;  2I58 A;  3G3F A;  1SQY A;  1MY4 A;  4LVQ A;  1VE4 A;  3LSX A;  5DVF A;  4ZEC A;  1Z7N E;  2RC7 A;  2QL3 A;  4PQJ A;  4X9T A;  3O9P A;  3IB1 A;  3A09 A;  4WED A;  3FV2 A;  2XXU A;  1B4Z A;  4OHN A;  5FTI A;  2DYX A;  2OCU A;  4DDD A;  3KOS A;  4P11 A;  2ZNS A;  3JV9 A;  4R75 A;  4XKP A;  4POX A;  1NMU A;  4OFO A;  2YJP A;  4X48 A;  2I49 A;  3VVF A;  3TOD A;  5CMM A;  2H25 A;  1XOC A;  3IOW A;  1MXZ A;  3OD7 A;  4NTL A;  4GD5 A;  1IXG A;  5HPQ A;  2DVC A;  4Q8R A;  3ODB A;  5ICQ A;  1MM6 A;  3JZJ A;  1MQG A;  2F6P A;  1JW5 A;  3RT8 A;  3T9X B;  5EHM A;  3VVE A;  2W7Y A;  2DP8 A;  4WXJ A;  1B9J A;  3G3I A;  4EXL A;  5CM6 A;  1XC1 A;  2Q8J A;  2FYI A;  4F1Y A;  2I0B A;  4QFN A;  3T66 A;  1IQ7 A;  1MQJ A;  3OSQ A;  1GGG A;  4XKQ A;  3I3V A;  1B7Z A;  3CI8 A;  4JWX A;  1SW1 A;  3K6X A;  2B65 A;  3C34 A;  4ZEK A;  3OEL A;  4YMA A;  3FV1 A;  2ZYK A;  4GVO A;  3T96 B;  5TP9 A;  2PX1 A;  2R9J A;  3ZSF A;  5TPA A;  3PUV E;  1MQI A;  2GFE A;  1A8F A;  2F7A A;  1JW4 A;  5ISU A;  3TTM A;  2F78 A;  1S7Y A;  4HCW A;  1LGB C;  2O51 A;  5IAI A;  4JSD A;  3QAX A;  4ZE8 A;  3KBR A;  4RPO A;  3PGF A;  3T93 B;  1LCF A;  2OWS A;  3K00 A;  4HTG A;  4XTC Q;  2QMW A;  3DP6 A;  3TTL A;  2Y7K A;  3G7W A;  4YMB A;  1LB8 A;  1EH3 A;  3K1N A;  3TTR A;  3Q28 A;  2REJ A;  2FA7 A;  2I3V A;  1N3X A;  4LON B;  1JW1 A;  3V5A A;  4EDP A;  1OMP A;  1UTB A;  3RN8 A;  1B6H A;  3TCF A;  3CVG A;  3HPI A;  4F19 A;  3C4M A;  4NF8 A;  1UTH B;  2B3B A;  1B0L A;  3U92 A;  3OO8 A;  5J1D A;  3SEW A;  1EZP A;  3OO6 A;  3C32 A;  5I57 B;  4OFJ A;  4IO2 A;  3W9V A;  1NFT A;  1TWY A;  4F1U A;  4BDQ A;  1ATG A;  2PT2 A;  3U1O A;  3AXF A;  4PFU A;  1Y3P A;  4U23 A;  4R2F A;  2QS4 A;  2M8C A;  1EZO A;  3L6H A;  4EQB A;  4LUB A;  2YPN A;  1B3E A;  3K02 A;  2AL5 A;  2DOJ A;  4Q5T A;  1LFI A;  4IY6 A;  4G68 A;  4ND9 A;  1I69 A;  3KN8 A;  3H4Z A;  3TCG A;  4OMB A;  3VV5 A;  4FED A;  4THI A;  3MAM A;  5JEI A;  4QSC A;  3ZS6 A;  4DXC A;  1A8E A;  2HCA A;  4IY5 A;  4NE4 A;  1Y20 A;  1LBC A;  3IOU A;  2O84 X;  2AIX A;  3ZKL A;  1VFE A;  4FAT A;  1I6B A;  4I9D A;  2ZMB A;  3HHF A;  4RJZ A;  4U4X A;  5KCJ B;  3DEL B;  2PBW A;  3WAF A;  4GQO A;  3IOT A;  4GIZ A;  5K2Y A;  1FTL A;  4YU0 A;  1FQC A;  4OYV A;  2F7B A;  2GHA A;  3H6V A;  2QPQ A;  1L5T A;  3IOR A;  1IUD A;  3S9M C;  1N7X A;  1USY H;  3N6U A;  3TZA A;  2Y7I A;  4H5G A;  2H9B A;  3H06 B;  1P1O A;  4U1O A;  1QVS A;  2GHB A;  2DS9 A;  3V8X B;  1NNF A;  4M4G A;  1Q35 A;  2D5W A;  3V83 A;  5ITO A;  3PMW A;  4WKM A;  2E1S A;  3C33 A;  4K3F A;  4RK2 A;  4DZ1 A;  1FQF A;  3MP1 A;  5AA4 B;  3HN0 A;  1OVB A;  1MXW A;  3THI A;  1LFH A;  1FQD A;  4F29 A;  2OJT A;  3UOR A;  3TTK A;  4HCY A;  3N26 A;  1LBB A;  1PB8 A;  4F39 A;  5CBS A;  2GRV A;  4HW8 A;  2NWJ A;  1MPD A;  3FVN A;  4XKN A;  1ZLQ A;  3SEY A;  1SYI A;  1M5E A;  4AQ4 A;  4I62 A;  1US4 A;  1LFG A;  5JTY B;  4FAJ A;  2UYE A;  4G4P A;  2ABH A;  1R6Z A;  2NOO A;  2DWI A;  1EU8 A;  3KFM A;  2ZYO A;  4NED A;  1N0T A;  2HXW A;  4ECF A;  3K6U A;  2VOZ A;  3KEI A;  2H5Y A;  4M1V A;  5I59 A;  3LSF B;  5CMC A;  5H8Q A;  3PPQ A;  2ZXT A;  3RNN A;  4XKR A;  2QS3 A;  2D21 A;  2IEE A;  2Z8F A;  4ZED A;  4RK9 A;  1LST A;  4I8C A;  4WEP A;  5L9O A;  2KLF A;  1PC3 A;  1B51 A;  5AA2 B;  4G8M A;  1UIU A;  1SW2 A;  3C35 A;  1OIB A;  2F5X A;  4QHQ A;  4RXL A;  3OEM A;  4GOT A;  3ILU B;  4PFY A;  3CR9 A;  1P1W A;  4E0W A;  1FTO A;  1LLS A;  3JYR A;  2OLB A;  3Q27 A;  3G3K A;  2XD2 A;  4OTE A;  3FVG A;  4G8N A;  4DCY A;  3B7D A;  4LAT A;  4NF4 A;  3VLU A;  4QSD A;  4NWD A;  3ECR A;  3BBR A;  4LA9 A;  5KDT B;  3H6W A;  1M5C A;  3TEL A;  2PMS A;  3QUJ A;  3MP6 A;  2VP1 A;  3S4U A;  2DE4 A;  1LAF E;  1N84 A;  5H8N A;  3TQL A;  4QFK A;  1RKM A;  2P1S A;  4IO3 A;  2HFB A;  1B5J A;  5EHS A;  3M3K A;  3MVW A;  1F9B A;  1Y3Q A;  3HO7 A;  4MFI A;  3CG1 A;  1M5B A;  1IIT A;  4RNS A;  3MVZ A;  4U2R A;  3U93 A;  4TQU Q;  3MZB A;  4EQ9 A;  4RYA A;  1B40 A;  1ZJL A;  3RPW A;  2ZYN A;  3T9H B;  3IO6 A;  4IGT A;  2OZZ A;  4NWC A;  3CFX A;  2UVI A;  3PPN A;  3USD A;  1B32 A;  1OVT A;  4U21 A;  4R73 A;  3QSL A;  2O1L A;  4LZ7 A;  2A5T B;  4I1D A;  2QRY A;  4OEN A;  2THI A;  1AIV A;  1BTJ A;  1IEJ A;  2I3W A;  4OZ9 A;  2O69 A;  3HCQ A;  3RLF E;  3FD3 A;  3QXM A;  4ZE9 A;  4BDM A;  4GWO A;  1OQH A;  4F2Q A;  4BDL A;  3PV0 E;  3OEK A;  2I4B A;  2VGQ A;  2NXO A;  3R6U A;  2RIN A;  3M8U A;  2Z8D A;  4OVJ A;  2ZNU A;  1M5D A;  2O1M A;  2OWT A;  3VE1 B;  1ZMG A;  4F18 A;  3SEV A;  2DQV A;  3HHG A;  4H1X A;  1MXV A;  3OOA A;  2XX9 A;  1QW0 A;  3Q25 A;  1T0K A;  4Z0I A;  1FQA A;  3UK4 A;  3SKP A;  3VXB A;  1QKB A;  2D3I A;  5I56 B;  2O7U A;  3DLN A;  1PB9 A;  5H8H A;  5FTH A;  1JVX A;  2DE3 A;  4R6H A;  1GVC A;  3GZG A;  3KJT A;  4JWO A;  4Q30 B;  3EHT A;  1FQE A;  3E9X A;  4Q0C A;  3MP8 A;  4PFT A;  3P7I A;  3OXN A;  1PDA A;  4ELP A;  4LZ8 A;  4PP0 A;  2V3U A;  3VVD A;  1QUJ A;  1Y3N A;  2O6A A;  4ZEI A;  1NNK A;  1XVX A;  1O63 A;  3PUX E;  1HSL A;  2DWH A;  3OO9 A;  3D4C A;  2XXT A;  4YKP A;  4C1T A;  4F2O A;  4QFO A;  3K1M A;  1B05 A;  3K6V A;  4KPT A;  4OET A;  3FXQ A;  4H0W A;  3FJ7 A;  2ZYM A;  3EHS A;  1URD A;  4EQ7 A;  1MRP A;  4O3C A;  5K2X A;  2I4C A;  4ESW A;  3TCH A;  2XXX A;  4LQ5 A;  3FJM A;  3PD9 A;  3IB0 A;  2ALU A;  4ZZE A;  3VFJ A;  1JEV A;  2V25 A;  5BUU A;  5A5X B;  1AMF A;  4GL0 A;  4N13 A;  1NNP A;  2PVU A;  1B1H A;  2DXR A;  3D4G A;  2X7Q A;  4KYS A;  3LUY A;  3ONM A;  1I6A A;  3T22 A;  1B3L A;  3O6I A;  1B58 A;  3DM0 A;  5FHO A;  3VDF A;  3PUZ E;  2ONS A;  4LZ5 A;  1UIV A;  3E3K A;  2AL4 A;  2V3T A;  2OBG A;  4R72 A;  1XT8 A;  5DTB A;  1QUI A;  3RTF B;  3N5L A;  4KR5 A;  4U22 A;  3U72 A;  3CSB A;  4X1B A;  3K01 A;  1Y4C A;  5TU0 A;  1IXC A;  1MY0 A;  1JEU A;  4JB7 A;  2DVZ A;  3KOT A;  1TFA A;  1POY 1;  2BJJ X;  2XXH A;  3T9U A;  3SER A;  2QS2 A;  4QF9 A;  1D9Y A;  5F7V A;  1SD3 A;  3A3U A;  1XHY A;  4JXI A;  2DSF A;  3H03 A;  4OFL A;  2H99 A;  1B46 A;  1DMB A;  4EXK A;  4YKK A;  2GH9 A;  5JK4 A;  1AL3 A;  3CFL A;  3G3H A;  4POW A;  5FHN A;  1NNT A;  3TMG A;  1POT A;  1NKX A;  2Y7P A;  3TQW A;  4XIG Q;  3DP4 A;  4H8I A;  4KYE A;  3MBP A;  1JET A;  2V93 A;  1A55 A;  3K4U A;  4KFQ A;  3VXC A;  3KGC A;  1UTH A;  2XXP A;  1MPC A;  1Y1Z A;  1SW4 A;  2Y84 A;  3KSX A;  2UXA A;  3FAT A;  2O7I A;  1SDX A;  5DEX B;  4L17 A;  1B1X A;  1VSO A;  3K0V A;  5F1Q A;  1MH4 A;  4FIM A;  4YKJ A;  5LOM A;  1PBQ A;  1IZ1 A;  5H8S A;  1ANF A;  3GBB A;  3V89 B;  3FGS A;  4OEV A;  4RPN A;  2I48 A;  3TEP A;  1QUK A;  5CRY A;  1BIY A;  3KG2 A;  3SEU A;  3O66 A;  1Y4T A;  3N94 A;  4N6P A;  1D9V A;  2VHA A;  1FCK A;  2HZL A;  3IO4 A;  1ZKB A;  1VR5 A;  4NF5 B;  1H45 A;  3ZKK A;  2F8D A;  2YLN A;  4IB2 A;  2ANJ A;  1OLC A;  1H44 A;  5EYF A;  5AE4 A;  1LAG E;  3I6V A;  4OES A;  1MS7 A;  4MLV A;  2H98 A;  2F6G A;  1R9Q A;  4PFW A;  3MJN A;  1US5 A;  4NF6 B;  4ZEB A;  1Y9U A;  4ELO A;  4KHZ E;  2HQ0 A;  3S9N C;  3IB2 A;  2PT1 A;  2QMX A;  3G3J A;  3H6U A;  3I5O A;  1H43 A;  3PD8 A;  2XXW A;  4QSE A;  5KCJ A;  1XVY A;  3EQ1 A;  3S2V A;  5L9M A;  2HAU A;  3MWB A;  1BP5 A;  3HV1 A;  3QK6 A;  3N6T A;  1R9L A;  2NVU B;  5H8F B;  5I2N A;  1NL5 A;  5H8N B;  2RCA A;  1QKA A;  4KQP A;  3W15 C;  3MVX A;  4IO6 A;  3G3G A;  5I2K B;  2QSX A;  5FHM A;  2AYS A;  5I58 B;  2P2A A;  2CZL A;  1Y1M A;  4YAH X;  5DVJ A;  2Y7R A;  5M2V A;  1GR2 A;  3TUS A;  4DXB A;  1A40 A;  1NH8 A;  3IR1 A;  1I6Q A;  3KSJ A;  4MH5 A;  2G29 A;  2R71 A;  1LCT A;  3QYT A;  2F97 A;  4GXA A;  3SDF A;  3RUM A;  4C1U A;  3O6G A;  2QS1 A;  3QIM A;  3UN6 A;  1B7H A;  4DCX A;  2Z23 A;  1MDQ A;  1M5F A;  5AA4 A;  1VFD A;  3RY3 A;  3VLV A;  4ZEF A;  3EF7 A;  1ZU0 A;  4JBZ A;  2RC8 A;  1HSJ A;  3C31 A;  1ELJ A;  4AB6 A;  1N3W A;  1MM7 A;  1YCJ A;  3FIR A;  4P0G A;  1IIW A;  2B3F A;  4IO7 A;  4GFR A;  5L8D A;  1EZ9 A;  2DE2 A;  4FE8 A;  2F35 A;  3IK6 B;  3LSW A;  4QRZ A;  3CSG A;  3GBA A;  3IJX B;  3VLW A;  1WOD A;  3H3G A;  4H65 A;  3FUZ A;  1N7W A;  1S9T A;  2REG A;  2UVG A;  4O3A A;  4ISU A;  4ELR A;  1P1U A;  3M3F A;  4G2Z A;  1B7U A;  3TKD A;  3E13 X;  1SI1 A;  2QJE A;  1N04 A;  1II5 A;  3EPE A;  3GXA A;  3KZG A;  5ITP A;  4DLD A;  1JQF A;  2NUV A;  4O3B A;  5CBR A;  3Q26 A;  5AA2 A;  3FZV A;  2I0C A;  1N76 A;  1LB9 A;  1FTM A;  1MQH A;  3PUW E;  3RTW B;  4GLI A;  3O6H A;  3OMB A;  5AA1 A;  4DXU A;  1JNF A;  3FXR A;  5TP9 B;  3MZ1 A;  2VD3 A;  3O28 A;  1BLF A;  5AA2 D;  1DPE A;  5TPA B;  4BDR A;  2A5S A;  1P1N A;  1MPB A;  1TT1 A;  1S50 A;  2XXV A;  5KDT A;  1A7L A;  4IO5 A;  2XXQ A;  4FEC A;  1IXH A;  4H8J A;  3U94 A;  3R7X A;  1MY3 A;  3PU5 A;  1SI0 A;  2Q88 A;  4NMY A;  4UAC A;  3MW0 A;  3BKI B;  4DIG A;  3PPR A;  3IOV A;  1CE2 A;  4JSO A;  3HST A;  4GF8 A;  2O68 A;  4BDO A;  1DPP A;  4Z7E A;  3EN3 A;  3KN7 A;  1UTB B;  2XXR A;  1FTJ A;  4F3S A;  5CC2 A;  1LAX A;  4NF8 B;  4R9G A;  1ZIU A;  3FAS A;  3K2D A;  1IXI A;  2RC9 A;  3IJO B;  3MC2 A;  3TPA A;  3B6Q A;  1CB6 A;  3IL1 B;  3CG3 A;  2R6G E;  2X7P A;  2OK2 A;  1OLA A;  4ONY A;  3H6T A;  1SYH A;  2A5T A;  1MDP 1;  1MXY A;  1DOT A;  4U1Z A;  1RYX A;  5L9S A;  1URG A;  3L6G A;  4IO4 A;  3UGW A;  4G68 B;  2VD2 A;  3IX1 A;  1B3F A;  4GXS B;  1B5I A;  2UVH A;  3OSR A;  4H67 A;  2DXY A;  3MPL A;  4DE8 A;  5B70 A;  3A3C A;  5HBC A;  5I84 A;  2V84 A;  1B52 A;  1A99 A;  1B3H A;  4OXV A;  2Z22 A;  3PMX A;  4MBP A;  3W9W A;  4R6Y A;  5I56 A;  4BDN A;  4F1V A;  4BLA A;  5AA3 A;  4LQ2 A;  4G68 C;  1B5H A;  3B6T A;  4U4S A;  4X1D A;  3O97 A;  3GLB A;  4FEB A;  4OWD A;  2I6E A;  1XS5 A;  1GV8 A;  3U8Q A;  5KZT A;  2DWA A;  5DVI A;  4N07 A;  1PBP A;  1FTK A;  4EF1 A;  4R2B A;  3BFT A;  1B4H A;  2RKM A;  2ONK E;  4PE5 B;  2FNC A;  4YIC A;  4TLM B;  2RF1 A;  3TTN A;  3F11 A;  2UYF A;  3O29 A;  1PEB A;  4XXU A;  1AOV A;  2HZK A;  2F7C A;  3FVO A;  3RT6 B;  3MUQ A;  4GL8 A;  4F3B A;  4KI0 E;  3H7M A;  3PPO A;  1A54 A;  3TAJ A;  2F34 A; 
#chains in the Genus database with same CATH topology
 1WDN A;  1YTV A;  2XXI A;  1FW0 A;  4ZDM A;  4O7M A;  4MF3 A;  4YZZ A;  4EF2 A;  3RQT A;  5IKB A;  2G93 A;  5ELV A;  3S9L C;  3CRB A;  4F3P A;  3MVY A;  3O2A A;  1FPF A;  4KCC A;  4R74 A;  2XX8 A;  5A5X A;  3TYH A;  2CMO A;  3IAZ A;  3S9E A;  1MH3 A;  2E0S A;  4H6D A;  5LTC A;  1OQG A;  4C0R A;  5CMK A;  1D3K A;  1SBP A;  2Q2A A;  4TOZ A;  4KYD A;  4LP2 B;  3PMV A;  4H5F A;  3SET A;  1PB7 A;  3FJG A;  5HM4 B;  5DT6 A;  3DP8 A;  1AH5 A;  5I57 A;  4P0I A;  5I2N B;  4JVI A;  3BIG A;  1MXX A;  3TFL A;  2V3Q A;  1DTG A;  1D4N A;  2IA4 A;  3MPK A;  5I59 B;  3QUF A;  4X8R A;  4MLQ A;  3CFZ A;  5H8Q B;  4JVC A;  4I3E A;  2XHD A;  2ONR A;  1Q9D A;  1O7T A;  2XXY A;  1Z7M E;  2ESN A;  3LBS A;  4F31 B;  2HAV A;  3C36 A;  4RA1 A;  2Q89 A;  1DTZ A;  1SVX B;  1H76 A;  1UQW A;  3Q29 A;  3WAE A;  1QUL A;  3B6W A;  1P99 A;  3E4R A;  1R1N A;  2DWJ A;  1LBY A;  4MIJ A;  1YPN A;  3OEN A;  4UA8 A;  1LAH E;  4YB7 A;  3LC8 A;  1Q1K A;  3SEX A;  1NV4 A;  4HS7 A;  1J1N A;  1RYO A;  1TFD A;  3R26 A;  4PET A;  4R9F A;  4OER A;  1IMC A;  2Q9T A;  4KCD A;  4X04 A;  4NF4 B;  3UA8 A;  4DI3 D;  4GRK A;  3UIF A;  1ZTY A;  2RCB A;  5CMB A;  4P47 A;  4MHF A;  2ZNT A;  2H4I A;  3A29 A;  1ZBM A;  4QFP A;  1NH7 A;  3C9H A;  4G77 A;  3UP9 A;  1TXF A;  2Y7W A;  2WKY A;  4P3L A;  3SES A;  3RPL B;  2LAO A;  3CIJ A;  5DEX A;  4NGU A;  3LR1 A;  2HEU A;  1MG1 A;  3TDJ A;  1GTK A;  1JVY A;  2PYY A;  4QFL A;  2Q2C A;  4E0X A;  2UVJ A;  1P1Q A;  1K9Z A;  4YB6 A;  3M3L A;  3LSL A;  1IME A;  1FQB A;  3LUZ A;  1FTA A;  4YKI A;  2WX9 A;  4PC9 A;  5B7D A;  4OVT A;  5ESY A;  4NF5 A;  1HSE A;  1KWH A;  1QJM A;  4R6K A;  3PPP A;  4GWS A;  5DYH A;  4AB5 A;  4ZZA A;  2XX7 A;  4JDF A;  1YAE A;  3OO7 A;  1H3D A;  4NF6 A;  1DSN A;  1B2H A;  4PFB A;  1KA1 A;  2XD3 A;  2F36 A;  1EYJ A;  4F22 A;  1NV3 A;  3K1P A;  4EUO A;  4ESX A;  2Y5L A;  1LBV A;  2Z8E A;  2X26 A;  1O64 A;  3KJ7 A;  1WVJ A;  1URS A;  2P0S A;  5JTY A;  4IGR A;  4G8H A;  1SW5 A;  1MY1 A;  4ZS9 A;  1MXU A;  5H8F A;  4YB5 A;  3K6W A;  1XI6 A;  3SZP A;  4JWY A;  3KN3 A;  1USY E;  3RGY A;  3FXU A;  3BFU A;  2VPN A;  3FVK A;  5T3J A;  3HFU A;  1MQD A;  3MQ9 A;  2QVV A;  3EHU A;  4OA4 A;  4KD5 A;  4OVR A;  4FJP A;  1IMD A;  3PUY E;  4OEU A;  4PAI A;  5BWJ A;  4TLL B;  1BKA A;  1KZ8 A;  5DW8 A;  3ILT B;  4F3G A;  2V4C A;  1DCU A;  1MY2 A;  4RY1 A;  5I2K A;  1B3G A;  5CI5 A;  4FOR A;  2KQZ A;  3IFA A;  5H8H B;  5ICT A;  3MZ9 A;  4ELQ A;  3T9V A;  1B0H A;  4OQO A;  5I58 A;  4H45 A;  2I58 A;  3G3F A;  1SQY A;  1MY4 A;  1FPL A;  4LVQ A;  1VE4 A;  3LSX A;  5DVF A;  4ZEC A;  1Z7N E;  2RC7 A;  4PQJ A;  2QL3 A;  4X9T A;  3O9P A;  2GQ1 A;  3IB1 A;  3A09 A;  4WED A;  3FV2 A;  2XXU A;  1B4Z A;  5ET8 A;  4OHN A;  5FTI A;  2DYX A;  2OCU A;  4DDD A;  3KOS A;  4P11 A;  2ZNS A;  3JV9 A;  4R75 A;  4XKP A;  3QMF A;  4POX A;  1NMU A;  4OFO A;  4GBW A;  2YJP A;  4X48 A;  2I49 A;  3VVF A;  3TOD A;  5CMM A;  2H25 A;  1XOC A;  4PDH A;  3IOW A;  1MXZ A;  3OD7 A;  4NTL A;  5IZ1 A;  4GD5 A;  1FPB A;  1IXG A;  1LBW A;  5HPQ A;  2DVC A;  4N4U A;  4Q8R A;  3ODB A;  5ICQ A;  1MM6 A;  3FXB A;  3JZJ A;  4O8M A;  1MQG A;  2F6P A;  1JW5 A;  3RT8 A;  3T9X B;  5EHM A;  3VVE A;  2W7Y A;  2DP8 A;  4WXJ A;  1B9J A;  3G3I A;  4EXL A;  5CM6 A;  1XC1 A;  2Q8J A;  2FYI A;  1NV5 A;  4F1Y A;  2I0B A;  4QFN A;  3T66 A;  1IQ7 A;  1MQJ A;  3OSQ A;  4N6K A;  1GGG A;  4XKQ A;  3I3V A;  4PGP A;  1B7Z A;  3CI8 A;  4JWX A;  1SW1 A;  3K6X A;  2B65 A;  3C34 A;  4ZEK A;  3OEL A;  4QBA A;  4YMA A;  3FV1 A;  2ZYK A;  4GVO A;  5ET7 A;  3T96 B;  5TP9 A;  2PX1 A;  2R9J A;  3ZSF A;  5TPA A;  3PUV E;  1MQI A;  4OAN A;  2GFE A;  4O94 A;  1A8F A;  2F7A A;  1CNQ A;  1JW4 A;  5ISU A;  4N81 A;  1LEV A;  3TTM A;  2F78 A;  1S7Y A;  4HCW A;  1LGB C;  2O51 A;  5IAI A;  4JSD A;  3QAX A;  3T0J A;  4PF8 A;  4PBH A;  4ZE8 A;  3KBR A;  4RPO A;  3PGF A;  2JJK A;  3T93 B;  1LCF A;  5A5L A;  2OWS A;  3K00 A;  4HTG A;  4XTC Q;  2QMW A;  3DP6 A;  3TTL A;  5I7I A;  1IMF A;  2Y7K A;  3G7W A;  1YYZ A;  4YMB A;  1LB8 A;  1EH3 A;  3K1N A;  3TTR A;  3Q28 A;  2REJ A;  4MNP A;  2FA7 A;  2I3V A;  1N3X A;  4LON B;  1JW1 A;  3V5A A;  4EDP A;  1OMP A;  2FIE A;  1UTB A;  3RN8 A;  1B6H A;  3TCF A;  3CVG A;  3HPI A;  5LDZ A;  4F19 A;  3C4M A;  4NF8 A;  1UTH B;  2B3B A;  2VPO A;  1B0L A;  1SPI A;  3U92 A;  4OVQ A;  1FBD A;  3OO8 A;  5J1D A;  2FIX A;  3SEW A;  1EZP A;  3OO6 A;  3C32 A;  5I57 B;  4OFJ A;  4IO2 A;  3W9V A;  1NFT A;  1TWY A;  4F1U A;  4BDQ A;  1ATG A;  2PT2 A;  3T1B A;  4PFR A;  1NV0 A;  2XWK A;  3U1O A;  3AXF A;  3KBZ A;  4PFU A;  1Y3P A;  4U23 A;  4R2F A;  2QS4 A;  1FPD A;  2M8C A;  1EZO A;  3L6H A;  4EQB A;  4LUB A;  2YPN A;  1B3E A;  3K02 A;  4JVD A;  2AL5 A;  2DOJ A;  4Q5T A;  2L5V A;  1LFI A;  1FBH A;  4IY6 A;  4G68 A;  4MX6 A;  4ND9 A;  1I69 A;  1IMA A;  3KN8 A;  3H4Z A;  4GWY A;  3TCG A;  4OMB A;  3VV5 A;  4FED A;  4THI A;  3MAM A;  5JEI A;  2OWZ A;  4QSC A;  3ZS6 A;  4DXC A;  1A8E A;  2HCA A;  4IY5 A;  4NHB A;  4NE4 A;  1Y20 A;  1LBC A;  3IOU A;  2O84 X;  1NV7 A;  2AIX A;  5ET6 A;  3ZKL A;  1VFE A;  4FAT A;  1I6B A;  4I9D A;  2ZMB A;  3HHF A;  2XWV A;  5EYG A;  4RJZ A;  4U4X A;  5KCJ B;  3DEL B;  2PBW A;  3WAF A;  4GQO A;  4NF0 A;  3IOT A;  4GIZ A;  5K2Y A;  1FTL A;  3EKI A;  4YU0 A;  1FQC A;  4OYV A;  4NG7 A;  2F7B A;  2GHA A;  3H6V A;  2QPQ A;  1L5T A;  3IOR A;  1IUD A;  3S9M C;  1N7X A;  1USY H;  1NUZ A;  3N6U A;  2B4L A;  3TZA A;  2WYP A;  2Y7I A;  4H5G A;  2H9B A;  3H06 B;  4P8B A;  1P1O A;  4U1O A;  5IZ3 B;  1QVS A;  2GHB A;  2DS9 A;  3V8X B;  1NNF A;  4M4G A;  1Q35 A;  2D5W A;  3V83 A;  5ITO A;  3PMW A;  4WKM A;  2E1S A;  3C33 A;  4K3F A;  4RK2 A;  4DZ1 A;  1FQF A;  3MP1 A;  5AA4 B;  4O7I A;  3HN0 A;  4UAB A;  1OVB A;  1MXW A;  3THI A;  1LFH A;  4N8Y A;  1FQD A;  4F29 A;  2OJT A;  3UOR A;  3TTK A;  3ISP A;  4HCY A;  3N26 A;  1LBB A;  1NI9 A;  1PB8 A;  4F39 A;  5CBS A;  2GRV A;  4HW8 A;  4PDD A;  2NWJ A;  1MPD A;  3FVN A;  4XKN A;  1ZLQ A;  3SEY A;  1SYI A;  1M5E A;  4AQ4 A;  4I62 A;  1US4 A;  1LFG A;  5JTY B;  4FAJ A;  2UYE A;  4G4P A;  1R6Z A;  2ABH A;  1NUX A;  2NOO A;  2CZH A;  2DWI A;  1EU8 A;  5IZZ A;  3KFM A;  2ZYO A;  4NED A;  1RDX A;  1N0T A;  2HXW A;  4ECF A;  3K6U A;  2VOZ A;  3KEI A;  2H5Y A;  3D1R A;  4M1V A;  5I59 A;  3LSF B;  4HE1 A;  5CMC A;  5H8Q A;  3PPQ A;  2ZXT A;  3RNN A;  4XKR A;  2QS3 A;  2D21 A;  2IEE A;  2Z8F A;  4ZED A;  4RK9 A;  1LST A;  4I8C A;  4WEP A;  5L9O A;  2KLF A;  1PC3 A;  1B51 A;  4XEQ A;  5AA2 B;  3GYY A;  4G8M A;  1UIU A;  1SW2 A;  3C35 A;  1OIB A;  2F5X A;  4P1L A;  4QHQ A;  4RXL A;  3OEM A;  4GOT A;  3ILU B;  2BJI A;  2OX3 A;  4PFY A;  3CR9 A;  1P1W A;  4E0W A;  1FTO A;  1LLS A;  3JYR A;  4FBP A;  2OLB A;  2ZZV A;  3BIH A;  3Q27 A;  3G3K A;  2XD2 A;  4OTE A;  3FVG A;  2PCR A;  2QFL A;  4G8N A;  4DCY A;  3B7D A;  3MYU A;  4LAT A;  4NF4 A;  3VLU A;  4QSD A;  4NWD A;  3ECR A;  3BBR A;  4LA9 A;  5KDT B;  3H6W A;  1M5C A;  3TEL A;  2PMS A;  3QUJ A;  3MP6 A;  4XF5 A;  1NV2 A;  2DDK A;  2VP1 A;  3S4U A;  2DE4 A;  1LAF E;  1N84 A;  5H8N A;  3TQL A;  4QFK A;  1RKM A;  2P1S A;  4IO3 A;  2HFB A;  2MKZ A;  3RPL A;  1B5J A;  4NAP A;  5EHS A;  1KA0 A;  3M3K A;  4HE0 A;  4GX4 A;  1FJ6 A;  3MVW A;  1F9B A;  1Y3Q A;  3HO7 A;  4MFI A;  3CG1 A;  1M5B A;  1IIT A;  4RNS A;  2FBP A;  3MVZ A;  4U2R A;  4LN5 A;  3U93 A;  4N15 A;  4TQU Q;  3MZB A;  4EQ9 A;  4RYA A;  1B40 A;  1ZJL A;  5EQ9 A;  3RPW A;  2ZYN A;  3T9H B;  4GWZ A;  3IO6 A;  4IGT A;  2OZZ A;  4NWC A;  3ROJ A;  3CFX A;  4NQ8 A;  2UVI A;  3PPN A;  3USD A;  2Q74 A;  1B32 A;  1OVT A;  4U21 A;  1FBP A;  4R73 A;  3QSL A;  2O1L A;  4LZ7 A;  2A5T B;  4I1D A;  2QRY A;  4OEN A;  2THI A;  1AIV A;  1BTJ A;  1IEJ A;  2I3W A;  4OZ9 A;  2O69 A;  3HCQ A;  1FBF A;  3RLF E;  3FD3 A;  3QXM A;  4ZE9 A;  2F3B A;  4BDM A;  4GWO A;  1OQH A;  4F2Q A;  4BDL A;  3PV0 E;  2CZK A;  3OEK A;  2I4B A;  2VGQ A;  2NXO A;  3R6U A;  2RIN A;  3M8U A;  2Z8D A;  4OVJ A;  2ZNU A;  1M5D A;  2O1M A;  2OWT A;  3VE1 B;  1ZMG A;  4F18 A;  2B4M A;  3SEV A;  2DQV A;  3HHG A;  4H1X A;  1MXV A;  3OOA A;  2XX9 A;  1QW0 A;  3Q25 A;  1T0K A;  4Z0I A;  1FQA A;  3UK4 A;  3SKP A;  2WEF A;  3VXB A;  1QKB A;  2D3I A;  5EQ8 A;  5I56 B;  2O7U A;  3DLN A;  1PB9 A;  5H8H A;  5FTH A;  1NUY A;  4G61 A;  4MAG A;  1JVX A;  2DE3 A;  4R6H A;  1GVC A;  3GZG A;  3KJT A;  4JWO A;  4Q30 B;  3EHT A;  1FQE A;  3E9X A;  4Q0C A;  3MP8 A;  4PFT A;  3P7I A;  3OXN A;  1PDA A;  4ELP A;  4LZ8 A;  4PP0 A;  2V3U A;  3VVD A;  1LBZ A;  1QUJ A;  4QXD A;  1NV1 A;  1Y3N A;  2O6A A;  4ZEI A;  1NNK A;  1XVX A;  1O63 A;  3PUX E;  1HSL A;  2DWH A;  3OO9 A;  3D4C A;  2XXT A;  4PAF A;  5EYH A;  1D9Q A;  1FBG A;  4YKP A;  4C1T A;  4F2O A;  4QFO A;  3K1M A;  1B05 A;  3K6V A;  4KPT A;  4OET A;  4OVS A;  3FXQ A;  4H0W A;  3FJ7 A;  2ZYM A;  3FBP A;  3EHS A;  1URD A;  4EQ7 A;  1MRP A;  2FHY A;  4O3C A;  5K2X A;  2HPG A;  2I4C A;  5I3S A;  3KC1 A;  4ESW A;  3TCH A;  2XXX A;  4LQ5 A;  3FJM A;  3PD9 A;  3IB0 A;  2ALU A;  4ZZE A;  3U65 A;  3VFJ A;  1JEV A;  1FJ9 A;  2V25 A;  5BUU A;  4PAK A;  5A5X B;  1AMF A;  4GL0 A;  4N13 A;  1NNP A;  2PVU A;  2ZZX A;  1B1H A;  4AS4 A;  2DXR A;  3D4G A;  2X7Q A;  4KYS A;  3LUY A;  3ONM A;  1I6A A;  2P3N A;  3T22 A;  1B3L A;  3O6I A;  1B58 A;  3DM0 A;  5FHO A;  4NN3 A;  3VDF A;  3PUZ E;  2ONS A;  4LZ5 A;  1UIV A;  3E3K A;  2AL4 A;  2V3T A;  2OBG A;  4R72 A;  1XT8 A;  2Y5K A;  1FPE A;  5DTB A;  4GX3 A;  2PFY A;  1QUI A;  3RTF B;  3N5L A;  4KR5 A;  4MNI A;  4U22 A;  3U72 A;  1EYI A;  3CSB A;  4X1B A;  3K01 A;  1Y4C A;  5TU0 A;  1DBZ A;  1IXC A;  4MJO A;  1MY0 A;  1JEU A;  4JB7 A;  2DVZ A;  3KOT A;  1TFA A;  1POY 1;  2BJJ X;  2XXH A;  4DI4 B;  3T9U A;  3SER A;  2VT5 A;  5FBP A;  2QS2 A;  4QF9 A;  1D9Y A;  5F7V A;  3PTY A;  1SD3 A;  3A3U A;  2WBB A;  1NUW A;  1XHY A;  4JXI A;  2DSF A;  2XXK A;  3H03 A;  4OFL A;  2H99 A;  1B46 A;  1DMB A;  4EXK A;  4YKK A;  2GH9 A;  5JK4 A;  1AL3 A;  3CFL A;  3G3H A;  4POW A;  5FHN A;  1NNT A;  3TMG A;  1POT A;  5J16 A;  1NKX A;  2Y7P A;  2CEY A;  3TQW A;  4XIG Q;  3DP4 A;  4H8I A;  4KYE A;  3MBP A;  5IM2 A;  1JET A;  5IGA A;  2V93 A;  1A55 A;  3K4U A;  4KFQ A;  3VXC A;  1QGX A;  3KGC A;  1UTH A;  2XXP A;  1MPC A;  1Y1Z A;  1SW4 A;  2Y84 A;  3KSX A;  2UXA A;  3FAT A;  2O7I A;  1SDX A;  4HE2 A;  5DEX B;  4L17 A;  1B1X A;  1VSO A;  4MMP A;  3K0V A;  5F1Q A;  1MH4 A;  4FIM A;  4YKJ A;  5LOM A;  1PBQ A;  1FPI A;  1IZ1 A;  5H8S A;  1JP4 A;  2FVZ A;  1FSA A;  4N17 A;  1ANF A;  3GBB A;  3V89 B;  4P1E A;  1BK4 A;  3FGS A;  1G0I A;  4OEV A;  4RPN A;  2I48 A;  3TEP A;  1QUK A;  5CRY A;  1BIY A;  3KG2 A;  3SEU A;  3O66 A;  1Y4T A;  4P9K A;  3N94 A;  4N6P A;  3KC0 A;  1D9V A;  2VHA A;  1FCK A;  1VDW A;  2HZL A;  3IO4 A;  1ZKB A;  1VR5 A;  2WBD A;  4NF5 B;  1H45 A;  1AWB A;  3ZKK A;  2F8D A;  2YLN A;  4IB2 A;  2ANJ A;  1OLC A;  1H44 A;  5EYF A;  5AE4 A;  1LAG E;  3I6V A;  4OES A;  1MS7 A;  4MLV A;  2H98 A;  3CHG A;  2F6G A;  1R9Q A;  4PFW A;  3MJN A;  1US5 A;  4NF6 B;  1K9Y A;  4ZEB A;  1Y9U A;  4ELO A;  4KHZ E;  2HQ0 A;  3S9N C;  4MNC A;  3IB2 A;  2PT1 A;  2QMX A;  2XA5 A;  3G3J A;  3H6U A;  3I5O A;  1H43 A;  3PD8 A;  2XXW A;  4QSE A;  5KCJ A;  1XVY A;  3EQ1 A;  3S2V A;  5L9M A;  2HAU A;  3MWB A;  4I3Y A;  1LBX A;  1BP5 A;  3HV1 A;  3QK6 A;  3N6T A;  1R9L A;  2NVU B;  5H8F B;  5I2N A;  1NL5 A;  5H8N B;  2RCA A;  4PFI A;  1QKA A;  3E78 A;  4KQP A;  2F3D A;  3W15 C;  3MVX A;  4IO6 A;  2CEX A;  4H46 A;  3G3G A;  5I2K B;  4I40 A;  2QSX A;  5FHM A;  2AYS A;  4PE3 A;  5I58 B;  2P2A A;  2CZL A;  1Y1M A;  4YAH X;  5DVJ A;  2Y7R A;  4GWW A;  5M2V A;  1GR2 A;  3TUS A;  4N6D A;  4DXB A;  1A40 A;  1NH8 A;  5IZ3 A;  3IR1 A;  1I6Q A;  3KSJ A;  4MH5 A;  2G29 A;  2R71 A;  1LCT A;  2PFZ A;  3QYT A;  2F97 A;  4GXA A;  3SDF A;  3RUM A;  4C1U A;  3O6G A;  2QS1 A;  3E79 A;  3QIM A;  3UN6 A;  1B7H A;  4DCX A;  2Z23 A;  1MDQ A;  1FPG A;  1M5F A;  5AA4 A;  1VFD A;  3RY3 A;  1FPK A;  2QVR A;  3VLV A;  5EQ7 A;  4ZEF A;  4OVP A;  3EF7 A;  1FBC A;  1ZU0 A;  2P3V A;  1G0H A;  4JBZ A;  2RC8 A;  1HSJ A;  3C31 A;  1DK4 A;  4PCD A;  1ELJ A;  4AB6 A;  1EYK A;  1N3W A;  1MM7 A;  1YCJ A;  3FIR A;  4P0G A;  2XWO A;  1IIW A;  2B3F A;  4IO7 A;  4GFR A;  5L8D A;  1EZ9 A;  2DE2 A;  4FE8 A;  2F35 A;  1RDZ A;  4IR8 A;  3IK6 B;  4HXV A;  5ET5 A;  3LSW A;  4MCO A;  4QRZ A;  3CSG A;  3GBA A;  3IJX B;  3VLW A;  1WOD A;  3H3G A;  3NOH A;  4H65 A;  1RDY A;  3FUZ A;  1N7W A;  1S9T A;  4GBV A;  4N91 A;  2REG A;  2UVG A;  4O3A A;  4ISU A;  4ELR A;  1P1U A;  3IFC A;  3M3F A;  4G2Z A;  1B7U A;  3TKD A;  3E13 X;  1SI1 A;  2QJE A;  1N04 A;  2Q8M A;  1II5 A;  3EPE A;  4N8G A;  3GXA A;  4MEV A;  3KZG A;  3MST A;  5ITP A;  4DLD A;  1JQF A;  2NUV A;  4O3B A;  5CBR A;  3Q26 A;  5AA2 A;  3FZV A;  4AS5 A;  2I0C A;  2CZI A;  1N76 A;  1LB9 A;  1FTM A;  1MQH A;  3PUW E;  3RTW B;  4GLI A;  3O6H A;  3OMB A;  5AA1 A;  4DXU A;  1JNF A;  3FXR A;  5TP9 B;  3MZ1 A;  2VD3 A;  3O28 A;  1BLF A;  3RYD A;  5AA2 D;  1DPE A;  5TPA B;  4BDR A;  2A5S A;  1P1N A;  3B50 A;  1MPB A;  1TT1 A;  1S50 A;  2XXV A;  5KDT A;  1A7L A;  4IO5 A;  4NX1 A;  2XXQ A;  4FEC A;  1IXH A;  4H8J A;  3U94 A;  3R7X A;  2QVU A;  1MY3 A;  3PU5 A;  1SI0 A;  2Q88 A;  2KR0 A;  4NMY A;  1YZ0 A;  4GWU A;  4UAC A;  3MW0 A;  5I5P A;  3BKI B;  4DIG A;  3B8B A;  3PPR A;  3IOV A;  1CE2 A;  4JSO A;  2R8T A;  3HST A;  4GF8 A;  2O68 A;  4BDO A;  1DPP A;  4Z7E A;  3EN3 A;  3KN7 A;  1UTB B;  2XXR A;  1FTJ A;  4PTK A;  4F3S A;  5CC2 A;  1LAX A;  4NF8 B;  4R9G A;  1ZIU A;  3FAS A;  3K2D A;  1IXI A;  4PBQ A;  2RC9 A;  3IJO B;  3MC2 A;  3TPA A;  3B6Q A;  1CB6 A;  3IL1 B;  3CG3 A;  2R6G E;  2X7P A;  2OK2 A;  1OLA A;  4ONY A;  1INP A;  4KXP A;  3H6T A;  1SYH A;  2A5T A;  1MDP 1;  1MXY A;  5F24 A;  4U1Z A;  1DOT A;  1RYX A;  5L9S A;  1URG A;  3L6G A;  4IO4 A;  1NV6 A;  3UGW A;  4G68 B;  2HHM A;  2VD2 A;  3IX1 A;  1B3F A;  4GXS B;  1B5I A;  4P56 A;  2UVH A;  1FRP A;  3LV0 A;  3OSR A;  4H67 A;  2DXY A;  3MPL A;  4GX6 A;  4DE8 A;  5B70 A;  3A3C A;  5HBC A;  1FBE A;  5I84 A;  2V84 A;  1B52 A;  1A99 A;  1B3H A;  4OXV A;  2Z22 A;  3PMX A;  4MBP A;  3W9W A;  4GWX A;  4R6Y A;  5I56 A;  4BDN A;  4F1V A;  4BLA A;  5AA3 A;  4LQ2 A;  4G68 C;  1B5H A;  3B6T A;  4U4S A;  4X1D A;  3O97 A;  3GLB A;  4FEB A;  4OWD A;  2HXR A;  2I6E A;  1FPJ A;  1XS5 A;  1GV8 A;  2XWI A;  3U8Q A;  5KZT A;  1YXI A;  2DWA A;  5DVI A;  1IMB A;  4N07 A;  1PBP A;  1FTK A;  4EF1 A;  4R2B A;  3BFT A;  1B4H A;  2RKM A;  2ONK E;  4PE5 B;  2FNC A;  4YIC A;  5EQA A;  4TLM B;  4XFE A;  2ZZW A;  2RF1 A;  3TTN A;  3F11 A;  2UYF A;  3O29 A;  1PEB A;  4XXU A;  1AOV A;  2HZK A;  2F7C A;  3FVO A;  3RT6 B;  4PF6 A;  3MUQ A;  4GL8 A;  4F3B A;  4PGN A;  4KI0 E;  3H7M A;  3PPO A;  1A54 A;  3TAJ A;  2F34 A;  2WYK A; 
#chains in the Genus database with same CATH homology
 1WDN A;  1YTV A;  2XXI A;  1FW0 A;  4ZDM A;  4MF3 A;  4YZZ A;  4EF2 A;  3RQT A;  5IKB A;  2G93 A;  5ELV A;  3S9L C;  3CRB A;  4F3P A;  3MVY A;  3O2A A;  4KCC A;  4R74 A;  2XX8 A;  5A5X A;  3TYH A;  2CMO A;  3IAZ A;  3S9E A;  1MH3 A;  2E0S A;  4H6D A;  1OQG A;  4C0R A;  5CMK A;  1D3K A;  1SBP A;  2Q2A A;  4TOZ A;  4KYD A;  4LP2 B;  3PMV A;  4H5F A;  3SET A;  1PB7 A;  3FJG A;  5HM4 B;  5DT6 A;  3DP8 A;  1AH5 A;  5I57 A;  4P0I A;  5I2N B;  1MXX A;  3TFL A;  2V3Q A;  1DTG A;  1D4N A;  2IA4 A;  3MPK A;  5I59 B;  3QUF A;  4MLQ A;  3CFZ A;  5H8Q B;  2XHD A;  2ONR A;  1O7T A;  2XXY A;  1Z7M E;  2ESN A;  3LBS A;  4F31 B;  2HAV A;  3C36 A;  4RA1 A;  2Q89 A;  1DTZ A;  1SVX B;  1H76 A;  1UQW A;  3Q29 A;  3WAE A;  1QUL A;  3B6W A;  1P99 A;  3E4R A;  1R1N A;  2DWJ A;  1YPN A;  3OEN A;  4UA8 A;  1LAH E;  4YB7 A;  3LC8 A;  1Q1K A;  3SEX A;  4HS7 A;  1J1N A;  1RYO A;  1TFD A;  3R26 A;  4PET A;  4R9F A;  4OER A;  2Q9T A;  4KCD A;  4NF4 B;  3UA8 A;  4GRK A;  3UIF A;  1ZTY A;  2RCB A;  5CMB A;  2ZNT A;  2H4I A;  1ZBM A;  4QFP A;  1NH7 A;  3C9H A;  4G77 A;  3UP9 A;  1TXF A;  2Y7W A;  2WKY A;  3SES A;  2LAO A;  3CIJ A;  5DEX A;  3LR1 A;  2HEU A;  1MG1 A;  3TDJ A;  1GTK A;  1JVY A;  2PYY A;  4QFL A;  2Q2C A;  4E0X A;  2UVJ A;  1P1Q A;  4YB6 A;  3M3L A;  3LSL A;  1FQB A;  4YKI A;  5B7D A;  4NF5 A;  1HSE A;  1KWH A;  1QJM A;  4R6K A;  3PPP A;  5DYH A;  4AB5 A;  4ZZA A;  2XX7 A;  4JDF A;  1YAE A;  3OO7 A;  1H3D A;  4NF6 A;  1DSN A;  1B2H A;  2XD3 A;  2F36 A;  4F22 A;  3K1P A;  4EUO A;  4ESX A;  2Z8E A;  2X26 A;  1O64 A;  3KJ7 A;  1WVJ A;  1URS A;  2P0S A;  5JTY A;  4IGR A;  4G8H A;  1SW5 A;  1MY1 A;  4ZS9 A;  1MXU A;  5H8F A;  4YB5 A;  3K6W A;  4JWY A;  3KN3 A;  1USY E;  3RGY A;  3FXU A;  3BFU A;  3FVK A;  1MQD A;  3MQ9 A;  3EHU A;  4KD5 A;  4FJP A;  4OEU A;  3PUY E;  5BWJ A;  4TLL B;  1BKA A;  3ILT B;  4F3G A;  1MY2 A;  4RY1 A;  5I2K A;  1B3G A;  5CI5 A;  4FOR A;  5H8H B;  5ICT A;  3MZ9 A;  4ELQ A;  3T9V A;  1B0H A;  4OQO A;  5I58 A;  2I58 A;  3G3F A;  1SQY A;  1MY4 A;  4LVQ A;  1VE4 A;  3LSX A;  5DVF A;  4ZEC A;  1Z7N E;  2RC7 A;  2QL3 A;  4PQJ A;  4X9T A;  3O9P A;  3IB1 A;  3A09 A;  4WED A;  3FV2 A;  2XXU A;  1B4Z A;  4OHN A;  5FTI A;  2DYX A;  2OCU A;  4DDD A;  3KOS A;  4P11 A;  2ZNS A;  3JV9 A;  4R75 A;  4XKP A;  4POX A;  1NMU A;  4OFO A;  2YJP A;  4X48 A;  2I49 A;  3VVF A;  3TOD A;  5CMM A;  2H25 A;  1XOC A;  3IOW A;  1MXZ A;  3OD7 A;  4NTL A;  4GD5 A;  1IXG A;  5HPQ A;  2DVC A;  4Q8R A;  3ODB A;  5ICQ A;  1MM6 A;  3JZJ A;  1MQG A;  2F6P A;  1JW5 A;  3RT8 A;  3T9X B;  5EHM A;  3VVE A;  2W7Y A;  2DP8 A;  4WXJ A;  1B9J A;  3G3I A;  4EXL A;  5CM6 A;  1XC1 A;  2Q8J A;  2FYI A;  4F1Y A;  2I0B A;  4QFN A;  3T66 A;  1IQ7 A;  1MQJ A;  3OSQ A;  1GGG A;  4XKQ A;  3I3V A;  1B7Z A;  3CI8 A;  4JWX A;  1SW1 A;  3K6X A;  2B65 A;  3C34 A;  4ZEK A;  3OEL A;  4YMA A;  3FV1 A;  2ZYK A;  4GVO A;  3T96 B;  5TP9 A;  2PX1 A;  2R9J A;  3ZSF A;  5TPA A;  3PUV E;  1MQI A;  2GFE A;  1A8F A;  2F7A A;  1JW4 A;  5ISU A;  3TTM A;  2F78 A;  1S7Y A;  4HCW A;  1LGB C;  2O51 A;  5IAI A;  4JSD A;  3QAX A;  4ZE8 A;  3KBR A;  4RPO A;  3PGF A;  3T93 B;  1LCF A;  2OWS A;  3K00 A;  4HTG A;  4XTC Q;  2QMW A;  3DP6 A;  3TTL A;  2Y7K A;  3G7W A;  4YMB A;  1LB8 A;  1EH3 A;  3K1N A;  3TTR A;  3Q28 A;  2REJ A;  2FA7 A;  2I3V A;  1N3X A;  4LON B;  1JW1 A;  3V5A A;  4EDP A;  1OMP A;  1UTB A;  3RN8 A;  1B6H A;  3TCF A;  3CVG A;  3HPI A;  4F19 A;  3C4M A;  4NF8 A;  1UTH B;  2B3B A;  1B0L A;  3U92 A;  3OO8 A;  5J1D A;  3SEW A;  1EZP A;  3OO6 A;  3C32 A;  5I57 B;  4OFJ A;  4IO2 A;  3W9V A;  1NFT A;  1TWY A;  4F1U A;  4BDQ A;  1ATG A;  2PT2 A;  3U1O A;  3AXF A;  4PFU A;  1Y3P A;  4U23 A;  4R2F A;  2QS4 A;  2M8C A;  1EZO A;  3L6H A;  4EQB A;  4LUB A;  2YPN A;  1B3E A;  3K02 A;  2AL5 A;  2DOJ A;  4Q5T A;  1LFI A;  4IY6 A;  4G68 A;  4ND9 A;  1I69 A;  3KN8 A;  3H4Z A;  3TCG A;  4OMB A;  3VV5 A;  4FED A;  4THI A;  3MAM A;  5JEI A;  4QSC A;  3ZS6 A;  4DXC A;  1A8E A;  2HCA A;  4IY5 A;  4NE4 A;  1Y20 A;  1LBC A;  3IOU A;  2O84 X;  2AIX A;  3ZKL A;  1VFE A;  4FAT A;  1I6B A;  4I9D A;  2ZMB A;  3HHF A;  4RJZ A;  4U4X A;  5KCJ B;  3DEL B;  2PBW A;  3WAF A;  4GQO A;  3IOT A;  4GIZ A;  5K2Y A;  1FTL A;  4YU0 A;  1FQC A;  4OYV A;  2F7B A;  2GHA A;  3H6V A;  2QPQ A;  1L5T A;  3IOR A;  1IUD A;  3S9M C;  1N7X A;  1USY H;  3N6U A;  3TZA A;  2Y7I A;  4H5G A;  2H9B A;  3H06 B;  1P1O A;  4U1O A;  1QVS A;  2GHB A;  2DS9 A;  3V8X B;  1NNF A;  4M4G A;  1Q35 A;  2D5W A;  3V83 A;  5ITO A;  3PMW A;  4WKM A;  2E1S A;  3C33 A;  4K3F A;  4RK2 A;  4DZ1 A;  1FQF A;  3MP1 A;  5AA4 B;  3HN0 A;  1OVB A;  1MXW A;  3THI A;  1LFH A;  1FQD A;  4F29 A;  2OJT A;  3UOR A;  3TTK A;  4HCY A;  3N26 A;  1LBB A;  1PB8 A;  4F39 A;  5CBS A;  2GRV A;  4HW8 A;  2NWJ A;  1MPD A;  3FVN A;  4XKN A;  1ZLQ A;  3SEY A;  1SYI A;  1M5E A;  4AQ4 A;  4I62 A;  1US4 A;  1LFG A;  5JTY B;  4FAJ A;  2UYE A;  4G4P A;  2ABH A;  1R6Z A;  2NOO A;  2DWI A;  1EU8 A;  3KFM A;  2ZYO A;  4NED A;  1N0T A;  2HXW A;  4ECF A;  3K6U A;  2VOZ A;  3KEI A;  2H5Y A;  4M1V A;  5I59 A;  3LSF B;  5CMC A;  5H8Q A;  3PPQ A;  2ZXT A;  3RNN A;  4XKR A;  2QS3 A;  2D21 A;  2IEE A;  2Z8F A;  4ZED A;  4RK9 A;  1LST A;  4I8C A;  4WEP A;  5L9O A;  2KLF A;  1PC3 A;  1B51 A;  5AA2 B;  4G8M A;  1UIU A;  1SW2 A;  3C35 A;  1OIB A;  2F5X A;  4QHQ A;  4RXL A;  3OEM A;  4GOT A;  3ILU B;  4PFY A;  3CR9 A;  1P1W A;  4E0W A;  1FTO A;  1LLS A;  3JYR A;  2OLB A;  3Q27 A;  3G3K A;  2XD2 A;  4OTE A;  3FVG A;  4G8N A;  4DCY A;  3B7D A;  4LAT A;  4NF4 A;  3VLU A;  4QSD A;  4NWD A;  3ECR A;  3BBR A;  4LA9 A;  5KDT B;  3H6W A;  1M5C A;  3TEL A;  2PMS A;  3QUJ A;  3MP6 A;  2VP1 A;  3S4U A;  2DE4 A;  1LAF E;  1N84 A;  5H8N A;  3TQL A;  4QFK A;  1RKM A;  2P1S A;  4IO3 A;  2HFB A;  1B5J A;  5EHS A;  3M3K A;  3MVW A;  1F9B A;  1Y3Q A;  3HO7 A;  4MFI A;  3CG1 A;  1M5B A;  1IIT A;  4RNS A;  3MVZ A;  4U2R A;  3U93 A;  4TQU Q;  3MZB A;  4EQ9 A;  4RYA A;  1B40 A;  1ZJL A;  3RPW A;  2ZYN A;  3T9H B;  3IO6 A;  4IGT A;  2OZZ A;  4NWC A;  3CFX A;  2UVI A;  3PPN A;  3USD A;  1B32 A;  1OVT A;  4U21 A;  4R73 A;  3QSL A;  2O1L A;  4LZ7 A;  2A5T B;  4I1D A;  2QRY A;  4OEN A;  2THI A;  1AIV A;  1BTJ A;  1IEJ A;  2I3W A;  4OZ9 A;  2O69 A;  3HCQ A;  3RLF E;  3FD3 A;  3QXM A;  4ZE9 A;  4BDM A;  4GWO A;  1OQH A;  4F2Q A;  4BDL A;  3PV0 E;  3OEK A;  2I4B A;  2VGQ A;  2NXO A;  3R6U A;  2RIN A;  3M8U A;  2Z8D A;  4OVJ A;  2ZNU A;  1M5D A;  2O1M A;  2OWT A;  3VE1 B;  1ZMG A;  4F18 A;  3SEV A;  2DQV A;  3HHG A;  4H1X A;  1MXV A;  3OOA A;  2XX9 A;  1QW0 A;  3Q25 A;  1T0K A;  4Z0I A;  1FQA A;  3UK4 A;  3SKP A;  3VXB A;  1QKB A;  2D3I A;  5I56 B;  2O7U A;  3DLN A;  1PB9 A;  5H8H A;  5FTH A;  1JVX A;  2DE3 A;  4R6H A;  1GVC A;  3GZG A;  3KJT A;  4JWO A;  4Q30 B;  3EHT A;  1FQE A;  3E9X A;  4Q0C A;  3MP8 A;  4PFT A;  3P7I A;  3OXN A;  1PDA A;  4ELP A;  4LZ8 A;  4PP0 A;  2V3U A;  3VVD A;  1QUJ A;  1Y3N A;  2O6A A;  4ZEI A;  1NNK A;  1XVX A;  1O63 A;  3PUX E;  1HSL A;  2DWH A;  3OO9 A;  3D4C A;  2XXT A;  4YKP A;  4C1T A;  4F2O A;  4QFO A;  3K1M A;  1B05 A;  3K6V A;  4KPT A;  4OET A;  3FXQ A;  4H0W A;  3FJ7 A;  2ZYM A;  3EHS A;  1URD A;  4EQ7 A;  1MRP A;  4O3C A;  5K2X A;  2I4C A;  4ESW A;  3TCH A;  2XXX A;  4LQ5 A;  3FJM A;  3PD9 A;  3IB0 A;  2ALU A;  4ZZE A;  3VFJ A;  1JEV A;  2V25 A;  5BUU A;  5A5X B;  1AMF A;  4GL0 A;  4N13 A;  1NNP A;  2PVU A;  1B1H A;  2DXR A;  3D4G A;  2X7Q A;  4KYS A;  3LUY A;  3ONM A;  1I6A A;  3T22 A;  1B3L A;  3O6I A;  1B58 A;  3DM0 A;  5FHO A;  3VDF A;  3PUZ E;  2ONS A;  4LZ5 A;  1UIV A;  3E3K A;  2AL4 A;  2V3T A;  2OBG A;  4R72 A;  1XT8 A;  5DTB A;  1QUI A;  3RTF B;  3N5L A;  4KR5 A;  4U22 A;  3U72 A;  3CSB A;  4X1B A;  3K01 A;  1Y4C A;  5TU0 A;  1IXC A;  1MY0 A;  1JEU A;  4JB7 A;  2DVZ A;  3KOT A;  1TFA A;  1POY 1;  2BJJ X;  2XXH A;  3T9U A;  3SER A;  2QS2 A;  4QF9 A;  1D9Y A;  5F7V A;  1SD3 A;  3A3U A;  1XHY A;  4JXI A;  2DSF A;  3H03 A;  4OFL A;  2H99 A;  1B46 A;  1DMB A;  4EXK A;  4YKK A;  2GH9 A;  5JK4 A;  1AL3 A;  3CFL A;  3G3H A;  4POW A;  5FHN A;  1NNT A;  3TMG A;  1POT A;  1NKX A;  2Y7P A;  3TQW A;  4XIG Q;  3DP4 A;  4H8I A;  4KYE A;  3MBP A;  1JET A;  2V93 A;  1A55 A;  3K4U A;  4KFQ A;  3VXC A;  3KGC A;  1UTH A;  2XXP A;  1MPC A;  1Y1Z A;  1SW4 A;  2Y84 A;  3KSX A;  2UXA A;  3FAT A;  2O7I A;  1SDX A;  5DEX B;  4L17 A;  1B1X A;  1VSO A;  3K0V A;  5F1Q A;  1MH4 A;  4FIM A;  4YKJ A;  5LOM A;  1PBQ A;  1IZ1 A;  5H8S A;  1ANF A;  3GBB A;  3V89 B;  3FGS A;  4OEV A;  4RPN A;  2I48 A;  3TEP A;  1QUK A;  5CRY A;  1BIY A;  3KG2 A;  3SEU A;  3O66 A;  1Y4T A;  3N94 A;  4N6P A;  1D9V A;  2VHA A;  1FCK A;  2HZL A;  3IO4 A;  1ZKB A;  1VR5 A;  4NF5 B;  1H45 A;  3ZKK A;  2F8D A;  2YLN A;  4IB2 A;  2ANJ A;  1OLC A;  1H44 A;  5EYF A;  5AE4 A;  1LAG E;  3I6V A;  4OES A;  1MS7 A;  4MLV A;  2H98 A;  2F6G A;  1R9Q A;  4PFW A;  3MJN A;  1US5 A;  4NF6 B;  4ZEB A;  1Y9U A;  4ELO A;  4KHZ E;  2HQ0 A;  3S9N C;  3IB2 A;  2PT1 A;  2QMX A;  3G3J A;  3H6U A;  3I5O A;  1H43 A;  3PD8 A;  2XXW A;  4QSE A;  5KCJ A;  1XVY A;  3EQ1 A;  3S2V A;  5L9M A;  2HAU A;  3MWB A;  1BP5 A;  3HV1 A;  3QK6 A;  3N6T A;  1R9L A;  2NVU B;  5H8F B;  5I2N A;  1NL5 A;  5H8N B;  2RCA A;  1QKA A;  4KQP A;  3W15 C;  3MVX A;  4IO6 A;  3G3G A;  5I2K B;  2QSX A;  5FHM A;  2AYS A;  5I58 B;  2P2A A;  2CZL A;  1Y1M A;  4YAH X;  5DVJ A;  2Y7R A;  5M2V A;  1GR2 A;  3TUS A;  4DXB A;  1A40 A;  1NH8 A;  3IR1 A;  1I6Q A;  3KSJ A;  4MH5 A;  2G29 A;  2R71 A;  1LCT A;  3QYT A;  2F97 A;  4GXA A;  3SDF A;  3RUM A;  4C1U A;  3O6G A;  2QS1 A;  3QIM A;  3UN6 A;  1B7H A;  4DCX A;  2Z23 A;  1MDQ A;  1M5F A;  5AA4 A;  1VFD A;  3RY3 A;  3VLV A;  4ZEF A;  3EF7 A;  1ZU0 A;  4JBZ A;  2RC8 A;  1HSJ A;  3C31 A;  1ELJ A;  4AB6 A;  1N3W A;  1MM7 A;  1YCJ A;  3FIR A;  4P0G A;  1IIW A;  2B3F A;  4IO7 A;  4GFR A;  5L8D A;  1EZ9 A;  2DE2 A;  4FE8 A;  2F35 A;  3IK6 B;  3LSW A;  4QRZ A;  3CSG A;  3GBA A;  3IJX B;  3VLW A;  1WOD A;  3H3G A;  4H65 A;  3FUZ A;  1N7W A;  1S9T A;  2REG A;  2UVG A;  4O3A A;  4ISU A;  4ELR A;  1P1U A;  3M3F A;  4G2Z A;  1B7U A;  3TKD A;  3E13 X;  1SI1 A;  2QJE A;  1N04 A;  1II5 A;  3EPE A;  3GXA A;  3KZG A;  5ITP A;  4DLD A;  1JQF A;  2NUV A;  4O3B A;  5CBR A;  3Q26 A;  5AA2 A;  3FZV A;  2I0C A;  1N76 A;  1LB9 A;  1FTM A;  1MQH A;  3PUW E;  3RTW B;  4GLI A;  3O6H A;  3OMB A;  5AA1 A;  4DXU A;  1JNF A;  3FXR A;  5TP9 B;  3MZ1 A;  2VD3 A;  3O28 A;  1BLF A;  5AA2 D;  1DPE A;  5TPA B;  4BDR A;  2A5S A;  1P1N A;  1MPB A;  1TT1 A;  1S50 A;  2XXV A;  5KDT A;  1A7L A;  4IO5 A;  2XXQ A;  4FEC A;  1IXH A;  4H8J A;  3U94 A;  3R7X A;  1MY3 A;  3PU5 A;  1SI0 A;  2Q88 A;  4NMY A;  4UAC A;  3MW0 A;  3BKI B;  4DIG A;  3PPR A;  3IOV A;  1CE2 A;  4JSO A;  3HST A;  4GF8 A;  2O68 A;  4BDO A;  1DPP A;  4Z7E A;  3EN3 A;  3KN7 A;  1UTB B;  2XXR A;  1FTJ A;  4F3S A;  5CC2 A;  1LAX A;  4NF8 B;  4R9G A;  1ZIU A;  3FAS A;  3K2D A;  1IXI A;  2RC9 A;  3IJO B;  3MC2 A;  3TPA A;  3B6Q A;  1CB6 A;  3IL1 B;  3CG3 A;  2R6G E;  2X7P A;  2OK2 A;  1OLA A;  4ONY A;  3H6T A;  1SYH A;  2A5T A;  1MDP 1;  1MXY A;  1DOT A;  4U1Z A;  1RYX A;  5L9S A;  1URG A;  3L6G A;  4IO4 A;  3UGW A;  4G68 B;  2VD2 A;  3IX1 A;  1B3F A;  4GXS B;  1B5I A;  2UVH A;  3OSR A;  4H67 A;  2DXY A;  3MPL A;  4DE8 A;  5B70 A;  3A3C A;  5HBC A;  5I84 A;  2V84 A;  1B52 A;  1A99 A;  1B3H A;  4OXV A;  2Z22 A;  3PMX A;  4MBP A;  3W9W A;  4R6Y A;  5I56 A;  4BDN A;  4F1V A;  4BLA A;  5AA3 A;  4LQ2 A;  4G68 C;  1B5H A;  3B6T A;  4U4S A;  4X1D A;  3O97 A;  3GLB A;  4FEB A;  4OWD A;  2I6E A;  1XS5 A;  1GV8 A;  3U8Q A;  5KZT A;  2DWA A;  5DVI A;  4N07 A;  1PBP A;  1FTK A;  4EF1 A;  4R2B A;  3BFT A;  1B4H A;  2RKM A;  2ONK E;  4PE5 B;  2FNC A;  4YIC A;  4TLM B;  2RF1 A;  3TTN A;  3F11 A;  2UYF A;  3O29 A;  1PEB A;  4XXU A;  1AOV A;  2HZK A;  2F7C A;  3FVO A;  3RT6 B;  3MUQ A;  4GL8 A;  4F3B A;  4KI0 E;  3H7M A;  3PPO A;  1A54 A;  3TAJ A;  2F34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...