4ELOA

Ferric binding protein in apo form 1
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
308
structure length
308
Chain Sequence
TLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ferric binding protein A
rcsb
source organism Thermus thermophilus
molecule tags Metal transport
molecule keywords Iron ABC transporter, periplasmic iron-binding protein
total genus 110
structure length 308
sequence length 308
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4eloA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4eloA02
4HTGA 4PFWA 1NNFA 4N07A 1EZOA 2UVJA 2Y7RA 4YKKA 3CG3A 3B6QA 2DQVA 3KN3A 3M3FA 2YLNA 4F29A 2F97A 4QSDA 1M5FA 5KCJA 3IB1A 1LFIA 3OO7A 4NF4A 3OO9A 1QJMA 1B1XA 1POTA 3W15C 4RJZA 3FZVA 3JYRA 4POXA 3VFJA 1QUIA 4IY5A 4QFNA 4NF8A 5I2NB 1YCJA 2QL3A 4H65A 2QMXA 5H8HB 4NMYA 4YKJA 4EUOA 2HAUA 1ZJLA 3RTWB 3GXAA 3QXMA 3K02A 4F19A 3MWBA 2H9BA 1P99A 1URSA 1MPDA 1SD3A 3FGSA 4THIA 2I58A 5FHNA 2V25A 3GLBA 2F5XA 2V93A 3IOWA 2XXVA 4ZZAA 4I62A 4ESWA 3I6VA 4OENA 2I3VA 3TPAA 3TAJA 3TTLA 3SESA 3U94A 3S9NC 1N0TA 2XHDA 4JXIA 2Y7KA 4F18A 4RYAA 1XOCA 1EH3A 3E13X 1US5A 2RC7A 3QAXA 2GHAA 1NMUA 2XX7A 1GVCA 4YB5A 1SBPA 3B6WA 1B58A 2G29A 2OJTA 3KBRA 1WDNA 2HZKA 3B6TA 3DLNA 3FIRA 5ISUA 3H6VA 1JEUA 1Z7NE 3T96B 5H8HA 1JW1A 3RNNA 3MP8A 3FD3A 4R74A 5LOMA 2RINA 2O7IA 1Y20A 2I4BA 5FTIA 1FQCA 4YICA 3V89B 4FJPA 2ABHA 4ELRA 3KGCA 5IKBA 2HQ0A 4H8JA 5H8QB 1SW2A 1MQGA 4KFQA 4OFLA 2ZYKA 2HFBA 2ALUA 3KOSA 4DXUA 1RYOA 2DWHA 4IO5A 3VDFA 1Q35A 4IY6A 2XXTA 4C1TA 2QPQA 3HN0A 1UTHB 4QSEA 2ANJA 2VP1A 1P1WA 4HCYA 1LSTA 2RKMA 3EHSA 4K3FA 5DEXA 4IGRA 2NXOA 2F7CA 3CIJA 1LB9A 2XX9A 3PMWA 3N5LA 4GRKA 1US4A 5I2KB 3MVZA 4ZEBA 3T93B 4E0XA 4Z7EA 4EQ9A 4WEPA 1N76A 3MPLA 4ZZEA 1MPCA 1IEJA 1JVXA 4AQ4A 1EU8A 4ZEIA 3FJGA 4NE4A 4YMAA 4R2BA 5I57B 4YKPA 3KOTA 4TQUQ 1N3WA 1WVJA 5H8NB 1NH7A 1N7WA 1R9LA 4NF5B 2HEUA 2Q2CA 1MG1A 1JNFA 3ECRA 1B7UA 2RF1A 3QUJA 2Z8DA 3S2VA 3CFZA 3W9WA 3IJOB 4RK2A 1TXFA 3C9HA 2ZYOA 1MDP1 1TT1A 3EHUA 3FV2A 2XD2A 3QUFA 5CMCA 2E0SA 3UORA 1URDA 1JW4A 2OWTA 3ILTB 2Y84A 3IR1A 4P0GA 4ZEFA 4KR5A 2A5TA 3WAFA 3VXCA 1OLAA 2O6AA 2OLBA 2R71A 4ZE8A 1MY3A 1OLCA 3I5OA 3MP6A 3Q26A 5K2YA 3V8XB 1R9QA 4P0IA 1Y3NA 4G77A 1H44A 3IO4A 3C35A 5JEIA 3K4UA 4OEVA 2Z23A 1B52A 3K6VA 4JWOA 5AA3A 2QJEA 3TEPA 3CSGA 4F2QA 1O7TA 4U4XA 3CVGA 2F34A 3IJXB 2PX1A 3QK6A 5CM6A 1BTJA 1SI0A 3T66A 2R6GE 1OVTA 3T9VA 4F22A 4MLVA 5TPAA 3OELA 4R2FA 4IGTA 4AB5A 1RYXA 1LFHA 3C32A 1L5TA 2DE4A 5I58B 3A09A 4FATA 3H4ZA 4IO7A 3VVFA 4I8CA 3MQ9A 3THIA 1M5CA 2OK2A 4BLAA 4R9FA 3U8QA 4NF4B 2ONKE 3VLWA 2DE2A 5EHMA 2A5TB 2DVCA 2IA4A 4ZEKA 3PGFA 1KWHA 3L6HA 1ATGA 1B9JA 3TMGA 1LBCA 4GLIA 4OEUA 1M5DA 3O66A 4QFKA 4EF1A 5HM4B 3R6UA 2NUVA 1MM7A 3LSWA 1S9TA 4KYEA 4AB6A 3RY3A 3C4MA 4G68B 3TODA 1B3FA 3ILUB 1USYH 1I6AA 4ZEDA 5BWJA 1DTZA 3N6UA 3PUWE 4LQ2A 4KYDA 2AIXA 4FORA 2PT2A 4KCDA 4YZZA 1VR5A 1NH8A 2V3UA 1Q1KA 3TCGA 1B6HA 3VXBA 1PBPA 3M3LA 4MF3A 3R7XA 3ONMA 3MBPA 1B4ZA 5I58A 3UIFA 3S9MC 4N13A 1Y3QA 3K6UA 1MXYA 4NF6B 5A5XB 1HSJA 1H45A 5CMKA 4F31B 2XXIA 2ESNA 1LLSA 1MQIA 3VV5A 3L6GA 5I59A 4GXAA 4OHNA 4GL8A 4HS7A 2ZNSA 5I84A 2H25A 1B51A 1HSLA 3DP6A 4PE5B 2X7PA 2Q89A 4WEDA 3T22A 2I0BA 2VGQA 3TTKA 4DCXA 4H67A 2I6EA 3EHTA 1JQFA 1WODA 3MJNA 3TCFA 3KN8A 1B1HA 1VFDA 3PUXE 3IOUA 1AOVA 1NNKA 3MZBA 5CI5A 3RT6B 3SETA 3C36A 5TP9B 2P1SA 1B32A 2UVGA 4R9GA 1Y4CA 1LAHE 1SVXB 2V3TA 2QS2A 3HV1A 3ODBA 3U72A 1MH4A 3Q25A 4LONB 3UK4A 3MP1A 1MY4A 3TELA 1NFTA 1MH3A 1B40A 3VVEA 1UTHA 4X9TA 3FASA 3K2DA 3UN6A 1D4NA 1XS5A 2B3BA 3RUMA 4NF6A 3ZSFA 1EZPA 1LB8A 3TUSA 3RLFE 1R6ZA 2UXAA 4DE8A 4OERA 4DXBA 3QYTA 1B7HA 1O63A 1IXIA 2RC8A 2QRYA 3D4CA 3IB0A 4L17A 1XT8A 4OZ9A 3TCHA 5H8QA 2HCAA 1LCFA 2H98A 3Q27A 4G2ZA 1Y1ZA 5B70A 2PBWA 4UACA 4NWDA 2GH9A 1JW5A 3KFMA 2PMSA 3T9XB 4DXCA 4ELQA 2F36A 3HHFA 5AA2D 1GTKA 1JVYA 2UYFA 3FVOA 1H76A 3K01A 1FQAA 3OO8A 4OMBA 4ZE9A 2VHAA 3OXNA 3FV1A 1B4HA 2I4CA 5H8NA 4F3BA 1AL3A 3IORA 3CSBA 4XIGQ 3RPWA 4RNSA 5DVFA 1USYE 1Y1MA 2LAOA 4G8HA 4JWXA 3QIMA 3FVNA 3PMVA 3O2AA 4R73A 5AA1A 2Z22A 3EN3A 1B3EA 5ICQA 1VSOA 1RKMA 2Q9TA 4O3AA 1SW1A 3A3UA 4PETA 2VOZA 4XTCQ 4U4SA 2F6GA 2A5SA 3SEVA 1VE4A 3DP8A 4GOTA 2B3FA 5CRYA 4ZECA 3PPNA 1B3HA 2OCUA 1SYIA 3IOTA 3TYHA 1ZKBA 2CMOA 1SQYA 3ZS6A 3SEXA 3TTMA 2O84X 3E3KA 3KEIA 4RPOA 1XVYA 1S50A 2HZLA 4KYSA 4U21A 4PFYA 2YJPA 3MW0A 4RPNA 5H8SA 4OFJA 3V5AA 4QSCA 4TLMB 1FTOA 3H03A 2AL5A 4G8NA 4FEBA 3K1MA 1P1UA 1JETA 1MRPA 3IOVA 1POY1 3KSXA 5KCJB 5HBCA 1MXUA 3T9HB 3SEWA 3MPKA 4U22A 4Z0IA 3RTFB 2DXRA 1GR2A 2D3IA 3IO6A 5ITPA 1A40A 3O6GA 4QHQA 4C1UA 3TZAA 4OTEA 3OMBA 4F3GA 5B7DA 1CB6A 5I2NA 2QS4A 4KI0E 2UYEA 3FXUA 4H6DA 1MXVA 5DTBA 4G4PA 2P2AA 3E4RA 1LCTA 5FHOA 4R6HA 5EYFA 3HO7A 1A99A 1DPPA 3PPOA 4GFRA 4H0WA 1A8FA 4FE8A 3IL1B 5CBRA 2AL4A 4M4GA 2M8CA 5CMMA 4BDQA 4PFUA 3G3JA 3K6WA 3TTNA 2GFEA 3S4UA 3R26A 1R1NA 3CR9A 1ZIUA 4FIMA 4OYVA 4PQJA 3SDFA 1AIVA 1MXZA 2VD2A 4LQ5A 3C31A 2O51A 1II5A 2QS3A 4IO2A 1MY2A 1QUJA 2XXUA 3MZ1A 1MDQA 3HPIA 1D9YA 4IB2A 2REGA 4FAJA 3K00A 2DSFA 1ZTYA 4MFIA 4ZS9A 1A55A 1FQBA 4E0WA 1LAFE 2DWIA 1LAGE 2HXWA 2QSXA 2F7AA 3H6UA 4RA1A 3FXRA 1DOTA 4X1DA 3U93A 4P11A 3C34A 3MVYA 4BDNA 3TQLA 1B5JA 1D9VA 3KG2A 3RGYA 5H8FB 3SKPA 2RC9A 3CG1A 1MY1A 3HSTA 4LVQA 4RXLA 4F3PA 3E9XA 4WXJA 1NNTA 4DDDA 3SEUA 3MAMA 4YB7A 2V84A 4O3CA 4LZ5A 4BDMA 1TWYA 5TU0A 1YPNA 5I59B 1SW5A 4OXVA 2VD3A 1ZLQA 2OZZA 4FEDA 2D21A 1Y4TA 3JZJA 2UVHA 4I1DA 3GBAA 1SI1A 5JTYB 1MQHA 4R75A 3VE1B 1ANFA 1YTVA 2X7QA 2P0SA 3KJTA 4OVJA 1I6BA 3EPEA 3UP9A 1XHYA 4RY1A 4Q8RA 2H4IA 3H7MA 3BKIB 1ZU0A 5ICTA 2XXYA 1N84A 3O6HA 3KZGA 2I0CA 4RK9A 4F2OA 4QF9A 3N6TA 2D5WA 3G3GA 1I6QA 1XC1A 5AE4A 1MY0A 1SYHA 4JB7A 1B0HA 4GF8A 3AXFA 2Q88A 3Q29A 3K0VA 3UA8A 2H5YA 3U92A 4DIGA 5H8FA 1OMPA 2HAVA 2XXWA 3GBBA 3B7DA 4WKMA 3MC2A 3N26A 5DVJA 1FTKA 3WAEA 3BFUA 2PYYA 4ECFA 1MPBA 1H43A 5ELVA 5AA2A 1OQGA 1LGBC 3CFLA 2ONSA 1T0KA 2I49A 1P1OA 3RQTA 5JTYA 3OENA 3PUYE 4OWDA 3PPQA 4TLLB 1LBBA 2PVUA 5F1QA 1JEVA 2F8DA 1TFDA 2DXYA 3G3HA 4QFOA 5DT6A 3ZKLA 2RCAA 3C33A 2O1MA 2XXQA 3FUZA 4H5GA 4LUBA 4ONYA 3TQWA 4ESXA 1QKBA 4NWCA 4R72A 2FA7A 4MH5A 3TDJA 4LA9A 4JWYA 5K2XA 2X26A 1UIVA 3HHGA 3LSFB 3S9LC 5HPQA 4EF2A 3D4GA 1FQFA 3O9PA 3PV0E 1B5HA 1GGGA 1BLFA 1TFAA 4IO3A 4U1OA 1FTMA 1IXCA 2NOOA 4IO4A 4TOZA 3FJ7A 3HCQA 5F7VA 3CFXA 4EQ7A 3PUZE 2QS1A 2Y7WA 2Z8FA 1A7LA 3EF7A 4QRZA 4XKQA 4LATA 1FW0A 5TPAB 4PFTA 1IZ1A 3ZKKA 3O29A 5I56A 4QFPA 4PP0A 1LAXA 1B3LA 3LSXA 4N6PA 4X48A 5L8DA 4F1UA 3LSLA 2H99A 4GL0A 4XXUA 3KN7A 1O64A 3OD7A 4EXKA 4HW8A 1CE2A 3CI8A 3G3FA 4NTLA 3TTRA 4NEDA 1FQEA 3PUVE 4GD5A 2OBGA 2ZNTA 1H3DA 3DELB 4YMBA 2KLFA 5AA4B 3V83A 2Q2AA 4MLQA 3MUQA 3GZGA 3MZ9A 1LFGA 1DMBA 1UIUA 1XVXA 2XXPA 3OOAA 1D3KA 2O69A 4JBZA 3TKDA 1UTBB 4Q30B 3FVKA 4NF8B 4G68A 3BBRA 3MVXA 5EHSA 1IIWA 2FNCA 3PD8A 4GIZA 4GVOA 4EXLA 5IAIA 4BDRA 4YKIA 3U1OA 1ZBMA 2G93A 4GXSB 2XXXA 2UVIA 1OIBA 4Q0CA 2V3QA 3LUYA 1Y3PA 4YB6A 1PB8A 1NNPA 1SW4A 1QUKA 3H3GA 4KD5A 3IX1A 2NWJA 3PD9A 3RN8A 2OWSA 4R6KA 1SDXA 4GQOA 4JSDA 3UGWA 4F1VA 2GHBA 4IO6A 1UQWA 4XKRA 2E1SA 3PMXA 1F9BA 1J1NA 2QMWA 3EQ1A 1GV8A 3OSRA 1PDAA 5KZTA 5L9OA 3VVDA 4EDPA 3LBSA 3CRBA 3M8UA 5FHMA 5AA4A 4O3BA 1PBQA 5CC2A 3P7IA 4OFOA 4EQBA 2F78A 4C0RA 3T9UA 2AYSA 1DPEA 4G68C 1UTBA 4X1BA 3LR1A 1M5EA 1QVSA 3IAZA 1B46A 1MM6A 2ZXTA 3VLUA 1NL5A 4OQOA 5A5XA 2I3WA 2NVUB 2Y7PA 5DEXB 5TP9A 1FTLA 5KDTB 2F6PA 5L9SA 1VFEA 3VLVA 1MXXA 4POWA 5AA2B 3SEYA 1AH5A 2RCBA 5I2KA 3M3KA 4YAHX 4XKNA 1ELJA 4DZ1A 3K1PA 3FATA 3W9VA 4GWOA 3K6XA 3DP4A 2XX8A 3KJ7A 2Q8JA 4DCYA 3MVWA 1URGA 3DM0A 4OETA 2B65A 1BIYA 4G8MA 1QULA 2DYXA 3G3KA 3O97A 1B7ZA 3OSQA 4BDLA 2ZYMA 4LZ8A 3I3VA 2THIA 1P1QA 3PU5A 2FYIA 3FJMA 4Q5TA 4DLDA 1MXWA 4FECA 2GRVA 4NF5A 1OQHA 4ISUA 4LP2B 2DWJA 1NKXA 4M1VA 1IQ7A 2XXHA 2F7BA 2I48A 2ZYNA 3KSJA 3USDA 3FVGA 5L9MA 1M5BA 2F35A 3SERA 4LZ7A 4ZDMA 1MS7A 1ZMGA 3G7WA 1IXHA 4U2RA 4ELOA 2ZNUA 3JV9A 4KHZE 1PC3A 4U23A 4JSOA 2Y7IA 1QKAA 3Q28A 5I57A 1FQDA 4ELPA 1B0LA 5JK4A 2O7UA 3OEKA 3O28A 3OEMA 4F3SA 1PB7A 2PT1A 1IXGA 2O1LA 3IK6B 1PB9A 1N7XA 5M2VA 5KDTA 3PPRA 1BKAA 3PPPA 1OVBA 2DWAA 4I9DA 3OO6A 1N3XA 3LC8A 5CMBA 2O68A 2R9JA 4H5FA 1B05A 1S7YA 1FTJA 1B3GA 1YAEA 2YPNA 1QW0A 5FTHA 3H6WA 3H6TA 1FCKA 4HCWA 4H8IA 4OESA 3O6IA 1HSEA 5CBSA 3G3IA 2ONRA 1A8EA 2REJA 4R6YA 3QSLA 4XKPA 4BDOA 1DSNA 2DE3A 4KCCA 4F1YA 5BUUA 1B2HA 1N04A 1PEBA 1Y9UA 2CZLA 2DVZA 2XXRA 3FXQA 3N94A 3TFLA 5DYHA 4U1ZA 3IB2A 1IITA 1MQJA 5J1DA 3K1NA 1I69A 1AMFA 2XD3A 4UA8A 5ITOA 1BP5A 1DTGA 2IEEA 1Z7ME 4F39A 1A54A 2W7YA 4MBPA 1EZ9A 2ZMBA 3BFTA 4KPTA 3RT8A 2WKYA 1IUDA 1P1NA 3A3CA 4JDFA 4H1XA 1B5IA 3F11A 2DP8A 3H06B 4QFLA 5DVIA 4ND9A 5I56B 3S9EA 2DOJA 4KQPA 4YU0A 2Z8EA 2DS9A 2BJJX 1MQDA
chains in the Genus database with same CATH superfamily
4HTGA 4N07A 4GBVA 2OWZA 3M3FA 3KN3A 4F29A 5KCJA 3W15C 1QJMA 1POTA 4H65A 5H8HB 4YKJA 3RTWB 3QXMA 4F19A 1FPGA 2H9BA 4THIA 2I58A 3GLBA 2XXVA 4ESWA 3I6VA 2I3VA 3TPAA 3TAJA 3SESA 3S9NC 4JXIA 2Y7KA 1EH3A 1US5A 2GHAA 2CEYA 4MNCA 1GVCA 1B58A 3T96B 5IZ3B 1JW1A 3RNNA 4DI3D 4O7IA 2I4BA 4FJPA 4OFLA 4OVRA 4DXUA 2QPQA 3HN0A 1P1WA 3FBPA 2NXOA 2F7CA 2XX9A 3PMWA 2Y5LA 1N76A 4ZZEA 5I57B 3FJGA 3A29A 1WVJA 1R9LA 2HEUA 2Q2CA 1JNFA 2RF1A 2Z8DA 3S2VA 2ZYOA 2OWTA 3BIGA 4ZE8A 3I5OA 1Y3NA 3IO4A 1KA0A 5JEIA 4OEVA 2Z23A 4JWOA 5AA3A 3CSGA 1FPLA 2R6GE 4F22A 4AB5A 1LFHA 4IGTA 1RYXA 4FATA 3VVFA 1M5CA 2R8TA 2IA4A 1B9JA 1FPEA 1USYH 1I6AA 4OANA 4LQ2A 4X8RA 4YZZA 1PBPA 4MF3A 5I58A 1Y3QA 1MXYA 2XXIA 2Q8MA 3VV5A 3KC0A 4OHNA 5I84A 2H25A 2VGQA 4H67A 3IOUA 4R9GA 2V3TA 2QS2A 3HV1A 3ODBA 2Y5KA 1UTHA 2XXKA 2B3BA 3ZSFA 4N15A 2CZKA 4L17A 1B7HA 1O63A 3IB0A 1XT8A 2HCAA 5B70A 4G2ZA 1Y1ZA 5T3JA 3T9XB 2F36A 3HHFA 1GTKA 2VT5A 2UYFA 5I5PA 5H8NA 3FV1A 4PFBA 1AL3A 5DVFA 3QIMA 3O2AA 2Z22A 3EN3A 1B3EA 1RDZA 4O3AA 1SW1A 1KZ8A 4XTCQ 4GOTA 5CRYA 4MNPA 3PPNA 1B3HA 3IOTA 1ZKBA 2CMOA 3KEIA 1XVYA 4H45A 4RPNA 5H8SA 4FEBA 3IO6A 2D3IA 5ITPA 4OTEA 3T1BA 2UYEA 3FXUA 4H6DA 2P2AA 1NUZA 1A8FA 3IL1B 2AL4A 4M4GA 3TTNA 1R1NA 1MXZA 2VD2A 4IO2A 2QS3A 1MY2A 4FAJA 2REGA 4MFIA 4NGUA 3TQLA 1D9VA 5EQ7A 4F3PA 4RXLA 5J16A 4O3CA 5I59B 2D21A 1Y4TA 5AA2A 3GBAA 2X7QA 2P0SA 1I6BA 1N84A 4F2OA 2D5WA 5AE4A 1FBCA 1B0HA 3AXFA 2Q88A 3Q29A 3K0VA 2H5YA 2WBDA 1OMPA 3B7DA 5DVJA 2PYYA 1MPBA 5ELVA 1LGBC 3CFLA 2I49A 5JTYA 1LBBA 5F1QA 1JEVA 3FUZA 4P9KA 4PFIA 4NWCA 3LSFB 1FQFA 1GGGA 1FTMA 3FJ7A 3CFXA 3PUZE 2QS1A 1A7LA 1IZ1A 1YZ0A 4PP0A 3LSXA 1B3LA 4X48A 4F1UA 3OD7A 1EYKA 1G0IA 3TTRA 1FQEA 3PUVE 3V83A 2KLFA 5AA4B 4MLQA 3MZ9A 3TKDA 4G68A 1IMEA 1LEVA 4PGPA 2UVIA 3LUYA 1NV4A 1PB8A 4KD5A 3IX1A 3RN8A 3PD9A 2OWSA 1SDXA 4N4UA 3RPLB 3B8BA 4IO6A 3EQ1A 2DDKA 3GYYA 1B46A 2ZXTA 3VLUA 2I3WA 5DEXB 5KDTB 4YAHX 1ELJA 2MKZA 3K1PA 3W9VA 3MVWA 4G8MA 5ET8A 4LZ8A 4FECA 4NF5A 4ISUA 4ZDMA 1IXHA 3Q28A 1RDXA 4ELPA 3O28A 1PB7A 4GBWA 5M2VA 2O68A 2R9JA 4H5FA 2YPNA 1FCKA 4H8IA 2VPNA 3G3IA 1A8EA 1EYIA 2REJA 1DSNA 4F1YA 4KCCA 1Y9UA 3N94A 1PEBA 1FPKA 4U1ZA 1MQJA 1FBGA 3K1NA 1AMFA 4UA8A 1Z7ME 4P3LA 4KPTA 1IUDA 2DP8A 2DS9A 4PFWA 1EZOA 4YKKA 2XWKA 2YLNA 2F97A 1NI9A 4RJZA 3JYRA 2V4CA 4HE0A 2QMXA 5IZ3A 4EUOA 3K02A 1SD3A 3FGSA 3ISPA 5ET7A 4I62A 5LDZA 3SZPA 2XHDA 3E13X 4OA4A 3B6WA 2OJTA 3EKIA 3B6TA 3H6VA 4R74A 2RINA 1FQCA 3V89B 1SW2A 2ZYKA 2ALUA 1RYOA 4IY6A 2XXTA 4C1TA 4QSEA 2ANJA 5IGAA 4HCYA 1LSTA 2RKMA 5DEXA 4K3FA 4ZEBA 5ET6A 4N91A 4WEPA 1MPCA 1IEJA 1EU8A 4YMAA 4NE4A 5IM2A 3KOTA 4P8BA 4PGNA 1N3WA 4NF5B 1B7UA 3IJOB 4RK2A 1MDP1 1TT1A 3UORA 1URDA 1JW4A 4P0GA 3VXCA 2O6AA 2R71A 1MY3A 3Q26A 1R9QA 1IMAA 1H44A 3K4UA 2QJEA 3CHGA 2F34A 2PX1A 1FBDA 3T66A 1OVTA 3MSTA 3OELA 1L5TA 2DE4A 5I58B 4IO7A 4I8CA 4BLAA 4R9FA 3U8QA 5EHMA 4ZEKA 3PGFA 1KWHA 1LBCA 4OEUA 1MM7A 3LSWA 4AB6A 3C4MA 3TODA 3PUWE 2GQ1A 2AIXA 4FORA 1IMCA 3VXBA 2V3UA 3TCGA 1B6HA 4I3YA 3ONMA 3S9MC 1NV0A 3K6UA 4PC9A 1HSJA 4MHFA 1MQIA 3DP6A 1HSLA 2Q89A 1NUXA 1JQFA 1WODA 2QVVA 3KN8A 1NNKA 3MZBA 3RT6B 3SETA 3C36A 2BJIA 2UVGA 3U72A 1SVXB 3Q25A 3TELA 1MH3A 4PE3A 3UN6A 1XS5A 1EZPA 3RLFE 1R6ZA 5BWJA 5CMBA 4OZ9A 5CC2A 3T0JA 2CEXA 4ELQA 4PAFA 4GWUA 3FVOA 2FBPA 4OMBA 2VPOA 4F3BA 4PCDA 3CSBA 3RPWA 2LAOA 3ROJA 4N6KA 4PF8A 1VSOA 4PETA 2VOZA 4U4SA 2F6GA 2XA5A 4ZECA 1QGXA 3SEXA 3E3KA 4PFYA 4GWXA 3MW0A 1FTOA 2AL5A 1P1UA 1MRPA 1POY1 1MXUA 1LBVA 4Z0IA 3RTFB 1GR2A 4MMPA 4C1UA 5I2NA 2OX3A 4P1EA 1MXVA 4GWZA 4FE8A 2FIEA 2M8CA 3K6WA 4PQJA 4OYVA 2WYPA 2WX9A 4LQ5A 3C31A 2O51A 1II5A 1QUJA 2XXUA 1MDQA 2CZHA 4ZS9A 4E0WA 4JVDA 2HXWA 1LAGE 2F7AA 1DOTA 4AS5A 2P3NA 3KG2A 3SKPA 3CG1A 3HSTA 2V84A 2PFZA 4LZ5A 4BDMA 1DCUA 4PBHA 1SW5A 2HHMA 1NV3A 5JTYB 3FXBA 1YTVA 3BKIB 2XXYA 3E78A 3N6TA 1XC1A 1SYHA 4JB7A 3UA8A 4GF8A 4DIGA 5H8FA 3MC2A 1LBZA 1OQGA 2ONSA 1P1OA 3RQTA 3OENA 3PUYE 4OWDA 3PPQA 4H46A 2F8DA 1TFDA 2DXYA 5DT6A 2RCAA 3C33A 4H5GA 4ONYA 2XWIA 4ESXA 5EQ9A 1UIVA 3HHGA 3S9LC 4EF2A 3MYUA 4GX3A 4IO4A 2NOOA 4XKQA 2Y7WA 5TPAB 4PFTA 3U65A 3ZKKA 4N6PA 1JP4A 3RPLA 4GL0A 4HW8A 3G3FA 4O8MA 4GD5A 2OBGA 3MUQA 1LFGA 1XVXA 3OOAA 1D3KA 4NF8B 3BBRA 3MVXA 4GIZA 1ZBMA 1OIBA 4Q0CA 3H3GA 2NWJA 4R6KA 3UGWA 2GHBA 1F9BA 3VVDA 4GWWA 5FHMA 3M8UA 4O3BA 3P7IA 4OFOA 2AYSA 1DPEA 1M5EA 1QVSA 3IAZA 1NL5A 2NVUB 5TP9A 1FTLA 5L9SA 2F6PA 1VFEA 1MXXA 1AH5A 3DP4A 2XX8A 3KJ7A 4I3EA 3G3KA 3OSQA 2FYIA 1MXWA 5A5LA 4M1VA 1NKXA 2DWJA 1IQ7A 2F7BA 2I48A 2CZIA 3FVGA 4P47A 1M5BA 4LZ7A 1ZMGA 2ZNUA 4U23A 4JSOA 5EQAA 1QKAA 1B0LA 5JK4A 2O7UA 3OEMA 3IK6B 2PT1A 1BKAA 2DWAA 4NN3A 4GX6A 4OVQA 1FTJA 5FTHA 1QW0A 3O6IA 1HSEA 2ONRA 4BDOA 2DE3A 5BUUA 1B2HA 2XXRA 4X04A 3IB2A 2XD3A 1BP5A 2IEEA 2ZMBA 3BFTA 4H1XA 1B5IA 3F11A 2XWOA 4QFLA 2FIXA 4YU0A 1H76A 3QMFA 3LC8A 1NV1A 1NNFA 5LTCA 4QSDA 1M5FA 3IB1A 3OO7A 4NF4A 3OO9A 1B1XA 4POXA 1QUIA 1YCJA 1P99A 5FHNA 2V25A 2F5XA 1D9QA 4ZZAA 4OENA 3TTLA 4RYAA 2RC7A 3QAXA 1SBPA 2G29A 3KBRA 2HZKA 4GX4A 3MP8A 3FD3A 5LOMA 5FTIA 2O7IA 1Y20A 4G61A 4PAKA 2ABHA 3KGCA 5IKBA 4N81A 4H8JA 5H8QB 1RDYA 1MQGA 4KFQA 2HFBA 1YXIA 3KOSA 3VDFA 1Q35A 2VP1A 4IGRA 1NV7A 1LB9A 4MCOA 3MPLA 1JVXA 2B4MA 4QBAA 4YKPA 4TQUQ 4I40A 1NH7A 1MG1A 3ECRA 3W9WA 3CFZA 4NHBA 3EHUA 4UABA 2XD2A 3QUFA 5CMCA 3ILTB 2Y84A 3IR1A 4KR5A 1OLAA 5K2YA 4G77A 2L5VA 3C35A 3K6VA 1O7TA 4U4XA 3CVGA 5CM6A 1BTJA 1SI0A 3A09A 3KBZA 3MQ9A 2OK2A 2A5TB 3L6HA 3TMGA 1M5DA 1YYZA 3O66A 4QFKA 4EF1A 4PTKA 4G68B 1B3FA 4ZEDA 1DTZA 3N6UA 4KYDA 2PT2A 4KCDA 1NH8A 1Q1KA 3R7XA 3MBPA 5A5XB 5CMKA 5F24A 4F31B 2ESNA 2B4LA 1LLSA 4OVTA 2FVZA 4XF5A 2ZNSA 1B51A 3T22A 2X7PA 4DCXA 3TTKA 3TCFA 4MAGA 3PUXE 1AOVA 5CI5A 4FBPA 1B32A 4LONB 3MP1A 1MY4A 1NFTA 3PTYA 4X9TA 1D4NA 3E79A 4NF6A 4N6DA 1LB8A 3TUSA 4DE8A 4OERA 3D4CA 1IXIA 2RC8A 2QRYA 3TCHA 5H8QA 1LCFA 2H98A 3HFUA 4UACA 1JW5A 3KFMA 5AA2D 1BK4A 2VHAA 3OXNA 1B4HA 4XIGQ 4G8HA 1FBFA 2Q9TA 1CNQA 3A3UA 2A5SA 3SEVA 1VE4A 4P56A 2B3FA 5EQ8A 1SYIA 3ZS6A 1SQYA 3TTMA 2O84X 4KYSA 1S50A 4U21A 4DI4B 4MEVA 4OFJA 3V5AA 4QSCA 4TLMB 3H03A 3K1MA 1JETA 3IOVA 4XFEA 3KSXA 5KCJB 3T9HB 4U22A 1A40A 3TZAA 2QS4A 2QVRA 4G4PA 3E4RA 4R6HA 1A99A 4GFRA 4H0WA 5CMMA 4PFUA 1FPBA 2GFEA 3R26A 3CR9A 1ZIUA 3LUZA 1AIVA 1NV6A 2KQZA 3HPIA 4IB2A 3K00A 4KXPA 1A55A 1FQBA 1LAFE 4RA1A 2QSXA 4X1DA 3FXRA 3C34A 3MVYA 4NAPA 5H8FB 2RC9A 1MY1A 4LVQA 4P1LA 3E9XA 4WXJA 4DDDA 4MX6A 3SEUA 3MAMA 4YB7A 1YPNA 1ZLQA 4FEDA 2UVHA 1SI1A 2FHYA 4R75A 3VE1B 4PDHA 3EPEA 1XHYA 4Q8RA 2H4IA 5ICTA 4OVPA 2I0CA 4QF9A 3G3GA 1MY0A 2HAVA 3GBBA 4O94A 4MJOA 4WKMA 3N26A 1H43A 1T0KA 5I3SA 4TLLB 2PVUA 3G3HA 1FPDA 2XXQA 2FA7A 1SPIA 4MH5A 4LA9A 4JWYA 5K2XA 3TDJA 3D4GA 1FBHA 1B5HA 1K9ZA 3NOHA 1IXCA 2XWVA 2Z8FA 3EF7A 4LATA 1FW0A 1INPA 5I56A 3O29A 2ZZXA 1LAXA 5L8DA 3LSLA 2H99A 3KN7A 1CE2A 1Q9DA 2Q2AA 3GZGA 2O69A 4JBZA 4Q30B 3FVKA 5EHSA 1NV5A 1IMFA 2G93A 1Y3PA 1NNPA 1QUKA 4GQOA 4XKRA 2E1SA 1J1NA 2QMWA 1GV8A 1VDWA 1PDAA 5KZTA 4EDPA 3CRBA 1DK4A 4EQBA 4C0RA 3T9UA 1UTBA 4X1BA 1MM6A 2Y7PA 4POWA 3SEYA 5I2KA 4GWSA 3FATA 4GWOA 3DM0A 4OETA 4OVSA 1BIYA 1QULA 2DYXA 3O97A 1XI6A 1B7ZA 5FBPA 2THIA 1P1QA 3PU5A 3FJMA 2GRVA 1OQHA 4LP2B 3IFAA 3USDA 2XXHA 5L9MA 3SERA 1MS7A 4ELOA 1FJ9A 1PC3A 2Y7IA 5ET5A 5I57A 4XEQA 1IXGA 3PPRA 5IZZA 3PPPA 4HE2A 4I9DA 3OO6A 1B3GA 3H6WA 4OESA 1IMDA 5CBSA 3QSLA 1N04A 2DVZA 2CZLA 5DYHA 1FTAA 1I69A 5ITOA 5ICQA 4F39A 1A54A 4MBPA 1P1NA 3A3CA 4JDFA 2KR0A 4ND9A 1NUYA 3KC1A 2DOJA 1MQDA 2UVJA 2Y7RA 3CG3A 3B6QA 2DQVA 1G0HA 1NUWA 1LFIA 3FZVA 3VFJA 4IY5A 4QFNA 4NF8A 5I2NB 2QL3A 4NMYA 2HAUA 1ZJLA 3GXAA 3MWBA 1URSA 1MPDA 2V93A 3IOWA 3U94A 1N0TA 4F18A 1XOCA 1NMUA 2XX7A 4YB5A 1WDNA 3FIRA 3DLNA 5ISUA 1JEUA 1Z7NE 5H8HA 4YICA 4ELRA 2HQ0A 4PFRA 4IR8A 2DWHA 4IO5A 1UTHB 4N8YA 5EYHA 3EHSA 3CIJA 4GRKA 5I2KB 3T93B 3N5LA 4Z7EA 1US4A 3MVZA 4E0XA 1DBZA 4EQ9A 4O7MA 4AQ4A 4ZEIA 4R2BA 5H8NB 1N7WA 3BIHA 3QUJA 2QFLA 1TXFA 3C9HA 3FV2A 5DW8A 2E0SA 4ZEFA 4JVCA 2A5TA 3WAFA 2OLBA 3V8XB 1OLCA 3MP6A 4P0IA 4PDDA 4GWYA 4NF0A 1EYJA 2PCRA 1B52A 3TEPA 1FPJA 4F2QA 3IJXB 3QK6A 3T9VA 4MLVA 5TPAA 4R2FA 3C32A 3H4ZA 3THIA 4NF4B 2ONKE 3VLWA 2DE2A 2DVCA 1KA1A 1ATGA 4HE1A 4GLIA 5HM4B 3R6UA 2NUVA 1FRPA 1S9TA 4KYEA 3RY3A 2F3BA 2JJKA 3ILUB 1VR5A 4LN5A 3M3LA 1B4ZA 3UIFA 2Q74A 4N13A 4NF6B 1H45A 5IZ1A 2P3VA 3L6GA 5I59A 4GXAA 4GL8A 4HS7A 3IFCA 4PE5B 5AA2B 4WEDA 4DZ1A 2HPGA 2I0BA 5L9OA 2I6EA 3EHTA 3MJNA 1B1HA 1VFDA 2WBBA 5TP9B 2P1SA 1Y4CA 1LAHE 3UK4A 1MH4A 1B40A 3VVEA 3FASA 3K2DA 3RUMA 5ESYA 2UXAA 4DXBA 3QYTA 3Q27A 1FPFA 2PBWA 4NWDA 2GH9A 2PMSA 4DXCA 1JVYA 3OO8A 3K01A 1FQAA 4ZE9A 4PF6A 4AS4A 2I4CA 3IORA 4RNSA 1USYE 1Y1MA 4JWXA 3FVNA 3PMVA 4R73A 5AA1A 1RKMA 4HXVA 3DP8A 2OCUA 5I7IA 3TYHA 4RPOA 4PBQA 2HZLA 2ZZWA 2ZZVA 2YJPA 4G8NA 5HBCA 3SEWA 3MPKA 2DXRA 3O6GA 4QHQA 4F3GA 5B7DA 3OMBA 1CB6A 4KI0E 5DTBA 1LCTA 5FHOA 5EYFA 3HO7A 1DPPA 3PPOA 5CBRA 4BDQA 3G3JA 3S4UA 4NX1A 4FIMA 3SDFA 3RYDA 3MZ1A 1D9YA 2DSFA 1ZTYA 2DWIA 3H6UA 3U93A 1K9YA 4P11A 4BDNA 1B5JA 3RGYA 1NNTA 4N8GA 1TWYA 5TU0A 4OXVA 2VD3A 1FBEA 4MNIA 2OZZA 3JZJA 4I1DA 1MQHA 1AWBA 1LBWA 1ANFA 3KJTA 4OVJA 3UP9A 4RY1A 3H7MA 1ZU0A 3O6HA 3KZGA 4RK9A 1I6QA 1IMBA 3U92A 2XXWA 1FTKA 3WAEA 3BFUA 4ECFA 2HXRA 4QFOA 3ZKLA 2O1MA 4LUBA 3TQWA 3D1RA 1QKBA 1FBPA 4R72A 2X26A 5HPQA 3O9PA 3PV0E 1FSAA 1BLFA 1TFAA 4IO3A 4U1OA 1FJ6A 4TOZA 3HCQA 5F7VA 4EQ7A 4QRZA 1LBXA 4QFPA 4XXUA 1O64A 4EXKA 3CI8A 4NTLA 4NEDA 1NV2A 1H3DA 2ZNTA 3DELB 4YMBA 1DMBA 1UIUA 2XXPA 1UTBB 4JVIA 1IIWA 2FNCA 3PD8A 4GVOA 4EXLA 5IAIA 4BDRA 2WYKA 3B50A 4YKIA 4GXSB 3U1OA 2XXXA 4QXDA 2V3QA 4YB6A 1SW4A 4F1VA 4JSDA 1UQWA 3PMXA 1LBYA 3OSRA 4NG7A 5AA4A 3LBSA 5EYGA 1PBQA 2F78A 4G68C 4PAIA 3LR1A 4OQOA 5A5XA 3VLVA 2RCBA 3M3KA 4XKNA 2F3DA 3K6XA 2Q8JA 4DCYA 1URGA 2B65A 4BDLA 2ZYMA 3I3VA 4Q5TA 4DLDA 1FPIA 3KSJA 2ZYNA 4N17A 2F35A 3G7WA 4U2RA 3JV9A 4KHZE 1FQDA 2WEFA 3OEKA 4F3SA 5KDTA 2O1LA 1PB9A 1N7XA 1OVBA 1N3XA 1B05A 1S7YA 1YAEA 3H6TA 4HCWA 2QVUA 4R6YA 4XKPA 3FXQA 3TFLA 1IITA 5J1DA 1DTGA 2W7YA 1EZ9A 3RT8A 2WKYA 2PFYA 3H06B 5DVIA 5I56B 4NQ8A 3S9EA 3LV0A 4KQPA 2Z8EA 2BJJX 4MIJA
chains in the Genus database with same CATH topology
4HTGA 4PFWA 1NNFA 4N07A 1EZOA 2UVJA 2Y7RA 4YKKA 3CG3A 3B6QA 2DQVA 3KN3A 3M3FA 2YLNA 4F29A 2F97A 4QSDA 1M5FA 5KCJA 3IB1A 1LFIA 3OO7A 4NF4A 3OO9A 1QJMA 1B1XA 1POTA 3W15C 4RJZA 3FZVA 3JYRA 4POXA 3VFJA 1QUIA 4IY5A 4QFNA 4NF8A 5I2NB 1YCJA 2QL3A 4H65A 2QMXA 5H8HB 4NMYA 4YKJA 4EUOA 2HAUA 1ZJLA 3RTWB 3GXAA 3QXMA 3K02A 4F19A 3MWBA 2H9BA 1P99A 1URSA 1MPDA 1SD3A 3FGSA 4THIA 2I58A 5FHNA 2V25A 3GLBA 2F5XA 2V93A 3IOWA 2XXVA 4ZZAA 4I62A 4ESWA 3I6VA 4OENA 2I3VA 3TPAA 3TAJA 3TTLA 3SESA 3U94A 3S9NC 1N0TA 2XHDA 4JXIA 2Y7KA 4F18A 4RYAA 1XOCA 1EH3A 3E13X 1US5A 2RC7A 3QAXA 2GHAA 1NMUA 2XX7A 1GVCA 4YB5A 1SBPA 3B6WA 1B58A 2G29A 2OJTA 3KBRA 1WDNA 2HZKA 3B6TA 3DLNA 3FIRA 5ISUA 3H6VA 1JEUA 1Z7NE 3T96B 5H8HA 1JW1A 3RNNA 3MP8A 3FD3A 4R74A 5LOMA 2RINA 2O7IA 1Y20A 2I4BA 5FTIA 1FQCA 4YICA 3V89B 4FJPA 2ABHA 4ELRA 3KGCA 5IKBA 2HQ0A 4H8JA 5H8QB 1SW2A 1MQGA 4KFQA 4OFLA 2ZYKA 2HFBA 2ALUA 3KOSA 4DXUA 1RYOA 2DWHA 4IO5A 3VDFA 1Q35A 4IY6A 2XXTA 4C1TA 2QPQA 3HN0A 1UTHB 4QSEA 2ANJA 2VP1A 1P1WA 4HCYA 1LSTA 2RKMA 3EHSA 4K3FA 5DEXA 4IGRA 2NXOA 2F7CA 3CIJA 1LB9A 2XX9A 3PMWA 3N5LA 4GRKA 1US4A 5I2KB 3MVZA 4ZEBA 3T93B 4E0XA 4Z7EA 4EQ9A 4WEPA 1N76A 3MPLA 4ZZEA 1MPCA 1IEJA 1JVXA 4AQ4A 1EU8A 4ZEIA 3FJGA 4NE4A 4YMAA 4R2BA 5I57B 4YKPA 3KOTA 4TQUQ 1N3WA 1WVJA 5H8NB 1NH7A 1N7WA 1R9LA 4NF5B 2HEUA 2Q2CA 1MG1A 1JNFA 3ECRA 1B7UA 2RF1A 3QUJA 2Z8DA 3S2VA 3CFZA 3W9WA 3IJOB 4RK2A 1TXFA 3C9HA 2ZYOA 1MDP1 1TT1A 3EHUA 3FV2A 2XD2A 3QUFA 5CMCA 2E0SA 3UORA 1URDA 1JW4A 2OWTA 3ILTB 2Y84A 3IR1A 4P0GA 4ZEFA 4KR5A 2A5TA 3WAFA 3VXCA 1OLAA 2O6AA 2OLBA 2R71A 4ZE8A 1MY3A 1OLCA 3I5OA 3MP6A 3Q26A 5K2YA 3V8XB 1R9QA 4P0IA 1Y3NA 4G77A 1H44A 3IO4A 3C35A 5JEIA 3K4UA 4OEVA 2Z23A 1B52A 3K6VA 4JWOA 5AA3A 2QJEA 3TEPA 3CSGA 4F2QA 1O7TA 4U4XA 3CVGA 2F34A 3IJXB 2PX1A 3QK6A 5CM6A 1BTJA 1SI0A 3T66A 2R6GE 1OVTA 3T9VA 4F22A 4MLVA 5TPAA 3OELA 4R2FA 4IGTA 4AB5A 1RYXA 1LFHA 3C32A 1L5TA 2DE4A 5I58B 3A09A 4FATA 3H4ZA 4IO7A 3VVFA 4I8CA 3MQ9A 3THIA 1M5CA 2OK2A 4BLAA 4R9FA 3U8QA 4NF4B 2ONKE 3VLWA 2DE2A 5EHMA 2A5TB 2DVCA 2IA4A 4ZEKA 3PGFA 1KWHA 3L6HA 1ATGA 1B9JA 3TMGA 1LBCA 4GLIA 4OEUA 1M5DA 3O66A 4QFKA 4EF1A 5HM4B 3R6UA 2NUVA 1MM7A 3LSWA 1S9TA 4KYEA 4AB6A 3RY3A 3C4MA 4G68B 3TODA 1B3FA 3ILUB 1USYH 1I6AA 4ZEDA 5BWJA 1DTZA 3N6UA 3PUWE 4LQ2A 4KYDA 2AIXA 4FORA 2PT2A 4KCDA 4YZZA 1VR5A 1NH8A 2V3UA 1Q1KA 3TCGA 1B6HA 3VXBA 1PBPA 3M3LA 4MF3A 3R7XA 3ONMA 3MBPA 1B4ZA 5I58A 3UIFA 3S9MC 4N13A 1Y3QA 3K6UA 1MXYA 4NF6B 5A5XB 1HSJA 1H45A 5CMKA 4F31B 2XXIA 2ESNA 1LLSA 1MQIA 3VV5A 3L6GA 5I59A 4GXAA 4OHNA 4GL8A 4HS7A 2ZNSA 5I84A 2H25A 1B51A 1HSLA 3DP6A 4PE5B 2X7PA 2Q89A 4WEDA 3T22A 2I0BA 2VGQA 3TTKA 4DCXA 4H67A 2I6EA 3EHTA 1JQFA 1WODA 3MJNA 3TCFA 3KN8A 1B1HA 1VFDA 3PUXE 3IOUA 1AOVA 1NNKA 3MZBA 5CI5A 3RT6B 3SETA 3C36A 5TP9B 2P1SA 1B32A 2UVGA 4R9GA 1Y4CA 1LAHE 1SVXB 2V3TA 2QS2A 3HV1A 3ODBA 3U72A 1MH4A 3Q25A 4LONB 3UK4A 3MP1A 1MY4A 3TELA 1NFTA 1MH3A 1B40A 3VVEA 1UTHA 4X9TA 3FASA 3K2DA 3UN6A 1D4NA 1XS5A 2B3BA 3RUMA 4NF6A 3ZSFA 1EZPA 1LB8A 3TUSA 3RLFE 1R6ZA 2UXAA 4DE8A 4OERA 4DXBA 3QYTA 1B7HA 1O63A 1IXIA 2RC8A 2QRYA 3D4CA 3IB0A 4L17A 1XT8A 4OZ9A 3TCHA 5H8QA 2HCAA 1LCFA 2H98A 3Q27A 4G2ZA 1Y1ZA 5B70A 2PBWA 4UACA 4NWDA 2GH9A 1JW5A 3KFMA 2PMSA 3T9XB 4DXCA 4ELQA 2F36A 3HHFA 5AA2D 1GTKA 1JVYA 2UYFA 3FVOA 1H76A 3K01A 1FQAA 3OO8A 4OMBA 4ZE9A 2VHAA 3OXNA 3FV1A 1B4HA 2I4CA 5H8NA 4F3BA 1AL3A 3IORA 3CSBA 4XIGQ 3RPWA 4RNSA 5DVFA 1USYE 1Y1MA 2LAOA 4G8HA 4JWXA 3QIMA 3FVNA 3PMVA 3O2AA 4R73A 5AA1A 2Z22A 3EN3A 1B3EA 5ICQA 1VSOA 1RKMA 2Q9TA 4O3AA 1SW1A 3A3UA 4PETA 2VOZA 4XTCQ 4U4SA 2F6GA 2A5SA 3SEVA 1VE4A 3DP8A 4GOTA 2B3FA 5CRYA 4ZECA 3PPNA 1B3HA 2OCUA 1SYIA 3IOTA 3TYHA 1ZKBA 2CMOA 1SQYA 3ZS6A 3SEXA 3TTMA 2O84X 3E3KA 3KEIA 4RPOA 1XVYA 1S50A 2HZLA 4KYSA 4U21A 4PFYA 2YJPA 3MW0A 4RPNA 5H8SA 4OFJA 3V5AA 4QSCA 4TLMB 1FTOA 3H03A 2AL5A 4G8NA 4FEBA 3K1MA 1P1UA 1JETA 1MRPA 3IOVA 1POY1 3KSXA 5KCJB 5HBCA 1MXUA 3T9HB 3SEWA 3MPKA 4U22A 4Z0IA 3RTFB 2DXRA 1GR2A 2D3IA 3IO6A 5ITPA 1A40A 3O6GA 4QHQA 4C1UA 3TZAA 4OTEA 3OMBA 4F3GA 5B7DA 1CB6A 5I2NA 2QS4A 4KI0E 2UYEA 3FXUA 4H6DA 1MXVA 5DTBA 4G4PA 2P2AA 3E4RA 1LCTA 5FHOA 4R6HA 5EYFA 3HO7A 1A99A 1DPPA 3PPOA 4GFRA 4H0WA 1A8FA 4FE8A 3IL1B 5CBRA 2AL4A 4M4GA 2M8CA 5CMMA 4BDQA 4PFUA 3G3JA 3K6WA 3TTNA 2GFEA 3S4UA 3R26A 1R1NA 3CR9A 1ZIUA 4FIMA 4OYVA 4PQJA 3SDFA 1AIVA 1MXZA 2VD2A 4LQ5A 3C31A 2O51A 1II5A 2QS3A 4IO2A 1MY2A 1QUJA 2XXUA 3MZ1A 1MDQA 3HPIA 1D9YA 4IB2A 2REGA 4FAJA 3K00A 2DSFA 1ZTYA 4MFIA 4ZS9A 1A55A 1FQBA 4E0WA 1LAFE 2DWIA 1LAGE 2HXWA 2QSXA 2F7AA 3H6UA 4RA1A 3FXRA 1DOTA 4X1DA 3U93A 4P11A 3C34A 3MVYA 4BDNA 3TQLA 1B5JA 1D9VA 3KG2A 3RGYA 5H8FB 3SKPA 2RC9A 3CG1A 1MY1A 3HSTA 4LVQA 4RXLA 4F3PA 3E9XA 4WXJA 1NNTA 4DDDA 3SEUA 3MAMA 4YB7A 2V84A 4O3CA 4LZ5A 4BDMA 1TWYA 5TU0A 1YPNA 5I59B 1SW5A 4OXVA 2VD3A 1ZLQA 2OZZA 4FEDA 2D21A 1Y4TA 3JZJA 2UVHA 4I1DA 3GBAA 1SI1A 5JTYB 1MQHA 4R75A 3VE1B 1ANFA 1YTVA 2X7QA 2P0SA 3KJTA 4OVJA 1I6BA 3EPEA 3UP9A 1XHYA 4RY1A 4Q8RA 2H4IA 3H7MA 3BKIB 1ZU0A 5ICTA 2XXYA 1N84A 3O6HA 3KZGA 2I0CA 4RK9A 4F2OA 4QF9A 3N6TA 2D5WA 3G3GA 1I6QA 1XC1A 5AE4A 1MY0A 1SYHA 4JB7A 1B0HA 4GF8A 3AXFA 2Q88A 3Q29A 3K0VA 3UA8A 2H5YA 3U92A 4DIGA 5H8FA 1OMPA 2HAVA 2XXWA 3GBBA 3B7DA 4WKMA 3MC2A 3N26A 5DVJA 1FTKA 3WAEA 3BFUA 2PYYA 4ECFA 1MPBA 1H43A 5ELVA 5AA2A 1OQGA 1LGBC 3CFLA 2ONSA 1T0KA 2I49A 1P1OA 3RQTA 5JTYA 3OENA 3PUYE 4OWDA 3PPQA 4TLLB 1LBBA 2PVUA 5F1QA 1JEVA 2F8DA 1TFDA 2DXYA 3G3HA 4QFOA 5DT6A 3ZKLA 2RCAA 3C33A 2O1MA 2XXQA 3FUZA 4H5GA 4LUBA 4ONYA 3TQWA 4ESXA 1QKBA 4NWCA 4R72A 2FA7A 4MH5A 3TDJA 4LA9A 4JWYA 5K2XA 2X26A 1UIVA 3HHGA 3LSFB 3S9LC 5HPQA 4EF2A 3D4GA 1FQFA 3O9PA 3PV0E 1B5HA 1GGGA 1BLFA 1TFAA 4IO3A 4U1OA 1FTMA 1IXCA 2NOOA 4IO4A 4TOZA 3FJ7A 3HCQA 5F7VA 3CFXA 4EQ7A 3PUZE 2QS1A 2Y7WA 2Z8FA 1A7LA 3EF7A 4QRZA 4XKQA 4LATA 1FW0A 5TPAB 4PFTA 1IZ1A 3ZKKA 3O29A 5I56A 4QFPA 4PP0A 1LAXA 1B3LA 3LSXA 4N6PA 4X48A 5L8DA 4F1UA 3LSLA 2H99A 4GL0A 4XXUA 3KN7A 1O64A 3OD7A 4EXKA 4HW8A 1CE2A 3CI8A 3G3FA 4NTLA 3TTRA 4NEDA 1FQEA 3PUVE 4GD5A 2OBGA 2ZNTA 1H3DA 3DELB 4YMBA 2KLFA 5AA4B 3V83A 2Q2AA 4MLQA 3MUQA 3GZGA 3MZ9A 1LFGA 1DMBA 1UIUA 1XVXA 2XXPA 3OOAA 1D3KA 2O69A 4JBZA 3TKDA 1UTBB 4Q30B 3FVKA 4NF8B 4G68A 3BBRA 3MVXA 5EHSA 1IIWA 2FNCA 3PD8A 4GIZA 4GVOA 4EXLA 5IAIA 4BDRA 4YKIA 3U1OA 1ZBMA 2G93A 4GXSB 2XXXA 2UVIA 1OIBA 4Q0CA 2V3QA 3LUYA 1Y3PA 4YB6A 1PB8A 1NNPA 1SW4A 1QUKA 3H3GA 4KD5A 3IX1A 2NWJA 3PD9A 3RN8A 2OWSA 4R6KA 1SDXA 4GQOA 4JSDA 3UGWA 4F1VA 2GHBA 4IO6A 1UQWA 4XKRA 2E1SA 3PMXA 1F9BA 1J1NA 2QMWA 3EQ1A 1GV8A 3OSRA 1PDAA 5KZTA 5L9OA 3VVDA 4EDPA 3LBSA 3CRBA 3M8UA 5FHMA 5AA4A 4O3BA 1PBQA 5CC2A 3P7IA 4OFOA 4EQBA 2F78A 4C0RA 3T9UA 2AYSA 1DPEA 4G68C 1UTBA 4X1BA 3LR1A 1M5EA 1QVSA 3IAZA 1B46A 1MM6A 2ZXTA 3VLUA 1NL5A 4OQOA 5A5XA 2I3WA 2NVUB 2Y7PA 5DEXB 5TP9A 1FTLA 5KDTB 2F6PA 5L9SA 1VFEA 3VLVA 1MXXA 4POWA 5AA2B 3SEYA 1AH5A 2RCBA 5I2KA 3M3KA 4YAHX 4XKNA 1ELJA 4DZ1A 3K1PA 3FATA 3W9VA 4GWOA 3K6XA 3DP4A 2XX8A 3KJ7A 2Q8JA 4DCYA 3MVWA 1URGA 3DM0A 4OETA 2B65A 1BIYA 4G8MA 1QULA 2DYXA 3G3KA 3O97A 1B7ZA 3OSQA 4BDLA 2ZYMA 4LZ8A 3I3VA 2THIA 1P1QA 3PU5A 2FYIA 3FJMA 4Q5TA 4DLDA 1MXWA 4FECA 2GRVA 4NF5A 1OQHA 4ISUA 4LP2B 2DWJA 1NKXA 4M1VA 1IQ7A 2XXHA 2F7BA 2I48A 2ZYNA 3KSJA 3USDA 3FVGA 5L9MA 1M5BA 2F35A 3SERA 4LZ7A 4ZDMA 1MS7A 1ZMGA 3G7WA 1IXHA 4U2RA 4ELOA 2ZNUA 3JV9A 4KHZE 1PC3A 4U23A 4JSOA 2Y7IA 1QKAA 3Q28A 5I57A 1FQDA 4ELPA 1B0LA 5JK4A 2O7UA 3OEKA 3O28A 3OEMA 4F3SA 1PB7A 2PT1A 1IXGA 2O1LA 3IK6B 1PB9A 1N7XA 5M2VA 5KDTA 3PPRA 1BKAA 3PPPA 1OVBA 2DWAA 4I9DA 3OO6A 1N3XA 3LC8A 5CMBA 2O68A 2R9JA 4H5FA 1B05A 1S7YA 1FTJA 1B3GA 1YAEA 2YPNA 1QW0A 5FTHA 3H6WA 3H6TA 1FCKA 4HCWA 4H8IA 4OESA 3O6IA 1HSEA 5CBSA 3G3IA 2ONRA 1A8EA 2REJA 4R6YA 3QSLA 4XKPA 4BDOA 1DSNA 2DE3A 4KCCA 4F1YA 5BUUA 1B2HA 1N04A 1PEBA 1Y9UA 2CZLA 2DVZA 2XXRA 3FXQA 3N94A 3TFLA 5DYHA 4U1ZA 3IB2A 1IITA 1MQJA 5J1DA 3K1NA 1I69A 1AMFA 2XD3A 4UA8A 5ITOA 1BP5A 1DTGA 2IEEA 1Z7ME 4F39A 1A54A 2W7YA 4MBPA 1EZ9A 2ZMBA 3BFTA 4KPTA 3RT8A 2WKYA 1IUDA 1P1NA 3A3CA 4JDFA 4H1XA 1B5IA 3F11A 2DP8A 3H06B 4QFLA 5DVIA 4ND9A 5I56B 3S9EA 2DOJA 4KQPA 4YU0A 2Z8EA 2DS9A 2BJJX 1MQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HTG A;  4PFW A;  1NNF A;  4N07 A;  1EZO A;  2UVJ A;  2Y7R A;  4YKK A;  3CG3 A;  3B6Q A;  2DQV A;  3KN3 A;  3M3F A;  2YLN A;  4F29 A;  2F97 A;  4QSD A;  1M5F A;  5KCJ A;  3IB1 A;  1LFI A;  3OO7 A;  4NF4 A;  3OO9 A;  1QJM A;  1B1X A;  1POT A;  3W15 C;  4RJZ A;  3FZV A;  3JYR A;  4POX A;  3VFJ A;  1QUI A;  4IY5 A;  4QFN A;  4NF8 A;  5I2N B;  1YCJ A;  2QL3 A;  4H65 A;  2QMX A;  5H8H B;  4NMY A;  4YKJ A;  4EUO A;  2HAU A;  1ZJL A;  3RTW B;  3GXA A;  3QXM A;  3K02 A;  4F19 A;  3MWB A;  2H9B A;  1P99 A;  1URS A;  1MPD A;  1SD3 A;  3FGS A;  4THI A;  2I58 A;  5FHN A;  2V25 A;  3GLB A;  2F5X A;  2V93 A;  3IOW A;  2XXV A;  4ZZA A;  4I62 A;  4ESW A;  3I6V A;  4OEN A;  2I3V A;  3TPA A;  3TAJ A;  3TTL A;  3SES A;  3U94 A;  3S9N C;  1N0T A;  2XHD A;  4JXI A;  2Y7K A;  4F18 A;  4RYA A;  1XOC A;  1EH3 A;  3E13 X;  1US5 A;  2RC7 A;  3QAX A;  2GHA A;  1NMU A;  2XX7 A;  1GVC A;  4YB5 A;  1SBP A;  3B6W A;  1B58 A;  2G29 A;  2OJT A;  3KBR A;  1WDN A;  2HZK A;  3B6T A;  3DLN A;  3FIR A;  5ISU A;  3H6V A;  1JEU A;  1Z7N E;  3T96 B;  5H8H A;  1JW1 A;  3RNN A;  3MP8 A;  3FD3 A;  4R74 A;  5LOM A;  2RIN A;  2O7I A;  1Y20 A;  2I4B A;  5FTI A;  1FQC A;  4YIC A;  3V89 B;  4FJP A;  2ABH A;  4ELR A;  3KGC A;  5IKB A;  2HQ0 A;  4H8J A;  5H8Q B;  1SW2 A;  1MQG A;  4KFQ A;  4OFL A;  2ZYK A;  2HFB A;  2ALU A;  3KOS A;  4DXU A;  1RYO A;  2DWH A;  4IO5 A;  3VDF A;  1Q35 A;  4IY6 A;  2XXT A;  4C1T A;  2QPQ A;  3HN0 A;  1UTH B;  4QSE A;  2ANJ A;  2VP1 A;  1P1W A;  4HCY A;  1LST A;  2RKM A;  3EHS A;  4K3F A;  5DEX A;  4IGR A;  2NXO A;  2F7C A;  3CIJ A;  1LB9 A;  2XX9 A;  3PMW A;  3N5L A;  4GRK A;  1US4 A;  5I2K B;  3MVZ A;  4ZEB A;  3T93 B;  4E0X A;  4Z7E A;  4EQ9 A;  4WEP A;  1N76 A;  3MPL A;  4ZZE A;  1MPC A;  1IEJ A;  1JVX A;  4AQ4 A;  1EU8 A;  4ZEI A;  3FJG A;  4NE4 A;  4YMA A;  4R2B A;  5I57 B;  4YKP A;  3KOT A;  4TQU Q;  1N3W A;  1WVJ A;  5H8N B;  1NH7 A;  1N7W A;  1R9L A;  4NF5 B;  2HEU A;  2Q2C A;  1MG1 A;  1JNF A;  3ECR A;  1B7U A;  2RF1 A;  3QUJ A;  2Z8D A;  3S2V A;  3CFZ A;  3W9W A;  3IJO B;  4RK2 A;  1TXF A;  3C9H A;  2ZYO A;  1MDP 1;  1TT1 A;  3EHU A;  3FV2 A;  2XD2 A;  3QUF A;  5CMC A;  2E0S A;  3UOR A;  1URD A;  1JW4 A;  2OWT A;  3ILT B;  2Y84 A;  3IR1 A;  4P0G A;  4ZEF A;  4KR5 A;  2A5T A;  3WAF A;  3VXC A;  1OLA A;  2O6A A;  2OLB A;  2R71 A;  4ZE8 A;  1MY3 A;  1OLC A;  3I5O A;  3MP6 A;  3Q26 A;  5K2Y A;  3V8X B;  1R9Q A;  4P0I A;  1Y3N A;  4G77 A;  1H44 A;  3IO4 A;  3C35 A;  5JEI A;  3K4U A;  4OEV A;  2Z23 A;  1B52 A;  3K6V A;  4JWO A;  5AA3 A;  2QJE A;  3TEP A;  3CSG A;  4F2Q A;  1O7T A;  4U4X A;  3CVG A;  2F34 A;  3IJX B;  2PX1 A;  3QK6 A;  5CM6 A;  1BTJ A;  1SI0 A;  3T66 A;  2R6G E;  1OVT A;  3T9V A;  4F22 A;  4MLV A;  5TPA A;  3OEL A;  4R2F A;  4IGT A;  4AB5 A;  1RYX A;  1LFH A;  3C32 A;  1L5T A;  2DE4 A;  5I58 B;  3A09 A;  4FAT A;  3H4Z A;  4IO7 A;  3VVF A;  4I8C A;  3MQ9 A;  3THI A;  1M5C A;  2OK2 A;  4BLA A;  4R9F A;  3U8Q A;  4NF4 B;  2ONK E;  3VLW A;  2DE2 A;  5EHM A;  2A5T B;  2DVC A;  2IA4 A;  4ZEK A;  3PGF A;  1KWH A;  3L6H A;  1ATG A;  1B9J A;  3TMG A;  1LBC A;  4GLI A;  4OEU A;  1M5D A;  3O66 A;  4QFK A;  4EF1 A;  5HM4 B;  3R6U A;  2NUV A;  1MM7 A;  3LSW A;  1S9T A;  4KYE A;  4AB6 A;  3RY3 A;  3C4M A;  4G68 B;  3TOD A;  1B3F A;  3ILU B;  1USY H;  1I6A A;  4ZED A;  5BWJ A;  1DTZ A;  3N6U A;  3PUW E;  4LQ2 A;  4KYD A;  2AIX A;  4FOR A;  2PT2 A;  4KCD A;  4YZZ A;  1VR5 A;  1NH8 A;  2V3U A;  1Q1K A;  3TCG A;  1B6H A;  3VXB A;  1PBP A;  3M3L A;  4MF3 A;  3R7X A;  3ONM A;  3MBP A;  1B4Z A;  5I58 A;  3UIF A;  3S9M C;  4N13 A;  1Y3Q A;  3K6U A;  1MXY A;  4NF6 B;  5A5X B;  1HSJ A;  1H45 A;  5CMK A;  4F31 B;  2XXI A;  2ESN A;  1LLS A;  1MQI A;  3VV5 A;  3L6G A;  5I59 A;  4GXA A;  4OHN A;  4GL8 A;  4HS7 A;  2ZNS A;  5I84 A;  2H25 A;  1B51 A;  1HSL A;  3DP6 A;  4PE5 B;  2X7P A;  2Q89 A;  4WED A;  3T22 A;  2I0B A;  2VGQ A;  3TTK A;  4DCX A;  4H67 A;  2I6E A;  3EHT A;  1JQF A;  1WOD A;  3MJN A;  3TCF A;  3KN8 A;  1B1H A;  1VFD A;  3PUX E;  3IOU A;  1AOV A;  1NNK A;  3MZB A;  5CI5 A;  3RT6 B;  3SET A;  3C36 A;  5TP9 B;  2P1S A;  1B32 A;  2UVG A;  4R9G A;  1Y4C A;  1LAH E;  1SVX B;  2V3T A;  2QS2 A;  3HV1 A;  3ODB A;  3U72 A;  1MH4 A;  3Q25 A;  4LON B;  3UK4 A;  3MP1 A;  1MY4 A;  3TEL A;  1NFT A;  1MH3 A;  1B40 A;  3VVE A;  1UTH A;  4X9T A;  3FAS A;  3K2D A;  3UN6 A;  1D4N A;  1XS5 A;  2B3B A;  3RUM A;  4NF6 A;  3ZSF A;  1EZP A;  1LB8 A;  3TUS A;  3RLF E;  1R6Z A;  2UXA A;  4DE8 A;  4OER A;  4DXB A;  3QYT A;  1B7H A;  1O63 A;  1IXI A;  2RC8 A;  2QRY A;  3D4C A;  3IB0 A;  4L17 A;  1XT8 A;  4OZ9 A;  3TCH A;  5H8Q A;  2HCA A;  1LCF A;  2H98 A;  3Q27 A;  4G2Z A;  1Y1Z A;  5B70 A;  2PBW A;  4UAC A;  4NWD A;  2GH9 A;  1JW5 A;  3KFM A;  2PMS A;  3T9X B;  4DXC A;  4ELQ A;  2F36 A;  3HHF A;  5AA2 D;  1GTK A;  1JVY A;  2UYF A;  3FVO A;  1H76 A;  3K01 A;  1FQA A;  3OO8 A;  4OMB A;  4ZE9 A;  2VHA A;  3OXN A;  3FV1 A;  1B4H A;  2I4C A;  5H8N A;  4F3B A;  1AL3 A;  3IOR A;  3CSB A;  4XIG Q;  3RPW A;  4RNS A;  5DVF A;  1USY E;  1Y1M A;  2LAO A;  4G8H A;  4JWX A;  3QIM A;  3FVN A;  3PMV A;  3O2A A;  4R73 A;  5AA1 A;  2Z22 A;  3EN3 A;  1B3E A;  5ICQ A;  1VSO A;  1RKM A;  2Q9T A;  4O3A A;  1SW1 A;  3A3U A;  4PET A;  2VOZ A;  4XTC Q;  4U4S A;  2F6G A;  2A5S A;  3SEV A;  1VE4 A;  3DP8 A;  4GOT A;  2B3F A;  5CRY A;  4ZEC A;  3PPN A;  1B3H A;  2OCU A;  1SYI A;  3IOT A;  3TYH A;  1ZKB A;  2CMO A;  1SQY A;  3ZS6 A;  3SEX A;  3TTM A;  2O84 X;  3E3K A;  3KEI A;  4RPO A;  1XVY A;  1S50 A;  2HZL A;  4KYS A;  4U21 A;  4PFY A;  2YJP A;  3MW0 A;  4RPN A;  5H8S A;  4OFJ A;  3V5A A;  4QSC A;  4TLM B;  1FTO A;  3H03 A;  2AL5 A;  4G8N A;  4FEB A;  3K1M A;  1P1U A;  1JET A;  1MRP A;  3IOV A;  1POY 1;  3KSX A;  5KCJ B;  5HBC A;  1MXU A;  3T9H B;  3SEW A;  3MPK A;  4U22 A;  4Z0I A;  3RTF B;  2DXR A;  1GR2 A;  2D3I A;  3IO6 A;  5ITP A;  1A40 A;  3O6G A;  4QHQ A;  4C1U A;  3TZA A;  4OTE A;  3OMB A;  4F3G A;  5B7D A;  1CB6 A;  5I2N A;  2QS4 A;  4KI0 E;  2UYE A;  3FXU A;  4H6D A;  1MXV A;  5DTB A;  4G4P A;  2P2A A;  3E4R A;  1LCT A;  5FHO A;  4R6H A;  5EYF A;  3HO7 A;  1A99 A;  1DPP A;  3PPO A;  4GFR A;  4H0W A;  1A8F A;  4FE8 A;  3IL1 B;  5CBR A;  2AL4 A;  4M4G A;  2M8C A;  5CMM A;  4BDQ A;  4PFU A;  3G3J A;  3K6W A;  3TTN A;  2GFE A;  3S4U A;  3R26 A;  1R1N A;  3CR9 A;  1ZIU A;  4FIM A;  4OYV A;  4PQJ A;  3SDF A;  1AIV A;  1MXZ A;  2VD2 A;  4LQ5 A;  3C31 A;  2O51 A;  1II5 A;  2QS3 A;  4IO2 A;  1MY2 A;  1QUJ A;  2XXU A;  3MZ1 A;  1MDQ A;  3HPI A;  1D9Y A;  4IB2 A;  2REG A;  4FAJ A;  3K00 A;  2DSF A;  1ZTY A;  4MFI A;  4ZS9 A;  1A55 A;  1FQB A;  4E0W A;  1LAF E;  2DWI A;  1LAG E;  2HXW A;  2QSX A;  2F7A A;  3H6U A;  4RA1 A;  3FXR A;  1DOT A;  4X1D A;  3U93 A;  4P11 A;  3C34 A;  3MVY A;  4BDN A;  3TQL A;  1B5J A;  1D9V A;  3KG2 A;  3RGY A;  5H8F B;  3SKP A;  2RC9 A;  3CG1 A;  1MY1 A;  3HST A;  4LVQ A;  4RXL A;  4F3P A;  3E9X A;  4WXJ A;  1NNT A;  4DDD A;  3SEU A;  3MAM A;  4YB7 A;  2V84 A;  4O3C A;  4LZ5 A;  4BDM A;  1TWY A;  5TU0 A;  1YPN A;  5I59 B;  1SW5 A;  4OXV A;  2VD3 A;  1ZLQ A;  2OZZ A;  4FED A;  2D21 A;  1Y4T A;  3JZJ A;  2UVH A;  4I1D A;  3GBA A;  1SI1 A;  5JTY B;  1MQH A;  4R75 A;  3VE1 B;  1ANF A;  1YTV A;  2X7Q A;  2P0S A;  3KJT A;  4OVJ A;  1I6B A;  3EPE A;  3UP9 A;  1XHY A;  4RY1 A;  4Q8R A;  2H4I A;  3H7M A;  3BKI B;  1ZU0 A;  5ICT A;  2XXY A;  1N84 A;  3O6H A;  3KZG A;  2I0C A;  4RK9 A;  4F2O A;  4QF9 A;  3N6T A;  2D5W A;  3G3G A;  1I6Q A;  1XC1 A;  5AE4 A;  1MY0 A;  1SYH A;  4JB7 A;  1B0H A;  4GF8 A;  3AXF A;  2Q88 A;  3Q29 A;  3K0V A;  3UA8 A;  2H5Y A;  3U92 A;  4DIG A;  5H8F A;  1OMP A;  2HAV A;  2XXW A;  3GBB A;  3B7D A;  4WKM A;  3MC2 A;  3N26 A;  5DVJ A;  1FTK A;  3WAE A;  3BFU A;  2PYY A;  4ECF A;  1MPB A;  1H43 A;  5ELV A;  5AA2 A;  1OQG A;  1LGB C;  3CFL A;  2ONS A;  1T0K A;  2I49 A;  1P1O A;  3RQT A;  5JTY A;  3OEN A;  3PUY E;  4OWD A;  3PPQ A;  4TLL B;  1LBB A;  2PVU A;  5F1Q A;  1JEV A;  2F8D A;  1TFD A;  2DXY A;  3G3H A;  4QFO A;  5DT6 A;  3ZKL A;  2RCA A;  3C33 A;  2O1M A;  2XXQ A;  3FUZ A;  4H5G A;  4LUB A;  4ONY A;  3TQW A;  4ESX A;  1QKB A;  4NWC A;  4R72 A;  2FA7 A;  4MH5 A;  3TDJ A;  4LA9 A;  4JWY A;  5K2X A;  2X26 A;  1UIV A;  3HHG A;  3LSF B;  3S9L C;  5HPQ A;  4EF2 A;  3D4G A;  1FQF A;  3O9P A;  3PV0 E;  1B5H A;  1GGG A;  1BLF A;  1TFA A;  4IO3 A;  4U1O A;  1FTM A;  1IXC A;  2NOO A;  4IO4 A;  4TOZ A;  3FJ7 A;  3HCQ A;  5F7V A;  3CFX A;  4EQ7 A;  3PUZ E;  2QS1 A;  2Y7W A;  2Z8F A;  1A7L A;  3EF7 A;  4QRZ A;  4XKQ A;  4LAT A;  1FW0 A;  5TPA B;  4PFT A;  1IZ1 A;  3ZKK A;  3O29 A;  5I56 A;  4QFP A;  4PP0 A;  1LAX A;  1B3L A;  3LSX A;  4N6P A;  4X48 A;  5L8D A;  4F1U A;  3LSL A;  2H99 A;  4GL0 A;  4XXU A;  3KN7 A;  1O64 A;  3OD7 A;  4EXK A;  4HW8 A;  1CE2 A;  3CI8 A;  3G3F A;  4NTL A;  3TTR A;  4NED A;  1FQE A;  3PUV E;  4GD5 A;  2OBG A;  2ZNT A;  1H3D A;  3DEL B;  4YMB A;  2KLF A;  5AA4 B;  3V83 A;  2Q2A A;  4MLQ A;  3MUQ A;  3GZG A;  3MZ9 A;  1LFG A;  1DMB A;  1UIU A;  1XVX A;  2XXP A;  3OOA A;  1D3K A;  2O69 A;  4JBZ A;  3TKD A;  1UTB B;  4Q30 B;  3FVK A;  4NF8 B;  4G68 A;  3BBR A;  3MVX A;  5EHS A;  1IIW A;  2FNC A;  3PD8 A;  4GIZ A;  4GVO A;  4EXL A;  5IAI A;  4BDR A;  4YKI A;  3U1O A;  1ZBM A;  2G93 A;  4GXS B;  2XXX A;  2UVI A;  1OIB A;  4Q0C A;  2V3Q A;  3LUY A;  1Y3P A;  4YB6 A;  1PB8 A;  1NNP A;  1SW4 A;  1QUK A;  3H3G A;  4KD5 A;  3IX1 A;  2NWJ A;  3PD9 A;  3RN8 A;  2OWS A;  4R6K A;  1SDX A;  4GQO A;  4JSD A;  3UGW A;  4F1V A;  2GHB A;  4IO6 A;  1UQW A;  4XKR A;  2E1S A;  3PMX A;  1F9B A;  1J1N A;  2QMW A;  3EQ1 A;  1GV8 A;  3OSR A;  1PDA A;  5KZT A;  5L9O A;  3VVD A;  4EDP A;  3LBS A;  3CRB A;  3M8U A;  5FHM A;  5AA4 A;  4O3B A;  1PBQ A;  5CC2 A;  3P7I A;  4OFO A;  4EQB A;  2F78 A;  4C0R A;  3T9U A;  2AYS A;  1DPE A;  4G68 C;  1UTB A;  4X1B A;  3LR1 A;  1M5E A;  1QVS A;  3IAZ A;  1B46 A;  1MM6 A;  2ZXT A;  3VLU A;  1NL5 A;  4OQO A;  5A5X A;  2I3W A;  2NVU B;  2Y7P A;  5DEX B;  5TP9 A;  1FTL A;  5KDT B;  2F6P A;  5L9S A;  1VFE A;  3VLV A;  1MXX A;  4POW A;  5AA2 B;  3SEY A;  1AH5 A;  2RCB A;  5I2K A;  3M3K A;  4YAH X;  4XKN A;  1ELJ A;  4DZ1 A;  3K1P A;  3FAT A;  3W9V A;  4GWO A;  3K6X A;  3DP4 A;  2XX8 A;  3KJ7 A;  2Q8J A;  4DCY A;  3MVW A;  1URG A;  3DM0 A;  4OET A;  2B65 A;  1BIY A;  4G8M A;  1QUL A;  2DYX A;  3G3K A;  3O97 A;  1B7Z A;  3OSQ A;  4BDL A;  2ZYM A;  4LZ8 A;  3I3V A;  2THI A;  1P1Q A;  3PU5 A;  2FYI A;  3FJM A;  4Q5T A;  4DLD A;  1MXW A;  4FEC A;  2GRV A;  4NF5 A;  1OQH A;  4ISU A;  4LP2 B;  2DWJ A;  1NKX A;  4M1V A;  1IQ7 A;  2XXH A;  2F7B A;  2I48 A;  2ZYN A;  3KSJ A;  3USD A;  3FVG A;  5L9M A;  1M5B A;  2F35 A;  3SER A;  4LZ7 A;  4ZDM A;  1MS7 A;  1ZMG A;  3G7W A;  1IXH A;  4U2R A;  4ELO A;  2ZNU A;  3JV9 A;  4KHZ E;  1PC3 A;  4U23 A;  4JSO A;  2Y7I A;  1QKA A;  3Q28 A;  5I57 A;  1FQD A;  4ELP A;  1B0L A;  5JK4 A;  2O7U A;  3OEK A;  3O28 A;  3OEM A;  4F3S A;  1PB7 A;  2PT1 A;  1IXG A;  2O1L A;  3IK6 B;  1PB9 A;  1N7X A;  5M2V A;  5KDT A;  3PPR A;  1BKA A;  3PPP A;  1OVB A;  2DWA A;  4I9D A;  3OO6 A;  1N3X A;  3LC8 A;  5CMB A;  2O68 A;  2R9J A;  4H5F A;  1B05 A;  1S7Y A;  1FTJ A;  1B3G A;  1YAE A;  2YPN A;  1QW0 A;  5FTH A;  3H6W A;  3H6T A;  1FCK A;  4HCW A;  4H8I A;  4OES A;  3O6I A;  1HSE A;  5CBS A;  3G3I A;  2ONR A;  1A8E A;  2REJ A;  4R6Y A;  3QSL A;  4XKP A;  4BDO A;  1DSN A;  2DE3 A;  4KCC A;  4F1Y A;  5BUU A;  1B2H A;  1N04 A;  1PEB A;  1Y9U A;  2CZL A;  2DVZ A;  2XXR A;  3FXQ A;  3N94 A;  3TFL A;  5DYH A;  4U1Z A;  3IB2 A;  1IIT A;  1MQJ A;  5J1D A;  3K1N A;  1I69 A;  1AMF A;  2XD3 A;  4UA8 A;  5ITO A;  1BP5 A;  1DTG A;  2IEE A;  1Z7M E;  4F39 A;  1A54 A;  2W7Y A;  4MBP A;  1EZ9 A;  2ZMB A;  3BFT A;  4KPT A;  3RT8 A;  2WKY A;  1IUD A;  1P1N A;  3A3C A;  4JDF A;  4H1X A;  1B5I A;  3F11 A;  2DP8 A;  3H06 B;  4QFL A;  5DVI A;  4ND9 A;  5I56 B;  3S9E A;  2DOJ A;  4KQP A;  4YU0 A;  2Z8E A;  2DS9 A;  2BJJ X;  1MQD A; 
#chains in the Genus database with same CATH topology
 4HTG A;  4N07 A;  4GBV A;  2OWZ A;  3M3F A;  3KN3 A;  4F29 A;  5KCJ A;  3W15 C;  1QJM A;  1POT A;  4H65 A;  5H8H B;  4YKJ A;  3RTW B;  3QXM A;  4F19 A;  1FPG A;  2H9B A;  4THI A;  2I58 A;  3GLB A;  2XXV A;  4ESW A;  3I6V A;  2I3V A;  3TPA A;  3TAJ A;  3SES A;  3S9N C;  4JXI A;  2Y7K A;  1EH3 A;  1US5 A;  2GHA A;  2CEY A;  4MNC A;  1GVC A;  1B58 A;  3T96 B;  5IZ3 B;  1JW1 A;  3RNN A;  4DI3 D;  4O7I A;  2I4B A;  4FJP A;  4OFL A;  4OVR A;  4DXU A;  2QPQ A;  3HN0 A;  1P1W A;  3FBP A;  2NXO A;  2F7C A;  2XX9 A;  3PMW A;  2Y5L A;  1N76 A;  4ZZE A;  5I57 B;  3FJG A;  3A29 A;  1WVJ A;  1R9L A;  2HEU A;  2Q2C A;  1JNF A;  2RF1 A;  2Z8D A;  3S2V A;  2ZYO A;  2OWT A;  3BIG A;  4ZE8 A;  3I5O A;  1Y3N A;  3IO4 A;  1KA0 A;  5JEI A;  4OEV A;  2Z23 A;  4JWO A;  5AA3 A;  3CSG A;  1FPL A;  2R6G E;  4F22 A;  4AB5 A;  1LFH A;  4IGT A;  1RYX A;  4FAT A;  3VVF A;  1M5C A;  2R8T A;  2IA4 A;  1B9J A;  1FPE A;  1USY H;  1I6A A;  4OAN A;  4LQ2 A;  4X8R A;  4YZZ A;  1PBP A;  4MF3 A;  5I58 A;  1Y3Q A;  1MXY A;  2XXI A;  2Q8M A;  3VV5 A;  3KC0 A;  4OHN A;  5I84 A;  2H25 A;  2VGQ A;  4H67 A;  3IOU A;  4R9G A;  2V3T A;  2QS2 A;  3HV1 A;  3ODB A;  2Y5K A;  1UTH A;  2XXK A;  2B3B A;  3ZSF A;  4N15 A;  2CZK A;  4L17 A;  1B7H A;  1O63 A;  3IB0 A;  1XT8 A;  2HCA A;  5B70 A;  4G2Z A;  1Y1Z A;  5T3J A;  3T9X B;  2F36 A;  3HHF A;  1GTK A;  2VT5 A;  2UYF A;  5I5P A;  5H8N A;  3FV1 A;  4PFB A;  1AL3 A;  5DVF A;  3QIM A;  3O2A A;  2Z22 A;  3EN3 A;  1B3E A;  1RDZ A;  4O3A A;  1SW1 A;  1KZ8 A;  4XTC Q;  4GOT A;  5CRY A;  4MNP A;  3PPN A;  1B3H A;  3IOT A;  1ZKB A;  2CMO A;  3KEI A;  1XVY A;  4H45 A;  4RPN A;  5H8S A;  4FEB A;  3IO6 A;  2D3I A;  5ITP A;  4OTE A;  3T1B A;  2UYE A;  3FXU A;  4H6D A;  2P2A A;  1NUZ A;  1A8F A;  3IL1 B;  2AL4 A;  4M4G A;  3TTN A;  1R1N A;  1MXZ A;  2VD2 A;  4IO2 A;  2QS3 A;  1MY2 A;  4FAJ A;  2REG A;  4MFI A;  4NGU A;  3TQL A;  1D9V A;  5EQ7 A;  4F3P A;  4RXL A;  5J16 A;  4O3C A;  5I59 B;  2D21 A;  1Y4T A;  5AA2 A;  3GBA A;  2X7Q A;  2P0S A;  1I6B A;  1N84 A;  4F2O A;  2D5W A;  5AE4 A;  1FBC A;  1B0H A;  3AXF A;  2Q88 A;  3Q29 A;  3K0V A;  2H5Y A;  2WBD A;  1OMP A;  3B7D A;  5DVJ A;  2PYY A;  1MPB A;  5ELV A;  1LGB C;  3CFL A;  2I49 A;  5JTY A;  1LBB A;  5F1Q A;  1JEV A;  3FUZ A;  4P9K A;  4PFI A;  4NWC A;  3LSF B;  1FQF A;  1GGG A;  1FTM A;  3FJ7 A;  3CFX A;  3PUZ E;  2QS1 A;  1A7L A;  1IZ1 A;  1YZ0 A;  4PP0 A;  3LSX A;  1B3L A;  4X48 A;  4F1U A;  3OD7 A;  1EYK A;  1G0I A;  3TTR A;  1FQE A;  3PUV E;  3V83 A;  2KLF A;  5AA4 B;  4MLQ A;  3MZ9 A;  3TKD A;  4G68 A;  1IME A;  1LEV A;  4PGP A;  2UVI A;  3LUY A;  1NV4 A;  1PB8 A;  4KD5 A;  3IX1 A;  3RN8 A;  3PD9 A;  2OWS A;  1SDX A;  4N4U A;  3RPL B;  3B8B A;  4IO6 A;  3EQ1 A;  2DDK A;  3GYY A;  1B46 A;  2ZXT A;  3VLU A;  2I3W A;  5DEX B;  5KDT B;  4YAH X;  1ELJ A;  2MKZ A;  3K1P A;  3W9V A;  3MVW A;  4G8M A;  5ET8 A;  4LZ8 A;  4FEC A;  4NF5 A;  4ISU A;  4ZDM A;  1IXH A;  3Q28 A;  1RDX A;  4ELP A;  3O28 A;  1PB7 A;  4GBW A;  5M2V A;  2O68 A;  2R9J A;  4H5F A;  2YPN A;  1FCK A;  4H8I A;  2VPN A;  3G3I A;  1A8E A;  1EYI A;  2REJ A;  1DSN A;  4F1Y A;  4KCC A;  1Y9U A;  3N94 A;  1PEB A;  1FPK A;  4U1Z A;  1MQJ A;  1FBG A;  3K1N A;  1AMF A;  4UA8 A;  1Z7M E;  4P3L A;  4KPT A;  1IUD A;  2DP8 A;  2DS9 A;  4PFW A;  1EZO A;  4YKK A;  2XWK A;  2YLN A;  2F97 A;  1NI9 A;  4RJZ A;  3JYR A;  2V4C A;  4HE0 A;  2QMX A;  5IZ3 A;  4EUO A;  3K02 A;  1SD3 A;  3FGS A;  3ISP A;  5ET7 A;  4I62 A;  5LDZ A;  3SZP A;  2XHD A;  3E13 X;  4OA4 A;  3B6W A;  2OJT A;  3EKI A;  3B6T A;  3H6V A;  4R74 A;  2RIN A;  1FQC A;  3V89 B;  1SW2 A;  2ZYK A;  2ALU A;  1RYO A;  4IY6 A;  2XXT A;  4C1T A;  4QSE A;  2ANJ A;  5IGA A;  4HCY A;  1LST A;  2RKM A;  5DEX A;  4K3F A;  4ZEB A;  5ET6 A;  4N91 A;  4WEP A;  1MPC A;  1IEJ A;  1EU8 A;  4YMA A;  4NE4 A;  5IM2 A;  3KOT A;  4P8B A;  4PGN A;  1N3W A;  4NF5 B;  1B7U A;  3IJO B;  4RK2 A;  1MDP 1;  1TT1 A;  3UOR A;  1URD A;  1JW4 A;  4P0G A;  3VXC A;  2O6A A;  2R71 A;  1MY3 A;  3Q26 A;  1R9Q A;  1IMA A;  1H44 A;  3K4U A;  2QJE A;  3CHG A;  2F34 A;  2PX1 A;  1FBD A;  3T66 A;  1OVT A;  3MST A;  3OEL A;  1L5T A;  2DE4 A;  5I58 B;  4IO7 A;  4I8C A;  4BLA A;  4R9F A;  3U8Q A;  5EHM A;  4ZEK A;  3PGF A;  1KWH A;  1LBC A;  4OEU A;  1MM7 A;  3LSW A;  4AB6 A;  3C4M A;  3TOD A;  3PUW E;  2GQ1 A;  2AIX A;  4FOR A;  1IMC A;  3VXB A;  2V3U A;  3TCG A;  1B6H A;  4I3Y A;  3ONM A;  3S9M C;  1NV0 A;  3K6U A;  4PC9 A;  1HSJ A;  4MHF A;  1MQI A;  3DP6 A;  1HSL A;  2Q89 A;  1NUX A;  1JQF A;  1WOD A;  2QVV A;  3KN8 A;  1NNK A;  3MZB A;  3RT6 B;  3SET A;  3C36 A;  2BJI A;  2UVG A;  3U72 A;  1SVX B;  3Q25 A;  3TEL A;  1MH3 A;  4PE3 A;  3UN6 A;  1XS5 A;  1EZP A;  3RLF E;  1R6Z A;  5BWJ A;  5CMB A;  4OZ9 A;  5CC2 A;  3T0J A;  2CEX A;  4ELQ A;  4PAF A;  4GWU A;  3FVO A;  2FBP A;  4OMB A;  2VPO A;  4F3B A;  4PCD A;  3CSB A;  3RPW A;  2LAO A;  3ROJ A;  4N6K A;  4PF8 A;  1VSO A;  4PET A;  2VOZ A;  4U4S A;  2F6G A;  2XA5 A;  4ZEC A;  1QGX A;  3SEX A;  3E3K A;  4PFY A;  4GWX A;  3MW0 A;  1FTO A;  2AL5 A;  1P1U A;  1MRP A;  1POY 1;  1MXU A;  1LBV A;  4Z0I A;  3RTF B;  1GR2 A;  4MMP A;  4C1U A;  5I2N A;  2OX3 A;  4P1E A;  1MXV A;  4GWZ A;  4FE8 A;  2FIE A;  2M8C A;  3K6W A;  4PQJ A;  4OYV A;  2WYP A;  2WX9 A;  4LQ5 A;  3C31 A;  2O51 A;  1II5 A;  1QUJ A;  2XXU A;  1MDQ A;  2CZH A;  4ZS9 A;  4E0W A;  4JVD A;  2HXW A;  1LAG E;  2F7A A;  1DOT A;  4AS5 A;  2P3N A;  3KG2 A;  3SKP A;  3CG1 A;  3HST A;  2V84 A;  2PFZ A;  4LZ5 A;  4BDM A;  1DCU A;  4PBH A;  1SW5 A;  2HHM A;  1NV3 A;  5JTY B;  3FXB A;  1YTV A;  3BKI B;  2XXY A;  3E78 A;  3N6T A;  1XC1 A;  1SYH A;  4JB7 A;  3UA8 A;  4GF8 A;  4DIG A;  5H8F A;  3MC2 A;  1LBZ A;  1OQG A;  2ONS A;  1P1O A;  3RQT A;  3OEN A;  3PUY E;  4OWD A;  3PPQ A;  4H46 A;  2F8D A;  1TFD A;  2DXY A;  5DT6 A;  2RCA A;  3C33 A;  4H5G A;  4ONY A;  2XWI A;  4ESX A;  5EQ9 A;  1UIV A;  3HHG A;  3S9L C;  4EF2 A;  3MYU A;  4GX3 A;  4IO4 A;  2NOO A;  4XKQ A;  2Y7W A;  5TPA B;  4PFT A;  3U65 A;  3ZKK A;  4N6P A;  1JP4 A;  3RPL A;  4GL0 A;  4HW8 A;  3G3F A;  4O8M A;  4GD5 A;  2OBG A;  3MUQ A;  1LFG A;  1XVX A;  3OOA A;  1D3K A;  4NF8 B;  3BBR A;  3MVX A;  4GIZ A;  1ZBM A;  1OIB A;  4Q0C A;  3H3G A;  2NWJ A;  4R6K A;  3UGW A;  2GHB A;  1F9B A;  3VVD A;  4GWW A;  5FHM A;  3M8U A;  4O3B A;  3P7I A;  4OFO A;  2AYS A;  1DPE A;  1M5E A;  1QVS A;  3IAZ A;  1NL5 A;  2NVU B;  5TP9 A;  1FTL A;  5L9S A;  2F6P A;  1VFE A;  1MXX A;  1AH5 A;  3DP4 A;  2XX8 A;  3KJ7 A;  4I3E A;  3G3K A;  3OSQ A;  2FYI A;  1MXW A;  5A5L A;  4M1V A;  1NKX A;  2DWJ A;  1IQ7 A;  2F7B A;  2I48 A;  2CZI A;  3FVG A;  4P47 A;  1M5B A;  4LZ7 A;  1ZMG A;  2ZNU A;  4U23 A;  4JSO A;  5EQA A;  1QKA A;  1B0L A;  5JK4 A;  2O7U A;  3OEM A;  3IK6 B;  2PT1 A;  1BKA A;  2DWA A;  4NN3 A;  4GX6 A;  4OVQ A;  1FTJ A;  5FTH A;  1QW0 A;  3O6I A;  1HSE A;  2ONR A;  4BDO A;  2DE3 A;  5BUU A;  1B2H A;  2XXR A;  4X04 A;  3IB2 A;  2XD3 A;  1BP5 A;  2IEE A;  2ZMB A;  3BFT A;  4H1X A;  1B5I A;  3F11 A;  2XWO A;  4QFL A;  2FIX A;  4YU0 A;  1H76 A;  3QMF A;  3LC8 A;  1NV1 A;  1NNF A;  5LTC A;  4QSD A;  1M5F A;  3IB1 A;  3OO7 A;  4NF4 A;  3OO9 A;  1B1X A;  4POX A;  1QUI A;  1YCJ A;  1P99 A;  5FHN A;  2V25 A;  2F5X A;  1D9Q A;  4ZZA A;  4OEN A;  3TTL A;  4RYA A;  2RC7 A;  3QAX A;  1SBP A;  2G29 A;  3KBR A;  2HZK A;  4GX4 A;  3MP8 A;  3FD3 A;  5LOM A;  5FTI A;  2O7I A;  1Y20 A;  4G61 A;  4PAK A;  2ABH A;  3KGC A;  5IKB A;  4N81 A;  4H8J A;  5H8Q B;  1RDY A;  1MQG A;  4KFQ A;  2HFB A;  1YXI A;  3KOS A;  3VDF A;  1Q35 A;  2VP1 A;  4IGR A;  1NV7 A;  1LB9 A;  4MCO A;  3MPL A;  1JVX A;  2B4M A;  4QBA A;  4YKP A;  4TQU Q;  4I40 A;  1NH7 A;  1MG1 A;  3ECR A;  3W9W A;  3CFZ A;  4NHB A;  3EHU A;  4UAB A;  2XD2 A;  3QUF A;  5CMC A;  3ILT B;  2Y84 A;  3IR1 A;  4KR5 A;  1OLA A;  5K2Y A;  4G77 A;  2L5V A;  3C35 A;  3K6V A;  1O7T A;  4U4X A;  3CVG A;  5CM6 A;  1BTJ A;  1SI0 A;  3A09 A;  3KBZ A;  3MQ9 A;  2OK2 A;  2A5T B;  3L6H A;  3TMG A;  1M5D A;  1YYZ A;  3O66 A;  4QFK A;  4EF1 A;  4PTK A;  4G68 B;  1B3F A;  4ZED A;  1DTZ A;  3N6U A;  4KYD A;  2PT2 A;  4KCD A;  1NH8 A;  1Q1K A;  3R7X A;  3MBP A;  5A5X B;  5CMK A;  5F24 A;  4F31 B;  2ESN A;  2B4L A;  1LLS A;  4OVT A;  2FVZ A;  4XF5 A;  2ZNS A;  1B51 A;  3T22 A;  2X7P A;  4DCX A;  3TTK A;  3TCF A;  4MAG A;  3PUX E;  1AOV A;  5CI5 A;  4FBP A;  1B32 A;  4LON B;  3MP1 A;  1MY4 A;  1NFT A;  3PTY A;  4X9T A;  1D4N A;  3E79 A;  4NF6 A;  4N6D A;  1LB8 A;  3TUS A;  4DE8 A;  4OER A;  3D4C A;  1IXI A;  2RC8 A;  2QRY A;  3TCH A;  5H8Q A;  1LCF A;  2H98 A;  3HFU A;  4UAC A;  1JW5 A;  3KFM A;  5AA2 D;  1BK4 A;  2VHA A;  3OXN A;  1B4H A;  4XIG Q;  4G8H A;  1FBF A;  2Q9T A;  1CNQ A;  3A3U A;  2A5S A;  3SEV A;  1VE4 A;  4P56 A;  2B3F A;  5EQ8 A;  1SYI A;  3ZS6 A;  1SQY A;  3TTM A;  2O84 X;  4KYS A;  1S50 A;  4U21 A;  4DI4 B;  4MEV A;  4OFJ A;  3V5A A;  4QSC A;  4TLM B;  3H03 A;  3K1M A;  1JET A;  3IOV A;  4XFE A;  3KSX A;  5KCJ B;  3T9H B;  4U22 A;  1A40 A;  3TZA A;  2QS4 A;  2QVR A;  4G4P A;  3E4R A;  4R6H A;  1A99 A;  4GFR A;  4H0W A;  5CMM A;  4PFU A;  1FPB A;  2GFE A;  3R26 A;  3CR9 A;  1ZIU A;  3LUZ A;  1AIV A;  1NV6 A;  2KQZ A;  3HPI A;  4IB2 A;  3K00 A;  4KXP A;  1A55 A;  1FQB A;  1LAF E;  4RA1 A;  2QSX A;  4X1D A;  3FXR A;  3C34 A;  3MVY A;  4NAP A;  5H8F B;  2RC9 A;  1MY1 A;  4LVQ A;  4P1L A;  3E9X A;  4WXJ A;  4DDD A;  4MX6 A;  3SEU A;  3MAM A;  4YB7 A;  1YPN A;  1ZLQ A;  4FED A;  2UVH A;  1SI1 A;  2FHY A;  4R75 A;  3VE1 B;  4PDH A;  3EPE A;  1XHY A;  4Q8R A;  2H4I A;  5ICT A;  4OVP A;  2I0C A;  4QF9 A;  3G3G A;  1MY0 A;  2HAV A;  3GBB A;  4O94 A;  4MJO A;  4WKM A;  3N26 A;  1H43 A;  1T0K A;  5I3S A;  4TLL B;  2PVU A;  3G3H A;  1FPD A;  2XXQ A;  2FA7 A;  1SPI A;  4MH5 A;  4LA9 A;  4JWY A;  5K2X A;  3TDJ A;  3D4G A;  1FBH A;  1B5H A;  1K9Z A;  3NOH A;  1IXC A;  2XWV A;  2Z8F A;  3EF7 A;  4LAT A;  1FW0 A;  1INP A;  5I56 A;  3O29 A;  2ZZX A;  1LAX A;  5L8D A;  3LSL A;  2H99 A;  3KN7 A;  1CE2 A;  1Q9D A;  2Q2A A;  3GZG A;  2O69 A;  4JBZ A;  4Q30 B;  3FVK A;  5EHS A;  1NV5 A;  1IMF A;  2G93 A;  1Y3P A;  1NNP A;  1QUK A;  4GQO A;  4XKR A;  2E1S A;  1J1N A;  2QMW A;  1GV8 A;  1VDW A;  1PDA A;  5KZT A;  4EDP A;  3CRB A;  1DK4 A;  4EQB A;  4C0R A;  3T9U A;  1UTB A;  4X1B A;  1MM6 A;  2Y7P A;  4POW A;  3SEY A;  5I2K A;  4GWS A;  3FAT A;  4GWO A;  3DM0 A;  4OET A;  4OVS A;  1BIY A;  1QUL A;  2DYX A;  3O97 A;  1XI6 A;  1B7Z A;  5FBP A;  2THI A;  1P1Q A;  3PU5 A;  3FJM A;  2GRV A;  1OQH A;  4LP2 B;  3IFA A;  3USD A;  2XXH A;  5L9M A;  3SER A;  1MS7 A;  4ELO A;  1FJ9 A;  1PC3 A;  2Y7I A;  5ET5 A;  5I57 A;  4XEQ A;  1IXG A;  3PPR A;  5IZZ A;  3PPP A;  4HE2 A;  4I9D A;  3OO6 A;  1B3G A;  3H6W A;  4OES A;  1IMD A;  5CBS A;  3QSL A;  1N04 A;  2DVZ A;  2CZL A;  5DYH A;  1FTA A;  1I69 A;  5ITO A;  5ICQ A;  4F39 A;  1A54 A;  4MBP A;  1P1N A;  3A3C A;  4JDF A;  2KR0 A;  4ND9 A;  1NUY A;  3KC1 A;  2DOJ A;  1MQD A;  2UVJ A;  2Y7R A;  3CG3 A;  3B6Q A;  2DQV A;  1G0H A;  1NUW A;  1LFI A;  3FZV A;  3VFJ A;  4IY5 A;  4QFN A;  4NF8 A;  5I2N B;  2QL3 A;  4NMY A;  2HAU A;  1ZJL A;  3GXA A;  3MWB A;  1URS A;  1MPD A;  2V93 A;  3IOW A;  3U94 A;  1N0T A;  4F18 A;  1XOC A;  1NMU A;  2XX7 A;  4YB5 A;  1WDN A;  3FIR A;  3DLN A;  5ISU A;  1JEU A;  1Z7N E;  5H8H A;  4YIC A;  4ELR A;  2HQ0 A;  4PFR A;  4IR8 A;  2DWH A;  4IO5 A;  1UTH B;  4N8Y A;  5EYH A;  3EHS A;  3CIJ A;  4GRK A;  5I2K B;  3T93 B;  3N5L A;  4Z7E A;  1US4 A;  3MVZ A;  4E0X A;  1DBZ A;  4EQ9 A;  4O7M A;  4AQ4 A;  4ZEI A;  4R2B A;  5H8N B;  1N7W A;  3BIH A;  3QUJ A;  2QFL A;  1TXF A;  3C9H A;  3FV2 A;  5DW8 A;  2E0S A;  4ZEF A;  4JVC A;  2A5T A;  3WAF A;  2OLB A;  3V8X B;  1OLC A;  3MP6 A;  4P0I A;  4PDD A;  4GWY A;  4NF0 A;  1EYJ A;  2PCR A;  1B52 A;  3TEP A;  1FPJ A;  4F2Q A;  3IJX B;  3QK6 A;  3T9V A;  4MLV A;  5TPA A;  4R2F A;  3C32 A;  3H4Z A;  3THI A;  4NF4 B;  2ONK E;  3VLW A;  2DE2 A;  2DVC A;  1KA1 A;  1ATG A;  4HE1 A;  4GLI A;  5HM4 B;  3R6U A;  2NUV A;  1FRP A;  1S9T A;  4KYE A;  3RY3 A;  2F3B A;  2JJK A;  3ILU B;  1VR5 A;  4LN5 A;  3M3L A;  1B4Z A;  3UIF A;  2Q74 A;  4N13 A;  4NF6 B;  1H45 A;  5IZ1 A;  2P3V A;  3L6G A;  5I59 A;  4GXA A;  4GL8 A;  4HS7 A;  3IFC A;  4PE5 B;  5AA2 B;  4WED A;  4DZ1 A;  2HPG A;  2I0B A;  5L9O A;  2I6E A;  3EHT A;  3MJN A;  1B1H A;  1VFD A;  2WBB A;  5TP9 B;  2P1S A;  1Y4C A;  1LAH E;  3UK4 A;  1MH4 A;  1B40 A;  3VVE A;  3FAS A;  3K2D A;  3RUM A;  5ESY A;  2UXA A;  4DXB A;  3QYT A;  3Q27 A;  1FPF A;  2PBW A;  4NWD A;  2GH9 A;  2PMS A;  4DXC A;  1JVY A;  3OO8 A;  3K01 A;  1FQA A;  4ZE9 A;  4PF6 A;  4AS4 A;  2I4C A;  3IOR A;  4RNS A;  1USY E;  1Y1M A;  4JWX A;  3FVN A;  3PMV A;  4R73 A;  5AA1 A;  1RKM A;  4HXV A;  3DP8 A;  2OCU A;  5I7I A;  3TYH A;  4RPO A;  4PBQ A;  2HZL A;  2ZZW A;  2ZZV A;  2YJP A;  4G8N A;  5HBC A;  3SEW A;  3MPK A;  2DXR A;  3O6G A;  4QHQ A;  4F3G A;  5B7D A;  3OMB A;  1CB6 A;  4KI0 E;  5DTB A;  1LCT A;  5FHO A;  5EYF A;  3HO7 A;  1DPP A;  3PPO A;  5CBR A;  4BDQ A;  3G3J A;  3S4U A;  4NX1 A;  4FIM A;  3SDF A;  3RYD A;  3MZ1 A;  1D9Y A;  2DSF A;  1ZTY A;  2DWI A;  3H6U A;  3U93 A;  1K9Y A;  4P11 A;  4BDN A;  1B5J A;  3RGY A;  1NNT A;  4N8G A;  1TWY A;  5TU0 A;  4OXV A;  2VD3 A;  1FBE A;  4MNI A;  2OZZ A;  3JZJ A;  4I1D A;  1MQH A;  1AWB A;  1LBW A;  1ANF A;  3KJT A;  4OVJ A;  3UP9 A;  4RY1 A;  3H7M A;  1ZU0 A;  3O6H A;  3KZG A;  4RK9 A;  1I6Q A;  1IMB A;  3U92 A;  2XXW A;  1FTK A;  3WAE A;  3BFU A;  4ECF A;  2HXR A;  4QFO A;  3ZKL A;  2O1M A;  4LUB A;  3TQW A;  3D1R A;  1QKB A;  1FBP A;  4R72 A;  2X26 A;  5HPQ A;  3O9P A;  3PV0 E;  1FSA A;  1BLF A;  1TFA A;  4IO3 A;  4U1O A;  1FJ6 A;  4TOZ A;  3HCQ A;  5F7V A;  4EQ7 A;  4QRZ A;  1LBX A;  4QFP A;  4XXU A;  1O64 A;  4EXK A;  3CI8 A;  4NTL A;  4NED A;  1NV2 A;  1H3D A;  2ZNT A;  3DEL B;  4YMB A;  1DMB A;  1UIU A;  2XXP A;  1UTB B;  4JVI A;  1IIW A;  2FNC A;  3PD8 A;  4GVO A;  4EXL A;  5IAI A;  4BDR A;  2WYK A;  3B50 A;  4YKI A;  4GXS B;  3U1O A;  2XXX A;  4QXD A;  2V3Q A;  4YB6 A;  1SW4 A;  4F1V A;  4JSD A;  1UQW A;  3PMX A;  1LBY A;  3OSR A;  4NG7 A;  5AA4 A;  3LBS A;  5EYG A;  1PBQ A;  2F78 A;  4G68 C;  4PAI A;  3LR1 A;  4OQO A;  5A5X A;  3VLV A;  2RCB A;  3M3K A;  4XKN A;  2F3D A;  3K6X A;  2Q8J A;  4DCY A;  1URG A;  2B65 A;  4BDL A;  2ZYM A;  3I3V A;  4Q5T A;  4DLD A;  1FPI A;  3KSJ A;  2ZYN A;  4N17 A;  2F35 A;  3G7W A;  4U2R A;  3JV9 A;  4KHZ E;  1FQD A;  2WEF A;  3OEK A;  4F3S A;  5KDT A;  2O1L A;  1PB9 A;  1N7X A;  1OVB A;  1N3X A;  1B05 A;  1S7Y A;  1YAE A;  3H6T A;  4HCW A;  2QVU A;  4R6Y A;  4XKP A;  3FXQ A;  3TFL A;  1IIT A;  5J1D A;  1DTG A;  2W7Y A;  1EZ9 A;  3RT8 A;  2WKY A;  2PFY A;  3H06 B;  5DVI A;  5I56 B;  4NQ8 A;  3S9E A;  3LV0 A;  4KQP A;  2Z8E A;  2BJJ X;  4MIJ A; 
#chains in the Genus database with same CATH homology
 4HTG A;  4PFW A;  1NNF A;  4N07 A;  1EZO A;  2UVJ A;  2Y7R A;  4YKK A;  3CG3 A;  3B6Q A;  2DQV A;  3KN3 A;  3M3F A;  2YLN A;  4F29 A;  2F97 A;  4QSD A;  1M5F A;  5KCJ A;  3IB1 A;  1LFI A;  3OO7 A;  4NF4 A;  3OO9 A;  1QJM A;  1B1X A;  1POT A;  3W15 C;  4RJZ A;  3FZV A;  3JYR A;  4POX A;  3VFJ A;  1QUI A;  4IY5 A;  4QFN A;  4NF8 A;  5I2N B;  1YCJ A;  2QL3 A;  4H65 A;  2QMX A;  5H8H B;  4NMY A;  4YKJ A;  4EUO A;  2HAU A;  1ZJL A;  3RTW B;  3GXA A;  3QXM A;  3K02 A;  4F19 A;  3MWB A;  2H9B A;  1P99 A;  1URS A;  1MPD A;  1SD3 A;  3FGS A;  4THI A;  2I58 A;  5FHN A;  2V25 A;  3GLB A;  2F5X A;  2V93 A;  3IOW A;  2XXV A;  4ZZA A;  4I62 A;  4ESW A;  3I6V A;  4OEN A;  2I3V A;  3TPA A;  3TAJ A;  3TTL A;  3SES A;  3U94 A;  3S9N C;  1N0T A;  2XHD A;  4JXI A;  2Y7K A;  4F18 A;  4RYA A;  1XOC A;  1EH3 A;  3E13 X;  1US5 A;  2RC7 A;  3QAX A;  2GHA A;  1NMU A;  2XX7 A;  1GVC A;  4YB5 A;  1SBP A;  3B6W A;  1B58 A;  2G29 A;  2OJT A;  3KBR A;  1WDN A;  2HZK A;  3B6T A;  3DLN A;  3FIR A;  5ISU A;  3H6V A;  1JEU A;  1Z7N E;  3T96 B;  5H8H A;  1JW1 A;  3RNN A;  3MP8 A;  3FD3 A;  4R74 A;  5LOM A;  2RIN A;  2O7I A;  1Y20 A;  2I4B A;  5FTI A;  1FQC A;  4YIC A;  3V89 B;  4FJP A;  2ABH A;  4ELR A;  3KGC A;  5IKB A;  2HQ0 A;  4H8J A;  5H8Q B;  1SW2 A;  1MQG A;  4KFQ A;  4OFL A;  2ZYK A;  2HFB A;  2ALU A;  3KOS A;  4DXU A;  1RYO A;  2DWH A;  4IO5 A;  3VDF A;  1Q35 A;  4IY6 A;  2XXT A;  4C1T A;  2QPQ A;  3HN0 A;  1UTH B;  4QSE A;  2ANJ A;  2VP1 A;  1P1W A;  4HCY A;  1LST A;  2RKM A;  3EHS A;  4K3F A;  5DEX A;  4IGR A;  2NXO A;  2F7C A;  3CIJ A;  1LB9 A;  2XX9 A;  3PMW A;  3N5L A;  4GRK A;  1US4 A;  5I2K B;  3MVZ A;  4ZEB A;  3T93 B;  4E0X A;  4Z7E A;  4EQ9 A;  4WEP A;  1N76 A;  3MPL A;  4ZZE A;  1MPC A;  1IEJ A;  1JVX A;  4AQ4 A;  1EU8 A;  4ZEI A;  3FJG A;  4NE4 A;  4YMA A;  4R2B A;  5I57 B;  4YKP A;  3KOT A;  4TQU Q;  1N3W A;  1WVJ A;  5H8N B;  1NH7 A;  1N7W A;  1R9L A;  4NF5 B;  2HEU A;  2Q2C A;  1MG1 A;  1JNF A;  3ECR A;  1B7U A;  2RF1 A;  3QUJ A;  2Z8D A;  3S2V A;  3CFZ A;  3W9W A;  3IJO B;  4RK2 A;  1TXF A;  3C9H A;  2ZYO A;  1MDP 1;  1TT1 A;  3EHU A;  3FV2 A;  2XD2 A;  3QUF A;  5CMC A;  2E0S A;  3UOR A;  1URD A;  1JW4 A;  2OWT A;  3ILT B;  2Y84 A;  3IR1 A;  4P0G A;  4ZEF A;  4KR5 A;  2A5T A;  3WAF A;  3VXC A;  1OLA A;  2O6A A;  2OLB A;  2R71 A;  4ZE8 A;  1MY3 A;  1OLC A;  3I5O A;  3MP6 A;  3Q26 A;  5K2Y A;  3V8X B;  1R9Q A;  4P0I A;  1Y3N A;  4G77 A;  1H44 A;  3IO4 A;  3C35 A;  5JEI A;  3K4U A;  4OEV A;  2Z23 A;  1B52 A;  3K6V A;  4JWO A;  5AA3 A;  2QJE A;  3TEP A;  3CSG A;  4F2Q A;  1O7T A;  4U4X A;  3CVG A;  2F34 A;  3IJX B;  2PX1 A;  3QK6 A;  5CM6 A;  1BTJ A;  1SI0 A;  3T66 A;  2R6G E;  1OVT A;  3T9V A;  4F22 A;  4MLV A;  5TPA A;  3OEL A;  4R2F A;  4IGT A;  4AB5 A;  1RYX A;  1LFH A;  3C32 A;  1L5T A;  2DE4 A;  5I58 B;  3A09 A;  4FAT A;  3H4Z A;  4IO7 A;  3VVF A;  4I8C A;  3MQ9 A;  3THI A;  1M5C A;  2OK2 A;  4BLA A;  4R9F A;  3U8Q A;  4NF4 B;  2ONK E;  3VLW A;  2DE2 A;  5EHM A;  2A5T B;  2DVC A;  2IA4 A;  4ZEK A;  3PGF A;  1KWH A;  3L6H A;  1ATG A;  1B9J A;  3TMG A;  1LBC A;  4GLI A;  4OEU A;  1M5D A;  3O66 A;  4QFK A;  4EF1 A;  5HM4 B;  3R6U A;  2NUV A;  1MM7 A;  3LSW A;  1S9T A;  4KYE A;  4AB6 A;  3RY3 A;  3C4M A;  4G68 B;  3TOD A;  1B3F A;  3ILU B;  1USY H;  1I6A A;  4ZED A;  5BWJ A;  1DTZ A;  3N6U A;  3PUW E;  4LQ2 A;  4KYD A;  2AIX A;  4FOR A;  2PT2 A;  4KCD A;  4YZZ A;  1VR5 A;  1NH8 A;  2V3U A;  1Q1K A;  3TCG A;  1B6H A;  3VXB A;  1PBP A;  3M3L A;  4MF3 A;  3R7X A;  3ONM A;  3MBP A;  1B4Z A;  5I58 A;  3UIF A;  3S9M C;  4N13 A;  1Y3Q A;  3K6U A;  1MXY A;  4NF6 B;  5A5X B;  1HSJ A;  1H45 A;  5CMK A;  4F31 B;  2XXI A;  2ESN A;  1LLS A;  1MQI A;  3VV5 A;  3L6G A;  5I59 A;  4GXA A;  4OHN A;  4GL8 A;  4HS7 A;  2ZNS A;  5I84 A;  2H25 A;  1B51 A;  1HSL A;  3DP6 A;  4PE5 B;  2X7P A;  2Q89 A;  4WED A;  3T22 A;  2I0B A;  2VGQ A;  3TTK A;  4DCX A;  4H67 A;  2I6E A;  3EHT A;  1JQF A;  1WOD A;  3MJN A;  3TCF A;  3KN8 A;  1B1H A;  1VFD A;  3PUX E;  3IOU A;  1AOV A;  1NNK A;  3MZB A;  5CI5 A;  3RT6 B;  3SET A;  3C36 A;  5TP9 B;  2P1S A;  1B32 A;  2UVG A;  4R9G A;  1Y4C A;  1LAH E;  1SVX B;  2V3T A;  2QS2 A;  3HV1 A;  3ODB A;  3U72 A;  1MH4 A;  3Q25 A;  4LON B;  3UK4 A;  3MP1 A;  1MY4 A;  3TEL A;  1NFT A;  1MH3 A;  1B40 A;  3VVE A;  1UTH A;  4X9T A;  3FAS A;  3K2D A;  3UN6 A;  1D4N A;  1XS5 A;  2B3B A;  3RUM A;  4NF6 A;  3ZSF A;  1EZP A;  1LB8 A;  3TUS A;  3RLF E;  1R6Z A;  2UXA A;  4DE8 A;  4OER A;  4DXB A;  3QYT A;  1B7H A;  1O63 A;  1IXI A;  2RC8 A;  2QRY A;  3D4C A;  3IB0 A;  4L17 A;  1XT8 A;  4OZ9 A;  3TCH A;  5H8Q A;  2HCA A;  1LCF A;  2H98 A;  3Q27 A;  4G2Z A;  1Y1Z A;  5B70 A;  2PBW A;  4UAC A;  4NWD A;  2GH9 A;  1JW5 A;  3KFM A;  2PMS A;  3T9X B;  4DXC A;  4ELQ A;  2F36 A;  3HHF A;  5AA2 D;  1GTK A;  1JVY A;  2UYF A;  3FVO A;  1H76 A;  3K01 A;  1FQA A;  3OO8 A;  4OMB A;  4ZE9 A;  2VHA A;  3OXN A;  3FV1 A;  1B4H A;  2I4C A;  5H8N A;  4F3B A;  1AL3 A;  3IOR A;  3CSB A;  4XIG Q;  3RPW A;  4RNS A;  5DVF A;  1USY E;  1Y1M A;  2LAO A;  4G8H A;  4JWX A;  3QIM A;  3FVN A;  3PMV A;  3O2A A;  4R73 A;  5AA1 A;  2Z22 A;  3EN3 A;  1B3E A;  5ICQ A;  1VSO A;  1RKM A;  2Q9T A;  4O3A A;  1SW1 A;  3A3U A;  4PET A;  2VOZ A;  4XTC Q;  4U4S A;  2F6G A;  2A5S A;  3SEV A;  1VE4 A;  3DP8 A;  4GOT A;  2B3F A;  5CRY A;  4ZEC A;  3PPN A;  1B3H A;  2OCU A;  1SYI A;  3IOT A;  3TYH A;  1ZKB A;  2CMO A;  1SQY A;  3ZS6 A;  3SEX A;  3TTM A;  2O84 X;  3E3K A;  3KEI A;  4RPO A;  1XVY A;  1S50 A;  2HZL A;  4KYS A;  4U21 A;  4PFY A;  2YJP A;  3MW0 A;  4RPN A;  5H8S A;  4OFJ A;  3V5A A;  4QSC A;  4TLM B;  1FTO A;  3H03 A;  2AL5 A;  4G8N A;  4FEB A;  3K1M A;  1P1U A;  1JET A;  1MRP A;  3IOV A;  1POY 1;  3KSX A;  5KCJ B;  5HBC A;  1MXU A;  3T9H B;  3SEW A;  3MPK A;  4U22 A;  4Z0I A;  3RTF B;  2DXR A;  1GR2 A;  2D3I A;  3IO6 A;  5ITP A;  1A40 A;  3O6G A;  4QHQ A;  4C1U A;  3TZA A;  4OTE A;  3OMB A;  4F3G A;  5B7D A;  1CB6 A;  5I2N A;  2QS4 A;  4KI0 E;  2UYE A;  3FXU A;  4H6D A;  1MXV A;  5DTB A;  4G4P A;  2P2A A;  3E4R A;  1LCT A;  5FHO A;  4R6H A;  5EYF A;  3HO7 A;  1A99 A;  1DPP A;  3PPO A;  4GFR A;  4H0W A;  1A8F A;  4FE8 A;  3IL1 B;  5CBR A;  2AL4 A;  4M4G A;  2M8C A;  5CMM A;  4BDQ A;  4PFU A;  3G3J A;  3K6W A;  3TTN A;  2GFE A;  3S4U A;  3R26 A;  1R1N A;  3CR9 A;  1ZIU A;  4FIM A;  4OYV A;  4PQJ A;  3SDF A;  1AIV A;  1MXZ A;  2VD2 A;  4LQ5 A;  3C31 A;  2O51 A;  1II5 A;  2QS3 A;  4IO2 A;  1MY2 A;  1QUJ A;  2XXU A;  3MZ1 A;  1MDQ A;  3HPI A;  1D9Y A;  4IB2 A;  2REG A;  4FAJ A;  3K00 A;  2DSF A;  1ZTY A;  4MFI A;  4ZS9 A;  1A55 A;  1FQB A;  4E0W A;  1LAF E;  2DWI A;  1LAG E;  2HXW A;  2QSX A;  2F7A A;  3H6U A;  4RA1 A;  3FXR A;  1DOT A;  4X1D A;  3U93 A;  4P11 A;  3C34 A;  3MVY A;  4BDN A;  3TQL A;  1B5J A;  1D9V A;  3KG2 A;  3RGY A;  5H8F B;  3SKP A;  2RC9 A;  3CG1 A;  1MY1 A;  3HST A;  4LVQ A;  4RXL A;  4F3P A;  3E9X A;  4WXJ A;  1NNT A;  4DDD A;  3SEU A;  3MAM A;  4YB7 A;  2V84 A;  4O3C A;  4LZ5 A;  4BDM A;  1TWY A;  5TU0 A;  1YPN A;  5I59 B;  1SW5 A;  4OXV A;  2VD3 A;  1ZLQ A;  2OZZ A;  4FED A;  2D21 A;  1Y4T A;  3JZJ A;  2UVH A;  4I1D A;  3GBA A;  1SI1 A;  5JTY B;  1MQH A;  4R75 A;  3VE1 B;  1ANF A;  1YTV A;  2X7Q A;  2P0S A;  3KJT A;  4OVJ A;  1I6B A;  3EPE A;  3UP9 A;  1XHY A;  4RY1 A;  4Q8R A;  2H4I A;  3H7M A;  3BKI B;  1ZU0 A;  5ICT A;  2XXY A;  1N84 A;  3O6H A;  3KZG A;  2I0C A;  4RK9 A;  4F2O A;  4QF9 A;  3N6T A;  2D5W A;  3G3G A;  1I6Q A;  1XC1 A;  5AE4 A;  1MY0 A;  1SYH A;  4JB7 A;  1B0H A;  4GF8 A;  3AXF A;  2Q88 A;  3Q29 A;  3K0V A;  3UA8 A;  2H5Y A;  3U92 A;  4DIG A;  5H8F A;  1OMP A;  2HAV A;  2XXW A;  3GBB A;  3B7D A;  4WKM A;  3MC2 A;  3N26 A;  5DVJ A;  1FTK A;  3WAE A;  3BFU A;  2PYY A;  4ECF A;  1MPB A;  1H43 A;  5ELV A;  5AA2 A;  1OQG A;  1LGB C;  3CFL A;  2ONS A;  1T0K A;  2I49 A;  1P1O A;  3RQT A;  5JTY A;  3OEN A;  3PUY E;  4OWD A;  3PPQ A;  4TLL B;  1LBB A;  2PVU A;  5F1Q A;  1JEV A;  2F8D A;  1TFD A;  2DXY A;  3G3H A;  4QFO A;  5DT6 A;  3ZKL A;  2RCA A;  3C33 A;  2O1M A;  2XXQ A;  3FUZ A;  4H5G A;  4LUB A;  4ONY A;  3TQW A;  4ESX A;  1QKB A;  4NWC A;  4R72 A;  2FA7 A;  4MH5 A;  3TDJ A;  4LA9 A;  4JWY A;  5K2X A;  2X26 A;  1UIV A;  3HHG A;  3LSF B;  3S9L C;  5HPQ A;  4EF2 A;  3D4G A;  1FQF A;  3O9P A;  3PV0 E;  1B5H A;  1GGG A;  1BLF A;  1TFA A;  4IO3 A;  4U1O A;  1FTM A;  1IXC A;  2NOO A;  4IO4 A;  4TOZ A;  3FJ7 A;  3HCQ A;  5F7V A;  3CFX A;  4EQ7 A;  3PUZ E;  2QS1 A;  2Y7W A;  2Z8F A;  1A7L A;  3EF7 A;  4QRZ A;  4XKQ A;  4LAT A;  1FW0 A;  5TPA B;  4PFT A;  1IZ1 A;  3ZKK A;  3O29 A;  5I56 A;  4QFP A;  4PP0 A;  1LAX A;  1B3L A;  3LSX A;  4N6P A;  4X48 A;  5L8D A;  4F1U A;  3LSL A;  2H99 A;  4GL0 A;  4XXU A;  3KN7 A;  1O64 A;  3OD7 A;  4EXK A;  4HW8 A;  1CE2 A;  3CI8 A;  3G3F A;  4NTL A;  3TTR A;  4NED A;  1FQE A;  3PUV E;  4GD5 A;  2OBG A;  2ZNT A;  1H3D A;  3DEL B;  4YMB A;  2KLF A;  5AA4 B;  3V83 A;  2Q2A A;  4MLQ A;  3MUQ A;  3GZG A;  3MZ9 A;  1LFG A;  1DMB A;  1UIU A;  1XVX A;  2XXP A;  3OOA A;  1D3K A;  2O69 A;  4JBZ A;  3TKD A;  1UTB B;  4Q30 B;  3FVK A;  4NF8 B;  4G68 A;  3BBR A;  3MVX A;  5EHS A;  1IIW A;  2FNC A;  3PD8 A;  4GIZ A;  4GVO A;  4EXL A;  5IAI A;  4BDR A;  4YKI A;  3U1O A;  1ZBM A;  2G93 A;  4GXS B;  2XXX A;  2UVI A;  1OIB A;  4Q0C A;  2V3Q A;  3LUY A;  1Y3P A;  4YB6 A;  1PB8 A;  1NNP A;  1SW4 A;  1QUK A;  3H3G A;  4KD5 A;  3IX1 A;  2NWJ A;  3PD9 A;  3RN8 A;  2OWS A;  4R6K A;  1SDX A;  4GQO A;  4JSD A;  3UGW A;  4F1V A;  2GHB A;  4IO6 A;  1UQW A;  4XKR A;  2E1S A;  3PMX A;  1F9B A;  1J1N A;  2QMW A;  3EQ1 A;  1GV8 A;  3OSR A;  1PDA A;  5KZT A;  5L9O A;  3VVD A;  4EDP A;  3LBS A;  3CRB A;  3M8U A;  5FHM A;  5AA4 A;  4O3B A;  1PBQ A;  5CC2 A;  3P7I A;  4OFO A;  4EQB A;  2F78 A;  4C0R A;  3T9U A;  2AYS A;  1DPE A;  4G68 C;  1UTB A;  4X1B A;  3LR1 A;  1M5E A;  1QVS A;  3IAZ A;  1B46 A;  1MM6 A;  2ZXT A;  3VLU A;  1NL5 A;  4OQO A;  5A5X A;  2I3W A;  2NVU B;  2Y7P A;  5DEX B;  5TP9 A;  1FTL A;  5KDT B;  2F6P A;  5L9S A;  1VFE A;  3VLV A;  1MXX A;  4POW A;  5AA2 B;  3SEY A;  1AH5 A;  2RCB A;  5I2K A;  3M3K A;  4YAH X;  4XKN A;  1ELJ A;  4DZ1 A;  3K1P A;  3FAT A;  3W9V A;  4GWO A;  3K6X A;  3DP4 A;  2XX8 A;  3KJ7 A;  2Q8J A;  4DCY A;  3MVW A;  1URG A;  3DM0 A;  4OET A;  2B65 A;  1BIY A;  4G8M A;  1QUL A;  2DYX A;  3G3K A;  3O97 A;  1B7Z A;  3OSQ A;  4BDL A;  2ZYM A;  4LZ8 A;  3I3V A;  2THI A;  1P1Q A;  3PU5 A;  2FYI A;  3FJM A;  4Q5T A;  4DLD A;  1MXW A;  4FEC A;  2GRV A;  4NF5 A;  1OQH A;  4ISU A;  4LP2 B;  2DWJ A;  1NKX A;  4M1V A;  1IQ7 A;  2XXH A;  2F7B A;  2I48 A;  2ZYN A;  3KSJ A;  3USD A;  3FVG A;  5L9M A;  1M5B A;  2F35 A;  3SER A;  4LZ7 A;  4ZDM A;  1MS7 A;  1ZMG A;  3G7W A;  1IXH A;  4U2R A;  4ELO A;  2ZNU A;  3JV9 A;  4KHZ E;  1PC3 A;  4U23 A;  4JSO A;  2Y7I A;  1QKA A;  3Q28 A;  5I57 A;  1FQD A;  4ELP A;  1B0L A;  5JK4 A;  2O7U A;  3OEK A;  3O28 A;  3OEM A;  4F3S A;  1PB7 A;  2PT1 A;  1IXG A;  2O1L A;  3IK6 B;  1PB9 A;  1N7X A;  5M2V A;  5KDT A;  3PPR A;  1BKA A;  3PPP A;  1OVB A;  2DWA A;  4I9D A;  3OO6 A;  1N3X A;  3LC8 A;  5CMB A;  2O68 A;  2R9J A;  4H5F A;  1B05 A;  1S7Y A;  1FTJ A;  1B3G A;  1YAE A;  2YPN A;  1QW0 A;  5FTH A;  3H6W A;  3H6T A;  1FCK A;  4HCW A;  4H8I A;  4OES A;  3O6I A;  1HSE A;  5CBS A;  3G3I A;  2ONR A;  1A8E A;  2REJ A;  4R6Y A;  3QSL A;  4XKP A;  4BDO A;  1DSN A;  2DE3 A;  4KCC A;  4F1Y A;  5BUU A;  1B2H A;  1N04 A;  1PEB A;  1Y9U A;  2CZL A;  2DVZ A;  2XXR A;  3FXQ A;  3N94 A;  3TFL A;  5DYH A;  4U1Z A;  3IB2 A;  1IIT A;  1MQJ A;  5J1D A;  3K1N A;  1I69 A;  1AMF A;  2XD3 A;  4UA8 A;  5ITO A;  1BP5 A;  1DTG A;  2IEE A;  1Z7M E;  4F39 A;  1A54 A;  2W7Y A;  4MBP A;  1EZ9 A;  2ZMB A;  3BFT A;  4KPT A;  3RT8 A;  2WKY A;  1IUD A;  1P1N A;  3A3C A;  4JDF A;  4H1X A;  1B5I A;  3F11 A;  2DP8 A;  3H06 B;  4QFL A;  5DVI A;  4ND9 A;  5I56 B;  3S9E A;  2DOJ A;  4KQP A;  4YU0 A;  2Z8E A;  2DS9 A;  2BJJ X;  1MQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...