3MYUA

Mycoplasma genitalium mg289
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
336
structure length
333
Chain Sequence
NTLIFNISLDHNADTSIEKFFTVFSKKLSGKLNKKINVNFNIVDDSFTKINNIQANKADFAFVNSQAIASNNWFGYTPLIQTLTTAFKEDLELDYYEDGNLQKKAEKTNLLFLSPPYKEWDDIKQKWTGNRYDFLYEPSKLVSFYRSMILITGSASEITAIKKAWNEKNWNQFMKFGIGHGQTNSASRFELPDLLFRKHFAKNYPGLQNAINSDPDKFAVVRGREIGINKNIKIVFDDANSFSWTQNIKRPFYTPIDPNDRLEILTYSDPLLYDIGIVSNNLSRIYQKAIGEIFIELAQSSEDLYGPSIGYNGYKMINDFEKEVVEIIEKTYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into Mycoplasma genitalium metabolism revealed by the structure of MG289, an extracytoplasmic thiamine binding lipoprotein.
pubmed doi rcsb
source organism Mycoplasma genitalium
molecule tags Vib binding protein
molecule keywords High affinity transport system protein p37
total genus 117
structure length 333
sequence length 336
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06646 Mycoplasma_p37 High affinity transport system protein p37
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.180 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3myuA01
3.40.190.190 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3myuA02
3E78A 3E79A 3EKIA 3MYUA
chains in the Genus database with same CATH superfamily
3H4ZA 3MBPA 4NX1A 3KBZA 4GWXA 4KD5A 2DE4A 4GXSB 3OELA 3A29A 4I40A 4NAPA 3TFLA 2FYIA 1QVSA 4ZEIA 2NOOA 4NF5A 3ROJA 1NNPA 1B52A 3B6QA 5FHMA 5ISUA 4GBVA 5I7IA 4F29A 2Y7IA 4GOTA 1AMFA 2Y84A 1OVBA 4XKPA 4P56A 5ET8A 1OQGA 3GLBA 1M5DA 4R74A 2CEXA 3TDJA 1I6QA 1ZJLA 1DOTA 4EXKA 1GGGA 3VLUA 4Q5TA 3EHTA 4PE5B 1OIBA 1SVXB 1EZPA 4F3GA 4KCCA 3JYRA 3L6GA 3FGSA 3H6VA 3K1NA 2XXWA 2R9JA 1AIVA 2X7PA 4MF3A 1MPBA 4YB5A 3FJMA 4NWDA 4Q8RA 3KN3A 4NG7A 3K0VA 4MIJA 4U1ZA 1OVTA 3IK6B 2Q8MA 4GWSA 3MZBA 1IIWA 3TCGA 4X1BA 3TELA 3O29A 5K2XA 3T9HB 1MY1A 4NF8B 5H8NA 5ICTA 3CSBA 3O9PA 1VSOA 3W9VA 3IFCA 4F3SA 5CMKA 1NUWA 2QS4A 3MYUA 4FECA 2CZHA 2DWHA 3IJXB 4MX6A 4GL0A 4MBPA 2QL3A 3LUZA 3OD7A 3I3VA 2YPNA 3TTKA 5JTYA 3IX1A 3IORA 1IMBA 3CFLA 1URSA 4I1DA 4O8MA 2CEYA 4RPNA 5DYHA 2OLBA 3GBAA 4G8HA 1EYJA 3UGWA 1B6HA 3LC8A 3I6VA 4MCOA 3N6TA 4R75A 5CMCA 1GR2A 1VDWA 3KFMA 5DEXB 3HHGA 1XVYA 1MDP1 1DTGA 4BDQA 5J16A 3PPNA 2PVUA 3MP6A 4PDHA 4AS5A 1NV7A 3PD9A 3C32A 3S9MC 4EDPA 4DXUA 1NUXA 4PCDA 4GXAA 4TQUQ 1BKAA 1AH5A 4RNSA 4TOZA 3TPAA 2DWAA 1Y4TA 3IOVA 1B7HA 2VD3A 1I6AA 1I69A 2GH9A 1H44A 1Y3QA 2RC8A 3E9XA 3HFUA 2DVZA 4HCWA 3WAEA 2M8CA 4ECFA 2DYXA 4Z0IA 3K6UA 4YICA 4O3AA 4X8RA 4O3CA 3TYHA 2F3BA 3FJ7A 4H5FA 1TFAA 4OFJA 3MWBA 1GVCA 4MFIA 3DP4A 5FHOA 3L6HA 4U1OA 4Q0CA 4YAHX 5AA1A 2F5XA 5H8FA 4XEQA 3V83A 1TFDA 2XX8A 4N13A 4XXUA 5ICQA 2YJPA 1LBYA 2ZZWA 1PBQA 2GHBA 4DI4B 2NVUB 4F22A 4I62A 5TP9B 4H6DA 4YU0A 5BWJA 4M1VA 2XXVA 2QS3A 1A7LA 3IOUA 4DLDA 3EF7A 2KR0A 3MJNA 3TUSA 2Z22A 1B5HA 3K4UA 4XF5A 3EN3A 3C34A 3CFZA 3VXCA 2ZYKA 5I56B 1KZ8A 1IXHA 1RYXA 2F7AA 4FEBA 3Q26A 1IMFA 4P3LA 1IXGA 2DWIA 3SEWA 3O6HA 3OO7A 4IO7A 3FXRA 1RKMA 5L9OA 4RY1A 2I58A 1FQCA 2WEFA 2G29A 1QUIA 5FTHA 1G0IA 3HHFA 1FPKA 4R2BA 4PGNA 1KA0A 5KCJB 1ATGA 4U2RA 3PUWE 5K2YA 3A3CA 3LV0A 1N84A 1J1NA 3SETA 4ZE9A 4NF4A 3JV9A 3D4CA 1SQYA 4ELRA 4PAFA 1UQWA 4OXVA 5AA3A 1BLFA 3KG2A 1EZOA 1WDNA 5I57B 2MKZA 3LUYA 4FATA 3OMBA 4OENA 3EPEA 1OMPA 4DXCA 4YB6A 3KJTA 4MLQA 1Q35A 1FPEA 2V3QA 1NL5A 4NF4B 4MMPA 3SERA 2QJEA 4WEDA 1LBBA 1JEVA 2B3FA 2QMWA 4ISUA 4PC9A 1US5A 3C33A 1B32A 4TLLB 3M3FA 4QHQA 3VV5A 3B6WA 2O84X 4HW8A 2I4BA 1FPGA 1SDXA 4DCYA 3FV2A 2IEEA 1DTZA 5AA2B 2OZZA 5I2NB 2AL5A 2Q8JA 3IL1B 3TODA 1D4NA 1MQGA 2PT1A 1LSTA 3W15C 1YPNA 4BDRA 1BK4A 1ZMGA 1O63A 4PFRA 4LONB 3MP1A 2HAUA 2ESNA 1WVJA 3C9HA 3USDA 5I56A 3QAXA 4GWUA 4L17A 1SYIA 1SD3A 4QSCA 1EH3A 1SW5A 1QGXA 5I84A 4N8YA 4GWOA 5HBCA 2ONSA 2O51A 1NV3A 4HXVA 4PFTA 5EYHA 1XC1A 1FW0A 1S9TA 4ND9A 4JVCA 2Q9TA 4O7MA 2X26A 3R7XA 4H0WA 3O66A 1SW1A 3PUVE 2Z8DA 1D3KA 4GX6A 1A54A 3KBRA 2V3UA 4N6PA 2ZZVA 5TPAB 1A55A 2WBBA 4KCDA 2DVCA 2XA5A 2NXOA 3KC1A 4NTLA 5ET6A 1FQDA 2JJKA 3N6UA 2F36A 4OVPA 1VFDA 1B40A 1VR5A 2DDKA 1Y4CA 4RXLA 3VVDA 5I3SA 4N4UA 4R9GA 2O1MA 3RPLA 3RUMA 2REGA 3AXFA 4Q30B 3G3GA 1WODA 3GZGA 4EUOA 3BIHA 2B4MA 1N3XA 2G93A 3E3KA 1N7XA 4LUBA 3TTLA 2PFZA 2XHDA 4P47A 1EYIA 4H45A 3PGFA 1P1QA 4PETA 2OBGA 5H8HB 2F34A 1MH3A 4IGRA 5DW8A 2VPOA 2DSFA 4EXLA 3K2DA 1GV8A 5I59B 4PP0A 4HTGA 4KR5A 3U92A 4U21A 2UVHA 2AL4A 2P0SA 3H03A 1OQHA 3F11A 4MNIA 3I5OA 3SEYA 4IO2A 3MZ1A 2VOZA 3QXMA 1IXCA 4IO3A 1LAXA 3GXAA 5M2VA 1NUZA 2H4IA 3LSWA 3ECRA 1NH7A 2NUVA 3LSFB 1FBCA 1LBWA 2WX9A 3FVOA 1SW4A 1FPDA 2Y7RA 5I57A 1MXVA 2HXWA 4OYVA 1D9YA 1KA1A 4QF9A 1IXIA 1EZ9A 3DM0A 5EYFA 2WKYA 4ELOA 2VPNA 4IY6A 4NF8A 3VLWA 4OESA 4PAKA 3PUZE 1TWYA 2UXAA 1P1NA 4KHZE 1Z7ME 3KN7A 4AB6A 1BP5A 3H06B 1B7ZA 1LB8A 3UA8A 4DE8A 1FQBA 1TT1A 4PGPA 1B1HA 1M5EA 1B4ZA 1LAFE 2XXTA 4EF2A 3KOSA 4ZEKA 1F9BA 1LEVA 4UA8A 1OLCA 3PMVA 1B3FA 3PD8A 1AOVA 4NF0A 2PYYA 4XKRA 4F1VA 3D4GA 4ZS9A 4H8JA 3CSGA 1B0LA 1FPJA 1QKBA 4HE1A 3P7IA 5ITOA 4MHFA 5IKBA 4K3FA 4YKPA 4BDMA 2PBWA 5H8SA 1Q9DA 3PPQA 3VVFA 5IZ3A 5CM6A 3OSRA 2Q74A 1CB6A 1N04A 4IO5A 3HO7A 4MLVA 3RGYA 3DP6A 1N7WA 1YZ0A 3T96B 4N07A 1FBGA 1R6ZA 3MAMA 1Y1MA 2O69A 2CZIA 1BIYA 3RPWA 3RQTA 1IITA 3FZVA 4QRZA 4GWYA 1K9ZA 3KEIA 2ZNTA 1MQDA 2H98A 2ANJA 1LFGA 1B51A 3BFUA 3PUXE 1QUKA 1NV6A 3M3KA 3ONMA 5I58A 4Z7EA 3KN8A 3DP8A 1XHYA 2ONKE 4ZZAA 1UIVA 2HAVA 1MQJA 1PB9A 3RYDA 4DIGA 2RINA 4ZEFA 2BJJX 5FHNA 5EHSA 1USYE 4MH5A 1URDA 1Q1KA 3RY3A 4OEUA 4BDNA 4NF6A 4DZ1A 3CFXA 3IJOB 4RYAA 2ZMBA 1G0HA 4QSDA 3D1RA 5DTBA 1LFIA 5A5XA 4TLMB 3A09A 1VE4A 4P9KA 3N26A 1LCTA 1NMUA 1HSEA 1II5A 2I0CA 1MM7A 5EHMA 3TCFA 1USYH 5LDZA 2NWJA 4KYDA 2UVIA 4H1XA 4ZZEA 4MAGA 3MZ9A 2ABHA 1I6BA 2Y5KA 4G8MA 1D9VA 3VVEA 4AS4A 3U94A 4RK9A 5KCJA 5I2NA 3HN0A 2GFEA 4R6KA 5CRYA 1JVYA 5I5PA 4JXIA 4P0GA 5I2KA 2OWSA 4IO4A 3FASA 1AL3A 4HCYA 2YLNA 4PDDA 4FORA 1S7YA 1YTVA 4ESWA 4MNPA 3H7MA 4FJPA 3C36A 3MSTA 1MQHA 3PMXA 3TQLA 4LQ2A 1SW2A 1P1WA 2E0SA 1NI9A 2DS9A 5FTIA 3JZJA 3OO9A 4DXBA 4NQ8A 3MPLA 3FATA 1HSJA 1FTJA 4QFPA 4NGUA 3QUFA 4X1DA 3C35A 2DP8A 4R72A 5H8QB 4X04A 1NKXA 3B8BA 4KI0E 1B1XA 5CBSA 2QVUA 3T9UA 5DT6A 1M5BA 3S9NC 3W9WA 2HHMA 3RNNA 4LVQA 1B05A 2AIXA 1ZKBA 4IY5A 1IMCA 3T9XB 4E0XA 1SI0A 5LOMA 1RDXA 1RYOA 1FTKA 2FIXA 2XWOA 2THIA 4P8BA 1K9YA 3PTYA 1RDZA 2HEUA 4JDFA 3KZGA 1LGBC 4ZECA 4PFWA 3WAFA 2L5VA 2PX1A 4GX3A 5H8FB 2QVRA 2Q89A 5IM2A 4U4SA 3KOTA 3T9VA 4F2OA 3VDFA 2FVZA 3DLNA 2FA7A 3O28A 4P0IA 1NV2A 2I4CA 5TP9A 2F6PA 3MC2A 4OVQA 3S2VA 5BUUA 3CIJA 4YMBA 1B5JA 3O6GA 2F97A 2HQ0A 1LLSA 4RA1A 2FIEA 4O7IA 5B70A 4OEVA 5AA4B 2QFLA 4JB7A 1L5TA 3BKIB 3U72A 2QRYA 4YKKA 2WBDA 1JVXA 3IOTA 4ZEDA 3TTMA 4F39A 4PFUA 1NV4A 3QSLA 2RKMA 2OK2A 5KZTA 1MRPA 1NNTA 3QMFA 3SKPA 1H45A 2OWZA 3PUYE 2B65A 1B3LA 4KYEA 3SDFA 3IAZA 3MVWA 3K6WA 1Y9UA 3Q28A 3FVNA 2HZKA 1FBHA 1OLAA 1FTAA 3G3FA 4QFKA 3KC0A 4JWOA 4N6DA 1B2HA 2W7YA 3OXNA 2HFBA 4GX4A 1O7TA 4BLAA 3N5LA 1NH8A 1LBCA 1N0TA 3RLFE 2XX7A 2B3BA 4H8IA 1NV5A 2B4LA 4XKQA 1KWHA 2VGQA 4BDLA 4NN3A 4JWXA 5JK4A 4GF8A 2XXQA 4WXJA 4DI3D 4PTKA 3T0JA 4ELPA 2V3TA 1LBZA 2XXIA 1IQ7A 4JSOA 3PV0E 3Q27A 4QSEA 3S4UA 1QUJA 1S50A 4PF8A 4JSDA 1FTOA 4UABA 4PQJA 1B9JA 1MXZA 2R6GE 3O6IA 3IO4A 2DE2A 1RDYA 1DCUA 3CHGA 2XXHA 4OMBA 3TTRA 3FJGA 1A99A 3CG1A 2Z23A 3TMGA 1IEJA 3UK4A 1H43A 4N15A 2DQVA 2BJIA 3EQ1A 3K02A 4H5GA 3ZSFA 1NFTA 5T3JA 1B3HA 1P1OA 2RF1A 2F6GA 3PPRA 4PFYA 4OFLA 5KDTB 5JEIA 1BTJA 2GRVA 3SESA 2Y7PA 4F1UA 3OEKA 1ZTYA 2X7QA 5ET7A 2V4CA 4F3BA 3E4RA 3ILTB 2XXYA 1FPIA 1FBDA 1XS5A 1FPLA 5CMMA 3S9EA 5EYGA 1FBEA 1T0KA 5DVIA 4JVDA 2ZXTA 1MXUA 1QW0A 2F7BA 4X9TA 1JW5A 3SEUA 2QS1A 3K6XA 4G4PA 2O68A 2XX9A 5TPAA 3T22A 4I3EA 2PCRA 3TEPA 4O94A 2CZKA 2OWTA 1YCJA 4X48A 4XTCQ 1JEUA 3E79A 3CR9A 1R1NA 1DK4A 3RPLB 4ZE8A 1SPIA 2P1SA 2O6AA 4KQPA 1R9LA 3N94A 1IMEA 4QBAA 2F8DA 4G2ZA 3UIFA 1P1UA 3QUJA 4RK2A 4XIGQ 2I49A 1PB7A 3KSXA 4G68A 4QFOA 3BBRA 1XI6A 4NHBA 5AE4A 1EYKA 2O7UA 4N6KA 1B3EA 2XXXA 3OOAA 4H65A 4XKNA 4LA9A 3SZPA 4GL8A 3MVXA 5IGAA 3ILUB 2CZLA 3G3JA 5L8DA 4ESXA 3OEMA 2WYPA 5A5LA 5I59A 4G8NA 4EQ7A 3KGCA 2V25A 4C1UA 3SEXA 3V89B 4EQ9A 1Y1ZA 4AQ4A 3FV1A 4I9DA 4F2QA 3R6UA 4OA4A 1QKAA 1B0HA 3O2AA 4IGTA 2XD3A 4KXPA 4C0RA 1YXIA 5KDTA 5L9SA 4R6YA 4IB2A 4OFOA 2HCAA 4OZ9A 2ALUA 3MVZA 3GYYA 1AWBA 3ZS6A 2R8TA 4YZZA 2GQ1A 1NNFA 1HSLA 1N76A 5H8QA 2P3VA 4HE0A 3PMWA 4O3BA 2V93A 3H6UA 5ELVA 1N3WA 4ELQA 1FBPA 1MY2A 4JWYA 1CNQA 4F1YA 2P3NA 3LSLA 2XXPA 1PC3A 2F3DA 3T66A 3TKDA 4G77A 4N81A 4GBWA 4ONYA 3VLVA 4POWA 3T93B 3VE1B 4PFIA 3FD3A 3ISPA 4LZ8A 3QYTA 3Q25A 1A40A 4N91A 4NWCA 1MS7A 1URGA 2I3VA 1Y20A 3K00A 4EQBA 1MH4A 1LB9A 2H5YA 5F1QA 2Y7WA 5IZ1A 2QMXA 2VP1A 2A5TA 2DOJA 1FRPA 1FQEA 3FXUA 2Z8FA 1XT8A 2XXRA 3B7DA 4GRKA 4ZEBA 3UORA 3K01A 3LR1A 4DCXA 2Y7KA 3IOWA 1JQFA 1FBFA 4U22A 5CI5A 1MXYA 2ZYMA 3HPIA 1H3DA 3FBPA 3MP8A 2ZNUA 2O7IA 4GLIA 1O64A 1SBPA 1DMBA 3FXBA 3M8UA 1ZIUA 3KJ7A 2FNCA 2GHAA 4EF1A 3V5AA 1ZLQA 3VXBA 2E1SA 1NNKA 2DXRA 4PAIA 1MM6A 2Y5LA 2REJA 4E0WA 3RTFB 5DVJA 4NF5B 5H8NB 3U1OA 3O97A 2WYKA 1JETA 4POXA 3HSTA 5F7VA 1H76A 1PBPA 1US4A 1B7UA 2D5WA 4YB7A 1FSAA 3K1PA 3K6VA 5F24A 4PF6A 2ONRA 3TAJA 5DVFA 2H99A 3FXQA 5CC2A 4R6HA 1GTKA 4R73A 1JNFA 4NMYA 4XFEA 4JBZA 5AA4A 2PFYA 3U65A 4GWWA 2HXRA 3MUQA 4PBQA 4P1EA 3EKIA 4R9FA 1UTBB 2D21A 3SEVA 1LAGE 2Q2AA 3BIGA 1IMDA 3G3HA 3IB2A 3S9LC 5L9MA 2ZNSA 1XOCA 4IR8A 5A5XB 3G7WA 3OO6A 1UTHA 1FCKA 2F7CA 2XD2A 3Q29A 2I6EA 3TCHA 1LAHE 3A3UA 5TU0A 2KLFA 4OTEA 2DXYA 1JP4A 1IZ1A 2UVJA 2PT2A 1DBZA 1NUYA 4WKMA 2PMSA 2QVVA 2V84A 3RT8A 3GBBA 1UTHB 1LCFA 5DEXA 2KQZA 4R2FA 3OENA 1FJ9A 2CMOA 2RC9A 3THIA 1FQFA 1LBVA 4MNCA 5EQ9A 4JVIA 3B6TA 3DELB 3BFTA 4FIMA 5B7DA 3FUZA 4HE2A 5EQ8A 4LZ7A 3C31A 2D3IA 3FIRA 4MEVA 1MY4A 4NE4A 2AYSA 1A8EA 5ESYA 5CBRA 1YYZA 4LN5A 3G3IA 5J1DA 1DSNA 1LFHA 5IAIA 4ZDMA 1M5FA 2P2AA 1VFEA 2H9BA 4AB5A 1PDAA 4OVSA 4GFRA 3EHSA 5JTYB 1MPDA 2UVGA 4FBPA 3OO8A 1QULA 1MY3A 4FEDA 1FJ6A 2OX3A 1DPEA 5IZ3B 3ZKLA 4DDDA 1FTLA 3LSXA 2H25A 4KYSA 2RCBA 2Q88A 5FBPA 2XWVA 5ET5A 3PPOA 2HZLA 1B5IA 1D9QA 3ZKKA 1DPPA 3R26A 3V8XB 4PBHA 1SYHA 3H3GA 1ELJA 3FVKA 4QFNA 4QFLA 4F3PA 2I0BA 3MQ9A 2ZYNA 4MJOA 2HPGA 2ZYOA 3CRBA 5AA2D 4LP2B 5HPQA 2UYFA 2VT5A 1Z7NE 4FE8A 4RPOA 4F19A 2DE3A 2ZZXA 1POY1 4NEDA 1B58A 3K1MA 3T1BA 4KPTA 2QPQA 4F18A 3RTWB 1MY0A 4RJZA 3MVYA 3QK6A 1FQAA 2UYEA 4KFQA 3FVGA 4U23A 2I48A 2RCAA 3QIMA 2Z8EA 3C4MA 1IMAA 1SI1A 1B46A 4LATA 4N17A 4OVTA 3CG3A 1PB8A 3MPKA 2Q2CA 2QSXA 3LBSA 4I8CA 4N8GA 3UN6A 4GIZA 1MDQA 3IR1A 1YAEA 2F35A 2R71A 1INPA 1ANFA 2DWJA 2F78A 1R9QA 3IB0A 5CMBA 4YKJA 4C1TA 1UIUA 5I58B 4IO6A 4U4XA 2XXKA 3IO6A 4PFBA 1FTMA 4THIA 1NV0A 5HM4B 1UTBA 1EU8A 4H67A 3OSQA 1FPFA 3B50A 4OVJA 5EQ7A 3ODBA 4OQOA 4M4GA 1FPBA 4BDOA 1TXFA 5H8HA 3VFJA 4UACA 1JW1A 4H46A 1B3GA 1M5CA 3IFAA 4OWDA 4F31B 1XVXA 3NOHA 1B4HA 1NV1A 4OHNA 3MW0A 2FHYA 1QJMA 4LQ5A 4FAJA 1IUDA 4OVRA 3TZAA 4PE3A 3H6WA 1ZBMA 4OANA 4OETA 1ZU0A 2XXUA 2VD2A 4GWZA 4YMAA 1MG1A 4YKIA 1A8FA 1LBXA 4G68B 4P1LA 2A5TB 4P11A 3CI8A 3TQWA 5EQAA 2QS2A 3U8QA 1Y3NA 4LZ5A 4HS7A 5IZZA 3E13X 4GD5A 2IA4A 3RT6B 5I2KB 3G3KA 1POTA 3UP9A 1Y3PA 4G68C 3IB1A 1PEBA 5ITPA 3M3LA 3E78A 3HV1A 5LTCA 1MXXA 4G61A 3TTNA 3RN8A 2XWKA 4QXDA 1MQIA 3HCQA 4OERA 2XWIA 3H6TA 3PPPA 3PU5A 3CVGA 2VHAA 4I3YA 1JW4A 1MXWA 2RC7A 3U93A 5AA2A 3EHUA 2A5SA 2O1LA 2FBPA 4WEPA 2OCUA 3KSJA 2I3WA 4GQOA 1P99A 4NF6B 2LAOA 1MPCA 4GVOA 1CE2A 2OJTA
chains in the Genus database with same CATH topology
5A5LA 5LDZA 4NX1A 3KBZA 4GWXA 4GX4A 4F1UA 2CZHA 2L5VA 1QGXA 4GX3A 2DE4A 4MAGA 4MNIA 3NOHA 1NV1A 2QVRA 1JP4A 2Y5KA 4PAFA 5ET7A 1FBFA 2V4CA 4MX6A 3A29A 4N8YA 5IM2A 4AS4A 4I40A 4NAPA 3LUZA 2FHYA 2F5XA 4MJOA 2HPGA 3FBPA 1NV3A 4XEQA 4HXVA 1YZ0A 3ROJA 2FVZA 4OA4A 1IMBA 5EYHA 1FBGA 1NUZA 4OVRA 1DBZA 4GBVA 1NUYA 1FPIA 1FBDA 1NV5A 2MKZA 2QVVA 4PE3A 2B4LA 2VT5A 5I7IA 2CZIA 1FBCA 1LBWA 2WX9A 4JVCA 1FPLA 1NV2A 2Q9TA 2KQZA 3FXBA 4O7MA 1FPDA 1FJ9A 1LBYA 2DE3A 2ZZWA 2ZZXA 4OANA 4F19A 4DI4B 5I5PA 5EYGA 3T1BA 4NN3A 1FBEA 1FPEA 2V3QA 4KXPA 4OVQA 2QPQA 4GWYA 1LBVA 4MMPA 5JK4A 4F18A 4MNCA 5EQ9A 1K9ZA 1YXIA 4GWZA 4O8MA 4JVDA 4JVIA 4HCYA 2CEYA 4DI3D 4GX6A 1KA1A 4P56A 5ET8A 4PDDA 4PTKA 4PAIA 3T0JA 1EYJA 1LBZA 4X9TA 1LBXA 4P1LA 4HE2A 2Y5LA 3GYYA 4MNPA 1NV6A 1AWBA 4PC9A 5EQ8A 2ZZVA 4M1VA 2WBBA 2XA5A 2CEXA 3MSTA 2R8TA 2VPNA 4MEVA 1IMAA 3KC1A 4MCOA 5EQAA 2FIEA 2WYKA 2GQ1A 4O7IA 4PAKA 2JJKA 4YZZA 5ET6A 4OVPA 4I3EA 4N17A 1VDWA 2P3VA 2QFLA 4OVTA 4HE0A 5ESYA 2DDKA 2PCRA 5IZZA 2KR0A 1NI9A 1YYZA 4O94A 4PF8A 2CZKA 4LN5A 4N8GA 5J1DA 5J16A 1FBPA 5I3SA 4N4UA 4NQ8A 1CNQA 4PDHA 4XF5A 3RYDA 3E78A 3RPLA 4NGUA 2P3NA 1NV7A 4UABA 4AS5A 3E79A 2F3DA 2WBDA 1FSAA 1INPA 1FPGA 4PF6A 1NUXA 4N81A 1DK4A 4PCDA 4GBWA 5F24A 3RPLB 5LTCA 2DE2A 1RDYA 1DCUA 4PGPA 1KZ8A 3CHGA 4G61A 4OVSA 1NV4A 4PFIA 2XWKA 3ISPA 4QXDA 1SPIA 4XFEA 1IMFA 3BIHA 4FBPA 2B4MA 2XXKA 4P3LA 3QMFA 2XWIA 4N91A 2PFYA 4X04A 2OWZA 4PFBA 1LEVA 1FJ6A 3B8BA 4NG7A 1IMEA 2OX3A 3U65A 1NV0A 2HXRA 4GWWA 4N15A 4MIJA 4QBAA 2QVUA 4PBQA 1G0HA 2PFZA 2Q8MA 4P1EA 5IZ3B 4GWSA 3EKIA 3D1RA 2BJIA 1FPFA 3B50A 2HHMA 3W9WA 4P47A 1BK4A 3BIGA 1IMDA 4NF0A 5EQ7A 1EYIA 2WEFA 4H45A 5IZ1A 3HFUA 4PFRA 2DVZA 5T3JA 4I3YA 4PETA 4HCWA 4F1VA 5FBPA 2XWVA 4IR8A 1G0IA 1XI6A 4NHBA 1EYKA 2WYPA 2HZKA 1FPKA 1FBHA 4P9KA 1FPJA 5ET5A 4N6KA 1IMCA 1FPBA 1FTAA 4HE1A 4X8RA 1FRPA 2VPOA 4PGNA 4YICA 5DW8A 1KA0A 2F3BA 2HZLA 3KC0A 1RDXA 2FBPA 4MHFA 1D9QA 3SZPA 2XWOA 2FIXA 3LV0A 3W9VA 4PBHA 4GWUA 4H46A 4P8BA 1K9YA 4N6DA 5IGAA 3IFCA 3IFAA 1Q9DA 3PTYA 1NUWA 3MYUA 1RDZA 5IZ3A 5CM6A 2Q74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E78 A;  3E79 A;  3EKI A;  3MYU A; 
#chains in the Genus database with same CATH topology
 3H4Z A;  3MBP A;  4NX1 A;  3KBZ A;  4GWX A;  4KD5 A;  2DE4 A;  4GXS B;  3OEL A;  3A29 A;  4I40 A;  4NAP A;  3TFL A;  2FYI A;  1QVS A;  4ZEI A;  2NOO A;  4NF5 A;  3ROJ A;  1NNP A;  1B52 A;  3B6Q A;  5FHM A;  5ISU A;  4GBV A;  5I7I A;  4F29 A;  2Y7I A;  4GOT A;  1AMF A;  2Y84 A;  1OVB A;  4XKP A;  4P56 A;  5ET8 A;  1OQG A;  3GLB A;  1M5D A;  4R74 A;  2CEX A;  3TDJ A;  1I6Q A;  1ZJL A;  1DOT A;  4EXK A;  1GGG A;  3VLU A;  4Q5T A;  3EHT A;  4PE5 B;  1OIB A;  1SVX B;  1EZP A;  4F3G A;  4KCC A;  3JYR A;  3L6G A;  3FGS A;  3H6V A;  3K1N A;  2XXW A;  2R9J A;  1AIV A;  2X7P A;  4MF3 A;  1MPB A;  4YB5 A;  3FJM A;  4NWD A;  4Q8R A;  3KN3 A;  4NG7 A;  3K0V A;  4MIJ A;  4U1Z A;  1OVT A;  3IK6 B;  2Q8M A;  4GWS A;  3MZB A;  1IIW A;  3TCG A;  4X1B A;  3TEL A;  3O29 A;  5K2X A;  3T9H B;  1MY1 A;  4NF8 B;  5H8N A;  5ICT A;  3CSB A;  3O9P A;  1VSO A;  3W9V A;  3IFC A;  4F3S A;  5CMK A;  1NUW A;  2QS4 A;  3MYU A;  4FEC A;  2CZH A;  2DWH A;  3IJX B;  4MX6 A;  4GL0 A;  4MBP A;  2QL3 A;  3LUZ A;  3OD7 A;  3I3V A;  2YPN A;  3TTK A;  5JTY A;  3IX1 A;  3IOR A;  1IMB A;  3CFL A;  1URS A;  4I1D A;  4O8M A;  2CEY A;  4RPN A;  5DYH A;  2OLB A;  3GBA A;  4G8H A;  1EYJ A;  3UGW A;  1B6H A;  3LC8 A;  3I6V A;  4MCO A;  3N6T A;  4R75 A;  5CMC A;  1GR2 A;  1VDW A;  3KFM A;  5DEX B;  3HHG A;  1XVY A;  1MDP 1;  1DTG A;  4BDQ A;  5J16 A;  3PPN A;  2PVU A;  3MP6 A;  4PDH A;  4AS5 A;  1NV7 A;  3PD9 A;  3C32 A;  3S9M C;  4EDP A;  4DXU A;  1NUX A;  4PCD A;  4GXA A;  4TQU Q;  1BKA A;  1AH5 A;  4RNS A;  4TOZ A;  3TPA A;  2DWA A;  1Y4T A;  3IOV A;  1B7H A;  2VD3 A;  1I6A A;  1I69 A;  2GH9 A;  1H44 A;  1Y3Q A;  2RC8 A;  3E9X A;  3HFU A;  2DVZ A;  4HCW A;  3WAE A;  2M8C A;  4ECF A;  2DYX A;  4Z0I A;  3K6U A;  4YIC A;  4O3A A;  4X8R A;  4O3C A;  3TYH A;  2F3B A;  3FJ7 A;  4H5F A;  1TFA A;  4OFJ A;  3MWB A;  1GVC A;  4MFI A;  3DP4 A;  5FHO A;  3L6H A;  4U1O A;  4Q0C A;  4YAH X;  5AA1 A;  2F5X A;  5H8F A;  4XEQ A;  3V83 A;  1TFD A;  2XX8 A;  4N13 A;  4XXU A;  5ICQ A;  2YJP A;  1LBY A;  2ZZW A;  1PBQ A;  2GHB A;  4DI4 B;  2NVU B;  4F22 A;  4I62 A;  5TP9 B;  4H6D A;  4YU0 A;  5BWJ A;  4M1V A;  2XXV A;  2QS3 A;  1A7L A;  3IOU A;  4DLD A;  3EF7 A;  2KR0 A;  3MJN A;  3TUS A;  2Z22 A;  1B5H A;  3K4U A;  4XF5 A;  3EN3 A;  3C34 A;  3CFZ A;  3VXC A;  2ZYK A;  5I56 B;  1KZ8 A;  1IXH A;  1RYX A;  2F7A A;  4FEB A;  3Q26 A;  1IMF A;  4P3L A;  1IXG A;  2DWI A;  3SEW A;  3O6H A;  3OO7 A;  4IO7 A;  3FXR A;  1RKM A;  5L9O A;  4RY1 A;  2I58 A;  1FQC A;  2WEF A;  2G29 A;  1QUI A;  5FTH A;  1G0I A;  3HHF A;  1FPK A;  4R2B A;  4PGN A;  1KA0 A;  5KCJ B;  1ATG A;  4U2R A;  3PUW E;  5K2Y A;  3A3C A;  3LV0 A;  1N84 A;  1J1N A;  3SET A;  4ZE9 A;  4NF4 A;  3JV9 A;  3D4C A;  1SQY A;  4ELR A;  4PAF A;  1UQW A;  4OXV A;  5AA3 A;  1BLF A;  3KG2 A;  1EZO A;  1WDN A;  5I57 B;  2MKZ A;  3LUY A;  4FAT A;  3OMB A;  4OEN A;  3EPE A;  1OMP A;  4DXC A;  4YB6 A;  3KJT A;  4MLQ A;  1Q35 A;  1FPE A;  2V3Q A;  1NL5 A;  4NF4 B;  4MMP A;  3SER A;  2QJE A;  4WED A;  1LBB A;  1JEV A;  2B3F A;  2QMW A;  4ISU A;  4PC9 A;  1US5 A;  3C33 A;  1B32 A;  4TLL B;  3M3F A;  4QHQ A;  3VV5 A;  3B6W A;  2O84 X;  4HW8 A;  2I4B A;  1FPG A;  1SDX A;  4DCY A;  3FV2 A;  2IEE A;  1DTZ A;  5AA2 B;  2OZZ A;  5I2N B;  2AL5 A;  2Q8J A;  3IL1 B;  3TOD A;  1D4N A;  1MQG A;  2PT1 A;  1LST A;  3W15 C;  1YPN A;  4BDR A;  1BK4 A;  1ZMG A;  1O63 A;  4PFR A;  4LON B;  3MP1 A;  2HAU A;  2ESN A;  1WVJ A;  3C9H A;  3USD A;  5I56 A;  3QAX A;  4GWU A;  4L17 A;  1SYI A;  1SD3 A;  4QSC A;  1EH3 A;  1SW5 A;  1QGX A;  5I84 A;  4N8Y A;  4GWO A;  5HBC A;  2ONS A;  2O51 A;  1NV3 A;  4HXV A;  4PFT A;  5EYH A;  1XC1 A;  1FW0 A;  1S9T A;  4ND9 A;  4JVC A;  2Q9T A;  4O7M A;  2X26 A;  3R7X A;  4H0W A;  3O66 A;  1SW1 A;  3PUV E;  2Z8D A;  1D3K A;  4GX6 A;  1A54 A;  3KBR A;  2V3U A;  4N6P A;  2ZZV A;  5TPA B;  1A55 A;  2WBB A;  4KCD A;  2DVC A;  2XA5 A;  2NXO A;  3KC1 A;  4NTL A;  5ET6 A;  1FQD A;  2JJK A;  3N6U A;  2F36 A;  4OVP A;  1VFD A;  1B40 A;  1VR5 A;  2DDK A;  1Y4C A;  4RXL A;  3VVD A;  5I3S A;  4N4U A;  4R9G A;  2O1M A;  3RPL A;  3RUM A;  2REG A;  3AXF A;  4Q30 B;  3G3G A;  1WOD A;  3GZG A;  4EUO A;  3BIH A;  2B4M A;  1N3X A;  2G93 A;  3E3K A;  1N7X A;  4LUB A;  3TTL A;  2PFZ A;  2XHD A;  4P47 A;  1EYI A;  4H45 A;  3PGF A;  1P1Q A;  4PET A;  2OBG A;  5H8H B;  2F34 A;  1MH3 A;  4IGR A;  5DW8 A;  2VPO A;  2DSF A;  4EXL A;  3K2D A;  1GV8 A;  5I59 B;  4PP0 A;  4HTG A;  4KR5 A;  3U92 A;  4U21 A;  2UVH A;  2AL4 A;  2P0S A;  3H03 A;  1OQH A;  3F11 A;  4MNI A;  3I5O A;  3SEY A;  4IO2 A;  3MZ1 A;  2VOZ A;  3QXM A;  1IXC A;  4IO3 A;  1LAX A;  3GXA A;  5M2V A;  1NUZ A;  2H4I A;  3LSW A;  3ECR A;  1NH7 A;  2NUV A;  3LSF B;  1FBC A;  1LBW A;  2WX9 A;  3FVO A;  1SW4 A;  1FPD A;  2Y7R A;  5I57 A;  1MXV A;  2HXW A;  4OYV A;  1D9Y A;  1KA1 A;  4QF9 A;  1IXI A;  1EZ9 A;  3DM0 A;  5EYF A;  2WKY A;  4ELO A;  2VPN A;  4IY6 A;  4NF8 A;  3VLW A;  4OES A;  4PAK A;  3PUZ E;  1TWY A;  2UXA A;  1P1N A;  4KHZ E;  1Z7M E;  3KN7 A;  4AB6 A;  1BP5 A;  3H06 B;  1B7Z A;  1LB8 A;  3UA8 A;  4DE8 A;  1FQB A;  1TT1 A;  4PGP A;  1B1H A;  1M5E A;  1B4Z A;  1LAF E;  2XXT A;  4EF2 A;  3KOS A;  4ZEK A;  1F9B A;  1LEV A;  4UA8 A;  1OLC A;  3PMV A;  1B3F A;  3PD8 A;  1AOV A;  4NF0 A;  2PYY A;  4XKR A;  4F1V A;  3D4G A;  4ZS9 A;  4H8J A;  3CSG A;  1B0L A;  1FPJ A;  1QKB A;  4HE1 A;  3P7I A;  5ITO A;  4MHF A;  5IKB A;  4K3F A;  4YKP A;  4BDM A;  2PBW A;  5H8S A;  1Q9D A;  3PPQ A;  3VVF A;  5IZ3 A;  5CM6 A;  3OSR A;  2Q74 A;  1CB6 A;  1N04 A;  4IO5 A;  3HO7 A;  4MLV A;  3RGY A;  3DP6 A;  1N7W A;  1YZ0 A;  3T96 B;  4N07 A;  1FBG A;  1R6Z A;  3MAM A;  1Y1M A;  2O69 A;  2CZI A;  1BIY A;  3RPW A;  3RQT A;  1IIT A;  3FZV A;  4QRZ A;  4GWY A;  1K9Z A;  3KEI A;  2ZNT A;  1MQD A;  2H98 A;  2ANJ A;  1LFG A;  1B51 A;  3BFU A;  3PUX E;  1QUK A;  1NV6 A;  3M3K A;  3ONM A;  5I58 A;  4Z7E A;  3KN8 A;  3DP8 A;  1XHY A;  2ONK E;  4ZZA A;  1UIV A;  2HAV A;  1MQJ A;  1PB9 A;  3RYD A;  4DIG A;  2RIN A;  4ZEF A;  2BJJ X;  5FHN A;  5EHS A;  1USY E;  4MH5 A;  1URD A;  1Q1K A;  3RY3 A;  4OEU A;  4BDN A;  4NF6 A;  4DZ1 A;  3CFX A;  3IJO B;  4RYA A;  2ZMB A;  1G0H A;  4QSD A;  3D1R A;  5DTB A;  1LFI A;  5A5X A;  4TLM B;  3A09 A;  1VE4 A;  4P9K A;  3N26 A;  1LCT A;  1NMU A;  1HSE A;  1II5 A;  2I0C A;  1MM7 A;  5EHM A;  3TCF A;  1USY H;  5LDZ A;  2NWJ A;  4KYD A;  2UVI A;  4H1X A;  4ZZE A;  4MAG A;  3MZ9 A;  2ABH A;  1I6B A;  2Y5K A;  4G8M A;  1D9V A;  3VVE A;  4AS4 A;  3U94 A;  4RK9 A;  5KCJ A;  5I2N A;  3HN0 A;  2GFE A;  4R6K A;  5CRY A;  1JVY A;  5I5P A;  4JXI A;  4P0G A;  5I2K A;  2OWS A;  4IO4 A;  3FAS A;  1AL3 A;  4HCY A;  2YLN A;  4PDD A;  4FOR A;  1S7Y A;  1YTV A;  4ESW A;  4MNP A;  3H7M A;  4FJP A;  3C36 A;  3MST A;  1MQH A;  3PMX A;  3TQL A;  4LQ2 A;  1SW2 A;  1P1W A;  2E0S A;  1NI9 A;  2DS9 A;  5FTI A;  3JZJ A;  3OO9 A;  4DXB A;  4NQ8 A;  3MPL A;  3FAT A;  1HSJ A;  1FTJ A;  4QFP A;  4NGU A;  3QUF A;  4X1D A;  3C35 A;  2DP8 A;  4R72 A;  5H8Q B;  4X04 A;  1NKX A;  3B8B A;  4KI0 E;  1B1X A;  5CBS A;  2QVU A;  3T9U A;  5DT6 A;  1M5B A;  3S9N C;  3W9W A;  2HHM A;  3RNN A;  4LVQ A;  1B05 A;  2AIX A;  1ZKB A;  4IY5 A;  1IMC A;  3T9X B;  4E0X A;  1SI0 A;  5LOM A;  1RDX A;  1RYO A;  1FTK A;  2FIX A;  2XWO A;  2THI A;  4P8B A;  1K9Y A;  3PTY A;  1RDZ A;  2HEU A;  4JDF A;  3KZG A;  1LGB C;  4ZEC A;  4PFW A;  3WAF A;  2L5V A;  2PX1 A;  4GX3 A;  5H8F B;  2QVR A;  2Q89 A;  5IM2 A;  4U4S A;  3KOT A;  3T9V A;  4F2O A;  3VDF A;  2FVZ A;  3DLN A;  2FA7 A;  3O28 A;  4P0I A;  1NV2 A;  2I4C A;  5TP9 A;  2F6P A;  3MC2 A;  4OVQ A;  3S2V A;  5BUU A;  3CIJ A;  4YMB A;  1B5J A;  3O6G A;  2F97 A;  2HQ0 A;  1LLS A;  4RA1 A;  2FIE A;  4O7I A;  5B70 A;  4OEV A;  5AA4 B;  2QFL A;  4JB7 A;  1L5T A;  3BKI B;  3U72 A;  2QRY A;  4YKK A;  2WBD A;  1JVX A;  3IOT A;  4ZED A;  3TTM A;  4F39 A;  4PFU A;  1NV4 A;  3QSL A;  2RKM A;  2OK2 A;  5KZT A;  1MRP A;  1NNT A;  3QMF A;  3SKP A;  1H45 A;  2OWZ A;  3PUY E;  2B65 A;  1B3L A;  4KYE A;  3SDF A;  3IAZ A;  3MVW A;  3K6W A;  1Y9U A;  3Q28 A;  3FVN A;  2HZK A;  1FBH A;  1OLA A;  1FTA A;  3G3F A;  4QFK A;  3KC0 A;  4JWO A;  4N6D A;  1B2H A;  2W7Y A;  3OXN A;  2HFB A;  4GX4 A;  1O7T A;  4BLA A;  3N5L A;  1NH8 A;  1LBC A;  1N0T A;  3RLF E;  2XX7 A;  2B3B A;  4H8I A;  1NV5 A;  2B4L A;  4XKQ A;  1KWH A;  2VGQ A;  4BDL A;  4NN3 A;  4JWX A;  5JK4 A;  4GF8 A;  2XXQ A;  4WXJ A;  4DI3 D;  4PTK A;  3T0J A;  4ELP A;  2V3T A;  1LBZ A;  2XXI A;  1IQ7 A;  4JSO A;  3PV0 E;  3Q27 A;  4QSE A;  3S4U A;  1QUJ A;  1S50 A;  4PF8 A;  4JSD A;  1FTO A;  4UAB A;  4PQJ A;  1B9J A;  1MXZ A;  2R6G E;  3O6I A;  3IO4 A;  2DE2 A;  1RDY A;  1DCU A;  3CHG A;  2XXH A;  4OMB A;  3TTR A;  3FJG A;  1A99 A;  3CG1 A;  2Z23 A;  3TMG A;  1IEJ A;  3UK4 A;  1H43 A;  4N15 A;  2DQV A;  2BJI A;  3EQ1 A;  3K02 A;  4H5G A;  3ZSF A;  1NFT A;  5T3J A;  1B3H A;  1P1O A;  2RF1 A;  2F6G A;  3PPR A;  4PFY A;  4OFL A;  5KDT B;  5JEI A;  1BTJ A;  2GRV A;  3SES A;  2Y7P A;  4F1U A;  3OEK A;  1ZTY A;  2X7Q A;  5ET7 A;  2V4C A;  4F3B A;  3E4R A;  3ILT B;  2XXY A;  1FPI A;  1FBD A;  1XS5 A;  1FPL A;  5CMM A;  3S9E A;  5EYG A;  1FBE A;  1T0K A;  5DVI A;  4JVD A;  2ZXT A;  1MXU A;  1QW0 A;  2F7B A;  4X9T A;  1JW5 A;  3SEU A;  2QS1 A;  3K6X A;  4G4P A;  2O68 A;  2XX9 A;  5TPA A;  3T22 A;  4I3E A;  2PCR A;  3TEP A;  4O94 A;  2CZK A;  2OWT A;  1YCJ A;  4X48 A;  4XTC Q;  1JEU A;  3E79 A;  3CR9 A;  1R1N A;  1DK4 A;  3RPL B;  4ZE8 A;  1SPI A;  2P1S A;  2O6A A;  4KQP A;  1R9L A;  3N94 A;  1IME A;  4QBA A;  2F8D A;  4G2Z A;  3UIF A;  1P1U A;  3QUJ A;  4RK2 A;  4XIG Q;  2I49 A;  1PB7 A;  3KSX A;  4G68 A;  4QFO A;  3BBR A;  1XI6 A;  4NHB A;  5AE4 A;  1EYK A;  2O7U A;  4N6K A;  1B3E A;  2XXX A;  3OOA A;  4H65 A;  4XKN A;  4LA9 A;  3SZP A;  4GL8 A;  3MVX A;  5IGA A;  3ILU B;  2CZL A;  3G3J A;  5L8D A;  4ESX A;  3OEM A;  2WYP A;  5A5L A;  5I59 A;  4G8N A;  4EQ7 A;  3KGC A;  2V25 A;  4C1U A;  3SEX A;  3V89 B;  4EQ9 A;  1Y1Z A;  4AQ4 A;  3FV1 A;  4I9D A;  4F2Q A;  3R6U A;  4OA4 A;  1QKA A;  1B0H A;  3O2A A;  4IGT A;  2XD3 A;  4KXP A;  4C0R A;  1YXI A;  5KDT A;  5L9S A;  4R6Y A;  4IB2 A;  4OFO A;  2HCA A;  4OZ9 A;  2ALU A;  3MVZ A;  3GYY A;  1AWB A;  3ZS6 A;  2R8T A;  4YZZ A;  2GQ1 A;  1NNF A;  1HSL A;  1N76 A;  5H8Q A;  2P3V A;  4HE0 A;  3PMW A;  4O3B A;  2V93 A;  3H6U A;  5ELV A;  1N3W A;  4ELQ A;  1FBP A;  1MY2 A;  4JWY A;  1CNQ A;  4F1Y A;  2P3N A;  3LSL A;  2XXP A;  1PC3 A;  2F3D A;  3T66 A;  3TKD A;  4G77 A;  4N81 A;  4GBW A;  4ONY A;  3VLV A;  4POW A;  3T93 B;  3VE1 B;  4PFI A;  3FD3 A;  3ISP A;  4LZ8 A;  3QYT A;  3Q25 A;  1A40 A;  4N91 A;  4NWC A;  1MS7 A;  1URG A;  2I3V A;  1Y20 A;  3K00 A;  4EQB A;  1MH4 A;  1LB9 A;  2H5Y A;  5F1Q A;  2Y7W A;  5IZ1 A;  2QMX A;  2VP1 A;  2A5T A;  2DOJ A;  1FRP A;  1FQE A;  3FXU A;  2Z8F A;  1XT8 A;  2XXR A;  3B7D A;  4GRK A;  4ZEB A;  3UOR A;  3K01 A;  3LR1 A;  4DCX A;  2Y7K A;  3IOW A;  1JQF A;  1FBF A;  4U22 A;  5CI5 A;  1MXY A;  2ZYM A;  3HPI A;  1H3D A;  3FBP A;  3MP8 A;  2ZNU A;  2O7I A;  4GLI A;  1O64 A;  1SBP A;  1DMB A;  3FXB A;  3M8U A;  1ZIU A;  3KJ7 A;  2FNC A;  2GHA A;  4EF1 A;  3V5A A;  1ZLQ A;  3VXB A;  2E1S A;  1NNK A;  2DXR A;  4PAI A;  1MM6 A;  2Y5L A;  2REJ A;  4E0W A;  3RTF B;  5DVJ A;  4NF5 B;  5H8N B;  3U1O A;  3O97 A;  2WYK A;  1JET A;  4POX A;  3HST A;  5F7V A;  1H76 A;  1PBP A;  1US4 A;  1B7U A;  2D5W A;  4YB7 A;  1FSA A;  3K1P A;  3K6V A;  5F24 A;  4PF6 A;  2ONR A;  3TAJ A;  5DVF A;  2H99 A;  3FXQ A;  5CC2 A;  4R6H A;  1GTK A;  4R73 A;  1JNF A;  4NMY A;  4XFE A;  4JBZ A;  5AA4 A;  2PFY A;  3U65 A;  4GWW A;  2HXR A;  3MUQ A;  4PBQ A;  4P1E A;  3EKI A;  4R9F A;  1UTB B;  2D21 A;  3SEV A;  1LAG E;  2Q2A A;  3BIG A;  1IMD A;  3G3H A;  3IB2 A;  3S9L C;  5L9M A;  2ZNS A;  1XOC A;  4IR8 A;  5A5X B;  3G7W A;  3OO6 A;  1UTH A;  1FCK A;  2F7C A;  2XD2 A;  3Q29 A;  2I6E A;  3TCH A;  1LAH E;  3A3U A;  5TU0 A;  2KLF A;  4OTE A;  2DXY A;  1JP4 A;  1IZ1 A;  2UVJ A;  2PT2 A;  1DBZ A;  1NUY A;  4WKM A;  2PMS A;  2QVV A;  2V84 A;  3RT8 A;  3GBB A;  1UTH B;  1LCF A;  5DEX A;  2KQZ A;  4R2F A;  3OEN A;  1FJ9 A;  2CMO A;  2RC9 A;  3THI A;  1FQF A;  1LBV A;  4MNC A;  5EQ9 A;  4JVI A;  3B6T A;  3DEL B;  3BFT A;  4FIM A;  5B7D A;  3FUZ A;  4HE2 A;  5EQ8 A;  4LZ7 A;  3C31 A;  2D3I A;  3FIR A;  4MEV A;  1MY4 A;  4NE4 A;  2AYS A;  1A8E A;  5ESY A;  5CBR A;  1YYZ A;  4LN5 A;  3G3I A;  5J1D A;  1DSN A;  1LFH A;  5IAI A;  4ZDM A;  1M5F A;  2P2A A;  1VFE A;  2H9B A;  4AB5 A;  1PDA A;  4OVS A;  4GFR A;  3EHS A;  5JTY B;  1MPD A;  2UVG A;  4FBP A;  3OO8 A;  1QUL A;  1MY3 A;  4FED A;  1FJ6 A;  2OX3 A;  1DPE A;  5IZ3 B;  3ZKL A;  4DDD A;  1FTL A;  3LSX A;  2H25 A;  4KYS A;  2RCB A;  2Q88 A;  5FBP A;  2XWV A;  5ET5 A;  3PPO A;  2HZL A;  1B5I A;  1D9Q A;  3ZKK A;  1DPP A;  3R26 A;  3V8X B;  4PBH A;  1SYH A;  3H3G A;  1ELJ A;  3FVK A;  4QFN A;  4QFL A;  4F3P A;  2I0B A;  3MQ9 A;  2ZYN A;  4MJO A;  2HPG A;  2ZYO A;  3CRB A;  5AA2 D;  4LP2 B;  5HPQ A;  2UYF A;  2VT5 A;  1Z7N E;  4FE8 A;  4RPO A;  4F19 A;  2DE3 A;  2ZZX A;  1POY 1;  4NED A;  1B58 A;  3K1M A;  3T1B A;  4KPT A;  2QPQ A;  4F18 A;  3RTW B;  1MY0 A;  4RJZ A;  3MVY A;  3QK6 A;  1FQA A;  2UYE A;  4KFQ A;  3FVG A;  4U23 A;  2I48 A;  2RCA A;  3QIM A;  2Z8E A;  3C4M A;  1IMA A;  1SI1 A;  1B46 A;  4LAT A;  4N17 A;  4OVT A;  3CG3 A;  1PB8 A;  3MPK A;  2Q2C A;  2QSX A;  3LBS A;  4I8C A;  4N8G A;  3UN6 A;  4GIZ A;  1MDQ A;  3IR1 A;  1YAE A;  2F35 A;  2R71 A;  1INP A;  1ANF A;  2DWJ A;  2F78 A;  1R9Q A;  3IB0 A;  5CMB A;  4YKJ A;  4C1T A;  1UIU A;  5I58 B;  4IO6 A;  4U4X A;  2XXK A;  3IO6 A;  4PFB A;  1FTM A;  4THI A;  1NV0 A;  5HM4 B;  1UTB A;  1EU8 A;  4H67 A;  3OSQ A;  1FPF A;  3B50 A;  4OVJ A;  5EQ7 A;  3ODB A;  4OQO A;  4M4G A;  1FPB A;  4BDO A;  1TXF A;  5H8H A;  3VFJ A;  4UAC A;  1JW1 A;  4H46 A;  1B3G A;  1M5C A;  3IFA A;  4OWD A;  4F31 B;  1XVX A;  3NOH A;  1B4H A;  1NV1 A;  4OHN A;  3MW0 A;  2FHY A;  1QJM A;  4LQ5 A;  4FAJ A;  1IUD A;  4OVR A;  3TZA A;  4PE3 A;  3H6W A;  1ZBM A;  4OAN A;  4OET A;  1ZU0 A;  2XXU A;  2VD2 A;  4GWZ A;  4YMA A;  1MG1 A;  4YKI A;  1A8F A;  1LBX A;  4G68 B;  4P1L A;  2A5T B;  4P11 A;  3CI8 A;  3TQW A;  5EQA A;  2QS2 A;  3U8Q A;  1Y3N A;  4LZ5 A;  4HS7 A;  5IZZ A;  3E13 X;  4GD5 A;  2IA4 A;  3RT6 B;  5I2K B;  3G3K A;  1POT A;  3UP9 A;  1Y3P A;  4G68 C;  3IB1 A;  1PEB A;  5ITP A;  3M3L A;  3E78 A;  3HV1 A;  5LTC A;  1MXX A;  4G61 A;  3TTN A;  3RN8 A;  2XWK A;  4QXD A;  1MQI A;  3HCQ A;  4OER A;  2XWI A;  3H6T A;  3PPP A;  3PU5 A;  3CVG A;  2VHA A;  4I3Y A;  1JW4 A;  1MXW A;  2RC7 A;  3U93 A;  5AA2 A;  3EHU A;  2A5S A;  2O1L A;  2FBP A;  4WEP A;  2OCU A;  3KSJ A;  2I3W A;  4GQO A;  1P99 A;  4NF6 B;  2LAO A;  1MPC A;  4GVO A;  1CE2 A;  2OJT A; 
#chains in the Genus database with same CATH homology
 5A5L A;  5LDZ A;  4NX1 A;  3KBZ A;  4GWX A;  4GX4 A;  4F1U A;  2CZH A;  2L5V A;  1QGX A;  4GX3 A;  2DE4 A;  4MAG A;  4MNI A;  3NOH A;  1NV1 A;  2QVR A;  1JP4 A;  2Y5K A;  4PAF A;  5ET7 A;  1FBF A;  2V4C A;  4MX6 A;  3A29 A;  4N8Y A;  5IM2 A;  4AS4 A;  4I40 A;  4NAP A;  3LUZ A;  2FHY A;  2F5X A;  4MJO A;  2HPG A;  3FBP A;  1NV3 A;  4XEQ A;  4HXV A;  1YZ0 A;  3ROJ A;  2FVZ A;  4OA4 A;  1IMB A;  5EYH A;  1FBG A;  1NUZ A;  4OVR A;  1DBZ A;  4GBV A;  1NUY A;  1FPI A;  1FBD A;  1NV5 A;  2MKZ A;  2QVV A;  4PE3 A;  2B4L A;  2VT5 A;  5I7I A;  2CZI A;  1FBC A;  1LBW A;  2WX9 A;  4JVC A;  1FPL A;  1NV2 A;  2Q9T A;  2KQZ A;  3FXB A;  4O7M A;  1FPD A;  1FJ9 A;  1LBY A;  2DE3 A;  2ZZW A;  2ZZX A;  4OAN A;  4F19 A;  4DI4 B;  5I5P A;  5EYG A;  3T1B A;  4NN3 A;  1FBE A;  1FPE A;  2V3Q A;  4KXP A;  4OVQ A;  2QPQ A;  4GWY A;  1LBV A;  4MMP A;  5JK4 A;  4F18 A;  4MNC A;  5EQ9 A;  1K9Z A;  1YXI A;  4GWZ A;  4O8M A;  4JVD A;  4JVI A;  4HCY A;  2CEY A;  4DI3 D;  4GX6 A;  1KA1 A;  4P56 A;  5ET8 A;  4PDD A;  4PTK A;  4PAI A;  3T0J A;  1EYJ A;  1LBZ A;  4X9T A;  1LBX A;  4P1L A;  4HE2 A;  2Y5L A;  3GYY A;  4MNP A;  1NV6 A;  1AWB A;  4PC9 A;  5EQ8 A;  2ZZV A;  4M1V A;  2WBB A;  2XA5 A;  2CEX A;  3MST A;  2R8T A;  2VPN A;  4MEV A;  1IMA A;  3KC1 A;  4MCO A;  5EQA A;  2FIE A;  2WYK A;  2GQ1 A;  4O7I A;  4PAK A;  2JJK A;  4YZZ A;  5ET6 A;  4OVP A;  4I3E A;  4N17 A;  1VDW A;  2P3V A;  2QFL A;  4OVT A;  4HE0 A;  5ESY A;  2DDK A;  2PCR A;  5IZZ A;  2KR0 A;  1NI9 A;  1YYZ A;  4O94 A;  4PF8 A;  2CZK A;  4LN5 A;  4N8G A;  5J1D A;  5J16 A;  1FBP A;  5I3S A;  4N4U A;  4NQ8 A;  1CNQ A;  4PDH A;  4XF5 A;  3RYD A;  3E78 A;  3RPL A;  4NGU A;  2P3N A;  1NV7 A;  4UAB A;  4AS5 A;  3E79 A;  2F3D A;  2WBD A;  1FSA A;  1INP A;  1FPG A;  4PF6 A;  1NUX A;  4N81 A;  1DK4 A;  4PCD A;  4GBW A;  5F24 A;  3RPL B;  5LTC A;  2DE2 A;  1RDY A;  1DCU A;  4PGP A;  1KZ8 A;  3CHG A;  4G61 A;  4OVS A;  1NV4 A;  4PFI A;  2XWK A;  3ISP A;  4QXD A;  1SPI A;  4XFE A;  1IMF A;  3BIH A;  4FBP A;  2B4M A;  2XXK A;  4P3L A;  3QMF A;  2XWI A;  4N91 A;  2PFY A;  4X04 A;  2OWZ A;  4PFB A;  1LEV A;  1FJ6 A;  3B8B A;  4NG7 A;  1IME A;  2OX3 A;  3U65 A;  1NV0 A;  2HXR A;  4GWW A;  4N15 A;  4MIJ A;  4QBA A;  2QVU A;  4PBQ A;  1G0H A;  2PFZ A;  2Q8M A;  4P1E A;  5IZ3 B;  4GWS A;  3EKI A;  3D1R A;  2BJI A;  1FPF A;  3B50 A;  2HHM A;  3W9W A;  4P47 A;  1BK4 A;  3BIG A;  1IMD A;  4NF0 A;  5EQ7 A;  1EYI A;  2WEF A;  4H45 A;  5IZ1 A;  3HFU A;  4PFR A;  2DVZ A;  5T3J A;  4I3Y A;  4PET A;  4HCW A;  4F1V A;  5FBP A;  2XWV A;  4IR8 A;  1G0I A;  1XI6 A;  4NHB A;  1EYK A;  2WYP A;  2HZK A;  1FPK A;  1FBH A;  4P9K A;  1FPJ A;  5ET5 A;  4N6K A;  1IMC A;  1FPB A;  1FTA A;  4HE1 A;  4X8R A;  1FRP A;  2VPO A;  4PGN A;  4YIC A;  5DW8 A;  1KA0 A;  2F3B A;  2HZL A;  3KC0 A;  1RDX A;  2FBP A;  4MHF A;  1D9Q A;  3SZP A;  2XWO A;  2FIX A;  3LV0 A;  3W9V A;  4PBH A;  4GWU A;  4H46 A;  4P8B A;  1K9Y A;  4N6D A;  5IGA A;  3IFC A;  3IFA A;  1Q9D A;  3PTY A;  1NUW A;  3MYU A;  1RDZ A;  5IZ3 A;  5CM6 A;  2Q74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...