3MYUA

Mycoplasma genitalium mg289
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
336
structure length
333
Chain Sequence
NTLIFNISLDHNADTSIEKFFTVFSKKLSGKLNKKINVNFNIVDDSFTKINNIQANKADFAFVNSQAIASNNWFGYTPLIQTLTTAFKEDLELDYYEDGNLQKKAEKTNLLFLSPPYKEWDDIKQKWTGNRYDFLYEPSKLVSFYRSMILITGSASEITAIKKAWNEKNWNQFMKFGIGHGQTNSASRFELPDLLFRKHFAKNYPGLQNAINSDPDKFAVVRGREIGINKNIKIVFDDANSFSWTQNIKRPFYTPIDPNDRLEILTYSDPLLYDIGIVSNNLSRIYQKAIGEIFIELAQSSEDLYGPSIGYNGYKMINDFEKEVVEIIEKTYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords High affinity transport system protein p37
publication title Insights into Mycoplasma genitalium metabolism revealed by the structure of MG289, an extracytoplasmic thiamine binding lipoprotein.
pubmed doi rcsb
source organism Mycoplasma genitalium
molecule tags Vib binding protein
total genus 117
structure length 333
sequence length 336
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06646 Mycoplasma_p37 High affinity transport system protein p37
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.180 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3myuA01
3.40.190.190 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3myuA02
3MYUA 3E78A 3E79A 3EKIA
chains in the Genus database with same CATH superfamily
1N7XA 3IR1A 5TPAA 4ZZAA 3IAZA 3T9XB 2GRVA 3UN6A 5A5LA 4FEDA 2P3VA 4O7IA 3G3FA 4KCDA 3SERA 3U65A 2E1SA 1LEVA 5FHNA 3U92A 4LA9A 2X7QA 3H6UA 4ZDMA 3ROJA 3TELA 1FPBA 2X26A 3BIHA 4DI3D 5I84A 2DWJA 3V5AA 1MG1A 4HTGA 2ZYOA 3IO4A 3H3GA 4I3EA 2Z23A 2O1LA 3TFLA 1FTAA 1URSA 4PAKA 3RGYA 4PDDA 4JVCA 3C32A 3S9LC 4NF4B 2F34A 4TLLB 3TTKA 4LQ5A 3M3LA 3G3JA 3CFZA 4GLIA 5HM4B 1FPEA 2Z8FA 2I4BA 5LDZA 3C4MA 1FBPA 1HSLA 3SEXA 2ABHA 1Q35A 4KD5A 1ZMGA 4IO7A 1NV3A 1MXVA 4RNSA 3USDA 1N3WA 1P1NA 2Y7WA 4QHQA 1QW0A 4KR5A 1S9TA 2DP8A 5K2YA 4F1YA 2RC9A 1ZLQA 1O64A 3PUVE 2O51A 5I7IA 2Y5KA 3MZ9A 3MVXA 2V93A 5H8NA 3K6VA 2UYEA 4IY5A 3DP8A 3FV2A 3K1NA 3FJGA 4G61A 4GWUA 5DW8A 1POY1 5IZ3A 4LONB 2DS9A 2R71A 5L9SA 4PE5B 3MP8A 1A40A 3N6TA 5AE4A 3MWBA 3NOHA 2FBPA 1LB8A 1NUXA 3B8BA 1YXIA 3Q25A 2DWAA 1XC1A 3S9EA 3MAMA 1FW0A 1WVJA 2AL4A 3KC0A 1BKAA 5I5PA 1KWHA 4IO2A 2NWJA 2WBDA 4NF8B 4OTEA 1R9LA 3RLFE 4GRKA 3VV5A 2QPQA 1LBCA 4GX4A 4QFLA 4NF6B 3G3GA 4N13A 1DBZA 2DXRA 3TODA 2OWZA 2L5VA 1TWYA 3G7WA 3LC8A 2WEFA 4GX3A 3ONMA 4LP2B 5DEXB 3IX1A 5EQ9A 4O3BA 1JW1A 4MNPA 2V25A 1KA1A 2ANJA 4YMAA 3CVGA 3MP1A 3BFTA 4YZZA 4I40A 3OELA 4QSEA 4HS7A 1MY2A 1FQDA 3TEPA 2B65A 4R6KA 1BTJA 1L5TA 4ESXA 3PMVA 3MC2A 2HXWA 3EQ1A 1A54A 3DELB 4N6KA 1P1OA 5DVIA 4P3LA 2R8TA 2I3WA 5BUUA 3ILTB 2GHBA 5TPAB 4P0GA 3A29A 3K1MA 5AA3A 2F78A 3OXNA 3PUWE 4EQ7A 1FQAA 1AH5A 4OYVA 4FBPA 2VP1A 1Y4CA 4XXUA 4GOTA 4U23A 1B5JA 1B3LA 4QFOA 3UIFA 4OETA 4E0WA 1NV7A 2QMXA 4DXBA 1US4A 3IOVA 3PGFA 3SZPA 1QKBA 4NHBA 1IXGA 3QMFA 4Z7EA 3OSRA 2RCBA 3VVDA 4IR8A 1DMBA 1NV5A 1QUJA 4UACA 4GWXA 4JVIA 1BK4A 2V3UA 5KZTA 1FTOA 2G93A 5ET8A 1EZOA 3VLWA 3JZJA 3BFUA 3PPQA 4FATA 4C1UA 1MY1A 5EHMA 5AA2A 4DI4B 2H25A 3TTRA 5H8NB 5F1QA 2YJPA 2REJA 4POWA 1B51A 1NV1A 4JSDA 3N94A 4P11A 3OO6A 2DVCA 1JQFA 2ONRA 3PUXE 4HW8A 1LFHA 3FJMA 1MM7A 3E79A 2Q2AA 4PTKA 4ELOA 1LSTA 4PFIA 1USYH 1NKXA 3FXUA 5ICTA 2OWSA 1NNTA 2ONKE 3KSJA 1B40A 5I2NB 1IMCA 2FIEA 1LB9A 2PMSA 3PU5A 3Q26A 5I2KA 1EU8A 3SEVA 3EHSA 5J16A 1MPBA 4OFJA 2XXKA 4YB7A 3EKIA 4OWDA 3IFCA 2OJTA 4MNIA 2IEEA 5JTYA 1S50A 4JWYA 4ZZEA 3TKDA 4G4PA 4JWOA 4PFTA 4F19A 1LAFE 1I6AA 2Q88A 4R9GA 1MQGA 4WEPA 3KBZA 4EDPA 4Q8RA 2V3TA 4OXVA 3PD8A 4MF3A 5T3JA 2RF1A 4U21A 2VGQA 1DPPA 3UP9A 3ISPA 3PUZE 3CFXA 5HBCA 2F6PA 4X1DA 2VT5A 2PX1A 4U1OA 5L9MA 1DTZA 1H45A 4H5FA 1EYIA 4QSDA 3FIRA 1N04A 1YAEA 5EQAA 2HEUA 1ANFA 4X48A 2HFBA 1A99A 4N6DA 2I58A 1P1UA 1IMBA 3TPAA 3TZAA 5J1DA 3K2DA 4R2FA 4NGUA 4F3PA 3JV9A 2AIXA 3LSWA 4RYAA 3VVFA 1TFAA 2A5TB 1VFDA 1MPDA 4R6HA 3T1BA 2F35A 4XFEA 1AOVA 1ZJLA 2Y7RA 2PCRA 2HAUA 4LZ8A 1PBQA 3A3UA 5B70A 4N8YA 4YU0A 4YB6A 3UGWA 4ELQA 1IUDA 1MS7A 3GXAA 3N5LA 1MQIA 1M5DA 1B7HA 2Q8MA 4ELPA 3MSTA 3GBBA 5H8SA 3SETA 4TOZA 1NI9A 3TCHA 4LUBA 4YAHX 1VFEA 5JK4A 2ZNUA 3UK4A 4FE8A 5EQ8A 1FPDA 5AA2B 4DIGA 3OEMA 4ZEDA 4ND9A 2KLFA 1MXXA 1NV2A 4TLMB 1IMAA 4PETA 4F22A 4N15A 2ZYKA 5ISUA 3G3HA 3KC1A 3CR9A 4MIJA 3MPKA 3K0VA 3EN3A 3RY3A 3T66A 3IOTA 3QSLA 4I3YA 1LCTA 1ZBMA 3C31A 4R74A 3TAJA 1LLSA 1R6ZA 1D9QA 1Y20A 5BWJA 3O2AA 3R6UA 3KN3A 1IQ7A 1HSEA 1Y3PA 4NQ8A 5I2KB 3RT8A 2D3IA 3F11A 3E13X 4GXAA 5I58A 3VLUA 3OD7A 1USYE 2FIXA 2JJKA 1IXCA 1LCFA 5KDTB 2B3FA 1RYXA 3HN0A 4ZECA 4IY6A 2OZZA 1PB9A 3PPNA 3IORA 2FNCA 4NN3A 5JTYB 2UXAA 1BLFA 1NNFA 4OEUA 3R26A 4QFKA 2UVJA 3TQLA 3O29A 4MHFA 4PGNA 4F3GA 1Y1ZA 2DYXA 1N3XA 3BBRA 2XXVA 4U4SA 3SEWA 2XWVA 3MYUA 1OQGA 1D9YA 1H43A 4RY1A 1BP5A 4H0WA 4YKPA 4P56A 1DOTA 1FTMA 3VXCA 3TUSA 1AIVA 4OENA 3FVNA 3UORA 1MH3A 3KFMA 3V83A 4HCWA 1FJ6A 4OESA 5CMCA 3EHTA 5IAIA 1FTLA 1OLCA 4HE2A 4EUOA 4PFRA 4F2OA 1IXHA 4U1ZA 1FPFA 4ONYA 5FHMA 4NEDA 1Y9UA 1JW4A 1G0HA 2CMOA 2I3VA 2QS3A 2XWKA 2F97A 5I57A 1B52A 1SVXB 1FBHA 2O1MA 4X04A 1B9JA 1PEBA 1NUWA 2REGA 2UVIA 4OA4A 4GL0A 4MCOA 3GLBA 4YKIA 1FBFA 2GH9A 1SQYA 1IEJA 5KCJA 3IJXB 1URGA 2ZMBA 4ISUA 3CFLA 1DK4A 4XKRA 4PCDA 3UA8A 4NTLA 4PAFA 3HSTA 3TQWA 5I56A 2PT1A 3PV0E 5ET6A 4GQOA 3PPOA 4C1TA 4RK9A 1AWBA 2W7YA 3D1RA 1ATGA 2XD2A 3K6XA 1US5A 4EF2A 2HQ0A 5TP9B 4NAPA 5L9OA 1SD3A 2HPGA 1FRPA 4GD5A 3S9NC 3TDJA 5ICQA 2V84A 4AB5A 5K2XA 4JSOA 1IITA 4XIGQ 1LFGA 3LSFB 4GWOA 4PP0A 3L6HA 2F7AA 2V3QA 2O7UA 2D21A 3E4RA 2DQVA 4XTCQ 3RT6B 1FPIA 4RPOA 5H8QA 3H6WA 3H4ZA 4H46A 4XKPA 3H6VA 1FQBA 3TCFA 4LVQA 4ZEFA 1JNFA 1FJ9A 3LUYA 4OMBA 4DCXA 1LAHE 4XKQA 2LAOA 5DTBA 4R6YA 4N91A 4BDOA 3WAEA 3FGSA 3K02A 3FATA 5I59A 2RC7A 4OERA 3O28A 4IB2A 4H45A 2F6GA 3RTWB 5M2VA 3FVKA 5CBSA 3CG1A 2WYPA 3O66A 5I58B 4MNCA 1XHYA 1UIUA 3ILUB 1SW4A 5AA2D 3FXRA 4O3AA 3IL1B 3U94A 3AXFA 3FBPA 4X1BA 4U2RA 3S2VA 1JEUA 3T9VA 1FBDA 3A3CA 1OVBA 2GFEA 4GXSB 3EF7A 3MJNA 4PBQA 1MQDA 1JETA 5CC2A 1NH8A 5CMKA 1NNPA 3A09A 1OQHA 1LBVA 2Y84A 1B6HA 4ZS9A 4O8MA 3V8XB 4BDRA 4AS5A 3O9PA 4G68A 2THIA 2HZKA 1RYOA 2UYFA 3BKIB 2DOJA 2Z8DA 4N17A 2F5XA 1NV0A 3QXMA 1GR2A 1IZ1A 1NUYA 1EYKA 2QVVA 2PVUA 1XVXA 2QS2A 3C34A 3TMGA 2H99A 2Y7PA 5I57B 1K9ZA 4WEDA 2AYSA 4BDQA 3LSLA 3IB1A 3QUFA 2MKZA 4N8GA 4XEQA 1HSJA 4X9TA 3KN7A 2NXOA 2M8CA 1B5HA 2CZIA 2PYYA 1N7WA 1QUKA 5EYFA 1SDXA 4ZE9A 1UIVA 1PDAA 4DLDA 3FV1A 4X8RA 3RUMA 5I56B 1OLAA 1CNQA 5ESYA 2XXHA 3TTMA 3HHFA 3IJOB 2I4CA 5IZ3B 4O7MA 4MBPA 2P1SA 3B6WA 4H6DA 2HAVA 5ELVA 5LTCA 4PC9A 2ZZWA 5HPQA 2OLBA 1LBXA 3K01A 1MXWA 3LV0A 4IO6A 4F3BA 2B4LA 3DLNA 4ZEIA 3N26A 1MM6A 1SW2A 4JWXA 3B6QA 4FEBA 1TFDA 3HPIA 2H9BA 1B2HA 4Q30B 3W15C 4ZEBA 4M4GA 2XXTA 4LQ2A 3Q29A 3DP4A 4H8JA 4OQOA 3KOTA 4F39A 1H44A 2QJEA 2OCUA 4K3FA 3C36A 4LN5A 4LATA 1RDZA 5I59B 1N84A 4I1DA 2IA4A 1B7ZA 3HHGA 3MBPA 1B4HA 1FBEA 2XHDA 2OK2A 1IMDA 1MY4A 1MH4A 3PMWA 2P2AA 1VSOA 3U72A 2PFZA 2Z8EA 4YKKA 1ELJA 3KJTA 1K9YA 3H7MA 3TTNA 3HCQA 2R6GE 4IGRA 1I69A 3IO6A 5H8FA 1ZTYA 1N0TA 3MZ1A 5DVFA 4LZ5A 1S7YA 1B0HA 1URDA 1QULA 4G8HA 3K4UA 3PMXA 4U22A 4QBAA 3GYYA 1PB8A 1LBYA 4GFRA 1CB6A 1B7UA 3FD3A 3C9HA 2ZNTA 3T0JA 4N81A 2Q2CA 3GBAA 1MQHA 2DE2A 3OOAA 1TXFA 4RJZA 3KN8A 2VHAA 2F7CA 4GBVA 5IKBA 3D4GA 4G8NA 4G68B 3QYTA 1O7TA 2ZNSA 3SEUA 2HZLA 4FJPA 4NE4A 4R73A 1XOCA 3OMBA 1G0IA 3BIGA 2I48A 4KQPA 1NUZA 3G3KA 4JBZA 1SYIA 1LBBA 3RQTA 5FTHA 1D4NA 1FPGA 1LBZA 5EQ7A 2XXWA 4P1EA 1FBGA 3LR1A 1WODA 2Y5LA 4IO5A 2WBBA 4G68C 2XXYA 3PUYE 4GBWA 2OX3A 4RPNA 1RKMA 3FXBA 1JVYA 3G3IA 1M5BA 1M5CA 2P3NA 2UVHA 2PT2A 3QIMA 2ZZVA 4OVRA 4P9KA 4EF1A 5LOMA 1EZ9A 5FBPA 1Z7NE 2CZLA 4XF5A 5CBRA 2F7BA 4JXIA 1XI6A 1M5EA 5CM6A 1VR5A 4POXA 4BDLA 1ZIUA 1B46A 3HV1A 4N4UA 4F1VA 3PPPA 3T96B 1H3DA 4YICA 3E3KA 4NF5A 4H1XA 1VDWA 2O69A 3I6VA 4H8IA 2VD3A 1A8EA 4KFQA 1JEVA 1UTHA 5FTIA 3U93A 1B58A 1GGGA 2CZKA 3FXQA 4HE1A 3QAXA 1FPJA 4KPTA 2QS1A 4F2QA 3ODBA 4RXLA 2HHMA 3ZKKA 4QFNA 3KG2A 4YKJA 1VE4A 3OO9A 2NUVA 2DE3A 3CG3A 1LFIA 1B3EA 3IFAA 4KYDA 2Q9TA 3RYDA 2RCAA 5ITOA 2QMWA 4THIA 3T22A 1JVXA 1O63A 4QXDA 4PF6A 1DTGA 4F1UA 3MVWA 2XWOA 2DWHA 2QS4A 4I8CA 4RA1A 3RPLA 1A7LA 1SI0A 3OO7A 5EHSA 1MXYA 2XA5A 1IXIA 3K6UA 4OVPA 3TCGA 4AQ4A 2XXUA 4MX6A 4G77A 3O6IA 1N76A 1MDQA 1A55A 1IMFA 3CI8A 3E78A 3CSBA 3OO8A 2Y7IA 3RNNA 1B3HA 4MAGA 2FA7A 3HO7A 2DXYA 1MY0A 5H8FB 4I9DA 2ZYNA 4IO3A 3VDFA 5DYHA 1FCKA 2X7PA 4PFWA 2QSXA 3KEIA 4FAJA 4WXJA 3O6HA 4PQJA 3RN8A 4DCYA 1KZ8A 1SBPA 3QUJA 4BDMA 2CZHA 3R7XA 4Z0IA 3H6TA 4PAIA 4U4XA 4P1LA 2O68A 3QK6A 2QVRA 4ZEKA 3IOUA 3KOSA 4F3SA 5CRYA 3D4CA 1OIBA 1FPLA 4PGPA 1SI1A 3IK6B 2F36A 2RC8A 2B4MA 5H8HA 1PB7A 3MP6A 1WDNA 4RK2A 3Q27A 1JW5A 1NFTA 3ZSFA 3Q28A 4OVTA 2GQ1A 3T9UA 3B7DA 3THIA 3CSGA 1FSAA 5AA4A 3VFJA 2QVUA 4GF8A 3IOWA 3LBSA 3LSXA 4G2ZA 1FTKA 4F18A 4KCCA 1CE2A 1Q1KA 1EYJA 1XVYA 2QL3A 1FQCA 1NMUA 4WKMA 2ONSA 2RKMA 1LBWA 3MW0A 4MLVA 3MQ9A 4OVJA 2P0SA 5IZ1A 5ET5A 1Z7ME 5CMBA 4Q0CA 4QF9A 1M5FA 1SPIA 1YCJA 1ZKBA 4NF5B 3SEYA 5EYHA 5I2NA 4P47A 3S9MC 1UTHB 1B3FA 5CMMA 2BJIA 4QRZA 3DM0A 5IM2A 2O84X 4MLQA 2YLNA 4ZE8A 3KZGA 1B4ZA 4PBHA 2E0SA 4MH5A 2ESNA 2PBWA 1OVTA 2KR0A 1RDXA 4ELRA 2XXRA 3VLVA 4YB5A 3IB0A 1MY3A 4N07A 3B50A 3RPLB 4GL8A 4GWZA 1DCUA 2H4IA 3FVGA 4F29A 4H5GA 1P99A 3B6TA 1EH3A 3N6UA 5DVJA 4GIZA 1SW5A 4AB6A 2O7IA 3O6GA 3FVOA 4OVQA 2CEYA 3H03A 1YYZA 4DXUA 1J1NA 4XKNA 3MPLA 3M8UA 2KQZA 3E9XA 5A5XA 1DPEA 4HCYA 2VOZA 2ZZXA 4MJOA 4NG7A 3M3FA 4E0XA 4R75A 1NV4A 4DZ1A 4O3CA 2UVGA 2Q89A 3TTLA 4MFIA 2ZXTA 3U1OA 2DVZA 2DWIA 4OFLA 2XXPA 5AA1A 1B1XA 5FHOA 1R9QA 2F3BA 4GWSA 1P1QA 1MXUA 2I49A 2A5TA 2XXIA 4QFPA 4NF0A 1A8FA 1GVCA 4BLAA 4NX1A 1JP4A 2G29A 1INPA 2V4CA 1Q9DA 4I62A 1LGBC 1QVSA 1LAXA 3CRBA 3ECRA 4ESWA 1B0LA 1UQWA 5KCJB 1B1HA 1MRPA 1UTBA 5ITPA 4NWDA 3S4UA 4EXLA 5H8HB 1Y1MA 4MEVA 2R9JA 1PBPA 2F3DA 2Y7KA 2H98A 2DE4A 1QJMA 5AA4B 1AMFA 4UA8A 1ZU0A 4GX6A 2WYKA 2XD3A 2FYIA 3KJ7A 4AS4A 1DSNA 3JYRA 4ECFA 4F31B 1B3GA 2I0BA 3MVZA 4JDFA 3V89B 3I5OA 1B5IA 1GTKA 3P7IA 2VPNA 3VE1B 4PFBA 2WX9A 1IIWA 3K6WA 3HFUA 4QSCA 1MQJA 4OEVA 3FJ7A 2YPNA 2O6AA 5H8QB 1EZPA 2QFLA 3VXBA 1XT8A 2Q8JA 2HCAA 1P1WA 2F8DA 4C0RA 4PFYA 1RDYA 4PFUA 4JVDA 2XWIA 3K1PA 1POTA 1QKAA 4L17A 5F7VA 2FHYA 4H67A 1MPCA 1Y3NA 4HE0A 2CEXA 4DDDA 3MVYA 4R2BA 2DDKA 3O97A 3OENA 3OSQA 3FUZA 5KDTA 1FTJA 2D5WA 4DXCA 3KGCA 3FZVA 4PE3A 4IO4A 4EQBA 4GVOA 4BDNA 2VPOA 2I6EA 5IGAA 1IMEA 1MXZA 1OMPA 4NMYA 4NWCA 2PFYA 5B7DA 4YMBA 3FASA 4FORA 1KA0A 1NH7A 3CHGA 1NNKA 2GHAA 1YZ0A 3KBRA 4OVSA 1T0KA 3T93B 4IGTA 3PD9A 3PTYA 1FQFA 5TU0A 3TYHA 5A5XB 4GWYA 2XX9A 3MZBA 1R1NA 4KYEA 4P8BA 3C35A 1NV6A 5ET7A 3ZKLA 1XS5A 4HXVA 3SESA 3IB2A 4NF4A 3MUQA 4O94A 3C33A 4DE8A 4R72A 3SKPA 4GWWA 2B3BA 3T9HB 4R9FA 2OWTA 4OANA 1D3KA 2XXQA 1BIYA 3H06B 3KSXA 2NVUB 2XX7A 4TQUQ 3EHUA 1TT1A 2Z22A 1NL5A 3EPEA 3U8QA 2QRYA 1B32A 4KYSA 3ZS6A 3LUZA 4P0IA 2I0CA 2H5YA 1MDP1 3DP6A 4H65A 2A5SA 4MMPA 1UTBB 1Y3QA 1SYHA 2ALUA 2AL5A 4OFOA 1FBCA 4EQ9A 1B05A 5F24A 3VVEA 5TP9A 4FECA 5I3SA 4KHZE 2FVZA 5IZZA 1AL3A 1F9BA 3RTFB 5CI5A 1I6BA 4OHNA 1QGXA 2ZYMA 2NOOA 4PF8A 3I3VA 4PDHA 5DT6A 1D9VA 1I6QA 3RPWA 3M3KA 3SDFA 1H76A 4EXKA 4NF8A 2BJJX 2OBGA 2HXRA 3WAFA 3W9VA 5EYGA 3PPRA 3GZGA 3OEKA 5L8DA 4NF6A 4JB7A 1PC3A 1GV8A 4Q5TA 5JEIA 1YTVA 4M1VA 2VD2A 1SW1A 4G8MA 3CIJA 5DEXA 2XXXA 1Y4TA 4LZ7A 2WKYA 1FPKA 2DSFA 1FQEA 1LAGE 1YPNA 1II5A 4KXPA 4KI0E 4OZ9A 4UABA 3K00A 4N6PA 3L6GA 2XX8A 2RINA 2Q74A 3W9WA 4FIMA 1QUIA
chains in the Genus database with same CATH topology
5IZ3B 4O7MA 2KR0A 4N8YA 1RDXA 5A5LA 5LTCA 4PC9A 2P3VA 2ZZWA 4O7IA 3U65A 1LBXA 1LEVA 3B50A 3ROJA 3RPLB 1FPBA 4GWZA 1DCUA 2Q8MA 3BIHA 3MSTA 3LV0A 4DI3D 2B4LA 1NI9A 4I3EA 5JK4A 1FTAA 4PAKA 4OVQA 2CEYA 5EQ8A 4PDDA 4JVCA 1YYZA 1FPDA 2KQZA 4HCYA 1NV2A 1FPEA 2ZZXA 4MJOA 5LDZA 1FBPA 4NG7A 1IMAA 4PETA 4LN5A 1RDZA 4N15A 1NV4A 3KC1A 1NV3A 1FBEA 2DVZA 1IMDA 4MIJA 2PFZA 2F3BA 4GWSA 4I3YA 1K9YA 5I7IA 2Y5KA 4NF0A 4NX1A 1JP4A 4G61A 1D9QA 1INPA 4GWUA 2V4CA 5DW8A 1Q9DA 4QBAA 3GYYA 5IZ3A 1LBYA 4NQ8A 3T0JA 4N81A 2FIXA 2DE2A 3NOHA 2JJKA 2FBPA 1NUXA 3B8BA 4NN3A 1YXIA 4GBVA 4MHFA 4PGNA 4MEVA 3KC0A 2HZLA 2XWVA 5I5PA 3MYUA 2F3DA 2WBDA 1G0IA 4P56A 2DE4A 3BIGA 1NUZA 2QPQA 4GX6A 2WYKA 4GX4A 4HCWA 1FJ6A 4AS4A 1DBZA 1FPGA 2OWZA 1LBZA 5EQ7A 2L5VA 4P1EA 4HE2A 1FBGA 4PFRA 2Y5LA 2WBBA 2WEFA 4GX3A 1FPFA 5EQ9A 2VPNA 4PFBA 2WX9A 3HFUA 4MNPA 4GBWA 1KA1A 2OX3A 3FXBA 4YZZA 4I40A 2P3NA 1G0HA 2QFLA 2ZZVA 4OVRA 4P9KA 2XWKA 5FBPA 1RDYA 1FBHA 4JVDA 4X04A 4XF5A 1XI6A 2XWIA 1NUWA 5CM6A 4OA4A 2FHYA 4HE0A 4N6KA 4MCOA 2CEXA 1FBFA 4P3LA 2DDKA 2R8TA 4N4UA 4F1VA 4YICA 3A29A 1VDWA 1DK4A 4PE3A 4PCDA 4PAFA 4FBPA 2VPOA 2CZKA 5IGAA 1IMEA 5ET6A 4HE1A 1FPJA 1AWBA 3D1RA 2PFYA 2HHMA 1NV7A 2DE3A 3IFAA 2Q9TA 3RYDA 4NAPA 1KA0A 3CHGA 3SZPA 1YZ0A 2HPGA 4NHBA 4OVSA 1FRPA 3QMFA 3PTYA 4QXDA 4PF6A 4IR8A 4F1UA 1NV5A 2XWOA 4GWYA 4GWXA 3RPLA 4JVIA 1BK4A 2V3QA 2XA5A 4P8BA 5ET8A 1NV6A 4OVPA 5ET7A 1FPIA 4H46A 4MX6A 4HXVA 4O94A 1IMFA 3E78A 4GWWA 1FJ9A 4MAGA 4DI4B 4N91A 4OANA 1NV1A 4H45A 2WYPA 3E79A 4MNCA 3LUZA 4PTKA 4PFIA 3FBPA 1KZ8A 4MMPA 1FBDA 1FBCA 1IMCA 2CZHA 2FIEA 4PBQA 5F24A 4PAIA 5I3SA 2FVZA 4P1LA 5IZZA 2QVRA 5J16A 2XXKA 1LBVA 3EKIA 3IFCA 1QGXA 4MNIA 4PF8A 1FPLA 4PGPA 4PDHA 4O8MA 2B4MA 4F19A 4AS5A 2HZKA 3KBZA 4OVTA 2GQ1A 4N17A 5T3JA 1FSAA 2HXRA 2F5XA 3W9VA 2QVUA 1NV0A 5EYGA 1NUYA 1EYKA 2QVVA 3ISPA 2VT5A 4F18A 1K9ZA 4M1VA 1EYJA 1EYIA 5EQAA 2MKZA 4N8GA 4XEQA 4N6DA 1LBWA 4X9TA 1FPKA 1IMBA 5IZ1A 5ET5A 5J1DA 2CZIA 1SPIA 4NGUA 5EYHA 4KXPA 4P47A 2BJIA 4UABA 4X8RA 1CNQA 5IM2A 3T1BA 5ESYA 4XFEA 2Q74A 3W9WA 4PBHA 2PCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MYU A;  3E78 A;  3E79 A;  3EKI A; 
#chains in the Genus database with same CATH topology
 1N7X A;  3IR1 A;  5TPA A;  4ZZA A;  3IAZ A;  3T9X B;  2GRV A;  3UN6 A;  5A5L A;  4FED A;  2P3V A;  4O7I A;  3G3F A;  4KCD A;  3SER A;  3U65 A;  2E1S A;  1LEV A;  5FHN A;  3U92 A;  4LA9 A;  2X7Q A;  3H6U A;  4ZDM A;  3ROJ A;  3TEL A;  1FPB A;  2X26 A;  3BIH A;  4DI3 D;  5I84 A;  2DWJ A;  3V5A A;  1MG1 A;  4HTG A;  2ZYO A;  3IO4 A;  3H3G A;  4I3E A;  2Z23 A;  2O1L A;  3TFL A;  1FTA A;  1URS A;  4PAK A;  3RGY A;  4PDD A;  4JVC A;  3C32 A;  3S9L C;  4NF4 B;  2F34 A;  4TLL B;  3TTK A;  4LQ5 A;  3M3L A;  3G3J A;  3CFZ A;  4GLI A;  5HM4 B;  1FPE A;  2Z8F A;  2I4B A;  5LDZ A;  3C4M A;  1FBP A;  1HSL A;  3SEX A;  2ABH A;  1Q35 A;  4KD5 A;  1ZMG A;  4IO7 A;  1NV3 A;  1MXV A;  4RNS A;  3USD A;  1N3W A;  1P1N A;  2Y7W A;  4QHQ A;  1QW0 A;  4KR5 A;  1S9T A;  2DP8 A;  5K2Y A;  4F1Y A;  2RC9 A;  1ZLQ A;  1O64 A;  3PUV E;  2O51 A;  5I7I A;  2Y5K A;  3MZ9 A;  3MVX A;  2V93 A;  5H8N A;  3K6V A;  2UYE A;  4IY5 A;  3DP8 A;  3FV2 A;  3K1N A;  3FJG A;  4G61 A;  4GWU A;  5DW8 A;  1POY 1;  5IZ3 A;  4LON B;  2DS9 A;  2R71 A;  5L9S A;  4PE5 B;  3MP8 A;  1A40 A;  3N6T A;  5AE4 A;  3MWB A;  3NOH A;  2FBP A;  1LB8 A;  1NUX A;  3B8B A;  1YXI A;  3Q25 A;  2DWA A;  1XC1 A;  3S9E A;  3MAM A;  1FW0 A;  1WVJ A;  2AL4 A;  3KC0 A;  1BKA A;  5I5P A;  1KWH A;  4IO2 A;  2NWJ A;  2WBD A;  4NF8 B;  4OTE A;  1R9L A;  3RLF E;  4GRK A;  3VV5 A;  2QPQ A;  1LBC A;  4GX4 A;  4QFL A;  4NF6 B;  3G3G A;  4N13 A;  1DBZ A;  2DXR A;  3TOD A;  2OWZ A;  2L5V A;  1TWY A;  3G7W A;  3LC8 A;  2WEF A;  4GX3 A;  3ONM A;  4LP2 B;  5DEX B;  3IX1 A;  5EQ9 A;  4O3B A;  1JW1 A;  4MNP A;  2V25 A;  1KA1 A;  2ANJ A;  4YMA A;  3CVG A;  3MP1 A;  3BFT A;  4YZZ A;  4I40 A;  3OEL A;  4QSE A;  4HS7 A;  1MY2 A;  1FQD A;  3TEP A;  2B65 A;  4R6K A;  1BTJ A;  1L5T A;  4ESX A;  3PMV A;  3MC2 A;  2HXW A;  3EQ1 A;  1A54 A;  3DEL B;  4N6K A;  1P1O A;  5DVI A;  4P3L A;  2R8T A;  2I3W A;  5BUU A;  3ILT B;  2GHB A;  5TPA B;  4P0G A;  3A29 A;  3K1M A;  5AA3 A;  2F78 A;  3OXN A;  3PUW E;  4EQ7 A;  1FQA A;  1AH5 A;  4OYV A;  4FBP A;  2VP1 A;  1Y4C A;  4XXU A;  4GOT A;  4U23 A;  1B5J A;  1B3L A;  4QFO A;  3UIF A;  4OET A;  4E0W A;  1NV7 A;  2QMX A;  4DXB A;  1US4 A;  3IOV A;  3PGF A;  3SZP A;  1QKB A;  4NHB A;  1IXG A;  3QMF A;  4Z7E A;  3OSR A;  2RCB A;  3VVD A;  4IR8 A;  1DMB A;  1NV5 A;  1QUJ A;  4UAC A;  4GWX A;  4JVI A;  1BK4 A;  2V3U A;  5KZT A;  1FTO A;  2G93 A;  5ET8 A;  1EZO A;  3VLW A;  3JZJ A;  3BFU A;  3PPQ A;  4FAT A;  4C1U A;  1MY1 A;  5EHM A;  5AA2 A;  4DI4 B;  2H25 A;  3TTR A;  5H8N B;  5F1Q A;  2YJP A;  2REJ A;  4POW A;  1B51 A;  1NV1 A;  4JSD A;  3N94 A;  4P11 A;  3OO6 A;  2DVC A;  1JQF A;  2ONR A;  3PUX E;  4HW8 A;  1LFH A;  3FJM A;  1MM7 A;  3E79 A;  2Q2A A;  4PTK A;  4ELO A;  1LST A;  4PFI A;  1USY H;  1NKX A;  3FXU A;  5ICT A;  2OWS A;  1NNT A;  2ONK E;  3KSJ A;  1B40 A;  5I2N B;  1IMC A;  2FIE A;  1LB9 A;  2PMS A;  3PU5 A;  3Q26 A;  5I2K A;  1EU8 A;  3SEV A;  3EHS A;  5J16 A;  1MPB A;  4OFJ A;  2XXK A;  4YB7 A;  3EKI A;  4OWD A;  3IFC A;  2OJT A;  4MNI A;  2IEE A;  5JTY A;  1S50 A;  4JWY A;  4ZZE A;  3TKD A;  4G4P A;  4JWO A;  4PFT A;  4F19 A;  1LAF E;  1I6A A;  2Q88 A;  4R9G A;  1MQG A;  4WEP A;  3KBZ A;  4EDP A;  4Q8R A;  2V3T A;  4OXV A;  3PD8 A;  4MF3 A;  5T3J A;  2RF1 A;  4U21 A;  2VGQ A;  1DPP A;  3UP9 A;  3ISP A;  3PUZ E;  3CFX A;  5HBC A;  2F6P A;  4X1D A;  2VT5 A;  2PX1 A;  4U1O A;  5L9M A;  1DTZ A;  1H45 A;  4H5F A;  1EYI A;  4QSD A;  3FIR A;  1N04 A;  1YAE A;  5EQA A;  2HEU A;  1ANF A;  4X48 A;  2HFB A;  1A99 A;  4N6D A;  2I58 A;  1P1U A;  1IMB A;  3TPA A;  3TZA A;  5J1D A;  3K2D A;  4R2F A;  4NGU A;  4F3P A;  3JV9 A;  2AIX A;  3LSW A;  4RYA A;  3VVF A;  1TFA A;  2A5T B;  1VFD A;  1MPD A;  4R6H A;  3T1B A;  2F35 A;  4XFE A;  1AOV A;  1ZJL A;  2Y7R A;  2PCR A;  2HAU A;  4LZ8 A;  1PBQ A;  3A3U A;  5B70 A;  4N8Y A;  4YU0 A;  4YB6 A;  3UGW A;  4ELQ A;  1IUD A;  1MS7 A;  3GXA A;  3N5L A;  1MQI A;  1M5D A;  1B7H A;  2Q8M A;  4ELP A;  3MST A;  3GBB A;  5H8S A;  3SET A;  4TOZ A;  1NI9 A;  3TCH A;  4LUB A;  4YAH X;  1VFE A;  5JK4 A;  2ZNU A;  3UK4 A;  4FE8 A;  5EQ8 A;  1FPD A;  5AA2 B;  4DIG A;  3OEM A;  4ZED A;  4ND9 A;  2KLF A;  1MXX A;  1NV2 A;  4TLM B;  1IMA A;  4PET A;  4F22 A;  4N15 A;  2ZYK A;  5ISU A;  3G3H A;  3KC1 A;  3CR9 A;  4MIJ A;  3MPK A;  3K0V A;  3EN3 A;  3RY3 A;  3T66 A;  3IOT A;  3QSL A;  4I3Y A;  1LCT A;  1ZBM A;  3C31 A;  4R74 A;  3TAJ A;  1LLS A;  1R6Z A;  1D9Q A;  1Y20 A;  5BWJ A;  3O2A A;  3R6U A;  3KN3 A;  1IQ7 A;  1HSE A;  1Y3P A;  4NQ8 A;  5I2K B;  3RT8 A;  2D3I A;  3F11 A;  3E13 X;  4GXA A;  5I58 A;  3VLU A;  3OD7 A;  1USY E;  2FIX A;  2JJK A;  1IXC A;  1LCF A;  5KDT B;  2B3F A;  1RYX A;  3HN0 A;  4ZEC A;  4IY6 A;  2OZZ A;  1PB9 A;  3PPN A;  3IOR A;  2FNC A;  4NN3 A;  5JTY B;  2UXA A;  1BLF A;  1NNF A;  4OEU A;  3R26 A;  4QFK A;  2UVJ A;  3TQL A;  3O29 A;  4MHF A;  4PGN A;  4F3G A;  1Y1Z A;  2DYX A;  1N3X A;  3BBR A;  2XXV A;  4U4S A;  3SEW A;  2XWV A;  3MYU A;  1OQG A;  1D9Y A;  1H43 A;  4RY1 A;  1BP5 A;  4H0W A;  4YKP A;  4P56 A;  1DOT A;  1FTM A;  3VXC A;  3TUS A;  1AIV A;  4OEN A;  3FVN A;  3UOR A;  1MH3 A;  3KFM A;  3V83 A;  4HCW A;  1FJ6 A;  4OES A;  5CMC A;  3EHT A;  5IAI A;  1FTL A;  1OLC A;  4HE2 A;  4EUO A;  4PFR A;  4F2O A;  1IXH A;  4U1Z A;  1FPF A;  4ONY A;  5FHM A;  4NED A;  1Y9U A;  1JW4 A;  1G0H A;  2CMO A;  2I3V A;  2QS3 A;  2XWK A;  2F97 A;  5I57 A;  1B52 A;  1SVX B;  1FBH A;  2O1M A;  4X04 A;  1B9J A;  1PEB A;  1NUW A;  2REG A;  2UVI A;  4OA4 A;  4GL0 A;  4MCO A;  3GLB A;  4YKI A;  1FBF A;  2GH9 A;  1SQY A;  1IEJ A;  5KCJ A;  3IJX B;  1URG A;  2ZMB A;  4ISU A;  3CFL A;  1DK4 A;  4XKR A;  4PCD A;  3UA8 A;  4NTL A;  4PAF A;  3HST A;  3TQW A;  5I56 A;  2PT1 A;  3PV0 E;  5ET6 A;  4GQO A;  3PPO A;  4C1T A;  4RK9 A;  1AWB A;  2W7Y A;  3D1R A;  1ATG A;  2XD2 A;  3K6X A;  1US5 A;  4EF2 A;  2HQ0 A;  5TP9 B;  4NAP A;  5L9O A;  1SD3 A;  2HPG A;  1FRP A;  4GD5 A;  3S9N C;  3TDJ A;  5ICQ A;  2V84 A;  4AB5 A;  5K2X A;  4JSO A;  1IIT A;  4XIG Q;  1LFG A;  3LSF B;  4GWO A;  4PP0 A;  3L6H A;  2F7A A;  2V3Q A;  2O7U A;  2D21 A;  3E4R A;  2DQV A;  4XTC Q;  3RT6 B;  1FPI A;  4RPO A;  5H8Q A;  3H6W A;  3H4Z A;  4H46 A;  4XKP A;  3H6V A;  1FQB A;  3TCF A;  4LVQ A;  4ZEF A;  1JNF A;  1FJ9 A;  3LUY A;  4OMB A;  4DCX A;  1LAH E;  4XKQ A;  2LAO A;  5DTB A;  4R6Y A;  4N91 A;  4BDO A;  3WAE A;  3FGS A;  3K02 A;  3FAT A;  5I59 A;  2RC7 A;  4OER A;  3O28 A;  4IB2 A;  4H45 A;  2F6G A;  3RTW B;  5M2V A;  3FVK A;  5CBS A;  3CG1 A;  2WYP A;  3O66 A;  5I58 B;  4MNC A;  1XHY A;  1UIU A;  3ILU B;  1SW4 A;  5AA2 D;  3FXR A;  4O3A A;  3IL1 B;  3U94 A;  3AXF A;  3FBP A;  4X1B A;  4U2R A;  3S2V A;  1JEU A;  3T9V A;  1FBD A;  3A3C A;  1OVB A;  2GFE A;  4GXS B;  3EF7 A;  3MJN A;  4PBQ A;  1MQD A;  1JET A;  5CC2 A;  1NH8 A;  5CMK A;  1NNP A;  3A09 A;  1OQH A;  1LBV A;  2Y84 A;  1B6H A;  4ZS9 A;  4O8M A;  3V8X B;  4BDR A;  4AS5 A;  3O9P A;  4G68 A;  2THI A;  2HZK A;  1RYO A;  2UYF A;  3BKI B;  2DOJ A;  2Z8D A;  4N17 A;  2F5X A;  1NV0 A;  3QXM A;  1GR2 A;  1IZ1 A;  1NUY A;  1EYK A;  2QVV A;  2PVU A;  1XVX A;  2QS2 A;  3C34 A;  3TMG A;  2H99 A;  2Y7P A;  5I57 B;  1K9Z A;  4WED A;  2AYS A;  4BDQ A;  3LSL A;  3IB1 A;  3QUF A;  2MKZ A;  4N8G A;  4XEQ A;  1HSJ A;  4X9T A;  3KN7 A;  2NXO A;  2M8C A;  1B5H A;  2CZI A;  2PYY A;  1N7W A;  1QUK A;  5EYF A;  1SDX A;  4ZE9 A;  1UIV A;  1PDA A;  4DLD A;  3FV1 A;  4X8R A;  3RUM A;  5I56 B;  1OLA A;  1CNQ A;  5ESY A;  2XXH A;  3TTM A;  3HHF A;  3IJO B;  2I4C A;  5IZ3 B;  4O7M A;  4MBP A;  2P1S A;  3B6W A;  4H6D A;  2HAV A;  5ELV A;  5LTC A;  4PC9 A;  2ZZW A;  5HPQ A;  2OLB A;  1LBX A;  3K01 A;  1MXW A;  3LV0 A;  4IO6 A;  4F3B A;  2B4L A;  3DLN A;  4ZEI A;  3N26 A;  1MM6 A;  1SW2 A;  4JWX A;  3B6Q A;  4FEB A;  1TFD A;  3HPI A;  2H9B A;  1B2H A;  4Q30 B;  3W15 C;  4ZEB A;  4M4G A;  2XXT A;  4LQ2 A;  3Q29 A;  3DP4 A;  4H8J A;  4OQO A;  3KOT A;  4F39 A;  1H44 A;  2QJE A;  2OCU A;  4K3F A;  3C36 A;  4LN5 A;  4LAT A;  1RDZ A;  5I59 B;  1N84 A;  4I1D A;  2IA4 A;  1B7Z A;  3HHG A;  3MBP A;  1B4H A;  1FBE A;  2XHD A;  2OK2 A;  1IMD A;  1MY4 A;  1MH4 A;  3PMW A;  2P2A A;  1VSO A;  3U72 A;  2PFZ A;  2Z8E A;  4YKK A;  1ELJ A;  3KJT A;  1K9Y A;  3H7M A;  3TTN A;  3HCQ A;  2R6G E;  4IGR A;  1I69 A;  3IO6 A;  5H8F A;  1ZTY A;  1N0T A;  3MZ1 A;  5DVF A;  4LZ5 A;  1S7Y A;  1B0H A;  1URD A;  1QUL A;  4G8H A;  3K4U A;  3PMX A;  4U22 A;  4QBA A;  3GYY A;  1PB8 A;  1LBY A;  4GFR A;  1CB6 A;  1B7U A;  3FD3 A;  3C9H A;  2ZNT A;  3T0J A;  4N81 A;  2Q2C A;  3GBA A;  1MQH A;  2DE2 A;  3OOA A;  1TXF A;  4RJZ A;  3KN8 A;  2VHA A;  2F7C A;  4GBV A;  5IKB A;  3D4G A;  4G8N A;  4G68 B;  3QYT A;  1O7T A;  2ZNS A;  3SEU A;  2HZL A;  4FJP A;  4NE4 A;  4R73 A;  1XOC A;  3OMB A;  1G0I A;  3BIG A;  2I48 A;  4KQP A;  1NUZ A;  3G3K A;  4JBZ A;  1SYI A;  1LBB A;  3RQT A;  5FTH A;  1D4N A;  1FPG A;  1LBZ A;  5EQ7 A;  2XXW A;  4P1E A;  1FBG A;  3LR1 A;  1WOD A;  2Y5L A;  4IO5 A;  2WBB A;  4G68 C;  2XXY A;  3PUY E;  4GBW A;  2OX3 A;  4RPN A;  1RKM A;  3FXB A;  1JVY A;  3G3I A;  1M5B A;  1M5C A;  2P3N A;  2UVH A;  2PT2 A;  3QIM A;  2ZZV A;  4OVR A;  4P9K A;  4EF1 A;  5LOM A;  1EZ9 A;  5FBP A;  1Z7N E;  2CZL A;  4XF5 A;  5CBR A;  2F7B A;  4JXI A;  1XI6 A;  1M5E A;  5CM6 A;  1VR5 A;  4POX A;  4BDL A;  1ZIU A;  1B46 A;  3HV1 A;  4N4U A;  4F1V A;  3PPP A;  3T96 B;  1H3D A;  4YIC A;  3E3K A;  4NF5 A;  4H1X A;  1VDW A;  2O69 A;  3I6V A;  4H8I A;  2VD3 A;  1A8E A;  4KFQ A;  1JEV A;  1UTH A;  5FTI A;  3U93 A;  1B58 A;  1GGG A;  2CZK A;  3FXQ A;  4HE1 A;  3QAX A;  1FPJ A;  4KPT A;  2QS1 A;  4F2Q A;  3ODB A;  4RXL A;  2HHM A;  3ZKK A;  4QFN A;  3KG2 A;  4YKJ A;  1VE4 A;  3OO9 A;  2NUV A;  2DE3 A;  3CG3 A;  1LFI A;  1B3E A;  3IFA A;  4KYD A;  2Q9T A;  3RYD A;  2RCA A;  5ITO A;  2QMW A;  4THI A;  3T22 A;  1JVX A;  1O63 A;  4QXD A;  4PF6 A;  1DTG A;  4F1U A;  3MVW A;  2XWO A;  2DWH A;  2QS4 A;  4I8C A;  4RA1 A;  3RPL A;  1A7L A;  1SI0 A;  3OO7 A;  5EHS A;  1MXY A;  2XA5 A;  1IXI A;  3K6U A;  4OVP A;  3TCG A;  4AQ4 A;  2XXU A;  4MX6 A;  4G77 A;  3O6I A;  1N76 A;  1MDQ A;  1A55 A;  1IMF A;  3CI8 A;  3E78 A;  3CSB A;  3OO8 A;  2Y7I A;  3RNN A;  1B3H A;  4MAG A;  2FA7 A;  3HO7 A;  2DXY A;  1MY0 A;  5H8F B;  4I9D A;  2ZYN A;  4IO3 A;  3VDF A;  5DYH A;  1FCK A;  2X7P A;  4PFW A;  2QSX A;  3KEI A;  4FAJ A;  4WXJ A;  3O6H A;  4PQJ A;  3RN8 A;  4DCY A;  1KZ8 A;  1SBP A;  3QUJ A;  4BDM A;  2CZH A;  3R7X A;  4Z0I A;  3H6T A;  4PAI A;  4U4X A;  4P1L A;  2O68 A;  3QK6 A;  2QVR A;  4ZEK A;  3IOU A;  3KOS A;  4F3S A;  5CRY A;  3D4C A;  1OIB A;  1FPL A;  4PGP A;  1SI1 A;  3IK6 B;  2F36 A;  2RC8 A;  2B4M A;  5H8H A;  1PB7 A;  3MP6 A;  1WDN A;  4RK2 A;  3Q27 A;  1JW5 A;  1NFT A;  3ZSF A;  3Q28 A;  4OVT A;  2GQ1 A;  3T9U A;  3B7D A;  3THI A;  3CSG A;  1FSA A;  5AA4 A;  3VFJ A;  2QVU A;  4GF8 A;  3IOW A;  3LBS A;  3LSX A;  4G2Z A;  1FTK A;  4F18 A;  4KCC A;  1CE2 A;  1Q1K A;  1EYJ A;  1XVY A;  2QL3 A;  1FQC A;  1NMU A;  4WKM A;  2ONS A;  2RKM A;  1LBW A;  3MW0 A;  4MLV A;  3MQ9 A;  4OVJ A;  2P0S A;  5IZ1 A;  5ET5 A;  1Z7M E;  5CMB A;  4Q0C A;  4QF9 A;  1M5F A;  1SPI A;  1YCJ A;  1ZKB A;  4NF5 B;  3SEY A;  5EYH A;  5I2N A;  4P47 A;  3S9M C;  1UTH B;  1B3F A;  5CMM A;  2BJI A;  4QRZ A;  3DM0 A;  5IM2 A;  2O84 X;  4MLQ A;  2YLN A;  4ZE8 A;  3KZG A;  1B4Z A;  4PBH A;  2E0S A;  4MH5 A;  2ESN A;  2PBW A;  1OVT A;  2KR0 A;  1RDX A;  4ELR A;  2XXR A;  3VLV A;  4YB5 A;  3IB0 A;  1MY3 A;  4N07 A;  3B50 A;  3RPL B;  4GL8 A;  4GWZ A;  1DCU A;  2H4I A;  3FVG A;  4F29 A;  4H5G A;  1P99 A;  3B6T A;  1EH3 A;  3N6U A;  5DVJ A;  4GIZ A;  1SW5 A;  4AB6 A;  2O7I A;  3O6G A;  3FVO A;  4OVQ A;  2CEY A;  3H03 A;  1YYZ A;  4DXU A;  1J1N A;  4XKN A;  3MPL A;  3M8U A;  2KQZ A;  3E9X A;  5A5X A;  1DPE A;  4HCY A;  2VOZ A;  2ZZX A;  4MJO A;  4NG7 A;  3M3F A;  4E0X A;  4R75 A;  1NV4 A;  4DZ1 A;  4O3C A;  2UVG A;  2Q89 A;  3TTL A;  4MFI A;  2ZXT A;  3U1O A;  2DVZ A;  2DWI A;  4OFL A;  2XXP A;  5AA1 A;  1B1X A;  5FHO A;  1R9Q A;  2F3B A;  4GWS A;  1P1Q A;  1MXU A;  2I49 A;  2A5T A;  2XXI A;  4QFP A;  4NF0 A;  1A8F A;  1GVC A;  4BLA A;  4NX1 A;  1JP4 A;  2G29 A;  1INP A;  2V4C A;  1Q9D A;  4I62 A;  1LGB C;  1QVS A;  1LAX A;  3CRB A;  3ECR A;  4ESW A;  1B0L A;  1UQW A;  5KCJ B;  1B1H A;  1MRP A;  1UTB A;  5ITP A;  4NWD A;  3S4U A;  4EXL A;  5H8H B;  1Y1M A;  4MEV A;  2R9J A;  1PBP A;  2F3D A;  2Y7K A;  2H98 A;  2DE4 A;  1QJM A;  5AA4 B;  1AMF A;  4UA8 A;  1ZU0 A;  4GX6 A;  2WYK A;  2XD3 A;  2FYI A;  3KJ7 A;  4AS4 A;  1DSN A;  3JYR A;  4ECF A;  4F31 B;  1B3G A;  2I0B A;  3MVZ A;  4JDF A;  3V89 B;  3I5O A;  1B5I A;  1GTK A;  3P7I A;  2VPN A;  3VE1 B;  4PFB A;  2WX9 A;  1IIW A;  3K6W A;  3HFU A;  4QSC A;  1MQJ A;  4OEV A;  3FJ7 A;  2YPN A;  2O6A A;  5H8Q B;  1EZP A;  2QFL A;  3VXB A;  1XT8 A;  2Q8J A;  2HCA A;  1P1W A;  2F8D A;  4C0R A;  4PFY A;  1RDY A;  4PFU A;  4JVD A;  2XWI A;  3K1P A;  1POT A;  1QKA A;  4L17 A;  5F7V A;  2FHY A;  4H67 A;  1MPC A;  1Y3N A;  4HE0 A;  2CEX A;  4DDD A;  3MVY A;  4R2B A;  2DDK A;  3O97 A;  3OEN A;  3OSQ A;  3FUZ A;  5KDT A;  1FTJ A;  2D5W A;  4DXC A;  3KGC A;  3FZV A;  4PE3 A;  4IO4 A;  4EQB A;  4GVO A;  4BDN A;  2VPO A;  2I6E A;  5IGA A;  1IME A;  1MXZ A;  1OMP A;  4NMY A;  4NWC A;  2PFY A;  5B7D A;  4YMB A;  3FAS A;  4FOR A;  1KA0 A;  1NH7 A;  3CHG A;  1NNK A;  2GHA A;  1YZ0 A;  3KBR A;  4OVS A;  1T0K A;  3T93 B;  4IGT A;  3PD9 A;  3PTY A;  1FQF A;  5TU0 A;  3TYH A;  5A5X B;  4GWY A;  2XX9 A;  3MZB A;  1R1N A;  4KYE A;  4P8B A;  3C35 A;  1NV6 A;  5ET7 A;  3ZKL A;  1XS5 A;  4HXV A;  3SES A;  3IB2 A;  4NF4 A;  3MUQ A;  4O94 A;  3C33 A;  4DE8 A;  4R72 A;  3SKP A;  4GWW A;  2B3B A;  3T9H B;  4R9F A;  2OWT A;  4OAN A;  1D3K A;  2XXQ A;  1BIY A;  3H06 B;  3KSX A;  2NVU B;  2XX7 A;  4TQU Q;  3EHU A;  1TT1 A;  2Z22 A;  1NL5 A;  3EPE A;  3U8Q A;  2QRY A;  1B32 A;  4KYS A;  3ZS6 A;  3LUZ A;  4P0I A;  2I0C A;  2H5Y A;  1MDP 1;  3DP6 A;  4H65 A;  2A5S A;  4MMP A;  1UTB B;  1Y3Q A;  1SYH A;  2ALU A;  2AL5 A;  4OFO A;  1FBC A;  4EQ9 A;  1B05 A;  5F24 A;  3VVE A;  5TP9 A;  4FEC A;  5I3S A;  4KHZ E;  2FVZ A;  5IZZ A;  1AL3 A;  1F9B A;  3RTF B;  5CI5 A;  1I6B A;  4OHN A;  1QGX A;  2ZYM A;  2NOO A;  4PF8 A;  3I3V A;  4PDH A;  5DT6 A;  1D9V A;  1I6Q A;  3RPW A;  3M3K A;  3SDF A;  1H76 A;  4EXK A;  4NF8 A;  2BJJ X;  2OBG A;  2HXR A;  3WAF A;  3W9V A;  5EYG A;  3PPR A;  3GZG A;  3OEK A;  5L8D A;  4NF6 A;  4JB7 A;  1PC3 A;  1GV8 A;  4Q5T A;  5JEI A;  1YTV A;  4M1V A;  2VD2 A;  1SW1 A;  4G8M A;  3CIJ A;  5DEX A;  2XXX A;  1Y4T A;  4LZ7 A;  2WKY A;  1FPK A;  2DSF A;  1FQE A;  1LAG E;  1YPN A;  1II5 A;  4KXP A;  4KI0 E;  4OZ9 A;  4UAB A;  3K00 A;  4N6P A;  3L6G A;  2XX8 A;  2RIN A;  2Q74 A;  3W9W A;  4FIM A;  1QUI A; 
#chains in the Genus database with same CATH homology
 5IZ3 B;  4O7M A;  2KR0 A;  4N8Y A;  1RDX A;  5A5L A;  5LTC A;  4PC9 A;  2P3V A;  2ZZW A;  4O7I A;  3U65 A;  1LBX A;  1LEV A;  3B50 A;  3ROJ A;  3RPL B;  1FPB A;  4GWZ A;  1DCU A;  2Q8M A;  3BIH A;  3MST A;  3LV0 A;  4DI3 D;  2B4L A;  1NI9 A;  4I3E A;  5JK4 A;  1FTA A;  4PAK A;  4OVQ A;  2CEY A;  5EQ8 A;  4PDD A;  4JVC A;  1YYZ A;  1FPD A;  2KQZ A;  4HCY A;  1NV2 A;  1FPE A;  2ZZX A;  4MJO A;  5LDZ A;  1FBP A;  4NG7 A;  1IMA A;  4PET A;  4LN5 A;  1RDZ A;  4N15 A;  1NV4 A;  3KC1 A;  1NV3 A;  1FBE A;  2DVZ A;  1IMD A;  4MIJ A;  2PFZ A;  2F3B A;  4GWS A;  4I3Y A;  1K9Y A;  5I7I A;  2Y5K A;  4NF0 A;  4NX1 A;  1JP4 A;  4G61 A;  1D9Q A;  1INP A;  4GWU A;  2V4C A;  5DW8 A;  1Q9D A;  4QBA A;  3GYY A;  5IZ3 A;  1LBY A;  4NQ8 A;  3T0J A;  4N81 A;  2FIX A;  2DE2 A;  3NOH A;  2JJK A;  2FBP A;  1NUX A;  3B8B A;  4NN3 A;  1YXI A;  4GBV A;  4MHF A;  4PGN A;  4MEV A;  3KC0 A;  2HZL A;  2XWV A;  5I5P A;  3MYU A;  2F3D A;  2WBD A;  1G0I A;  4P56 A;  2DE4 A;  3BIG A;  1NUZ A;  2QPQ A;  4GX6 A;  2WYK A;  4GX4 A;  4HCW A;  1FJ6 A;  4AS4 A;  1DBZ A;  1FPG A;  2OWZ A;  1LBZ A;  5EQ7 A;  2L5V A;  4P1E A;  4HE2 A;  1FBG A;  4PFR A;  2Y5L A;  2WBB A;  2WEF A;  4GX3 A;  1FPF A;  5EQ9 A;  2VPN A;  4PFB A;  2WX9 A;  3HFU A;  4MNP A;  4GBW A;  1KA1 A;  2OX3 A;  3FXB A;  4YZZ A;  4I40 A;  2P3N A;  1G0H A;  2QFL A;  2ZZV A;  4OVR A;  4P9K A;  2XWK A;  5FBP A;  1RDY A;  1FBH A;  4JVD A;  4X04 A;  4XF5 A;  1XI6 A;  2XWI A;  1NUW A;  5CM6 A;  4OA4 A;  2FHY A;  4HE0 A;  4N6K A;  4MCO A;  2CEX A;  1FBF A;  4P3L A;  2DDK A;  2R8T A;  4N4U A;  4F1V A;  4YIC A;  3A29 A;  1VDW A;  1DK4 A;  4PE3 A;  4PCD A;  4PAF A;  4FBP A;  2VPO A;  2CZK A;  5IGA A;  1IME A;  5ET6 A;  4HE1 A;  1FPJ A;  1AWB A;  3D1R A;  2PFY A;  2HHM A;  1NV7 A;  2DE3 A;  3IFA A;  2Q9T A;  3RYD A;  4NAP A;  1KA0 A;  3CHG A;  3SZP A;  1YZ0 A;  2HPG A;  4NHB A;  4OVS A;  1FRP A;  3QMF A;  3PTY A;  4QXD A;  4PF6 A;  4IR8 A;  4F1U A;  1NV5 A;  2XWO A;  4GWY A;  4GWX A;  3RPL A;  4JVI A;  1BK4 A;  2V3Q A;  2XA5 A;  4P8B A;  5ET8 A;  1NV6 A;  4OVP A;  5ET7 A;  1FPI A;  4H46 A;  4MX6 A;  4HXV A;  4O94 A;  1IMF A;  3E78 A;  4GWW A;  1FJ9 A;  4MAG A;  4DI4 B;  4N91 A;  4OAN A;  1NV1 A;  4H45 A;  2WYP A;  3E79 A;  4MNC A;  3LUZ A;  4PTK A;  4PFI A;  3FBP A;  1KZ8 A;  4MMP A;  1FBD A;  1FBC A;  1IMC A;  2CZH A;  2FIE A;  4PBQ A;  5F24 A;  4PAI A;  5I3S A;  2FVZ A;  4P1L A;  5IZZ A;  2QVR A;  5J16 A;  2XXK A;  1LBV A;  3EKI A;  3IFC A;  1QGX A;  4MNI A;  4PF8 A;  1FPL A;  4PGP A;  4PDH A;  4O8M A;  2B4M A;  4F19 A;  4AS5 A;  2HZK A;  3KBZ A;  4OVT A;  2GQ1 A;  4N17 A;  5T3J A;  1FSA A;  2HXR A;  2F5X A;  3W9V A;  2QVU A;  1NV0 A;  5EYG A;  1NUY A;  1EYK A;  2QVV A;  3ISP A;  2VT5 A;  4F18 A;  1K9Z A;  4M1V A;  1EYJ A;  1EYI A;  5EQA A;  2MKZ A;  4N8G A;  4XEQ A;  4N6D A;  1LBW A;  4X9T A;  1FPK A;  1IMB A;  5IZ1 A;  5ET5 A;  5J1D A;  2CZI A;  1SPI A;  4NGU A;  5EYH A;  4KXP A;  4P47 A;  2BJI A;  4UAB A;  4X8R A;  1CNQ A;  5IM2 A;  3T1B A;  5ESY A;  4XFE A;  2Q74 A;  3W9W A;  4PBH A;  2PCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...