3MYUA

Mycoplasma genitalium mg289
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
336
structure length
333
Chain Sequence
NTLIFNISLDHNADTSIEKFFTVFSKKLSGKLNKKINVNFNIVDDSFTKINNIQANKADFAFVNSQAIASNNWFGYTPLIQTLTTAFKEDLELDYYEDGNLQKKAEKTNLLFLSPPYKEWDDIKQKWTGNRYDFLYEPSKLVSFYRSMILITGSASEITAIKKAWNEKNWNQFMKFGIGHGQTNSASRFELPDLLFRKHFAKNYPGLQNAINSDPDKFAVVRGREIGINKNIKIVFDDANSFSWTQNIKRPFYTPIDPNDRLEILTYSDPLLYDIGIVSNNLSRIYQKAIGEIFIELAQSSEDLYGPSIGYNGYKMINDFEKEVVEIIEKTYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Vib binding protein
molecule keywords High affinity transport system protein p37
publication title Insights into Mycoplasma genitalium metabolism revealed by the structure of MG289, an extracytoplasmic thiamine binding lipoprotein.
pubmed doi rcsb
source organism Mycoplasma genitalium
total genus 117
structure length 333
sequence length 336
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06646 Mycoplasma_p37 High affinity transport system protein p37
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.180 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3myuA01
3.40.190.190 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3myuA02
3E78A 3E79A 3EKIA 3MYUA
chains in the Genus database with same CATH superfamily
2UYEA 4WEDA 3MVXA 1MQIA 4X48A 4MJOA 4K3FA 3A3CA 1LFHA 3VV5A 4ELQA 3IFAA 3W9VA 3T66A 1IIWA 1AIVA 4PFBA 4QRZA 4KXPA 4ZE8A 3QK6A 5ET5A 2DWIA 2HXRA 4TOZA 2F5XA 4PF8A 1FQAA 4X9TA 1R6ZA 2G93A 2OWTA 3N94A 2V93A 1TXFA 1DSNA 2HQ0A 3MJNA 3MUQA 2YJPA 1NH7A 3IB0A 4N6KA 1MPBA 4OEUA 3O6IA 1Y9UA 5ICQA 1B0HA 1QKBA 5F7VA 4C1TA 4YU0A 3FXBA 2UVHA 4KYDA 5ESYA 3SZPA 3OO6A 1ZU0A 2XWKA 4MIJA 4R6KA 2RC9A 2RINA 4AB5A 5H8NB 5L9MA 2CZHA 3A09A 1SW5A 4IB2A 1MH3A 4QHQA 1OQGA 3M3FA 3S4UA 4IY6A 3KN7A 5IZ1A 2P3NA 1FBCA 1A40A 4X1DA 1NNPA 4R6YA 3C36A 2GFEA 5FTHA 4HE1A 2PCRA 4U1OA 1OLAA 3EHSA 1B3LA 4NF8A 2XXQA 4YB6A 4L17A 3KN8A 3OO9A 3BIHA 4KD5A 1WVJA 1EZOA 1SI1A 1N7WA 4KYEA 4DLDA 5I2KB 4GXAA 4R73A 4ZEDA 5M2VA 5CRYA 1POTA 3RYDA 5FBPA 4NQ8A 3IB2A 5F1QA 3SEWA 4LA9A 3IOWA 2W7YA 3Q27A 5DT6A 1QUIA 2F97A 3ILTB 3UORA 1FSAA 2H98A 3DLNA 2OBGA 3TCGA 5I5PA 2PFYA 1SD3A 2ESNA 4OZ9A 3DELB 3KN3A 3H7MA 1SW2A 3FVGA 1B58A 5L9SA 3BKIB 4PFIA 2A5SA 4YKIA 2Q89A 1FQEA 3LUYA 3PPNA 3L6HA 1ZJLA 5K2XA 1M5FA 3MBPA 3HPIA 1AMFA 1MY3A 4NF5A 3OO8A 2DYXA 1LBYA 3K1NA 3RTFB 1POY1 4MBPA 2Q88A 1B32A 4H8JA 1MXUA 1O7TA 4FBPA 1SW4A 1B4ZA 2PX1A 4N17A 4YKKA 3LUZA 3U1OA 5I2NA 3GBAA 5ELVA 1FTOA 1B52A 2XX7A 2O7IA 4H6DA 4KR5A 2XXKA 4N6DA 4H5GA 3KFMA 4QFPA 3PUZE 3TODA 1LEVA 2HAVA 4RY1A 4I40A 1US4A 3RLFE 3RT6B 4G8HA 2FHYA 1B2HA 4QSCA 1EZ9A 4LVQA 1SW1A 3TELA 3TKDA 2DWJA 1FQBA 1TFDA 2F34A 1KZ8A 1XI6A 3O9PA 1URSA 1LCFA 3S9LC 4IO2A 4ELRA 4PDHA 2HHMA 4FAJA 4TQUQ 2Q74A 2ABHA 1ZKBA 5A5LA 4X8RA 4XKRA 4OVJA 3G7WA 5JK4A 2RC8A 2ZNTA 3PPPA 1ANFA 3PD9A 1MY1A 5I58B 3CRBA 3SERA 1N3WA 2NVUB 3U8QA 2XXUA 4ZZEA 4Q5TA 4LZ5A 1GVCA 1OIBA 4N07A 3BIGA 3H6UA 3OENA 4N13A 2B3BA 1M5EA 3G3HA 3QXMA 4F3SA 4MH5A 1DTGA 4YMBA 3DM0A 1LCTA 4POXA 2A5TA 2UXAA 2THIA 4O3BA 3VLWA 1A7LA 5EQ7A 3IFCA 4KQPA 4EXKA 1I69A 2I0CA 2X7PA 1SYHA 2HCAA 4KCCA 5LDZA 4OFJA 3S2VA 4GXSB 1FPBA 1CE2A 3M3KA 2DXYA 1B51A 1YZ0A 4BDRA 2GRVA 4ESXA 3EHTA 1FTKA 2NOOA 4P47A 4PTKA 2E0SA 4P9KA 1B9JA 3FUZA 4QFOA 1H44A 4MMPA 4PDDA 3FXRA 4GL8A 3PMWA 2BJIA 3CVGA 3R26A 5FTIA 1IXGA 2WEFA 3PPRA 3R6UA 4RPNA 3BFTA 1VDWA 5TPAA 1HSJA 2PBWA 4EQ7A 2QS1A 1UTBA 4H1XA 1LB9A 2H5YA 2KR0A 4XEQA 4POWA 1ZLQA 5HPQA 3QUFA 1UIVA 2CEYA 3EHUA 3OEMA 3WAEA 4RA1A 4E0XA 5BUUA 5AA2B 2QFLA 4QFNA 3TTLA 1DOTA 4U4SA 4G68A 4H0WA 4I62A 4RK2A 4LUBA 2I48A 4I3YA 1FCKA 5L9OA 5IZ3B 2ZZXA 3OD7A 4AB6A 2IEEA 3O6HA 1AL3A 3MP1A 3MVZA 2VOZA 1LB8A 4RNSA 2XA5A 2FIXA 3MZBA 3SEYA 4DDDA 2D21A 3IO6A 3E78A 4NF6B 3FV2A 1Y3NA 4EF1A 4MEVA 4NGUA 2HXWA 1LBCA 4F39A 4F1YA 4NG7A 1SBPA 5I57B 1NV0A 2QVVA 2NUVA 4R74A 3L6GA 2GQ1A 1N84A 3MP8A 2XXTA 1OQHA 5H8QA 1A54A 2OX3A 3MSTA 1PBQA 3EF7A 4O94A 2O7UA 2VD3A 4GX3A 4JDFA 4ZS9A 4ECFA 1S50A 4ZEBA 2LAOA 1A99A 5KZTA 3U65A 4GX4A 4XKPA 4NN3A 2DS9A 2F78A 4OYVA 2F6PA 3V83A 1NL5A 2OCUA 5AA4B 4OETA 3E4RA 2O51A 2ZZVA 2WKYA 3FJ7A 3PV0E 4IR8A 3VE1B 3K00A 1QJMA 4FATA 1NI9A 4GBVA 1BK4A 5H8HB 3VFJA 3EKIA 4IGTA 2Q8JA 2DP8A 1HSEA 1FQDA 5ET6A 5KCJA 4DXUA 1OVBA 2WX9A 2WBBA 5DVJA 4F1VA 3K2DA 2I6EA 1IXCA 5DVFA 1DPEA 3CFZA 4P1EA 4WXJA 2R9JA 1NV5A 4NAPA 2ZYNA 1OLCA 4U4XA 3E79A 4F2QA 3KC1A 3UK4A 1QUJA 4OVTA 3TZAA 2GHBA 4PC9A 4OHNA 1NFTA 3TTRA 1AOVA 1FTAA 4QFKA 2PVUA 4LZ8A 2HAUA 2ONSA 1NNFA 3SEXA 2HPGA 3I6VA 4HCYA 1AH5A 1LFIA 2I3VA 2ZNUA 3KJTA 2PT2A 3Q25A 1IMDA 4PFUA 4ZEFA 1B4HA 4FEBA 4Q30B 1Y20A 4H45A 2RKMA 4YKJA 1YYZA 3VXBA 2F7AA 1L5TA 4OVPA 1XT8A 5EYGA 2AL5A 4WEPA 1JNFA 4KFQA 3USDA 1CB6A 3IR1A 3OOAA 2Y7WA 3CIJA 5ICTA 3ECRA 3TQWA 1TT1A 4NF0A 2OJTA 4F1UA 1MXWA 1GV8A 3ZKKA 2QJEA 1UTHA 1D9QA 1URDA 1FBPA 1BLFA 1FBGA 2O69A 3K02A 2WYKA 5IKBA 3O29A 5CC2A 3CSBA 4OERA 4PCDA 4I8CA 5A5XA 1WODA 1Z7NE 2Y5KA 2Q2AA 2FNCA 3S9MC 1PDAA 2I58A 1MXXA 1UIUA 4GWYA 3G3GA 4HCWA 4BLAA 3ONMA 2FYIA 2ZZWA 2I4BA 2X7QA 2FA7A 1YTVA 3CFXA 1IUDA 5FHNA 5IM2A 1NUWA 3KOSA 2DVCA 4JWOA 3MVWA 2V3UA 2XWIA 3RPLB 5EQ8A 4GWWA 1EZPA 3EPEA 3QAXA 3U93A 2F8DA 2DOJA 3UA8A 3GXAA 1Q9DA 1FQFA 2XXHA 1S7YA 4ELOA 3JYRA 3TTMA 2ZNSA 3PGFA 3KBRA 4G68C 4O7MA 1B7HA 3C4MA 3VLVA 3RT8A 4JVDA 1DCUA 3MQ9A 3TYHA 2V3TA 2X26A 4BDMA 1FPJA 1G0HA 3C9HA 3C34A 5ET8A 3K6UA 4MLQA 3OMBA 4G4PA 5IAIA 1Y1MA 1IQ7A 1PB9A 4OVRA 4HE2A 4LP2B 4QBAA 1RDXA 4YAHX 4F31B 5HBCA 4ZZAA 3FXQA 3TFLA 5EHSA 3EN3A 2DWHA 2D3IA 4RJZA 1MQHA 3DP4A 4PGPA 2UVGA 4R75A 1MQJA 3H6TA 3HCQA 2ONKE 2VT5A 4C1UA 1N76A 3O97A 3MC2A 1B3HA 3N26A 3TEPA 1I6QA 4EF2A 1LAXA 4R9FA 4XTCQ 3K1MA 2HEUA 4G8NA 2P2AA 1IMFA 3H03A 4FE8A 5H8FA 3PUYE 4MAGA 5JTYB 4DCYA 2FVZA 3T0JA 1N04A 1LAGE 3A29A 3T1BA 2QS4A 1B6HA 4E0WA 2UVJA 2MKZA 3UN6A 2ANJA 2DE4A 3GZGA 4FEDA 1LAFE 4H5FA 3V5AA 3HN0A 3JV9A 5LOMA 1S9TA 4G8MA 1M5CA 2H4IA 3FIRA 2RC7A 3FV1A 4OFOA 3OXNA 2V84A 4I1DA 2Z8DA 3IL1B 2P1SA 1XOCA 1Q35A 1Y3QA 4JSDA 3T22A 2R8TA 5I84A 4IGRA 1OMPA 4XXUA 3QYTA 1FPDA 5DEXB 1B05A 1FPKA 1US5A 4YICA 1MM7A 2YLNA 3C32A 1QKAA 1RYOA 2VPNA 3HSTA 2QSXA 2L5VA 4ONYA 3VVFA 1MDQA 3K6XA 3DP6A 1D3KA 2F7CA 4R2FA 3BBRA 5I56B 5K2YA 3IK6B 3LC8A 1UQWA 4OVQA 3TMGA 4P0GA 2DE2A 1MM6A 2HZKA 1JW1A 4ND9A 1P1NA 3TPAA 3K6WA 2F36A 4H65A 1B0LA 2DVZA 3AXFA 3TQLA 2PYYA 1RDZA 2H99A 3CR9A 5H8NA 3PPQA 1BIYA 2OZZA 4Z7EA 4NTLA 1LBWA 1FBFA 4HS7A 1FRPA 4LQ2A 4NWDA 4YZZA 2QRYA 3C35A 4RXLA 1GGGA 3S9NC 5TU0A 4N81A 1NUZA 4PBHA 3MVYA 5TP9B 4U1ZA 3IB1A 4F29A 3M8UA 1B46A 1JVYA 5DVIA 4GWZA 1B40A 4GD5A 5CI5A 2OWSA 3IOVA 3EQ1A 4O3CA 3W15C 4NF4B 4IO7A 1QUKA 4GFRA 1PEBA 3FZVA 4TLMB 4PGNA 2ALUA 1IXIA 1NUYA 4OA4A 2AL4A 5I2KA 1VSOA 5IZZA 1IMEA 4DXBA 2XXVA 1IEJA 3T9VA 3LBSA 1FTMA 2UYFA 3U72A 4RK9A 4JSOA 3LSLA 1MDP1 1A8FA 1Q1KA 3OSQA 5I59B 3VXCA 1MPDA 4EDPA 1NNTA 3PD8A 2O84X 4PE3A 2VPOA 4X04A 2O68A 4F22A 1NV4A 2JJKA 3H6VA 2WBDA 2RCBA 1DBZA 3K6VA 4JWXA 3SEUA 3CFLA 1H43A 2I4CA 3TCFA 1XC1A 3OEKA 2QMXA 1KWHA 3OELA 1PBPA 1SYIA 3Q28A 5EQAA 5CMMA 4EXLA 3FVKA 3QIMA 5ISUA 3HHGA 1D4NA 1Y1ZA 3VVDA 4IO6A 1URGA 3IOUA 4EQBA 3UP9A 5ITPA 1IMBA 2QL3A 4F19A 1IITA 1R1NA 3N5LA 3V89B 3U92A 4O3AA 5B7DA 1WDNA 4ZDMA 4MNCA 4GWOA 1BTJA 3IO4A 1CNQA 4KYSA 1NV2A 1TFAA 2E1SA 4LATA 4XKNA 4BDNA 4MNIA 4UACA 5EHMA 1PB7A 3ROJA 4GBWA 2O6AA 2G29A 4MX6A 3K4UA 3RN8A 1RKMA 4MLVA 2XXRA 1B5HA 4KCDA 2Y7IA 4OMBA 1JQFA 1O64A 4PFWA 1VE4A 1MXYA 1NV6A 1B3GA 1D9YA 1GTKA 4DXCA 2R6GE 1DTZA 1ZIUA 2F3DA 3QMFA 1A8EA 4PFYA 4NF8B 4NMYA 4GL0A 3RUMA 4UA8A 3PUVE 4XF5A 3MWBA 5J16A 5I56A 3B8BA 3Q26A 3RGYA 4EUOA 4I3EA 3I3VA 2WYPA 4THIA 2VD2A 5AE4A 5I7IA 3RY3A 5I58A 4QSDA 1FJ9A 1EU8A 4N8YA 4ISUA 1EYIA 4MHFA 1ZTYA 4ESWA 3FJMA 3IORA 5IGAA 3C33A 1LBZA 1MQDA 3H06B 1FPFA 3FVNA 4DE8A 1NKXA 2ZYMA 1SPIA 3BFUA 1LFGA 2O1LA 4OFLA 5CBRA 2KQZA 2ZXTA 5BWJA 1FPGA 1ZBMA 1IXHA 3W9WA 2REGA 3RQTA 3KOTA 4LZ7A 2I0BA 4GWUA 3CG1A 3RPWA 3MYUA 1JP4A 1DK4A 4P8BA 1T0KA 1N7XA 3D4GA 2VHAA 1B1HA 3MZ9A 5AA3A 3N6UA 1I6BA 3B50A 4NF5B 3UGWA 2FBPA 2Q9TA 3Q29A 1D9VA 5H8SA 4MNPA 1LLSA 2DWAA 4GX6A 4RPOA 3H6WA 3FATA 4NE4A 4OANA 5AA2D 1H3DA 2QS2A 4F3BA 2D5WA 4FJPA 1LSTA 5JEIA 2F3BA 4NHBA 5I2NB 1SI0A 1OVTA 3TTKA 4N8GA 1QW0A 2NWJA 3HV1A 1Y4TA 3LSFB 1B7ZA 1B7UA 3GLBA 3KZGA 2M8CA 3FBPA 1QGXA 2Y7RA 3G3IA 4DCXA 4BDLA 2XXIA 3FVOA 5AA2A 3SETA 3KJ7A 1LAHE 3VDFA 4RYAA 1Y3PA 4PAKA 2KLFA 4QSEA 3KC0A 1P1WA 4PE5B 2DDKA 1J1NA 4F3PA 4JVCA 2RF1A 5IZ3A 5CBSA 2XD3A 2XX8A 1PB8A 3ILUB 1VFDA 4O7IA 4PFTA 4LQ5A 3P7IA 3SDFA 2XWVA 5F24A 3G3FA 3QUJA 1FBHA 4IO4A 4Q0CA 4JXIA 5ITOA 4NF6A 5KDTB 1USYH 4OVSA 1Z7ME 1RYXA 3ZSFA 3O6GA 3KGCA 5I57A 2R71A 1IZ1A 2Z23A 4U2RA 2CEXA 1GR2A 1MG1A 4G2ZA 5EQ9A 3E13X 4H67A 5EYHA 4QXDA 4C0RA 2XX9A 4AS4A 2A5TB 1FPEA 3IJOB 2PT1A 1TWYA 3V8XB 4GWXA 4GLIA 4PF6A 2Z8FA 3HO7A 1EYKA 3MPKA 1JEUA 1JW4A 1YXIA 1FPLA 2ONRA 4N91A 1Y4CA 3PUWE 3TDJA 4GIZA 5CM6A 4N6PA 5AA4A 1ELJA 1K9ZA 4FIMA 3B7DA 3THIA 4R6HA 4JVIA 2QS3A 2QVRA 2XHDA 1EYJA 4HE0A 3SKPA 5H8HA 3ZKLA 1B3FA 4GVOA 1INPA 3B6WA 3T96B 3DP8A 1FTLA 1VR5A 3KEIA 4P3LA 2OLBA 4QF9A 4IY5A 5TPAB 1B3EA 1FJ6A 4MFIA 1UTBB 2V25A 4I9DA 3KSJA 2B3FA 2QPQA 1F9BA 1FTJA 3MZ1A 4XFEA 1NMUA 1FPIA 1QULA 4X1BA 4YMAA 4KI0E 3QSLA 5CMCA 4N15A 3PMVA 4IO5A 4BDOA 1DPPA 2Z8EA 4G68B 1MRPA 2QVUA 3H3GA 3LSWA 1NV1A 1EH3A 1LBXA 4DI4B 3G3JA 4O8MA 4WKMA 1NH8A 1LBBA 2HZLA 2O1MA 4PP0A 3GBBA 4KPTA 5L8DA 1NNKA 1USYE 2CZKA 4Z0IA 5DW8A 4M4GA 3K01A 3GYYA 1B5IA 2HFBA 2CMOA 2Y5LA 4GF8A 2AYSA 1B1XA 2BJJX 4P56A 4ZECA 2B65A 4GWSA 2UVIA 4PQJA 3MW0A 3M3LA 4HXVA 5H8QB 2I49A 1MXVA 4OQOA 4LN5A 2DQVA 2XXPA 4P0IA 5B70A 1BKAA 2I3WA 3KSXA 3S9EA 2DXRA 3O66A 3OSRA 5DTBA 4IO3A 3CG3A 5T3JA 4U22A 3RPLA 4OESA 4F2OA 1PC3A 3O28A 4YB7A 5KDTA 5KCJB 3CSGA 3I5OA 4ZEIA 4R72A 2Y84A 4Q8RA 2DE3A 4JB7A 1KA1A 2F7BA 2XXYA 2AIXA 2V3QA 5FHOA 2FIEA 3LR1A 2V4CA 1N3XA 2QMWA 3B6QA 2P3VA 3MP6A 1XS5A 3U94A 3ODBA 1SDXA 3IX1A 3KBZA 4QFLA 4H8IA 3PUXE 1G0IA 3K0VA 1NUXA 1P99A 1P1OA 4ZE9A 1IMAA 4R9GA 4UABA 3PU5A 3F11A 3VVEA 4FORA 1LGBC 4BDQA 3T9XB 1MS7A 1FQCA 1P1UA 2Q8MA 4ELPA 5J1DA 1XHYA 1H45A 3WAFA 2CZLA 4DI3D 1IMCA 3G3KA 4DIGA 1JEVA 4EQ9A 4OWDA 2B4LA 3JZJA 3FGSA 4PETA 1O63A 1FW0A 4TLLB 3HFUA 3B6TA 2OWZA 3FJGA 3PPOA 4PAFA 3UIFA 5JTYA 1UTHB 2DSFA 4FECA 2H9BA 1MQGA 4GOTA 2P0SA 5DYHA 2ZYOA 3PTYA 4PAIA 2Y7KA 5A5XB 1YCJA 2NXOA 1B5JA 5AA1A 1QVSA 5HM4B 1JETA 1XVXA 1JW5A 2F35A 2REJA 1LBVA 4U23A 1M5BA 2VP1A 3FXUA 3MPLA 5ET7A 3LV0A 4U21A 4NWCA 1MY4A 4NEDA 1XVYA 4MCOA 1SQYA 3VLUA 1KA0A 3SESA 2VGQA 1JVXA 2GHAA 3T93B 5CMBA 3OO7A 4H46A 1YPNA 5DEXA 3SEVA 1R9QA 4GRKA 3E9XA 3RNNA 2Y7PA 4P1LA 1NV3A 2Q2CA 4XIGQ 4AS5A 4OENA 4HW8A 1AWBA 3FASA 2ZMBA 3TAJA 4YKPA 2XD2A 3KG2A 1R9LA 1M5DA 3R7XA 3LSXA 1N0TA 3D1RA 5CMKA 5LTCA 3TTNA 1MXZA 4PBQA 2PMSA 2YPNA 3O2AA 4PFRA 1HSLA 3NOHA 4R2BA 3IAZA 4GQOA 3ISPA 2ZYKA 4F18A 1FBEA 1ATGA 4KHZE 3PMXA 2F6GA 1SVXB 1II5A 3K1PA 1FBDA 4ZEKA 5EYFA 4DZ1A 4OEVA 4G61A 3D4CA 2XXXA 5TP9A 4AQ4A 3CHGA 2CZIA 4YB5A 2B4MA 4JBZA 5I3SA 5H8FB 1BP5A 1I6AA 4NF4A 1K9YA 3HHFA 4MF3A 3T9UA 3ZS6A 2Z22A 3CI8A 4G77A 4N4UA 4P11A 1A55A 4NX1A 4M1VA 4OXVA 1ZMGA 1MY2A 2H25A 2IA4A 1RDYA 1MH4A 2RCAA 5FHMA 3RTWB 2OK2A 4OTEA 3TCHA 3N6TA 5I59A 4HTGA 3H4ZA 1YAEA 2XXWA 1DMBA 3FD3A 3MAMA 1MPCA 3TUSA 2GH9A 1MY0A 4XKQA 2PFZA 3A3UA 4LONB 3E3KA 1P1QA 3T9HB 1H76A 1VFEA 4JWYA 2XWOA 1NV7A 3IJXB 4F3GA 3IOTA 3C31A
chains in the Genus database with same CATH topology
4MJOA 2QPQA 3IFAA 3W9VA 4GWZA 4XFEA 1FPIA 2OX3A 3MSTA 4PFBA 4KXPA 4O94A 4GX3A 5ET5A 4N15A 2HXRA 2F5XA 4PF8A 4X9TA 4PGNA 1NUYA 4OA4A 5IZZA 1IMEA 3U65A 4GX4A 4NN3A 2QVUA 4N6KA 3FXBA 5ESYA 1NV1A 2ZZVA 1LBXA 4IR8A 3SZPA 4X04A 4PE3A 2VPOA 4DI4B 1NV4A 2JJKA 1NI9A 2WBDA 2XWKA 4GBVA 4MIJA 1BK4A 4O8MA 1DBZA 3EKIA 2HZLA 2CZHA 5ET6A 5EQAA 2CZKA 2WX9A 5DW8A 2WBBA 5IZ1A 4F1VA 3GYYA 2P3NA 1FBCA 2Y5LA 4P1EA 4P56A 1NV5A 4NAPA 4HE1A 4GWSA 3E79A 3KC1A 2PCRA 4OVTA 4HXVA 1IMBA 4PC9A 4F19A 1FTAA 3BIHA 4LN5A 4MNCA 2HPGA 4HCYA 1CNQA 1NV2A 3RYDA 1IMDA 5FBPA 4NQ8A 4MNIA 4H45A 3ROJA 4GBWA 5T3JA 3RPLA 4MX6A 1YYZA 4OVPA 5EYGA 2DE3A 1FSAA 1KA1A 2V3QA 4NF0A 5I5PA 2PFYA 4F1UA 1NV6A 2FIEA 1D9QA 2V4CA 1FBPA 1FBGA 2F3DA 2WYKA 3QMFA 2P3VA 4PCDA 4PFIA 3KBZA 4XF5A 5J16A 2Y5KA 1G0IA 1NUXA 1IMAA 3B8BA 4UABA 1LBYA 4GWYA 4I3EA 4HCWA 2WYPA 4FBPA 2ZZWA 2Q8MA 5I7IA 4N17A 1FJ9A 5J1DA 4N8YA 1EYIA 4MHFA 5IM2A 1NUWA 3LUZA 2XWIA 3RPLB 5EQ8A 4GWWA 4DI3D 5IGAA 1IMCA 1LBZA 2XXKA 4N6DA 2B4LA 1Q9DA 1FPFA 4PETA 1LEVA 4I40A 1SPIA 3HFUA 2OWZA 2FHYA 2KQZA 1FPGA 4PAFA 3W9WA 4O7MA 1KZ8A 1XI6A 4JVDA 1DCUA 4GWUA 4PDHA 2HHMA 3PTYA 4PAIA 3MYUA 1JP4A 1DK4A 4P8BA 1FPJA 1G0HA 2Q74A 5ET8A 5A5LA 3B50A 2FBPA 2Q9TA 4X8RA 4MNPA 1LBVA 4OVRA 4GX6A 5ET7A 3LV0A 4HE2A 4OANA 4QBAA 5JK4A 1RDXA 4MCOA 1KA0A 2F3BA 4NHBA 4PGPA 3BIGA 4H46A 2VT5A 4N8GA 4P1LA 1IMFA 1NV3A 4AS5A 3FBPA 1QGXA 1AWBA 4MAGA 5EQ7A 3IFCA 4PAKA 2FVZA 3T0JA 3A29A 3D1RA 5LTCA 3KC0A 5LDZA 3T1BA 2DDKA 1FPBA 4JVCA 4PBQA 2MKZA 5IZ3A 1YZ0A 2DE4A 4PFRA 4P47A 4PTKA 4O7IA 4P9KA 3NOHA 4MMPA 4PDDA 2XWVA 5F24A 2BJIA 3ISPA 4F18A 1FBEA 1FBHA 4OVSA 2WEFA 2R8TA 1FBDA 1FPDA 1VDWA 1FPKA 2CEXA 4YICA 4G61A 5EQ9A 2KR0A 2VPNA 5EYHA 4QXDA 4XEQA 4AS4A 3CHGA 2CZIA 2L5VA 2B4MA 2CEYA 5I3SA 1FPEA 1K9YA 4GWXA 2QFLA 4N4UA 4PF6A 4NX1A 4M1VA 1EYKA 1RDYA 1YXIA 4OVQA 1FPLA 2DE2A 4N91A 2HZKA 4I3YA 5CM6A 5IZ3B 2ZZXA 1K9ZA 2DVZA 4JVIA 2QVRA 1RDZA 1EYJA 4HE0A 2XA5A 2FIXA 2PFZA 3E78A 1INPA 1LBWA 1FBFA 1FRPA 4YZZA 4MEVA 4NGUA 4P3LA 4NG7A 2XWOA 1NV0A 2QVVA 4N81A 1NUZA 1NV7A 4PBHA 2GQ1A 1FJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E78 A;  3E79 A;  3EKI A;  3MYU A; 
#chains in the Genus database with same CATH topology
 2UYE A;  4WED A;  3MVX A;  1MQI A;  4X48 A;  4MJO A;  4K3F A;  3A3C A;  1LFH A;  3VV5 A;  4ELQ A;  3IFA A;  3W9V A;  3T66 A;  1IIW A;  1AIV A;  4PFB A;  4QRZ A;  4KXP A;  4ZE8 A;  3QK6 A;  5ET5 A;  2DWI A;  2HXR A;  4TOZ A;  2F5X A;  4PF8 A;  1FQA A;  4X9T A;  1R6Z A;  2G93 A;  2OWT A;  3N94 A;  2V93 A;  1TXF A;  1DSN A;  2HQ0 A;  3MJN A;  3MUQ A;  2YJP A;  1NH7 A;  3IB0 A;  4N6K A;  1MPB A;  4OEU A;  3O6I A;  1Y9U A;  5ICQ A;  1B0H A;  1QKB A;  5F7V A;  4C1T A;  4YU0 A;  3FXB A;  2UVH A;  4KYD A;  5ESY A;  3SZP A;  3OO6 A;  1ZU0 A;  2XWK A;  4MIJ A;  4R6K A;  2RC9 A;  2RIN A;  4AB5 A;  5H8N B;  5L9M A;  2CZH A;  3A09 A;  1SW5 A;  4IB2 A;  1MH3 A;  4QHQ A;  1OQG A;  3M3F A;  3S4U A;  4IY6 A;  3KN7 A;  5IZ1 A;  2P3N A;  1FBC A;  1A40 A;  4X1D A;  1NNP A;  4R6Y A;  3C36 A;  2GFE A;  5FTH A;  4HE1 A;  2PCR A;  4U1O A;  1OLA A;  3EHS A;  1B3L A;  4NF8 A;  2XXQ A;  4YB6 A;  4L17 A;  3KN8 A;  3OO9 A;  3BIH A;  4KD5 A;  1WVJ A;  1EZO A;  1SI1 A;  1N7W A;  4KYE A;  4DLD A;  5I2K B;  4GXA A;  4R73 A;  4ZED A;  5M2V A;  5CRY A;  1POT A;  3RYD A;  5FBP A;  4NQ8 A;  3IB2 A;  5F1Q A;  3SEW A;  4LA9 A;  3IOW A;  2W7Y A;  3Q27 A;  5DT6 A;  1QUI A;  2F97 A;  3ILT B;  3UOR A;  1FSA A;  2H98 A;  3DLN A;  2OBG A;  3TCG A;  5I5P A;  2PFY A;  1SD3 A;  2ESN A;  4OZ9 A;  3DEL B;  3KN3 A;  3H7M A;  1SW2 A;  3FVG A;  1B58 A;  5L9S A;  3BKI B;  4PFI A;  2A5S A;  4YKI A;  2Q89 A;  1FQE A;  3LUY A;  3PPN A;  3L6H A;  1ZJL A;  5K2X A;  1M5F A;  3MBP A;  3HPI A;  1AMF A;  1MY3 A;  4NF5 A;  3OO8 A;  2DYX A;  1LBY A;  3K1N A;  3RTF B;  1POY 1;  4MBP A;  2Q88 A;  1B32 A;  4H8J A;  1MXU A;  1O7T A;  4FBP A;  1SW4 A;  1B4Z A;  2PX1 A;  4N17 A;  4YKK A;  3LUZ A;  3U1O A;  5I2N A;  3GBA A;  5ELV A;  1FTO A;  1B52 A;  2XX7 A;  2O7I A;  4H6D A;  4KR5 A;  2XXK A;  4N6D A;  4H5G A;  3KFM A;  4QFP A;  3PUZ E;  3TOD A;  1LEV A;  2HAV A;  4RY1 A;  4I40 A;  1US4 A;  3RLF E;  3RT6 B;  4G8H A;  2FHY A;  1B2H A;  4QSC A;  1EZ9 A;  4LVQ A;  1SW1 A;  3TEL A;  3TKD A;  2DWJ A;  1FQB A;  1TFD A;  2F34 A;  1KZ8 A;  1XI6 A;  3O9P A;  1URS A;  1LCF A;  3S9L C;  4IO2 A;  4ELR A;  4PDH A;  2HHM A;  4FAJ A;  4TQU Q;  2Q74 A;  2ABH A;  1ZKB A;  5A5L A;  4X8R A;  4XKR A;  4OVJ A;  3G7W A;  5JK4 A;  2RC8 A;  2ZNT A;  3PPP A;  1ANF A;  3PD9 A;  1MY1 A;  5I58 B;  3CRB A;  3SER A;  1N3W A;  2NVU B;  3U8Q A;  2XXU A;  4ZZE A;  4Q5T A;  4LZ5 A;  1GVC A;  1OIB A;  4N07 A;  3BIG A;  3H6U A;  3OEN A;  4N13 A;  2B3B A;  1M5E A;  3G3H A;  3QXM A;  4F3S A;  4MH5 A;  1DTG A;  4YMB A;  3DM0 A;  1LCT A;  4POX A;  2A5T A;  2UXA A;  2THI A;  4O3B A;  3VLW A;  1A7L A;  5EQ7 A;  3IFC A;  4KQP A;  4EXK A;  1I69 A;  2I0C A;  2X7P A;  1SYH A;  2HCA A;  4KCC A;  5LDZ A;  4OFJ A;  3S2V A;  4GXS B;  1FPB A;  1CE2 A;  3M3K A;  2DXY A;  1B51 A;  1YZ0 A;  4BDR A;  2GRV A;  4ESX A;  3EHT A;  1FTK A;  2NOO A;  4P47 A;  4PTK A;  2E0S A;  4P9K A;  1B9J A;  3FUZ A;  4QFO A;  1H44 A;  4MMP A;  4PDD A;  3FXR A;  4GL8 A;  3PMW A;  2BJI A;  3CVG A;  3R26 A;  5FTI A;  1IXG A;  2WEF A;  3PPR A;  3R6U A;  4RPN A;  3BFT A;  1VDW A;  5TPA A;  1HSJ A;  2PBW A;  4EQ7 A;  2QS1 A;  1UTB A;  4H1X A;  1LB9 A;  2H5Y A;  2KR0 A;  4XEQ A;  4POW A;  1ZLQ A;  5HPQ A;  3QUF A;  1UIV A;  2CEY A;  3EHU A;  3OEM A;  3WAE A;  4RA1 A;  4E0X A;  5BUU A;  5AA2 B;  2QFL A;  4QFN A;  3TTL A;  1DOT A;  4U4S A;  4G68 A;  4H0W A;  4I62 A;  4RK2 A;  4LUB A;  2I48 A;  4I3Y A;  1FCK A;  5L9O A;  5IZ3 B;  2ZZX A;  3OD7 A;  4AB6 A;  2IEE A;  3O6H A;  1AL3 A;  3MP1 A;  3MVZ A;  2VOZ A;  1LB8 A;  4RNS A;  2XA5 A;  2FIX A;  3MZB A;  3SEY A;  4DDD A;  2D21 A;  3IO6 A;  3E78 A;  4NF6 B;  3FV2 A;  1Y3N A;  4EF1 A;  4MEV A;  4NGU A;  2HXW A;  1LBC A;  4F39 A;  4F1Y A;  4NG7 A;  1SBP A;  5I57 B;  1NV0 A;  2QVV A;  2NUV A;  4R74 A;  3L6G A;  2GQ1 A;  1N84 A;  3MP8 A;  2XXT A;  1OQH A;  5H8Q A;  1A54 A;  2OX3 A;  3MST A;  1PBQ A;  3EF7 A;  4O94 A;  2O7U A;  2VD3 A;  4GX3 A;  4JDF A;  4ZS9 A;  4ECF A;  1S50 A;  4ZEB A;  2LAO A;  1A99 A;  5KZT A;  3U65 A;  4GX4 A;  4XKP A;  4NN3 A;  2DS9 A;  2F78 A;  4OYV A;  2F6P A;  3V83 A;  1NL5 A;  2OCU A;  5AA4 B;  4OET A;  3E4R A;  2O51 A;  2ZZV A;  2WKY A;  3FJ7 A;  3PV0 E;  4IR8 A;  3VE1 B;  3K00 A;  1QJM A;  4FAT A;  1NI9 A;  4GBV A;  1BK4 A;  5H8H B;  3VFJ A;  3EKI A;  4IGT A;  2Q8J A;  2DP8 A;  1HSE A;  1FQD A;  5ET6 A;  5KCJ A;  4DXU A;  1OVB A;  2WX9 A;  2WBB A;  5DVJ A;  4F1V A;  3K2D A;  2I6E A;  1IXC A;  5DVF A;  1DPE A;  3CFZ A;  4P1E A;  4WXJ A;  2R9J A;  1NV5 A;  4NAP A;  2ZYN A;  1OLC A;  4U4X A;  3E79 A;  4F2Q A;  3KC1 A;  3UK4 A;  1QUJ A;  4OVT A;  3TZA A;  2GHB A;  4PC9 A;  4OHN A;  1NFT A;  3TTR A;  1AOV A;  1FTA A;  4QFK A;  2PVU A;  4LZ8 A;  2HAU A;  2ONS A;  1NNF A;  3SEX A;  2HPG A;  3I6V A;  4HCY A;  1AH5 A;  1LFI A;  2I3V A;  2ZNU A;  3KJT A;  2PT2 A;  3Q25 A;  1IMD A;  4PFU A;  4ZEF A;  1B4H A;  4FEB A;  4Q30 B;  1Y20 A;  4H45 A;  2RKM A;  4YKJ A;  1YYZ A;  3VXB A;  2F7A A;  1L5T A;  4OVP A;  1XT8 A;  5EYG A;  2AL5 A;  4WEP A;  1JNF A;  4KFQ A;  3USD A;  1CB6 A;  3IR1 A;  3OOA A;  2Y7W A;  3CIJ A;  5ICT A;  3ECR A;  3TQW A;  1TT1 A;  4NF0 A;  2OJT A;  4F1U A;  1MXW A;  1GV8 A;  3ZKK A;  2QJE A;  1UTH A;  1D9Q A;  1URD A;  1FBP A;  1BLF A;  1FBG A;  2O69 A;  3K02 A;  2WYK A;  5IKB A;  3O29 A;  5CC2 A;  3CSB A;  4OER A;  4PCD A;  4I8C A;  5A5X A;  1WOD A;  1Z7N E;  2Y5K A;  2Q2A A;  2FNC A;  3S9M C;  1PDA A;  2I58 A;  1MXX A;  1UIU A;  4GWY A;  3G3G A;  4HCW A;  4BLA A;  3ONM A;  2FYI A;  2ZZW A;  2I4B A;  2X7Q A;  2FA7 A;  1YTV A;  3CFX A;  1IUD A;  5FHN A;  5IM2 A;  1NUW A;  3KOS A;  2DVC A;  4JWO A;  3MVW A;  2V3U A;  2XWI A;  3RPL B;  5EQ8 A;  4GWW A;  1EZP A;  3EPE A;  3QAX A;  3U93 A;  2F8D A;  2DOJ A;  3UA8 A;  3GXA A;  1Q9D A;  1FQF A;  2XXH A;  1S7Y A;  4ELO A;  3JYR A;  3TTM A;  2ZNS A;  3PGF A;  3KBR A;  4G68 C;  4O7M A;  1B7H A;  3C4M A;  3VLV A;  3RT8 A;  4JVD A;  1DCU A;  3MQ9 A;  3TYH A;  2V3T A;  2X26 A;  4BDM A;  1FPJ A;  1G0H A;  3C9H A;  3C34 A;  5ET8 A;  3K6U A;  4MLQ A;  3OMB A;  4G4P A;  5IAI A;  1Y1M A;  1IQ7 A;  1PB9 A;  4OVR A;  4HE2 A;  4LP2 B;  4QBA A;  1RDX A;  4YAH X;  4F31 B;  5HBC A;  4ZZA A;  3FXQ A;  3TFL A;  5EHS A;  3EN3 A;  2DWH A;  2D3I A;  4RJZ A;  1MQH A;  3DP4 A;  4PGP A;  2UVG A;  4R75 A;  1MQJ A;  3H6T A;  3HCQ A;  2ONK E;  2VT5 A;  4C1U A;  1N76 A;  3O97 A;  3MC2 A;  1B3H A;  3N26 A;  3TEP A;  1I6Q A;  4EF2 A;  1LAX A;  4R9F A;  4XTC Q;  3K1M A;  2HEU A;  4G8N A;  2P2A A;  1IMF A;  3H03 A;  4FE8 A;  5H8F A;  3PUY E;  4MAG A;  5JTY B;  4DCY A;  2FVZ A;  3T0J A;  1N04 A;  1LAG E;  3A29 A;  3T1B A;  2QS4 A;  1B6H A;  4E0W A;  2UVJ A;  2MKZ A;  3UN6 A;  2ANJ A;  2DE4 A;  3GZG A;  4FED A;  1LAF E;  4H5F A;  3V5A A;  3HN0 A;  3JV9 A;  5LOM A;  1S9T A;  4G8M A;  1M5C A;  2H4I A;  3FIR A;  2RC7 A;  3FV1 A;  4OFO A;  3OXN A;  2V84 A;  4I1D A;  2Z8D A;  3IL1 B;  2P1S A;  1XOC A;  1Q35 A;  1Y3Q A;  4JSD A;  3T22 A;  2R8T A;  5I84 A;  4IGR A;  1OMP A;  4XXU A;  3QYT A;  1FPD A;  5DEX B;  1B05 A;  1FPK A;  1US5 A;  4YIC A;  1MM7 A;  2YLN A;  3C32 A;  1QKA A;  1RYO A;  2VPN A;  3HST A;  2QSX A;  2L5V A;  4ONY A;  3VVF A;  1MDQ A;  3K6X A;  3DP6 A;  1D3K A;  2F7C A;  4R2F A;  3BBR A;  5I56 B;  5K2Y A;  3IK6 B;  3LC8 A;  1UQW A;  4OVQ A;  3TMG A;  4P0G A;  2DE2 A;  1MM6 A;  2HZK A;  1JW1 A;  4ND9 A;  1P1N A;  3TPA A;  3K6W A;  2F36 A;  4H65 A;  1B0L A;  2DVZ A;  3AXF A;  3TQL A;  2PYY A;  1RDZ A;  2H99 A;  3CR9 A;  5H8N A;  3PPQ A;  1BIY A;  2OZZ A;  4Z7E A;  4NTL A;  1LBW A;  1FBF A;  4HS7 A;  1FRP A;  4LQ2 A;  4NWD A;  4YZZ A;  2QRY A;  3C35 A;  4RXL A;  1GGG A;  3S9N C;  5TU0 A;  4N81 A;  1NUZ A;  4PBH A;  3MVY A;  5TP9 B;  4U1Z A;  3IB1 A;  4F29 A;  3M8U A;  1B46 A;  1JVY A;  5DVI A;  4GWZ A;  1B40 A;  4GD5 A;  5CI5 A;  2OWS A;  3IOV A;  3EQ1 A;  4O3C A;  3W15 C;  4NF4 B;  4IO7 A;  1QUK A;  4GFR A;  1PEB A;  3FZV A;  4TLM B;  4PGN A;  2ALU A;  1IXI A;  1NUY A;  4OA4 A;  2AL4 A;  5I2K A;  1VSO A;  5IZZ A;  1IME A;  4DXB A;  2XXV A;  1IEJ A;  3T9V A;  3LBS A;  1FTM A;  2UYF A;  3U72 A;  4RK9 A;  4JSO A;  3LSL A;  1MDP 1;  1A8F A;  1Q1K A;  3OSQ A;  5I59 B;  3VXC A;  1MPD A;  4EDP A;  1NNT A;  3PD8 A;  2O84 X;  4PE3 A;  2VPO A;  4X04 A;  2O68 A;  4F22 A;  1NV4 A;  2JJK A;  3H6V A;  2WBD A;  2RCB A;  1DBZ A;  3K6V A;  4JWX A;  3SEU A;  3CFL A;  1H43 A;  2I4C A;  3TCF A;  1XC1 A;  3OEK A;  2QMX A;  1KWH A;  3OEL A;  1PBP A;  1SYI A;  3Q28 A;  5EQA A;  5CMM A;  4EXL A;  3FVK A;  3QIM A;  5ISU A;  3HHG A;  1D4N A;  1Y1Z A;  3VVD A;  4IO6 A;  1URG A;  3IOU A;  4EQB A;  3UP9 A;  5ITP A;  1IMB A;  2QL3 A;  4F19 A;  1IIT A;  1R1N A;  3N5L A;  3V89 B;  3U92 A;  4O3A A;  5B7D A;  1WDN A;  4ZDM A;  4MNC A;  4GWO A;  1BTJ A;  3IO4 A;  1CNQ A;  4KYS A;  1NV2 A;  1TFA A;  2E1S A;  4LAT A;  4XKN A;  4BDN A;  4MNI A;  4UAC A;  5EHM A;  1PB7 A;  3ROJ A;  4GBW A;  2O6A A;  2G29 A;  4MX6 A;  3K4U A;  3RN8 A;  1RKM A;  4MLV A;  2XXR A;  1B5H A;  4KCD A;  2Y7I A;  4OMB A;  1JQF A;  1O64 A;  4PFW A;  1VE4 A;  1MXY A;  1NV6 A;  1B3G A;  1D9Y A;  1GTK A;  4DXC A;  2R6G E;  1DTZ A;  1ZIU A;  2F3D A;  3QMF A;  1A8E A;  4PFY A;  4NF8 B;  4NMY A;  4GL0 A;  3RUM A;  4UA8 A;  3PUV E;  4XF5 A;  3MWB A;  5J16 A;  5I56 A;  3B8B A;  3Q26 A;  3RGY A;  4EUO A;  4I3E A;  3I3V A;  2WYP A;  4THI A;  2VD2 A;  5AE4 A;  5I7I A;  3RY3 A;  5I58 A;  4QSD A;  1FJ9 A;  1EU8 A;  4N8Y A;  4ISU A;  1EYI A;  4MHF A;  1ZTY A;  4ESW A;  3FJM A;  3IOR A;  5IGA A;  3C33 A;  1LBZ A;  1MQD A;  3H06 B;  1FPF A;  3FVN A;  4DE8 A;  1NKX A;  2ZYM A;  1SPI A;  3BFU A;  1LFG A;  2O1L A;  4OFL A;  5CBR A;  2KQZ A;  2ZXT A;  5BWJ A;  1FPG A;  1ZBM A;  1IXH A;  3W9W A;  2REG A;  3RQT A;  3KOT A;  4LZ7 A;  2I0B A;  4GWU A;  3CG1 A;  3RPW A;  3MYU A;  1JP4 A;  1DK4 A;  4P8B A;  1T0K A;  1N7X A;  3D4G A;  2VHA A;  1B1H A;  3MZ9 A;  5AA3 A;  3N6U A;  1I6B A;  3B50 A;  4NF5 B;  3UGW A;  2FBP A;  2Q9T A;  3Q29 A;  1D9V A;  5H8S A;  4MNP A;  1LLS A;  2DWA A;  4GX6 A;  4RPO A;  3H6W A;  3FAT A;  4NE4 A;  4OAN A;  5AA2 D;  1H3D A;  2QS2 A;  4F3B A;  2D5W A;  4FJP A;  1LST A;  5JEI A;  2F3B A;  4NHB A;  5I2N B;  1SI0 A;  1OVT A;  3TTK A;  4N8G A;  1QW0 A;  2NWJ A;  3HV1 A;  1Y4T A;  3LSF B;  1B7Z A;  1B7U A;  3GLB A;  3KZG A;  2M8C A;  3FBP A;  1QGX A;  2Y7R A;  3G3I A;  4DCX A;  4BDL A;  2XXI A;  3FVO A;  5AA2 A;  3SET A;  3KJ7 A;  1LAH E;  3VDF A;  4RYA A;  1Y3P A;  4PAK A;  2KLF A;  4QSE A;  3KC0 A;  1P1W A;  4PE5 B;  2DDK A;  1J1N A;  4F3P A;  4JVC A;  2RF1 A;  5IZ3 A;  5CBS A;  2XD3 A;  2XX8 A;  1PB8 A;  3ILU B;  1VFD A;  4O7I A;  4PFT A;  4LQ5 A;  3P7I A;  3SDF A;  2XWV A;  5F24 A;  3G3F A;  3QUJ A;  1FBH A;  4IO4 A;  4Q0C A;  4JXI A;  5ITO A;  4NF6 A;  5KDT B;  1USY H;  4OVS A;  1Z7M E;  1RYX A;  3ZSF A;  3O6G A;  3KGC A;  5I57 A;  2R71 A;  1IZ1 A;  2Z23 A;  4U2R A;  2CEX A;  1GR2 A;  1MG1 A;  4G2Z A;  5EQ9 A;  3E13 X;  4H67 A;  5EYH A;  4QXD A;  4C0R A;  2XX9 A;  4AS4 A;  2A5T B;  1FPE A;  3IJO B;  2PT1 A;  1TWY A;  3V8X B;  4GWX A;  4GLI A;  4PF6 A;  2Z8F A;  3HO7 A;  1EYK A;  3MPK A;  1JEU A;  1JW4 A;  1YXI A;  1FPL A;  2ONR A;  4N91 A;  1Y4C A;  3PUW E;  3TDJ A;  4GIZ A;  5CM6 A;  4N6P A;  5AA4 A;  1ELJ A;  1K9Z A;  4FIM A;  3B7D A;  3THI A;  4R6H A;  4JVI A;  2QS3 A;  2QVR A;  2XHD A;  1EYJ A;  4HE0 A;  3SKP A;  5H8H A;  3ZKL A;  1B3F A;  4GVO A;  1INP A;  3B6W A;  3T96 B;  3DP8 A;  1FTL A;  1VR5 A;  3KEI A;  4P3L A;  2OLB A;  4QF9 A;  4IY5 A;  5TPA B;  1B3E A;  1FJ6 A;  4MFI A;  1UTB B;  2V25 A;  4I9D A;  3KSJ A;  2B3F A;  2QPQ A;  1F9B A;  1FTJ A;  3MZ1 A;  4XFE A;  1NMU A;  1FPI A;  1QUL A;  4X1B A;  4YMA A;  4KI0 E;  3QSL A;  5CMC A;  4N15 A;  3PMV A;  4IO5 A;  4BDO A;  1DPP A;  2Z8E A;  4G68 B;  1MRP A;  2QVU A;  3H3G A;  3LSW A;  1NV1 A;  1EH3 A;  1LBX A;  4DI4 B;  3G3J A;  4O8M A;  4WKM A;  1NH8 A;  1LBB A;  2HZL A;  2O1M A;  4PP0 A;  3GBB A;  4KPT A;  5L8D A;  1NNK A;  1USY E;  2CZK A;  4Z0I A;  5DW8 A;  4M4G A;  3K01 A;  3GYY A;  1B5I A;  2HFB A;  2CMO A;  2Y5L A;  4GF8 A;  2AYS A;  1B1X A;  2BJJ X;  4P56 A;  4ZEC A;  2B65 A;  4GWS A;  2UVI A;  4PQJ A;  3MW0 A;  3M3L A;  4HXV A;  5H8Q B;  2I49 A;  1MXV A;  4OQO A;  4LN5 A;  2DQV A;  2XXP A;  4P0I A;  5B70 A;  1BKA A;  2I3W A;  3KSX A;  3S9E A;  2DXR A;  3O66 A;  3OSR A;  5DTB A;  4IO3 A;  3CG3 A;  5T3J A;  4U22 A;  3RPL A;  4OES A;  4F2O A;  1PC3 A;  3O28 A;  4YB7 A;  5KDT A;  5KCJ B;  3CSG A;  3I5O A;  4ZEI A;  4R72 A;  2Y84 A;  4Q8R A;  2DE3 A;  4JB7 A;  1KA1 A;  2F7B A;  2XXY A;  2AIX A;  2V3Q A;  5FHO A;  2FIE A;  3LR1 A;  2V4C A;  1N3X A;  2QMW A;  3B6Q A;  2P3V A;  3MP6 A;  1XS5 A;  3U94 A;  3ODB A;  1SDX A;  3IX1 A;  3KBZ A;  4QFL A;  4H8I A;  3PUX E;  1G0I A;  3K0V A;  1NUX A;  1P99 A;  1P1O A;  4ZE9 A;  1IMA A;  4R9G A;  4UAB A;  3PU5 A;  3F11 A;  3VVE A;  4FOR A;  1LGB C;  4BDQ A;  3T9X B;  1MS7 A;  1FQC A;  1P1U A;  2Q8M A;  4ELP A;  5J1D A;  1XHY A;  1H45 A;  3WAF A;  2CZL A;  4DI3 D;  1IMC A;  3G3K A;  4DIG A;  1JEV A;  4EQ9 A;  4OWD A;  2B4L A;  3JZJ A;  3FGS A;  4PET A;  1O63 A;  1FW0 A;  4TLL B;  3HFU A;  3B6T A;  2OWZ A;  3FJG A;  3PPO A;  4PAF A;  3UIF A;  5JTY A;  1UTH B;  2DSF A;  4FEC A;  2H9B A;  1MQG A;  4GOT A;  2P0S A;  5DYH A;  2ZYO A;  3PTY A;  4PAI A;  2Y7K A;  5A5X B;  1YCJ A;  2NXO A;  1B5J A;  5AA1 A;  1QVS A;  5HM4 B;  1JET A;  1XVX A;  1JW5 A;  2F35 A;  2REJ A;  1LBV A;  4U23 A;  1M5B A;  2VP1 A;  3FXU A;  3MPL A;  5ET7 A;  3LV0 A;  4U21 A;  4NWC A;  1MY4 A;  4NED A;  1XVY A;  4MCO A;  1SQY A;  3VLU A;  1KA0 A;  3SES A;  2VGQ A;  1JVX A;  2GHA A;  3T93 B;  5CMB A;  3OO7 A;  4H46 A;  1YPN A;  5DEX A;  3SEV A;  1R9Q A;  4GRK A;  3E9X A;  3RNN A;  2Y7P A;  4P1L A;  1NV3 A;  2Q2C A;  4XIG Q;  4AS5 A;  4OEN A;  4HW8 A;  1AWB A;  3FAS A;  2ZMB A;  3TAJ A;  4YKP A;  2XD2 A;  3KG2 A;  1R9L A;  1M5D A;  3R7X A;  3LSX A;  1N0T A;  3D1R A;  5CMK A;  5LTC A;  3TTN A;  1MXZ A;  4PBQ A;  2PMS A;  2YPN A;  3O2A A;  4PFR A;  1HSL A;  3NOH A;  4R2B A;  3IAZ A;  4GQO A;  3ISP A;  2ZYK A;  4F18 A;  1FBE A;  1ATG A;  4KHZ E;  3PMX A;  2F6G A;  1SVX B;  1II5 A;  3K1P A;  1FBD A;  4ZEK A;  5EYF A;  4DZ1 A;  4OEV A;  4G61 A;  3D4C A;  2XXX A;  5TP9 A;  4AQ4 A;  3CHG A;  2CZI A;  4YB5 A;  2B4M A;  4JBZ A;  5I3S A;  5H8F B;  1BP5 A;  1I6A A;  4NF4 A;  1K9Y A;  3HHF A;  4MF3 A;  3T9U A;  3ZS6 A;  2Z22 A;  3CI8 A;  4G77 A;  4N4U A;  4P11 A;  1A55 A;  4NX1 A;  4M1V A;  4OXV A;  1ZMG A;  1MY2 A;  2H25 A;  2IA4 A;  1RDY A;  1MH4 A;  2RCA A;  5FHM A;  3RTW B;  2OK2 A;  4OTE A;  3TCH A;  3N6T A;  5I59 A;  4HTG A;  3H4Z A;  1YAE A;  2XXW A;  1DMB A;  3FD3 A;  3MAM A;  1MPC A;  3TUS A;  2GH9 A;  1MY0 A;  4XKQ A;  2PFZ A;  3A3U A;  4LON B;  3E3K A;  1P1Q A;  3T9H B;  1H76 A;  1VFE A;  4JWY A;  2XWO A;  1NV7 A;  3IJX B;  4F3G A;  3IOT A;  3C31 A; 
#chains in the Genus database with same CATH homology
 4MJO A;  2QPQ A;  3IFA A;  3W9V A;  4GWZ A;  4XFE A;  1FPI A;  2OX3 A;  3MST A;  4PFB A;  4KXP A;  4O94 A;  4GX3 A;  5ET5 A;  4N15 A;  2HXR A;  2F5X A;  4PF8 A;  4X9T A;  4PGN A;  1NUY A;  4OA4 A;  5IZZ A;  1IME A;  3U65 A;  4GX4 A;  4NN3 A;  2QVU A;  4N6K A;  3FXB A;  5ESY A;  1NV1 A;  2ZZV A;  1LBX A;  4IR8 A;  3SZP A;  4X04 A;  4PE3 A;  2VPO A;  4DI4 B;  1NV4 A;  2JJK A;  1NI9 A;  2WBD A;  2XWK A;  4GBV A;  4MIJ A;  1BK4 A;  4O8M A;  1DBZ A;  3EKI A;  2HZL A;  2CZH A;  5ET6 A;  5EQA A;  2CZK A;  2WX9 A;  5DW8 A;  2WBB A;  5IZ1 A;  4F1V A;  3GYY A;  2P3N A;  1FBC A;  2Y5L A;  4P1E A;  4P56 A;  1NV5 A;  4NAP A;  4HE1 A;  4GWS A;  3E79 A;  3KC1 A;  2PCR A;  4OVT A;  4HXV A;  1IMB A;  4PC9 A;  4F19 A;  1FTA A;  3BIH A;  4LN5 A;  4MNC A;  2HPG A;  4HCY A;  1CNQ A;  1NV2 A;  3RYD A;  1IMD A;  5FBP A;  4NQ8 A;  4MNI A;  4H45 A;  3ROJ A;  4GBW A;  5T3J A;  3RPL A;  4MX6 A;  1YYZ A;  4OVP A;  5EYG A;  2DE3 A;  1FSA A;  1KA1 A;  2V3Q A;  4NF0 A;  5I5P A;  2PFY A;  4F1U A;  1NV6 A;  2FIE A;  1D9Q A;  2V4C A;  1FBP A;  1FBG A;  2F3D A;  2WYK A;  3QMF A;  2P3V A;  4PCD A;  4PFI A;  3KBZ A;  4XF5 A;  5J16 A;  2Y5K A;  1G0I A;  1NUX A;  1IMA A;  3B8B A;  4UAB A;  1LBY A;  4GWY A;  4I3E A;  4HCW A;  2WYP A;  4FBP A;  2ZZW A;  2Q8M A;  5I7I A;  4N17 A;  1FJ9 A;  5J1D A;  4N8Y A;  1EYI A;  4MHF A;  5IM2 A;  1NUW A;  3LUZ A;  2XWI A;  3RPL B;  5EQ8 A;  4GWW A;  4DI3 D;  5IGA A;  1IMC A;  1LBZ A;  2XXK A;  4N6D A;  2B4L A;  1Q9D A;  1FPF A;  4PET A;  1LEV A;  4I40 A;  1SPI A;  3HFU A;  2OWZ A;  2FHY A;  2KQZ A;  1FPG A;  4PAF A;  3W9W A;  4O7M A;  1KZ8 A;  1XI6 A;  4JVD A;  1DCU A;  4GWU A;  4PDH A;  2HHM A;  3PTY A;  4PAI A;  3MYU A;  1JP4 A;  1DK4 A;  4P8B A;  1FPJ A;  1G0H A;  2Q74 A;  5ET8 A;  5A5L A;  3B50 A;  2FBP A;  2Q9T A;  4X8R A;  4MNP A;  1LBV A;  4OVR A;  4GX6 A;  5ET7 A;  3LV0 A;  4HE2 A;  4OAN A;  4QBA A;  5JK4 A;  1RDX A;  4MCO A;  1KA0 A;  2F3B A;  4NHB A;  4PGP A;  3BIG A;  4H46 A;  2VT5 A;  4N8G A;  4P1L A;  1IMF A;  1NV3 A;  4AS5 A;  3FBP A;  1QGX A;  1AWB A;  4MAG A;  5EQ7 A;  3IFC A;  4PAK A;  2FVZ A;  3T0J A;  3A29 A;  3D1R A;  5LTC A;  3KC0 A;  5LDZ A;  3T1B A;  2DDK A;  1FPB A;  4JVC A;  4PBQ A;  2MKZ A;  5IZ3 A;  1YZ0 A;  2DE4 A;  4PFR A;  4P47 A;  4PTK A;  4O7I A;  4P9K A;  3NOH A;  4MMP A;  4PDD A;  2XWV A;  5F24 A;  2BJI A;  3ISP A;  4F18 A;  1FBE A;  1FBH A;  4OVS A;  2WEF A;  2R8T A;  1FBD A;  1FPD A;  1VDW A;  1FPK A;  2CEX A;  4YIC A;  4G61 A;  5EQ9 A;  2KR0 A;  2VPN A;  5EYH A;  4QXD A;  4XEQ A;  4AS4 A;  3CHG A;  2CZI A;  2L5V A;  2B4M A;  2CEY A;  5I3S A;  1FPE A;  1K9Y A;  4GWX A;  2QFL A;  4N4U A;  4PF6 A;  4NX1 A;  4M1V A;  1EYK A;  1RDY A;  1YXI A;  4OVQ A;  1FPL A;  2DE2 A;  4N91 A;  2HZK A;  4I3Y A;  5CM6 A;  5IZ3 B;  2ZZX A;  1K9Z A;  2DVZ A;  4JVI A;  2QVR A;  1RDZ A;  1EYJ A;  4HE0 A;  2XA5 A;  2FIX A;  2PFZ A;  3E78 A;  1INP A;  1LBW A;  1FBF A;  1FRP A;  4YZZ A;  4MEV A;  4NGU A;  4P3L A;  4NG7 A;  2XWO A;  1NV0 A;  2QVV A;  4N81 A;  1NUZ A;  1NV7 A;  4PBH A;  2GQ1 A;  1FJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...