5CMBA

Mnemiopsis leidyi ml032222a iglur lbd r703k mutant glycine complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
247
structure length
247
Chain Sequence
LIGRHLRLGSVEEQPFMFFATEGCEGNDCWSGMVNDMVVKLSEDLGFTYEYIQPDDRKFGALNKTTNEWNGMIRDLLDDKTDMIAIDLSTNSARKSAIDYSFPFMDAGIKAVVKGEGTTLNQVLELLDQDKYKWGVIGSKHPETLLKTHRDSRYSRLVDEGVELKDLNHAIETLRGGLFVFIDEGPVLAHNLISDCDVFSVGEEFQSFEYAFGLPKDSPYKSLIDSHLLKFREEGFIDILWEKWSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords ML032222a iGluR
publication title Molecular lock regulates binding of glycine to a primitive NMDA receptor.
pubmed doi rcsb
source organism Mnemiopsis leidyi
total genus 78
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5cmbA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5cmbA02
1B9JA 5ICTA 3KOSA 4X1DA 5EHSA 3I6VA 2OBGA 2F36A 3K6UA 4YB7A 2QPQA 1SYIA 3KN8A 1Y1MA 2P0SA 3HV1A 1B1HA 4XXUA 1LB9A 1D9VA 4FORA 3IO4A 1B3HA 4F1YA 3ODBA 5DEXA 2UVHA 3KJ7A 1B32A 1R1NA 2RC9A 1UTBB 3C32A 1Y1ZA 2WKYA 3MZ9A 4Q5TA 2OWTA 4YICA 1HSLA 4I62A 2RC8A 1B2HA 2F5XA 2HCAA 2F35A 3IO6A 4EXKA 1SW5A 4GOTA 1MM6A 4HTGA 1GVCA 2HZLA 3RLFE 4GVOA 4QRZA 3MZBA 3EPEA 5LOMA 1MPBA 4R72A 3A3UA 4KD5A 2XD3A 3PPOA 4YKIA 4P11A 1MM7A 3TTMA 1JETA 4IO5A 1UTHB 1H3DA 1H43A 2F8DA 2YJPA 3C31A 1VE4A 4NWCA 5TP9B 2XD2A 2GHAA 4E0WA 3IOTA 5K2XA 4U21A 3FV2A 3TTNA 3LSWA 3CIJA 4G68C 3W9WA 4Q30B 4F29A 4I9DA 2QS3A 1LAHE 4FATA 5I59A 4H8IA 3MC2A 3N94A 1RYXA 1MQDA 3HCQA 4EQ7A 4U2RA 3G3JA 2Z8FA 2THIA 3FVKA 1HSJA 4YMBA 3GBBA 3PD8A 3VXBA 1AL3A 1B58A 3CFZA 1MY4A 1NH7A 1B46A 1Y20A 5DYHA 3QUJA 3MVYA 3IJXB 4YKKA 3QIMA 4G4PA 2Q2CA 1S50A 4GXAA 4ZZEA 3RPWA 3QXMA 4IO3A 1TT1A 4RXLA 5H8NB 1GV8A 3DLNA 4X48A 4ZEFA 1LCTA 4F3BA 2OJTA 1HSEA 3MW0A 1MRPA 1B52A 3U1OA 5CMKA 2PX1A 4LONB 5I84A 3H6VA 3HPIA 3LSFB 4JSDA 1OQHA 4NF6A 1DPPA 4RJZA 1FCKA 5DVFA 2HAUA 1DTGA 3PV0E 1NKXA 3UP9A 3BBRA 3CG1A 5H8HA 3MZ1A 4ND9A 5H8FB 2DE3A 3H6UA 1B3FA 1Z7ME 4ONYA 2XXUA 4JBZA 4FIMA 2GFEA 3BFTA 3O97A 3DM0A 1BTJA 4ZECA 2O6AA 3OD7A 5TU0A 4MH5A 1USYH 2XXPA 5I57A 5J1DA 1NH8A 3EHUA 4NF4A 5I58B 4GWOA 4KCCA 2DWAA 2O7UA 2XXRA 1J1NA 4KHZE 1NNFA 3IJOB 5CBRA 2H9BA 2X7QA 4ESXA 4DCXA 1LGBC 2Q9TA 4ZEBA 1Q1KA 2I58A 2DP8A 1Y3QA 2OWSA 1M5CA 3PUXE 4DZ1A 1UQWA 4DXBA 3LSLA 4YAHX 5I2KA 1Y9UA 4OVJA 4YB6A 5TPAB 1H45A 3EHSA 3S9LC 4BDRA 3LC8A 2HFBA 4RA1A 1MY2A 3D4CA 2D21A 5FTHA 4R9GA 3KSJA 3KGCA 3Q28A 1VR5A 5AA4A 2I3VA 3MWBA 1POY1 3QSLA 1QUKA 3PPQA 4FEBA 2QJEA 4R75A 5CBSA 1ANFA 3HHGA 3K2DA 3KFMA 2FYIA 1R9QA 3LR1A 3O6IA 3W15C 2H4IA 3AXFA 1OLAA 1MS7A 2QMXA 1B40A 4FEDA 1XVXA 2A5TB 2QL3A 3EF7A 3PUVE 4PETA 3OO6A 4DDDA 4H5FA 3TCFA 1N04A 2XXIA 3PPNA 2BJJX 3OOAA 4JWXA 4GXSB 1O63A 2DXRA 3IB1A 1P1NA 4F2OA 4OHNA 5CI5A 3R6UA 4OERA 2I0CA 2F7AA 1LFGA 3O28A 3U8QA 3KZGA 3M3KA 1PBPA 2VGQA 3C33A 3FVGA 3N5LA 4MLVA 1PC3A 2RCAA 4MLQA 1R6ZA 2F78A 4O3CA 4X9TA 3VDFA 1OVTA 1POTA 3K6VA 4JDFA 2PVUA 4OFJA 4G68A 3TTRA 4TQUQ 2DVCA 3ILTB 1DOTA 4U4XA 4F2QA 5AA2D 4IY6A 2B3FA 4IO4A 1URSA 2ZYNA 2NUVA 5AA2B 4Z0IA 3T22A 2XX7A 4ECFA 1B7UA 2GRVA 3TEPA 3C34A 1EZOA 1D3KA 2F6GA 3B6WA 4LA9A 4ZZAA 4JXIA 4H0WA 1VFDA 4G2ZA 2I49A 1LSTA 3RTFB 3O6HA 2XXXA 5BWJA 2Z23A 4FJPA 1MXWA 4OQOA 4R74A 2I6EA 2ABHA 3OMBA 4OWDA 4NF8A 3H4ZA 3PUZE 4QF9A 3KN7A 1ZIUA 1PEBA 2M8CA 1B05A 2I0BA 3RNNA 1SQYA 2O1MA 4I1DA 3U92A 3M3FA 3U93A 2Y7WA 1MPCA 3N6UA 1N0TA 4XKQA 1R9LA 2A5SA 5DEXB 1N76A 1I6BA 3WAFA 3TFLA 4BDOA 1B7ZA 4YKPA 4H65A 3OO7A 3TZAA 1S9TA 4PFUA 4ZEIA 3B6TA 5FHOA 1AOVA 4EF1A 5A5XA 2QS4A 1LB8A 2GH9A 4LUBA 3PUWE 5F1QA 1B5IA 4U1OA 1A99A 1NNKA 2QRYA 4YZZA 3C4MA 1N3XA 4HCWA 4YKJA 2RCBA 1URDA 1Y3PA 2QS1A 2Q88A 3O2AA 3JYRA 3O29A 3L6HA 1EH3A 2ANJA 4RPNA 4OEUA 3FXUA 1MY1A 4L17A 4F31B 5I59B 4P0IA 4G77A 2UXAA 2B65A 4WEPA 1QUJA 1SI0A 1LFIA 1VFEA 3T9UA 4H6DA 3FJ7A 1P1UA 3VLVA 1DTZA 4RPOA 3C9HA 3IR1A 5K2YA 4THIA 3SKPA 4F3GA 3DP4A 3EHTA 1MQGA 2RC7A 1MH3A 4NEDA 1ZTYA 1FQFA 3K0VA 1Y4TA 2HEUA 1OMPA 3VVDA 4MFIA 2ONKE 1CE2A 3CRBA 1XOCA 3G3GA 2Y7KA 3OXNA 1NL5A 3V89B 3RY3A 5ISUA 2VHAA 4LZ5A 1JNFA 1IUDA 5AA1A 2HXWA 2AIXA 3FD3A 4TLLB 4U23A 2DSFA 2XXTA 3H6WA 4WEDA 4NF6B 1ZLQA 4TLMB 4DE8A 3R26A 2ZYMA 3ILUB 4IO6A 4PFWA 5ICQA 3FXRA 5H8HB 1SW1A 2V84A 1YAEA 3CFXA 1B51A 2REJA 4QSCA 3IAZA 3EQ1A 1ZKBA 1Q35A 3IORA 4GQOA 5I57B 4NF4B 1JW4A 2W7YA 4KYDA 3RUMA 4MBPA 1PB9A 3DP8A 3RQTA 1ZBMA 1TFDA 4G8MA 4RK9A 2XXVA 1MDQA 1N84A 4BDQA 2ZNUA 1LBCA 1SW2A 1A54A 1IEJA 2O84X 1I6AA 3E9XA 2VD3A 1IXIA 3K1NA 1JEUA 3TPAA 4XKNA 3V8XB 3CVGA 3VLUA 3FUZA 5I2KB 2RF1A 2Z22A 4LQ2A 3MP1A 3S9EA 4BLAA 1P99A 5BUUA 1QKAA 4WXJA 3TYHA 2KLFA 5CRYA 1FTOA 3TTLA 2FNCA 5AA4B 3UA8A 3I5OA 2UVJA 4F3PA 1WODA 2OZZA 3A3CA 3IOUA 3VLWA 1QJMA 4N13A 3MQ9A 5KZTA 3QK6A 1MXZA 3TTKA 4ELRA 2P1SA 4R9FA 2H98A 3ZSFA 3ONMA 4Q0CA 3S9NC 2H5YA 1FQBA 4RK2A 4R6HA 5EYFA 1N7XA 1MQIA 3I3VA 1ELJA 1FW0A 1MXXA 3OO8A 4HS7A 3V5AA 1XVYA 1P1QA 3CFLA 3VVEA 1DPEA 3U94A 1NMUA 1YPNA 4LATA 1JW5A 3OEKA 2DE2A 4DLDA 1RKMA 2D5WA 1MPDA 3K02A 5EHMA 4NF5B 5KCJA 4X1BA 2AYSA 3TUSA 1MY0A 4LP2B 4NMYA 4N07A 1MQJA 3K1PA 3UN6A 4M4GA 4C0RA 2YLNA 5DT6A 1LCFA 2DXYA 3M3LA 3PU5A 2REGA 1FQCA 3P7IA 5HPQA 4C1TA 4F19A 5DVIA 3KN3A 3K00A 4N6PA 3H03A 1SW4A 1H76A 1PB8A 4G68B 3B6QA 4ELPA 1BIYA 1IZ1A 2PMSA 1WDNA 4PQJA 4DIGA 3VV5A 3IK6B 4RYAA 1MXVA 3G7WA 2B3BA 3T93B 4R2BA 4IY5A 4YB5A 4GL0A 3HSTA 2XXQA 4IGTA 1US5A 2O69A 4OYVA 1BLFA 4WKMA 5B7DA 1CB6A 3CG3A 1B4HA 5CC2A 3LBSA 1AIVA 3TDJA 3H3GA 3TODA 1OVBA 4JB7A 1OLCA 1TFAA 4NF8B 4PE5B 2UYEA 3OELA 4KR5A 1GTKA 4ZDMA 4NF5A 1LFHA 4LZ7A 3UIFA 3S2VA 5ITOA 5I56A 4C1UA 5JTYA 2I4BA 4I8CA 3Q27A 4EQ9A 1IITA 4LQ5A 4R6KA 3KSXA 2Q8JA 4KYEA 5A5XB 1FTJA 2XX9A 1WVJA 4POXA 1FQAA 3FVNA 5H8SA 4NTLA 2OK2A 2F34A 1MDP1 3TELA 3TQLA 1SYHA 1VSOA 5H8QA 3Q25A 3MP8A 3MP6A 3F11A 1A55A 2D3IA 3O6GA 1MXYA 3EN3A 1FTMA 4QFKA 4ZS9A 2DWHA 3TCHA 1IXCA 3OEMA 1Y4CA 3RGYA 2V3UA 2I4CA 1MH4A 2R9JA 4ELQA 1EZ9A 4E0XA 4BDMA 5IAIA 3IB2A 2I3WA 3SEYA 3SEXA 1EZPA 4Q8RA 3UORA 4IO7A 4G8NA 4PFTA 2DYXA 3FATA 3GLBA 5FHMA 2NXOA 4F1UA 2F6PA 4XTCQ 1FQDA 3QAXA 2F7BA 4BDLA 3RTWB 4OFOA 4EXLA 2NVUB 3KG2A 2O68A 4K3FA 4F18A 1L5TA 4POWA 3IL1B 4NWDA 1O7TA 4R2FA 3SEWA 3OSRA 4JSOA 4U1ZA 1FQEA 3N6TA 3IX1A 4OFLA 4AB6A 3JV9A 2ONRA 2ZNTA 4U22A 4OZ9A 4OESA 3DP6A 2Y7RA 1N3WA 2PBWA 1JVXA 4DXCA 2Q89A 3MVXA 2E1SA 3PMVA 1S7YA 4OETA 1KWHA 4OXVA 2IEEA 4U4SA 5L9SA 2ESNA 2Z8DA 4AQ4A 2HQ0A 2H99A 3THIA 5HBCA 3C35A 2VP1A 2FA7A 1OQGA 3GXAA 3H6TA 5ITPA 3E13X 3FJMA 1B0HA 1ZJLA 5DTBA 1B5HA 1I69A 4ESWA 1Z7NE 1F9BA 4QFNA 1FTLA 4DCYA 1A40A 4HCYA 3MAMA 3KBRA 4P0GA 2HZKA 1NNTA 3TAJA 1LAFE 4KFQA 3O66A 3G3IA 1SD3A 3TQWA 3MPKA 3FASA 2R6GE 1B6HA 1P1WA 4ZEKA 3E4RA 3N26A 1P1OA 5KDTA 5CMBA 5AE4A 2VD2A 1XC1A 3VE1B 5I2NA 3D4GA 4PFYA 4GRKA 5CM6A 1MQHA 5HM4B 3KOTA 1TXFA 2RKMA 3FXQA 4R73A 3WAEA 1URGA 1MY3A 3V83A 3S9MC 3CSGA 4TOZA 3JZJA 4BDNA 4H8JA 2PT2A 3S4UA 1LAGE 1AH5A 4F22A 4LVQA 4QHQA 1SI1A 4YMAA 5KCJB 1H44A 3ZKLA 2XXHA 2OCUA 3M8UA 4ZE8A 1LBBA 3LSXA 1OIBA 3PMWA 2I48A 1QW0A 2UVIA 1UTBA 1QULA 3SETA 1XS5A 1PDAA 5FTIA 1LLSA 2Y84A 1MG1A 1DMBA 4H67A 3T66A 5FHNA 1I6QA 3U72A 2YPNA 5L9OA 2E0SA 1ATGA 5DVJA 3TCGA 4IB2A 4FAJA 4GIZA 4RNSA 2G93A 1B1XA 3K4UA 1USYE 3QUFA 2H25A 3PGFA 2OLBA 4GL8A 1UTHA 2F7CA 2IA4A 2DWJA 1TWYA 1II5A 5TP9A 2O7IA 2QMWA 4KPTA 3MJNA 1FTKA 4DXUA 1YCJA 5B70A 3FGSA 2LAOA 1YTVA 2UVGA 3OSQA 1JQFA 1EU8A 4GD5A 3PMXA 4JWOA 2XXYA 3SESA 2RINA 4M1VA 1B0LA 1NFTA 2DS9A 4O3BA 3OO9A 2G29A 4F3SA 4XIGQ 5I56B 1IXHA 1D4NA 2V3QA 3USDA 3MVZA 3SEVA 4F39A 5JTYB 3UGWA 2QSXA 1LAXA 1B7HA 4MF3A 4KCDA 3FZVA 3IOWA 3K01A 3A09A 3IOVA 2CZLA 4QSEA 1M5EA 5IKBA 4PP0A 3OENA 4EF2A 5H8NA 5JEIA 1A8FA 4OEVA 1N7WA 2VOZA 2DOJA 2O1LA 3IB0A 3O9PA 5AA3A 2X7PA 2DVZA 5F7VA 3ECRA 5H8QB 1RYOA 4OENA 3T96B 3RT6B 3RN8A 3Q29A 1T0KA 3T9XB 1SVXB 3FVOA 1IQ7A 3HHFA 5H8FA 1QKBA 3TMGA 1NNPA 2O51A 3K6XA 3KJTA 4KYSA 1JEVA 1M5BA 3SDFA 3DELB 3PD9A 2QS2A 4AB5A 5I58A 1D9YA 2XHDA 2Q2AA 4ZEDA 3CR9A 3RT8A 4UACA 1UIUA 3VFJA 5JK4A 3L6GA 4R6YA 2ZYOA 3K6WA 2DE4A 3VVFA 1SDXA 3C36A 5M2VA 4HW8A 4G8HA 3K1MA 1IIWA 3CSBA 1XHYA 1QUIA 4NE4A 2NOOA 5TPAA 3MPLA 3R7XA 3MBPA 4ZE9A 3VXCA 5CMMA 3FV1A 2V25A 4O3AA 4EQBA 2ZXTA 3ZKKA 1O64A 4XKPA 4Z7EA 4OMBA 2DQVA 1B4ZA 2ZNSA 4RY1A 5L9MA 3SEUA 1JVYA 2ONSA 3G3KA 2F97A 1MXUA 3MUQA 4FE8A 1SBPA 1B3LA 2ZYKA 4F1VA 2V93A 2X26A 4GFRA 2A5TA 3GZGA 4JWYA 2Z8EA 2Y7PA 3H06B 4IGRA 1A7LA 4QFOA 2ALUA 1M5FA 3B7DA 3PPPA 3G3HA 2P2AA 1XT8A 5ELVA 3FJGA 3PUYE 2GHBA 3W9VA 4ELOA 4GLIA 4IO2A 4XKRA 1UIVA 4OTEA 3TKDA 3PPRA 1B3GA 3MVWA 3GBAA 3HO7A 1ZU0A 3E3KA 1GGGA 2UYFA 4H1XA 4KQPA 3Q26A 4KI0E 1GR2A 3H7MA 4QFPA 1PBQA 3T9VA 4EDPA 3BFUA 2AL5A 1US4A 2ZMBA 4LZ8A 2PYYA 3G3FA 4FECA 5CMCA 1ZMGA 4H5GA 2HAVA 3UK4A 4QSDA 3QYTA 1BP5A 5KDTB 2XX8A 5L8DA 3KEIA 4ISUA 1Y3NA 1DSNA 2Y7IA 2NWJA 5AA2A 3SERA 3T9HB 3BKIB 1QVSA 1A8EA 2DWIA 2R71A 3ZS6A 1B3EA 5I2NB 3HN0A 2V3TA 1B5JA 1JW1A 1AMFA 2AL4A 2XXWA 1IXGA 1M5DA 3CI8A 2PT1A 4EUOA 4GF8A 1PB7A 3FIRA 4YU0A 4UA8A 2CMOA 1BKAA 3LUYA 4QFLA
chains in the Genus database with same CATH superfamily
4PF6A 1B9JA 5ICTA 3KOSA 4X1DA 2XWVA 5EHSA 3I6VA 2OBGA 2F36A 3K6UA 2ZZVA 4YB7A 2QPQA 4O8MA 1SYIA 3KN8A 1Y1MA 2P0SA 3HV1A 1B1HA 4XXUA 1LB9A 1D9VA 4FORA 3IO4A 4H45A 1B3HA 4F1YA 3ODBA 5DEXA 2UVHA 3KJ7A 1B32A 1R1NA 2RC9A 3T1BA 1UTBB 3C32A 1Y1ZA 2WKYA 3MZ9A 4Q5TA 2OWTA 4YICA 1HSLA 4I62A 2RC8A 1B2HA 2F5XA 2HCAA 2F35A 3IO6A 4GOTA 1SW5A 4MJOA 4EXKA 5IZ1A 1MM6A 4HTGA 1GVCA 2HZLA 5ET8A 3RLFE 4GVOA 4QRZA 3MZBA 3EPEA 5LOMA 1MPBA 4GX3A 4R72A 3A3UA 4P8BA 4KD5A 2XD3A 3PPOA 4YKIA 4P11A 1MM7A 3TTMA 4P3LA 1JETA 4H46A 4IO5A 1UTHB 1H3DA 1H43A 2F8DA 2YJPA 3C31A 1VE4A 4NWCA 5TP9B 2XD2A 5ESYA 2GHAA 4E0WA 3IOTA 5K2XA 4U21A 3FV2A 3TTNA 3LSWA 3CIJA 4G68C 3W9WA 4Q30B 4F29A 1FPKA 4I9DA 2QS3A 1G0IA 1LAHE 4FATA 5I59A 4H8IA 3MC2A 3N94A 4MIJA 1RYXA 3ISPA 1MQDA 3HCQA 4EQ7A 3LV0A 4U2RA 3G3JA 2Z8FA 2THIA 3FVKA 1LBVA 1HSJA 4YMBA 4DI4B 3GBBA 3PD8A 3VXBA 1AL3A 1B58A 1FPDA 3CFZA 1IMEA 1MY4A 1NH7A 1B46A 1Y20A 5DYHA 2WYKA 3QUJA 2WX9A 3MVYA 3IJXB 4YKKA 1NUYA 3QIMA 4G4PA 2Q2CA 1S50A 4O7IA 4GXAA 4ZZEA 3RPWA 3QXMA 4IO3A 1TT1A 4RXLA 5H8NB 1GV8A 3DLNA 4X48A 4ZEFA 1LCTA 4F3BA 2OJTA 1HSEA 3MW0A 5FBPA 1MRPA 2ZZWA 1B52A 3U1OA 5CMKA 2PX1A 4GWUA 4LONB 5I84A 3H6VA 3HPIA 3LSFB 4JSDA 1OQHA 1FPJA 4NF6A 1DPPA 4RJZA 3PTYA 1FBFA 1FCKA 5DVFA 2HAUA 1DTGA 3PV0E 4NX1A 1NKXA 3UP9A 3BBRA 3CG1A 5H8HA 3MZ1A 4ND9A 5H8FB 2DE3A 3H6UA 1B3FA 1Z7ME 4O94A 1LEVA 4ONYA 4OVSA 2XXUA 4JBZA 4FIMA 2GFEA 3BFTA 3O97A 5I7IA 3DM0A 1BTJA 4ZECA 2O6AA 3OD7A 1D9QA 5TU0A 4MH5A 1USYH 2XXPA 5I57A 5J1DA 1NH8A 3EHUA 4NF4A 5I58B 4GWOA 4KCCA 2DWAA 2O7UA 5IZ3A 2XXRA 3RPLB 1J1NA 4KHZE 1NNFA 3IJOB 5CBRA 2H9BA 2X7QA 4ESXA 4DCXA 1LGBC 2Q9TA 5A5LA 3IFAA 5EQ8A 1KA1A 4ZEBA 1Q1KA 2I58A 2DP8A 4NN3A 3RYDA 1Y3QA 2OWSA 1M5CA 3PUXE 1RDXA 4DZ1A 5DW8A 1UQWA 4DXBA 3LSLA 4YAHX 5I2KA 1Y9UA 4OVJA 4YB6A 5TPAB 1H45A 3EHSA 3S9LC 4BDRA 3LC8A 2HFBA 5EYGA 4RA1A 1MY2A 3D4CA 2D21A 5FTHA 4R9GA 3KSJA 3KGCA 3Q28A 1VR5A 5AA4A 2I3VA 3MWBA 1POY1 3QSLA 4OANA 2CZKA 3BIGA 1QUKA 3PPQA 4FEBA 2QJEA 4R75A 5CBSA 1ANFA 3HHGA 3K2DA 2R8TA 3KFMA 2FYIA 1R9QA 3LR1A 3O6IA 3W15C 1FBCA 2H4IA 3AXFA 1OLAA 2CEYA 1MS7A 2QMXA 1B40A 4FEDA 4NHBA 1XVXA 2A5TB 2QL3A 3EF7A 3PUVE 4PETA 3OO6A 4DDDA 3T0JA 4H5FA 3TCFA 1N04A 2XXIA 3PPNA 2BJJX 2FIXA 3OOAA 4JWXA 2XXKA 4GXSB 4PFRA 1O63A 2DXRA 3IB1A 1P1NA 4F2OA 4OHNA 5CI5A 3R6UA 4OERA 4PTKA 1DCUA 1IMFA 2I0CA 2F7AA 1LFGA 3D1RA 3O28A 4PC9A 3U8QA 3KZGA 3M3KA 1PBPA 2VGQA 3C33A 3FVGA 3N5LA 4MLVA 1PC3A 1FBHA 2RCAA 2Y5LA 4QXDA 4MLQA 1R6ZA 2JJKA 2F78A 4O3CA 4X9TA 3VDFA 1OVTA 1POTA 3K6VA 4JDFA 2PVUA 4OFJA 4G68A 5IGAA 3TTRA 4TQUQ 2DVCA 3ILTB 5ET5A 3ROJA 1DOTA 4U4XA 4F2QA 5AA2D 4IY6A 2B3FA 2KR0A 4GWWA 4IO4A 1URSA 2ZYNA 2NUVA 5AA2B 4Z0IA 3T22A 2VT5A 2XX7A 4ECFA 1B7UA 2GRVA 3TEPA 3C34A 4MNIA 1EZOA 1D3KA 4MAGA 2F6GA 3B6WA 4LA9A 4ZZAA 4JXIA 4H0WA 1VFDA 2FVZA 4G2ZA 2I49A 1LSTA 3RTFB 3O6HA 2XXXA 5BWJA 2Z23A 4FJPA 1MXWA 4OQOA 4R74A 2I6EA 2ABHA 3OMBA 4OWDA 4NF8A 1G0HA 1NV0A 4PDHA 3H4ZA 3PUZE 4QF9A 3KN7A 1INPA 1ZIUA 1PEBA 2M8CA 1B05A 2I0BA 1NV1A 4XEQA 3RNNA 1SQYA 2O1MA 4I1DA 4PAIA 3U92A 2WEFA 3M3FA 4N6DA 3U93A 2Y7WA 1MPCA 1SPIA 3N6UA 1N0TA 4X04A 4XKQA 1R9LA 2A5SA 5DEXB 1N76A 1I6BA 3WAFA 3TFLA 1NV4A 4NGUA 4BDOA 1B7ZA 4YKPA 4H65A 2PCRA 3OO7A 3TZAA 1S9TA 4PFUA 4ZEIA 3B6TA 5FHOA 1AOVA 4EF1A 5A5XA 2QS4A 1LB8A 2GH9A 4LUBA 4MCOA 3PUWE 5F1QA 2GQ1A 1B5IA 4U1OA 4AS5A 1A99A 1NNKA 2QRYA 4YZZA 3C4MA 1N3XA 4HCWA 4YKJA 2RCBA 1URDA 1Y3PA 2QS1A 2Q88A 3O2AA 3JYRA 3O29A 2F3BA 3L6HA 1EH3A 2ANJA 4RPNA 4OEUA 3FXUA 1DK4A 4N17A 1MY1A 4L17A 4F31B 5I59B 4P0IA 4G77A 2UXAA 2B65A 4WEPA 1QUJA 1SI0A 1LFIA 1VFEA 3T9UA 4H6DA 2V4CA 3FJ7A 1P1UA 3VLVA 1DTZA 4RPOA 1IMAA 3C9HA 4PAFA 3IR1A 5K2YA 4THIA 3SKPA 4F3GA 3DP4A 3EHTA 1MQGA 2RC7A 1MH3A 4NEDA 1ZTYA 1FQFA 3K0VA 1Y4TA 2HEUA 1OMPA 3VVDA 4MFIA 2ONKE 1CE2A 3CRBA 1XOCA 3G3GA 2Y7KA 4PGNA 3OXNA 1NL5A 3V89B 3RY3A 5ISUA 2VHAA 4LZ5A 1JNFA 4P9KA 1IUDA 4N8YA 5AA1A 2HXWA 2AIXA 3KC1A 3FD3A 3FBPA 4TLLB 4U23A 2XWKA 2DSFA 2XXTA 3H6WA 4WEDA 4NF6B 1ZLQA 4TLMB 4DE8A 3R26A 2ZYMA 1RDZA 3ILUB 4IO6A 4PFWA 5ICQA 3FXRA 5H8HB 1SW1A 2V84A 1YAEA 3CFXA 1B51A 2REJA 4QSCA 3IAZA 3EQ1A 1ZKBA 1Q35A 3IORA 4GQOA 5I57B 4NF4B 1JW4A 2W7YA 4KYDA 3A29A 3RUMA 4MBPA 1PB9A 3DP8A 5IZ3B 3RQTA 1ZBMA 1TFDA 4OVPA 4G8MA 4RK9A 2XXVA 1MDQA 1N84A 3CHGA 4BDQA 1NI9A 2OWZA 2ZNUA 1LBCA 1SW2A 4IR8A 1A54A 1IEJA 2O84X 1I6AA 3E9XA 1FPIA 2VD3A 1IXIA 3K1NA 1JEUA 3TPAA 1DBZA 4XKNA 1AWBA 3V8XB 3CVGA 3VLUA 1CNQA 3FUZA 5I2KB 2RF1A 2Z22A 4LQ2A 3MP1A 2XA5A 3S9EA 4BLAA 1P99A 5BUUA 1QKAA 4WXJA 1FJ9A 3TYHA 2F3DA 1NUXA 2KLFA 5CRYA 1FTOA 3TTLA 4PCDA 2FNCA 5AA4B 3UA8A 3I5OA 4P56A 2P3NA 2UVJA 4F3PA 1WODA 2OZZA 2HPGA 4FBPA 1YXIA 3A3CA 5F24A 3IOUA 1FRPA 4GX4A 1QJMA 3VLWA 4N13A 2PFYA 3MQ9A 4P1LA 5KZTA 3QK6A 1MXZA 3TTKA 4ELRA 2P1SA 4OVQA 4R9FA 2H98A 3ZSFA 3ONMA 4Q0CA 3S9NC 2H5YA 1FQBA 4RK2A 4R6HA 5EYFA 1N7XA 1MQIA 3I3VA 1ELJA 1FW0A 1MXXA 3OO8A 4HS7A 3V5AA 1XVYA 1P1QA 3CFLA 3VVEA 1DPEA 3U94A 1NMUA 4LATA 1YPNA 1JW5A 3OEKA 2DE2A 4DLDA 2DDKA 1RKMA 2D5WA 1MPDA 3K02A 5EHMA 2B4MA 4NF5B 5KCJA 4X1BA 2AYSA 3TUSA 1MY0A 4LP2B 5EYHA 2Q8MA 1BK4A 4NMYA 4N07A 2WBBA 1MQJA 3K1PA 3UN6A 4M4GA 4C0RA 2YLNA 5DT6A 5LTCA 1LCFA 2DXYA 3M3LA 3PU5A 2REGA 1FQCA 3P7IA 5HPQA 1FPLA 4C1TA 4F19A 5DVIA 3KN3A 2CZIA 3K00A 1RDYA 4N6PA 3H03A 1SW4A 4HE1A 1H76A 1PB8A 2Q74A 4G68B 3B6QA 4ELPA 2CEXA 1BIYA 1IZ1A 4NF0A 2PMSA 1WDNA 4PQJA 4DIGA 4HE0A 3VV5A 3IK6B 4RYAA 1MXVA 3G7WA 2B3BA 3T93B 4R2BA 4IY5A 4N4UA 1EYKA 4YB5A 4GL0A 3HSTA 2XXQA 4IGTA 1US5A 2O69A 4OYVA 1BLFA 1KA0A 4WKMA 5B7DA 3NOHA 1CB6A 2MKZA 3CG3A 4MMPA 1B4HA 1IMDA 5CC2A 3LBSA 3MSTA 1AIVA 3TDJA 3H3GA 2B4LA 4MX6A 3TODA 1OVBA 3KBZA 4JB7A 4N15A 1OLCA 1TFAA 4NF8B 4PE5B 2QVRA 2UYEA 3OELA 4KR5A 4NAPA 4GBWA 1GTKA 4ZDMA 2HXRA 4NF5A 1LFHA 4LZ7A 1XI6A 3UIFA 3S2VA 5ITOA 5EQ9A 4GWZA 5I56A 1NV5A 1K9ZA 4C1UA 5JTYA 2I4BA 4I8CA 4OVRA 1FPFA 3Q27A 4EQ9A 1IITA 4LQ5A 4R6KA 3KSXA 2Q8JA 4KYEA 5A5XB 1FTJA 3IFCA 3KC0A 2XX9A 1WVJA 1NUZA 4POXA 1FQAA 3FVNA 5H8SA 4NTLA 3LUZA 2OK2A 2F34A 1MDP1 3TELA 3TQLA 1SYHA 1VSOA 5H8QA 2L5VA 3Q25A 3MP8A 4N91A 3MP6A 3F11A 1A55A 2D3IA 3O6GA 1MXYA 3EN3A 4XFEA 1FTMA 4QFKA 4ZS9A 2DWHA 1K9YA 3TCHA 1IXCA 4GX6A 3OEMA 1Y4CA 3RGYA 2V3UA 2I4CA 1MH4A 2R9JA 4ELQA 1EZ9A 4E0XA 4BDMA 5IAIA 3IB2A 2I3WA 3SEYA 3SEXA 1EZPA 4Q8RA 3UORA 4IO7A 4G8NA 4PFBA 4PFTA 2DYXA 5LDZA 1FTAA 4P47A 1FSAA 3FATA 3GLBA 4GBVA 5FHMA 2NXOA 4F1UA 2F6PA 4XTCQ 1FQDA 3QAXA 5IM2A 2F7BA 4BDLA 3RTWB 4OFOA 4OVTA 4EXLA 4I3EA 2NVUB 3KG2A 2O68A 4K3FA 4F18A 1L5TA 4POWA 4MNCA 3IL1B 4NWDA 1O7TA 4R2FA 2WYPA 3SEWA 1Q9DA 3OSRA 1FBDA 4JSOA 4G61A 4U1ZA 1FQEA 3N6TA 3IX1A 4OFLA 4AB6A 3JV9A 2ONRA 2ZNTA 4U22A 4OZ9A 4OESA 3DP6A 2Y7RA 1N3WA 2PBWA 4O7MA 1JVXA 4DXCA 2KQZA 2Q89A 3MVXA 2E1SA 3PMVA 1S7YA 4OETA 1NUWA 1KWHA 4OXVA 2IEEA 1JP4A 4U4SA 5L9SA 2ESNA 1NV7A 2Z8DA 4AQ4A 4HE2A 2HQ0A 2H99A 4AS4A 3THIA 5HBCA 3C35A 1FBEA 2VP1A 2FA7A 1OQGA 3GXAA 3H6TA 5ITPA 3E13X 3FJMA 1B0HA 1ZJLA 5DTBA 1B5HA 1I69A 4ESWA 1Z7NE 1F9BA 4QFNA 4JVIA 4LN5A 1FTLA 4DCYA 1A40A 4HCYA 3MAMA 3KBRA 4P0GA 2HZKA 1NNTA 3TAJA 1LAFE 4KFQA 3O66A 3G3IA 1LBYA 1SD3A 3TQWA 3MPKA 3FASA 2R6GE 1B6HA 1P1WA 4ZEKA 1LBWA 4PBHA 3E4RA 3N26A 1P1OA 5KDTA 5CMBA 3GYYA 5AE4A 2VD2A 1XC1A 3VE1B 5I2NA 2HHMA 3D4GA 4PFYA 4GRKA 5CM6A 1NV3A 1EYIA 1MQHA 5HM4B 3KOTA 1TXFA 2RKMA 3FXQA 4R73A 4PDDA 3WAEA 1URGA 1MY3A 3V83A 3S9MC 1NV6A 3CSGA 4TOZA 3JZJA 4BDNA 3MYUA 5T3JA 4H8JA 2PT2A 5EQAA 1FPEA 3S4UA 1LAGE 1AH5A 4F22A 5IZZA 4LVQA 4QHQA 1SI1A 4YMAA 3E79A 5KCJB 1H44A 3ZKLA 2XXHA 2OCUA 3M8UA 4X8RA 1LBBA 4ZE8A 2QVVA 3LSXA 1OIBA 3PMWA 4PF8A 2CZHA 2I48A 1QW0A 2UVIA 1UTBA 1QULA 4MEVA 1KZ8A 3SETA 2VPOA 1XS5A 1PDAA 5FTIA 1LLSA 2Y84A 1MG1A 1DMBA 4H67A 3T66A 5FHNA 1I6QA 2FBPA 3U72A 2YPNA 5L9OA 2E0SA 1ATGA 5DVJA 3TCGA 4IB2A 4FAJA 4GIZA 4RNSA 2G93A 1B1XA 3K4UA 4PFIA 1USYE 4XF5A 3QUFA 2H25A 4PBQA 4N81A 3PGFA 2OLBA 4GL8A 1UTHA 2F7CA 2IA4A 2DWJA 4NQ8A 1TWYA 1II5A 5TP9A 1YZ0A 2O7IA 2QMWA 4KPTA 2VPNA 1FBPA 4JVCA 4JVDA 3MJNA 3FXBA 1FTKA 4UABA 4DXUA 3E78A 5ET6A 1YCJA 5I3SA 5B70A 3FGSA 2LAOA 2FIEA 1YTVA 2UVGA 3OSQA 1JQFA 1EU8A 4GD5A 5EQ7A 3PMXA 4JWOA 2XXYA 3SESA 2RINA 4M1VA 1B0LA 1NFTA 2DS9A 3U65A 4O3BA 3OO9A 2G29A 4F3SA 4XIGQ 2BJIA 5I56B 4GWSA 1IXHA 4PAKA 1D4NA 2V3QA 3USDA 3MVZA 3SEVA 4F39A 5JTYB 3UGWA 2QSXA 1LAXA 1B7HA 3HFUA 4MF3A 4KCDA 3FZVA 3IOWA 3K01A 1LBXA 3A09A 3IOVA 2CZLA 4QSEA 1M5EA 3QMFA 4DI3D 5IKBA 4PP0A 3OENA 4EF2A 5H8NA 5JEIA 1A8FA 4OEVA 1N7WA 2VOZA 2DOJA 2O1LA 3IB0A 3O9PA 5AA3A 2X7PA 2DVZA 5F7VA 3ECRA 4N6KA 1LBZA 5H8QB 1RYOA 4GWYA 4HXVA 4N8GA 4OENA 3T96B 3RT6B 3RN8A 3Q29A 1T0KA 3BIHA 3T9XB 1SVXB 3FVOA 1IQ7A 3HHFA 5H8FA 1QKBA 3TMGA 3SZPA 1NNPA 2P3VA 2O51A 3K6XA 3KJTA 4KYSA 1JEVA 1M5BA 3SDFA 3DELB 3PD9A 2QS2A 4AB5A 1IMCA 5I58A 1D9YA 2XHDA 2Q2AA 4ZEDA 2FHYA 3CR9A 3RPLA 3RT8A 4UACA 1UIUA 3VFJA 4QBAA 4NG7A 1FPBA 5JK4A 1EYJA 3L6GA 4R6YA 2ZYOA 3K6WA 2DE4A 3VVFA 1SDXA 1FPGA 3C36A 5M2VA 4HW8A 4G8HA 3K1MA 4P1EA 2QVUA 1VDWA 1IIWA 3CSBA 1XHYA 4PE3A 1QUIA 4NE4A 2NOOA 5TPAA 4OA4A 4MHFA 3MPLA 3R7XA 3MBPA 4ZE9A 3VXCA 5CMMA 3FV1A 2V25A 4O3AA 4EQBA 2ZXTA 3ZKKA 1O64A 4XKPA 4Z7EA 4OMBA 2DQVA 2Y5KA 1B4ZA 2ZNSA 4RY1A 5L9MA 4I3YA 3SEUA 1JVYA 2ONSA 3G3KA 4MNPA 2F97A 1IMBA 1MXUA 3MUQA 1QGXA 4FE8A 1SBPA 1B3LA 2ZYKA 4F1VA 2V93A 2X26A 4GFRA 2WBDA 2A5TA 1FBGA 3GZGA 2PFZA 4JWYA 2Z8EA 2Y7PA 3H06B 5I5PA 4IGRA 1A7LA 4QFOA 2ALUA 1M5FA 3B7DA 3PPPA 2XWIA 3G3HA 2P2AA 1XT8A 5ET7A 5ELVA 4I40A 3FJGA 3PUYE 2GHBA 2ZZXA 3W9VA 4ELOA 3EKIA 4GLIA 4IO2A 4XKRA 1UIVA 4OTEA 3TKDA 3PPRA 1B3GA 4GWXA 3MVWA 3GBAA 3HO7A 1ZU0A 3E3KA 1GGGA 2UYFA 4H1XA 4KQPA 3Q26A 4KI0E 1GR2A 3H7MA 4QFPA 1NV2A 1PBQA 3T9VA 2XWOA 4EDPA 3BFUA 2AL5A 2OX3A 1US4A 2ZMBA 4LZ8A 2PYYA 3G3FA 4FECA 5CMCA 1YYZA 1ZMGA 4PGPA 4H5GA 2HAVA 3UK4A 4QSDA 3QYTA 3B50A 4KXPA 1BP5A 5KDTB 2XX8A 5L8DA 3KEIA 4ISUA 1Y3NA 1DSNA 2Y7IA 2NWJA 5AA2A 3SERA 3T9HB 3BKIB 1QVSA 1A8EA 2DWIA 2R71A 3ZS6A 1B3EA 5I2NB 3HN0A 2V3TA 1B5JA 1JW1A 1AMFA 2AL4A 2XXWA 1IXGA 1M5DA 3CI8A 2PT1A 4EUOA 5J16A 2QFLA 4GF8A 1FJ6A 1PB7A 3FIRA 4YU0A 4UA8A 2CMOA 1BKAA 3LUYA 3B8BA 4QFLA
chains in the Genus database with same CATH topology
1B9JA 5ICTA 3KOSA 4X1DA 5EHSA 3I6VA 2OBGA 2F36A 3K6UA 4YB7A 2QPQA 1SYIA 3KN8A 1Y1MA 2P0SA 3HV1A 1B1HA 4XXUA 1LB9A 1D9VA 4FORA 3IO4A 1B3HA 4F1YA 3ODBA 5DEXA 2UVHA 3KJ7A 1B32A 1R1NA 2RC9A 1UTBB 3C32A 1Y1ZA 2WKYA 3MZ9A 4Q5TA 2OWTA 4YICA 1HSLA 4I62A 2RC8A 1B2HA 2F5XA 2HCAA 2F35A 3IO6A 4EXKA 1SW5A 4GOTA 1MM6A 4HTGA 1GVCA 2HZLA 3RLFE 4GVOA 4QRZA 3MZBA 3EPEA 5LOMA 1MPBA 4R72A 3A3UA 4KD5A 2XD3A 3PPOA 4YKIA 4P11A 1MM7A 3TTMA 1JETA 4IO5A 1UTHB 1H3DA 1H43A 2F8DA 2YJPA 3C31A 1VE4A 4NWCA 5TP9B 2XD2A 2GHAA 4E0WA 3IOTA 5K2XA 4U21A 3FV2A 3TTNA 3LSWA 3CIJA 4G68C 3W9WA 4Q30B 4F29A 4I9DA 2QS3A 1LAHE 4FATA 5I59A 4H8IA 3MC2A 3N94A 1RYXA 1MQDA 3HCQA 4EQ7A 4U2RA 3G3JA 2Z8FA 2THIA 3FVKA 1HSJA 4YMBA 3GBBA 3PD8A 3VXBA 1AL3A 1B58A 3CFZA 1MY4A 1NH7A 1B46A 1Y20A 5DYHA 3QUJA 3MVYA 3IJXB 4YKKA 3QIMA 4G4PA 2Q2CA 1S50A 4GXAA 4ZZEA 3RPWA 3QXMA 4IO3A 1TT1A 4RXLA 5H8NB 1GV8A 3DLNA 4X48A 4ZEFA 1LCTA 4F3BA 2OJTA 1HSEA 3MW0A 1MRPA 1B52A 3U1OA 5CMKA 2PX1A 4LONB 5I84A 3H6VA 3HPIA 3LSFB 4JSDA 1OQHA 4NF6A 1DPPA 4RJZA 1FCKA 5DVFA 2HAUA 1DTGA 3PV0E 1NKXA 3UP9A 3BBRA 3CG1A 5H8HA 3MZ1A 4ND9A 5H8FB 2DE3A 3H6UA 1B3FA 1Z7ME 4ONYA 2XXUA 4JBZA 4FIMA 2GFEA 3BFTA 3O97A 3DM0A 1BTJA 4ZECA 2O6AA 3OD7A 5TU0A 4MH5A 1USYH 2XXPA 5I57A 5J1DA 1NH8A 3EHUA 4NF4A 5I58B 4GWOA 4KCCA 2DWAA 2O7UA 2XXRA 1J1NA 4KHZE 1NNFA 3IJOB 5CBRA 2H9BA 2X7QA 4ESXA 4DCXA 1LGBC 2Q9TA 4ZEBA 1Q1KA 2I58A 2DP8A 1Y3QA 2OWSA 1M5CA 3PUXE 4DZ1A 1UQWA 4DXBA 3LSLA 4YAHX 5I2KA 1Y9UA 4OVJA 4YB6A 5TPAB 1H45A 3EHSA 3S9LC 4BDRA 3LC8A 2HFBA 4RA1A 1MY2A 3D4CA 2D21A 5FTHA 4R9GA 3KSJA 3KGCA 3Q28A 1VR5A 5AA4A 2I3VA 3MWBA 1POY1 3QSLA 1QUKA 3PPQA 4FEBA 2QJEA 4R75A 5CBSA 1ANFA 3HHGA 3K2DA 3KFMA 2FYIA 1R9QA 3LR1A 3O6IA 3W15C 2H4IA 3AXFA 1OLAA 1MS7A 2QMXA 1B40A 4FEDA 1XVXA 2A5TB 2QL3A 3EF7A 3PUVE 4PETA 3OO6A 4DDDA 4H5FA 3TCFA 1N04A 2XXIA 3PPNA 2BJJX 3OOAA 4JWXA 4GXSB 1O63A 2DXRA 3IB1A 1P1NA 4F2OA 4OHNA 5CI5A 3R6UA 4OERA 2I0CA 2F7AA 1LFGA 3O28A 3U8QA 3KZGA 3M3KA 1PBPA 2VGQA 3C33A 3FVGA 3N5LA 4MLVA 1PC3A 2RCAA 4MLQA 1R6ZA 2F78A 4O3CA 4X9TA 3VDFA 1OVTA 1POTA 3K6VA 4JDFA 2PVUA 4OFJA 4G68A 3TTRA 4TQUQ 2DVCA 3ILTB 1DOTA 4U4XA 4F2QA 5AA2D 4IY6A 2B3FA 4IO4A 1URSA 2ZYNA 2NUVA 5AA2B 4Z0IA 3T22A 2XX7A 4ECFA 1B7UA 2GRVA 3TEPA 3C34A 1EZOA 1D3KA 2F6GA 3B6WA 4LA9A 4ZZAA 4JXIA 4H0WA 1VFDA 4G2ZA 2I49A 1LSTA 3RTFB 3O6HA 2XXXA 5BWJA 2Z23A 4FJPA 1MXWA 4OQOA 4R74A 2I6EA 2ABHA 3OMBA 4OWDA 4NF8A 3H4ZA 3PUZE 4QF9A 3KN7A 1ZIUA 1PEBA 2M8CA 1B05A 2I0BA 3RNNA 1SQYA 2O1MA 4I1DA 3U92A 3M3FA 3U93A 2Y7WA 1MPCA 3N6UA 1N0TA 4XKQA 1R9LA 2A5SA 5DEXB 1N76A 1I6BA 3WAFA 3TFLA 4BDOA 1B7ZA 4YKPA 4H65A 3OO7A 3TZAA 1S9TA 4PFUA 4ZEIA 3B6TA 5FHOA 1AOVA 4EF1A 5A5XA 2QS4A 1LB8A 2GH9A 4LUBA 3PUWE 5F1QA 1B5IA 4U1OA 1A99A 1NNKA 2QRYA 4YZZA 3C4MA 1N3XA 4HCWA 4YKJA 2RCBA 1URDA 1Y3PA 2QS1A 2Q88A 3O2AA 3JYRA 3O29A 3L6HA 1EH3A 2ANJA 4RPNA 4OEUA 3FXUA 1MY1A 4L17A 4F31B 5I59B 4P0IA 4G77A 2UXAA 2B65A 4WEPA 1QUJA 1SI0A 1LFIA 1VFEA 3T9UA 4H6DA 3FJ7A 1P1UA 3VLVA 1DTZA 4RPOA 3C9HA 3IR1A 5K2YA 4THIA 3SKPA 4F3GA 3DP4A 3EHTA 1MQGA 2RC7A 1MH3A 4NEDA 1ZTYA 1FQFA 3K0VA 1Y4TA 2HEUA 1OMPA 3VVDA 4MFIA 2ONKE 1CE2A 3CRBA 1XOCA 3G3GA 2Y7KA 3OXNA 1NL5A 3V89B 3RY3A 5ISUA 2VHAA 4LZ5A 1JNFA 1IUDA 5AA1A 2HXWA 2AIXA 3FD3A 4TLLB 4U23A 2DSFA 2XXTA 3H6WA 4WEDA 4NF6B 1ZLQA 4TLMB 4DE8A 3R26A 2ZYMA 3ILUB 4IO6A 4PFWA 5ICQA 3FXRA 5H8HB 1SW1A 2V84A 1YAEA 3CFXA 1B51A 2REJA 4QSCA 3IAZA 3EQ1A 1ZKBA 1Q35A 3IORA 4GQOA 5I57B 4NF4B 1JW4A 2W7YA 4KYDA 3RUMA 4MBPA 1PB9A 3DP8A 3RQTA 1ZBMA 1TFDA 4G8MA 4RK9A 2XXVA 1MDQA 1N84A 4BDQA 2ZNUA 1LBCA 1SW2A 1A54A 1IEJA 2O84X 1I6AA 3E9XA 2VD3A 1IXIA 3K1NA 1JEUA 3TPAA 4XKNA 3V8XB 3CVGA 3VLUA 3FUZA 5I2KB 2RF1A 2Z22A 4LQ2A 3MP1A 3S9EA 4BLAA 1P99A 5BUUA 1QKAA 4WXJA 3TYHA 2KLFA 5CRYA 1FTOA 3TTLA 2FNCA 5AA4B 3UA8A 3I5OA 2UVJA 4F3PA 1WODA 2OZZA 3A3CA 3IOUA 3VLWA 1QJMA 4N13A 3MQ9A 5KZTA 3QK6A 1MXZA 3TTKA 4ELRA 2P1SA 4R9FA 2H98A 3ZSFA 3ONMA 4Q0CA 3S9NC 2H5YA 1FQBA 4RK2A 4R6HA 5EYFA 1N7XA 1MQIA 3I3VA 1ELJA 1FW0A 1MXXA 3OO8A 4HS7A 3V5AA 1XVYA 1P1QA 3CFLA 3VVEA 1DPEA 3U94A 1NMUA 1YPNA 4LATA 1JW5A 3OEKA 2DE2A 4DLDA 1RKMA 2D5WA 1MPDA 3K02A 5EHMA 4NF5B 5KCJA 4X1BA 2AYSA 3TUSA 1MY0A 4LP2B 4NMYA 4N07A 1MQJA 3K1PA 3UN6A 4M4GA 4C0RA 2YLNA 5DT6A 1LCFA 2DXYA 3M3LA 3PU5A 2REGA 1FQCA 3P7IA 5HPQA 4C1TA 4F19A 5DVIA 3KN3A 3K00A 4N6PA 3H03A 1SW4A 1H76A 1PB8A 4G68B 3B6QA 4ELPA 1BIYA 1IZ1A 2PMSA 1WDNA 4PQJA 4DIGA 3VV5A 3IK6B 4RYAA 1MXVA 3G7WA 2B3BA 3T93B 4R2BA 4IY5A 4YB5A 4GL0A 3HSTA 2XXQA 4IGTA 1US5A 2O69A 4OYVA 1BLFA 4WKMA 5B7DA 1CB6A 3CG3A 1B4HA 5CC2A 3LBSA 1AIVA 3TDJA 3H3GA 3TODA 1OVBA 4JB7A 1OLCA 1TFAA 4NF8B 4PE5B 2UYEA 3OELA 4KR5A 1GTKA 4ZDMA 4NF5A 1LFHA 4LZ7A 3UIFA 3S2VA 5ITOA 5I56A 4C1UA 5JTYA 2I4BA 4I8CA 3Q27A 4EQ9A 1IITA 4LQ5A 4R6KA 3KSXA 2Q8JA 4KYEA 5A5XB 1FTJA 2XX9A 1WVJA 4POXA 1FQAA 3FVNA 5H8SA 4NTLA 2OK2A 2F34A 1MDP1 3TELA 3TQLA 1SYHA 1VSOA 5H8QA 3Q25A 3MP8A 3MP6A 3F11A 1A55A 2D3IA 3O6GA 1MXYA 3EN3A 1FTMA 4QFKA 4ZS9A 2DWHA 3TCHA 1IXCA 3OEMA 1Y4CA 3RGYA 2V3UA 2I4CA 1MH4A 2R9JA 4ELQA 1EZ9A 4E0XA 4BDMA 5IAIA 3IB2A 2I3WA 3SEYA 3SEXA 1EZPA 4Q8RA 3UORA 4IO7A 4G8NA 4PFTA 2DYXA 3FATA 3GLBA 5FHMA 2NXOA 4F1UA 2F6PA 4XTCQ 1FQDA 3QAXA 2F7BA 4BDLA 3RTWB 4OFOA 4EXLA 2NVUB 3KG2A 2O68A 4K3FA 4F18A 1L5TA 4POWA 3IL1B 4NWDA 1O7TA 4R2FA 3SEWA 3OSRA 4JSOA 4U1ZA 1FQEA 3N6TA 3IX1A 4OFLA 4AB6A 3JV9A 2ONRA 2ZNTA 4U22A 4OZ9A 4OESA 3DP6A 2Y7RA 1N3WA 2PBWA 1JVXA 4DXCA 2Q89A 3MVXA 2E1SA 3PMVA 1S7YA 4OETA 1KWHA 4OXVA 2IEEA 4U4SA 5L9SA 2ESNA 2Z8DA 4AQ4A 2HQ0A 2H99A 3THIA 5HBCA 3C35A 2VP1A 2FA7A 1OQGA 3GXAA 3H6TA 5ITPA 3E13X 3FJMA 1B0HA 1ZJLA 5DTBA 1B5HA 1I69A 4ESWA 1Z7NE 1F9BA 4QFNA 1FTLA 4DCYA 1A40A 4HCYA 3MAMA 3KBRA 4P0GA 2HZKA 1NNTA 3TAJA 1LAFE 4KFQA 3O66A 3G3IA 1SD3A 3TQWA 3MPKA 3FASA 2R6GE 1B6HA 1P1WA 4ZEKA 3E4RA 3N26A 1P1OA 5KDTA 5CMBA 5AE4A 2VD2A 1XC1A 3VE1B 5I2NA 3D4GA 4PFYA 4GRKA 5CM6A 1MQHA 5HM4B 3KOTA 1TXFA 2RKMA 3FXQA 4R73A 3WAEA 1URGA 1MY3A 3V83A 3S9MC 3CSGA 4TOZA 3JZJA 4BDNA 4H8JA 2PT2A 3S4UA 1LAGE 1AH5A 4F22A 4LVQA 4QHQA 1SI1A 4YMAA 5KCJB 1H44A 3ZKLA 2XXHA 2OCUA 3M8UA 4ZE8A 1LBBA 3LSXA 1OIBA 3PMWA 2I48A 1QW0A 2UVIA 1UTBA 1QULA 3SETA 1XS5A 1PDAA 5FTIA 1LLSA 2Y84A 1MG1A 1DMBA 4H67A 3T66A 5FHNA 1I6QA 3U72A 2YPNA 5L9OA 2E0SA 1ATGA 5DVJA 3TCGA 4IB2A 4FAJA 4GIZA 4RNSA 2G93A 1B1XA 3K4UA 1USYE 3QUFA 2H25A 3PGFA 2OLBA 4GL8A 1UTHA 2F7CA 2IA4A 2DWJA 1TWYA 1II5A 5TP9A 2O7IA 2QMWA 4KPTA 3MJNA 1FTKA 4DXUA 1YCJA 5B70A 3FGSA 2LAOA 1YTVA 2UVGA 3OSQA 1JQFA 1EU8A 4GD5A 3PMXA 4JWOA 2XXYA 3SESA 2RINA 4M1VA 1B0LA 1NFTA 2DS9A 4O3BA 3OO9A 2G29A 4F3SA 4XIGQ 5I56B 1IXHA 1D4NA 2V3QA 3USDA 3MVZA 3SEVA 4F39A 5JTYB 3UGWA 2QSXA 1LAXA 1B7HA 4MF3A 4KCDA 3FZVA 3IOWA 3K01A 3A09A 3IOVA 2CZLA 4QSEA 1M5EA 5IKBA 4PP0A 3OENA 4EF2A 5H8NA 5JEIA 1A8FA 4OEVA 1N7WA 2VOZA 2DOJA 2O1LA 3IB0A 3O9PA 5AA3A 2X7PA 2DVZA 5F7VA 3ECRA 5H8QB 1RYOA 4OENA 3T96B 3RT6B 3RN8A 3Q29A 1T0KA 3T9XB 1SVXB 3FVOA 1IQ7A 3HHFA 5H8FA 1QKBA 3TMGA 1NNPA 2O51A 3K6XA 3KJTA 4KYSA 1JEVA 1M5BA 3SDFA 3DELB 3PD9A 2QS2A 4AB5A 5I58A 1D9YA 2XHDA 2Q2AA 4ZEDA 3CR9A 3RT8A 4UACA 1UIUA 3VFJA 5JK4A 3L6GA 4R6YA 2ZYOA 3K6WA 2DE4A 3VVFA 1SDXA 3C36A 5M2VA 4HW8A 4G8HA 3K1MA 1IIWA 3CSBA 1XHYA 1QUIA 4NE4A 2NOOA 5TPAA 3MPLA 3R7XA 3MBPA 4ZE9A 3VXCA 5CMMA 3FV1A 2V25A 4O3AA 4EQBA 2ZXTA 3ZKKA 1O64A 4XKPA 4Z7EA 4OMBA 2DQVA 1B4ZA 2ZNSA 4RY1A 5L9MA 3SEUA 1JVYA 2ONSA 3G3KA 2F97A 1MXUA 3MUQA 4FE8A 1SBPA 1B3LA 2ZYKA 4F1VA 2V93A 2X26A 4GFRA 2A5TA 3GZGA 4JWYA 2Z8EA 2Y7PA 3H06B 4IGRA 1A7LA 4QFOA 2ALUA 1M5FA 3B7DA 3PPPA 3G3HA 2P2AA 1XT8A 5ELVA 3FJGA 3PUYE 2GHBA 3W9VA 4ELOA 4GLIA 4IO2A 4XKRA 1UIVA 4OTEA 3TKDA 3PPRA 1B3GA 3MVWA 3GBAA 3HO7A 1ZU0A 3E3KA 1GGGA 2UYFA 4H1XA 4KQPA 3Q26A 4KI0E 1GR2A 3H7MA 4QFPA 1PBQA 3T9VA 4EDPA 3BFUA 2AL5A 1US4A 2ZMBA 4LZ8A 2PYYA 3G3FA 4FECA 5CMCA 1ZMGA 4H5GA 2HAVA 3UK4A 4QSDA 3QYTA 1BP5A 5KDTB 2XX8A 5L8DA 3KEIA 4ISUA 1Y3NA 1DSNA 2Y7IA 2NWJA 5AA2A 3SERA 3T9HB 3BKIB 1QVSA 1A8EA 2DWIA 2R71A 3ZS6A 1B3EA 5I2NB 3HN0A 2V3TA 1B5JA 1JW1A 1AMFA 2AL4A 2XXWA 1IXGA 1M5DA 3CI8A 2PT1A 4EUOA 4GF8A 1PB7A 3FIRA 4YU0A 4UA8A 2CMOA 1BKAA 3LUYA 4QFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9J A;  5ICT A;  3KOS A;  4X1D A;  5EHS A;  3I6V A;  2OBG A;  2F36 A;  3K6U A;  4YB7 A;  2QPQ A;  1SYI A;  3KN8 A;  1Y1M A;  2P0S A;  3HV1 A;  1B1H A;  4XXU A;  1LB9 A;  1D9V A;  4FOR A;  3IO4 A;  1B3H A;  4F1Y A;  3ODB A;  5DEX A;  2UVH A;  3KJ7 A;  1B32 A;  1R1N A;  2RC9 A;  1UTB B;  3C32 A;  1Y1Z A;  2WKY A;  3MZ9 A;  4Q5T A;  2OWT A;  4YIC A;  1HSL A;  4I62 A;  2RC8 A;  1B2H A;  2F5X A;  2HCA A;  2F35 A;  3IO6 A;  4EXK A;  1SW5 A;  4GOT A;  1MM6 A;  4HTG A;  1GVC A;  2HZL A;  3RLF E;  4GVO A;  4QRZ A;  3MZB A;  3EPE A;  5LOM A;  1MPB A;  4R72 A;  3A3U A;  4KD5 A;  2XD3 A;  3PPO A;  4YKI A;  4P11 A;  1MM7 A;  3TTM A;  1JET A;  4IO5 A;  1UTH B;  1H3D A;  1H43 A;  2F8D A;  2YJP A;  3C31 A;  1VE4 A;  4NWC A;  5TP9 B;  2XD2 A;  2GHA A;  4E0W A;  3IOT A;  5K2X A;  4U21 A;  3FV2 A;  3TTN A;  3LSW A;  3CIJ A;  4G68 C;  3W9W A;  4Q30 B;  4F29 A;  4I9D A;  2QS3 A;  1LAH E;  4FAT A;  5I59 A;  4H8I A;  3MC2 A;  3N94 A;  1RYX A;  1MQD A;  3HCQ A;  4EQ7 A;  4U2R A;  3G3J A;  2Z8F A;  2THI A;  3FVK A;  1HSJ A;  4YMB A;  3GBB A;  3PD8 A;  3VXB A;  1AL3 A;  1B58 A;  3CFZ A;  1MY4 A;  1NH7 A;  1B46 A;  1Y20 A;  5DYH A;  3QUJ A;  3MVY A;  3IJX B;  4YKK A;  3QIM A;  4G4P A;  2Q2C A;  1S50 A;  4GXA A;  4ZZE A;  3RPW A;  3QXM A;  4IO3 A;  1TT1 A;  4RXL A;  5H8N B;  1GV8 A;  3DLN A;  4X48 A;  4ZEF A;  1LCT A;  4F3B A;  2OJT A;  1HSE A;  3MW0 A;  1MRP A;  1B52 A;  3U1O A;  5CMK A;  2PX1 A;  4LON B;  5I84 A;  3H6V A;  3HPI A;  3LSF B;  4JSD A;  1OQH A;  4NF6 A;  1DPP A;  4RJZ A;  1FCK A;  5DVF A;  2HAU A;  1DTG A;  3PV0 E;  1NKX A;  3UP9 A;  3BBR A;  3CG1 A;  5H8H A;  3MZ1 A;  4ND9 A;  5H8F B;  2DE3 A;  3H6U A;  1B3F A;  1Z7M E;  4ONY A;  2XXU A;  4JBZ A;  4FIM A;  2GFE A;  3BFT A;  3O97 A;  3DM0 A;  1BTJ A;  4ZEC A;  2O6A A;  3OD7 A;  5TU0 A;  4MH5 A;  1USY H;  2XXP A;  5I57 A;  5J1D A;  1NH8 A;  3EHU A;  4NF4 A;  5I58 B;  4GWO A;  4KCC A;  2DWA A;  2O7U A;  2XXR A;  1J1N A;  4KHZ E;  1NNF A;  3IJO B;  5CBR A;  2H9B A;  2X7Q A;  4ESX A;  4DCX A;  1LGB C;  2Q9T A;  4ZEB A;  1Q1K A;  2I58 A;  2DP8 A;  1Y3Q A;  2OWS A;  1M5C A;  3PUX E;  4DZ1 A;  1UQW A;  4DXB A;  3LSL A;  4YAH X;  5I2K A;  1Y9U A;  4OVJ A;  4YB6 A;  5TPA B;  1H45 A;  3EHS A;  3S9L C;  4BDR A;  3LC8 A;  2HFB A;  4RA1 A;  1MY2 A;  3D4C A;  2D21 A;  5FTH A;  4R9G A;  3KSJ A;  3KGC A;  3Q28 A;  1VR5 A;  5AA4 A;  2I3V A;  3MWB A;  1POY 1;  3QSL A;  1QUK A;  3PPQ A;  4FEB A;  2QJE A;  4R75 A;  5CBS A;  1ANF A;  3HHG A;  3K2D A;  3KFM A;  2FYI A;  1R9Q A;  3LR1 A;  3O6I A;  3W15 C;  2H4I A;  3AXF A;  1OLA A;  1MS7 A;  2QMX A;  1B40 A;  4FED A;  1XVX A;  2A5T B;  2QL3 A;  3EF7 A;  3PUV E;  4PET A;  3OO6 A;  4DDD A;  4H5F A;  3TCF A;  1N04 A;  2XXI A;  3PPN A;  2BJJ X;  3OOA A;  4JWX A;  4GXS B;  1O63 A;  2DXR A;  3IB1 A;  1P1N A;  4F2O A;  4OHN A;  5CI5 A;  3R6U A;  4OER A;  2I0C A;  2F7A A;  1LFG A;  3O28 A;  3U8Q A;  3KZG A;  3M3K A;  1PBP A;  2VGQ A;  3C33 A;  3FVG A;  3N5L A;  4MLV A;  1PC3 A;  2RCA A;  4MLQ A;  1R6Z A;  2F78 A;  4O3C A;  4X9T A;  3VDF A;  1OVT A;  1POT A;  3K6V A;  4JDF A;  2PVU A;  4OFJ A;  4G68 A;  3TTR A;  4TQU Q;  2DVC A;  3ILT B;  1DOT A;  4U4X A;  4F2Q A;  5AA2 D;  4IY6 A;  2B3F A;  4IO4 A;  1URS A;  2ZYN A;  2NUV A;  5AA2 B;  4Z0I A;  3T22 A;  2XX7 A;  4ECF A;  1B7U A;  2GRV A;  3TEP A;  3C34 A;  1EZO A;  1D3K A;  2F6G A;  3B6W A;  4LA9 A;  4ZZA A;  4JXI A;  4H0W A;  1VFD A;  4G2Z A;  2I49 A;  1LST A;  3RTF B;  3O6H A;  2XXX A;  5BWJ A;  2Z23 A;  4FJP A;  1MXW A;  4OQO A;  4R74 A;  2I6E A;  2ABH A;  3OMB A;  4OWD A;  4NF8 A;  3H4Z A;  3PUZ E;  4QF9 A;  3KN7 A;  1ZIU A;  1PEB A;  2M8C A;  1B05 A;  2I0B A;  3RNN A;  1SQY A;  2O1M A;  4I1D A;  3U92 A;  3M3F A;  3U93 A;  2Y7W A;  1MPC A;  3N6U A;  1N0T A;  4XKQ A;  1R9L A;  2A5S A;  5DEX B;  1N76 A;  1I6B A;  3WAF A;  3TFL A;  4BDO A;  1B7Z A;  4YKP A;  4H65 A;  3OO7 A;  3TZA A;  1S9T A;  4PFU A;  4ZEI A;  3B6T A;  5FHO A;  1AOV A;  4EF1 A;  5A5X A;  2QS4 A;  1LB8 A;  2GH9 A;  4LUB A;  3PUW E;  5F1Q A;  1B5I A;  4U1O A;  1A99 A;  1NNK A;  2QRY A;  4YZZ A;  3C4M A;  1N3X A;  4HCW A;  4YKJ A;  2RCB A;  1URD A;  1Y3P A;  2QS1 A;  2Q88 A;  3O2A A;  3JYR A;  3O29 A;  3L6H A;  1EH3 A;  2ANJ A;  4RPN A;  4OEU A;  3FXU A;  1MY1 A;  4L17 A;  4F31 B;  5I59 B;  4P0I A;  4G77 A;  2UXA A;  2B65 A;  4WEP A;  1QUJ A;  1SI0 A;  1LFI A;  1VFE A;  3T9U A;  4H6D A;  3FJ7 A;  1P1U A;  3VLV A;  1DTZ A;  4RPO A;  3C9H A;  3IR1 A;  5K2Y A;  4THI A;  3SKP A;  4F3G A;  3DP4 A;  3EHT A;  1MQG A;  2RC7 A;  1MH3 A;  4NED A;  1ZTY A;  1FQF A;  3K0V A;  1Y4T A;  2HEU A;  1OMP A;  3VVD A;  4MFI A;  2ONK E;  1CE2 A;  3CRB A;  1XOC A;  3G3G A;  2Y7K A;  3OXN A;  1NL5 A;  3V89 B;  3RY3 A;  5ISU A;  2VHA A;  4LZ5 A;  1JNF A;  1IUD A;  5AA1 A;  2HXW A;  2AIX A;  3FD3 A;  4TLL B;  4U23 A;  2DSF A;  2XXT A;  3H6W A;  4WED A;  4NF6 B;  1ZLQ A;  4TLM B;  4DE8 A;  3R26 A;  2ZYM A;  3ILU B;  4IO6 A;  4PFW A;  5ICQ A;  3FXR A;  5H8H B;  1SW1 A;  2V84 A;  1YAE A;  3CFX A;  1B51 A;  2REJ A;  4QSC A;  3IAZ A;  3EQ1 A;  1ZKB A;  1Q35 A;  3IOR A;  4GQO A;  5I57 B;  4NF4 B;  1JW4 A;  2W7Y A;  4KYD A;  3RUM A;  4MBP A;  1PB9 A;  3DP8 A;  3RQT A;  1ZBM A;  1TFD A;  4G8M A;  4RK9 A;  2XXV A;  1MDQ A;  1N84 A;  4BDQ A;  2ZNU A;  1LBC A;  1SW2 A;  1A54 A;  1IEJ A;  2O84 X;  1I6A A;  3E9X A;  2VD3 A;  1IXI A;  3K1N A;  1JEU A;  3TPA A;  4XKN A;  3V8X B;  3CVG A;  3VLU A;  3FUZ A;  5I2K B;  2RF1 A;  2Z22 A;  4LQ2 A;  3MP1 A;  3S9E A;  4BLA A;  1P99 A;  5BUU A;  1QKA A;  4WXJ A;  3TYH A;  2KLF A;  5CRY A;  1FTO A;  3TTL A;  2FNC A;  5AA4 B;  3UA8 A;  3I5O A;  2UVJ A;  4F3P A;  1WOD A;  2OZZ A;  3A3C A;  3IOU A;  3VLW A;  1QJM A;  4N13 A;  3MQ9 A;  5KZT A;  3QK6 A;  1MXZ A;  3TTK A;  4ELR A;  2P1S A;  4R9F A;  2H98 A;  3ZSF A;  3ONM A;  4Q0C A;  3S9N C;  2H5Y A;  1FQB A;  4RK2 A;  4R6H A;  5EYF A;  1N7X A;  1MQI A;  3I3V A;  1ELJ A;  1FW0 A;  1MXX A;  3OO8 A;  4HS7 A;  3V5A A;  1XVY A;  1P1Q A;  3CFL A;  3VVE A;  1DPE A;  3U94 A;  1NMU A;  1YPN A;  4LAT A;  1JW5 A;  3OEK A;  2DE2 A;  4DLD A;  1RKM A;  2D5W A;  1MPD A;  3K02 A;  5EHM A;  4NF5 B;  5KCJ A;  4X1B A;  2AYS A;  3TUS A;  1MY0 A;  4LP2 B;  4NMY A;  4N07 A;  1MQJ A;  3K1P A;  3UN6 A;  4M4G A;  4C0R A;  2YLN A;  5DT6 A;  1LCF A;  2DXY A;  3M3L A;  3PU5 A;  2REG A;  1FQC A;  3P7I A;  5HPQ A;  4C1T A;  4F19 A;  5DVI A;  3KN3 A;  3K00 A;  4N6P A;  3H03 A;  1SW4 A;  1H76 A;  1PB8 A;  4G68 B;  3B6Q A;  4ELP A;  1BIY A;  1IZ1 A;  2PMS A;  1WDN A;  4PQJ A;  4DIG A;  3VV5 A;  3IK6 B;  4RYA A;  1MXV A;  3G7W A;  2B3B A;  3T93 B;  4R2B A;  4IY5 A;  4YB5 A;  4GL0 A;  3HST A;  2XXQ A;  4IGT A;  1US5 A;  2O69 A;  4OYV A;  1BLF A;  4WKM A;  5B7D A;  1CB6 A;  3CG3 A;  1B4H A;  5CC2 A;  3LBS A;  1AIV A;  3TDJ A;  3H3G A;  3TOD A;  1OVB A;  4JB7 A;  1OLC A;  1TFA A;  4NF8 B;  4PE5 B;  2UYE A;  3OEL A;  4KR5 A;  1GTK A;  4ZDM A;  4NF5 A;  1LFH A;  4LZ7 A;  3UIF A;  3S2V A;  5ITO A;  5I56 A;  4C1U A;  5JTY A;  2I4B A;  4I8C A;  3Q27 A;  4EQ9 A;  1IIT A;  4LQ5 A;  4R6K A;  3KSX A;  2Q8J A;  4KYE A;  5A5X B;  1FTJ A;  2XX9 A;  1WVJ A;  4POX A;  1FQA A;  3FVN A;  5H8S A;  4NTL A;  2OK2 A;  2F34 A;  1MDP 1;  3TEL A;  3TQL A;  1SYH A;  1VSO A;  5H8Q A;  3Q25 A;  3MP8 A;  3MP6 A;  3F11 A;  1A55 A;  2D3I A;  3O6G A;  1MXY A;  3EN3 A;  1FTM A;  4QFK A;  4ZS9 A;  2DWH A;  3TCH A;  1IXC A;  3OEM A;  1Y4C A;  3RGY A;  2V3U A;  2I4C A;  1MH4 A;  2R9J A;  4ELQ A;  1EZ9 A;  4E0X A;  4BDM A;  5IAI A;  3IB2 A;  2I3W A;  3SEY A;  3SEX A;  1EZP A;  4Q8R A;  3UOR A;  4IO7 A;  4G8N A;  4PFT A;  2DYX A;  3FAT A;  3GLB A;  5FHM A;  2NXO A;  4F1U A;  2F6P A;  4XTC Q;  1FQD A;  3QAX A;  2F7B A;  4BDL A;  3RTW B;  4OFO A;  4EXL A;  2NVU B;  3KG2 A;  2O68 A;  4K3F A;  4F18 A;  1L5T A;  4POW A;  3IL1 B;  4NWD A;  1O7T A;  4R2F A;  3SEW A;  3OSR A;  4JSO A;  4U1Z A;  1FQE A;  3N6T A;  3IX1 A;  4OFL A;  4AB6 A;  3JV9 A;  2ONR A;  2ZNT A;  4U22 A;  4OZ9 A;  4OES A;  3DP6 A;  2Y7R A;  1N3W A;  2PBW A;  1JVX A;  4DXC A;  2Q89 A;  3MVX A;  2E1S A;  3PMV A;  1S7Y A;  4OET A;  1KWH A;  4OXV A;  2IEE A;  4U4S A;  5L9S A;  2ESN A;  2Z8D A;  4AQ4 A;  2HQ0 A;  2H99 A;  3THI A;  5HBC A;  3C35 A;  2VP1 A;  2FA7 A;  1OQG A;  3GXA A;  3H6T A;  5ITP A;  3E13 X;  3FJM A;  1B0H A;  1ZJL A;  5DTB A;  1B5H A;  1I69 A;  4ESW A;  1Z7N E;  1F9B A;  4QFN A;  1FTL A;  4DCY A;  1A40 A;  4HCY A;  3MAM A;  3KBR A;  4P0G A;  2HZK A;  1NNT A;  3TAJ A;  1LAF E;  4KFQ A;  3O66 A;  3G3I A;  1SD3 A;  3TQW A;  3MPK A;  3FAS A;  2R6G E;  1B6H A;  1P1W A;  4ZEK A;  3E4R A;  3N26 A;  1P1O A;  5KDT A;  5CMB A;  5AE4 A;  2VD2 A;  1XC1 A;  3VE1 B;  5I2N A;  3D4G A;  4PFY A;  4GRK A;  5CM6 A;  1MQH A;  5HM4 B;  3KOT A;  1TXF A;  2RKM A;  3FXQ A;  4R73 A;  3WAE A;  1URG A;  1MY3 A;  3V83 A;  3S9M C;  3CSG A;  4TOZ A;  3JZJ A;  4BDN A;  4H8J A;  2PT2 A;  3S4U A;  1LAG E;  1AH5 A;  4F22 A;  4LVQ A;  4QHQ A;  1SI1 A;  4YMA A;  5KCJ B;  1H44 A;  3ZKL A;  2XXH A;  2OCU A;  3M8U A;  4ZE8 A;  1LBB A;  3LSX A;  1OIB A;  3PMW A;  2I48 A;  1QW0 A;  2UVI A;  1UTB A;  1QUL A;  3SET A;  1XS5 A;  1PDA A;  5FTI A;  1LLS A;  2Y84 A;  1MG1 A;  1DMB A;  4H67 A;  3T66 A;  5FHN A;  1I6Q A;  3U72 A;  2YPN A;  5L9O A;  2E0S A;  1ATG A;  5DVJ A;  3TCG A;  4IB2 A;  4FAJ A;  4GIZ A;  4RNS A;  2G93 A;  1B1X A;  3K4U A;  1USY E;  3QUF A;  2H25 A;  3PGF A;  2OLB A;  4GL8 A;  1UTH A;  2F7C A;  2IA4 A;  2DWJ A;  1TWY A;  1II5 A;  5TP9 A;  2O7I A;  2QMW A;  4KPT A;  3MJN A;  1FTK A;  4DXU A;  1YCJ A;  5B70 A;  3FGS A;  2LAO A;  1YTV A;  2UVG A;  3OSQ A;  1JQF A;  1EU8 A;  4GD5 A;  3PMX A;  4JWO A;  2XXY A;  3SES A;  2RIN A;  4M1V A;  1B0L A;  1NFT A;  2DS9 A;  4O3B A;  3OO9 A;  2G29 A;  4F3S A;  4XIG Q;  5I56 B;  1IXH A;  1D4N A;  2V3Q A;  3USD A;  3MVZ A;  3SEV A;  4F39 A;  5JTY B;  3UGW A;  2QSX A;  1LAX A;  1B7H A;  4MF3 A;  4KCD A;  3FZV A;  3IOW A;  3K01 A;  3A09 A;  3IOV A;  2CZL A;  4QSE A;  1M5E A;  5IKB A;  4PP0 A;  3OEN A;  4EF2 A;  5H8N A;  5JEI A;  1A8F A;  4OEV A;  1N7W A;  2VOZ A;  2DOJ A;  2O1L A;  3IB0 A;  3O9P A;  5AA3 A;  2X7P A;  2DVZ A;  5F7V A;  3ECR A;  5H8Q B;  1RYO A;  4OEN A;  3T96 B;  3RT6 B;  3RN8 A;  3Q29 A;  1T0K A;  3T9X B;  1SVX B;  3FVO A;  1IQ7 A;  3HHF A;  5H8F A;  1QKB A;  3TMG A;  1NNP A;  2O51 A;  3K6X A;  3KJT A;  4KYS A;  1JEV A;  1M5B A;  3SDF A;  3DEL B;  3PD9 A;  2QS2 A;  4AB5 A;  5I58 A;  1D9Y A;  2XHD A;  2Q2A A;  4ZED A;  3CR9 A;  3RT8 A;  4UAC A;  1UIU A;  3VFJ A;  5JK4 A;  3L6G A;  4R6Y A;  2ZYO A;  3K6W A;  2DE4 A;  3VVF A;  1SDX A;  3C36 A;  5M2V A;  4HW8 A;  4G8H A;  3K1M A;  1IIW A;  3CSB A;  1XHY A;  1QUI A;  4NE4 A;  2NOO A;  5TPA A;  3MPL A;  3R7X A;  3MBP A;  4ZE9 A;  3VXC A;  5CMM A;  3FV1 A;  2V25 A;  4O3A A;  4EQB A;  2ZXT A;  3ZKK A;  1O64 A;  4XKP A;  4Z7E A;  4OMB A;  2DQV A;  1B4Z A;  2ZNS A;  4RY1 A;  5L9M A;  3SEU A;  1JVY A;  2ONS A;  3G3K A;  2F97 A;  1MXU A;  3MUQ A;  4FE8 A;  1SBP A;  1B3L A;  2ZYK A;  4F1V A;  2V93 A;  2X26 A;  4GFR A;  2A5T A;  3GZG A;  4JWY A;  2Z8E A;  2Y7P A;  3H06 B;  4IGR A;  1A7L A;  4QFO A;  2ALU A;  1M5F A;  3B7D A;  3PPP A;  3G3H A;  2P2A A;  1XT8 A;  5ELV A;  3FJG A;  3PUY E;  2GHB A;  3W9V A;  4ELO A;  4GLI A;  4IO2 A;  4XKR A;  1UIV A;  4OTE A;  3TKD A;  3PPR A;  1B3G A;  3MVW A;  3GBA A;  3HO7 A;  1ZU0 A;  3E3K A;  1GGG A;  2UYF A;  4H1X A;  4KQP A;  3Q26 A;  4KI0 E;  1GR2 A;  3H7M A;  4QFP A;  1PBQ A;  3T9V A;  4EDP A;  3BFU A;  2AL5 A;  1US4 A;  2ZMB A;  4LZ8 A;  2PYY A;  3G3F A;  4FEC A;  5CMC A;  1ZMG A;  4H5G A;  2HAV A;  3UK4 A;  4QSD A;  3QYT A;  1BP5 A;  5KDT B;  2XX8 A;  5L8D A;  3KEI A;  4ISU A;  1Y3N A;  1DSN A;  2Y7I A;  2NWJ A;  5AA2 A;  3SER A;  3T9H B;  3BKI B;  1QVS A;  1A8E A;  2DWI A;  2R71 A;  3ZS6 A;  1B3E A;  5I2N B;  3HN0 A;  2V3T A;  1B5J A;  1JW1 A;  1AMF A;  2AL4 A;  2XXW A;  1IXG A;  1M5D A;  3CI8 A;  2PT1 A;  4EUO A;  4GF8 A;  1PB7 A;  3FIR A;  4YU0 A;  4UA8 A;  2CMO A;  1BKA A;  3LUY A;  4QFL A; 
#chains in the Genus database with same CATH topology
 4PF6 A;  1B9J A;  5ICT A;  3KOS A;  4X1D A;  2XWV A;  5EHS A;  3I6V A;  2OBG A;  2F36 A;  3K6U A;  2ZZV A;  4YB7 A;  2QPQ A;  4O8M A;  1SYI A;  3KN8 A;  1Y1M A;  2P0S A;  3HV1 A;  1B1H A;  4XXU A;  1LB9 A;  1D9V A;  4FOR A;  3IO4 A;  4H45 A;  1B3H A;  4F1Y A;  3ODB A;  5DEX A;  2UVH A;  3KJ7 A;  1B32 A;  1R1N A;  2RC9 A;  3T1B A;  1UTB B;  3C32 A;  1Y1Z A;  2WKY A;  3MZ9 A;  4Q5T A;  2OWT A;  4YIC A;  1HSL A;  4I62 A;  2RC8 A;  1B2H A;  2F5X A;  2HCA A;  2F35 A;  3IO6 A;  4GOT A;  1SW5 A;  4MJO A;  4EXK A;  5IZ1 A;  1MM6 A;  4HTG A;  1GVC A;  2HZL A;  5ET8 A;  3RLF E;  4GVO A;  4QRZ A;  3MZB A;  3EPE A;  5LOM A;  1MPB A;  4GX3 A;  4R72 A;  3A3U A;  4P8B A;  4KD5 A;  2XD3 A;  3PPO A;  4YKI A;  4P11 A;  1MM7 A;  3TTM A;  4P3L A;  1JET A;  4H46 A;  4IO5 A;  1UTH B;  1H3D A;  1H43 A;  2F8D A;  2YJP A;  3C31 A;  1VE4 A;  4NWC A;  5TP9 B;  2XD2 A;  5ESY A;  2GHA A;  4E0W A;  3IOT A;  5K2X A;  4U21 A;  3FV2 A;  3TTN A;  3LSW A;  3CIJ A;  4G68 C;  3W9W A;  4Q30 B;  4F29 A;  1FPK A;  4I9D A;  2QS3 A;  1G0I A;  1LAH E;  4FAT A;  5I59 A;  4H8I A;  3MC2 A;  3N94 A;  4MIJ A;  1RYX A;  3ISP A;  1MQD A;  3HCQ A;  4EQ7 A;  3LV0 A;  4U2R A;  3G3J A;  2Z8F A;  2THI A;  3FVK A;  1LBV A;  1HSJ A;  4YMB A;  4DI4 B;  3GBB A;  3PD8 A;  3VXB A;  1AL3 A;  1B58 A;  1FPD A;  3CFZ A;  1IME A;  1MY4 A;  1NH7 A;  1B46 A;  1Y20 A;  5DYH A;  2WYK A;  3QUJ A;  2WX9 A;  3MVY A;  3IJX B;  4YKK A;  1NUY A;  3QIM A;  4G4P A;  2Q2C A;  1S50 A;  4O7I A;  4GXA A;  4ZZE A;  3RPW A;  3QXM A;  4IO3 A;  1TT1 A;  4RXL A;  5H8N B;  1GV8 A;  3DLN A;  4X48 A;  4ZEF A;  1LCT A;  4F3B A;  2OJT A;  1HSE A;  3MW0 A;  5FBP A;  1MRP A;  2ZZW A;  1B52 A;  3U1O A;  5CMK A;  2PX1 A;  4GWU A;  4LON B;  5I84 A;  3H6V A;  3HPI A;  3LSF B;  4JSD A;  1OQH A;  1FPJ A;  4NF6 A;  1DPP A;  4RJZ A;  3PTY A;  1FBF A;  1FCK A;  5DVF A;  2HAU A;  1DTG A;  3PV0 E;  4NX1 A;  1NKX A;  3UP9 A;  3BBR A;  3CG1 A;  5H8H A;  3MZ1 A;  4ND9 A;  5H8F B;  2DE3 A;  3H6U A;  1B3F A;  1Z7M E;  4O94 A;  1LEV A;  4ONY A;  4OVS A;  2XXU A;  4JBZ A;  4FIM A;  2GFE A;  3BFT A;  3O97 A;  5I7I A;  3DM0 A;  1BTJ A;  4ZEC A;  2O6A A;  3OD7 A;  1D9Q A;  5TU0 A;  4MH5 A;  1USY H;  2XXP A;  5I57 A;  5J1D A;  1NH8 A;  3EHU A;  4NF4 A;  5I58 B;  4GWO A;  4KCC A;  2DWA A;  2O7U A;  5IZ3 A;  2XXR A;  3RPL B;  1J1N A;  4KHZ E;  1NNF A;  3IJO B;  5CBR A;  2H9B A;  2X7Q A;  4ESX A;  4DCX A;  1LGB C;  2Q9T A;  5A5L A;  3IFA A;  5EQ8 A;  1KA1 A;  4ZEB A;  1Q1K A;  2I58 A;  2DP8 A;  4NN3 A;  3RYD A;  1Y3Q A;  2OWS A;  1M5C A;  3PUX E;  1RDX A;  4DZ1 A;  5DW8 A;  1UQW A;  4DXB A;  3LSL A;  4YAH X;  5I2K A;  1Y9U A;  4OVJ A;  4YB6 A;  5TPA B;  1H45 A;  3EHS A;  3S9L C;  4BDR A;  3LC8 A;  2HFB A;  5EYG A;  4RA1 A;  1MY2 A;  3D4C A;  2D21 A;  5FTH A;  4R9G A;  3KSJ A;  3KGC A;  3Q28 A;  1VR5 A;  5AA4 A;  2I3V A;  3MWB A;  1POY 1;  3QSL A;  4OAN A;  2CZK A;  3BIG A;  1QUK A;  3PPQ A;  4FEB A;  2QJE A;  4R75 A;  5CBS A;  1ANF A;  3HHG A;  3K2D A;  2R8T A;  3KFM A;  2FYI A;  1R9Q A;  3LR1 A;  3O6I A;  3W15 C;  1FBC A;  2H4I A;  3AXF A;  1OLA A;  2CEY A;  1MS7 A;  2QMX A;  1B40 A;  4FED A;  4NHB A;  1XVX A;  2A5T B;  2QL3 A;  3EF7 A;  3PUV E;  4PET A;  3OO6 A;  4DDD A;  3T0J A;  4H5F A;  3TCF A;  1N04 A;  2XXI A;  3PPN A;  2BJJ X;  2FIX A;  3OOA A;  4JWX A;  2XXK A;  4GXS B;  4PFR A;  1O63 A;  2DXR A;  3IB1 A;  1P1N A;  4F2O A;  4OHN A;  5CI5 A;  3R6U A;  4OER A;  4PTK A;  1DCU A;  1IMF A;  2I0C A;  2F7A A;  1LFG A;  3D1R A;  3O28 A;  4PC9 A;  3U8Q A;  3KZG A;  3M3K A;  1PBP A;  2VGQ A;  3C33 A;  3FVG A;  3N5L A;  4MLV A;  1PC3 A;  1FBH A;  2RCA A;  2Y5L A;  4QXD A;  4MLQ A;  1R6Z A;  2JJK A;  2F78 A;  4O3C A;  4X9T A;  3VDF A;  1OVT A;  1POT A;  3K6V A;  4JDF A;  2PVU A;  4OFJ A;  4G68 A;  5IGA A;  3TTR A;  4TQU Q;  2DVC A;  3ILT B;  5ET5 A;  3ROJ A;  1DOT A;  4U4X A;  4F2Q A;  5AA2 D;  4IY6 A;  2B3F A;  2KR0 A;  4GWW A;  4IO4 A;  1URS A;  2ZYN A;  2NUV A;  5AA2 B;  4Z0I A;  3T22 A;  2VT5 A;  2XX7 A;  4ECF A;  1B7U A;  2GRV A;  3TEP A;  3C34 A;  4MNI A;  1EZO A;  1D3K A;  4MAG A;  2F6G A;  3B6W A;  4LA9 A;  4ZZA A;  4JXI A;  4H0W A;  1VFD A;  2FVZ A;  4G2Z A;  2I49 A;  1LST A;  3RTF B;  3O6H A;  2XXX A;  5BWJ A;  2Z23 A;  4FJP A;  1MXW A;  4OQO A;  4R74 A;  2I6E A;  2ABH A;  3OMB A;  4OWD A;  4NF8 A;  1G0H A;  1NV0 A;  4PDH A;  3H4Z A;  3PUZ E;  4QF9 A;  3KN7 A;  1INP A;  1ZIU A;  1PEB A;  2M8C A;  1B05 A;  2I0B A;  1NV1 A;  4XEQ A;  3RNN A;  1SQY A;  2O1M A;  4I1D A;  4PAI A;  3U92 A;  2WEF A;  3M3F A;  4N6D A;  3U93 A;  2Y7W A;  1MPC A;  1SPI A;  3N6U A;  1N0T A;  4X04 A;  4XKQ A;  1R9L A;  2A5S A;  5DEX B;  1N76 A;  1I6B A;  3WAF A;  3TFL A;  1NV4 A;  4NGU A;  4BDO A;  1B7Z A;  4YKP A;  4H65 A;  2PCR A;  3OO7 A;  3TZA A;  1S9T A;  4PFU A;  4ZEI A;  3B6T A;  5FHO A;  1AOV A;  4EF1 A;  5A5X A;  2QS4 A;  1LB8 A;  2GH9 A;  4LUB A;  4MCO A;  3PUW E;  5F1Q A;  2GQ1 A;  1B5I A;  4U1O A;  4AS5 A;  1A99 A;  1NNK A;  2QRY A;  4YZZ A;  3C4M A;  1N3X A;  4HCW A;  4YKJ A;  2RCB A;  1URD A;  1Y3P A;  2QS1 A;  2Q88 A;  3O2A A;  3JYR A;  3O29 A;  2F3B A;  3L6H A;  1EH3 A;  2ANJ A;  4RPN A;  4OEU A;  3FXU A;  1DK4 A;  4N17 A;  1MY1 A;  4L17 A;  4F31 B;  5I59 B;  4P0I A;  4G77 A;  2UXA A;  2B65 A;  4WEP A;  1QUJ A;  1SI0 A;  1LFI A;  1VFE A;  3T9U A;  4H6D A;  2V4C A;  3FJ7 A;  1P1U A;  3VLV A;  1DTZ A;  4RPO A;  1IMA A;  3C9H A;  4PAF A;  3IR1 A;  5K2Y A;  4THI A;  3SKP A;  4F3G A;  3DP4 A;  3EHT A;  1MQG A;  2RC7 A;  1MH3 A;  4NED A;  1ZTY A;  1FQF A;  3K0V A;  1Y4T A;  2HEU A;  1OMP A;  3VVD A;  4MFI A;  2ONK E;  1CE2 A;  3CRB A;  1XOC A;  3G3G A;  2Y7K A;  4PGN A;  3OXN A;  1NL5 A;  3V89 B;  3RY3 A;  5ISU A;  2VHA A;  4LZ5 A;  1JNF A;  4P9K A;  1IUD A;  4N8Y A;  5AA1 A;  2HXW A;  2AIX A;  3KC1 A;  3FD3 A;  3FBP A;  4TLL B;  4U23 A;  2XWK A;  2DSF A;  2XXT A;  3H6W A;  4WED A;  4NF6 B;  1ZLQ A;  4TLM B;  4DE8 A;  3R26 A;  2ZYM A;  1RDZ A;  3ILU B;  4IO6 A;  4PFW A;  5ICQ A;  3FXR A;  5H8H B;  1SW1 A;  2V84 A;  1YAE A;  3CFX A;  1B51 A;  2REJ A;  4QSC A;  3IAZ A;  3EQ1 A;  1ZKB A;  1Q35 A;  3IOR A;  4GQO A;  5I57 B;  4NF4 B;  1JW4 A;  2W7Y A;  4KYD A;  3A29 A;  3RUM A;  4MBP A;  1PB9 A;  3DP8 A;  5IZ3 B;  3RQT A;  1ZBM A;  1TFD A;  4OVP A;  4G8M A;  4RK9 A;  2XXV A;  1MDQ A;  1N84 A;  3CHG A;  4BDQ A;  1NI9 A;  2OWZ A;  2ZNU A;  1LBC A;  1SW2 A;  4IR8 A;  1A54 A;  1IEJ A;  2O84 X;  1I6A A;  3E9X A;  1FPI A;  2VD3 A;  1IXI A;  3K1N A;  1JEU A;  3TPA A;  1DBZ A;  4XKN A;  1AWB A;  3V8X B;  3CVG A;  3VLU A;  1CNQ A;  3FUZ A;  5I2K B;  2RF1 A;  2Z22 A;  4LQ2 A;  3MP1 A;  2XA5 A;  3S9E A;  4BLA A;  1P99 A;  5BUU A;  1QKA A;  4WXJ A;  1FJ9 A;  3TYH A;  2F3D A;  1NUX A;  2KLF A;  5CRY A;  1FTO A;  3TTL A;  4PCD A;  2FNC A;  5AA4 B;  3UA8 A;  3I5O A;  4P56 A;  2P3N A;  2UVJ A;  4F3P A;  1WOD A;  2OZZ A;  2HPG A;  4FBP A;  1YXI A;  3A3C A;  5F24 A;  3IOU A;  1FRP A;  4GX4 A;  1QJM A;  3VLW A;  4N13 A;  2PFY A;  3MQ9 A;  4P1L A;  5KZT A;  3QK6 A;  1MXZ A;  3TTK A;  4ELR A;  2P1S A;  4OVQ A;  4R9F A;  2H98 A;  3ZSF A;  3ONM A;  4Q0C A;  3S9N C;  2H5Y A;  1FQB A;  4RK2 A;  4R6H A;  5EYF A;  1N7X A;  1MQI A;  3I3V A;  1ELJ A;  1FW0 A;  1MXX A;  3OO8 A;  4HS7 A;  3V5A A;  1XVY A;  1P1Q A;  3CFL A;  3VVE A;  1DPE A;  3U94 A;  1NMU A;  4LAT A;  1YPN A;  1JW5 A;  3OEK A;  2DE2 A;  4DLD A;  2DDK A;  1RKM A;  2D5W A;  1MPD A;  3K02 A;  5EHM A;  2B4M A;  4NF5 B;  5KCJ A;  4X1B A;  2AYS A;  3TUS A;  1MY0 A;  4LP2 B;  5EYH A;  2Q8M A;  1BK4 A;  4NMY A;  4N07 A;  2WBB A;  1MQJ A;  3K1P A;  3UN6 A;  4M4G A;  4C0R A;  2YLN A;  5DT6 A;  5LTC A;  1LCF A;  2DXY A;  3M3L A;  3PU5 A;  2REG A;  1FQC A;  3P7I A;  5HPQ A;  1FPL A;  4C1T A;  4F19 A;  5DVI A;  3KN3 A;  2CZI A;  3K00 A;  1RDY A;  4N6P A;  3H03 A;  1SW4 A;  4HE1 A;  1H76 A;  1PB8 A;  2Q74 A;  4G68 B;  3B6Q A;  4ELP A;  2CEX A;  1BIY A;  1IZ1 A;  4NF0 A;  2PMS A;  1WDN A;  4PQJ A;  4DIG A;  4HE0 A;  3VV5 A;  3IK6 B;  4RYA A;  1MXV A;  3G7W A;  2B3B A;  3T93 B;  4R2B A;  4IY5 A;  4N4U A;  1EYK A;  4YB5 A;  4GL0 A;  3HST A;  2XXQ A;  4IGT A;  1US5 A;  2O69 A;  4OYV A;  1BLF A;  1KA0 A;  4WKM A;  5B7D A;  3NOH A;  1CB6 A;  2MKZ A;  3CG3 A;  4MMP A;  1B4H A;  1IMD A;  5CC2 A;  3LBS A;  3MST A;  1AIV A;  3TDJ A;  3H3G A;  2B4L A;  4MX6 A;  3TOD A;  1OVB A;  3KBZ A;  4JB7 A;  4N15 A;  1OLC A;  1TFA A;  4NF8 B;  4PE5 B;  2QVR A;  2UYE A;  3OEL A;  4KR5 A;  4NAP A;  4GBW A;  1GTK A;  4ZDM A;  2HXR A;  4NF5 A;  1LFH A;  4LZ7 A;  1XI6 A;  3UIF A;  3S2V A;  5ITO A;  5EQ9 A;  4GWZ A;  5I56 A;  1NV5 A;  1K9Z A;  4C1U A;  5JTY A;  2I4B A;  4I8C A;  4OVR A;  1FPF A;  3Q27 A;  4EQ9 A;  1IIT A;  4LQ5 A;  4R6K A;  3KSX A;  2Q8J A;  4KYE A;  5A5X B;  1FTJ A;  3IFC A;  3KC0 A;  2XX9 A;  1WVJ A;  1NUZ A;  4POX A;  1FQA A;  3FVN A;  5H8S A;  4NTL A;  3LUZ A;  2OK2 A;  2F34 A;  1MDP 1;  3TEL A;  3TQL A;  1SYH A;  1VSO A;  5H8Q A;  2L5V A;  3Q25 A;  3MP8 A;  4N91 A;  3MP6 A;  3F11 A;  1A55 A;  2D3I A;  3O6G A;  1MXY A;  3EN3 A;  4XFE A;  1FTM A;  4QFK A;  4ZS9 A;  2DWH A;  1K9Y A;  3TCH A;  1IXC A;  4GX6 A;  3OEM A;  1Y4C A;  3RGY A;  2V3U A;  2I4C A;  1MH4 A;  2R9J A;  4ELQ A;  1EZ9 A;  4E0X A;  4BDM A;  5IAI A;  3IB2 A;  2I3W A;  3SEY A;  3SEX A;  1EZP A;  4Q8R A;  3UOR A;  4IO7 A;  4G8N A;  4PFB A;  4PFT A;  2DYX A;  5LDZ A;  1FTA A;  4P47 A;  1FSA A;  3FAT A;  3GLB A;  4GBV A;  5FHM A;  2NXO A;  4F1U A;  2F6P A;  4XTC Q;  1FQD A;  3QAX A;  5IM2 A;  2F7B A;  4BDL A;  3RTW B;  4OFO A;  4OVT A;  4EXL A;  4I3E A;  2NVU B;  3KG2 A;  2O68 A;  4K3F A;  4F18 A;  1L5T A;  4POW A;  4MNC A;  3IL1 B;  4NWD A;  1O7T A;  4R2F A;  2WYP A;  3SEW A;  1Q9D A;  3OSR A;  1FBD A;  4JSO A;  4G61 A;  4U1Z A;  1FQE A;  3N6T A;  3IX1 A;  4OFL A;  4AB6 A;  3JV9 A;  2ONR A;  2ZNT A;  4U22 A;  4OZ9 A;  4OES A;  3DP6 A;  2Y7R A;  1N3W A;  2PBW A;  4O7M A;  1JVX A;  4DXC A;  2KQZ A;  2Q89 A;  3MVX A;  2E1S A;  3PMV A;  1S7Y A;  4OET A;  1NUW A;  1KWH A;  4OXV A;  2IEE A;  1JP4 A;  4U4S A;  5L9S A;  2ESN A;  1NV7 A;  2Z8D A;  4AQ4 A;  4HE2 A;  2HQ0 A;  2H99 A;  4AS4 A;  3THI A;  5HBC A;  3C35 A;  1FBE A;  2VP1 A;  2FA7 A;  1OQG A;  3GXA A;  3H6T A;  5ITP A;  3E13 X;  3FJM A;  1B0H A;  1ZJL A;  5DTB A;  1B5H A;  1I69 A;  4ESW A;  1Z7N E;  1F9B A;  4QFN A;  4JVI A;  4LN5 A;  1FTL A;  4DCY A;  1A40 A;  4HCY A;  3MAM A;  3KBR A;  4P0G A;  2HZK A;  1NNT A;  3TAJ A;  1LAF E;  4KFQ A;  3O66 A;  3G3I A;  1LBY A;  1SD3 A;  3TQW A;  3MPK A;  3FAS A;  2R6G E;  1B6H A;  1P1W A;  4ZEK A;  1LBW A;  4PBH A;  3E4R A;  3N26 A;  1P1O A;  5KDT A;  5CMB A;  3GYY A;  5AE4 A;  2VD2 A;  1XC1 A;  3VE1 B;  5I2N A;  2HHM A;  3D4G A;  4PFY A;  4GRK A;  5CM6 A;  1NV3 A;  1EYI A;  1MQH A;  5HM4 B;  3KOT A;  1TXF A;  2RKM A;  3FXQ A;  4R73 A;  4PDD A;  3WAE A;  1URG A;  1MY3 A;  3V83 A;  3S9M C;  1NV6 A;  3CSG A;  4TOZ A;  3JZJ A;  4BDN A;  3MYU A;  5T3J A;  4H8J A;  2PT2 A;  5EQA A;  1FPE A;  3S4U A;  1LAG E;  1AH5 A;  4F22 A;  5IZZ A;  4LVQ A;  4QHQ A;  1SI1 A;  4YMA A;  3E79 A;  5KCJ B;  1H44 A;  3ZKL A;  2XXH A;  2OCU A;  3M8U A;  4X8R A;  1LBB A;  4ZE8 A;  2QVV A;  3LSX A;  1OIB A;  3PMW A;  4PF8 A;  2CZH A;  2I48 A;  1QW0 A;  2UVI A;  1UTB A;  1QUL A;  4MEV A;  1KZ8 A;  3SET A;  2VPO A;  1XS5 A;  1PDA A;  5FTI A;  1LLS A;  2Y84 A;  1MG1 A;  1DMB A;  4H67 A;  3T66 A;  5FHN A;  1I6Q A;  2FBP A;  3U72 A;  2YPN A;  5L9O A;  2E0S A;  1ATG A;  5DVJ A;  3TCG A;  4IB2 A;  4FAJ A;  4GIZ A;  4RNS A;  2G93 A;  1B1X A;  3K4U A;  4PFI A;  1USY E;  4XF5 A;  3QUF A;  2H25 A;  4PBQ A;  4N81 A;  3PGF A;  2OLB A;  4GL8 A;  1UTH A;  2F7C A;  2IA4 A;  2DWJ A;  4NQ8 A;  1TWY A;  1II5 A;  5TP9 A;  1YZ0 A;  2O7I A;  2QMW A;  4KPT A;  2VPN A;  1FBP A;  4JVC A;  4JVD A;  3MJN A;  3FXB A;  1FTK A;  4UAB A;  4DXU A;  3E78 A;  5ET6 A;  1YCJ A;  5I3S A;  5B70 A;  3FGS A;  2LAO A;  2FIE A;  1YTV A;  2UVG A;  3OSQ A;  1JQF A;  1EU8 A;  4GD5 A;  5EQ7 A;  3PMX A;  4JWO A;  2XXY A;  3SES A;  2RIN A;  4M1V A;  1B0L A;  1NFT A;  2DS9 A;  3U65 A;  4O3B A;  3OO9 A;  2G29 A;  4F3S A;  4XIG Q;  2BJI A;  5I56 B;  4GWS A;  1IXH A;  4PAK A;  1D4N A;  2V3Q A;  3USD A;  3MVZ A;  3SEV A;  4F39 A;  5JTY B;  3UGW A;  2QSX A;  1LAX A;  1B7H A;  3HFU A;  4MF3 A;  4KCD A;  3FZV A;  3IOW A;  3K01 A;  1LBX A;  3A09 A;  3IOV A;  2CZL A;  4QSE A;  1M5E A;  3QMF A;  4DI3 D;  5IKB A;  4PP0 A;  3OEN A;  4EF2 A;  5H8N A;  5JEI A;  1A8F A;  4OEV A;  1N7W A;  2VOZ A;  2DOJ A;  2O1L A;  3IB0 A;  3O9P A;  5AA3 A;  2X7P A;  2DVZ A;  5F7V A;  3ECR A;  4N6K A;  1LBZ A;  5H8Q B;  1RYO A;  4GWY A;  4HXV A;  4N8G A;  4OEN A;  3T96 B;  3RT6 B;  3RN8 A;  3Q29 A;  1T0K A;  3BIH A;  3T9X B;  1SVX B;  3FVO A;  1IQ7 A;  3HHF A;  5H8F A;  1QKB A;  3TMG A;  3SZP A;  1NNP A;  2P3V A;  2O51 A;  3K6X A;  3KJT A;  4KYS A;  1JEV A;  1M5B A;  3SDF A;  3DEL B;  3PD9 A;  2QS2 A;  4AB5 A;  1IMC A;  5I58 A;  1D9Y A;  2XHD A;  2Q2A A;  4ZED A;  2FHY A;  3CR9 A;  3RPL A;  3RT8 A;  4UAC A;  1UIU A;  3VFJ A;  4QBA A;  4NG7 A;  1FPB A;  5JK4 A;  1EYJ A;  3L6G A;  4R6Y A;  2ZYO A;  3K6W A;  2DE4 A;  3VVF A;  1SDX A;  1FPG A;  3C36 A;  5M2V A;  4HW8 A;  4G8H A;  3K1M A;  4P1E A;  2QVU A;  1VDW A;  1IIW A;  3CSB A;  1XHY A;  4PE3 A;  1QUI A;  4NE4 A;  2NOO A;  5TPA A;  4OA4 A;  4MHF A;  3MPL A;  3R7X A;  3MBP A;  4ZE9 A;  3VXC A;  5CMM A;  3FV1 A;  2V25 A;  4O3A A;  4EQB A;  2ZXT A;  3ZKK A;  1O64 A;  4XKP A;  4Z7E A;  4OMB A;  2DQV A;  2Y5K A;  1B4Z A;  2ZNS A;  4RY1 A;  5L9M A;  4I3Y A;  3SEU A;  1JVY A;  2ONS A;  3G3K A;  4MNP A;  2F97 A;  1IMB A;  1MXU A;  3MUQ A;  1QGX A;  4FE8 A;  1SBP A;  1B3L A;  2ZYK A;  4F1V A;  2V93 A;  2X26 A;  4GFR A;  2WBD A;  2A5T A;  1FBG A;  3GZG A;  2PFZ A;  4JWY A;  2Z8E A;  2Y7P A;  3H06 B;  5I5P A;  4IGR A;  1A7L A;  4QFO A;  2ALU A;  1M5F A;  3B7D A;  3PPP A;  2XWI A;  3G3H A;  2P2A A;  1XT8 A;  5ET7 A;  5ELV A;  4I40 A;  3FJG A;  3PUY E;  2GHB A;  2ZZX A;  3W9V A;  4ELO A;  3EKI A;  4GLI A;  4IO2 A;  4XKR A;  1UIV A;  4OTE A;  3TKD A;  3PPR A;  1B3G A;  4GWX A;  3MVW A;  3GBA A;  3HO7 A;  1ZU0 A;  3E3K A;  1GGG A;  2UYF A;  4H1X A;  4KQP A;  3Q26 A;  4KI0 E;  1GR2 A;  3H7M A;  4QFP A;  1NV2 A;  1PBQ A;  3T9V A;  2XWO A;  4EDP A;  3BFU A;  2AL5 A;  2OX3 A;  1US4 A;  2ZMB A;  4LZ8 A;  2PYY A;  3G3F A;  4FEC A;  5CMC A;  1YYZ A;  1ZMG A;  4PGP A;  4H5G A;  2HAV A;  3UK4 A;  4QSD A;  3QYT A;  3B50 A;  4KXP A;  1BP5 A;  5KDT B;  2XX8 A;  5L8D A;  3KEI A;  4ISU A;  1Y3N A;  1DSN A;  2Y7I A;  2NWJ A;  5AA2 A;  3SER A;  3T9H B;  3BKI B;  1QVS A;  1A8E A;  2DWI A;  2R71 A;  3ZS6 A;  1B3E A;  5I2N B;  3HN0 A;  2V3T A;  1B5J A;  1JW1 A;  1AMF A;  2AL4 A;  2XXW A;  1IXG A;  1M5D A;  3CI8 A;  2PT1 A;  4EUO A;  5J16 A;  2QFL A;  4GF8 A;  1FJ6 A;  1PB7 A;  3FIR A;  4YU0 A;  4UA8 A;  2CMO A;  1BKA A;  3LUY A;  3B8B A;  4QFL A; 
#chains in the Genus database with same CATH homology
 1B9J A;  5ICT A;  3KOS A;  4X1D A;  5EHS A;  3I6V A;  2OBG A;  2F36 A;  3K6U A;  4YB7 A;  2QPQ A;  1SYI A;  3KN8 A;  1Y1M A;  2P0S A;  3HV1 A;  1B1H A;  4XXU A;  1LB9 A;  1D9V A;  4FOR A;  3IO4 A;  1B3H A;  4F1Y A;  3ODB A;  5DEX A;  2UVH A;  3KJ7 A;  1B32 A;  1R1N A;  2RC9 A;  1UTB B;  3C32 A;  1Y1Z A;  2WKY A;  3MZ9 A;  4Q5T A;  2OWT A;  4YIC A;  1HSL A;  4I62 A;  2RC8 A;  1B2H A;  2F5X A;  2HCA A;  2F35 A;  3IO6 A;  4EXK A;  1SW5 A;  4GOT A;  1MM6 A;  4HTG A;  1GVC A;  2HZL A;  3RLF E;  4GVO A;  4QRZ A;  3MZB A;  3EPE A;  5LOM A;  1MPB A;  4R72 A;  3A3U A;  4KD5 A;  2XD3 A;  3PPO A;  4YKI A;  4P11 A;  1MM7 A;  3TTM A;  1JET A;  4IO5 A;  1UTH B;  1H3D A;  1H43 A;  2F8D A;  2YJP A;  3C31 A;  1VE4 A;  4NWC A;  5TP9 B;  2XD2 A;  2GHA A;  4E0W A;  3IOT A;  5K2X A;  4U21 A;  3FV2 A;  3TTN A;  3LSW A;  3CIJ A;  4G68 C;  3W9W A;  4Q30 B;  4F29 A;  4I9D A;  2QS3 A;  1LAH E;  4FAT A;  5I59 A;  4H8I A;  3MC2 A;  3N94 A;  1RYX A;  1MQD A;  3HCQ A;  4EQ7 A;  4U2R A;  3G3J A;  2Z8F A;  2THI A;  3FVK A;  1HSJ A;  4YMB A;  3GBB A;  3PD8 A;  3VXB A;  1AL3 A;  1B58 A;  3CFZ A;  1MY4 A;  1NH7 A;  1B46 A;  1Y20 A;  5DYH A;  3QUJ A;  3MVY A;  3IJX B;  4YKK A;  3QIM A;  4G4P A;  2Q2C A;  1S50 A;  4GXA A;  4ZZE A;  3RPW A;  3QXM A;  4IO3 A;  1TT1 A;  4RXL A;  5H8N B;  1GV8 A;  3DLN A;  4X48 A;  4ZEF A;  1LCT A;  4F3B A;  2OJT A;  1HSE A;  3MW0 A;  1MRP A;  1B52 A;  3U1O A;  5CMK A;  2PX1 A;  4LON B;  5I84 A;  3H6V A;  3HPI A;  3LSF B;  4JSD A;  1OQH A;  4NF6 A;  1DPP A;  4RJZ A;  1FCK A;  5DVF A;  2HAU A;  1DTG A;  3PV0 E;  1NKX A;  3UP9 A;  3BBR A;  3CG1 A;  5H8H A;  3MZ1 A;  4ND9 A;  5H8F B;  2DE3 A;  3H6U A;  1B3F A;  1Z7M E;  4ONY A;  2XXU A;  4JBZ A;  4FIM A;  2GFE A;  3BFT A;  3O97 A;  3DM0 A;  1BTJ A;  4ZEC A;  2O6A A;  3OD7 A;  5TU0 A;  4MH5 A;  1USY H;  2XXP A;  5I57 A;  5J1D A;  1NH8 A;  3EHU A;  4NF4 A;  5I58 B;  4GWO A;  4KCC A;  2DWA A;  2O7U A;  2XXR A;  1J1N A;  4KHZ E;  1NNF A;  3IJO B;  5CBR A;  2H9B A;  2X7Q A;  4ESX A;  4DCX A;  1LGB C;  2Q9T A;  4ZEB A;  1Q1K A;  2I58 A;  2DP8 A;  1Y3Q A;  2OWS A;  1M5C A;  3PUX E;  4DZ1 A;  1UQW A;  4DXB A;  3LSL A;  4YAH X;  5I2K A;  1Y9U A;  4OVJ A;  4YB6 A;  5TPA B;  1H45 A;  3EHS A;  3S9L C;  4BDR A;  3LC8 A;  2HFB A;  4RA1 A;  1MY2 A;  3D4C A;  2D21 A;  5FTH A;  4R9G A;  3KSJ A;  3KGC A;  3Q28 A;  1VR5 A;  5AA4 A;  2I3V A;  3MWB A;  1POY 1;  3QSL A;  1QUK A;  3PPQ A;  4FEB A;  2QJE A;  4R75 A;  5CBS A;  1ANF A;  3HHG A;  3K2D A;  3KFM A;  2FYI A;  1R9Q A;  3LR1 A;  3O6I A;  3W15 C;  2H4I A;  3AXF A;  1OLA A;  1MS7 A;  2QMX A;  1B40 A;  4FED A;  1XVX A;  2A5T B;  2QL3 A;  3EF7 A;  3PUV E;  4PET A;  3OO6 A;  4DDD A;  4H5F A;  3TCF A;  1N04 A;  2XXI A;  3PPN A;  2BJJ X;  3OOA A;  4JWX A;  4GXS B;  1O63 A;  2DXR A;  3IB1 A;  1P1N A;  4F2O A;  4OHN A;  5CI5 A;  3R6U A;  4OER A;  2I0C A;  2F7A A;  1LFG A;  3O28 A;  3U8Q A;  3KZG A;  3M3K A;  1PBP A;  2VGQ A;  3C33 A;  3FVG A;  3N5L A;  4MLV A;  1PC3 A;  2RCA A;  4MLQ A;  1R6Z A;  2F78 A;  4O3C A;  4X9T A;  3VDF A;  1OVT A;  1POT A;  3K6V A;  4JDF A;  2PVU A;  4OFJ A;  4G68 A;  3TTR A;  4TQU Q;  2DVC A;  3ILT B;  1DOT A;  4U4X A;  4F2Q A;  5AA2 D;  4IY6 A;  2B3F A;  4IO4 A;  1URS A;  2ZYN A;  2NUV A;  5AA2 B;  4Z0I A;  3T22 A;  2XX7 A;  4ECF A;  1B7U A;  2GRV A;  3TEP A;  3C34 A;  1EZO A;  1D3K A;  2F6G A;  3B6W A;  4LA9 A;  4ZZA A;  4JXI A;  4H0W A;  1VFD A;  4G2Z A;  2I49 A;  1LST A;  3RTF B;  3O6H A;  2XXX A;  5BWJ A;  2Z23 A;  4FJP A;  1MXW A;  4OQO A;  4R74 A;  2I6E A;  2ABH A;  3OMB A;  4OWD A;  4NF8 A;  3H4Z A;  3PUZ E;  4QF9 A;  3KN7 A;  1ZIU A;  1PEB A;  2M8C A;  1B05 A;  2I0B A;  3RNN A;  1SQY A;  2O1M A;  4I1D A;  3U92 A;  3M3F A;  3U93 A;  2Y7W A;  1MPC A;  3N6U A;  1N0T A;  4XKQ A;  1R9L A;  2A5S A;  5DEX B;  1N76 A;  1I6B A;  3WAF A;  3TFL A;  4BDO A;  1B7Z A;  4YKP A;  4H65 A;  3OO7 A;  3TZA A;  1S9T A;  4PFU A;  4ZEI A;  3B6T A;  5FHO A;  1AOV A;  4EF1 A;  5A5X A;  2QS4 A;  1LB8 A;  2GH9 A;  4LUB A;  3PUW E;  5F1Q A;  1B5I A;  4U1O A;  1A99 A;  1NNK A;  2QRY A;  4YZZ A;  3C4M A;  1N3X A;  4HCW A;  4YKJ A;  2RCB A;  1URD A;  1Y3P A;  2QS1 A;  2Q88 A;  3O2A A;  3JYR A;  3O29 A;  3L6H A;  1EH3 A;  2ANJ A;  4RPN A;  4OEU A;  3FXU A;  1MY1 A;  4L17 A;  4F31 B;  5I59 B;  4P0I A;  4G77 A;  2UXA A;  2B65 A;  4WEP A;  1QUJ A;  1SI0 A;  1LFI A;  1VFE A;  3T9U A;  4H6D A;  3FJ7 A;  1P1U A;  3VLV A;  1DTZ A;  4RPO A;  3C9H A;  3IR1 A;  5K2Y A;  4THI A;  3SKP A;  4F3G A;  3DP4 A;  3EHT A;  1MQG A;  2RC7 A;  1MH3 A;  4NED A;  1ZTY A;  1FQF A;  3K0V A;  1Y4T A;  2HEU A;  1OMP A;  3VVD A;  4MFI A;  2ONK E;  1CE2 A;  3CRB A;  1XOC A;  3G3G A;  2Y7K A;  3OXN A;  1NL5 A;  3V89 B;  3RY3 A;  5ISU A;  2VHA A;  4LZ5 A;  1JNF A;  1IUD A;  5AA1 A;  2HXW A;  2AIX A;  3FD3 A;  4TLL B;  4U23 A;  2DSF A;  2XXT A;  3H6W A;  4WED A;  4NF6 B;  1ZLQ A;  4TLM B;  4DE8 A;  3R26 A;  2ZYM A;  3ILU B;  4IO6 A;  4PFW A;  5ICQ A;  3FXR A;  5H8H B;  1SW1 A;  2V84 A;  1YAE A;  3CFX A;  1B51 A;  2REJ A;  4QSC A;  3IAZ A;  3EQ1 A;  1ZKB A;  1Q35 A;  3IOR A;  4GQO A;  5I57 B;  4NF4 B;  1JW4 A;  2W7Y A;  4KYD A;  3RUM A;  4MBP A;  1PB9 A;  3DP8 A;  3RQT A;  1ZBM A;  1TFD A;  4G8M A;  4RK9 A;  2XXV A;  1MDQ A;  1N84 A;  4BDQ A;  2ZNU A;  1LBC A;  1SW2 A;  1A54 A;  1IEJ A;  2O84 X;  1I6A A;  3E9X A;  2VD3 A;  1IXI A;  3K1N A;  1JEU A;  3TPA A;  4XKN A;  3V8X B;  3CVG A;  3VLU A;  3FUZ A;  5I2K B;  2RF1 A;  2Z22 A;  4LQ2 A;  3MP1 A;  3S9E A;  4BLA A;  1P99 A;  5BUU A;  1QKA A;  4WXJ A;  3TYH A;  2KLF A;  5CRY A;  1FTO A;  3TTL A;  2FNC A;  5AA4 B;  3UA8 A;  3I5O A;  2UVJ A;  4F3P A;  1WOD A;  2OZZ A;  3A3C A;  3IOU A;  3VLW A;  1QJM A;  4N13 A;  3MQ9 A;  5KZT A;  3QK6 A;  1MXZ A;  3TTK A;  4ELR A;  2P1S A;  4R9F A;  2H98 A;  3ZSF A;  3ONM A;  4Q0C A;  3S9N C;  2H5Y A;  1FQB A;  4RK2 A;  4R6H A;  5EYF A;  1N7X A;  1MQI A;  3I3V A;  1ELJ A;  1FW0 A;  1MXX A;  3OO8 A;  4HS7 A;  3V5A A;  1XVY A;  1P1Q A;  3CFL A;  3VVE A;  1DPE A;  3U94 A;  1NMU A;  1YPN A;  4LAT A;  1JW5 A;  3OEK A;  2DE2 A;  4DLD A;  1RKM A;  2D5W A;  1MPD A;  3K02 A;  5EHM A;  4NF5 B;  5KCJ A;  4X1B A;  2AYS A;  3TUS A;  1MY0 A;  4LP2 B;  4NMY A;  4N07 A;  1MQJ A;  3K1P A;  3UN6 A;  4M4G A;  4C0R A;  2YLN A;  5DT6 A;  1LCF A;  2DXY A;  3M3L A;  3PU5 A;  2REG A;  1FQC A;  3P7I A;  5HPQ A;  4C1T A;  4F19 A;  5DVI A;  3KN3 A;  3K00 A;  4N6P A;  3H03 A;  1SW4 A;  1H76 A;  1PB8 A;  4G68 B;  3B6Q A;  4ELP A;  1BIY A;  1IZ1 A;  2PMS A;  1WDN A;  4PQJ A;  4DIG A;  3VV5 A;  3IK6 B;  4RYA A;  1MXV A;  3G7W A;  2B3B A;  3T93 B;  4R2B A;  4IY5 A;  4YB5 A;  4GL0 A;  3HST A;  2XXQ A;  4IGT A;  1US5 A;  2O69 A;  4OYV A;  1BLF A;  4WKM A;  5B7D A;  1CB6 A;  3CG3 A;  1B4H A;  5CC2 A;  3LBS A;  1AIV A;  3TDJ A;  3H3G A;  3TOD A;  1OVB A;  4JB7 A;  1OLC A;  1TFA A;  4NF8 B;  4PE5 B;  2UYE A;  3OEL A;  4KR5 A;  1GTK A;  4ZDM A;  4NF5 A;  1LFH A;  4LZ7 A;  3UIF A;  3S2V A;  5ITO A;  5I56 A;  4C1U A;  5JTY A;  2I4B A;  4I8C A;  3Q27 A;  4EQ9 A;  1IIT A;  4LQ5 A;  4R6K A;  3KSX A;  2Q8J A;  4KYE A;  5A5X B;  1FTJ A;  2XX9 A;  1WVJ A;  4POX A;  1FQA A;  3FVN A;  5H8S A;  4NTL A;  2OK2 A;  2F34 A;  1MDP 1;  3TEL A;  3TQL A;  1SYH A;  1VSO A;  5H8Q A;  3Q25 A;  3MP8 A;  3MP6 A;  3F11 A;  1A55 A;  2D3I A;  3O6G A;  1MXY A;  3EN3 A;  1FTM A;  4QFK A;  4ZS9 A;  2DWH A;  3TCH A;  1IXC A;  3OEM A;  1Y4C A;  3RGY A;  2V3U A;  2I4C A;  1MH4 A;  2R9J A;  4ELQ A;  1EZ9 A;  4E0X A;  4BDM A;  5IAI A;  3IB2 A;  2I3W A;  3SEY A;  3SEX A;  1EZP A;  4Q8R A;  3UOR A;  4IO7 A;  4G8N A;  4PFT A;  2DYX A;  3FAT A;  3GLB A;  5FHM A;  2NXO A;  4F1U A;  2F6P A;  4XTC Q;  1FQD A;  3QAX A;  2F7B A;  4BDL A;  3RTW B;  4OFO A;  4EXL A;  2NVU B;  3KG2 A;  2O68 A;  4K3F A;  4F18 A;  1L5T A;  4POW A;  3IL1 B;  4NWD A;  1O7T A;  4R2F A;  3SEW A;  3OSR A;  4JSO A;  4U1Z A;  1FQE A;  3N6T A;  3IX1 A;  4OFL A;  4AB6 A;  3JV9 A;  2ONR A;  2ZNT A;  4U22 A;  4OZ9 A;  4OES A;  3DP6 A;  2Y7R A;  1N3W A;  2PBW A;  1JVX A;  4DXC A;  2Q89 A;  3MVX A;  2E1S A;  3PMV A;  1S7Y A;  4OET A;  1KWH A;  4OXV A;  2IEE A;  4U4S A;  5L9S A;  2ESN A;  2Z8D A;  4AQ4 A;  2HQ0 A;  2H99 A;  3THI A;  5HBC A;  3C35 A;  2VP1 A;  2FA7 A;  1OQG A;  3GXA A;  3H6T A;  5ITP A;  3E13 X;  3FJM A;  1B0H A;  1ZJL A;  5DTB A;  1B5H A;  1I69 A;  4ESW A;  1Z7N E;  1F9B A;  4QFN A;  1FTL A;  4DCY A;  1A40 A;  4HCY A;  3MAM A;  3KBR A;  4P0G A;  2HZK A;  1NNT A;  3TAJ A;  1LAF E;  4KFQ A;  3O66 A;  3G3I A;  1SD3 A;  3TQW A;  3MPK A;  3FAS A;  2R6G E;  1B6H A;  1P1W A;  4ZEK A;  3E4R A;  3N26 A;  1P1O A;  5KDT A;  5CMB A;  5AE4 A;  2VD2 A;  1XC1 A;  3VE1 B;  5I2N A;  3D4G A;  4PFY A;  4GRK A;  5CM6 A;  1MQH A;  5HM4 B;  3KOT A;  1TXF A;  2RKM A;  3FXQ A;  4R73 A;  3WAE A;  1URG A;  1MY3 A;  3V83 A;  3S9M C;  3CSG A;  4TOZ A;  3JZJ A;  4BDN A;  4H8J A;  2PT2 A;  3S4U A;  1LAG E;  1AH5 A;  4F22 A;  4LVQ A;  4QHQ A;  1SI1 A;  4YMA A;  5KCJ B;  1H44 A;  3ZKL A;  2XXH A;  2OCU A;  3M8U A;  4ZE8 A;  1LBB A;  3LSX A;  1OIB A;  3PMW A;  2I48 A;  1QW0 A;  2UVI A;  1UTB A;  1QUL A;  3SET A;  1XS5 A;  1PDA A;  5FTI A;  1LLS A;  2Y84 A;  1MG1 A;  1DMB A;  4H67 A;  3T66 A;  5FHN A;  1I6Q A;  3U72 A;  2YPN A;  5L9O A;  2E0S A;  1ATG A;  5DVJ A;  3TCG A;  4IB2 A;  4FAJ A;  4GIZ A;  4RNS A;  2G93 A;  1B1X A;  3K4U A;  1USY E;  3QUF A;  2H25 A;  3PGF A;  2OLB A;  4GL8 A;  1UTH A;  2F7C A;  2IA4 A;  2DWJ A;  1TWY A;  1II5 A;  5TP9 A;  2O7I A;  2QMW A;  4KPT A;  3MJN A;  1FTK A;  4DXU A;  1YCJ A;  5B70 A;  3FGS A;  2LAO A;  1YTV A;  2UVG A;  3OSQ A;  1JQF A;  1EU8 A;  4GD5 A;  3PMX A;  4JWO A;  2XXY A;  3SES A;  2RIN A;  4M1V A;  1B0L A;  1NFT A;  2DS9 A;  4O3B A;  3OO9 A;  2G29 A;  4F3S A;  4XIG Q;  5I56 B;  1IXH A;  1D4N A;  2V3Q A;  3USD A;  3MVZ A;  3SEV A;  4F39 A;  5JTY B;  3UGW A;  2QSX A;  1LAX A;  1B7H A;  4MF3 A;  4KCD A;  3FZV A;  3IOW A;  3K01 A;  3A09 A;  3IOV A;  2CZL A;  4QSE A;  1M5E A;  5IKB A;  4PP0 A;  3OEN A;  4EF2 A;  5H8N A;  5JEI A;  1A8F A;  4OEV A;  1N7W A;  2VOZ A;  2DOJ A;  2O1L A;  3IB0 A;  3O9P A;  5AA3 A;  2X7P A;  2DVZ A;  5F7V A;  3ECR A;  5H8Q B;  1RYO A;  4OEN A;  3T96 B;  3RT6 B;  3RN8 A;  3Q29 A;  1T0K A;  3T9X B;  1SVX B;  3FVO A;  1IQ7 A;  3HHF A;  5H8F A;  1QKB A;  3TMG A;  1NNP A;  2O51 A;  3K6X A;  3KJT A;  4KYS A;  1JEV A;  1M5B A;  3SDF A;  3DEL B;  3PD9 A;  2QS2 A;  4AB5 A;  5I58 A;  1D9Y A;  2XHD A;  2Q2A A;  4ZED A;  3CR9 A;  3RT8 A;  4UAC A;  1UIU A;  3VFJ A;  5JK4 A;  3L6G A;  4R6Y A;  2ZYO A;  3K6W A;  2DE4 A;  3VVF A;  1SDX A;  3C36 A;  5M2V A;  4HW8 A;  4G8H A;  3K1M A;  1IIW A;  3CSB A;  1XHY A;  1QUI A;  4NE4 A;  2NOO A;  5TPA A;  3MPL A;  3R7X A;  3MBP A;  4ZE9 A;  3VXC A;  5CMM A;  3FV1 A;  2V25 A;  4O3A A;  4EQB A;  2ZXT A;  3ZKK A;  1O64 A;  4XKP A;  4Z7E A;  4OMB A;  2DQV A;  1B4Z A;  2ZNS A;  4RY1 A;  5L9M A;  3SEU A;  1JVY A;  2ONS A;  3G3K A;  2F97 A;  1MXU A;  3MUQ A;  4FE8 A;  1SBP A;  1B3L A;  2ZYK A;  4F1V A;  2V93 A;  2X26 A;  4GFR A;  2A5T A;  3GZG A;  4JWY A;  2Z8E A;  2Y7P A;  3H06 B;  4IGR A;  1A7L A;  4QFO A;  2ALU A;  1M5F A;  3B7D A;  3PPP A;  3G3H A;  2P2A A;  1XT8 A;  5ELV A;  3FJG A;  3PUY E;  2GHB A;  3W9V A;  4ELO A;  4GLI A;  4IO2 A;  4XKR A;  1UIV A;  4OTE A;  3TKD A;  3PPR A;  1B3G A;  3MVW A;  3GBA A;  3HO7 A;  1ZU0 A;  3E3K A;  1GGG A;  2UYF A;  4H1X A;  4KQP A;  3Q26 A;  4KI0 E;  1GR2 A;  3H7M A;  4QFP A;  1PBQ A;  3T9V A;  4EDP A;  3BFU A;  2AL5 A;  1US4 A;  2ZMB A;  4LZ8 A;  2PYY A;  3G3F A;  4FEC A;  5CMC A;  1ZMG A;  4H5G A;  2HAV A;  3UK4 A;  4QSD A;  3QYT A;  1BP5 A;  5KDT B;  2XX8 A;  5L8D A;  3KEI A;  4ISU A;  1Y3N A;  1DSN A;  2Y7I A;  2NWJ A;  5AA2 A;  3SER A;  3T9H B;  3BKI B;  1QVS A;  1A8E A;  2DWI A;  2R71 A;  3ZS6 A;  1B3E A;  5I2N B;  3HN0 A;  2V3T A;  1B5J A;  1JW1 A;  1AMF A;  2AL4 A;  2XXW A;  1IXG A;  1M5D A;  3CI8 A;  2PT1 A;  4EUO A;  4GF8 A;  1PB7 A;  3FIR A;  4YU0 A;  4UA8 A;  2CMO A;  1BKA A;  3LUY A;  4QFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...