1YAEA

Structure of the kainate receptor subunit glur6 agonist binding domain complexed with domoic acid
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
289
structure length
261
Chain Sequence
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the kainate receptor subunit GluR6 agonist-binding domain complexed with domoic acid.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
total genus 73
structure length 261
sequence length 289
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1yaeA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1yaeA02
4O3AA 1LBBA 1LFHA 2I4CA 3H3GA 1JW5A 1NNTA 1FQFA 1TFDA 1PBPA 4IY6A 4OENA 4OXVA 2ZNTA 5EHMA 4KFQA 3T93B 3OSRA 3MZ9A 3FATA 5TPAB 4F3PA 5JTYB 1UTHB 2XXXA 1URGA 1PC3A 1MY0A 3FVKA 3HPIA 3O28A 3PV0E 1YTVA 5H8QA 1POY1 2OCUA 2XD2A 2GHBA 2XXRA 4YMBA 3N26A 4DXBA 3C32A 2G29A 3SERA 4PETA 2W7YA 4N13A 3PUVE 1FQCA 1FTMA 1LB9A 2DVZA 1H76A 2O1LA 3FXRA 3IR1A 5L9MA 4P11A 3EHUA 1ELJA 5TPAA 3S4UA 5I2KB 1DSNA 3ILTB 5K2XA 3VXCA 1M5FA 3DELB 3OELA 3B6QA 4QFOA 4GD5A 2QS4A 2I0CA 4LZ7A 3K1NA 4NTLA 1B0HA 1P1NA 3KG2A 4ND9A 2AL5A 4U4SA 3TTMA 4UACA 4PFYA 2F6PA 1OVBA 1PBQA 4GIZA 3C36A 2XXTA 2I49A 2Q8JA 3USDA 4ESWA 3FV1A 4LATA 3PPNA 4KCDA 1UTBA 5I57A 5H8HA 3I5OA 3ZKLA 1LAHE 3N5LA 4YU0A 4KHZE 4UA8A 3IO6A 1QULA 3MP8A 3VXBA 3L6HA 3PU5A 3HCQA 3TYHA 5I59A 3RN8A 4E0XA 2RC7A 2QSXA 1KWHA 2HFBA 1MM7A 4G2ZA 4IB2A 4TQUQ 1YCJA 5DVIA 5EYFA 5F1QA 5AA2A 3TCGA 3DP6A 1URDA 3IL1B 3IOUA 3R6UA 4IO6A 3O6HA 3TQWA 3W15C 2P2AA 2XXUA 1B1HA 1HSLA 1N7WA 4HCWA 3V89B 1N76A 1MXYA 4FATA 3KFMA 3CG3A 3HHFA 3IB1A 3O2AA 2F35A 2H99A 4O3CA 4F3BA 4WXJA 3G3KA 2XXPA 2YPNA 1ZJLA 2R9JA 3DM0A 3PPPA 4G4PA 2AYSA 1NNFA 4FJPA 3TPAA 1MM6A 4OWDA 1FW0A 4DXUA 4QF9A 1MXZA 3CG1A 3MZBA 1B7HA 1US4A 1PDAA 2F8DA 4U23A 3IOTA 2OLBA 1JETA 3A09A 1MXWA 2XXHA 3TCFA 2UXAA 4BDNA 2NOOA 2F6GA 3FUZA 4EUOA 4N6PA 2KLFA 4OZ9A 3SEYA 3S9NC 3EN3A 3JYRA 1JW1A 4JWOA 1LFGA 4TOZA 2CZLA 1QVSA 2UVIA 4H1XA 1P99A 3K6UA 1B7ZA 4ZZAA 1OQHA 5JEIA 2WKYA 1B5HA 3SDFA 2F36A 2I3WA 5I58B 1VSOA 5ICTA 3UGWA 1FQBA 2M8CA 1FCKA 1O7TA 1B0LA 3LR1A 2QJEA 4JXIA 3UP9A 3EHTA 1AMFA 4THIA 1IUDA 1FTLA 3H03A 2H98A 1GR2A 3HSTA 3K6WA 1B40A 1UIVA 3C4MA 1VR5A 2GFEA 4NF6A 3RTWB 3SESA 1MQHA 2O84X 2F7AA 1BKAA 2P1SA 2VHAA 3M8UA 4RPOA 5FHOA 4BDRA 3K6XA 5TP9A 2B3FA 3OO7A 3IOVA 2Z23A 2DXRA 5H8FA 1ZIUA 2CMOA 3Q29A 1BP5A 2F78A 2GH9A 3Q28A 3WAEA 5A5XA 1N3WA 5H8QB 1D4NA 3GBAA 1JEVA 4DXCA 5KDTB 2AIXA 4YB7A 5HM4B 4H6DA 4P0IA 5KZTA 4ZE8A 4YMAA 3K1MA 3OMBA 4JBZA 5I2NA 1DTZA 2PVUA 1Y4TA 5EHSA 3T9VA 1MDQA 5DVFA 1Y9UA 4I8CA 4ZEBA 2HZLA 2BJJX 3KOSA 1ANFA 3FJMA 1DPEA 3LSFB 1SW5A 3M3KA 2XXQA 4BDMA 4DE8A 4PE5B 3TTKA 1SD3A 4F1UA 1EZOA 3HHGA 3MPKA 1GGGA 2HXWA 2OZZA 2VP1A 2ZYOA 3FIRA 1PB9A 3Q25A 5DVJA 5H8SA 2RINA 1QUJA 4F3SA 2HQ0A 1LAXA 1TWYA 2H9BA 4LONB 4OFJA 3KN7A 5HBCA 3GXAA 4G68C 3H4ZA 3VV5A 2A5TA 1A40A 2ZNUA 1OVTA 3BBRA 3CIJA 3EPEA 3KZGA 4H8JA 4ZEKA 4HTGA 4F1YA 4RA1A 3U8QA 1MY2A 5I56A 1R9LA 4F39A 5B7DA 5B70A 1B7UA 1B6HA 1MQGA 3MVXA 1B3FA 2ANJA 1MY1A 2QRYA 2YJPA 4OMBA 2RCAA 3EF7A 4BLAA 4LVQA 3KJTA 2UYFA 3OO8A 3R7XA 2DYXA 4FE8A 4ESXA 3G7WA 4QSCA 1B2HA 2V84A 1QKAA 1VE4A 1QUIA 1O63A 1WDNA 1URSA 3LC8A 4G68A 4XXUA 4YAHX 4QFLA 4AB5A 1ATGA 4GXSB 3TTNA 4DDDA 2B3BA 4RJZA 3LBSA 1QJMA 1N0TA 2DWAA 1J1NA 4U1OA 3TQLA 5ISUA 3TFLA 3B7DA 1JVXA 3CI8A 2D21A 4OTEA 4DCXA 1B32A 4Z7EA 5JTYA 4ELQA 4YKJA 3TELA 3HO7A 4ZEDA 4MBPA 3BFUA 4ZECA 2DOJA 1B1XA 3CFZA 1GTKA 2Y7IA 3KN8A 3PUXE 4NEDA 5L9OA 2IA4A 2XX8A 3U93A 4BDQA 1P1UA 2Q9TA 2I6EA 1JQFA 3T66A 4KPTA 4R72A 1CB6A 2OJTA 3C9HA 3R26A 5CI5A 3AXFA 3B6WA 4H5FA 4ONYA 2FNCA 1SDXA 4EXLA 4TLLB 2QMWA 2R71A 1QUKA 3I6VA 2XX9A 5L8DA 4NE4A 1BTJA 2Q2AA 5I84A 1Y4CA 1JVYA 2E0SA 4X1DA 3C31A 3SKPA 3TTRA 3CSBA 2OBGA 1IQ7A 4OFOA 4OEVA 5DT6A 4JWYA 4KQPA 3K6VA 3FZVA 1AH5A 1B5JA 1IZ1A 4QRZA 4EQBA 1SI1A 5I2NB 4IGRA 4XTCQ 1LGBC 1QW0A 4IO2A 3MUQA 4EF2A 2HEUA 1T0KA 3OEKA 4GL0A 1MPCA 4R6KA 5CMCA 1DPPA 1IEJA 1MY4A 3IB2A 4OHNA 2FA7A 2DVCA 5DEXB 4C1TA 4G77A 4F18A 4EF1A 2REGA 2H25A 1LB8A 2PMSA 4GWOA 4KYDA 3U1OA 4YKKA 4ZE9A 5LOMA 1VFDA 4GXAA 4YICA 2RKMA 3FXUA 2B65A 3FJGA 3LSWA 1M5BA 3H6UA 4JB7A 3F11A 1DTGA 3CFXA 4DCYA 1A54A 1MS7A 1US5A 3OSQA 3S9MC 3N6TA 5CBRA 1SW4A 4XKRA 4Q8RA 1UIUA 2GHAA 2NVUB 3OENA 5BWJA 5F7VA 1H43A 2Q2CA 3PPRA 4U21A 4NF4B 4DZ1A 1N84A 2I3VA 2O68A 3N94A 3A3UA 2XXYA 2F7BA 4U1ZA 2O1MA 1H45A 4FAJA 1QKBA 2XXWA 4Q0CA 4X48A 3CVGA 3E4RA 4I9DA 4WKMA 4MLQA 2PBWA 3ZSFA 3RTFB 4EXKA 2Q88A 1AOVA 1XC1A 4NWCA 4ELOA 4G8HA 1MG1A 1P1OA 3K0VA 1H3DA 2ONKE 4IO3A 1NFTA 3ODBA 3RLFE 3PUWE 3BFTA 1IXIA 1D9VA 1FTJA 3K00A 3KSJA 3P7IA 5AA1A 4ELRA 5CMKA 4U22A 4HCYA 4R6YA 4X1BA 4R9GA 2DQVA 3ONMA 4NMYA 4RYAA 2V93A 4QSDA 2X26A 4R2BA 1R6ZA 1MRPA 1LCTA 1GV8A 3VE1B 2Y7RA 3M3LA 1TXFA 4FEBA 4R9FA 1II5A 5FTHA 1FQDA 3GBBA 1Z7ME 5AE4A 3C33A 4GVOA 4PP0A 5CMMA 1GVCA 4YKPA 3O6IA 3G3JA 1SVXB 1BLFA 3DP4A 4GOTA 4I62A 5ITOA 4KR5A 3JZJA 1F9BA 1A55A 2X7QA 1MXXA 4HW8A 5IAIA 5L9SA 1MXUA 2ZXTA 1IIWA 3U92A 3SETA 3G3FA 2DWIA 2NUVA 2Y7PA 3T9XB 4H5GA 2O69A 3IB0A 1MPBA 4R6HA 3VFJA 4F3GA 2PYYA 3OO6A 3KOTA 3Q26A 4N07A 2DS9A 5J1DA 2V25A 1M5CA 2O7IA 5HPQA 3FASA 3I3VA 1XS5A 1M5EA 2I48A 3E9XA 3KEIA 4ECFA 5H8NB 2Z8EA 4XKQA 4M4GA 2P0SA 3RGYA 1NKXA 3QYTA 1B3EA 3MP6A 4OERA 1PB8A 5I59B 3EQ1A 3PUYE 4MFIA 2O7UA 3RT8A 3MZ1A 3MBPA 1B46A 3TKDA 1B9JA 2QS1A 3T96B 2G93A 3MPLA 3VLVA 3LSLA 4JSOA 3UORA 1LLSA 1B4HA 3VLUA 2PX1A 5CBSA 2DE4A 1MH3A 3IJXB 2DWHA 5I2KA 5KCJA 1Q35A 1MH4A 3O6GA 1Y3QA 3O66A 4OQOA 4RY1A 5M2VA 1MY3A 4RPNA 1Y1MA 4OESA 4NF4A 4EDPA 4O3BA 5DEXA 1JNFA 1I6AA 2H4IA 1NNPA 1FQEA 4Q5TA 1RKMA 4M1VA 4YZZA 3V8XB 1LAFE 1TT1A 3K4UA 5CC2A 3HN0A 5AA4B 2NXOA 1MDP1 3K01A 2Z22A 4BDOA 5I57B 1B58A 4G68B 3RPWA 2Y7WA 1P1QA 1I6BA 2ESNA 2HCAA 3D4GA 4F22A 2RF1A 2UVHA 2D3IA 4QFPA 5ELVA 5DTBA 4FEDA 2VD3A 2DE2A 2F34A 1B05A 1NH7A 2OWTA 2R6GE 1ZMGA 1LFIA 3G3IA 4E0WA 1SW2A 3G3GA 3RQTA 3Q27A 5ITPA 2YLNA 2ZNSA 2DP8A 3MC2A 3QUJA 1XHYA 1DOTA 1H44A 2ZYKA 3SEWA 3OXNA 1OLCA 2A5TB 2UYEA 4WEDA 4QHQA 3MWBA 3TAJA 1HSJA 1LAGE 4RK9A 3S2VA 3FGSA 4POXA 4F2OA 1N3XA 1R9QA 4PQJA 2DWJA 3T9UA 1PB7A 5CRYA 3CFLA 3ZS6A 4F19A 4XKNA 3DP8A 2DXYA 3GZGA 3PGFA 4YB5A 4KYSA 3UN6A 1POTA 1EU8A 1L5TA 3TMGA 1YPNA 2I4BA 3ECRA 2DSFA 4R73A 2XX7A 3TCHA 3MVYA 2H5YA 3PUZE 2F7CA 3UA8A 4BDLA 5KCJB 3TDJA 1B51A 3CR9A 4LQ2A 4U4XA 2D5WA 4GQOA 1LBCA 2I0BA 3O97A 3OEMA 5H8HB 1SYHA 2ABHA 2V3QA 1OLAA 2ZMBA 1MXVA 1XVXA 3FD3A 4LQ5A 4MF3A 4PFTA 3IORA 3E3KA 3O29A 4PFUA 3ZKKA 5CM6A 5CMBA 3O9PA 4NF5B 1B4ZA 2ONRA 1S50A 1IXCA 3MVZA 1N7XA 4MLVA 5AA4A 3SEXA 3SEVA 4GF8A 1MQIA 3C35A 3HV1A 3W9VA 1VFEA 4G8NA 5JK4A 2UVJA 4OETA 4WEPA 4OEUA 4R2FA 3TEPA 3TUSA 3BKIB 1Q1KA 5A5XB 2THIA 3IOWA 1XT8A 2FYIA 3QUFA 5KDTA 2ZYMA 1IITA 1Y3PA 1R1NA 3D4CA 4I1DA 3MJNA 4NWDA 4C0RA 5AA2B 2RCBA 4KD5A 1XOCA 4NF8A 3N6UA 4IY5A 1JEUA 4G8MA 2XHDA 4MH5A 3RNNA 3W9WA 4LZ5A 1Z7NE 3TZAA 3U94A 4GL8A 3TTLA 1B52A 1WODA 1A99A 3IJOB 4XIGQ 3IK6B 4QFNA 2OWSA 1RYXA 1NL5A 2ONSA 3MQ9A 2ALUA 3OO9A 4OVJA 3H06B 2X7PA 3IO4A 4LZ8A 4RXLA 4LA9A 1RYOA 2NWJA 1SBPA 4IO5A 2XD3A 2V3TA 2IEEA 2VGQA 2QL3A 4NF6B 4F29A 4F1VA 1USYH 4GRKA 4F2QA 5I56B 3K2DA 1MQDA 2Y84A 3H7MA 2Q89A 3B6TA 2I58A 3OD7A 4XKPA 4C1UA 1S7YA 1M5DA 1B3GA 1I69A 3QXMA 5I58A 1USYE 3DLNA 3H6VA 1ZLQA 4L17A 3PPOA 2A5SA 3H6WA 1A8FA 1SQYA 1HSEA 2Z8DA 1S9TA 3KGCA 3OOAA 3UIFA 4IO4A 4ISUA 1EH3A 4NF5A 4OFLA 4ZDMA 2AL4A 2RC8A 2XXIA 1A7LA 3E13X 2Y7KA 3FJ7A 4R75A 4EQ9A 1LSTA 3S9LC 3FVGA 1D9YA 4P0GA 4GFRA 3TODA 1BIYA 2O51A 2E1SA 2RC9A 4X9TA 4DLDA 1NH8A 3G3HA 4AQ4A 5IKBA 1EZPA 3KBRA 1SYIA 3L6GA 4KCCA 5H8NA 3UK4A 2QPQA 3V5AA 3MW0A 1ZU0A 3M3FA 4IO7A 2QS3A 4LP2B 4QFKA 4U2RA 3GLBA 1DMBA 4H65A 1Y1ZA 2HZKA 1XVYA 1B3LA 3FXQA 3QAXA 4JSDA 1Y20A 5FHMA 3S9EA 1JW4A 1ZBMA 1B3HA 3PPQA 4K3FA 1TFAA 1YAEA 1AIVA 3RUMA 4HS7A 1O64A 2QS2A 2HAUA 2VD2A 5TU0A 4OYVA 4ZS9A 3T9HB 5TP9B 4R74A 1I6QA 1ZKBA 5H8FB 3T22A 1CE2A 1UTHA 1MQJA 4AB6A 1FTKA 3PMVA 4IGTA 4ZZEA 1ZTYA 4TLMB 3VVDA 3PMWA 3PD9A 2OK2A 4DIGA 3QSLA 4FECA 4POWA 3LSXA 4KI0E 1A8EA 5AA2D 1Y3NA 3FVOA 3FV2A 3H6TA 4PFWA 5BUUA 1SI0A 5FTIA 1EZ9A 4RK2A 4F31B 2QMXA 4JWXA 1FTOA 1N04A 1UTBB 4JDFA 2UVGA 4KYEA 1NMUA 3IAZA 3MVWA 1OQGA 3SEUA 1UQWA 4H8IA 2VOZA 3ILUB 4Z0IA 2F97A 5ICQA 3KSXA 4H0WA 5AA3A 3K02A 2XXVA 1NNKA 2ZYNA 2PT1A 2REJA 3RT6B 2PT2A 3PD8A 3C34A 3THIA 4NF8B 1IXHA 2O6AA 1FQAA 3MP1A 1OIBA 4LUBA 4QSEA 3WAFA 3V83A 1D3KA 1WVJA 4H67A 3MAMA 3QIMA 3QK6A 4ELPA 1B5IA 3PMXA 5DYHA 4FIMA 4Q30B 3VDFA 2V3UA 4GLIA 4EQ7A 3KJ7A 2DE3A 3CRBA 3K1PA 4RNSA 1IXGA 3IX1A 4YKIA 2GRVA 1AL3A 2HAVA 3U72A 3VVFA 2LAOA 4FORA 5FHNA 1LCFA 3CSGA 1SW1A 3FVNA 4YB6A 3A3CA 5K2YA 2F5XA 3JV9A 4ZEIA 1PEBA 3RY3A 3LUYA 3VVEA 1OMPA 1P1WA 2Z8FA 1MPDA 3KN3A 4ZEFA 3EHSA 3VLWA
chains in the Genus database with same CATH superfamily
1LBBA 1LFHA 1TFDA 1FQFA 4OENA 3FATA 4O7MA 5JTYB 1MY0A 4MNPA 4YMBA 3C32A 2G29A 2W7YA 2O1LA 3IR1A 5I2KB 4NQ8A 3OELA 3B6QA 4QFOA 4LZ7A 3K1NA 2PFYA 3TTMA 4OVTA 4UACA 1PBQA 4GIZA 3C36A 2XXTA 2I49A 2Q8JA 2F3BA 1UTBA 1LAHE 3VXBA 3HCQA 4G2ZA 2HFBA 1MM7A 5EYFA 1URDA 3R6UA 2XXUA 1N7WA 4HCWA 5IZ3B 4WXJA 2R9JA 3PPPA 4NAPA 1G0IA 1FW0A 3MZBA 4UABA 2UXAA 4BDNA 3FUZA 4EUOA 1JW1A 1LFGA 4GWUA 1B7ZA 3SDFA 4OANA 1VSOA 3UGWA 2M8CA 1O7TA 3LR1A 4JXIA 3EHTA 3K6WA 2GFEA 3RTWB 3SESA 1MQHA 2VHAA 1BKAA 5FHOA 2F78A 1N3WA 2FBPA 4DXCA 3GBAA 1QGXA 4YB7A 5HM4B 2B4MA 5KZTA 1MDQA 2BJJX 1SW5A 4DE8A 1VDWA 4F1UA 3HHGA 1GGGA 2HXWA 2VP1A 2ZYOA 4GX4A 1QUJA 2H9BA 4G68C 1A40A 3CIJA 1EYKA 4ZEKA 4HTGA 3U8QA 1R9LA 5B70A 1MY1A 4LVQA 3G7WA 1QKAA 1O63A 4G68A 3TTNA 2B3BA 4RJZA 3LBSA 1FBHA 4U1OA 1LBYA 3B7DA 2D21A 2MKZA 5IGAA 3TELA 3HO7A 3BFUA 1GTKA 1P1UA 1JQFA 3T66A 1CB6A 2OJTA 3AXFA 3B6WA 1FPGA 3CSBA 2FIXA 4KQPA 4IGRA 4XTCQ 3T0JA 1QW0A 4EF2A 3IB2A 4LN5A 2FA7A 2DVCA 5DEXB 4C1TA 3LV0A 4EF1A 2REGA 2H25A 4GWOA 4KYDA 4MHFA 4O8MA 4YICA 3FXUA 1M5BA 3H6UA 4JB7A 4DCYA 1DTGA 3CFXA 1DBZA 2NVUB 1H43A 2I3VA 3A3UA 4U1ZA 2XXWA 4Q0CA 3CVGA 4WKMA 2PBWA 4NWCA 4G8HA 1P1OA 1NFTA 3CHGA 3PUWE 3BFTA 5CMKA 4RYAA 4QSDA 2X26A 4JVDA 1R6ZA 3VE1B 5FTHA 1FQDA 1Z7ME 2L5VA 1GVCA 5ET6A 3G3JA 3DP4A 4GOTA 5ITOA 1MXUA 4HXVA 2DWIA 3IB0A 4F3GA 2PYYA 3Q26A 2DS9A 2V25A 5HPQA 3KEIA 4M4GA 3QYTA 1B3EA 4MFIA 3MZ1A 5EQAA 3MPLA 3LSLA 5CBSA 2DE4A 5I2KA 1MY3A 4RPNA 1JNFA 2H4IA 4Q5TA 5A5LA 5CC2A 1RKMA 4NGUA 1LAFE 4I40A 3KC0A 2Z22A 5I57B 1B58A 3RPWA 2Y7WA 1P1QA 1I6BA 4F22A 4FEDA 2DE2A 2OWTA 1NH7A 3G3IA 2XXKA 1ZMGA 4E0WA 1SW2A 5FBPA 5ITPA 3GYYA 1XHYA 2A5TB 4DI3D 2DDKA 4F19A 3PGFA 4I3YA 1POTA 1YPNA 2I4BA 3MVYA 2F7CA 4N17A 1B51A 3TZAA 2I0BA 3OEMA 1SYHA 2V3QA 3ISPA 3IORA 1IXCA 1IMEA 4MLVA 2CZKA 2Y5KA 3SEVA 4GF8A 3HV1A 3W9VA 4WEPA 1Q1KA 5A5XB 3IOWA 4HE2A 4C0RA 4NF8A 4MH5A 3W9WA 4LZ5A 1Z7NE 3U94A 3TTLA 1B52A 1A99A 2WEFA 4PDDA 2HPGA 3MQ9A 2ALUA 3H06B 4N81A 4LA9A 1RYOA 1SBPA 2XD3A 2VGQA 4F29A 1USYH 2Y84A 3H7MA 3B6TA 1FPBA 1LBXA 3OD7A 2WBBA 3QMFA 1B3GA 1AWBA 5I58A 1CNQA 3DLNA 4PAFA 4L17A 3PPOA 3KGCA 4ISUA 4HE0A 4NF5A 1A7LA 2Y7KA 2E1SA 1EZPA 1SYIA 5H8NA 1ZU0A 4QFKA 4U2RA 1DMBA 2HZKA 1Y20A 1B3HA 3PPQA 1FBCA 4P1LA 1O64A 2QS2A 4OYVA 4ZS9A 4GWSA 1ZKBA 1UTHA 1FTKA 3VVDA 1ZTYA 2ZZWA 3PMWA 1NUYA 3QSLA 4FECA 1A8EA 2WX9A 3KBZA 5FTIA 4RK2A 4F31B 1LBZA 1KA0A 1NUZA 3MVWA 1OQGA 1UQWA 3ILUB 4H45A 2F97A 4PBHA 4PAIA 1NNKA 2FHYA 4PGNA 3PD8A 4NF8B 2O6AA 3V83A 1OIBA 1WVJA 3MAMA 3QIMA 3QK6A 4ELPA 1B5IA 3PMXA 5DYHA 5J16A 2V3UA 4GLIA 3KJ7A 1IMDA 3CRBA 1IXGA 1LCFA 4ZEFA 3T22A 5DW8A 3TMGA 1JW5A 1PBPA 2ZNTA 4KFQA 5TPAB 1NUWA 1UTHB 1PC3A 5H8QA 3O28A 4NG7A 1POY1 2GHBA 4DXBA 3SERA 3PUVE 1FQCA 1LB9A 1DCUA 5TPAA 1ELJA 5K2XA 4PE3A 1M5FA 3DELB 4OVPA 4GD5A 4G61A 4NTLA 1B0HA 1P1NA 2AL5A 4U4SA 2F6PA 1IMBA 4ESWA 3USDA 5I57A 3PPNA 1FBPA 3I5OA 2QVVA 3N5LA 4P1EA 4UA8A 3MP8A 3L6HA 3TYHA 3RN8A 1KWHA 5I5PA 1IMAA 4PBQA 3TCGA 3DP6A 3IOUA 4IO6A 1BK4A 2CZIA 1N76A 1NV1A 3IB1A 3O2AA 2AYSA 1MXZA 3CG1A 1US4A 2F8DA 4U23A 2OLBA 3A09A 2XXHA 2NOOA 4N6PA 4TOZA 3JYRA 4JWOA 2CZLA 4PDHA 1P99A 5JEIA 2WKYA 1FQBA 3H03A 2H98A 1GR2A 2OWZA 3C4MA 1VR5A 4NF6A 3M8UA 4MNIA 3K6XA 2B3FA 2Z23A 2DXRA 4OVQA 4PF8A 5A5XA 3WAEA 1NI9A 1FBEA 2QVUA 4H6DA 4JBZA 5I2NA 1FPFA 1Y4TA 5DVFA 4ZEBA 3KOSA 4BDMA 4PE5B 4GBVA 1SD3A 3MPKA 2B4LA 2HQ0A 1LAXA 1TWYA 1FSAA 4OFJA 3KN7A 3H4ZA 2A5TA 2KR0A 3KZGA 1OVTA 3EPEA 3U65A 1MY2A 5I56A 5B7DA 1B6HA 3MVXA 2ANJA 1JP4A 4BLAA 3KJTA 2UYFA 3R7XA 4ESXA 4QSCA 1VE4A 3LC8A 4AB5A 4QFLA 4DDDA 1N0TA 1J1NA 3TQLA 5ISUA 4XFEA 3CI8A 5JTYA 4ZEDA 4MBPA 2Y7IA 3KN8A 2XX8A 3U93A 4BDQA 2Q9TA 3I6VA 1BTJA 2Q2AA 1Y4CA 3RPLB 2E0SA 4X1DA 5ICTA 4OEVA 4JWYA 1IZ1A 1SI1A 1T0KA 4IO2A 4GL0A 2PFZA 4AS4A 1LB8A 2PMSA 5LOMA 4GXAA 2B65A 3FJGA 1A54A 3OSQA 3S9MC 3N6TA 1KA1A 4XKRA 1UIUA 3PPRA 2XXYA 4FAJA 1QKBA 4MLQA 4EXKA 4ELOA 4IO3A 1MG1A 3K0VA 1H3DA 4MNCA 3B50A 4U22A 4OVRA 4HCYA 4R6YA 3RPLA 1LCTA 2Y7RA 2VPOA 1II5A 4PP0A 1BLFA 4I62A 1F9BA 1A55A 2X7QA 1MXXA 5L9SA 2ZXTA 2NUVA 3T9XB 4H5GA 4R6HA 1MPBA 3VFJA 5J1DA 1M5EA 4XKQA 2P0SA 1NKXA 1PB8A 5I59B 3T96B 3VLVA 2WBDA 4JSOA 3VLUA 1B4HA 2PX1A 1MH3A 3IJXB 4N6KA 1MH4A 4RY1A 3O66A 5M2VA 1G0HA 4EDPA 1Y1MA 4NF4A 1NNPA 1FQEA 4YZZA 4M1VA 3K4UA 5AA4B 3K01A 4G68B 2HCAA 3D4GA 4O94A 2VD3A 2F34A 2Y5LA 3G3GA 1DOTA 3SEWA 1OLCA 4WEDA 3MWBA 1R9QA 3T9UA 1PB7A 4NHBA 3CFLA 2DXYA 1NV6A 4KYSA 1EU8A 2DSFA 4R73A 3PUZE 4N91A 2D5WA 1LBCA 1IMFA 2ABHA 5EYHA 4MF3A 1MXVA 1XVXA 3FD3A 4PFTA 5IKBA 3O9PA 1FBDA 2ONRA 3SEXA 1FBGA 1VFEA 2UVJA 1YXIA 4R2FA 1LBVA 2ZYMA 4I1DA 4NWDA 1FBFA 2XHDA 3RNNA 4XIGQ 2F3DA 1RYXA 3OO9A 2X7PA 3MSTA 2NWJA 4NF6B 4P8BA 4GRKA 4F2QA 5I56B 1NV2A 1MQDA 4XKPA 1M5DA 3QXMA 3ROJA 2R8TA 4RPOA 3RTFB 2A5SA 1A8FA 2Z8DA 4IO4A 2XA5A 1NUXA 4ZDMA 5AE4A 2RC8A 4R75A 4MEVA 3FJ7A 4P3LA 3S9LC 4EQ9A 1LSTA 3FVGA 2O51A 3G3HA 4AQ4A 3KBRA 4KCCA 3UK4A 3MW0A 3M3FA 1YZ0A 3GLBA 4H65A 3FXQA 3QAXA 5LTCA 1ZBMA 4N4UA 4PC9A 5TU0A 3T9HB 4AB6A 5I3SA 4DIGA 3PD9A 2OK2A 4POWA 2VPNA 5AA2D 3FVOA 3FV2A 1SI0A 3NOHA 1FTOA 4JDFA 1IMCA 4I3EA 3KSXA 5AA3A 2XXVA 2ZYNA 3THIA 1IXHA 4QSEA 1FQAA 1D3KA 2P3VA 1NV0A 4GBWA 4KXPA 1AL3A 3IFCA 5T3JA 3A3CA 4ZEIA 1PEBA 3ILTB 3VXCA 2I4CA 3H3GA 4IY6A 5IZ1A 3T93B 4F3PA 3FVKA 3N26A 4PTKA 4PETA 4N13A 1FTMA 1K9ZA 4P11A 3EHUA 3S4UA 5I7IA 2QS4A 2I0CA 4ND9A 4OVSA 1OVBA 4PFIA 3FV1A 4KCDA 4N8GA 3SZPA 5H8HA 4YU0A 1QULA 4E0XA 2RC7A 4TQUQ 5F1QA 3IL1B 3W15C 2P2AA 3E78A 1HSLA 4GWXA 1MXYA 5EYGA 2F35A 2H99A 4MAGA 4O3CA 4F3BA 3FXBA 3G3KA 2XXPA 2YPNA 1ZJLA 4FJPA 4P47A 1PDAA 3IOTA 4GWYA 1MXWA 4XF5A 1YYZA 3SEYA 3EN3A 4H1XA 4ZZAA 2P3NA 2I3WA 1B0LA 2QJEA 3UP9A 1AMFA 4THIA 1IUDA 1UIVA 4XEQA 4BDRA 3BIHA 1BP5A 5H8QB 5KDTB 4JVCA 4ZE8A 3K1MA 3OMBA 1FJ6A 4I8CA 1ANFA 4P56A 3FJMA 3BIGA 3LSFB 3M3KA 3TTKA 5H8SA 3FIRA 5DVJA 2RINA 3VV5A 2GQ1A 4F1YA 1FJ9A 4RA1A 3PTYA 1B7UA 4JVIA 1MQGA 4OMBA 2RCAA 4PAKA 3OO8A 1QUIA 4XXUA 4GXSB 2DWAA 2WYPA 4DCXA 4OTEA 4Z7EA 1B32A 1EYJA 3CFZA 3PUXE 4NEDA 2IA4A 4MX6A 3IFAA 1NV4A 2I6EA 1RDZA 4R72A 3C9HA 2XWKA 4H5FA 2FNCA 4EXLA 2R71A 1QUKA 2XX9A 5L8DA 5I84A 2V4CA 2OBGA 1IQ7A 3K6VA 3FZVA 4PFBA 4QRZA 5I2NB 1LGBC 3MUQA 3OEKA 4R6KA 1DPPA 1IEJA 1MY4A 4OHNA 4G77A 4F18A 4P9KA 2RKMA 1MS7A 2Q2CA 4NF4B 2F7BA 2O1MA 1H45A 3E4RA 4I9DA 2Q88A 1XC1A 1EYIA 1IXIA 1FTJA 3P7IA 4ELRA 4X1BA 4R9GA 2DQVA 3KC1A 4NMYA 2JJKA 3M3LA 2HHMA 1TXFA 4FEBA 4R9FA 3C33A 5CMMA 1LBWA 1Q9DA 1SVXB 4KR5A 4HW8A 2Y7PA 2O69A 3OO6A 1M5CA 3FASA 3I3VA 1XS5A 2I48A 3E9XA 4ECFA 4MCOA 3MP6A 1XI6A 3PUYE 2O7UA 3MBPA 1FPKA 1B9JA 2QS1A 2G93A 1LLSA 2DWHA 3O6GA 4OQOA 3MYUA 1I6AA 2QFLA 3HN0A 2NXOA 4MIJA 1NV7A 2ESNA 4QFPA 5ELVA 5DTBA 2R6GE 1LFIA 2YLNA 2DP8A 3QUJA 2ZYKA 3OXNA 2UYEA 4DI4B 2ZZXA 1FPJA 4MJOA 1HSJA 3S2VA 4POXA 1N3XA 4N6DA 4PQJA 4O7IA 2DWJA 5ESYA 3DP8A 3GZGA 1L5TA 2XX7A 5KCJB 4BDLA 4HE1A 3CR9A 4LQ2A 4U4XA 5H8HB 1OLAA 5CM6A 3E3KA 4X04A 1B4ZA 3A29A 1S50A 3MVZA 5AA4A 4NX1A 5JK4A 4OETA 4OEUA 2THIA 2FYIA 2WYKA 3QUFA 5KDTA 1IITA 1R1NA 2RCBA 3N6UA 4IY5A 1JEUA 4G8MA 1DK4A 4QFNA 2OWSA 1NL5A 4OVJA 5IZZA 3IO4A 4LZ8A 4FBPA 4RXLA 4IO5A 2IEEA 2QL3A 1INPA 4AS5A 3K2DA 1S7YA 1I69A 3U72A 3H6WA 1SQYA 1EH3A 4OFLA 2XXIA 3E13X 1D9YA 4N15A 2QPQA 1NV5A 2XWIA 1Y1ZA 1XVYA 3B8BA 4JSDA 3S9EA 5FHMA 1JW4A 2CEYA 1TFAA 1YAEA 3RUMA 4HS7A 4N8YA 2OX3A 2HAUA 2KQZA 5TP9B 4R74A 5H8FB 1CE2A 1MQJA 4TLMB 1RDXA 3H6TA 5BUUA 1UTBB 2UVGA 3IAZA 3SEUA 2VOZA 5ICQA 2XWVA 2PT1A 2REJA 4PFRA 2PT2A 3C34A 3WAFA 4H67A 5EQ9A 4Q30B 2DE3A 3K1PA 4YKIA 3IX1A 2GRVA 2HAVA 5FHNA 3FVNA 4YB6A 3RYDA 2F5XA 3JV9A 3RY3A 3VVEA 1OMPA 1P1WA 3KN3A 1MPDA 5KCJA 3VLWA 4O3AA 1NNTA 4OXVA 5EHMA 3OSRA 3MZ9A 2XXXA 1URGA 3HPIA 3PV0E 1YTVA 2OCUA 5EQ8A 2XD2A 2XXRA 4GX3A 3FXRA 2DVZA 1H76A 5L9MA 1DSNA 4H46A 3E79A 3KG2A 4PFYA 4LATA 3ZKLA 4KHZE 4GX6A 3IO6A 3PU5A 4IB2A 2QSXA 2HXRA 1YCJA 5DVIA 5AA2A 3O6HA 3TQWA 1B1HA 3V89B 4FATA 3KFMA 3CG3A 3HHFA 1FTAA 3DM0A 4G4PA 5ET8A 1NNFA 1MM6A 4OWDA 4QF9A 1B7HA 1JETA 3TCFA 2F6GA 2KLFA 4OZ9A 3S9NC 1QVSA 2UVIA 3K6UA 2CEXA 1OQHA 1B5HA 2F36A 5I58B 1FCKA 4X8RA 1FTLA 3HSTA 1B40A 2O84X 2F7AA 2P1SA 3EKIA 5TP9A 3OO7A 3IOVA 5H8FA 1ZIUA 3D1RA 2CMOA 3Q29A 2GH9A 3Q28A 1D4NA 1JEVA 2AIXA 4P0IA 4YMAA 1DTZA 2PVUA 5EHSA 3T9VA 1Y9UA 2HZLA 1DPEA 2XXQA 1EZOA 2OZZA 3Q25A 1PB9A 4F3SA 4LONB 5HBCA 3GXAA 2ZNUA 3BBRA 4H8JA 4QBAA 4F39A 1B3FA 2YJPA 2QRYA 2QVRA 3EF7A 2DYXA 4FE8A 1B2HA 2V84A 1WDNA 1URSA 4YAHX 5IZ3A 1ATGA 1QJMA 3TFLA 1JVXA 4ELQA 4YKJA 2BJIA 4ZECA 2DOJA 1B1XA 5L9OA 4OA4A 4KPTA 1LEVA 3R26A 4ONYA 1SDXA 4TLLB 2QMWA 4NE4A 5F24A 1JVYA 3SKPA 3C31A 4PF6A 3TTRA 4OFOA 5DT6A 3V5AA 1AH5A 1B5JA 4EQBA 2HEUA 1MPCA 2CZHA 3FBPA 5CMCA 5LDZA 2PCRA 4GWZA 4ZE9A 3U1OA 4YKKA 1VFDA 3RT6B 2VT5A 3LSWA 3F11A 1US5A 1FPIA 5CBRA 1SW4A 4IR8A 4Q8RA 2XWOA 2GHAA 3OENA 5BWJA 5F7VA 4DZ1A 4U21A 1N84A 2O68A 3N94A 4X48A 3ZSFA 4GWWA 1AOVA 2ONKE 3ODBA 3RLFE 1D9VA 3K00A 3KSJA 5AA1A 3ONMA 1FRPA 2V93A 4R2BA 1MRPA 1GV8A 4NN3A 3GBBA 4GVOA 1K9YA 4YKPA 3O6IA 3JZJA 5IAIA 1IIWA 3U92A 3SETA 3G3FA 3KOTA 4N07A 2O7IA 1NV3A 5H8NB 2Z8EA 3RGYA 4OERA 3EQ1A 3RT8A 1B46A 3TKDA 3HFUA 3UORA 1Q35A 1Y3QA 4OESA 2Q8MA 4O3BA 5DEXA 3V8XB 5I59A 1TT1A 1SPIA 1MDP1 4BDOA 2RF1A 2UVHA 2D3IA 1B05A 3RQTA 3Q27A 2ZNSA 3MC2A 1H44A 1D9QA 4QHQA 1RDYA 1KZ8A 3TAJA 1LAGE 4F2OA 3FGSA 5CRYA 3ZS6A 2FIEA 4XKNA 4YB5A 3UN6A 4DXUA 4PCDA 3ECRA 3TCHA 4QXDA 2H5YA 3UA8A 3TDJA 5EQ7A 4GQOA 3O97A 2ZZVA 2ZMBA 4RK9A 4LQ5A 4PFUA 3ZKKA 3O29A 2Q74A 5CMBA 4MMPA 4NF5B 1N7XA 1MQIA 3C35A 4G8NA 3LUZA 3TEPA 3TUSA 3BKIB 1XT8A 1Y3PA 3D4CA 3MJNA 5AA2B 4KD5A 1XOCA 4GL8A 1WODA 3IJOB 3IK6B 3T1BA 2ONSA 4NF0A 2V3TA 4F1VA 2Q89A 2I58A 4C1UA 5ET5A 1USYE 3TPAA 3H6VA 1ZLQA 1HSEA 3OOAA 1S9TA 3UIFA 2AL4A 1FPLA 1FPDA 4P0GA 4GFRA 3TODA 1BIYA 2RC9A 4DLDA 4X9TA 1NH8A 3L6GA 4IO7A 4LP2B 2QS3A 1B3LA 1AIVA 4K3FA 2VD2A 5ET7A 1I6QA 4ZZEA 3PMVA 4IGTA 3LSXA 4KI0E 1Y3NA 4PFWA 1EZ9A 2QMXA 4JWXA 1N04A 4KYEA 1NMUA 4H8IA 4Z0IA 4H0WA 3K02A 5IM2A 4PGPA 3MP1A 4LUBA 2FVZA 4FIMA 3VDFA 4EQ7A 4RNSA 1FPEA 3VVFA 2LAOA 4FORA 3CSGA 1SW1A 5K2YA 3LUYA 2Z8FA 5CI5A 3EHSA
chains in the Genus database with same CATH topology
4O3AA 1LBBA 1LFHA 2I4CA 3H3GA 1JW5A 1NNTA 1FQFA 1TFDA 1PBPA 4IY6A 4OENA 4OXVA 2ZNTA 5EHMA 4KFQA 3T93B 3OSRA 3MZ9A 3FATA 5TPAB 4F3PA 5JTYB 1UTHB 2XXXA 1URGA 1PC3A 1MY0A 3FVKA 3HPIA 3O28A 3PV0E 1YTVA 5H8QA 1POY1 2OCUA 2XD2A 2GHBA 2XXRA 4YMBA 3N26A 4DXBA 3C32A 2G29A 3SERA 4PETA 2W7YA 4N13A 3PUVE 1FQCA 1FTMA 1LB9A 2DVZA 1H76A 2O1LA 3FXRA 3IR1A 5L9MA 4P11A 3EHUA 1ELJA 5TPAA 3S4UA 5I2KB 1DSNA 3ILTB 5K2XA 3VXCA 1M5FA 3DELB 3OELA 3B6QA 4QFOA 4GD5A 2QS4A 2I0CA 4LZ7A 3K1NA 4NTLA 1B0HA 1P1NA 3KG2A 4ND9A 2AL5A 4U4SA 3TTMA 4UACA 4PFYA 2F6PA 1OVBA 1PBQA 4GIZA 3C36A 2XXTA 2I49A 2Q8JA 3USDA 4ESWA 3FV1A 4LATA 3PPNA 4KCDA 1UTBA 5I57A 5H8HA 3I5OA 3ZKLA 1LAHE 3N5LA 4YU0A 4KHZE 4UA8A 3IO6A 1QULA 3MP8A 3VXBA 3L6HA 3PU5A 3HCQA 3TYHA 5I59A 3RN8A 4E0XA 2RC7A 2QSXA 1KWHA 2HFBA 1MM7A 4G2ZA 4IB2A 4TQUQ 1YCJA 5DVIA 5EYFA 5F1QA 5AA2A 3TCGA 3DP6A 1URDA 3IL1B 3IOUA 3R6UA 4IO6A 3O6HA 3TQWA 3W15C 2P2AA 2XXUA 1B1HA 1HSLA 1N7WA 4HCWA 3V89B 1N76A 1MXYA 4FATA 3KFMA 3CG3A 3HHFA 3IB1A 3O2AA 2F35A 2H99A 4O3CA 4F3BA 4WXJA 3G3KA 2XXPA 2YPNA 1ZJLA 2R9JA 3DM0A 3PPPA 4G4PA 2AYSA 1NNFA 4FJPA 3TPAA 1MM6A 4OWDA 1FW0A 4DXUA 4QF9A 1MXZA 3CG1A 3MZBA 1B7HA 1US4A 1PDAA 2F8DA 4U23A 3IOTA 2OLBA 1JETA 3A09A 1MXWA 2XXHA 3TCFA 2UXAA 4BDNA 2NOOA 2F6GA 3FUZA 4EUOA 4N6PA 2KLFA 4OZ9A 3SEYA 3S9NC 3EN3A 3JYRA 1JW1A 4JWOA 1LFGA 4TOZA 2CZLA 1QVSA 2UVIA 4H1XA 1P99A 3K6UA 1B7ZA 4ZZAA 1OQHA 5JEIA 2WKYA 1B5HA 3SDFA 2F36A 2I3WA 5I58B 1VSOA 5ICTA 3UGWA 1FQBA 2M8CA 1FCKA 1O7TA 1B0LA 3LR1A 2QJEA 4JXIA 3UP9A 3EHTA 1AMFA 4THIA 1IUDA 1FTLA 3H03A 2H98A 1GR2A 3HSTA 3K6WA 1B40A 1UIVA 3C4MA 1VR5A 2GFEA 4NF6A 3RTWB 3SESA 1MQHA 2O84X 2F7AA 1BKAA 2P1SA 2VHAA 3M8UA 4RPOA 5FHOA 4BDRA 3K6XA 5TP9A 2B3FA 3OO7A 3IOVA 2Z23A 2DXRA 5H8FA 1ZIUA 2CMOA 3Q29A 1BP5A 2F78A 2GH9A 3Q28A 3WAEA 5A5XA 1N3WA 5H8QB 1D4NA 3GBAA 1JEVA 4DXCA 5KDTB 2AIXA 4YB7A 5HM4B 4H6DA 4P0IA 5KZTA 4ZE8A 4YMAA 3K1MA 3OMBA 4JBZA 5I2NA 1DTZA 2PVUA 1Y4TA 5EHSA 3T9VA 1MDQA 5DVFA 1Y9UA 4I8CA 4ZEBA 2HZLA 2BJJX 3KOSA 1ANFA 3FJMA 1DPEA 3LSFB 1SW5A 3M3KA 2XXQA 4BDMA 4DE8A 4PE5B 3TTKA 1SD3A 4F1UA 1EZOA 3HHGA 3MPKA 1GGGA 2HXWA 2OZZA 2VP1A 2ZYOA 3FIRA 1PB9A 3Q25A 5DVJA 5H8SA 2RINA 1QUJA 4F3SA 2HQ0A 1LAXA 1TWYA 2H9BA 4LONB 4OFJA 3KN7A 5HBCA 3GXAA 4G68C 3H4ZA 3VV5A 2A5TA 1A40A 2ZNUA 1OVTA 3BBRA 3CIJA 3EPEA 3KZGA 4H8JA 4ZEKA 4HTGA 4F1YA 4RA1A 3U8QA 1MY2A 5I56A 1R9LA 4F39A 5B7DA 5B70A 1B7UA 1B6HA 1MQGA 3MVXA 1B3FA 2ANJA 1MY1A 2QRYA 2YJPA 4OMBA 2RCAA 3EF7A 4BLAA 4LVQA 3KJTA 2UYFA 3OO8A 3R7XA 2DYXA 4FE8A 4ESXA 3G7WA 4QSCA 1B2HA 2V84A 1QKAA 1VE4A 1QUIA 1O63A 1WDNA 1URSA 3LC8A 4G68A 4XXUA 4YAHX 4QFLA 4AB5A 1ATGA 4GXSB 3TTNA 4DDDA 2B3BA 4RJZA 3LBSA 1QJMA 1N0TA 2DWAA 1J1NA 4U1OA 3TQLA 5ISUA 3TFLA 3B7DA 1JVXA 3CI8A 2D21A 4OTEA 4DCXA 1B32A 4Z7EA 5JTYA 4ELQA 4YKJA 3TELA 3HO7A 4ZEDA 4MBPA 3BFUA 4ZECA 2DOJA 1B1XA 3CFZA 1GTKA 2Y7IA 3KN8A 3PUXE 4NEDA 5L9OA 2IA4A 2XX8A 3U93A 4BDQA 1P1UA 2Q9TA 2I6EA 1JQFA 3T66A 4KPTA 4R72A 1CB6A 2OJTA 3C9HA 3R26A 5CI5A 3AXFA 3B6WA 4H5FA 4ONYA 2FNCA 1SDXA 4EXLA 4TLLB 2QMWA 2R71A 1QUKA 3I6VA 2XX9A 5L8DA 4NE4A 1BTJA 2Q2AA 5I84A 1Y4CA 1JVYA 2E0SA 4X1DA 3C31A 3SKPA 3TTRA 3CSBA 2OBGA 1IQ7A 4OFOA 4OEVA 5DT6A 4JWYA 4KQPA 3K6VA 3FZVA 1AH5A 1B5JA 1IZ1A 4QRZA 4EQBA 1SI1A 5I2NB 4IGRA 4XTCQ 1LGBC 1QW0A 4IO2A 3MUQA 4EF2A 2HEUA 1T0KA 3OEKA 4GL0A 1MPCA 4R6KA 5CMCA 1DPPA 1IEJA 1MY4A 3IB2A 4OHNA 2FA7A 2DVCA 5DEXB 4C1TA 4G77A 4F18A 4EF1A 2REGA 2H25A 1LB8A 2PMSA 4GWOA 4KYDA 3U1OA 4YKKA 4ZE9A 5LOMA 1VFDA 4GXAA 4YICA 2RKMA 3FXUA 2B65A 3FJGA 3LSWA 1M5BA 3H6UA 4JB7A 3F11A 1DTGA 3CFXA 4DCYA 1A54A 1MS7A 1US5A 3OSQA 3S9MC 3N6TA 5CBRA 1SW4A 4XKRA 4Q8RA 1UIUA 2GHAA 2NVUB 3OENA 5BWJA 5F7VA 1H43A 2Q2CA 3PPRA 4U21A 4NF4B 4DZ1A 1N84A 2I3VA 2O68A 3N94A 3A3UA 2XXYA 2F7BA 4U1ZA 2O1MA 1H45A 4FAJA 1QKBA 2XXWA 4Q0CA 4X48A 3CVGA 3E4RA 4I9DA 4WKMA 4MLQA 2PBWA 3ZSFA 3RTFB 4EXKA 2Q88A 1AOVA 1XC1A 4NWCA 4ELOA 4G8HA 1MG1A 1P1OA 3K0VA 1H3DA 2ONKE 4IO3A 1NFTA 3ODBA 3RLFE 3PUWE 3BFTA 1IXIA 1D9VA 1FTJA 3K00A 3KSJA 3P7IA 5AA1A 4ELRA 5CMKA 4U22A 4HCYA 4R6YA 4X1BA 4R9GA 2DQVA 3ONMA 4NMYA 4RYAA 2V93A 4QSDA 2X26A 4R2BA 1R6ZA 1MRPA 1LCTA 1GV8A 3VE1B 2Y7RA 3M3LA 1TXFA 4FEBA 4R9FA 1II5A 5FTHA 1FQDA 3GBBA 1Z7ME 5AE4A 3C33A 4GVOA 4PP0A 5CMMA 1GVCA 4YKPA 3O6IA 3G3JA 1SVXB 1BLFA 3DP4A 4GOTA 4I62A 5ITOA 4KR5A 3JZJA 1F9BA 1A55A 2X7QA 1MXXA 4HW8A 5IAIA 5L9SA 1MXUA 2ZXTA 1IIWA 3U92A 3SETA 3G3FA 2DWIA 2NUVA 2Y7PA 3T9XB 4H5GA 2O69A 3IB0A 1MPBA 4R6HA 3VFJA 4F3GA 2PYYA 3OO6A 3KOTA 3Q26A 4N07A 2DS9A 5J1DA 2V25A 1M5CA 2O7IA 5HPQA 3FASA 3I3VA 1XS5A 1M5EA 2I48A 3E9XA 3KEIA 4ECFA 5H8NB 2Z8EA 4XKQA 4M4GA 2P0SA 3RGYA 1NKXA 3QYTA 1B3EA 3MP6A 4OERA 1PB8A 5I59B 3EQ1A 3PUYE 4MFIA 2O7UA 3RT8A 3MZ1A 3MBPA 1B46A 3TKDA 1B9JA 2QS1A 3T96B 2G93A 3MPLA 3VLVA 3LSLA 4JSOA 3UORA 1LLSA 1B4HA 3VLUA 2PX1A 5CBSA 2DE4A 1MH3A 3IJXB 2DWHA 5I2KA 5KCJA 1Q35A 1MH4A 3O6GA 1Y3QA 3O66A 4OQOA 4RY1A 5M2VA 1MY3A 4RPNA 1Y1MA 4OESA 4NF4A 4EDPA 4O3BA 5DEXA 1JNFA 1I6AA 2H4IA 1NNPA 1FQEA 4Q5TA 1RKMA 4M1VA 4YZZA 3V8XB 1LAFE 1TT1A 3K4UA 5CC2A 3HN0A 5AA4B 2NXOA 1MDP1 3K01A 2Z22A 4BDOA 5I57B 1B58A 4G68B 3RPWA 2Y7WA 1P1QA 1I6BA 2ESNA 2HCAA 3D4GA 4F22A 2RF1A 2UVHA 2D3IA 4QFPA 5ELVA 5DTBA 4FEDA 2VD3A 2DE2A 2F34A 1B05A 1NH7A 2OWTA 2R6GE 1ZMGA 1LFIA 3G3IA 4E0WA 1SW2A 3G3GA 3RQTA 3Q27A 5ITPA 2YLNA 2ZNSA 2DP8A 3MC2A 3QUJA 1XHYA 1DOTA 1H44A 2ZYKA 3SEWA 3OXNA 1OLCA 2A5TB 2UYEA 4WEDA 4QHQA 3MWBA 3TAJA 1HSJA 1LAGE 4RK9A 3S2VA 3FGSA 4POXA 4F2OA 1N3XA 1R9QA 4PQJA 2DWJA 3T9UA 1PB7A 5CRYA 3CFLA 3ZS6A 4F19A 4XKNA 3DP8A 2DXYA 3GZGA 3PGFA 4YB5A 4KYSA 3UN6A 1POTA 1EU8A 1L5TA 3TMGA 1YPNA 2I4BA 3ECRA 2DSFA 4R73A 2XX7A 3TCHA 3MVYA 2H5YA 3PUZE 2F7CA 3UA8A 4BDLA 5KCJB 3TDJA 1B51A 3CR9A 4LQ2A 4U4XA 2D5WA 4GQOA 1LBCA 2I0BA 3O97A 3OEMA 5H8HB 1SYHA 2ABHA 2V3QA 1OLAA 2ZMBA 1MXVA 1XVXA 3FD3A 4LQ5A 4MF3A 4PFTA 3IORA 3E3KA 3O29A 4PFUA 3ZKKA 5CM6A 5CMBA 3O9PA 4NF5B 1B4ZA 2ONRA 1S50A 1IXCA 3MVZA 1N7XA 4MLVA 5AA4A 3SEXA 3SEVA 4GF8A 1MQIA 3C35A 3HV1A 3W9VA 1VFEA 4G8NA 5JK4A 2UVJA 4OETA 4WEPA 4OEUA 4R2FA 3TEPA 3TUSA 3BKIB 1Q1KA 5A5XB 2THIA 3IOWA 1XT8A 2FYIA 3QUFA 5KDTA 2ZYMA 1IITA 1Y3PA 1R1NA 3D4CA 4I1DA 3MJNA 4NWDA 4C0RA 5AA2B 2RCBA 4KD5A 1XOCA 4NF8A 3N6UA 4IY5A 1JEUA 4G8MA 2XHDA 4MH5A 3RNNA 3W9WA 4LZ5A 1Z7NE 3TZAA 3U94A 4GL8A 3TTLA 1B52A 1WODA 1A99A 3IJOB 4XIGQ 3IK6B 4QFNA 2OWSA 1RYXA 1NL5A 2ONSA 3MQ9A 2ALUA 3OO9A 4OVJA 3H06B 2X7PA 3IO4A 4LZ8A 4RXLA 4LA9A 1RYOA 2NWJA 1SBPA 4IO5A 2XD3A 2V3TA 2IEEA 2VGQA 2QL3A 4NF6B 4F29A 4F1VA 1USYH 4GRKA 4F2QA 5I56B 3K2DA 1MQDA 2Y84A 3H7MA 2Q89A 3B6TA 2I58A 3OD7A 4XKPA 4C1UA 1S7YA 1M5DA 1B3GA 1I69A 3QXMA 5I58A 1USYE 3DLNA 3H6VA 1ZLQA 4L17A 3PPOA 2A5SA 3H6WA 1A8FA 1SQYA 1HSEA 2Z8DA 1S9TA 3KGCA 3OOAA 3UIFA 4IO4A 4ISUA 1EH3A 4NF5A 4OFLA 4ZDMA 2AL4A 2RC8A 2XXIA 1A7LA 3E13X 2Y7KA 3FJ7A 4R75A 4EQ9A 1LSTA 3S9LC 3FVGA 1D9YA 4P0GA 4GFRA 3TODA 1BIYA 2O51A 2E1SA 2RC9A 4X9TA 4DLDA 1NH8A 3G3HA 4AQ4A 5IKBA 1EZPA 3KBRA 1SYIA 3L6GA 4KCCA 5H8NA 3UK4A 2QPQA 3V5AA 3MW0A 1ZU0A 3M3FA 4IO7A 2QS3A 4LP2B 4QFKA 4U2RA 3GLBA 1DMBA 4H65A 1Y1ZA 2HZKA 1XVYA 1B3LA 3FXQA 3QAXA 4JSDA 1Y20A 5FHMA 3S9EA 1JW4A 1ZBMA 1B3HA 3PPQA 4K3FA 1TFAA 1YAEA 1AIVA 3RUMA 4HS7A 1O64A 2QS2A 2HAUA 2VD2A 5TU0A 4OYVA 4ZS9A 3T9HB 5TP9B 4R74A 1I6QA 1ZKBA 5H8FB 3T22A 1CE2A 1UTHA 1MQJA 4AB6A 1FTKA 3PMVA 4IGTA 4ZZEA 1ZTYA 4TLMB 3VVDA 3PMWA 3PD9A 2OK2A 4DIGA 3QSLA 4FECA 4POWA 3LSXA 4KI0E 1A8EA 5AA2D 1Y3NA 3FVOA 3FV2A 3H6TA 4PFWA 5BUUA 1SI0A 5FTIA 1EZ9A 4RK2A 4F31B 2QMXA 4JWXA 1FTOA 1N04A 1UTBB 4JDFA 2UVGA 4KYEA 1NMUA 3IAZA 3MVWA 1OQGA 3SEUA 1UQWA 4H8IA 2VOZA 3ILUB 4Z0IA 2F97A 5ICQA 3KSXA 4H0WA 5AA3A 3K02A 2XXVA 1NNKA 2ZYNA 2PT1A 2REJA 3RT6B 2PT2A 3PD8A 3C34A 3THIA 4NF8B 1IXHA 2O6AA 1FQAA 3MP1A 1OIBA 4LUBA 4QSEA 3WAFA 3V83A 1D3KA 1WVJA 4H67A 3MAMA 3QIMA 3QK6A 4ELPA 1B5IA 3PMXA 5DYHA 4FIMA 4Q30B 3VDFA 2V3UA 4GLIA 4EQ7A 3KJ7A 2DE3A 3CRBA 3K1PA 4RNSA 1IXGA 3IX1A 4YKIA 2GRVA 1AL3A 2HAVA 3U72A 3VVFA 2LAOA 4FORA 5FHNA 1LCFA 3CSGA 1SW1A 3FVNA 4YB6A 3A3CA 5K2YA 2F5XA 3JV9A 4ZEIA 1PEBA 3RY3A 3LUYA 3VVEA 1OMPA 1P1WA 2Z8FA 1MPDA 3KN3A 4ZEFA 3EHSA 3VLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O3A A;  1LBB A;  1LFH A;  2I4C A;  3H3G A;  1JW5 A;  1NNT A;  1FQF A;  1TFD A;  1PBP A;  4IY6 A;  4OEN A;  4OXV A;  2ZNT A;  5EHM A;  4KFQ A;  3T93 B;  3OSR A;  3MZ9 A;  3FAT A;  5TPA B;  4F3P A;  5JTY B;  1UTH B;  2XXX A;  1URG A;  1PC3 A;  1MY0 A;  3FVK A;  3HPI A;  3O28 A;  3PV0 E;  1YTV A;  5H8Q A;  1POY 1;  2OCU A;  2XD2 A;  2GHB A;  2XXR A;  4YMB A;  3N26 A;  4DXB A;  3C32 A;  2G29 A;  3SER A;  4PET A;  2W7Y A;  4N13 A;  3PUV E;  1FQC A;  1FTM A;  1LB9 A;  2DVZ A;  1H76 A;  2O1L A;  3FXR A;  3IR1 A;  5L9M A;  4P11 A;  3EHU A;  1ELJ A;  5TPA A;  3S4U A;  5I2K B;  1DSN A;  3ILT B;  5K2X A;  3VXC A;  1M5F A;  3DEL B;  3OEL A;  3B6Q A;  4QFO A;  4GD5 A;  2QS4 A;  2I0C A;  4LZ7 A;  3K1N A;  4NTL A;  1B0H A;  1P1N A;  3KG2 A;  4ND9 A;  2AL5 A;  4U4S A;  3TTM A;  4UAC A;  4PFY A;  2F6P A;  1OVB A;  1PBQ A;  4GIZ A;  3C36 A;  2XXT A;  2I49 A;  2Q8J A;  3USD A;  4ESW A;  3FV1 A;  4LAT A;  3PPN A;  4KCD A;  1UTB A;  5I57 A;  5H8H A;  3I5O A;  3ZKL A;  1LAH E;  3N5L A;  4YU0 A;  4KHZ E;  4UA8 A;  3IO6 A;  1QUL A;  3MP8 A;  3VXB A;  3L6H A;  3PU5 A;  3HCQ A;  3TYH A;  5I59 A;  3RN8 A;  4E0X A;  2RC7 A;  2QSX A;  1KWH A;  2HFB A;  1MM7 A;  4G2Z A;  4IB2 A;  4TQU Q;  1YCJ A;  5DVI A;  5EYF A;  5F1Q A;  5AA2 A;  3TCG A;  3DP6 A;  1URD A;  3IL1 B;  3IOU A;  3R6U A;  4IO6 A;  3O6H A;  3TQW A;  3W15 C;  2P2A A;  2XXU A;  1B1H A;  1HSL A;  1N7W A;  4HCW A;  3V89 B;  1N76 A;  1MXY A;  4FAT A;  3KFM A;  3CG3 A;  3HHF A;  3IB1 A;  3O2A A;  2F35 A;  2H99 A;  4O3C A;  4F3B A;  4WXJ A;  3G3K A;  2XXP A;  2YPN A;  1ZJL A;  2R9J A;  3DM0 A;  3PPP A;  4G4P A;  2AYS A;  1NNF A;  4FJP A;  3TPA A;  1MM6 A;  4OWD A;  1FW0 A;  4DXU A;  4QF9 A;  1MXZ A;  3CG1 A;  3MZB A;  1B7H A;  1US4 A;  1PDA A;  2F8D A;  4U23 A;  3IOT A;  2OLB A;  1JET A;  3A09 A;  1MXW A;  2XXH A;  3TCF A;  2UXA A;  4BDN A;  2NOO A;  2F6G A;  3FUZ A;  4EUO A;  4N6P A;  2KLF A;  4OZ9 A;  3SEY A;  3S9N C;  3EN3 A;  3JYR A;  1JW1 A;  4JWO A;  1LFG A;  4TOZ A;  2CZL A;  1QVS A;  2UVI A;  4H1X A;  1P99 A;  3K6U A;  1B7Z A;  4ZZA A;  1OQH A;  5JEI A;  2WKY A;  1B5H A;  3SDF A;  2F36 A;  2I3W A;  5I58 B;  1VSO A;  5ICT A;  3UGW A;  1FQB A;  2M8C A;  1FCK A;  1O7T A;  1B0L A;  3LR1 A;  2QJE A;  4JXI A;  3UP9 A;  3EHT A;  1AMF A;  4THI A;  1IUD A;  1FTL A;  3H03 A;  2H98 A;  1GR2 A;  3HST A;  3K6W A;  1B40 A;  1UIV A;  3C4M A;  1VR5 A;  2GFE A;  4NF6 A;  3RTW B;  3SES A;  1MQH A;  2O84 X;  2F7A A;  1BKA A;  2P1S A;  2VHA A;  3M8U A;  4RPO A;  5FHO A;  4BDR A;  3K6X A;  5TP9 A;  2B3F A;  3OO7 A;  3IOV A;  2Z23 A;  2DXR A;  5H8F A;  1ZIU A;  2CMO A;  3Q29 A;  1BP5 A;  2F78 A;  2GH9 A;  3Q28 A;  3WAE A;  5A5X A;  1N3W A;  5H8Q B;  1D4N A;  3GBA A;  1JEV A;  4DXC A;  5KDT B;  2AIX A;  4YB7 A;  5HM4 B;  4H6D A;  4P0I A;  5KZT A;  4ZE8 A;  4YMA A;  3K1M A;  3OMB A;  4JBZ A;  5I2N A;  1DTZ A;  2PVU A;  1Y4T A;  5EHS A;  3T9V A;  1MDQ A;  5DVF A;  1Y9U A;  4I8C A;  4ZEB A;  2HZL A;  2BJJ X;  3KOS A;  1ANF A;  3FJM A;  1DPE A;  3LSF B;  1SW5 A;  3M3K A;  2XXQ A;  4BDM A;  4DE8 A;  4PE5 B;  3TTK A;  1SD3 A;  4F1U A;  1EZO A;  3HHG A;  3MPK A;  1GGG A;  2HXW A;  2OZZ A;  2VP1 A;  2ZYO A;  3FIR A;  1PB9 A;  3Q25 A;  5DVJ A;  5H8S A;  2RIN A;  1QUJ A;  4F3S A;  2HQ0 A;  1LAX A;  1TWY A;  2H9B A;  4LON B;  4OFJ A;  3KN7 A;  5HBC A;  3GXA A;  4G68 C;  3H4Z A;  3VV5 A;  2A5T A;  1A40 A;  2ZNU A;  1OVT A;  3BBR A;  3CIJ A;  3EPE A;  3KZG A;  4H8J A;  4ZEK A;  4HTG A;  4F1Y A;  4RA1 A;  3U8Q A;  1MY2 A;  5I56 A;  1R9L A;  4F39 A;  5B7D A;  5B70 A;  1B7U A;  1B6H A;  1MQG A;  3MVX A;  1B3F A;  2ANJ A;  1MY1 A;  2QRY A;  2YJP A;  4OMB A;  2RCA A;  3EF7 A;  4BLA A;  4LVQ A;  3KJT A;  2UYF A;  3OO8 A;  3R7X A;  2DYX A;  4FE8 A;  4ESX A;  3G7W A;  4QSC A;  1B2H A;  2V84 A;  1QKA A;  1VE4 A;  1QUI A;  1O63 A;  1WDN A;  1URS A;  3LC8 A;  4G68 A;  4XXU A;  4YAH X;  4QFL A;  4AB5 A;  1ATG A;  4GXS B;  3TTN A;  4DDD A;  2B3B A;  4RJZ A;  3LBS A;  1QJM A;  1N0T A;  2DWA A;  1J1N A;  4U1O A;  3TQL A;  5ISU A;  3TFL A;  3B7D A;  1JVX A;  3CI8 A;  2D21 A;  4OTE A;  4DCX A;  1B32 A;  4Z7E A;  5JTY A;  4ELQ A;  4YKJ A;  3TEL A;  3HO7 A;  4ZED A;  4MBP A;  3BFU A;  4ZEC A;  2DOJ A;  1B1X A;  3CFZ A;  1GTK A;  2Y7I A;  3KN8 A;  3PUX E;  4NED A;  5L9O A;  2IA4 A;  2XX8 A;  3U93 A;  4BDQ A;  1P1U A;  2Q9T A;  2I6E A;  1JQF A;  3T66 A;  4KPT A;  4R72 A;  1CB6 A;  2OJT A;  3C9H A;  3R26 A;  5CI5 A;  3AXF A;  3B6W A;  4H5F A;  4ONY A;  2FNC A;  1SDX A;  4EXL A;  4TLL B;  2QMW A;  2R71 A;  1QUK A;  3I6V A;  2XX9 A;  5L8D A;  4NE4 A;  1BTJ A;  2Q2A A;  5I84 A;  1Y4C A;  1JVY A;  2E0S A;  4X1D A;  3C31 A;  3SKP A;  3TTR A;  3CSB A;  2OBG A;  1IQ7 A;  4OFO A;  4OEV A;  5DT6 A;  4JWY A;  4KQP A;  3K6V A;  3FZV A;  1AH5 A;  1B5J A;  1IZ1 A;  4QRZ A;  4EQB A;  1SI1 A;  5I2N B;  4IGR A;  4XTC Q;  1LGB C;  1QW0 A;  4IO2 A;  3MUQ A;  4EF2 A;  2HEU A;  1T0K A;  3OEK A;  4GL0 A;  1MPC A;  4R6K A;  5CMC A;  1DPP A;  1IEJ A;  1MY4 A;  3IB2 A;  4OHN A;  2FA7 A;  2DVC A;  5DEX B;  4C1T A;  4G77 A;  4F18 A;  4EF1 A;  2REG A;  2H25 A;  1LB8 A;  2PMS A;  4GWO A;  4KYD A;  3U1O A;  4YKK A;  4ZE9 A;  5LOM A;  1VFD A;  4GXA A;  4YIC A;  2RKM A;  3FXU A;  2B65 A;  3FJG A;  3LSW A;  1M5B A;  3H6U A;  4JB7 A;  3F11 A;  1DTG A;  3CFX A;  4DCY A;  1A54 A;  1MS7 A;  1US5 A;  3OSQ A;  3S9M C;  3N6T A;  5CBR A;  1SW4 A;  4XKR A;  4Q8R A;  1UIU A;  2GHA A;  2NVU B;  3OEN A;  5BWJ A;  5F7V A;  1H43 A;  2Q2C A;  3PPR A;  4U21 A;  4NF4 B;  4DZ1 A;  1N84 A;  2I3V A;  2O68 A;  3N94 A;  3A3U A;  2XXY A;  2F7B A;  4U1Z A;  2O1M A;  1H45 A;  4FAJ A;  1QKB A;  2XXW A;  4Q0C A;  4X48 A;  3CVG A;  3E4R A;  4I9D A;  4WKM A;  4MLQ A;  2PBW A;  3ZSF A;  3RTF B;  4EXK A;  2Q88 A;  1AOV A;  1XC1 A;  4NWC A;  4ELO A;  4G8H A;  1MG1 A;  1P1O A;  3K0V A;  1H3D A;  2ONK E;  4IO3 A;  1NFT A;  3ODB A;  3RLF E;  3PUW E;  3BFT A;  1IXI A;  1D9V A;  1FTJ A;  3K00 A;  3KSJ A;  3P7I A;  5AA1 A;  4ELR A;  5CMK A;  4U22 A;  4HCY A;  4R6Y A;  4X1B A;  4R9G A;  2DQV A;  3ONM A;  4NMY A;  4RYA A;  2V93 A;  4QSD A;  2X26 A;  4R2B A;  1R6Z A;  1MRP A;  1LCT A;  1GV8 A;  3VE1 B;  2Y7R A;  3M3L A;  1TXF A;  4FEB A;  4R9F A;  1II5 A;  5FTH A;  1FQD A;  3GBB A;  1Z7M E;  5AE4 A;  3C33 A;  4GVO A;  4PP0 A;  5CMM A;  1GVC A;  4YKP A;  3O6I A;  3G3J A;  1SVX B;  1BLF A;  3DP4 A;  4GOT A;  4I62 A;  5ITO A;  4KR5 A;  3JZJ A;  1F9B A;  1A55 A;  2X7Q A;  1MXX A;  4HW8 A;  5IAI A;  5L9S A;  1MXU A;  2ZXT A;  1IIW A;  3U92 A;  3SET A;  3G3F A;  2DWI A;  2NUV A;  2Y7P A;  3T9X B;  4H5G A;  2O69 A;  3IB0 A;  1MPB A;  4R6H A;  3VFJ A;  4F3G A;  2PYY A;  3OO6 A;  3KOT A;  3Q26 A;  4N07 A;  2DS9 A;  5J1D A;  2V25 A;  1M5C A;  2O7I A;  5HPQ A;  3FAS A;  3I3V A;  1XS5 A;  1M5E A;  2I48 A;  3E9X A;  3KEI A;  4ECF A;  5H8N B;  2Z8E A;  4XKQ A;  4M4G A;  2P0S A;  3RGY A;  1NKX A;  3QYT A;  1B3E A;  3MP6 A;  4OER A;  1PB8 A;  5I59 B;  3EQ1 A;  3PUY E;  4MFI A;  2O7U A;  3RT8 A;  3MZ1 A;  3MBP A;  1B46 A;  3TKD A;  1B9J A;  2QS1 A;  3T96 B;  2G93 A;  3MPL A;  3VLV A;  3LSL A;  4JSO A;  3UOR A;  1LLS A;  1B4H A;  3VLU A;  2PX1 A;  5CBS A;  2DE4 A;  1MH3 A;  3IJX B;  2DWH A;  5I2K A;  5KCJ A;  1Q35 A;  1MH4 A;  3O6G A;  1Y3Q A;  3O66 A;  4OQO A;  4RY1 A;  5M2V A;  1MY3 A;  4RPN A;  1Y1M A;  4OES A;  4NF4 A;  4EDP A;  4O3B A;  5DEX A;  1JNF A;  1I6A A;  2H4I A;  1NNP A;  1FQE A;  4Q5T A;  1RKM A;  4M1V A;  4YZZ A;  3V8X B;  1LAF E;  1TT1 A;  3K4U A;  5CC2 A;  3HN0 A;  5AA4 B;  2NXO A;  1MDP 1;  3K01 A;  2Z22 A;  4BDO A;  5I57 B;  1B58 A;  4G68 B;  3RPW A;  2Y7W A;  1P1Q A;  1I6B A;  2ESN A;  2HCA A;  3D4G A;  4F22 A;  2RF1 A;  2UVH A;  2D3I A;  4QFP A;  5ELV A;  5DTB A;  4FED A;  2VD3 A;  2DE2 A;  2F34 A;  1B05 A;  1NH7 A;  2OWT A;  2R6G E;  1ZMG A;  1LFI A;  3G3I A;  4E0W A;  1SW2 A;  3G3G A;  3RQT A;  3Q27 A;  5ITP A;  2YLN A;  2ZNS A;  2DP8 A;  3MC2 A;  3QUJ A;  1XHY A;  1DOT A;  1H44 A;  2ZYK A;  3SEW A;  3OXN A;  1OLC A;  2A5T B;  2UYE A;  4WED A;  4QHQ A;  3MWB A;  3TAJ A;  1HSJ A;  1LAG E;  4RK9 A;  3S2V A;  3FGS A;  4POX A;  4F2O A;  1N3X A;  1R9Q A;  4PQJ A;  2DWJ A;  3T9U A;  1PB7 A;  5CRY A;  3CFL A;  3ZS6 A;  4F19 A;  4XKN A;  3DP8 A;  2DXY A;  3GZG A;  3PGF A;  4YB5 A;  4KYS A;  3UN6 A;  1POT A;  1EU8 A;  1L5T A;  3TMG A;  1YPN A;  2I4B A;  3ECR A;  2DSF A;  4R73 A;  2XX7 A;  3TCH A;  3MVY A;  2H5Y A;  3PUZ E;  2F7C A;  3UA8 A;  4BDL A;  5KCJ B;  3TDJ A;  1B51 A;  3CR9 A;  4LQ2 A;  4U4X A;  2D5W A;  4GQO A;  1LBC A;  2I0B A;  3O97 A;  3OEM A;  5H8H B;  1SYH A;  2ABH A;  2V3Q A;  1OLA A;  2ZMB A;  1MXV A;  1XVX A;  3FD3 A;  4LQ5 A;  4MF3 A;  4PFT A;  3IOR A;  3E3K A;  3O29 A;  4PFU A;  3ZKK A;  5CM6 A;  5CMB A;  3O9P A;  4NF5 B;  1B4Z A;  2ONR A;  1S50 A;  1IXC A;  3MVZ A;  1N7X A;  4MLV A;  5AA4 A;  3SEX A;  3SEV A;  4GF8 A;  1MQI A;  3C35 A;  3HV1 A;  3W9V A;  1VFE A;  4G8N A;  5JK4 A;  2UVJ A;  4OET A;  4WEP A;  4OEU A;  4R2F A;  3TEP A;  3TUS A;  3BKI B;  1Q1K A;  5A5X B;  2THI A;  3IOW A;  1XT8 A;  2FYI A;  3QUF A;  5KDT A;  2ZYM A;  1IIT A;  1Y3P A;  1R1N A;  3D4C A;  4I1D A;  3MJN A;  4NWD A;  4C0R A;  5AA2 B;  2RCB A;  4KD5 A;  1XOC A;  4NF8 A;  3N6U A;  4IY5 A;  1JEU A;  4G8M A;  2XHD A;  4MH5 A;  3RNN A;  3W9W A;  4LZ5 A;  1Z7N E;  3TZA A;  3U94 A;  4GL8 A;  3TTL A;  1B52 A;  1WOD A;  1A99 A;  3IJO B;  4XIG Q;  3IK6 B;  4QFN A;  2OWS A;  1RYX A;  1NL5 A;  2ONS A;  3MQ9 A;  2ALU A;  3OO9 A;  4OVJ A;  3H06 B;  2X7P A;  3IO4 A;  4LZ8 A;  4RXL A;  4LA9 A;  1RYO A;  2NWJ A;  1SBP A;  4IO5 A;  2XD3 A;  2V3T A;  2IEE A;  2VGQ A;  2QL3 A;  4NF6 B;  4F29 A;  4F1V A;  1USY H;  4GRK A;  4F2Q A;  5I56 B;  3K2D A;  1MQD A;  2Y84 A;  3H7M A;  2Q89 A;  3B6T A;  2I58 A;  3OD7 A;  4XKP A;  4C1U A;  1S7Y A;  1M5D A;  1B3G A;  1I69 A;  3QXM A;  5I58 A;  1USY E;  3DLN A;  3H6V A;  1ZLQ A;  4L17 A;  3PPO A;  2A5S A;  3H6W A;  1A8F A;  1SQY A;  1HSE A;  2Z8D A;  1S9T A;  3KGC A;  3OOA A;  3UIF A;  4IO4 A;  4ISU A;  1EH3 A;  4NF5 A;  4OFL A;  4ZDM A;  2AL4 A;  2RC8 A;  2XXI A;  1A7L A;  3E13 X;  2Y7K A;  3FJ7 A;  4R75 A;  4EQ9 A;  1LST A;  3S9L C;  3FVG A;  1D9Y A;  4P0G A;  4GFR A;  3TOD A;  1BIY A;  2O51 A;  2E1S A;  2RC9 A;  4X9T A;  4DLD A;  1NH8 A;  3G3H A;  4AQ4 A;  5IKB A;  1EZP A;  3KBR A;  1SYI A;  3L6G A;  4KCC A;  5H8N A;  3UK4 A;  2QPQ A;  3V5A A;  3MW0 A;  1ZU0 A;  3M3F A;  4IO7 A;  2QS3 A;  4LP2 B;  4QFK A;  4U2R A;  3GLB A;  1DMB A;  4H65 A;  1Y1Z A;  2HZK A;  1XVY A;  1B3L A;  3FXQ A;  3QAX A;  4JSD A;  1Y20 A;  5FHM A;  3S9E A;  1JW4 A;  1ZBM A;  1B3H A;  3PPQ A;  4K3F A;  1TFA A;  1YAE A;  1AIV A;  3RUM A;  4HS7 A;  1O64 A;  2QS2 A;  2HAU A;  2VD2 A;  5TU0 A;  4OYV A;  4ZS9 A;  3T9H B;  5TP9 B;  4R74 A;  1I6Q A;  1ZKB A;  5H8F B;  3T22 A;  1CE2 A;  1UTH A;  1MQJ A;  4AB6 A;  1FTK A;  3PMV A;  4IGT A;  4ZZE A;  1ZTY A;  4TLM B;  3VVD A;  3PMW A;  3PD9 A;  2OK2 A;  4DIG A;  3QSL A;  4FEC A;  4POW A;  3LSX A;  4KI0 E;  1A8E A;  5AA2 D;  1Y3N A;  3FVO A;  3FV2 A;  3H6T A;  4PFW A;  5BUU A;  1SI0 A;  5FTI A;  1EZ9 A;  4RK2 A;  4F31 B;  2QMX A;  4JWX A;  1FTO A;  1N04 A;  1UTB B;  4JDF A;  2UVG A;  4KYE A;  1NMU A;  3IAZ A;  3MVW A;  1OQG A;  3SEU A;  1UQW A;  4H8I A;  2VOZ A;  3ILU B;  4Z0I A;  2F97 A;  5ICQ A;  3KSX A;  4H0W A;  5AA3 A;  3K02 A;  2XXV A;  1NNK A;  2ZYN A;  2PT1 A;  2REJ A;  3RT6 B;  2PT2 A;  3PD8 A;  3C34 A;  3THI A;  4NF8 B;  1IXH A;  2O6A A;  1FQA A;  3MP1 A;  1OIB A;  4LUB A;  4QSE A;  3WAF A;  3V83 A;  1D3K A;  1WVJ A;  4H67 A;  3MAM A;  3QIM A;  3QK6 A;  4ELP A;  1B5I A;  3PMX A;  5DYH A;  4FIM A;  4Q30 B;  3VDF A;  2V3U A;  4GLI A;  4EQ7 A;  3KJ7 A;  2DE3 A;  3CRB A;  3K1P A;  4RNS A;  1IXG A;  3IX1 A;  4YKI A;  2GRV A;  1AL3 A;  2HAV A;  3U72 A;  3VVF A;  2LAO A;  4FOR A;  5FHN A;  1LCF A;  3CSG A;  1SW1 A;  3FVN A;  4YB6 A;  3A3C A;  5K2Y A;  2F5X A;  3JV9 A;  4ZEI A;  1PEB A;  3RY3 A;  3LUY A;  3VVE A;  1OMP A;  1P1W A;  2Z8F A;  1MPD A;  3KN3 A;  4ZEF A;  3EHS A;  3VLW A; 
#chains in the Genus database with same CATH topology
 1LBB A;  1LFH A;  1TFD A;  1FQF A;  4OEN A;  3FAT A;  4O7M A;  5JTY B;  1MY0 A;  4MNP A;  4YMB A;  3C32 A;  2G29 A;  2W7Y A;  2O1L A;  3IR1 A;  5I2K B;  4NQ8 A;  3OEL A;  3B6Q A;  4QFO A;  4LZ7 A;  3K1N A;  2PFY A;  3TTM A;  4OVT A;  4UAC A;  1PBQ A;  4GIZ A;  3C36 A;  2XXT A;  2I49 A;  2Q8J A;  2F3B A;  1UTB A;  1LAH E;  3VXB A;  3HCQ A;  4G2Z A;  2HFB A;  1MM7 A;  5EYF A;  1URD A;  3R6U A;  2XXU A;  1N7W A;  4HCW A;  5IZ3 B;  4WXJ A;  2R9J A;  3PPP A;  4NAP A;  1G0I A;  1FW0 A;  3MZB A;  4UAB A;  2UXA A;  4BDN A;  3FUZ A;  4EUO A;  1JW1 A;  1LFG A;  4GWU A;  1B7Z A;  3SDF A;  4OAN A;  1VSO A;  3UGW A;  2M8C A;  1O7T A;  3LR1 A;  4JXI A;  3EHT A;  3K6W A;  2GFE A;  3RTW B;  3SES A;  1MQH A;  2VHA A;  1BKA A;  5FHO A;  2F78 A;  1N3W A;  2FBP A;  4DXC A;  3GBA A;  1QGX A;  4YB7 A;  5HM4 B;  2B4M A;  5KZT A;  1MDQ A;  2BJJ X;  1SW5 A;  4DE8 A;  1VDW A;  4F1U A;  3HHG A;  1GGG A;  2HXW A;  2VP1 A;  2ZYO A;  4GX4 A;  1QUJ A;  2H9B A;  4G68 C;  1A40 A;  3CIJ A;  1EYK A;  4ZEK A;  4HTG A;  3U8Q A;  1R9L A;  5B70 A;  1MY1 A;  4LVQ A;  3G7W A;  1QKA A;  1O63 A;  4G68 A;  3TTN A;  2B3B A;  4RJZ A;  3LBS A;  1FBH A;  4U1O A;  1LBY A;  3B7D A;  2D21 A;  2MKZ A;  5IGA A;  3TEL A;  3HO7 A;  3BFU A;  1GTK A;  1P1U A;  1JQF A;  3T66 A;  1CB6 A;  2OJT A;  3AXF A;  3B6W A;  1FPG A;  3CSB A;  2FIX A;  4KQP A;  4IGR A;  4XTC Q;  3T0J A;  1QW0 A;  4EF2 A;  3IB2 A;  4LN5 A;  2FA7 A;  2DVC A;  5DEX B;  4C1T A;  3LV0 A;  4EF1 A;  2REG A;  2H25 A;  4GWO A;  4KYD A;  4MHF A;  4O8M A;  4YIC A;  3FXU A;  1M5B A;  3H6U A;  4JB7 A;  4DCY A;  1DTG A;  3CFX A;  1DBZ A;  2NVU B;  1H43 A;  2I3V A;  3A3U A;  4U1Z A;  2XXW A;  4Q0C A;  3CVG A;  4WKM A;  2PBW A;  4NWC A;  4G8H A;  1P1O A;  1NFT A;  3CHG A;  3PUW E;  3BFT A;  5CMK A;  4RYA A;  4QSD A;  2X26 A;  4JVD A;  1R6Z A;  3VE1 B;  5FTH A;  1FQD A;  1Z7M E;  2L5V A;  1GVC A;  5ET6 A;  3G3J A;  3DP4 A;  4GOT A;  5ITO A;  1MXU A;  4HXV A;  2DWI A;  3IB0 A;  4F3G A;  2PYY A;  3Q26 A;  2DS9 A;  2V25 A;  5HPQ A;  3KEI A;  4M4G A;  3QYT A;  1B3E A;  4MFI A;  3MZ1 A;  5EQA A;  3MPL A;  3LSL A;  5CBS A;  2DE4 A;  5I2K A;  1MY3 A;  4RPN A;  1JNF A;  2H4I A;  4Q5T A;  5A5L A;  5CC2 A;  1RKM A;  4NGU A;  1LAF E;  4I40 A;  3KC0 A;  2Z22 A;  5I57 B;  1B58 A;  3RPW A;  2Y7W A;  1P1Q A;  1I6B A;  4F22 A;  4FED A;  2DE2 A;  2OWT A;  1NH7 A;  3G3I A;  2XXK A;  1ZMG A;  4E0W A;  1SW2 A;  5FBP A;  5ITP A;  3GYY A;  1XHY A;  2A5T B;  4DI3 D;  2DDK A;  4F19 A;  3PGF A;  4I3Y A;  1POT A;  1YPN A;  2I4B A;  3MVY A;  2F7C A;  4N17 A;  1B51 A;  3TZA A;  2I0B A;  3OEM A;  1SYH A;  2V3Q A;  3ISP A;  3IOR A;  1IXC A;  1IME A;  4MLV A;  2CZK A;  2Y5K A;  3SEV A;  4GF8 A;  3HV1 A;  3W9V A;  4WEP A;  1Q1K A;  5A5X B;  3IOW A;  4HE2 A;  4C0R A;  4NF8 A;  4MH5 A;  3W9W A;  4LZ5 A;  1Z7N E;  3U94 A;  3TTL A;  1B52 A;  1A99 A;  2WEF A;  4PDD A;  2HPG A;  3MQ9 A;  2ALU A;  3H06 B;  4N81 A;  4LA9 A;  1RYO A;  1SBP A;  2XD3 A;  2VGQ A;  4F29 A;  1USY H;  2Y84 A;  3H7M A;  3B6T A;  1FPB A;  1LBX A;  3OD7 A;  2WBB A;  3QMF A;  1B3G A;  1AWB A;  5I58 A;  1CNQ A;  3DLN A;  4PAF A;  4L17 A;  3PPO A;  3KGC A;  4ISU A;  4HE0 A;  4NF5 A;  1A7L A;  2Y7K A;  2E1S A;  1EZP A;  1SYI A;  5H8N A;  1ZU0 A;  4QFK A;  4U2R A;  1DMB A;  2HZK A;  1Y20 A;  1B3H A;  3PPQ A;  1FBC A;  4P1L A;  1O64 A;  2QS2 A;  4OYV A;  4ZS9 A;  4GWS A;  1ZKB A;  1UTH A;  1FTK A;  3VVD A;  1ZTY A;  2ZZW A;  3PMW A;  1NUY A;  3QSL A;  4FEC A;  1A8E A;  2WX9 A;  3KBZ A;  5FTI A;  4RK2 A;  4F31 B;  1LBZ A;  1KA0 A;  1NUZ A;  3MVW A;  1OQG A;  1UQW A;  3ILU B;  4H45 A;  2F97 A;  4PBH A;  4PAI A;  1NNK A;  2FHY A;  4PGN A;  3PD8 A;  4NF8 B;  2O6A A;  3V83 A;  1OIB A;  1WVJ A;  3MAM A;  3QIM A;  3QK6 A;  4ELP A;  1B5I A;  3PMX A;  5DYH A;  5J16 A;  2V3U A;  4GLI A;  3KJ7 A;  1IMD A;  3CRB A;  1IXG A;  1LCF A;  4ZEF A;  3T22 A;  5DW8 A;  3TMG A;  1JW5 A;  1PBP A;  2ZNT A;  4KFQ A;  5TPA B;  1NUW A;  1UTH B;  1PC3 A;  5H8Q A;  3O28 A;  4NG7 A;  1POY 1;  2GHB A;  4DXB A;  3SER A;  3PUV E;  1FQC A;  1LB9 A;  1DCU A;  5TPA A;  1ELJ A;  5K2X A;  4PE3 A;  1M5F A;  3DEL B;  4OVP A;  4GD5 A;  4G61 A;  4NTL A;  1B0H A;  1P1N A;  2AL5 A;  4U4S A;  2F6P A;  1IMB A;  4ESW A;  3USD A;  5I57 A;  3PPN A;  1FBP A;  3I5O A;  2QVV A;  3N5L A;  4P1E A;  4UA8 A;  3MP8 A;  3L6H A;  3TYH A;  3RN8 A;  1KWH A;  5I5P A;  1IMA A;  4PBQ A;  3TCG A;  3DP6 A;  3IOU A;  4IO6 A;  1BK4 A;  2CZI A;  1N76 A;  1NV1 A;  3IB1 A;  3O2A A;  2AYS A;  1MXZ A;  3CG1 A;  1US4 A;  2F8D A;  4U23 A;  2OLB A;  3A09 A;  2XXH A;  2NOO A;  4N6P A;  4TOZ A;  3JYR A;  4JWO A;  2CZL A;  4PDH A;  1P99 A;  5JEI A;  2WKY A;  1FQB A;  3H03 A;  2H98 A;  1GR2 A;  2OWZ A;  3C4M A;  1VR5 A;  4NF6 A;  3M8U A;  4MNI A;  3K6X A;  2B3F A;  2Z23 A;  2DXR A;  4OVQ A;  4PF8 A;  5A5X A;  3WAE A;  1NI9 A;  1FBE A;  2QVU A;  4H6D A;  4JBZ A;  5I2N A;  1FPF A;  1Y4T A;  5DVF A;  4ZEB A;  3KOS A;  4BDM A;  4PE5 B;  4GBV A;  1SD3 A;  3MPK A;  2B4L A;  2HQ0 A;  1LAX A;  1TWY A;  1FSA A;  4OFJ A;  3KN7 A;  3H4Z A;  2A5T A;  2KR0 A;  3KZG A;  1OVT A;  3EPE A;  3U65 A;  1MY2 A;  5I56 A;  5B7D A;  1B6H A;  3MVX A;  2ANJ A;  1JP4 A;  4BLA A;  3KJT A;  2UYF A;  3R7X A;  4ESX A;  4QSC A;  1VE4 A;  3LC8 A;  4AB5 A;  4QFL A;  4DDD A;  1N0T A;  1J1N A;  3TQL A;  5ISU A;  4XFE A;  3CI8 A;  5JTY A;  4ZED A;  4MBP A;  2Y7I A;  3KN8 A;  2XX8 A;  3U93 A;  4BDQ A;  2Q9T A;  3I6V A;  1BTJ A;  2Q2A A;  1Y4C A;  3RPL B;  2E0S A;  4X1D A;  5ICT A;  4OEV A;  4JWY A;  1IZ1 A;  1SI1 A;  1T0K A;  4IO2 A;  4GL0 A;  2PFZ A;  4AS4 A;  1LB8 A;  2PMS A;  5LOM A;  4GXA A;  2B65 A;  3FJG A;  1A54 A;  3OSQ A;  3S9M C;  3N6T A;  1KA1 A;  4XKR A;  1UIU A;  3PPR A;  2XXY A;  4FAJ A;  1QKB A;  4MLQ A;  4EXK A;  4ELO A;  4IO3 A;  1MG1 A;  3K0V A;  1H3D A;  4MNC A;  3B50 A;  4U22 A;  4OVR A;  4HCY A;  4R6Y A;  3RPL A;  1LCT A;  2Y7R A;  2VPO A;  1II5 A;  4PP0 A;  1BLF A;  4I62 A;  1F9B A;  1A55 A;  2X7Q A;  1MXX A;  5L9S A;  2ZXT A;  2NUV A;  3T9X B;  4H5G A;  4R6H A;  1MPB A;  3VFJ A;  5J1D A;  1M5E A;  4XKQ A;  2P0S A;  1NKX A;  1PB8 A;  5I59 B;  3T96 B;  3VLV A;  2WBD A;  4JSO A;  3VLU A;  1B4H A;  2PX1 A;  1MH3 A;  3IJX B;  4N6K A;  1MH4 A;  4RY1 A;  3O66 A;  5M2V A;  1G0H A;  4EDP A;  1Y1M A;  4NF4 A;  1NNP A;  1FQE A;  4YZZ A;  4M1V A;  3K4U A;  5AA4 B;  3K01 A;  4G68 B;  2HCA A;  3D4G A;  4O94 A;  2VD3 A;  2F34 A;  2Y5L A;  3G3G A;  1DOT A;  3SEW A;  1OLC A;  4WED A;  3MWB A;  1R9Q A;  3T9U A;  1PB7 A;  4NHB A;  3CFL A;  2DXY A;  1NV6 A;  4KYS A;  1EU8 A;  2DSF A;  4R73 A;  3PUZ E;  4N91 A;  2D5W A;  1LBC A;  1IMF A;  2ABH A;  5EYH A;  4MF3 A;  1MXV A;  1XVX A;  3FD3 A;  4PFT A;  5IKB A;  3O9P A;  1FBD A;  2ONR A;  3SEX A;  1FBG A;  1VFE A;  2UVJ A;  1YXI A;  4R2F A;  1LBV A;  2ZYM A;  4I1D A;  4NWD A;  1FBF A;  2XHD A;  3RNN A;  4XIG Q;  2F3D A;  1RYX A;  3OO9 A;  2X7P A;  3MST A;  2NWJ A;  4NF6 B;  4P8B A;  4GRK A;  4F2Q A;  5I56 B;  1NV2 A;  1MQD A;  4XKP A;  1M5D A;  3QXM A;  3ROJ A;  2R8T A;  4RPO A;  3RTF B;  2A5S A;  1A8F A;  2Z8D A;  4IO4 A;  2XA5 A;  1NUX A;  4ZDM A;  5AE4 A;  2RC8 A;  4R75 A;  4MEV A;  3FJ7 A;  4P3L A;  3S9L C;  4EQ9 A;  1LST A;  3FVG A;  2O51 A;  3G3H A;  4AQ4 A;  3KBR A;  4KCC A;  3UK4 A;  3MW0 A;  3M3F A;  1YZ0 A;  3GLB A;  4H65 A;  3FXQ A;  3QAX A;  5LTC A;  1ZBM A;  4N4U A;  4PC9 A;  5TU0 A;  3T9H B;  4AB6 A;  5I3S A;  4DIG A;  3PD9 A;  2OK2 A;  4POW A;  2VPN A;  5AA2 D;  3FVO A;  3FV2 A;  1SI0 A;  3NOH A;  1FTO A;  4JDF A;  1IMC A;  4I3E A;  3KSX A;  5AA3 A;  2XXV A;  2ZYN A;  3THI A;  1IXH A;  4QSE A;  1FQA A;  1D3K A;  2P3V A;  1NV0 A;  4GBW A;  4KXP A;  1AL3 A;  3IFC A;  5T3J A;  3A3C A;  4ZEI A;  1PEB A;  3ILT B;  3VXC A;  2I4C A;  3H3G A;  4IY6 A;  5IZ1 A;  3T93 B;  4F3P A;  3FVK A;  3N26 A;  4PTK A;  4PET A;  4N13 A;  1FTM A;  1K9Z A;  4P11 A;  3EHU A;  3S4U A;  5I7I A;  2QS4 A;  2I0C A;  4ND9 A;  4OVS A;  1OVB A;  4PFI A;  3FV1 A;  4KCD A;  4N8G A;  3SZP A;  5H8H A;  4YU0 A;  1QUL A;  4E0X A;  2RC7 A;  4TQU Q;  5F1Q A;  3IL1 B;  3W15 C;  2P2A A;  3E78 A;  1HSL A;  4GWX A;  1MXY A;  5EYG A;  2F35 A;  2H99 A;  4MAG A;  4O3C A;  4F3B A;  3FXB A;  3G3K A;  2XXP A;  2YPN A;  1ZJL A;  4FJP A;  4P47 A;  1PDA A;  3IOT A;  4GWY A;  1MXW A;  4XF5 A;  1YYZ A;  3SEY A;  3EN3 A;  4H1X A;  4ZZA A;  2P3N A;  2I3W A;  1B0L A;  2QJE A;  3UP9 A;  1AMF A;  4THI A;  1IUD A;  1UIV A;  4XEQ A;  4BDR A;  3BIH A;  1BP5 A;  5H8Q B;  5KDT B;  4JVC A;  4ZE8 A;  3K1M A;  3OMB A;  1FJ6 A;  4I8C A;  1ANF A;  4P56 A;  3FJM A;  3BIG A;  3LSF B;  3M3K A;  3TTK A;  5H8S A;  3FIR A;  5DVJ A;  2RIN A;  3VV5 A;  2GQ1 A;  4F1Y A;  1FJ9 A;  4RA1 A;  3PTY A;  1B7U A;  4JVI A;  1MQG A;  4OMB A;  2RCA A;  4PAK A;  3OO8 A;  1QUI A;  4XXU A;  4GXS B;  2DWA A;  2WYP A;  4DCX A;  4OTE A;  4Z7E A;  1B32 A;  1EYJ A;  3CFZ A;  3PUX E;  4NED A;  2IA4 A;  4MX6 A;  3IFA A;  1NV4 A;  2I6E A;  1RDZ A;  4R72 A;  3C9H A;  2XWK A;  4H5F A;  2FNC A;  4EXL A;  2R71 A;  1QUK A;  2XX9 A;  5L8D A;  5I84 A;  2V4C A;  2OBG A;  1IQ7 A;  3K6V A;  3FZV A;  4PFB A;  4QRZ A;  5I2N B;  1LGB C;  3MUQ A;  3OEK A;  4R6K A;  1DPP A;  1IEJ A;  1MY4 A;  4OHN A;  4G77 A;  4F18 A;  4P9K A;  2RKM A;  1MS7 A;  2Q2C A;  4NF4 B;  2F7B A;  2O1M A;  1H45 A;  3E4R A;  4I9D A;  2Q88 A;  1XC1 A;  1EYI A;  1IXI A;  1FTJ A;  3P7I A;  4ELR A;  4X1B A;  4R9G A;  2DQV A;  3KC1 A;  4NMY A;  2JJK A;  3M3L A;  2HHM A;  1TXF A;  4FEB A;  4R9F A;  3C33 A;  5CMM A;  1LBW A;  1Q9D A;  1SVX B;  4KR5 A;  4HW8 A;  2Y7P A;  2O69 A;  3OO6 A;  1M5C A;  3FAS A;  3I3V A;  1XS5 A;  2I48 A;  3E9X A;  4ECF A;  4MCO A;  3MP6 A;  1XI6 A;  3PUY E;  2O7U A;  3MBP A;  1FPK A;  1B9J A;  2QS1 A;  2G93 A;  1LLS A;  2DWH A;  3O6G A;  4OQO A;  3MYU A;  1I6A A;  2QFL A;  3HN0 A;  2NXO A;  4MIJ A;  1NV7 A;  2ESN A;  4QFP A;  5ELV A;  5DTB A;  2R6G E;  1LFI A;  2YLN A;  2DP8 A;  3QUJ A;  2ZYK A;  3OXN A;  2UYE A;  4DI4 B;  2ZZX A;  1FPJ A;  4MJO A;  1HSJ A;  3S2V A;  4POX A;  1N3X A;  4N6D A;  4PQJ A;  4O7I A;  2DWJ A;  5ESY A;  3DP8 A;  3GZG A;  1L5T A;  2XX7 A;  5KCJ B;  4BDL A;  4HE1 A;  3CR9 A;  4LQ2 A;  4U4X A;  5H8H B;  1OLA A;  5CM6 A;  3E3K A;  4X04 A;  1B4Z A;  3A29 A;  1S50 A;  3MVZ A;  5AA4 A;  4NX1 A;  5JK4 A;  4OET A;  4OEU A;  2THI A;  2FYI A;  2WYK A;  3QUF A;  5KDT A;  1IIT A;  1R1N A;  2RCB A;  3N6U A;  4IY5 A;  1JEU A;  4G8M A;  1DK4 A;  4QFN A;  2OWS A;  1NL5 A;  4OVJ A;  5IZZ A;  3IO4 A;  4LZ8 A;  4FBP A;  4RXL A;  4IO5 A;  2IEE A;  2QL3 A;  1INP A;  4AS5 A;  3K2D A;  1S7Y A;  1I69 A;  3U72 A;  3H6W A;  1SQY A;  1EH3 A;  4OFL A;  2XXI A;  3E13 X;  1D9Y A;  4N15 A;  2QPQ A;  1NV5 A;  2XWI A;  1Y1Z A;  1XVY A;  3B8B A;  4JSD A;  3S9E A;  5FHM A;  1JW4 A;  2CEY A;  1TFA A;  1YAE A;  3RUM A;  4HS7 A;  4N8Y A;  2OX3 A;  2HAU A;  2KQZ A;  5TP9 B;  4R74 A;  5H8F B;  1CE2 A;  1MQJ A;  4TLM B;  1RDX A;  3H6T A;  5BUU A;  1UTB B;  2UVG A;  3IAZ A;  3SEU A;  2VOZ A;  5ICQ A;  2XWV A;  2PT1 A;  2REJ A;  4PFR A;  2PT2 A;  3C34 A;  3WAF A;  4H67 A;  5EQ9 A;  4Q30 B;  2DE3 A;  3K1P A;  4YKI A;  3IX1 A;  2GRV A;  2HAV A;  5FHN A;  3FVN A;  4YB6 A;  3RYD A;  2F5X A;  3JV9 A;  3RY3 A;  3VVE A;  1OMP A;  1P1W A;  3KN3 A;  1MPD A;  5KCJ A;  3VLW A;  4O3A A;  1NNT A;  4OXV A;  5EHM A;  3OSR A;  3MZ9 A;  2XXX A;  1URG A;  3HPI A;  3PV0 E;  1YTV A;  2OCU A;  5EQ8 A;  2XD2 A;  2XXR A;  4GX3 A;  3FXR A;  2DVZ A;  1H76 A;  5L9M A;  1DSN A;  4H46 A;  3E79 A;  3KG2 A;  4PFY A;  4LAT A;  3ZKL A;  4KHZ E;  4GX6 A;  3IO6 A;  3PU5 A;  4IB2 A;  2QSX A;  2HXR A;  1YCJ A;  5DVI A;  5AA2 A;  3O6H A;  3TQW A;  1B1H A;  3V89 B;  4FAT A;  3KFM A;  3CG3 A;  3HHF A;  1FTA A;  3DM0 A;  4G4P A;  5ET8 A;  1NNF A;  1MM6 A;  4OWD A;  4QF9 A;  1B7H A;  1JET A;  3TCF A;  2F6G A;  2KLF A;  4OZ9 A;  3S9N C;  1QVS A;  2UVI A;  3K6U A;  2CEX A;  1OQH A;  1B5H A;  2F36 A;  5I58 B;  1FCK A;  4X8R A;  1FTL A;  3HST A;  1B40 A;  2O84 X;  2F7A A;  2P1S A;  3EKI A;  5TP9 A;  3OO7 A;  3IOV A;  5H8F A;  1ZIU A;  3D1R A;  2CMO A;  3Q29 A;  2GH9 A;  3Q28 A;  1D4N A;  1JEV A;  2AIX A;  4P0I A;  4YMA A;  1DTZ A;  2PVU A;  5EHS A;  3T9V A;  1Y9U A;  2HZL A;  1DPE A;  2XXQ A;  1EZO A;  2OZZ A;  3Q25 A;  1PB9 A;  4F3S A;  4LON B;  5HBC A;  3GXA A;  2ZNU A;  3BBR A;  4H8J A;  4QBA A;  4F39 A;  1B3F A;  2YJP A;  2QRY A;  2QVR A;  3EF7 A;  2DYX A;  4FE8 A;  1B2H A;  2V84 A;  1WDN A;  1URS A;  4YAH X;  5IZ3 A;  1ATG A;  1QJM A;  3TFL A;  1JVX A;  4ELQ A;  4YKJ A;  2BJI A;  4ZEC A;  2DOJ A;  1B1X A;  5L9O A;  4OA4 A;  4KPT A;  1LEV A;  3R26 A;  4ONY A;  1SDX A;  4TLL B;  2QMW A;  4NE4 A;  5F24 A;  1JVY A;  3SKP A;  3C31 A;  4PF6 A;  3TTR A;  4OFO A;  5DT6 A;  3V5A A;  1AH5 A;  1B5J A;  4EQB A;  2HEU A;  1MPC A;  2CZH A;  3FBP A;  5CMC A;  5LDZ A;  2PCR A;  4GWZ A;  4ZE9 A;  3U1O A;  4YKK A;  1VFD A;  3RT6 B;  2VT5 A;  3LSW A;  3F11 A;  1US5 A;  1FPI A;  5CBR A;  1SW4 A;  4IR8 A;  4Q8R A;  2XWO A;  2GHA A;  3OEN A;  5BWJ A;  5F7V A;  4DZ1 A;  4U21 A;  1N84 A;  2O68 A;  3N94 A;  4X48 A;  3ZSF A;  4GWW A;  1AOV A;  2ONK E;  3ODB A;  3RLF E;  1D9V A;  3K00 A;  3KSJ A;  5AA1 A;  3ONM A;  1FRP A;  2V93 A;  4R2B A;  1MRP A;  1GV8 A;  4NN3 A;  3GBB A;  4GVO A;  1K9Y A;  4YKP A;  3O6I A;  3JZJ A;  5IAI A;  1IIW A;  3U92 A;  3SET A;  3G3F A;  3KOT A;  4N07 A;  2O7I A;  1NV3 A;  5H8N B;  2Z8E A;  3RGY A;  4OER A;  3EQ1 A;  3RT8 A;  1B46 A;  3TKD A;  3HFU A;  3UOR A;  1Q35 A;  1Y3Q A;  4OES A;  2Q8M A;  4O3B A;  5DEX A;  3V8X B;  5I59 A;  1TT1 A;  1SPI A;  1MDP 1;  4BDO A;  2RF1 A;  2UVH A;  2D3I A;  1B05 A;  3RQT A;  3Q27 A;  2ZNS A;  3MC2 A;  1H44 A;  1D9Q A;  4QHQ A;  1RDY A;  1KZ8 A;  3TAJ A;  1LAG E;  4F2O A;  3FGS A;  5CRY A;  3ZS6 A;  2FIE A;  4XKN A;  4YB5 A;  3UN6 A;  4DXU A;  4PCD A;  3ECR A;  3TCH A;  4QXD A;  2H5Y A;  3UA8 A;  3TDJ A;  5EQ7 A;  4GQO A;  3O97 A;  2ZZV A;  2ZMB A;  4RK9 A;  4LQ5 A;  4PFU A;  3ZKK A;  3O29 A;  2Q74 A;  5CMB A;  4MMP A;  4NF5 B;  1N7X A;  1MQI A;  3C35 A;  4G8N A;  3LUZ A;  3TEP A;  3TUS A;  3BKI B;  1XT8 A;  1Y3P A;  3D4C A;  3MJN A;  5AA2 B;  4KD5 A;  1XOC A;  4GL8 A;  1WOD A;  3IJO B;  3IK6 B;  3T1B A;  2ONS A;  4NF0 A;  2V3T A;  4F1V A;  2Q89 A;  2I58 A;  4C1U A;  5ET5 A;  1USY E;  3TPA A;  3H6V A;  1ZLQ A;  1HSE A;  3OOA A;  1S9T A;  3UIF A;  2AL4 A;  1FPL A;  1FPD A;  4P0G A;  4GFR A;  3TOD A;  1BIY A;  2RC9 A;  4DLD A;  4X9T A;  1NH8 A;  3L6G A;  4IO7 A;  4LP2 B;  2QS3 A;  1B3L A;  1AIV A;  4K3F A;  2VD2 A;  5ET7 A;  1I6Q A;  4ZZE A;  3PMV A;  4IGT A;  3LSX A;  4KI0 E;  1Y3N A;  4PFW A;  1EZ9 A;  2QMX A;  4JWX A;  1N04 A;  4KYE A;  1NMU A;  4H8I A;  4Z0I A;  4H0W A;  3K02 A;  5IM2 A;  4PGP A;  3MP1 A;  4LUB A;  2FVZ A;  4FIM A;  3VDF A;  4EQ7 A;  4RNS A;  1FPE A;  3VVF A;  2LAO A;  4FOR A;  3CSG A;  1SW1 A;  5K2Y A;  3LUY A;  2Z8F A;  5CI5 A;  3EHS A; 
#chains in the Genus database with same CATH homology
 4O3A A;  1LBB A;  1LFH A;  2I4C A;  3H3G A;  1JW5 A;  1NNT A;  1FQF A;  1TFD A;  1PBP A;  4IY6 A;  4OEN A;  4OXV A;  2ZNT A;  5EHM A;  4KFQ A;  3T93 B;  3OSR A;  3MZ9 A;  3FAT A;  5TPA B;  4F3P A;  5JTY B;  1UTH B;  2XXX A;  1URG A;  1PC3 A;  1MY0 A;  3FVK A;  3HPI A;  3O28 A;  3PV0 E;  1YTV A;  5H8Q A;  1POY 1;  2OCU A;  2XD2 A;  2GHB A;  2XXR A;  4YMB A;  3N26 A;  4DXB A;  3C32 A;  2G29 A;  3SER A;  4PET A;  2W7Y A;  4N13 A;  3PUV E;  1FQC A;  1FTM A;  1LB9 A;  2DVZ A;  1H76 A;  2O1L A;  3FXR A;  3IR1 A;  5L9M A;  4P11 A;  3EHU A;  1ELJ A;  5TPA A;  3S4U A;  5I2K B;  1DSN A;  3ILT B;  5K2X A;  3VXC A;  1M5F A;  3DEL B;  3OEL A;  3B6Q A;  4QFO A;  4GD5 A;  2QS4 A;  2I0C A;  4LZ7 A;  3K1N A;  4NTL A;  1B0H A;  1P1N A;  3KG2 A;  4ND9 A;  2AL5 A;  4U4S A;  3TTM A;  4UAC A;  4PFY A;  2F6P A;  1OVB A;  1PBQ A;  4GIZ A;  3C36 A;  2XXT A;  2I49 A;  2Q8J A;  3USD A;  4ESW A;  3FV1 A;  4LAT A;  3PPN A;  4KCD A;  1UTB A;  5I57 A;  5H8H A;  3I5O A;  3ZKL A;  1LAH E;  3N5L A;  4YU0 A;  4KHZ E;  4UA8 A;  3IO6 A;  1QUL A;  3MP8 A;  3VXB A;  3L6H A;  3PU5 A;  3HCQ A;  3TYH A;  5I59 A;  3RN8 A;  4E0X A;  2RC7 A;  2QSX A;  1KWH A;  2HFB A;  1MM7 A;  4G2Z A;  4IB2 A;  4TQU Q;  1YCJ A;  5DVI A;  5EYF A;  5F1Q A;  5AA2 A;  3TCG A;  3DP6 A;  1URD A;  3IL1 B;  3IOU A;  3R6U A;  4IO6 A;  3O6H A;  3TQW A;  3W15 C;  2P2A A;  2XXU A;  1B1H A;  1HSL A;  1N7W A;  4HCW A;  3V89 B;  1N76 A;  1MXY A;  4FAT A;  3KFM A;  3CG3 A;  3HHF A;  3IB1 A;  3O2A A;  2F35 A;  2H99 A;  4O3C A;  4F3B A;  4WXJ A;  3G3K A;  2XXP A;  2YPN A;  1ZJL A;  2R9J A;  3DM0 A;  3PPP A;  4G4P A;  2AYS A;  1NNF A;  4FJP A;  3TPA A;  1MM6 A;  4OWD A;  1FW0 A;  4DXU A;  4QF9 A;  1MXZ A;  3CG1 A;  3MZB A;  1B7H A;  1US4 A;  1PDA A;  2F8D A;  4U23 A;  3IOT A;  2OLB A;  1JET A;  3A09 A;  1MXW A;  2XXH A;  3TCF A;  2UXA A;  4BDN A;  2NOO A;  2F6G A;  3FUZ A;  4EUO A;  4N6P A;  2KLF A;  4OZ9 A;  3SEY A;  3S9N C;  3EN3 A;  3JYR A;  1JW1 A;  4JWO A;  1LFG A;  4TOZ A;  2CZL A;  1QVS A;  2UVI A;  4H1X A;  1P99 A;  3K6U A;  1B7Z A;  4ZZA A;  1OQH A;  5JEI A;  2WKY A;  1B5H A;  3SDF A;  2F36 A;  2I3W A;  5I58 B;  1VSO A;  5ICT A;  3UGW A;  1FQB A;  2M8C A;  1FCK A;  1O7T A;  1B0L A;  3LR1 A;  2QJE A;  4JXI A;  3UP9 A;  3EHT A;  1AMF A;  4THI A;  1IUD A;  1FTL A;  3H03 A;  2H98 A;  1GR2 A;  3HST A;  3K6W A;  1B40 A;  1UIV A;  3C4M A;  1VR5 A;  2GFE A;  4NF6 A;  3RTW B;  3SES A;  1MQH A;  2O84 X;  2F7A A;  1BKA A;  2P1S A;  2VHA A;  3M8U A;  4RPO A;  5FHO A;  4BDR A;  3K6X A;  5TP9 A;  2B3F A;  3OO7 A;  3IOV A;  2Z23 A;  2DXR A;  5H8F A;  1ZIU A;  2CMO A;  3Q29 A;  1BP5 A;  2F78 A;  2GH9 A;  3Q28 A;  3WAE A;  5A5X A;  1N3W A;  5H8Q B;  1D4N A;  3GBA A;  1JEV A;  4DXC A;  5KDT B;  2AIX A;  4YB7 A;  5HM4 B;  4H6D A;  4P0I A;  5KZT A;  4ZE8 A;  4YMA A;  3K1M A;  3OMB A;  4JBZ A;  5I2N A;  1DTZ A;  2PVU A;  1Y4T A;  5EHS A;  3T9V A;  1MDQ A;  5DVF A;  1Y9U A;  4I8C A;  4ZEB A;  2HZL A;  2BJJ X;  3KOS A;  1ANF A;  3FJM A;  1DPE A;  3LSF B;  1SW5 A;  3M3K A;  2XXQ A;  4BDM A;  4DE8 A;  4PE5 B;  3TTK A;  1SD3 A;  4F1U A;  1EZO A;  3HHG A;  3MPK A;  1GGG A;  2HXW A;  2OZZ A;  2VP1 A;  2ZYO A;  3FIR A;  1PB9 A;  3Q25 A;  5DVJ A;  5H8S A;  2RIN A;  1QUJ A;  4F3S A;  2HQ0 A;  1LAX A;  1TWY A;  2H9B A;  4LON B;  4OFJ A;  3KN7 A;  5HBC A;  3GXA A;  4G68 C;  3H4Z A;  3VV5 A;  2A5T A;  1A40 A;  2ZNU A;  1OVT A;  3BBR A;  3CIJ A;  3EPE A;  3KZG A;  4H8J A;  4ZEK A;  4HTG A;  4F1Y A;  4RA1 A;  3U8Q A;  1MY2 A;  5I56 A;  1R9L A;  4F39 A;  5B7D A;  5B70 A;  1B7U A;  1B6H A;  1MQG A;  3MVX A;  1B3F A;  2ANJ A;  1MY1 A;  2QRY A;  2YJP A;  4OMB A;  2RCA A;  3EF7 A;  4BLA A;  4LVQ A;  3KJT A;  2UYF A;  3OO8 A;  3R7X A;  2DYX A;  4FE8 A;  4ESX A;  3G7W A;  4QSC A;  1B2H A;  2V84 A;  1QKA A;  1VE4 A;  1QUI A;  1O63 A;  1WDN A;  1URS A;  3LC8 A;  4G68 A;  4XXU A;  4YAH X;  4QFL A;  4AB5 A;  1ATG A;  4GXS B;  3TTN A;  4DDD A;  2B3B A;  4RJZ A;  3LBS A;  1QJM A;  1N0T A;  2DWA A;  1J1N A;  4U1O A;  3TQL A;  5ISU A;  3TFL A;  3B7D A;  1JVX A;  3CI8 A;  2D21 A;  4OTE A;  4DCX A;  1B32 A;  4Z7E A;  5JTY A;  4ELQ A;  4YKJ A;  3TEL A;  3HO7 A;  4ZED A;  4MBP A;  3BFU A;  4ZEC A;  2DOJ A;  1B1X A;  3CFZ A;  1GTK A;  2Y7I A;  3KN8 A;  3PUX E;  4NED A;  5L9O A;  2IA4 A;  2XX8 A;  3U93 A;  4BDQ A;  1P1U A;  2Q9T A;  2I6E A;  1JQF A;  3T66 A;  4KPT A;  4R72 A;  1CB6 A;  2OJT A;  3C9H A;  3R26 A;  5CI5 A;  3AXF A;  3B6W A;  4H5F A;  4ONY A;  2FNC A;  1SDX A;  4EXL A;  4TLL B;  2QMW A;  2R71 A;  1QUK A;  3I6V A;  2XX9 A;  5L8D A;  4NE4 A;  1BTJ A;  2Q2A A;  5I84 A;  1Y4C A;  1JVY A;  2E0S A;  4X1D A;  3C31 A;  3SKP A;  3TTR A;  3CSB A;  2OBG A;  1IQ7 A;  4OFO A;  4OEV A;  5DT6 A;  4JWY A;  4KQP A;  3K6V A;  3FZV A;  1AH5 A;  1B5J A;  1IZ1 A;  4QRZ A;  4EQB A;  1SI1 A;  5I2N B;  4IGR A;  4XTC Q;  1LGB C;  1QW0 A;  4IO2 A;  3MUQ A;  4EF2 A;  2HEU A;  1T0K A;  3OEK A;  4GL0 A;  1MPC A;  4R6K A;  5CMC A;  1DPP A;  1IEJ A;  1MY4 A;  3IB2 A;  4OHN A;  2FA7 A;  2DVC A;  5DEX B;  4C1T A;  4G77 A;  4F18 A;  4EF1 A;  2REG A;  2H25 A;  1LB8 A;  2PMS A;  4GWO A;  4KYD A;  3U1O A;  4YKK A;  4ZE9 A;  5LOM A;  1VFD A;  4GXA A;  4YIC A;  2RKM A;  3FXU A;  2B65 A;  3FJG A;  3LSW A;  1M5B A;  3H6U A;  4JB7 A;  3F11 A;  1DTG A;  3CFX A;  4DCY A;  1A54 A;  1MS7 A;  1US5 A;  3OSQ A;  3S9M C;  3N6T A;  5CBR A;  1SW4 A;  4XKR A;  4Q8R A;  1UIU A;  2GHA A;  2NVU B;  3OEN A;  5BWJ A;  5F7V A;  1H43 A;  2Q2C A;  3PPR A;  4U21 A;  4NF4 B;  4DZ1 A;  1N84 A;  2I3V A;  2O68 A;  3N94 A;  3A3U A;  2XXY A;  2F7B A;  4U1Z A;  2O1M A;  1H45 A;  4FAJ A;  1QKB A;  2XXW A;  4Q0C A;  4X48 A;  3CVG A;  3E4R A;  4I9D A;  4WKM A;  4MLQ A;  2PBW A;  3ZSF A;  3RTF B;  4EXK A;  2Q88 A;  1AOV A;  1XC1 A;  4NWC A;  4ELO A;  4G8H A;  1MG1 A;  1P1O A;  3K0V A;  1H3D A;  2ONK E;  4IO3 A;  1NFT A;  3ODB A;  3RLF E;  3PUW E;  3BFT A;  1IXI A;  1D9V A;  1FTJ A;  3K00 A;  3KSJ A;  3P7I A;  5AA1 A;  4ELR A;  5CMK A;  4U22 A;  4HCY A;  4R6Y A;  4X1B A;  4R9G A;  2DQV A;  3ONM A;  4NMY A;  4RYA A;  2V93 A;  4QSD A;  2X26 A;  4R2B A;  1R6Z A;  1MRP A;  1LCT A;  1GV8 A;  3VE1 B;  2Y7R A;  3M3L A;  1TXF A;  4FEB A;  4R9F A;  1II5 A;  5FTH A;  1FQD A;  3GBB A;  1Z7M E;  5AE4 A;  3C33 A;  4GVO A;  4PP0 A;  5CMM A;  1GVC A;  4YKP A;  3O6I A;  3G3J A;  1SVX B;  1BLF A;  3DP4 A;  4GOT A;  4I62 A;  5ITO A;  4KR5 A;  3JZJ A;  1F9B A;  1A55 A;  2X7Q A;  1MXX A;  4HW8 A;  5IAI A;  5L9S A;  1MXU A;  2ZXT A;  1IIW A;  3U92 A;  3SET A;  3G3F A;  2DWI A;  2NUV A;  2Y7P A;  3T9X B;  4H5G A;  2O69 A;  3IB0 A;  1MPB A;  4R6H A;  3VFJ A;  4F3G A;  2PYY A;  3OO6 A;  3KOT A;  3Q26 A;  4N07 A;  2DS9 A;  5J1D A;  2V25 A;  1M5C A;  2O7I A;  5HPQ A;  3FAS A;  3I3V A;  1XS5 A;  1M5E A;  2I48 A;  3E9X A;  3KEI A;  4ECF A;  5H8N B;  2Z8E A;  4XKQ A;  4M4G A;  2P0S A;  3RGY A;  1NKX A;  3QYT A;  1B3E A;  3MP6 A;  4OER A;  1PB8 A;  5I59 B;  3EQ1 A;  3PUY E;  4MFI A;  2O7U A;  3RT8 A;  3MZ1 A;  3MBP A;  1B46 A;  3TKD A;  1B9J A;  2QS1 A;  3T96 B;  2G93 A;  3MPL A;  3VLV A;  3LSL A;  4JSO A;  3UOR A;  1LLS A;  1B4H A;  3VLU A;  2PX1 A;  5CBS A;  2DE4 A;  1MH3 A;  3IJX B;  2DWH A;  5I2K A;  5KCJ A;  1Q35 A;  1MH4 A;  3O6G A;  1Y3Q A;  3O66 A;  4OQO A;  4RY1 A;  5M2V A;  1MY3 A;  4RPN A;  1Y1M A;  4OES A;  4NF4 A;  4EDP A;  4O3B A;  5DEX A;  1JNF A;  1I6A A;  2H4I A;  1NNP A;  1FQE A;  4Q5T A;  1RKM A;  4M1V A;  4YZZ A;  3V8X B;  1LAF E;  1TT1 A;  3K4U A;  5CC2 A;  3HN0 A;  5AA4 B;  2NXO A;  1MDP 1;  3K01 A;  2Z22 A;  4BDO A;  5I57 B;  1B58 A;  4G68 B;  3RPW A;  2Y7W A;  1P1Q A;  1I6B A;  2ESN A;  2HCA A;  3D4G A;  4F22 A;  2RF1 A;  2UVH A;  2D3I A;  4QFP A;  5ELV A;  5DTB A;  4FED A;  2VD3 A;  2DE2 A;  2F34 A;  1B05 A;  1NH7 A;  2OWT A;  2R6G E;  1ZMG A;  1LFI A;  3G3I A;  4E0W A;  1SW2 A;  3G3G A;  3RQT A;  3Q27 A;  5ITP A;  2YLN A;  2ZNS A;  2DP8 A;  3MC2 A;  3QUJ A;  1XHY A;  1DOT A;  1H44 A;  2ZYK A;  3SEW A;  3OXN A;  1OLC A;  2A5T B;  2UYE A;  4WED A;  4QHQ A;  3MWB A;  3TAJ A;  1HSJ A;  1LAG E;  4RK9 A;  3S2V A;  3FGS A;  4POX A;  4F2O A;  1N3X A;  1R9Q A;  4PQJ A;  2DWJ A;  3T9U A;  1PB7 A;  5CRY A;  3CFL A;  3ZS6 A;  4F19 A;  4XKN A;  3DP8 A;  2DXY A;  3GZG A;  3PGF A;  4YB5 A;  4KYS A;  3UN6 A;  1POT A;  1EU8 A;  1L5T A;  3TMG A;  1YPN A;  2I4B A;  3ECR A;  2DSF A;  4R73 A;  2XX7 A;  3TCH A;  3MVY A;  2H5Y A;  3PUZ E;  2F7C A;  3UA8 A;  4BDL A;  5KCJ B;  3TDJ A;  1B51 A;  3CR9 A;  4LQ2 A;  4U4X A;  2D5W A;  4GQO A;  1LBC A;  2I0B A;  3O97 A;  3OEM A;  5H8H B;  1SYH A;  2ABH A;  2V3Q A;  1OLA A;  2ZMB A;  1MXV A;  1XVX A;  3FD3 A;  4LQ5 A;  4MF3 A;  4PFT A;  3IOR A;  3E3K A;  3O29 A;  4PFU A;  3ZKK A;  5CM6 A;  5CMB A;  3O9P A;  4NF5 B;  1B4Z A;  2ONR A;  1S50 A;  1IXC A;  3MVZ A;  1N7X A;  4MLV A;  5AA4 A;  3SEX A;  3SEV A;  4GF8 A;  1MQI A;  3C35 A;  3HV1 A;  3W9V A;  1VFE A;  4G8N A;  5JK4 A;  2UVJ A;  4OET A;  4WEP A;  4OEU A;  4R2F A;  3TEP A;  3TUS A;  3BKI B;  1Q1K A;  5A5X B;  2THI A;  3IOW A;  1XT8 A;  2FYI A;  3QUF A;  5KDT A;  2ZYM A;  1IIT A;  1Y3P A;  1R1N A;  3D4C A;  4I1D A;  3MJN A;  4NWD A;  4C0R A;  5AA2 B;  2RCB A;  4KD5 A;  1XOC A;  4NF8 A;  3N6U A;  4IY5 A;  1JEU A;  4G8M A;  2XHD A;  4MH5 A;  3RNN A;  3W9W A;  4LZ5 A;  1Z7N E;  3TZA A;  3U94 A;  4GL8 A;  3TTL A;  1B52 A;  1WOD A;  1A99 A;  3IJO B;  4XIG Q;  3IK6 B;  4QFN A;  2OWS A;  1RYX A;  1NL5 A;  2ONS A;  3MQ9 A;  2ALU A;  3OO9 A;  4OVJ A;  3H06 B;  2X7P A;  3IO4 A;  4LZ8 A;  4RXL A;  4LA9 A;  1RYO A;  2NWJ A;  1SBP A;  4IO5 A;  2XD3 A;  2V3T A;  2IEE A;  2VGQ A;  2QL3 A;  4NF6 B;  4F29 A;  4F1V A;  1USY H;  4GRK A;  4F2Q A;  5I56 B;  3K2D A;  1MQD A;  2Y84 A;  3H7M A;  2Q89 A;  3B6T A;  2I58 A;  3OD7 A;  4XKP A;  4C1U A;  1S7Y A;  1M5D A;  1B3G A;  1I69 A;  3QXM A;  5I58 A;  1USY E;  3DLN A;  3H6V A;  1ZLQ A;  4L17 A;  3PPO A;  2A5S A;  3H6W A;  1A8F A;  1SQY A;  1HSE A;  2Z8D A;  1S9T A;  3KGC A;  3OOA A;  3UIF A;  4IO4 A;  4ISU A;  1EH3 A;  4NF5 A;  4OFL A;  4ZDM A;  2AL4 A;  2RC8 A;  2XXI A;  1A7L A;  3E13 X;  2Y7K A;  3FJ7 A;  4R75 A;  4EQ9 A;  1LST A;  3S9L C;  3FVG A;  1D9Y A;  4P0G A;  4GFR A;  3TOD A;  1BIY A;  2O51 A;  2E1S A;  2RC9 A;  4X9T A;  4DLD A;  1NH8 A;  3G3H A;  4AQ4 A;  5IKB A;  1EZP A;  3KBR A;  1SYI A;  3L6G A;  4KCC A;  5H8N A;  3UK4 A;  2QPQ A;  3V5A A;  3MW0 A;  1ZU0 A;  3M3F A;  4IO7 A;  2QS3 A;  4LP2 B;  4QFK A;  4U2R A;  3GLB A;  1DMB A;  4H65 A;  1Y1Z A;  2HZK A;  1XVY A;  1B3L A;  3FXQ A;  3QAX A;  4JSD A;  1Y20 A;  5FHM A;  3S9E A;  1JW4 A;  1ZBM A;  1B3H A;  3PPQ A;  4K3F A;  1TFA A;  1YAE A;  1AIV A;  3RUM A;  4HS7 A;  1O64 A;  2QS2 A;  2HAU A;  2VD2 A;  5TU0 A;  4OYV A;  4ZS9 A;  3T9H B;  5TP9 B;  4R74 A;  1I6Q A;  1ZKB A;  5H8F B;  3T22 A;  1CE2 A;  1UTH A;  1MQJ A;  4AB6 A;  1FTK A;  3PMV A;  4IGT A;  4ZZE A;  1ZTY A;  4TLM B;  3VVD A;  3PMW A;  3PD9 A;  2OK2 A;  4DIG A;  3QSL A;  4FEC A;  4POW A;  3LSX A;  4KI0 E;  1A8E A;  5AA2 D;  1Y3N A;  3FVO A;  3FV2 A;  3H6T A;  4PFW A;  5BUU A;  1SI0 A;  5FTI A;  1EZ9 A;  4RK2 A;  4F31 B;  2QMX A;  4JWX A;  1FTO A;  1N04 A;  1UTB B;  4JDF A;  2UVG A;  4KYE A;  1NMU A;  3IAZ A;  3MVW A;  1OQG A;  3SEU A;  1UQW A;  4H8I A;  2VOZ A;  3ILU B;  4Z0I A;  2F97 A;  5ICQ A;  3KSX A;  4H0W A;  5AA3 A;  3K02 A;  2XXV A;  1NNK A;  2ZYN A;  2PT1 A;  2REJ A;  3RT6 B;  2PT2 A;  3PD8 A;  3C34 A;  3THI A;  4NF8 B;  1IXH A;  2O6A A;  1FQA A;  3MP1 A;  1OIB A;  4LUB A;  4QSE A;  3WAF A;  3V83 A;  1D3K A;  1WVJ A;  4H67 A;  3MAM A;  3QIM A;  3QK6 A;  4ELP A;  1B5I A;  3PMX A;  5DYH A;  4FIM A;  4Q30 B;  3VDF A;  2V3U A;  4GLI A;  4EQ7 A;  3KJ7 A;  2DE3 A;  3CRB A;  3K1P A;  4RNS A;  1IXG A;  3IX1 A;  4YKI A;  2GRV A;  1AL3 A;  2HAV A;  3U72 A;  3VVF A;  2LAO A;  4FOR A;  5FHN A;  1LCF A;  3CSG A;  1SW1 A;  3FVN A;  4YB6 A;  3A3C A;  5K2Y A;  2F5X A;  3JV9 A;  4ZEI A;  1PEB A;  3RY3 A;  3LUY A;  3VVE A;  1OMP A;  1P1W A;  2Z8F A;  1MPD A;  3KN3 A;  4ZEF A;  3EHS A;  3VLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...