1YAEA

Structure of the kainate receptor subunit glur6 agonist binding domain complexed with domoic acid
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
289
structure length
261
Chain Sequence
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Structure of the kainate receptor subunit GluR6 agonist-binding domain complexed with domoic acid.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 73
structure length 261
sequence length 289
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1yaeA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1yaeA02
4NF8A 3KSJA 1MXZA 4FAJA 1Z7ME 2D5WA 2O84X 1MY0A 3TELA 3M3LA 1QUIA 1H3DA 1Y4CA 3K4UA 3K00A 4I8CA 3H03A 3G3FA 1LBCA 1SI0A 4IO7A 1SD3A 3SETA 1PC3A 1DPPA 2P2AA 2AYSA 5A5XA 4F31B 2Q9TA 4MBPA 3S9MC 3HV1A 4OENA 3EN3A 1AMFA 3H3GA 3OSRA 3OO6A 4PFYA 3HO7A 2OJTA 1B3LA 4LP2B 4R73A 3FVKA 3IB2A 4OHNA 3E4RA 4NE4A 4EUOA 4L17A 4DCYA 4F2OA 5FHMA 5ICTA 4FORA 1S7YA 5F1QA 1H43A 1B46A 4MLQA 1LFHA 3T22A 2UVHA 4G8HA 3VDFA 2V93A 4KYDA 1SYIA 4BDLA 4PE5B 1Y1MA 3MP6A 2DYXA 1XC1A 1B32A 4OVJA 4G8MA 3K6WA 4ZEDA 2F7CA 3Q26A 3FIRA 1IEJA 1GGGA 1I69A 1B5JA 4FIMA 1TFAA 5I2NB 2QMWA 5H8NA 4GVOA 4QFPA 5I2NA 1OVBA 1WDNA 2Y7RA 4BDRA 3IAZA 4F1YA 1RKMA 1VFDA 4QF9A 1JW1A 4GWOA 4LVQA 2I58A 1EZ9A 3OD7A 4WEPA 1FTOA 1B1XA 4F3PA 4X1DA 3C33A 3CIJA 1Q35A 3K6UA 4QSEA 4HTGA 4ELQA 5DVJA 1H45A 5ISUA 2HZKA 2VHAA 5HM4B 5I58B 1M5FA 1EU8A 1TT1A 3EHTA 3HCQA 1A55A 3HSTA 5EHSA 1IIWA 3N6TA 3M8UA 3FXQA 4QSDA 1S9TA 3TCHA 3PPPA 1N0TA 4U21A 2B3FA 5I2KB 1P1WA 4TLMB 1OLCA 4K3FA 3F11A 4H6DA 2FYIA 3MVYA 4KQPA 3QYTA 4LONB 4KYSA 5I2KA 3BKIB 1PBQA 1NNPA 2Z8EA 1M5CA 5I59A 4DE8A 4LATA 1NH8A 4R2FA 3HHGA 4XKNA 1QJMA 5L9OA 2XHDA 4HCYA 3MUQA 4IGRA 3VLUA 1PBPA 2ANJA 2Q2AA 4DXBA 1SBPA 2ZNSA 3FV1A 4R6KA 4IO3A 2O51A 4UACA 4RXLA 1A99A 3OO7A 4R74A 4OESA 2Y7PA 3QIMA 1D9YA 2DS9A 3DLNA 4I9DA 4F22A 2PVUA 4DDDA 1FQCA 4FECA 4ZEIA 3OXNA 1O64A 1P1UA 2AL4A 2VOZA 4NF4B 4JSDA 2PT2A 3FJGA 1FQFA 1ZMGA 3M3FA 5AA3A 1NNKA 3V89B 4NF4A 3M3KA 4TOZA 2Q8JA 3TQLA 3UN6A 3MWBA 5AA2D 2XX9A 1B7ZA 2GHAA 3TKDA 2HXWA 3N26A 4ELRA 1Y9UA 4MH5A 5CBRA 1UTHB 1A8FA 3VFJA 1EZPA 2A5SA 2HAVA 1UTHA 3PU5A 3BBRA 4EQBA 4ZDMA 2H25A 3SKPA 3SEYA 3UORA 4R6HA 3O97A 3TTNA 2ESNA 1B6HA 1H76A 4EQ9A 4R72A 3H6VA 2Q88A 2CMOA 3OO9A 3U94A 3I5OA 1PEBA 2Z22A 4RPNA 4RJZA 1JQFA 3IB1A 4N6PA 3K6VA 4ELOA 1YAEA 3HPIA 3H6UA 4NEDA 1MQHA 4FEDA 1FTJA 5TPAB 2R9JA 3O66A 1JETA 5TPAA 1ZBMA 4KHZE 3MJNA 4OZ9A 3OEMA 2X7QA 4NMYA 3C35A 2QJEA 2RC9A 1S50A 4ZZEA 1XVXA 2OBGA 3VXBA 3LR1A 2DVZA 4DLDA 2NVUB 5JTYB 3K1MA 1N3XA 3TFLA 4WEDA 2H5YA 5JTYA 4ELPA 1NMUA 2XXYA 5AA2B 3R7XA 1JVXA 1QKAA 4G4PA 3T96B 3S2VA 4LUBA 4C1TA 1Y3QA 2XX7A 1DTGA 1URGA 3JYRA 1JEVA 1R6ZA 3QXMA 3MAMA 4OMBA 1MY3A 3PUXE 1N04A 3Q27A 3MPKA 4Z0IA 3T9UA 3K02A 1JW5A 3DP8A 5DEXB 3KOTA 3FVNA 3KJTA 2Z8FA 4O3AA 1MH3A 2OK2A 4F29A 2E0SA 2RF1A 5ICQA 3ZKKA 2Y7KA 3GBBA 3VXCA 2QRYA 1SW4A 4P11A 4XKRA 4G77A 3CFZA 2DWJA 4OETA 1POTA 2QMXA 1QULA 2V84A 3JV9A 4IB2A 1LFIA 1POY1 1VR5A 1R1NA 5L9SA 1MH4A 4G68C 1DOTA 3O29A 1OLAA 2YLNA 3RGYA 5AA4B 3U1OA 4IO5A 3KN3A 3K1PA 2DWIA 4U1OA 1PB8A 4G68B 1NNTA 2GRVA 2G93A 4F18A 3ZSFA 3OO8A 1Y3PA 1UTBB 3SERA 2DE3A 2I3WA 3K6XA 3IO4A 2ZYOA 4C0RA 2ZYMA 4EXKA 4OYVA 1PB7A 2M8CA 3P7IA 2IA4A 3Q25A 2F78A 3RY3A 3R6UA 2O1LA 4LQ5A 3H7MA 2F5XA 3PMVA 3RNNA 2HCAA 2XXIA 2WKYA 4R9FA 5H8QB 1MRPA 3TZAA 4RYAA 3RPWA 2FNCA 2ZXTA 4YMBA 1HSLA 2I0BA 5H8QA 2I4BA 3KFMA 4RA1A 4KYEA 4HS7A 5CMCA 2O68A 1NKXA 1QUKA 3UP9A 4HCWA 3QSLA 3W9VA 3MZ9A 3V5AA 3TEPA 1IZ1A 4THIA 4JSOA 1H44A 3OEKA 1UQWA 1ZTYA 4R75A 3LSXA 2HZLA 1T0KA 2PYYA 5IKBA 2UYFA 4QHQA 3KOSA 3IK6B 4ESXA 4GOTA 1DTZA 1MDP1 1MDQA 1XOCA 4ZEFA 1KWHA 3CR9A 3W9WA 1B0LA 2A5TB 5L9MA 4GFRA 1AOVA 1MM6A 2A5TA 1B40A 2HAUA 4FE8A 4X48A 5EYFA 4DXUA 4F19A 1Y4TA 1BTJA 1LBBA 3FV2A 3TTRA 4OQOA 2E1SA 3C32A 3H6WA 5FTHA 1JEUA 3LSLA 1GVCA 2R6GE 3PPNA 1B1HA 2ONRA 3G7WA 1B51A 3O6HA 3SEUA 4BLAA 1TXFA 1QUJA 4RPOA 3U8QA 1NNFA 1N7WA 1ANFA 3EPEA 3KN8A 4EDPA 4Z7EA 2X7PA 3PD9A 1LCTA 2GHBA 1M5EA 3TQWA 3I3VA 3T93B 3PMWA 2NXOA 1SW1A 4JWXA 2OWSA 4PFUA 3FXUA 2VGQA 3FATA 2BJJX 3CRBA 4H67A 2XXXA 2F7BA 5I58A 3W15C 3A09A 1MXXA 3MZBA 4IO4A 1PDAA 3ILUB 5FHOA 3UA8A 1OVTA 2F34A 1MXVA 4YMAA 2V3UA 2XD3A 1B9JA 1MQJA 1ELJA 1MXYA 5DTBA 3VVEA 1HSEA 1LB8A 3IJOB 1IUDA 2DQVA 3BFUA 4ZE9A 2O69A 2RC7A 1AL3A 3G3HA 1R9LA 1B3FA 4BDOA 3V8XB 3MP8A 3U92A 4MF3A 1LAHE 3GZGA 4FEBA 4AB6A 2DE2A 3T9XB 4GRKA 1A8EA 3EF7A 5ITPA 1TWYA 3G3IA 2OZZA 1B5IA 4OXVA 4YB7A 1FQEA 3FZVA 2GH9A 1SW2A 1VE4A 2PMSA 3CVGA 3KGCA 3O2AA 1LAFE 3DP4A 1P1QA 1MQIA 1FQBA 1MY2A 5DVIA 5I56B 1PB9A 2XXPA 3E13X 4DXCA 4OERA 5DVFA 4G8NA 2XX8A 2DWHA 2RKMA 2HQ0A 5BWJA 4C1UA 2F35A 4GIZA 3KJ7A 1USYH 1WODA 4GF8A 4H8JA 4MFIA 3CG1A 2X26A 5K2XA 4H5FA 5CRYA 4NF5B 3TCFA 3E9XA 2VD3A 1Z7NE 3LSFB 5JEIA 3VLWA 2NOOA 3SDFA 2ZYNA 4QFNA 1URDA 3MC2A 5H8FB 3T66A 2I48A 3VVDA 3I6VA 4JBZA 5FHNA 3O28A 3OSQA 4I62A 5H8HB 4Q0CA 4U1ZA 2UXAA 4WXJA 1EZOA 5H8HA 1MQDA 3FVOA 5FTIA 2LAOA 1FTLA 2PX1A 3PD8A 2RCBA 3SESA 1YTVA 3LSWA 2VD2A 2ZYKA 1USYE 1US5A 3N94A 4RY1A 5L8DA 2RINA 3OOAA 4POXA 1SQYA 2Z23A 1N3WA 4LZ8A 3TUSA 2I3VA 4G2ZA 1XVYA 5H8SA 1B7UA 1D9VA 4LQ2A 3DM0A 3WAEA 1ZIUA 3HHFA 3MP1A 3IB0A 4BDQA 3MBPA 3R26A 1GR2A 1LAGE 4F3SA 4PFTA 1FCKA 3IOTA 1Y20A 4M1VA 2H4IA 3O6GA 4ZEKA 1A54A 1N84A 4NTLA 4NF6B 4BDNA 2YJPA 4ZS9A 1YCJA 2ZNTA 1B05A 2DWAA 1UIUA 3RUMA 2NUVA 4NF6A 3S9NC 4U22A 3OMBA 1B3HA 5KDTB 2G29A 5AA2A 2R71A 4EQ7A 1A40A 4DCXA 5KDTA 1BLFA 1SVXB 2QS4A 3C9HA 3FJMA 4OFOA 4R2BA 4LZ7A 4P0IA 5AA1A 5TP9B 2D21A 1OQHA 4H8IA 3MW0A 1N76A 5I57B 5B70A 4I1DA 5TP9A 4O3CA 4ND9A 2PBWA 4XTCQ 5I57A 2XD2A 5BUUA 4U4SA 4IY5A 1NFTA 1US4A 3K01A 4ONYA 3QUJA 2I6EA 5DEXA 4JB7A 3WAFA 4F39A 1JVYA 4ZZAA 1M5DA 2ZNUA 4YAHX 5CM6A 1J1NA 2PT1A 1B52A 1RYOA 4KD5A 3C34A 4NWCA 1OIBA 1P99A 2XXRA 3LC8A 1B7HA 2DE4A 3RTWB 4XKQA 1XHYA 2O1MA 1MPCA 5EHMA 2H9BA 3QAXA 3V83A 2P1SA 1XS5A 4PETA 3A3UA 5AA4A 4GQOA 3FUZA 3TYHA 1SYHA 4G68A 4NWDA 5CC2A 1UTBA 4NF8B 1IXCA 1FQDA 2OLBA 3HN0A 4U23A 2QS3A 4GXSB 4Q30B 3TAJA 1B0HA 1MPBA 3GXAA 4H1XA 4JXIA 4H0WA 1MG1A 1QVSA 2Y7WA 1FTKA 5HPQA 3SEXA 5KZTA 3CFLA 4KFQA 3MZ1A 3CG3A 4E0WA 3S9LC 2UVJA 3ONMA 4MLVA 3Q28A 4EF1A 5A5XB 3PPRA 1ZJLA 3KN7A 2O6AA 4PP0A 4GD5A 3RT6B 3USDA 3EHSA 3MVXA 1NL5A 2Y7IA 2B3BA 3CSGA 4TLLB 1DPEA 4GL8A 1ATGA 2XXUA 1BP5A 2Q2CA 5AE4A 4X1BA 3MPLA 4OEVA 2UYEA 4RK9A 4R6YA 4OWDA 5B7DA 4LZ5A 4KR5A 1F9BA 3FD3A 1Y3NA 2RCAA 4XIGQ 5CMMA 3PPQA 3H06B 5M2VA 2QPQA 2RC8A 1CE2A 1CB6A 1MS7A 4YU0A 2H98A 2IEEA 4N07A 4IO2A 1B3EA 1NH7A 4WKMA 3GBAA 4PQJA 3O6IA 1ZKBA 1URSA 1FQAA 1WVJA 3MVZA 1MPDA 3PPOA 2QL3A 2ABHA 3CFXA 5H8NB 3IJXB 3UIFA 4DZ1A 4IGTA 2P0SA 1M5BA 3K0VA 4JDFA 2QS1A 4YZZA 4QFOA 4QRZA 3OELA 4QSCA 3O9PA 1A7LA 4FJPA 3IR1A 5DT6A 3A3CA 5ITOA 3EHUA 3OENA 1I6QA 2XXHA 4M4GA 4YKKA 3S4UA 3MVWA 3L6GA 3RTFB 1IQ7A 5ELVA 1MY4A 3PV0E 4YB5A 3PMXA 2Y84A 2NWJA 4Q8RA 2OCUA 4XKPA 2HFBA 3UGWA 4F3GA 3CI8A 2V3TA 1B2HA 2QSXA 3DELB 4IO6A 1B4HA 2O7IA 3T9HB 1O7TA 4N13A 5J1DA 3C36A 3FGSA 3RQTA 3UK4A 5I59B 2O7UA 3S9EA 4ISUA 4UA8A 3IOWA 3VLVA 3IL1B 4U4XA 3TTKA 2VP1A 3FXRA 4IY6A 5CBSA 3TODA 2I0CA 4TQUQ 4KCCA 2OWTA 1FTMA 4ZE8A 5JK4A 3G3GA 1YPNA 4POWA 4XXUA 3Q29A 3T9VA 3C31A 1ZLQA 4HW8A 1N7XA 4AQ4A 1LGBC 1MXWA 5CI5A 1B58A 3U93A 3JZJA 3D4GA 4ZEBA 1L5TA 2ONKE 2D3IA 4F1VA 2UVIA 4KI0E 1D4NA 2AL5A 4OTEA 2DP8A 4KCDA 3THIA 2DSFA 4JWOA 5I56A 2F6PA 4O3BA 3PUWE 3IORA 1II5A 4F1UA 4BDMA 2XXQA 2I4CA 1IXGA 3PUYE 4NF5A 3TCGA 2QS2A 3G3KA 3H6TA 5K2YA 4GLIA 1DSNA 1QW0A 1B3GA 4P0GA 2B65A 3SEVA 2FA7A 3KBRA 5IAIA 2DVCA 2ALUA 2W7YA 3C4MA 3MQ9A 4GXAA 4F2QA 5H8FA 1LB9A 2ONSA 4EF2A 2V3QA 4QFLA 2AIXA 3CSBA 1FW0A 3RT8A 3IX1A 1OMPA 3ZS6A 1HSJA 1TFDA 2F7AA 3N6UA 3EQ1A 1GTKA 3KSXA 3VE1B 1MY1A 3IO6A 4ESWA 3TPAA 2KLFA 3QUFA 2DOJA 4OFJA 2F6GA 4OFLA 1I6BA 4LA9A 1LFGA 1IXHA 3B7DA 3B6WA 3FJ7A 4PFWA 1Y1ZA 4RNSA 1VFEA 3BFTA 3VV5A 3L6HA 1AIVA 3TMGA 2YPNA 1P1OA 2Q89A 3FASA 4X9TA 2THIA 3RN8A 4DIGA 1I6AA 1VSOA 3TTMA 1OQGA 5KCJB 4ECFA 3IOUA 2ZMBA 1LAXA 3QK6A 5KCJA 1R9QA 2Z8DA 4E0XA 2GFEA 3PUVE 1LCFA 3KZGA 1D3KA 1XT8A 4F3BA 5TU0A 3U72A 4Q5TA 1SW5A 4YKPA 5CMKA 4JWYA 2UVGA 2V25A 2DXYA 1JNFA 2I49A 1QKBA 5DYHA 3TDJA 1EH3A 1JW4A 1SI1A 4GL0A 3PUZE 1GV8A 2XXVA 3N5LA 4KPTA 4EXLA 3LBSA 4RK2A 2F97A 1P1NA 4ZECA 3AXFA 3K1NA 4R9GA 1DMBA 1RYXA 1MXUA 5LOMA 4YKIA 3DP6A 3PGFA 1IITA 4OEUA 2REJA 4YB6A 1UIVA 2DXRA 3SEWA 3RLFE 1MM7A 3ZKLA 1MQGA 3H4ZA 2F8DA 4AB5A 1LLSA 1B5HA 3ODBA 1IXIA 5I84A 1BKAA 3B6TA 1O63A 3G3JA 4YKJA 1LSTA 3B6QA 2H99A 4U2RA 3E3KA 3D4CA 3FVGA 1ZU0A 3ECRA 5HBCA 4H65A 3TTLA 1Q1KA 5F7VA 3GLBA 2XXTA 2HEUA 2CZLA 4FATA 1B4ZA 2F36A 3KG2A 1BIYA 3VVFA 3KEIA 1SDXA 4H5GA 2XXWA 5CMBA 3LUYA 3ILTB 1AH5A 3IOVA 3K2DA 2REGA 4YICA 4QFKA
chains in the Genus database with same CATH superfamily
4NF8A 1LBVA 3KSJA 1MXZA 4FAJA 1Z7ME 2D5WA 2O84X 1MY0A 3TELA 3M3LA 1QUIA 1H3DA 1Y4CA 3K4UA 3K00A 4I8CA 3H03A 3G3FA 1LBCA 1SI0A 4IO7A 2Q74A 1JP4A 1SD3A 3SETA 1QGXA 1LBYA 1PC3A 1DPPA 2P2AA 2AYSA 5A5XA 4F31B 3FXBA 4GWWA 2Q9TA 4MBPA 3S9MC 3HV1A 4OENA 3EN3A 1AMFA 3H3GA 3OSRA 2WBDA 3OO6A 4HE1A 4PFYA 3HO7A 2OJTA 1B3LA 4LP2B 4R73A 4LN5A 3FVKA 3IB2A 4OHNA 3E4RA 2ZZWA 4NE4A 4EUOA 4L17A 5ET5A 4DCYA 4F2OA 5FHMA 5ICTA 4FORA 2F3BA 3KBZA 1S7YA 1FPEA 5F1QA 4N6KA 1H43A 1B46A 4MLQA 1LFHA 3T22A 4GBWA 4X04A 2UVHA 4G8HA 3VDFA 2V93A 4KYDA 4MJOA 1SYIA 5EYGA 4BDLA 4PE5B 1Y1MA 3MP6A 2DYXA 5I3SA 2BJIA 1XC1A 1B32A 4OVJA 4P9KA 4G8MA 3K6WA 4ZEDA 4KXPA 2F7CA 3Q26A 3FIRA 2V4CA 1IEJA 1GGGA 1I69A 1B5JA 4FIMA 4NG7A 4P47A 1TFAA 4O7MA 5I2NB 2QMWA 5H8NA 4GVOA 2HPGA 4QFPA 5I2NA 1OVBA 1WDNA 2Y7RA 3HFUA 4BDRA 1XI6A 3IAZA 4F1YA 4HE2A 4GX3A 2QFLA 1RKMA 1VFDA 2HHMA 4QF9A 1JW1A 4GWOA 4LVQA 4HXVA 2I58A 1EZ9A 3OD7A 4WEPA 1FTOA 1B1XA 4F3PA 4X1DA 3C33A 3CIJA 1Q35A 3K6UA 4QSEA 4HTGA 4ELQA 5DVJA 1H45A 5ISUA 2HZKA 2VHAA 5HM4B 5I58B 1M5FA 1EU8A 1TT1A 3EHTA 3ROJA 1K9YA 3HCQA 1A55A 3HSTA 5EHSA 1IIWA 1KA1A 3M8UA 3N6TA 3FXQA 4QSDA 1S9TA 3TCHA 3PPPA 1N0TA 4U21A 2B3FA 2WX9A 1LBXA 3ISPA 5I2KB 1P1WA 4TLMB 4PGPA 1OLCA 4K3FA 3F11A 4H6DA 4NGUA 2FYIA 3MVYA 4KQPA 3QYTA 4LONB 4KYSA 5I2KA 3BKIB 1PBQA 1NNPA 2Z8EA 1M5CA 2WYKA 5I59A 1NV4A 4DE8A 4LATA 2WEFA 1NH8A 4R2FA 3HHGA 4XKNA 1QJMA 4MX6A 5L9OA 2CZKA 2XHDA 4HCYA 3MUQA 4IGRA 3VLUA 1PBPA 2ANJA 2Q2AA 4DXBA 3NOHA 1SBPA 2ZNSA 3FV1A 4R6KA 4IO3A 2O51A 4UACA 4RXLA 1A99A 3OO7A 4R74A 4OESA 2Y7PA 3QIMA 1D9YA 2DS9A 3DLNA 4I9DA 4F22A 2PVUA 4DDDA 1FQCA 4FECA 5FBPA 4ZEIA 3OXNA 1O64A 2VPNA 1P1UA 2AL4A 2VOZA 4NF4B 1FJ6A 1IMCA 4JSDA 2PT2A 3FJGA 1FQFA 1ZMGA 3M3FA 5AA3A 1NNKA 3V89B 5EQ9A 1FPFA 4NF4A 3M3KA 4TOZA 2Q8JA 1RDYA 3TQLA 3UN6A 3MWBA 5AA2D 2XX9A 1B7ZA 2GHAA 1NV3A 3TKDA 1FBDA 2HXWA 3N26A 4ELRA 1Y9UA 4MH5A 5CBRA 1UTHB 1A8FA 3BIHA 3FBPA 3VFJA 1EZPA 2A5SA 2HAVA 1UTHA 3PU5A 1LBWA 3BBRA 4EQBA 2P3VA 4ZDMA 2H25A 1G0HA 3SKPA 3SEYA 3UORA 4R6HA 2VPOA 3O97A 3TTNA 2ESNA 1B6HA 1H76A 4MHFA 4EQ9A 4R72A 3H6VA 2Q88A 5EQ8A 2CMOA 4GWSA 1KZ8A 3OO9A 3U94A 3I5OA 2WBBA 1NUWA 1YXIA 2HXRA 4DI4B 1PEBA 2Z22A 4RPNA 4RJZA 1JQFA 3IB1A 4N6PA 3K6VA 4ELOA 1YAEA 3HPIA 3H6UA 4NEDA 1FSAA 1MQHA 4FEDA 2GQ1A 1FTJA 5TPAB 2R9JA 3O66A 2CZHA 1JETA 5TPAA 1ZBMA 4KHZE 3MJNA 4OZ9A 2KQZA 3OEMA 2X7QA 4NMYA 2WYPA 3C35A 2QJEA 1NI9A 2RC9A 2FIEA 1NV2A 1S50A 4ZZEA 1XVXA 2OBGA 3VXBA 4I3YA 3LR1A 5DW8A 2DVZA 4DLDA 2NVUB 5JTYB 3K1MA 1N3XA 3TFLA 4WEDA 1FPKA 4N15A 2H5YA 2XWOA 4NN3A 5JTYA 4ELPA 1NMUA 2XXYA 5AA2B 3R7XA 1JVXA 3PTYA 1QKAA 4G4PA 3T96B 3S2VA 4LUBA 4C1TA 1Y3QA 2XX7A 1DTGA 1URGA 3JYRA 1JEVA 1R6ZA 3QXMA 4MNIA 3MAMA 4OMBA 1MY3A 3PUXE 1N04A 3Q27A 3MPKA 4Z0IA 3T9UA 3K02A 1JW5A 3DP8A 5DEXB 1INPA 3KOTA 3FVNA 3KJTA 2Z8FA 4O3AA 1MH3A 2OK2A 4F29A 2E0SA 2RF1A 5ICQA 3ZKKA 2Y7KA 3GBBA 3VXCA 4PFBA 2QRYA 1SW4A 5EYHA 4PFIA 4P11A 4XKRA 4G77A 3CFZA 3MSTA 4OVQA 2DWJA 4OETA 1POTA 2FHYA 2QMXA 1QULA 4P8BA 2V84A 3JV9A 4IB2A 1LFIA 1POY1 1VR5A 1R1NA 5J16A 5L9SA 1MH4A 4G68C 1DOTA 3O29A 1OLAA 2YLNA 3RGYA 5AA4B 3U1OA 4IO5A 3KN3A 2CZIA 3K1PA 2DWIA 4U1OA 1FPLA 1PB8A 4G68B 1NNTA 2DDKA 2GRVA 4PBHA 2G93A 4F18A 3ZSFA 3OO8A 1RDZA 1Y3PA 1UTBB 3SERA 2DE3A 2I3WA 3K6XA 1CNQA 3IO4A 2ZYOA 4C0RA 2ZYMA 4EXKA 1DBZA 1NV7A 4OYVA 1PB7A 2M8CA 1NUXA 2XWIA 2FBPA 3P7IA 2PFYA 2IA4A 3Q25A 2F78A 3RY3A 3R6UA 2O1LA 4LQ5A 3H7MA 5EQ7A 2KR0A 1LBZA 2F5XA 3PMVA 3RNNA 4MMPA 2HCAA 2XXIA 2WKYA 4R9FA 5H8QB 1MRPA 3TZAA 4RYAA 3RPWA 2FNCA 2ZXTA 2OX3A 4YMBA 1HSLA 2I0BA 5H8QA 2I4BA 3KFMA 4RA1A 4KYEA 1IMEA 4HS7A 5CMCA 4GWZA 2O68A 1FPIA 1NKXA 1QUKA 3UP9A 4HCWA 3QSLA 3W9VA 3MZ9A 3V5AA 4N17A 3TEPA 1IZ1A 1FBPA 4THIA 4JSOA 1H44A 3OEKA 1UQWA 1ZTYA 4R75A 4PGNA 3LSXA 2HZLA 1T0KA 2PYYA 1NUYA 5IKBA 1FBHA 2UYFA 4QHQA 3KOSA 3IK6B 4ESXA 4GOTA 1DTZA 1MDP1 1MDQA 1XOCA 4ZEFA 1KWHA 3CR9A 3W9WA 1B0LA 2A5TB 5L9MA 4H45A 4GFRA 1AOVA 1MM6A 4N8YA 2CEYA 2A5TA 1B40A 2HAUA 4FE8A 4X48A 5EYFA 4DXUA 2MKZA 4F19A 1Y4TA 1BTJA 1LBBA 3FV2A 3TTRA 4OQOA 2E1SA 5T3JA 3C32A 3H6WA 5FTHA 1JEUA 3LSLA 1GVCA 2R6GE 3PPNA 1B1HA 2ONRA 3G7WA 1B51A 3O6HA 3SEUA 3U65A 4BLAA 4OVTA 4GWUA 1TXFA 1QUJA 4RPOA 3U8QA 1NNFA 1N7WA 1ANFA 3EPEA 3KN8A 4EDPA 4Z7EA 2X7PA 3PD9A 5IGAA 1LCTA 3QMFA 1FBCA 1Q9DA 2GHBA 1M5EA 3TQWA 3I3VA 3T93B 3PMWA 2NXOA 1SW1A 4JWXA 2OWSA 4PFUA 3FXUA 2VGQA 3FATA 2BJJX 3CRBA 4H67A 4PE3A 2XXXA 2F7BA 5I58A 3D1RA 3W15C 3A09A 1MXXA 3MZBA 4IO4A 3BIGA 4PF8A 1PDAA 3ILUB 5FHOA 3UA8A 1OVTA 1IMBA 2F34A 1MXVA 4YMAA 2V3UA 2XD3A 1B9JA 1MQJA 4I40A 1ELJA 4NAPA 1MXYA 1G0IA 5DTBA 3VVEA 4PTKA 4XF5A 1HSEA 1LB8A 3IJOB 1IUDA 2DQVA 3BFUA 4ZE9A 2O69A 2RC7A 1AL3A 3G3HA 1R9LA 1B3FA 4BDOA 3V8XB 4GWXA 3MP8A 3U92A 4MF3A 1LAHE 3GZGA 1YZ0A 4FEBA 4AB6A 2DE2A 4GWYA 3T9XB 4GRKA 2Y5LA 4PCDA 1A8EA 3EF7A 4PDHA 5ITPA 1TWYA 3G3IA 2OZZA 3T1BA 1B5IA 4OXVA 2QVRA 4MNPA 1FQEA 4YB7A 3FZVA 2GH9A 1SW2A 1VE4A 2PMSA 3CVGA 3KGCA 3O2AA 1LAFE 3DP4A 4MNCA 1P1QA 1MQIA 1FQBA 1MY2A 5DVIA 5I56B 1PB9A 2XXPA 3E13X 4DXCA 4OERA 5DVFA 4G8NA 2XX8A 2DWHA 2RKMA 4XEQA 2HQ0A 5BWJA 4NF0A 4C1UA 2F35A 4GIZA 3KJ7A 1USYH 1WODA 4PFRA 4GF8A 4H8JA 4MFIA 3CG1A 2X26A 5K2XA 4H5FA 5CRYA 4NF5B 3TCFA 3E9XA 2VD3A 1Z7NE 3LV0A 3LSFB 5JEIA 3VLWA 4H46A 2NOOA 3SDFA 2ZYNA 1AWBA 4QFNA 1URDA 3MC2A 5H8FB 3T66A 3RPLB 2I48A 4IR8A 3VVDA 3I6VA 4JBZA 5FHNA 3O28A 3RPLA 3OSQA 1VDWA 4I62A 5H8HB 4Q0CA 4U1ZA 1NV0A 2UXAA 4WXJA 1EZOA 4I3EA 5H8HA 1MQDA 3FVOA 4HE0A 5FTIA 2OWZA 2LAOA 1FTLA 2PX1A 3PD8A 2FVZA 2RCBA 3SESA 1YTVA 3LSWA 2VD2A 2ZYKA 1USYE 1US5A 3N94A 4RY1A 5L8DA 2RINA 3OOAA 4POXA 1SQYA 2Z23A 1N3WA 4LZ8A 3TUSA 3KC0A 4OANA 2I3VA 4G2ZA 1XVYA 5H8SA 1B7UA 1D9VA 4LQ2A 3DM0A 5ET8A 3T0JA 3WAEA 4NX1A 1DK4A 1ZIUA 3HHFA 3MP1A 1NV1A 3IB0A 4BDQA 3MBPA 3R26A 1GR2A 1LAGE 4F3SA 4PFTA 1FCKA 3IOTA 1Y20A 4M1VA 2H4IA 3O6GA 4ZEKA 1A54A 1N84A 4NTLA 4NF6B 4BDNA 2YJPA 4ZS9A 1YCJA 2ZNTA 1B05A 2DWAA 1UIUA 3RUMA 2NUVA 4NF6A 3E78A 3S9NC 4U22A 3OMBA 1B3HA 5KDTB 2G29A 4GBVA 5AA2A 2R71A 3A29A 2PFZA 2L5VA 4EQ7A 1A40A 4DCXA 5KDTA 1BLFA 1SVXB 2QS4A 3C9HA 3FJMA 4OFOA 4R2BA 4LZ7A 4P0IA 5AA1A 5TP9B 2D21A 1OQHA 4H8IA 3MW0A 1N76A 5I57B 4PBQA 5B70A 4I1DA 5TP9A 4O3CA 4ND9A 2PBWA 4XTCQ 5I57A 2XD2A 5BUUA 2B4MA 4U4SA 4IY5A 1NFTA 1US4A 1FBGA 3E79A 3K01A 3QUJA 4ONYA 2I6EA 1IMFA 5DEXA 4JB7A 4G61A 3WAFA 4PAKA 4F39A 5IZ1A 1JVYA 5IM2A 4ZZAA 1M5DA 2ZNUA 4N81A 4YAHX 5CM6A 1J1NA 2PT1A 1B52A 1RYOA 4KD5A 4MAGA 3C34A 4NWCA 1OIBA 1P99A 2XXRA 3CHGA 3LC8A 3KC1A 1B7HA 2DE4A 2VT5A 3RTWB 4XKQA 1XHYA 2O1MA 1MPCA 5EHMA 2H9BA 3QAXA 3V83A 2P1SA 3RYDA 5F24A 1XS5A 1FBEA 4PETA 3A3UA 5I7IA 4OVSA 5AA4A 4GQOA 3FUZA 3TYHA 1SYHA 4G68A 4NWDA 5CC2A 1UTBA 4PDDA 1FPJA 4NF8B 1IXCA 1FQDA 2OLBA 3HN0A 4U23A 2QS3A 4GXSB 4Q30B 3TAJA 1B0HA 2QVVA 1MPBA 3GXAA 4H1XA 1SPIA 4JXIA 4H0WA 1MG1A 1QVSA 5LDZA 2Y7WA 1FTKA 5HPQA 3SEXA 5KZTA 3CFLA 4KFQA 3MZ1A 3CG3A 4E0WA 3S9LC 2UVJA 3ONMA 4MLVA 3Q28A 2PCRA 4EF1A 4MIJA 5A5XB 3PPRA 1ZJLA 3KN7A 2O6AA 4PP0A 4GD5A 4P56A 3RT6B 3USDA 3EHSA 3MVXA 1NL5A 2Y7IA 2B3BA 1K9ZA 3CSGA 4TLLB 1DPEA 4GL8A 1ATGA 1FRPA 2XXUA 1BP5A 2Q2CA 4AS5A 5AE4A 2P3NA 4QBAA 4X1BA 3MPLA 4O7IA 4OEVA 4O94A 2UYEA 4RK9A 4R6YA 4P1LA 4OWDA 2ZZVA 5B7DA 4LZ5A 4KR5A 1F9BA 3FD3A 1Y3NA 2RCAA 4XIGQ 1BK4A 5CMMA 3PPQA 3H06B 5M2VA 2QPQA 2RC8A 1CE2A 1CB6A 1MS7A 4YU0A 2H98A 2IEEA 5IZZA 4N07A 4IO2A 5EQAA 3IFCA 1B3EA 1NH7A 4WKMA 3GBAA 4PQJA 3O6IA 1ZKBA 1URSA 1FQAA 1WVJA 3MVZA 2Y5KA 1MPDA 3PPOA 3EKIA 2QL3A 2ABHA 3CFXA 5H8NB 3IJXB 3UIFA 4DZ1A 4IGTA 2P0SA 1M5BA 3K0VA 4JDFA 2QS1A 4YZZA 4JVDA 4QFOA 4QRZA 3OELA 4QSCA 3O9PA 3B8BA 5A5LA 1A7LA 4FJPA 3IR1A 5DT6A 3A3CA 1D9QA 5ITOA 3EHUA 4OVPA 3OENA 2B4LA 4PF6A 1I6QA 2XXHA 4M4GA 4YKKA 3IFAA 3S4UA 3MVWA 3GYYA 3L6GA 3RTFB 1IQ7A 5ELVA 1MY4A 3PV0E 4YB5A 3PMXA 2Y84A 2NWJA 4Q8RA 2OCUA 4XKPA 2HFBA 3UGWA 4F3GA 3CI8A 2V3TA 1B2HA 2QSXA 3DELB 4IO6A 1B4HA 2O7IA 3T9HB 1O7TA 4N6DA 4N13A 5J1DA 3C36A 3FGSA 4N91A 1LEVA 2FIXA 3RQTA 3SZPA 3UK4A 5I59B 2R8TA 2O7UA 3S9EA 4XFEA 4ISUA 4UA8A 3IOWA 3VLVA 3IL1B 1FPBA 1NV5A 4U4XA 1NV6A 3TTKA 2XWVA 2VP1A 4GX6A 5I5PA 4N8GA 3FXRA 4IY6A 5CBSA 3TODA 2I0CA 4TQUQ 4KCCA 2OWTA 1FTMA 4ZE8A 2ZZXA 5JK4A 3G3GA 1YPNA 4POWA 4XXUA 3Q29A 3T9VA 3C31A 1ZLQA 4OVRA 4HW8A 1N7XA 4AQ4A 1LGBC 1MXWA 5CI5A 1B58A 3U93A 3JZJA 3D4GA 4ZEBA 1L5TA 2ONKE 2D3IA 4F1VA 1FPGA 2UVIA 4KI0E 1D4NA 2AL5A 1IMAA 4OTEA 2DP8A 5ET6A 1KA0A 4MEVA 4KCDA 4P1EA 3THIA 2DSFA 4JWOA 5I56A 2F6PA 4O3BA 3PUWE 4NQ8A 3IORA 1II5A 4F1UA 4BDMA 2XXQA 2I4CA 1IXGA 3PUYE 4PC9A 4NF5A 3TCGA 2QS2A 3G3KA 3H6TA 5K2YA 4GLIA 1DSNA 4DI3D 1QW0A 1B3GA 4P0GA 2B65A 3SEVA 1FTAA 2FA7A 3KBRA 5IAIA 2DVCA 2ALUA 2W7YA 3C4MA 3MQ9A 4GXAA 4UABA 1YYZA 4F2QA 5H8FA 1LB9A 2ONSA 4EF2A 2V3QA 4QFLA 2AIXA 3CSBA 1FW0A 3RT8A 2QVUA 3IX1A 1OMPA 3ZS6A 1HSJA 1TFDA 2F7AA 1IMDA 4AS4A 1FPDA 2Q8MA 3N6UA 3EQ1A 1GTKA 4QXDA 3KSXA 3VE1B 1MY1A 4NHBA 3IO6A 4ESWA 3TPAA 2KLFA 3QUFA 2DOJA 4OFJA 2F6GA 4OFLA 1I6BA 4OA4A 4LA9A 1LFGA 1IXHA 3B7DA 3B6WA 3FJ7A 4PFWA 4X8RA 1Y1ZA 4RNSA 1VFEA 3BFTA 2XXKA 3VV5A 3L6HA 1AIVA 3TMGA 2YPNA 1P1OA 2Q89A 3FASA 4X9TA 2THIA 3RN8A 1EYJA 4DIGA 1I6AA 1VSOA 3TTMA 1OQGA 4MCOA 5KCJB 4ECFA 3IOUA 2ZMBA 1LAXA 3QK6A 5KCJA 1R9QA 2Z8DA 4E0XA 2GFEA 3PUVE 4FBPA 1LCFA 3KZGA 1D3KA 1XT8A 4F3BA 5ESYA 2CEXA 5TU0A 2XA5A 3U72A 1EYKA 2XWKA 4Q5TA 4JVCA 1SW5A 4YKPA 5CMKA 4JWYA 5ET7A 2UVGA 2V25A 2DXYA 5LTCA 1JNFA 2I49A 1QKBA 5DYHA 3TDJA 1EYIA 1EH3A 1JW4A 1SI1A 4GL0A 3PUZE 1GV8A 2XXVA 1NUZA 3N5LA 4KPTA 3B50A 4EXLA 3LBSA 3LUZA 4RK2A 4GX4A 4JVIA 4O8MA 2F97A 1P1NA 4ZECA 3AXFA 4N4UA 3K1NA 4R9GA 1DMBA 1RYXA 1MXUA 5LOMA 1FBFA 1RDXA 4YKIA 3DP6A 3PGFA 1IITA 4OEUA 2REJA 4YB6A 1UIVA 2DXRA 3SEWA 3RLFE 3MYUA 1MM7A 3ZKLA 1MQGA 1DCUA 3H4ZA 2F8DA 4AB5A 1LLSA 2JJKA 1B5HA 3ODBA 1IXIA 5I84A 1BKAA 3B6TA 1O63A 3G3JA 4YKJA 1LSTA 3B6QA 2H99A 4U2RA 3E3KA 3D4CA 3FVGA 4PAIA 1ZU0A 3ECRA 5HBCA 4H65A 3TTLA 1Q1KA 5F7VA 5IZ3B 3GLBA 2XXTA 2HEUA 2CZLA 1FJ9A 4FATA 4PAFA 1B4ZA 2F36A 3KG2A 1BIYA 3VVFA 5IZ3A 3KEIA 2F3DA 1SDXA 4H5GA 2XXWA 5CMBA 3LUYA 3ILTB 1AH5A 3IOVA 4P3LA 3K2DA 2REGA 4YICA 4QFKA
chains in the Genus database with same CATH topology
4NF8A 3KSJA 1MXZA 4FAJA 1Z7ME 2D5WA 2O84X 1MY0A 3TELA 3M3LA 1QUIA 1H3DA 1Y4CA 3K4UA 3K00A 4I8CA 3H03A 3G3FA 1LBCA 1SI0A 4IO7A 1SD3A 3SETA 1PC3A 1DPPA 2P2AA 2AYSA 5A5XA 4F31B 2Q9TA 4MBPA 3S9MC 3HV1A 4OENA 3EN3A 1AMFA 3H3GA 3OSRA 3OO6A 4PFYA 3HO7A 2OJTA 1B3LA 4LP2B 4R73A 3FVKA 3IB2A 4OHNA 3E4RA 4NE4A 4EUOA 4L17A 4DCYA 4F2OA 5FHMA 5ICTA 4FORA 1S7YA 5F1QA 1H43A 1B46A 4MLQA 1LFHA 3T22A 2UVHA 4G8HA 3VDFA 2V93A 4KYDA 1SYIA 4BDLA 4PE5B 1Y1MA 3MP6A 2DYXA 1XC1A 1B32A 4OVJA 4G8MA 3K6WA 4ZEDA 2F7CA 3Q26A 3FIRA 1IEJA 1GGGA 1I69A 1B5JA 4FIMA 1TFAA 5I2NB 2QMWA 5H8NA 4GVOA 4QFPA 5I2NA 1OVBA 1WDNA 2Y7RA 4BDRA 3IAZA 4F1YA 1RKMA 1VFDA 4QF9A 1JW1A 4GWOA 4LVQA 2I58A 1EZ9A 3OD7A 4WEPA 1FTOA 1B1XA 4F3PA 4X1DA 3C33A 3CIJA 1Q35A 3K6UA 4QSEA 4HTGA 4ELQA 5DVJA 1H45A 5ISUA 2HZKA 2VHAA 5HM4B 5I58B 1M5FA 1EU8A 1TT1A 3EHTA 3HCQA 1A55A 3HSTA 5EHSA 1IIWA 3N6TA 3M8UA 3FXQA 4QSDA 1S9TA 3TCHA 3PPPA 1N0TA 4U21A 2B3FA 5I2KB 1P1WA 4TLMB 1OLCA 4K3FA 3F11A 4H6DA 2FYIA 3MVYA 4KQPA 3QYTA 4LONB 4KYSA 5I2KA 3BKIB 1PBQA 1NNPA 2Z8EA 1M5CA 5I59A 4DE8A 4LATA 1NH8A 4R2FA 3HHGA 4XKNA 1QJMA 5L9OA 2XHDA 4HCYA 3MUQA 4IGRA 3VLUA 1PBPA 2ANJA 2Q2AA 4DXBA 1SBPA 2ZNSA 3FV1A 4R6KA 4IO3A 2O51A 4UACA 4RXLA 1A99A 3OO7A 4R74A 4OESA 2Y7PA 3QIMA 1D9YA 2DS9A 3DLNA 4I9DA 4F22A 2PVUA 4DDDA 1FQCA 4FECA 4ZEIA 3OXNA 1O64A 1P1UA 2AL4A 2VOZA 4NF4B 4JSDA 2PT2A 3FJGA 1FQFA 1ZMGA 3M3FA 5AA3A 1NNKA 3V89B 4NF4A 3M3KA 4TOZA 2Q8JA 3TQLA 3UN6A 3MWBA 5AA2D 2XX9A 1B7ZA 2GHAA 3TKDA 2HXWA 3N26A 4ELRA 1Y9UA 4MH5A 5CBRA 1UTHB 1A8FA 3VFJA 1EZPA 2A5SA 2HAVA 1UTHA 3PU5A 3BBRA 4EQBA 4ZDMA 2H25A 3SKPA 3SEYA 3UORA 4R6HA 3O97A 3TTNA 2ESNA 1B6HA 1H76A 4EQ9A 4R72A 3H6VA 2Q88A 2CMOA 3OO9A 3U94A 3I5OA 1PEBA 2Z22A 4RPNA 4RJZA 1JQFA 3IB1A 4N6PA 3K6VA 4ELOA 1YAEA 3HPIA 3H6UA 4NEDA 1MQHA 4FEDA 1FTJA 5TPAB 2R9JA 3O66A 1JETA 5TPAA 1ZBMA 4KHZE 3MJNA 4OZ9A 3OEMA 2X7QA 4NMYA 3C35A 2QJEA 2RC9A 1S50A 4ZZEA 1XVXA 2OBGA 3VXBA 3LR1A 2DVZA 4DLDA 2NVUB 5JTYB 3K1MA 1N3XA 3TFLA 4WEDA 2H5YA 5JTYA 4ELPA 1NMUA 2XXYA 5AA2B 3R7XA 1JVXA 1QKAA 4G4PA 3T96B 3S2VA 4LUBA 4C1TA 1Y3QA 2XX7A 1DTGA 1URGA 3JYRA 1JEVA 1R6ZA 3QXMA 3MAMA 4OMBA 1MY3A 3PUXE 1N04A 3Q27A 3MPKA 4Z0IA 3T9UA 3K02A 1JW5A 3DP8A 5DEXB 3KOTA 3FVNA 3KJTA 2Z8FA 4O3AA 1MH3A 2OK2A 4F29A 2E0SA 2RF1A 5ICQA 3ZKKA 2Y7KA 3GBBA 3VXCA 2QRYA 1SW4A 4P11A 4XKRA 4G77A 3CFZA 2DWJA 4OETA 1POTA 2QMXA 1QULA 2V84A 3JV9A 4IB2A 1LFIA 1POY1 1VR5A 1R1NA 5L9SA 1MH4A 4G68C 1DOTA 3O29A 1OLAA 2YLNA 3RGYA 5AA4B 3U1OA 4IO5A 3KN3A 3K1PA 2DWIA 4U1OA 1PB8A 4G68B 1NNTA 2GRVA 2G93A 4F18A 3ZSFA 3OO8A 1Y3PA 1UTBB 3SERA 2DE3A 2I3WA 3K6XA 3IO4A 2ZYOA 4C0RA 2ZYMA 4EXKA 4OYVA 1PB7A 2M8CA 3P7IA 2IA4A 3Q25A 2F78A 3RY3A 3R6UA 2O1LA 4LQ5A 3H7MA 2F5XA 3PMVA 3RNNA 2HCAA 2XXIA 2WKYA 4R9FA 5H8QB 1MRPA 3TZAA 4RYAA 3RPWA 2FNCA 2ZXTA 4YMBA 1HSLA 2I0BA 5H8QA 2I4BA 3KFMA 4RA1A 4KYEA 4HS7A 5CMCA 2O68A 1NKXA 1QUKA 3UP9A 4HCWA 3QSLA 3W9VA 3MZ9A 3V5AA 3TEPA 1IZ1A 4THIA 4JSOA 1H44A 3OEKA 1UQWA 1ZTYA 4R75A 3LSXA 2HZLA 1T0KA 2PYYA 5IKBA 2UYFA 4QHQA 3KOSA 3IK6B 4ESXA 4GOTA 1DTZA 1MDP1 1MDQA 1XOCA 4ZEFA 1KWHA 3CR9A 3W9WA 1B0LA 2A5TB 5L9MA 4GFRA 1AOVA 1MM6A 2A5TA 1B40A 2HAUA 4FE8A 4X48A 5EYFA 4DXUA 4F19A 1Y4TA 1BTJA 1LBBA 3FV2A 3TTRA 4OQOA 2E1SA 3C32A 3H6WA 5FTHA 1JEUA 3LSLA 1GVCA 2R6GE 3PPNA 1B1HA 2ONRA 3G7WA 1B51A 3O6HA 3SEUA 4BLAA 1TXFA 1QUJA 4RPOA 3U8QA 1NNFA 1N7WA 1ANFA 3EPEA 3KN8A 4EDPA 4Z7EA 2X7PA 3PD9A 1LCTA 2GHBA 1M5EA 3TQWA 3I3VA 3T93B 3PMWA 2NXOA 1SW1A 4JWXA 2OWSA 4PFUA 3FXUA 2VGQA 3FATA 2BJJX 3CRBA 4H67A 2XXXA 2F7BA 5I58A 3W15C 3A09A 1MXXA 3MZBA 4IO4A 1PDAA 3ILUB 5FHOA 3UA8A 1OVTA 2F34A 1MXVA 4YMAA 2V3UA 2XD3A 1B9JA 1MQJA 1ELJA 1MXYA 5DTBA 3VVEA 1HSEA 1LB8A 3IJOB 1IUDA 2DQVA 3BFUA 4ZE9A 2O69A 2RC7A 1AL3A 3G3HA 1R9LA 1B3FA 4BDOA 3V8XB 3MP8A 3U92A 4MF3A 1LAHE 3GZGA 4FEBA 4AB6A 2DE2A 3T9XB 4GRKA 1A8EA 3EF7A 5ITPA 1TWYA 3G3IA 2OZZA 1B5IA 4OXVA 4YB7A 1FQEA 3FZVA 2GH9A 1SW2A 1VE4A 2PMSA 3CVGA 3KGCA 3O2AA 1LAFE 3DP4A 1P1QA 1MQIA 1FQBA 1MY2A 5DVIA 5I56B 1PB9A 2XXPA 3E13X 4DXCA 4OERA 5DVFA 4G8NA 2XX8A 2DWHA 2RKMA 2HQ0A 5BWJA 4C1UA 2F35A 4GIZA 3KJ7A 1USYH 1WODA 4GF8A 4H8JA 4MFIA 3CG1A 2X26A 5K2XA 4H5FA 5CRYA 4NF5B 3TCFA 3E9XA 2VD3A 1Z7NE 3LSFB 5JEIA 3VLWA 2NOOA 3SDFA 2ZYNA 4QFNA 1URDA 3MC2A 5H8FB 3T66A 2I48A 3VVDA 3I6VA 4JBZA 5FHNA 3O28A 3OSQA 4I62A 5H8HB 4Q0CA 4U1ZA 2UXAA 4WXJA 1EZOA 5H8HA 1MQDA 3FVOA 5FTIA 2LAOA 1FTLA 2PX1A 3PD8A 2RCBA 3SESA 1YTVA 3LSWA 2VD2A 2ZYKA 1USYE 1US5A 3N94A 4RY1A 5L8DA 2RINA 3OOAA 4POXA 1SQYA 2Z23A 1N3WA 4LZ8A 3TUSA 2I3VA 4G2ZA 1XVYA 5H8SA 1B7UA 1D9VA 4LQ2A 3DM0A 3WAEA 1ZIUA 3HHFA 3MP1A 3IB0A 4BDQA 3MBPA 3R26A 1GR2A 1LAGE 4F3SA 4PFTA 1FCKA 3IOTA 1Y20A 4M1VA 2H4IA 3O6GA 4ZEKA 1A54A 1N84A 4NTLA 4NF6B 4BDNA 2YJPA 4ZS9A 1YCJA 2ZNTA 1B05A 2DWAA 1UIUA 3RUMA 2NUVA 4NF6A 3S9NC 4U22A 3OMBA 1B3HA 5KDTB 2G29A 5AA2A 2R71A 4EQ7A 1A40A 4DCXA 5KDTA 1BLFA 1SVXB 2QS4A 3C9HA 3FJMA 4OFOA 4R2BA 4LZ7A 4P0IA 5AA1A 5TP9B 2D21A 1OQHA 4H8IA 3MW0A 1N76A 5I57B 5B70A 4I1DA 5TP9A 4O3CA 4ND9A 2PBWA 4XTCQ 5I57A 2XD2A 5BUUA 4U4SA 4IY5A 1NFTA 1US4A 3K01A 4ONYA 3QUJA 2I6EA 5DEXA 4JB7A 3WAFA 4F39A 1JVYA 4ZZAA 1M5DA 2ZNUA 4YAHX 5CM6A 1J1NA 2PT1A 1B52A 1RYOA 4KD5A 3C34A 4NWCA 1OIBA 1P99A 2XXRA 3LC8A 1B7HA 2DE4A 3RTWB 4XKQA 1XHYA 2O1MA 1MPCA 5EHMA 2H9BA 3QAXA 3V83A 2P1SA 1XS5A 4PETA 3A3UA 5AA4A 4GQOA 3FUZA 3TYHA 1SYHA 4G68A 4NWDA 5CC2A 1UTBA 4NF8B 1IXCA 1FQDA 2OLBA 3HN0A 4U23A 2QS3A 4GXSB 4Q30B 3TAJA 1B0HA 1MPBA 3GXAA 4H1XA 4JXIA 4H0WA 1MG1A 1QVSA 2Y7WA 1FTKA 5HPQA 3SEXA 5KZTA 3CFLA 4KFQA 3MZ1A 3CG3A 4E0WA 3S9LC 2UVJA 3ONMA 4MLVA 3Q28A 4EF1A 5A5XB 3PPRA 1ZJLA 3KN7A 2O6AA 4PP0A 4GD5A 3RT6B 3USDA 3EHSA 3MVXA 1NL5A 2Y7IA 2B3BA 3CSGA 4TLLB 1DPEA 4GL8A 1ATGA 2XXUA 1BP5A 2Q2CA 5AE4A 4X1BA 3MPLA 4OEVA 2UYEA 4RK9A 4R6YA 4OWDA 5B7DA 4LZ5A 4KR5A 1F9BA 3FD3A 1Y3NA 2RCAA 4XIGQ 5CMMA 3PPQA 3H06B 5M2VA 2QPQA 2RC8A 1CE2A 1CB6A 1MS7A 4YU0A 2H98A 2IEEA 4N07A 4IO2A 1B3EA 1NH7A 4WKMA 3GBAA 4PQJA 3O6IA 1ZKBA 1URSA 1FQAA 1WVJA 3MVZA 1MPDA 3PPOA 2QL3A 2ABHA 3CFXA 5H8NB 3IJXB 3UIFA 4DZ1A 4IGTA 2P0SA 1M5BA 3K0VA 4JDFA 2QS1A 4YZZA 4QFOA 4QRZA 3OELA 4QSCA 3O9PA 1A7LA 4FJPA 3IR1A 5DT6A 3A3CA 5ITOA 3EHUA 3OENA 1I6QA 2XXHA 4M4GA 4YKKA 3S4UA 3MVWA 3L6GA 3RTFB 1IQ7A 5ELVA 1MY4A 3PV0E 4YB5A 3PMXA 2Y84A 2NWJA 4Q8RA 2OCUA 4XKPA 2HFBA 3UGWA 4F3GA 3CI8A 2V3TA 1B2HA 2QSXA 3DELB 4IO6A 1B4HA 2O7IA 3T9HB 1O7TA 4N13A 5J1DA 3C36A 3FGSA 3RQTA 3UK4A 5I59B 2O7UA 3S9EA 4ISUA 4UA8A 3IOWA 3VLVA 3IL1B 4U4XA 3TTKA 2VP1A 3FXRA 4IY6A 5CBSA 3TODA 2I0CA 4TQUQ 4KCCA 2OWTA 1FTMA 4ZE8A 5JK4A 3G3GA 1YPNA 4POWA 4XXUA 3Q29A 3T9VA 3C31A 1ZLQA 4HW8A 1N7XA 4AQ4A 1LGBC 1MXWA 5CI5A 1B58A 3U93A 3JZJA 3D4GA 4ZEBA 1L5TA 2ONKE 2D3IA 4F1VA 2UVIA 4KI0E 1D4NA 2AL5A 4OTEA 2DP8A 4KCDA 3THIA 2DSFA 4JWOA 5I56A 2F6PA 4O3BA 3PUWE 3IORA 1II5A 4F1UA 4BDMA 2XXQA 2I4CA 1IXGA 3PUYE 4NF5A 3TCGA 2QS2A 3G3KA 3H6TA 5K2YA 4GLIA 1DSNA 1QW0A 1B3GA 4P0GA 2B65A 3SEVA 2FA7A 3KBRA 5IAIA 2DVCA 2ALUA 2W7YA 3C4MA 3MQ9A 4GXAA 4F2QA 5H8FA 1LB9A 2ONSA 4EF2A 2V3QA 4QFLA 2AIXA 3CSBA 1FW0A 3RT8A 3IX1A 1OMPA 3ZS6A 1HSJA 1TFDA 2F7AA 3N6UA 3EQ1A 1GTKA 3KSXA 3VE1B 1MY1A 3IO6A 4ESWA 3TPAA 2KLFA 3QUFA 2DOJA 4OFJA 2F6GA 4OFLA 1I6BA 4LA9A 1LFGA 1IXHA 3B7DA 3B6WA 3FJ7A 4PFWA 1Y1ZA 4RNSA 1VFEA 3BFTA 3VV5A 3L6HA 1AIVA 3TMGA 2YPNA 1P1OA 2Q89A 3FASA 4X9TA 2THIA 3RN8A 4DIGA 1I6AA 1VSOA 3TTMA 1OQGA 5KCJB 4ECFA 3IOUA 2ZMBA 1LAXA 3QK6A 5KCJA 1R9QA 2Z8DA 4E0XA 2GFEA 3PUVE 1LCFA 3KZGA 1D3KA 1XT8A 4F3BA 5TU0A 3U72A 4Q5TA 1SW5A 4YKPA 5CMKA 4JWYA 2UVGA 2V25A 2DXYA 1JNFA 2I49A 1QKBA 5DYHA 3TDJA 1EH3A 1JW4A 1SI1A 4GL0A 3PUZE 1GV8A 2XXVA 3N5LA 4KPTA 4EXLA 3LBSA 4RK2A 2F97A 1P1NA 4ZECA 3AXFA 3K1NA 4R9GA 1DMBA 1RYXA 1MXUA 5LOMA 4YKIA 3DP6A 3PGFA 1IITA 4OEUA 2REJA 4YB6A 1UIVA 2DXRA 3SEWA 3RLFE 1MM7A 3ZKLA 1MQGA 3H4ZA 2F8DA 4AB5A 1LLSA 1B5HA 3ODBA 1IXIA 5I84A 1BKAA 3B6TA 1O63A 3G3JA 4YKJA 1LSTA 3B6QA 2H99A 4U2RA 3E3KA 3D4CA 3FVGA 1ZU0A 3ECRA 5HBCA 4H65A 3TTLA 1Q1KA 5F7VA 3GLBA 2XXTA 2HEUA 2CZLA 4FATA 1B4ZA 2F36A 3KG2A 1BIYA 3VVFA 3KEIA 1SDXA 4H5GA 2XXWA 5CMBA 3LUYA 3ILTB 1AH5A 3IOVA 3K2DA 2REGA 4YICA 4QFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NF8 A;  3KSJ A;  1MXZ A;  4FAJ A;  1Z7M E;  2D5W A;  2O84 X;  1MY0 A;  3TEL A;  3M3L A;  1QUI A;  1H3D A;  1Y4C A;  3K4U A;  3K00 A;  4I8C A;  3H03 A;  3G3F A;  1LBC A;  1SI0 A;  4IO7 A;  1SD3 A;  3SET A;  1PC3 A;  1DPP A;  2P2A A;  2AYS A;  5A5X A;  4F31 B;  2Q9T A;  4MBP A;  3S9M C;  3HV1 A;  4OEN A;  3EN3 A;  1AMF A;  3H3G A;  3OSR A;  3OO6 A;  4PFY A;  3HO7 A;  2OJT A;  1B3L A;  4LP2 B;  4R73 A;  3FVK A;  3IB2 A;  4OHN A;  3E4R A;  4NE4 A;  4EUO A;  4L17 A;  4DCY A;  4F2O A;  5FHM A;  5ICT A;  4FOR A;  1S7Y A;  5F1Q A;  1H43 A;  1B46 A;  4MLQ A;  1LFH A;  3T22 A;  2UVH A;  4G8H A;  3VDF A;  2V93 A;  4KYD A;  1SYI A;  4BDL A;  4PE5 B;  1Y1M A;  3MP6 A;  2DYX A;  1XC1 A;  1B32 A;  4OVJ A;  4G8M A;  3K6W A;  4ZED A;  2F7C A;  3Q26 A;  3FIR A;  1IEJ A;  1GGG A;  1I69 A;  1B5J A;  4FIM A;  1TFA A;  5I2N B;  2QMW A;  5H8N A;  4GVO A;  4QFP A;  5I2N A;  1OVB A;  1WDN A;  2Y7R A;  4BDR A;  3IAZ A;  4F1Y A;  1RKM A;  1VFD A;  4QF9 A;  1JW1 A;  4GWO A;  4LVQ A;  2I58 A;  1EZ9 A;  3OD7 A;  4WEP A;  1FTO A;  1B1X A;  4F3P A;  4X1D A;  3C33 A;  3CIJ A;  1Q35 A;  3K6U A;  4QSE A;  4HTG A;  4ELQ A;  5DVJ A;  1H45 A;  5ISU A;  2HZK A;  2VHA A;  5HM4 B;  5I58 B;  1M5F A;  1EU8 A;  1TT1 A;  3EHT A;  3HCQ A;  1A55 A;  3HST A;  5EHS A;  1IIW A;  3N6T A;  3M8U A;  3FXQ A;  4QSD A;  1S9T A;  3TCH A;  3PPP A;  1N0T A;  4U21 A;  2B3F A;  5I2K B;  1P1W A;  4TLM B;  1OLC A;  4K3F A;  3F11 A;  4H6D A;  2FYI A;  3MVY A;  4KQP A;  3QYT A;  4LON B;  4KYS A;  5I2K A;  3BKI B;  1PBQ A;  1NNP A;  2Z8E A;  1M5C A;  5I59 A;  4DE8 A;  4LAT A;  1NH8 A;  4R2F A;  3HHG A;  4XKN A;  1QJM A;  5L9O A;  2XHD A;  4HCY A;  3MUQ A;  4IGR A;  3VLU A;  1PBP A;  2ANJ A;  2Q2A A;  4DXB A;  1SBP A;  2ZNS A;  3FV1 A;  4R6K A;  4IO3 A;  2O51 A;  4UAC A;  4RXL A;  1A99 A;  3OO7 A;  4R74 A;  4OES A;  2Y7P A;  3QIM A;  1D9Y A;  2DS9 A;  3DLN A;  4I9D A;  4F22 A;  2PVU A;  4DDD A;  1FQC A;  4FEC A;  4ZEI A;  3OXN A;  1O64 A;  1P1U A;  2AL4 A;  2VOZ A;  4NF4 B;  4JSD A;  2PT2 A;  3FJG A;  1FQF A;  1ZMG A;  3M3F A;  5AA3 A;  1NNK A;  3V89 B;  4NF4 A;  3M3K A;  4TOZ A;  2Q8J A;  3TQL A;  3UN6 A;  3MWB A;  5AA2 D;  2XX9 A;  1B7Z A;  2GHA A;  3TKD A;  2HXW A;  3N26 A;  4ELR A;  1Y9U A;  4MH5 A;  5CBR A;  1UTH B;  1A8F A;  3VFJ A;  1EZP A;  2A5S A;  2HAV A;  1UTH A;  3PU5 A;  3BBR A;  4EQB A;  4ZDM A;  2H25 A;  3SKP A;  3SEY A;  3UOR A;  4R6H A;  3O97 A;  3TTN A;  2ESN A;  1B6H A;  1H76 A;  4EQ9 A;  4R72 A;  3H6V A;  2Q88 A;  2CMO A;  3OO9 A;  3U94 A;  3I5O A;  1PEB A;  2Z22 A;  4RPN A;  4RJZ A;  1JQF A;  3IB1 A;  4N6P A;  3K6V A;  4ELO A;  1YAE A;  3HPI A;  3H6U A;  4NED A;  1MQH A;  4FED A;  1FTJ A;  5TPA B;  2R9J A;  3O66 A;  1JET A;  5TPA A;  1ZBM A;  4KHZ E;  3MJN A;  4OZ9 A;  3OEM A;  2X7Q A;  4NMY A;  3C35 A;  2QJE A;  2RC9 A;  1S50 A;  4ZZE A;  1XVX A;  2OBG A;  3VXB A;  3LR1 A;  2DVZ A;  4DLD A;  2NVU B;  5JTY B;  3K1M A;  1N3X A;  3TFL A;  4WED A;  2H5Y A;  5JTY A;  4ELP A;  1NMU A;  2XXY A;  5AA2 B;  3R7X A;  1JVX A;  1QKA A;  4G4P A;  3T96 B;  3S2V A;  4LUB A;  4C1T A;  1Y3Q A;  2XX7 A;  1DTG A;  1URG A;  3JYR A;  1JEV A;  1R6Z A;  3QXM A;  3MAM A;  4OMB A;  1MY3 A;  3PUX E;  1N04 A;  3Q27 A;  3MPK A;  4Z0I A;  3T9U A;  3K02 A;  1JW5 A;  3DP8 A;  5DEX B;  3KOT A;  3FVN A;  3KJT A;  2Z8F A;  4O3A A;  1MH3 A;  2OK2 A;  4F29 A;  2E0S A;  2RF1 A;  5ICQ A;  3ZKK A;  2Y7K A;  3GBB A;  3VXC A;  2QRY A;  1SW4 A;  4P11 A;  4XKR A;  4G77 A;  3CFZ A;  2DWJ A;  4OET A;  1POT A;  2QMX A;  1QUL A;  2V84 A;  3JV9 A;  4IB2 A;  1LFI A;  1POY 1;  1VR5 A;  1R1N A;  5L9S A;  1MH4 A;  4G68 C;  1DOT A;  3O29 A;  1OLA A;  2YLN A;  3RGY A;  5AA4 B;  3U1O A;  4IO5 A;  3KN3 A;  3K1P A;  2DWI A;  4U1O A;  1PB8 A;  4G68 B;  1NNT A;  2GRV A;  2G93 A;  4F18 A;  3ZSF A;  3OO8 A;  1Y3P A;  1UTB B;  3SER A;  2DE3 A;  2I3W A;  3K6X A;  3IO4 A;  2ZYO A;  4C0R A;  2ZYM A;  4EXK A;  4OYV A;  1PB7 A;  2M8C A;  3P7I A;  2IA4 A;  3Q25 A;  2F78 A;  3RY3 A;  3R6U A;  2O1L A;  4LQ5 A;  3H7M A;  2F5X A;  3PMV A;  3RNN A;  2HCA A;  2XXI A;  2WKY A;  4R9F A;  5H8Q B;  1MRP A;  3TZA A;  4RYA A;  3RPW A;  2FNC A;  2ZXT A;  4YMB A;  1HSL A;  2I0B A;  5H8Q A;  2I4B A;  3KFM A;  4RA1 A;  4KYE A;  4HS7 A;  5CMC A;  2O68 A;  1NKX A;  1QUK A;  3UP9 A;  4HCW A;  3QSL A;  3W9V A;  3MZ9 A;  3V5A A;  3TEP A;  1IZ1 A;  4THI A;  4JSO A;  1H44 A;  3OEK A;  1UQW A;  1ZTY A;  4R75 A;  3LSX A;  2HZL A;  1T0K A;  2PYY A;  5IKB A;  2UYF A;  4QHQ A;  3KOS A;  3IK6 B;  4ESX A;  4GOT A;  1DTZ A;  1MDP 1;  1MDQ A;  1XOC A;  4ZEF A;  1KWH A;  3CR9 A;  3W9W A;  1B0L A;  2A5T B;  5L9M A;  4GFR A;  1AOV A;  1MM6 A;  2A5T A;  1B40 A;  2HAU A;  4FE8 A;  4X48 A;  5EYF A;  4DXU A;  4F19 A;  1Y4T A;  1BTJ A;  1LBB A;  3FV2 A;  3TTR A;  4OQO A;  2E1S A;  3C32 A;  3H6W A;  5FTH A;  1JEU A;  3LSL A;  1GVC A;  2R6G E;  3PPN A;  1B1H A;  2ONR A;  3G7W A;  1B51 A;  3O6H A;  3SEU A;  4BLA A;  1TXF A;  1QUJ A;  4RPO A;  3U8Q A;  1NNF A;  1N7W A;  1ANF A;  3EPE A;  3KN8 A;  4EDP A;  4Z7E A;  2X7P A;  3PD9 A;  1LCT A;  2GHB A;  1M5E A;  3TQW A;  3I3V A;  3T93 B;  3PMW A;  2NXO A;  1SW1 A;  4JWX A;  2OWS A;  4PFU A;  3FXU A;  2VGQ A;  3FAT A;  2BJJ X;  3CRB A;  4H67 A;  2XXX A;  2F7B A;  5I58 A;  3W15 C;  3A09 A;  1MXX A;  3MZB A;  4IO4 A;  1PDA A;  3ILU B;  5FHO A;  3UA8 A;  1OVT A;  2F34 A;  1MXV A;  4YMA A;  2V3U A;  2XD3 A;  1B9J A;  1MQJ A;  1ELJ A;  1MXY A;  5DTB A;  3VVE A;  1HSE A;  1LB8 A;  3IJO B;  1IUD A;  2DQV A;  3BFU A;  4ZE9 A;  2O69 A;  2RC7 A;  1AL3 A;  3G3H A;  1R9L A;  1B3F A;  4BDO A;  3V8X B;  3MP8 A;  3U92 A;  4MF3 A;  1LAH E;  3GZG A;  4FEB A;  4AB6 A;  2DE2 A;  3T9X B;  4GRK A;  1A8E A;  3EF7 A;  5ITP A;  1TWY A;  3G3I A;  2OZZ A;  1B5I A;  4OXV A;  4YB7 A;  1FQE A;  3FZV A;  2GH9 A;  1SW2 A;  1VE4 A;  2PMS A;  3CVG A;  3KGC A;  3O2A A;  1LAF E;  3DP4 A;  1P1Q A;  1MQI A;  1FQB A;  1MY2 A;  5DVI A;  5I56 B;  1PB9 A;  2XXP A;  3E13 X;  4DXC A;  4OER A;  5DVF A;  4G8N A;  2XX8 A;  2DWH A;  2RKM A;  2HQ0 A;  5BWJ A;  4C1U A;  2F35 A;  4GIZ A;  3KJ7 A;  1USY H;  1WOD A;  4GF8 A;  4H8J A;  4MFI A;  3CG1 A;  2X26 A;  5K2X A;  4H5F A;  5CRY A;  4NF5 B;  3TCF A;  3E9X A;  2VD3 A;  1Z7N E;  3LSF B;  5JEI A;  3VLW A;  2NOO A;  3SDF A;  2ZYN A;  4QFN A;  1URD A;  3MC2 A;  5H8F B;  3T66 A;  2I48 A;  3VVD A;  3I6V A;  4JBZ A;  5FHN A;  3O28 A;  3OSQ A;  4I62 A;  5H8H B;  4Q0C A;  4U1Z A;  2UXA A;  4WXJ A;  1EZO A;  5H8H A;  1MQD A;  3FVO A;  5FTI A;  2LAO A;  1FTL A;  2PX1 A;  3PD8 A;  2RCB A;  3SES A;  1YTV A;  3LSW A;  2VD2 A;  2ZYK A;  1USY E;  1US5 A;  3N94 A;  4RY1 A;  5L8D A;  2RIN A;  3OOA A;  4POX A;  1SQY A;  2Z23 A;  1N3W A;  4LZ8 A;  3TUS A;  2I3V A;  4G2Z A;  1XVY A;  5H8S A;  1B7U A;  1D9V A;  4LQ2 A;  3DM0 A;  3WAE A;  1ZIU A;  3HHF A;  3MP1 A;  3IB0 A;  4BDQ A;  3MBP A;  3R26 A;  1GR2 A;  1LAG E;  4F3S A;  4PFT A;  1FCK A;  3IOT A;  1Y20 A;  4M1V A;  2H4I A;  3O6G A;  4ZEK A;  1A54 A;  1N84 A;  4NTL A;  4NF6 B;  4BDN A;  2YJP A;  4ZS9 A;  1YCJ A;  2ZNT A;  1B05 A;  2DWA A;  1UIU A;  3RUM A;  2NUV A;  4NF6 A;  3S9N C;  4U22 A;  3OMB A;  1B3H A;  5KDT B;  2G29 A;  5AA2 A;  2R71 A;  4EQ7 A;  1A40 A;  4DCX A;  5KDT A;  1BLF A;  1SVX B;  2QS4 A;  3C9H A;  3FJM A;  4OFO A;  4R2B A;  4LZ7 A;  4P0I A;  5AA1 A;  5TP9 B;  2D21 A;  1OQH A;  4H8I A;  3MW0 A;  1N76 A;  5I57 B;  5B70 A;  4I1D A;  5TP9 A;  4O3C A;  4ND9 A;  2PBW A;  4XTC Q;  5I57 A;  2XD2 A;  5BUU A;  4U4S A;  4IY5 A;  1NFT A;  1US4 A;  3K01 A;  4ONY A;  3QUJ A;  2I6E A;  5DEX A;  4JB7 A;  3WAF A;  4F39 A;  1JVY A;  4ZZA A;  1M5D A;  2ZNU A;  4YAH X;  5CM6 A;  1J1N A;  2PT1 A;  1B52 A;  1RYO A;  4KD5 A;  3C34 A;  4NWC A;  1OIB A;  1P99 A;  2XXR A;  3LC8 A;  1B7H A;  2DE4 A;  3RTW B;  4XKQ A;  1XHY A;  2O1M A;  1MPC A;  5EHM A;  2H9B A;  3QAX A;  3V83 A;  2P1S A;  1XS5 A;  4PET A;  3A3U A;  5AA4 A;  4GQO A;  3FUZ A;  3TYH A;  1SYH A;  4G68 A;  4NWD A;  5CC2 A;  1UTB A;  4NF8 B;  1IXC A;  1FQD A;  2OLB A;  3HN0 A;  4U23 A;  2QS3 A;  4GXS B;  4Q30 B;  3TAJ A;  1B0H A;  1MPB A;  3GXA A;  4H1X A;  4JXI A;  4H0W A;  1MG1 A;  1QVS A;  2Y7W A;  1FTK A;  5HPQ A;  3SEX A;  5KZT A;  3CFL A;  4KFQ A;  3MZ1 A;  3CG3 A;  4E0W A;  3S9L C;  2UVJ A;  3ONM A;  4MLV A;  3Q28 A;  4EF1 A;  5A5X B;  3PPR A;  1ZJL A;  3KN7 A;  2O6A A;  4PP0 A;  4GD5 A;  3RT6 B;  3USD A;  3EHS A;  3MVX A;  1NL5 A;  2Y7I A;  2B3B A;  3CSG A;  4TLL B;  1DPE A;  4GL8 A;  1ATG A;  2XXU A;  1BP5 A;  2Q2C A;  5AE4 A;  4X1B A;  3MPL A;  4OEV A;  2UYE A;  4RK9 A;  4R6Y A;  4OWD A;  5B7D A;  4LZ5 A;  4KR5 A;  1F9B A;  3FD3 A;  1Y3N A;  2RCA A;  4XIG Q;  5CMM A;  3PPQ A;  3H06 B;  5M2V A;  2QPQ A;  2RC8 A;  1CE2 A;  1CB6 A;  1MS7 A;  4YU0 A;  2H98 A;  2IEE A;  4N07 A;  4IO2 A;  1B3E A;  1NH7 A;  4WKM A;  3GBA A;  4PQJ A;  3O6I A;  1ZKB A;  1URS A;  1FQA A;  1WVJ A;  3MVZ A;  1MPD A;  3PPO A;  2QL3 A;  2ABH A;  3CFX A;  5H8N B;  3IJX B;  3UIF A;  4DZ1 A;  4IGT A;  2P0S A;  1M5B A;  3K0V A;  4JDF A;  2QS1 A;  4YZZ A;  4QFO A;  4QRZ A;  3OEL A;  4QSC A;  3O9P A;  1A7L A;  4FJP A;  3IR1 A;  5DT6 A;  3A3C A;  5ITO A;  3EHU A;  3OEN A;  1I6Q A;  2XXH A;  4M4G A;  4YKK A;  3S4U A;  3MVW A;  3L6G A;  3RTF B;  1IQ7 A;  5ELV A;  1MY4 A;  3PV0 E;  4YB5 A;  3PMX A;  2Y84 A;  2NWJ A;  4Q8R A;  2OCU A;  4XKP A;  2HFB A;  3UGW A;  4F3G A;  3CI8 A;  2V3T A;  1B2H A;  2QSX A;  3DEL B;  4IO6 A;  1B4H A;  2O7I A;  3T9H B;  1O7T A;  4N13 A;  5J1D A;  3C36 A;  3FGS A;  3RQT A;  3UK4 A;  5I59 B;  2O7U A;  3S9E A;  4ISU A;  4UA8 A;  3IOW A;  3VLV A;  3IL1 B;  4U4X A;  3TTK A;  2VP1 A;  3FXR A;  4IY6 A;  5CBS A;  3TOD A;  2I0C A;  4TQU Q;  4KCC A;  2OWT A;  1FTM A;  4ZE8 A;  5JK4 A;  3G3G A;  1YPN A;  4POW A;  4XXU A;  3Q29 A;  3T9V A;  3C31 A;  1ZLQ A;  4HW8 A;  1N7X A;  4AQ4 A;  1LGB C;  1MXW A;  5CI5 A;  1B58 A;  3U93 A;  3JZJ A;  3D4G A;  4ZEB A;  1L5T A;  2ONK E;  2D3I A;  4F1V A;  2UVI A;  4KI0 E;  1D4N A;  2AL5 A;  4OTE A;  2DP8 A;  4KCD A;  3THI A;  2DSF A;  4JWO A;  5I56 A;  2F6P A;  4O3B A;  3PUW E;  3IOR A;  1II5 A;  4F1U A;  4BDM A;  2XXQ A;  2I4C A;  1IXG A;  3PUY E;  4NF5 A;  3TCG A;  2QS2 A;  3G3K A;  3H6T A;  5K2Y A;  4GLI A;  1DSN A;  1QW0 A;  1B3G A;  4P0G A;  2B65 A;  3SEV A;  2FA7 A;  3KBR A;  5IAI A;  2DVC A;  2ALU A;  2W7Y A;  3C4M A;  3MQ9 A;  4GXA A;  4F2Q A;  5H8F A;  1LB9 A;  2ONS A;  4EF2 A;  2V3Q A;  4QFL A;  2AIX A;  3CSB A;  1FW0 A;  3RT8 A;  3IX1 A;  1OMP A;  3ZS6 A;  1HSJ A;  1TFD A;  2F7A A;  3N6U A;  3EQ1 A;  1GTK A;  3KSX A;  3VE1 B;  1MY1 A;  3IO6 A;  4ESW A;  3TPA A;  2KLF A;  3QUF A;  2DOJ A;  4OFJ A;  2F6G A;  4OFL A;  1I6B A;  4LA9 A;  1LFG A;  1IXH A;  3B7D A;  3B6W A;  3FJ7 A;  4PFW A;  1Y1Z A;  4RNS A;  1VFE A;  3BFT A;  3VV5 A;  3L6H A;  1AIV A;  3TMG A;  2YPN A;  1P1O A;  2Q89 A;  3FAS A;  4X9T A;  2THI A;  3RN8 A;  4DIG A;  1I6A A;  1VSO A;  3TTM A;  1OQG A;  5KCJ B;  4ECF A;  3IOU A;  2ZMB A;  1LAX A;  3QK6 A;  5KCJ A;  1R9Q A;  2Z8D A;  4E0X A;  2GFE A;  3PUV E;  1LCF A;  3KZG A;  1D3K A;  1XT8 A;  4F3B A;  5TU0 A;  3U72 A;  4Q5T A;  1SW5 A;  4YKP A;  5CMK A;  4JWY A;  2UVG A;  2V25 A;  2DXY A;  1JNF A;  2I49 A;  1QKB A;  5DYH A;  3TDJ A;  1EH3 A;  1JW4 A;  1SI1 A;  4GL0 A;  3PUZ E;  1GV8 A;  2XXV A;  3N5L A;  4KPT A;  4EXL A;  3LBS A;  4RK2 A;  2F97 A;  1P1N A;  4ZEC A;  3AXF A;  3K1N A;  4R9G A;  1DMB A;  1RYX A;  1MXU A;  5LOM A;  4YKI A;  3DP6 A;  3PGF A;  1IIT A;  4OEU A;  2REJ A;  4YB6 A;  1UIV A;  2DXR A;  3SEW A;  3RLF E;  1MM7 A;  3ZKL A;  1MQG A;  3H4Z A;  2F8D A;  4AB5 A;  1LLS A;  1B5H A;  3ODB A;  1IXI A;  5I84 A;  1BKA A;  3B6T A;  1O63 A;  3G3J A;  4YKJ A;  1LST A;  3B6Q A;  2H99 A;  4U2R A;  3E3K A;  3D4C A;  3FVG A;  1ZU0 A;  3ECR A;  5HBC A;  4H65 A;  3TTL A;  1Q1K A;  5F7V A;  3GLB A;  2XXT A;  2HEU A;  2CZL A;  4FAT A;  1B4Z A;  2F36 A;  3KG2 A;  1BIY A;  3VVF A;  3KEI A;  1SDX A;  4H5G A;  2XXW A;  5CMB A;  3LUY A;  3ILT B;  1AH5 A;  3IOV A;  3K2D A;  2REG A;  4YIC A;  4QFK A; 
#chains in the Genus database with same CATH topology
 4NF8 A;  1LBV A;  3KSJ A;  1MXZ A;  4FAJ A;  1Z7M E;  2D5W A;  2O84 X;  1MY0 A;  3TEL A;  3M3L A;  1QUI A;  1H3D A;  1Y4C A;  3K4U A;  3K00 A;  4I8C A;  3H03 A;  3G3F A;  1LBC A;  1SI0 A;  4IO7 A;  2Q74 A;  1JP4 A;  1SD3 A;  3SET A;  1QGX A;  1LBY A;  1PC3 A;  1DPP A;  2P2A A;  2AYS A;  5A5X A;  4F31 B;  3FXB A;  4GWW A;  2Q9T A;  4MBP A;  3S9M C;  3HV1 A;  4OEN A;  3EN3 A;  1AMF A;  3H3G A;  3OSR A;  2WBD A;  3OO6 A;  4HE1 A;  4PFY A;  3HO7 A;  2OJT A;  1B3L A;  4LP2 B;  4R73 A;  4LN5 A;  3FVK A;  3IB2 A;  4OHN A;  3E4R A;  2ZZW A;  4NE4 A;  4EUO A;  4L17 A;  5ET5 A;  4DCY A;  4F2O A;  5FHM A;  5ICT A;  4FOR A;  2F3B A;  3KBZ A;  1S7Y A;  1FPE A;  5F1Q A;  4N6K A;  1H43 A;  1B46 A;  4MLQ A;  1LFH A;  3T22 A;  4GBW A;  4X04 A;  2UVH A;  4G8H A;  3VDF A;  2V93 A;  4KYD A;  4MJO A;  1SYI A;  5EYG A;  4BDL A;  4PE5 B;  1Y1M A;  3MP6 A;  2DYX A;  5I3S A;  2BJI A;  1XC1 A;  1B32 A;  4OVJ A;  4P9K A;  4G8M A;  3K6W A;  4ZED A;  4KXP A;  2F7C A;  3Q26 A;  3FIR A;  2V4C A;  1IEJ A;  1GGG A;  1I69 A;  1B5J A;  4FIM A;  4NG7 A;  4P47 A;  1TFA A;  4O7M A;  5I2N B;  2QMW A;  5H8N A;  4GVO A;  2HPG A;  4QFP A;  5I2N A;  1OVB A;  1WDN A;  2Y7R A;  3HFU A;  4BDR A;  1XI6 A;  3IAZ A;  4F1Y A;  4HE2 A;  4GX3 A;  2QFL A;  1RKM A;  1VFD A;  2HHM A;  4QF9 A;  1JW1 A;  4GWO A;  4LVQ A;  4HXV A;  2I58 A;  1EZ9 A;  3OD7 A;  4WEP A;  1FTO A;  1B1X A;  4F3P A;  4X1D A;  3C33 A;  3CIJ A;  1Q35 A;  3K6U A;  4QSE A;  4HTG A;  4ELQ A;  5DVJ A;  1H45 A;  5ISU A;  2HZK A;  2VHA A;  5HM4 B;  5I58 B;  1M5F A;  1EU8 A;  1TT1 A;  3EHT A;  3ROJ A;  1K9Y A;  3HCQ A;  1A55 A;  3HST A;  5EHS A;  1IIW A;  1KA1 A;  3M8U A;  3N6T A;  3FXQ A;  4QSD A;  1S9T A;  3TCH A;  3PPP A;  1N0T A;  4U21 A;  2B3F A;  2WX9 A;  1LBX A;  3ISP A;  5I2K B;  1P1W A;  4TLM B;  4PGP A;  1OLC A;  4K3F A;  3F11 A;  4H6D A;  4NGU A;  2FYI A;  3MVY A;  4KQP A;  3QYT A;  4LON B;  4KYS A;  5I2K A;  3BKI B;  1PBQ A;  1NNP A;  2Z8E A;  1M5C A;  2WYK A;  5I59 A;  1NV4 A;  4DE8 A;  4LAT A;  2WEF A;  1NH8 A;  4R2F A;  3HHG A;  4XKN A;  1QJM A;  4MX6 A;  5L9O A;  2CZK A;  2XHD A;  4HCY A;  3MUQ A;  4IGR A;  3VLU A;  1PBP A;  2ANJ A;  2Q2A A;  4DXB A;  3NOH A;  1SBP A;  2ZNS A;  3FV1 A;  4R6K A;  4IO3 A;  2O51 A;  4UAC A;  4RXL A;  1A99 A;  3OO7 A;  4R74 A;  4OES A;  2Y7P A;  3QIM A;  1D9Y A;  2DS9 A;  3DLN A;  4I9D A;  4F22 A;  2PVU A;  4DDD A;  1FQC A;  4FEC A;  5FBP A;  4ZEI A;  3OXN A;  1O64 A;  2VPN A;  1P1U A;  2AL4 A;  2VOZ A;  4NF4 B;  1FJ6 A;  1IMC A;  4JSD A;  2PT2 A;  3FJG A;  1FQF A;  1ZMG A;  3M3F A;  5AA3 A;  1NNK A;  3V89 B;  5EQ9 A;  1FPF A;  4NF4 A;  3M3K A;  4TOZ A;  2Q8J A;  1RDY A;  3TQL A;  3UN6 A;  3MWB A;  5AA2 D;  2XX9 A;  1B7Z A;  2GHA A;  1NV3 A;  3TKD A;  1FBD A;  2HXW A;  3N26 A;  4ELR A;  1Y9U A;  4MH5 A;  5CBR A;  1UTH B;  1A8F A;  3BIH A;  3FBP A;  3VFJ A;  1EZP A;  2A5S A;  2HAV A;  1UTH A;  3PU5 A;  1LBW A;  3BBR A;  4EQB A;  2P3V A;  4ZDM A;  2H25 A;  1G0H A;  3SKP A;  3SEY A;  3UOR A;  4R6H A;  2VPO A;  3O97 A;  3TTN A;  2ESN A;  1B6H A;  1H76 A;  4MHF A;  4EQ9 A;  4R72 A;  3H6V A;  2Q88 A;  5EQ8 A;  2CMO A;  4GWS A;  1KZ8 A;  3OO9 A;  3U94 A;  3I5O A;  2WBB A;  1NUW A;  1YXI A;  2HXR A;  4DI4 B;  1PEB A;  2Z22 A;  4RPN A;  4RJZ A;  1JQF A;  3IB1 A;  4N6P A;  3K6V A;  4ELO A;  1YAE A;  3HPI A;  3H6U A;  4NED A;  1FSA A;  1MQH A;  4FED A;  2GQ1 A;  1FTJ A;  5TPA B;  2R9J A;  3O66 A;  2CZH A;  1JET A;  5TPA A;  1ZBM A;  4KHZ E;  3MJN A;  4OZ9 A;  2KQZ A;  3OEM A;  2X7Q A;  4NMY A;  2WYP A;  3C35 A;  2QJE A;  1NI9 A;  2RC9 A;  2FIE A;  1NV2 A;  1S50 A;  4ZZE A;  1XVX A;  2OBG A;  3VXB A;  4I3Y A;  3LR1 A;  5DW8 A;  2DVZ A;  4DLD A;  2NVU B;  5JTY B;  3K1M A;  1N3X A;  3TFL A;  4WED A;  1FPK A;  4N15 A;  2H5Y A;  2XWO A;  4NN3 A;  5JTY A;  4ELP A;  1NMU A;  2XXY A;  5AA2 B;  3R7X A;  1JVX A;  3PTY A;  1QKA A;  4G4P A;  3T96 B;  3S2V A;  4LUB A;  4C1T A;  1Y3Q A;  2XX7 A;  1DTG A;  1URG A;  3JYR A;  1JEV A;  1R6Z A;  3QXM A;  4MNI A;  3MAM A;  4OMB A;  1MY3 A;  3PUX E;  1N04 A;  3Q27 A;  3MPK A;  4Z0I A;  3T9U A;  3K02 A;  1JW5 A;  3DP8 A;  5DEX B;  1INP A;  3KOT A;  3FVN A;  3KJT A;  2Z8F A;  4O3A A;  1MH3 A;  2OK2 A;  4F29 A;  2E0S A;  2RF1 A;  5ICQ A;  3ZKK A;  2Y7K A;  3GBB A;  3VXC A;  4PFB A;  2QRY A;  1SW4 A;  5EYH A;  4PFI A;  4P11 A;  4XKR A;  4G77 A;  3CFZ A;  3MST A;  4OVQ A;  2DWJ A;  4OET A;  1POT A;  2FHY A;  2QMX A;  1QUL A;  4P8B A;  2V84 A;  3JV9 A;  4IB2 A;  1LFI A;  1POY 1;  1VR5 A;  1R1N A;  5J16 A;  5L9S A;  1MH4 A;  4G68 C;  1DOT A;  3O29 A;  1OLA A;  2YLN A;  3RGY A;  5AA4 B;  3U1O A;  4IO5 A;  3KN3 A;  2CZI A;  3K1P A;  2DWI A;  4U1O A;  1FPL A;  1PB8 A;  4G68 B;  1NNT A;  2DDK A;  2GRV A;  4PBH A;  2G93 A;  4F18 A;  3ZSF A;  3OO8 A;  1RDZ A;  1Y3P A;  1UTB B;  3SER A;  2DE3 A;  2I3W A;  3K6X A;  1CNQ A;  3IO4 A;  2ZYO A;  4C0R A;  2ZYM A;  4EXK A;  1DBZ A;  1NV7 A;  4OYV A;  1PB7 A;  2M8C A;  1NUX A;  2XWI A;  2FBP A;  3P7I A;  2PFY A;  2IA4 A;  3Q25 A;  2F78 A;  3RY3 A;  3R6U A;  2O1L A;  4LQ5 A;  3H7M A;  5EQ7 A;  2KR0 A;  1LBZ A;  2F5X A;  3PMV A;  3RNN A;  4MMP A;  2HCA A;  2XXI A;  2WKY A;  4R9F A;  5H8Q B;  1MRP A;  3TZA A;  4RYA A;  3RPW A;  2FNC A;  2ZXT A;  2OX3 A;  4YMB A;  1HSL A;  2I0B A;  5H8Q A;  2I4B A;  3KFM A;  4RA1 A;  4KYE A;  1IME A;  4HS7 A;  5CMC A;  4GWZ A;  2O68 A;  1FPI A;  1NKX A;  1QUK A;  3UP9 A;  4HCW A;  3QSL A;  3W9V A;  3MZ9 A;  3V5A A;  4N17 A;  3TEP A;  1IZ1 A;  1FBP A;  4THI A;  4JSO A;  1H44 A;  3OEK A;  1UQW A;  1ZTY A;  4R75 A;  4PGN A;  3LSX A;  2HZL A;  1T0K A;  2PYY A;  1NUY A;  5IKB A;  1FBH A;  2UYF A;  4QHQ A;  3KOS A;  3IK6 B;  4ESX A;  4GOT A;  1DTZ A;  1MDP 1;  1MDQ A;  1XOC A;  4ZEF A;  1KWH A;  3CR9 A;  3W9W A;  1B0L A;  2A5T B;  5L9M A;  4H45 A;  4GFR A;  1AOV A;  1MM6 A;  4N8Y A;  2CEY A;  2A5T A;  1B40 A;  2HAU A;  4FE8 A;  4X48 A;  5EYF A;  4DXU A;  2MKZ A;  4F19 A;  1Y4T A;  1BTJ A;  1LBB A;  3FV2 A;  3TTR A;  4OQO A;  2E1S A;  5T3J A;  3C32 A;  3H6W A;  5FTH A;  1JEU A;  3LSL A;  1GVC A;  2R6G E;  3PPN A;  1B1H A;  2ONR A;  3G7W A;  1B51 A;  3O6H A;  3SEU A;  3U65 A;  4BLA A;  4OVT A;  4GWU A;  1TXF A;  1QUJ A;  4RPO A;  3U8Q A;  1NNF A;  1N7W A;  1ANF A;  3EPE A;  3KN8 A;  4EDP A;  4Z7E A;  2X7P A;  3PD9 A;  5IGA A;  1LCT A;  3QMF A;  1FBC A;  1Q9D A;  2GHB A;  1M5E A;  3TQW A;  3I3V A;  3T93 B;  3PMW A;  2NXO A;  1SW1 A;  4JWX A;  2OWS A;  4PFU A;  3FXU A;  2VGQ A;  3FAT A;  2BJJ X;  3CRB A;  4H67 A;  4PE3 A;  2XXX A;  2F7B A;  5I58 A;  3D1R A;  3W15 C;  3A09 A;  1MXX A;  3MZB A;  4IO4 A;  3BIG A;  4PF8 A;  1PDA A;  3ILU B;  5FHO A;  3UA8 A;  1OVT A;  1IMB A;  2F34 A;  1MXV A;  4YMA A;  2V3U A;  2XD3 A;  1B9J A;  1MQJ A;  4I40 A;  1ELJ A;  4NAP A;  1MXY A;  1G0I A;  5DTB A;  3VVE A;  4PTK A;  4XF5 A;  1HSE A;  1LB8 A;  3IJO B;  1IUD A;  2DQV A;  3BFU A;  4ZE9 A;  2O69 A;  2RC7 A;  1AL3 A;  3G3H A;  1R9L A;  1B3F A;  4BDO A;  3V8X B;  4GWX A;  3MP8 A;  3U92 A;  4MF3 A;  1LAH E;  3GZG A;  1YZ0 A;  4FEB A;  4AB6 A;  2DE2 A;  4GWY A;  3T9X B;  4GRK A;  2Y5L A;  4PCD A;  1A8E A;  3EF7 A;  4PDH A;  5ITP A;  1TWY A;  3G3I A;  2OZZ A;  3T1B A;  1B5I A;  4OXV A;  2QVR A;  4MNP A;  1FQE A;  4YB7 A;  3FZV A;  2GH9 A;  1SW2 A;  1VE4 A;  2PMS A;  3CVG A;  3KGC A;  3O2A A;  1LAF E;  3DP4 A;  4MNC A;  1P1Q A;  1MQI A;  1FQB A;  1MY2 A;  5DVI A;  5I56 B;  1PB9 A;  2XXP A;  3E13 X;  4DXC A;  4OER A;  5DVF A;  4G8N A;  2XX8 A;  2DWH A;  2RKM A;  4XEQ A;  2HQ0 A;  5BWJ A;  4NF0 A;  4C1U A;  2F35 A;  4GIZ A;  3KJ7 A;  1USY H;  1WOD A;  4PFR A;  4GF8 A;  4H8J A;  4MFI A;  3CG1 A;  2X26 A;  5K2X A;  4H5F A;  5CRY A;  4NF5 B;  3TCF A;  3E9X A;  2VD3 A;  1Z7N E;  3LV0 A;  3LSF B;  5JEI A;  3VLW A;  4H46 A;  2NOO A;  3SDF A;  2ZYN A;  1AWB A;  4QFN A;  1URD A;  3MC2 A;  5H8F B;  3T66 A;  3RPL B;  2I48 A;  4IR8 A;  3VVD A;  3I6V A;  4JBZ A;  5FHN A;  3O28 A;  3RPL A;  3OSQ A;  1VDW A;  4I62 A;  5H8H B;  4Q0C A;  4U1Z A;  1NV0 A;  2UXA A;  4WXJ A;  1EZO A;  4I3E A;  5H8H A;  1MQD A;  3FVO A;  4HE0 A;  5FTI A;  2OWZ A;  2LAO A;  1FTL A;  2PX1 A;  3PD8 A;  2FVZ A;  2RCB A;  3SES A;  1YTV A;  3LSW A;  2VD2 A;  2ZYK A;  1USY E;  1US5 A;  3N94 A;  4RY1 A;  5L8D A;  2RIN A;  3OOA A;  4POX A;  1SQY A;  2Z23 A;  1N3W A;  4LZ8 A;  3TUS A;  3KC0 A;  4OAN A;  2I3V A;  4G2Z A;  1XVY A;  5H8S A;  1B7U A;  1D9V A;  4LQ2 A;  3DM0 A;  5ET8 A;  3T0J A;  3WAE A;  4NX1 A;  1DK4 A;  1ZIU A;  3HHF A;  3MP1 A;  1NV1 A;  3IB0 A;  4BDQ A;  3MBP A;  3R26 A;  1GR2 A;  1LAG E;  4F3S A;  4PFT A;  1FCK A;  3IOT A;  1Y20 A;  4M1V A;  2H4I A;  3O6G A;  4ZEK A;  1A54 A;  1N84 A;  4NTL A;  4NF6 B;  4BDN A;  2YJP A;  4ZS9 A;  1YCJ A;  2ZNT A;  1B05 A;  2DWA A;  1UIU A;  3RUM A;  2NUV A;  4NF6 A;  3E78 A;  3S9N C;  4U22 A;  3OMB A;  1B3H A;  5KDT B;  2G29 A;  4GBV A;  5AA2 A;  2R71 A;  3A29 A;  2PFZ A;  2L5V A;  4EQ7 A;  1A40 A;  4DCX A;  5KDT A;  1BLF A;  1SVX B;  2QS4 A;  3C9H A;  3FJM A;  4OFO A;  4R2B A;  4LZ7 A;  4P0I A;  5AA1 A;  5TP9 B;  2D21 A;  1OQH A;  4H8I A;  3MW0 A;  1N76 A;  5I57 B;  4PBQ A;  5B70 A;  4I1D A;  5TP9 A;  4O3C A;  4ND9 A;  2PBW A;  4XTC Q;  5I57 A;  2XD2 A;  5BUU A;  2B4M A;  4U4S A;  4IY5 A;  1NFT A;  1US4 A;  1FBG A;  3E79 A;  3K01 A;  3QUJ A;  4ONY A;  2I6E A;  1IMF A;  5DEX A;  4JB7 A;  4G61 A;  3WAF A;  4PAK A;  4F39 A;  5IZ1 A;  1JVY A;  5IM2 A;  4ZZA A;  1M5D A;  2ZNU A;  4N81 A;  4YAH X;  5CM6 A;  1J1N A;  2PT1 A;  1B52 A;  1RYO A;  4KD5 A;  4MAG A;  3C34 A;  4NWC A;  1OIB A;  1P99 A;  2XXR A;  3CHG A;  3LC8 A;  3KC1 A;  1B7H A;  2DE4 A;  2VT5 A;  3RTW B;  4XKQ A;  1XHY A;  2O1M A;  1MPC A;  5EHM A;  2H9B A;  3QAX A;  3V83 A;  2P1S A;  3RYD A;  5F24 A;  1XS5 A;  1FBE A;  4PET A;  3A3U A;  5I7I A;  4OVS A;  5AA4 A;  4GQO A;  3FUZ A;  3TYH A;  1SYH A;  4G68 A;  4NWD A;  5CC2 A;  1UTB A;  4PDD A;  1FPJ A;  4NF8 B;  1IXC A;  1FQD A;  2OLB A;  3HN0 A;  4U23 A;  2QS3 A;  4GXS B;  4Q30 B;  3TAJ A;  1B0H A;  2QVV A;  1MPB A;  3GXA A;  4H1X A;  1SPI A;  4JXI A;  4H0W A;  1MG1 A;  1QVS A;  5LDZ A;  2Y7W A;  1FTK A;  5HPQ A;  3SEX A;  5KZT A;  3CFL A;  4KFQ A;  3MZ1 A;  3CG3 A;  4E0W A;  3S9L C;  2UVJ A;  3ONM A;  4MLV A;  3Q28 A;  2PCR A;  4EF1 A;  4MIJ A;  5A5X B;  3PPR A;  1ZJL A;  3KN7 A;  2O6A A;  4PP0 A;  4GD5 A;  4P56 A;  3RT6 B;  3USD A;  3EHS A;  3MVX A;  1NL5 A;  2Y7I A;  2B3B A;  1K9Z A;  3CSG A;  4TLL B;  1DPE A;  4GL8 A;  1ATG A;  1FRP A;  2XXU A;  1BP5 A;  2Q2C A;  4AS5 A;  5AE4 A;  2P3N A;  4QBA A;  4X1B A;  3MPL A;  4O7I A;  4OEV A;  4O94 A;  2UYE A;  4RK9 A;  4R6Y A;  4P1L A;  4OWD A;  2ZZV A;  5B7D A;  4LZ5 A;  4KR5 A;  1F9B A;  3FD3 A;  1Y3N A;  2RCA A;  4XIG Q;  1BK4 A;  5CMM A;  3PPQ A;  3H06 B;  5M2V A;  2QPQ A;  2RC8 A;  1CE2 A;  1CB6 A;  1MS7 A;  4YU0 A;  2H98 A;  2IEE A;  5IZZ A;  4N07 A;  4IO2 A;  5EQA A;  3IFC A;  1B3E A;  1NH7 A;  4WKM A;  3GBA A;  4PQJ A;  3O6I A;  1ZKB A;  1URS A;  1FQA A;  1WVJ A;  3MVZ A;  2Y5K A;  1MPD A;  3PPO A;  3EKI A;  2QL3 A;  2ABH A;  3CFX A;  5H8N B;  3IJX B;  3UIF A;  4DZ1 A;  4IGT A;  2P0S A;  1M5B A;  3K0V A;  4JDF A;  2QS1 A;  4YZZ A;  4JVD A;  4QFO A;  4QRZ A;  3OEL A;  4QSC A;  3O9P A;  3B8B A;  5A5L A;  1A7L A;  4FJP A;  3IR1 A;  5DT6 A;  3A3C A;  1D9Q A;  5ITO A;  3EHU A;  4OVP A;  3OEN A;  2B4L A;  4PF6 A;  1I6Q A;  2XXH A;  4M4G A;  4YKK A;  3IFA A;  3S4U A;  3MVW A;  3GYY A;  3L6G A;  3RTF B;  1IQ7 A;  5ELV A;  1MY4 A;  3PV0 E;  4YB5 A;  3PMX A;  2Y84 A;  2NWJ A;  4Q8R A;  2OCU A;  4XKP A;  2HFB A;  3UGW A;  4F3G A;  3CI8 A;  2V3T A;  1B2H A;  2QSX A;  3DEL B;  4IO6 A;  1B4H A;  2O7I A;  3T9H B;  1O7T A;  4N6D A;  4N13 A;  5J1D A;  3C36 A;  3FGS A;  4N91 A;  1LEV A;  2FIX A;  3RQT A;  3SZP A;  3UK4 A;  5I59 B;  2R8T A;  2O7U A;  3S9E A;  4XFE A;  4ISU A;  4UA8 A;  3IOW A;  3VLV A;  3IL1 B;  1FPB A;  1NV5 A;  4U4X A;  1NV6 A;  3TTK A;  2XWV A;  2VP1 A;  4GX6 A;  5I5P A;  4N8G A;  3FXR A;  4IY6 A;  5CBS A;  3TOD A;  2I0C A;  4TQU Q;  4KCC A;  2OWT A;  1FTM A;  4ZE8 A;  2ZZX A;  5JK4 A;  3G3G A;  1YPN A;  4POW A;  4XXU A;  3Q29 A;  3T9V A;  3C31 A;  1ZLQ A;  4OVR A;  4HW8 A;  1N7X A;  4AQ4 A;  1LGB C;  1MXW A;  5CI5 A;  1B58 A;  3U93 A;  3JZJ A;  3D4G A;  4ZEB A;  1L5T A;  2ONK E;  2D3I A;  4F1V A;  1FPG A;  2UVI A;  4KI0 E;  1D4N A;  2AL5 A;  1IMA A;  4OTE A;  2DP8 A;  5ET6 A;  1KA0 A;  4MEV A;  4KCD A;  4P1E A;  3THI A;  2DSF A;  4JWO A;  5I56 A;  2F6P A;  4O3B A;  3PUW E;  4NQ8 A;  3IOR A;  1II5 A;  4F1U A;  4BDM A;  2XXQ A;  2I4C A;  1IXG A;  3PUY E;  4PC9 A;  4NF5 A;  3TCG A;  2QS2 A;  3G3K A;  3H6T A;  5K2Y A;  4GLI A;  1DSN A;  4DI3 D;  1QW0 A;  1B3G A;  4P0G A;  2B65 A;  3SEV A;  1FTA A;  2FA7 A;  3KBR A;  5IAI A;  2DVC A;  2ALU A;  2W7Y A;  3C4M A;  3MQ9 A;  4GXA A;  4UAB A;  1YYZ A;  4F2Q A;  5H8F A;  1LB9 A;  2ONS A;  4EF2 A;  2V3Q A;  4QFL A;  2AIX A;  3CSB A;  1FW0 A;  3RT8 A;  2QVU A;  3IX1 A;  1OMP A;  3ZS6 A;  1HSJ A;  1TFD A;  2F7A A;  1IMD A;  4AS4 A;  1FPD A;  2Q8M A;  3N6U A;  3EQ1 A;  1GTK A;  4QXD A;  3KSX A;  3VE1 B;  1MY1 A;  4NHB A;  3IO6 A;  4ESW A;  3TPA A;  2KLF A;  3QUF A;  2DOJ A;  4OFJ A;  2F6G A;  4OFL A;  1I6B A;  4OA4 A;  4LA9 A;  1LFG A;  1IXH A;  3B7D A;  3B6W A;  3FJ7 A;  4PFW A;  4X8R A;  1Y1Z A;  4RNS A;  1VFE A;  3BFT A;  2XXK A;  3VV5 A;  3L6H A;  1AIV A;  3TMG A;  2YPN A;  1P1O A;  2Q89 A;  3FAS A;  4X9T A;  2THI A;  3RN8 A;  1EYJ A;  4DIG A;  1I6A A;  1VSO A;  3TTM A;  1OQG A;  4MCO A;  5KCJ B;  4ECF A;  3IOU A;  2ZMB A;  1LAX A;  3QK6 A;  5KCJ A;  1R9Q A;  2Z8D A;  4E0X A;  2GFE A;  3PUV E;  4FBP A;  1LCF A;  3KZG A;  1D3K A;  1XT8 A;  4F3B A;  5ESY A;  2CEX A;  5TU0 A;  2XA5 A;  3U72 A;  1EYK A;  2XWK A;  4Q5T A;  4JVC A;  1SW5 A;  4YKP A;  5CMK A;  4JWY A;  5ET7 A;  2UVG A;  2V25 A;  2DXY A;  5LTC A;  1JNF A;  2I49 A;  1QKB A;  5DYH A;  3TDJ A;  1EYI A;  1EH3 A;  1JW4 A;  1SI1 A;  4GL0 A;  3PUZ E;  1GV8 A;  2XXV A;  1NUZ A;  3N5L A;  4KPT A;  3B50 A;  4EXL A;  3LBS A;  3LUZ A;  4RK2 A;  4GX4 A;  4JVI A;  4O8M A;  2F97 A;  1P1N A;  4ZEC A;  3AXF A;  4N4U A;  3K1N A;  4R9G A;  1DMB A;  1RYX A;  1MXU A;  5LOM A;  1FBF A;  1RDX A;  4YKI A;  3DP6 A;  3PGF A;  1IIT A;  4OEU A;  2REJ A;  4YB6 A;  1UIV A;  2DXR A;  3SEW A;  3RLF E;  3MYU A;  1MM7 A;  3ZKL A;  1MQG A;  1DCU A;  3H4Z A;  2F8D A;  4AB5 A;  1LLS A;  2JJK A;  1B5H A;  3ODB A;  1IXI A;  5I84 A;  1BKA A;  3B6T A;  1O63 A;  3G3J A;  4YKJ A;  1LST A;  3B6Q A;  2H99 A;  4U2R A;  3E3K A;  3D4C A;  3FVG A;  4PAI A;  1ZU0 A;  3ECR A;  5HBC A;  4H65 A;  3TTL A;  1Q1K A;  5F7V A;  5IZ3 B;  3GLB A;  2XXT A;  2HEU A;  2CZL A;  1FJ9 A;  4FAT A;  4PAF A;  1B4Z A;  2F36 A;  3KG2 A;  1BIY A;  3VVF A;  5IZ3 A;  3KEI A;  2F3D A;  1SDX A;  4H5G A;  2XXW A;  5CMB A;  3LUY A;  3ILT B;  1AH5 A;  3IOV A;  4P3L A;  3K2D A;  2REG A;  4YIC A;  4QFK A; 
#chains in the Genus database with same CATH homology
 4NF8 A;  3KSJ A;  1MXZ A;  4FAJ A;  1Z7M E;  2D5W A;  2O84 X;  1MY0 A;  3TEL A;  3M3L A;  1QUI A;  1H3D A;  1Y4C A;  3K4U A;  3K00 A;  4I8C A;  3H03 A;  3G3F A;  1LBC A;  1SI0 A;  4IO7 A;  1SD3 A;  3SET A;  1PC3 A;  1DPP A;  2P2A A;  2AYS A;  5A5X A;  4F31 B;  2Q9T A;  4MBP A;  3S9M C;  3HV1 A;  4OEN A;  3EN3 A;  1AMF A;  3H3G A;  3OSR A;  3OO6 A;  4PFY A;  3HO7 A;  2OJT A;  1B3L A;  4LP2 B;  4R73 A;  3FVK A;  3IB2 A;  4OHN A;  3E4R A;  4NE4 A;  4EUO A;  4L17 A;  4DCY A;  4F2O A;  5FHM A;  5ICT A;  4FOR A;  1S7Y A;  5F1Q A;  1H43 A;  1B46 A;  4MLQ A;  1LFH A;  3T22 A;  2UVH A;  4G8H A;  3VDF A;  2V93 A;  4KYD A;  1SYI A;  4BDL A;  4PE5 B;  1Y1M A;  3MP6 A;  2DYX A;  1XC1 A;  1B32 A;  4OVJ A;  4G8M A;  3K6W A;  4ZED A;  2F7C A;  3Q26 A;  3FIR A;  1IEJ A;  1GGG A;  1I69 A;  1B5J A;  4FIM A;  1TFA A;  5I2N B;  2QMW A;  5H8N A;  4GVO A;  4QFP A;  5I2N A;  1OVB A;  1WDN A;  2Y7R A;  4BDR A;  3IAZ A;  4F1Y A;  1RKM A;  1VFD A;  4QF9 A;  1JW1 A;  4GWO A;  4LVQ A;  2I58 A;  1EZ9 A;  3OD7 A;  4WEP A;  1FTO A;  1B1X A;  4F3P A;  4X1D A;  3C33 A;  3CIJ A;  1Q35 A;  3K6U A;  4QSE A;  4HTG A;  4ELQ A;  5DVJ A;  1H45 A;  5ISU A;  2HZK A;  2VHA A;  5HM4 B;  5I58 B;  1M5F A;  1EU8 A;  1TT1 A;  3EHT A;  3HCQ A;  1A55 A;  3HST A;  5EHS A;  1IIW A;  3N6T A;  3M8U A;  3FXQ A;  4QSD A;  1S9T A;  3TCH A;  3PPP A;  1N0T A;  4U21 A;  2B3F A;  5I2K B;  1P1W A;  4TLM B;  1OLC A;  4K3F A;  3F11 A;  4H6D A;  2FYI A;  3MVY A;  4KQP A;  3QYT A;  4LON B;  4KYS A;  5I2K A;  3BKI B;  1PBQ A;  1NNP A;  2Z8E A;  1M5C A;  5I59 A;  4DE8 A;  4LAT A;  1NH8 A;  4R2F A;  3HHG A;  4XKN A;  1QJM A;  5L9O A;  2XHD A;  4HCY A;  3MUQ A;  4IGR A;  3VLU A;  1PBP A;  2ANJ A;  2Q2A A;  4DXB A;  1SBP A;  2ZNS A;  3FV1 A;  4R6K A;  4IO3 A;  2O51 A;  4UAC A;  4RXL A;  1A99 A;  3OO7 A;  4R74 A;  4OES A;  2Y7P A;  3QIM A;  1D9Y A;  2DS9 A;  3DLN A;  4I9D A;  4F22 A;  2PVU A;  4DDD A;  1FQC A;  4FEC A;  4ZEI A;  3OXN A;  1O64 A;  1P1U A;  2AL4 A;  2VOZ A;  4NF4 B;  4JSD A;  2PT2 A;  3FJG A;  1FQF A;  1ZMG A;  3M3F A;  5AA3 A;  1NNK A;  3V89 B;  4NF4 A;  3M3K A;  4TOZ A;  2Q8J A;  3TQL A;  3UN6 A;  3MWB A;  5AA2 D;  2XX9 A;  1B7Z A;  2GHA A;  3TKD A;  2HXW A;  3N26 A;  4ELR A;  1Y9U A;  4MH5 A;  5CBR A;  1UTH B;  1A8F A;  3VFJ A;  1EZP A;  2A5S A;  2HAV A;  1UTH A;  3PU5 A;  3BBR A;  4EQB A;  4ZDM A;  2H25 A;  3SKP A;  3SEY A;  3UOR A;  4R6H A;  3O97 A;  3TTN A;  2ESN A;  1B6H A;  1H76 A;  4EQ9 A;  4R72 A;  3H6V A;  2Q88 A;  2CMO A;  3OO9 A;  3U94 A;  3I5O A;  1PEB A;  2Z22 A;  4RPN A;  4RJZ A;  1JQF A;  3IB1 A;  4N6P A;  3K6V A;  4ELO A;  1YAE A;  3HPI A;  3H6U A;  4NED A;  1MQH A;  4FED A;  1FTJ A;  5TPA B;  2R9J A;  3O66 A;  1JET A;  5TPA A;  1ZBM A;  4KHZ E;  3MJN A;  4OZ9 A;  3OEM A;  2X7Q A;  4NMY A;  3C35 A;  2QJE A;  2RC9 A;  1S50 A;  4ZZE A;  1XVX A;  2OBG A;  3VXB A;  3LR1 A;  2DVZ A;  4DLD A;  2NVU B;  5JTY B;  3K1M A;  1N3X A;  3TFL A;  4WED A;  2H5Y A;  5JTY A;  4ELP A;  1NMU A;  2XXY A;  5AA2 B;  3R7X A;  1JVX A;  1QKA A;  4G4P A;  3T96 B;  3S2V A;  4LUB A;  4C1T A;  1Y3Q A;  2XX7 A;  1DTG A;  1URG A;  3JYR A;  1JEV A;  1R6Z A;  3QXM A;  3MAM A;  4OMB A;  1MY3 A;  3PUX E;  1N04 A;  3Q27 A;  3MPK A;  4Z0I A;  3T9U A;  3K02 A;  1JW5 A;  3DP8 A;  5DEX B;  3KOT A;  3FVN A;  3KJT A;  2Z8F A;  4O3A A;  1MH3 A;  2OK2 A;  4F29 A;  2E0S A;  2RF1 A;  5ICQ A;  3ZKK A;  2Y7K A;  3GBB A;  3VXC A;  2QRY A;  1SW4 A;  4P11 A;  4XKR A;  4G77 A;  3CFZ A;  2DWJ A;  4OET A;  1POT A;  2QMX A;  1QUL A;  2V84 A;  3JV9 A;  4IB2 A;  1LFI A;  1POY 1;  1VR5 A;  1R1N A;  5L9S A;  1MH4 A;  4G68 C;  1DOT A;  3O29 A;  1OLA A;  2YLN A;  3RGY A;  5AA4 B;  3U1O A;  4IO5 A;  3KN3 A;  3K1P A;  2DWI A;  4U1O A;  1PB8 A;  4G68 B;  1NNT A;  2GRV A;  2G93 A;  4F18 A;  3ZSF A;  3OO8 A;  1Y3P A;  1UTB B;  3SER A;  2DE3 A;  2I3W A;  3K6X A;  3IO4 A;  2ZYO A;  4C0R A;  2ZYM A;  4EXK A;  4OYV A;  1PB7 A;  2M8C A;  3P7I A;  2IA4 A;  3Q25 A;  2F78 A;  3RY3 A;  3R6U A;  2O1L A;  4LQ5 A;  3H7M A;  2F5X A;  3PMV A;  3RNN A;  2HCA A;  2XXI A;  2WKY A;  4R9F A;  5H8Q B;  1MRP A;  3TZA A;  4RYA A;  3RPW A;  2FNC A;  2ZXT A;  4YMB A;  1HSL A;  2I0B A;  5H8Q A;  2I4B A;  3KFM A;  4RA1 A;  4KYE A;  4HS7 A;  5CMC A;  2O68 A;  1NKX A;  1QUK A;  3UP9 A;  4HCW A;  3QSL A;  3W9V A;  3MZ9 A;  3V5A A;  3TEP A;  1IZ1 A;  4THI A;  4JSO A;  1H44 A;  3OEK A;  1UQW A;  1ZTY A;  4R75 A;  3LSX A;  2HZL A;  1T0K A;  2PYY A;  5IKB A;  2UYF A;  4QHQ A;  3KOS A;  3IK6 B;  4ESX A;  4GOT A;  1DTZ A;  1MDP 1;  1MDQ A;  1XOC A;  4ZEF A;  1KWH A;  3CR9 A;  3W9W A;  1B0L A;  2A5T B;  5L9M A;  4GFR A;  1AOV A;  1MM6 A;  2A5T A;  1B40 A;  2HAU A;  4FE8 A;  4X48 A;  5EYF A;  4DXU A;  4F19 A;  1Y4T A;  1BTJ A;  1LBB A;  3FV2 A;  3TTR A;  4OQO A;  2E1S A;  3C32 A;  3H6W A;  5FTH A;  1JEU A;  3LSL A;  1GVC A;  2R6G E;  3PPN A;  1B1H A;  2ONR A;  3G7W A;  1B51 A;  3O6H A;  3SEU A;  4BLA A;  1TXF A;  1QUJ A;  4RPO A;  3U8Q A;  1NNF A;  1N7W A;  1ANF A;  3EPE A;  3KN8 A;  4EDP A;  4Z7E A;  2X7P A;  3PD9 A;  1LCT A;  2GHB A;  1M5E A;  3TQW A;  3I3V A;  3T93 B;  3PMW A;  2NXO A;  1SW1 A;  4JWX A;  2OWS A;  4PFU A;  3FXU A;  2VGQ A;  3FAT A;  2BJJ X;  3CRB A;  4H67 A;  2XXX A;  2F7B A;  5I58 A;  3W15 C;  3A09 A;  1MXX A;  3MZB A;  4IO4 A;  1PDA A;  3ILU B;  5FHO A;  3UA8 A;  1OVT A;  2F34 A;  1MXV A;  4YMA A;  2V3U A;  2XD3 A;  1B9J A;  1MQJ A;  1ELJ A;  1MXY A;  5DTB A;  3VVE A;  1HSE A;  1LB8 A;  3IJO B;  1IUD A;  2DQV A;  3BFU A;  4ZE9 A;  2O69 A;  2RC7 A;  1AL3 A;  3G3H A;  1R9L A;  1B3F A;  4BDO A;  3V8X B;  3MP8 A;  3U92 A;  4MF3 A;  1LAH E;  3GZG A;  4FEB A;  4AB6 A;  2DE2 A;  3T9X B;  4GRK A;  1A8E A;  3EF7 A;  5ITP A;  1TWY A;  3G3I A;  2OZZ A;  1B5I A;  4OXV A;  4YB7 A;  1FQE A;  3FZV A;  2GH9 A;  1SW2 A;  1VE4 A;  2PMS A;  3CVG A;  3KGC A;  3O2A A;  1LAF E;  3DP4 A;  1P1Q A;  1MQI A;  1FQB A;  1MY2 A;  5DVI A;  5I56 B;  1PB9 A;  2XXP A;  3E13 X;  4DXC A;  4OER A;  5DVF A;  4G8N A;  2XX8 A;  2DWH A;  2RKM A;  2HQ0 A;  5BWJ A;  4C1U A;  2F35 A;  4GIZ A;  3KJ7 A;  1USY H;  1WOD A;  4GF8 A;  4H8J A;  4MFI A;  3CG1 A;  2X26 A;  5K2X A;  4H5F A;  5CRY A;  4NF5 B;  3TCF A;  3E9X A;  2VD3 A;  1Z7N E;  3LSF B;  5JEI A;  3VLW A;  2NOO A;  3SDF A;  2ZYN A;  4QFN A;  1URD A;  3MC2 A;  5H8F B;  3T66 A;  2I48 A;  3VVD A;  3I6V A;  4JBZ A;  5FHN A;  3O28 A;  3OSQ A;  4I62 A;  5H8H B;  4Q0C A;  4U1Z A;  2UXA A;  4WXJ A;  1EZO A;  5H8H A;  1MQD A;  3FVO A;  5FTI A;  2LAO A;  1FTL A;  2PX1 A;  3PD8 A;  2RCB A;  3SES A;  1YTV A;  3LSW A;  2VD2 A;  2ZYK A;  1USY E;  1US5 A;  3N94 A;  4RY1 A;  5L8D A;  2RIN A;  3OOA A;  4POX A;  1SQY A;  2Z23 A;  1N3W A;  4LZ8 A;  3TUS A;  2I3V A;  4G2Z A;  1XVY A;  5H8S A;  1B7U A;  1D9V A;  4LQ2 A;  3DM0 A;  3WAE A;  1ZIU A;  3HHF A;  3MP1 A;  3IB0 A;  4BDQ A;  3MBP A;  3R26 A;  1GR2 A;  1LAG E;  4F3S A;  4PFT A;  1FCK A;  3IOT A;  1Y20 A;  4M1V A;  2H4I A;  3O6G A;  4ZEK A;  1A54 A;  1N84 A;  4NTL A;  4NF6 B;  4BDN A;  2YJP A;  4ZS9 A;  1YCJ A;  2ZNT A;  1B05 A;  2DWA A;  1UIU A;  3RUM A;  2NUV A;  4NF6 A;  3S9N C;  4U22 A;  3OMB A;  1B3H A;  5KDT B;  2G29 A;  5AA2 A;  2R71 A;  4EQ7 A;  1A40 A;  4DCX A;  5KDT A;  1BLF A;  1SVX B;  2QS4 A;  3C9H A;  3FJM A;  4OFO A;  4R2B A;  4LZ7 A;  4P0I A;  5AA1 A;  5TP9 B;  2D21 A;  1OQH A;  4H8I A;  3MW0 A;  1N76 A;  5I57 B;  5B70 A;  4I1D A;  5TP9 A;  4O3C A;  4ND9 A;  2PBW A;  4XTC Q;  5I57 A;  2XD2 A;  5BUU A;  4U4S A;  4IY5 A;  1NFT A;  1US4 A;  3K01 A;  4ONY A;  3QUJ A;  2I6E A;  5DEX A;  4JB7 A;  3WAF A;  4F39 A;  1JVY A;  4ZZA A;  1M5D A;  2ZNU A;  4YAH X;  5CM6 A;  1J1N A;  2PT1 A;  1B52 A;  1RYO A;  4KD5 A;  3C34 A;  4NWC A;  1OIB A;  1P99 A;  2XXR A;  3LC8 A;  1B7H A;  2DE4 A;  3RTW B;  4XKQ A;  1XHY A;  2O1M A;  1MPC A;  5EHM A;  2H9B A;  3QAX A;  3V83 A;  2P1S A;  1XS5 A;  4PET A;  3A3U A;  5AA4 A;  4GQO A;  3FUZ A;  3TYH A;  1SYH A;  4G68 A;  4NWD A;  5CC2 A;  1UTB A;  4NF8 B;  1IXC A;  1FQD A;  2OLB A;  3HN0 A;  4U23 A;  2QS3 A;  4GXS B;  4Q30 B;  3TAJ A;  1B0H A;  1MPB A;  3GXA A;  4H1X A;  4JXI A;  4H0W A;  1MG1 A;  1QVS A;  2Y7W A;  1FTK A;  5HPQ A;  3SEX A;  5KZT A;  3CFL A;  4KFQ A;  3MZ1 A;  3CG3 A;  4E0W A;  3S9L C;  2UVJ A;  3ONM A;  4MLV A;  3Q28 A;  4EF1 A;  5A5X B;  3PPR A;  1ZJL A;  3KN7 A;  2O6A A;  4PP0 A;  4GD5 A;  3RT6 B;  3USD A;  3EHS A;  3MVX A;  1NL5 A;  2Y7I A;  2B3B A;  3CSG A;  4TLL B;  1DPE A;  4GL8 A;  1ATG A;  2XXU A;  1BP5 A;  2Q2C A;  5AE4 A;  4X1B A;  3MPL A;  4OEV A;  2UYE A;  4RK9 A;  4R6Y A;  4OWD A;  5B7D A;  4LZ5 A;  4KR5 A;  1F9B A;  3FD3 A;  1Y3N A;  2RCA A;  4XIG Q;  5CMM A;  3PPQ A;  3H06 B;  5M2V A;  2QPQ A;  2RC8 A;  1CE2 A;  1CB6 A;  1MS7 A;  4YU0 A;  2H98 A;  2IEE A;  4N07 A;  4IO2 A;  1B3E A;  1NH7 A;  4WKM A;  3GBA A;  4PQJ A;  3O6I A;  1ZKB A;  1URS A;  1FQA A;  1WVJ A;  3MVZ A;  1MPD A;  3PPO A;  2QL3 A;  2ABH A;  3CFX A;  5H8N B;  3IJX B;  3UIF A;  4DZ1 A;  4IGT A;  2P0S A;  1M5B A;  3K0V A;  4JDF A;  2QS1 A;  4YZZ A;  4QFO A;  4QRZ A;  3OEL A;  4QSC A;  3O9P A;  1A7L A;  4FJP A;  3IR1 A;  5DT6 A;  3A3C A;  5ITO A;  3EHU A;  3OEN A;  1I6Q A;  2XXH A;  4M4G A;  4YKK A;  3S4U A;  3MVW A;  3L6G A;  3RTF B;  1IQ7 A;  5ELV A;  1MY4 A;  3PV0 E;  4YB5 A;  3PMX A;  2Y84 A;  2NWJ A;  4Q8R A;  2OCU A;  4XKP A;  2HFB A;  3UGW A;  4F3G A;  3CI8 A;  2V3T A;  1B2H A;  2QSX A;  3DEL B;  4IO6 A;  1B4H A;  2O7I A;  3T9H B;  1O7T A;  4N13 A;  5J1D A;  3C36 A;  3FGS A;  3RQT A;  3UK4 A;  5I59 B;  2O7U A;  3S9E A;  4ISU A;  4UA8 A;  3IOW A;  3VLV A;  3IL1 B;  4U4X A;  3TTK A;  2VP1 A;  3FXR A;  4IY6 A;  5CBS A;  3TOD A;  2I0C A;  4TQU Q;  4KCC A;  2OWT A;  1FTM A;  4ZE8 A;  5JK4 A;  3G3G A;  1YPN A;  4POW A;  4XXU A;  3Q29 A;  3T9V A;  3C31 A;  1ZLQ A;  4HW8 A;  1N7X A;  4AQ4 A;  1LGB C;  1MXW A;  5CI5 A;  1B58 A;  3U93 A;  3JZJ A;  3D4G A;  4ZEB A;  1L5T A;  2ONK E;  2D3I A;  4F1V A;  2UVI A;  4KI0 E;  1D4N A;  2AL5 A;  4OTE A;  2DP8 A;  4KCD A;  3THI A;  2DSF A;  4JWO A;  5I56 A;  2F6P A;  4O3B A;  3PUW E;  3IOR A;  1II5 A;  4F1U A;  4BDM A;  2XXQ A;  2I4C A;  1IXG A;  3PUY E;  4NF5 A;  3TCG A;  2QS2 A;  3G3K A;  3H6T A;  5K2Y A;  4GLI A;  1DSN A;  1QW0 A;  1B3G A;  4P0G A;  2B65 A;  3SEV A;  2FA7 A;  3KBR A;  5IAI A;  2DVC A;  2ALU A;  2W7Y A;  3C4M A;  3MQ9 A;  4GXA A;  4F2Q A;  5H8F A;  1LB9 A;  2ONS A;  4EF2 A;  2V3Q A;  4QFL A;  2AIX A;  3CSB A;  1FW0 A;  3RT8 A;  3IX1 A;  1OMP A;  3ZS6 A;  1HSJ A;  1TFD A;  2F7A A;  3N6U A;  3EQ1 A;  1GTK A;  3KSX A;  3VE1 B;  1MY1 A;  3IO6 A;  4ESW A;  3TPA A;  2KLF A;  3QUF A;  2DOJ A;  4OFJ A;  2F6G A;  4OFL A;  1I6B A;  4LA9 A;  1LFG A;  1IXH A;  3B7D A;  3B6W A;  3FJ7 A;  4PFW A;  1Y1Z A;  4RNS A;  1VFE A;  3BFT A;  3VV5 A;  3L6H A;  1AIV A;  3TMG A;  2YPN A;  1P1O A;  2Q89 A;  3FAS A;  4X9T A;  2THI A;  3RN8 A;  4DIG A;  1I6A A;  1VSO A;  3TTM A;  1OQG A;  5KCJ B;  4ECF A;  3IOU A;  2ZMB A;  1LAX A;  3QK6 A;  5KCJ A;  1R9Q A;  2Z8D A;  4E0X A;  2GFE A;  3PUV E;  1LCF A;  3KZG A;  1D3K A;  1XT8 A;  4F3B A;  5TU0 A;  3U72 A;  4Q5T A;  1SW5 A;  4YKP A;  5CMK A;  4JWY A;  2UVG A;  2V25 A;  2DXY A;  1JNF A;  2I49 A;  1QKB A;  5DYH A;  3TDJ A;  1EH3 A;  1JW4 A;  1SI1 A;  4GL0 A;  3PUZ E;  1GV8 A;  2XXV A;  3N5L A;  4KPT A;  4EXL A;  3LBS A;  4RK2 A;  2F97 A;  1P1N A;  4ZEC A;  3AXF A;  3K1N A;  4R9G A;  1DMB A;  1RYX A;  1MXU A;  5LOM A;  4YKI A;  3DP6 A;  3PGF A;  1IIT A;  4OEU A;  2REJ A;  4YB6 A;  1UIV A;  2DXR A;  3SEW A;  3RLF E;  1MM7 A;  3ZKL A;  1MQG A;  3H4Z A;  2F8D A;  4AB5 A;  1LLS A;  1B5H A;  3ODB A;  1IXI A;  5I84 A;  1BKA A;  3B6T A;  1O63 A;  3G3J A;  4YKJ A;  1LST A;  3B6Q A;  2H99 A;  4U2R A;  3E3K A;  3D4C A;  3FVG A;  1ZU0 A;  3ECR A;  5HBC A;  4H65 A;  3TTL A;  1Q1K A;  5F7V A;  3GLB A;  2XXT A;  2HEU A;  2CZL A;  4FAT A;  1B4Z A;  2F36 A;  3KG2 A;  1BIY A;  3VVF A;  3KEI A;  1SDX A;  4H5G A;  2XXW A;  5CMB A;  3LUY A;  3ILT B;  1AH5 A;  3IOV A;  3K2D A;  2REG A;  4YIC A;  4QFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...