1YAEA

Structure of the kainate receptor subunit glur6 agonist binding domain complexed with domoic acid
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
289
structure length
261
Chain Sequence
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Structure of the kainate receptor subunit GluR6 agonist-binding domain complexed with domoic acid.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 73
structure length 261
sequence length 289
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1yaeA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1yaeA02
4YAHX 4OESA 4BDOA 5ELVA 2DP8A 1SDXA 2PT2A 1IIWA 2B3BA 5CBSA 3VFJA 3G3HA 3H06B 3KGCA 1UQWA 4ISUA 4PE5B 3PPRA 1LLSA 3DP4A 2AIXA 2M8CA 1EH3A 1D9YA 5DVFA 3TCHA 1LAHE 4F39A 4IB2A 1O63A 1SBPA 1H3DA 3OEKA 4LA9A 3BBRA 1DPPA 2H98A 1UTBB 5DEXB 1USYH 1JW1A 5AA2D 3RNNA 1QW0A 3K6VA 4PETA 1B3FA 3V83A 1FQEA 3H3GA 4U22A 2OZZA 4C0RA 4ELQA 3K6WA 2F34A 1IXIA 1RYXA 4GL0A 2UVIA 2HEUA 4JWXA 3HV1A 1US5A 3BFTA 4OEUA 1NH8A 3E4RA 3RY3A 3S9MC 3OENA 1JEVA 2OK2A 3A09A 1H44A 1JNFA 2HZKA 2D5WA 3HHFA 3VXBA 3FJMA 2PT1A 2NVUB 1L5TA 3KJTA 2OBGA 3CVGA 4KYEA 5H8NB 4ZE8A 2W7YA 2IEEA 1N3XA 4G68A 5I59B 4LZ7A 1JQFA 2Q2AA 4K3FA 2ZMBA 4R74A 2REGA 4LZ5A 4BDLA 2FNCA 1FTKA 3RTWB 3PMVA 3PPPA 1F9BA 4GF8A 2DYXA 2ZYMA 2YJPA 3EF7A 1ZLQA 3TPAA 1POTA 4PFUA 5I2KA 3H6WA 4F29A 3H6TA 1M5CA 4TLLB 3VDFA 3T9HB 1AL3A 3O28A 2E0SA 4ZEDA 2Y7RA 2UYEA 2PVUA 1JVXA 3SEWA 4LQ5A 2F7BA 2I4CA 3HSTA 1CB6A 4NF6A 3UGWA 3G7WA 4LP2B 2F7AA 1O7TA 2O84X 1OVBA 1HSJA 1LAXA 1QKAA 3G3IA 2NXOA 4ELPA 3CIJA 4X1BA 1NNFA 3C36A 3EHUA 2DE4A 1I6QA 3TTLA 1MXZA 5L9MA 3TZAA 2YPNA 5J1DA 2I6EA 5A5XA 3IO6A 5IAIA 3TMGA 1VFDA 3T9UA 1A54A 1D3KA 2KLFA 4DXCA 3C34A 3EQ1A 3PUXE 2ZNUA 4DZ1A 3OELA 3S2VA 4KPTA 4O3AA 4DCXA 4ZZAA 2P1SA 3QUFA 2A5TB 5H8QA 1TT1A 3TKDA 1FQCA 4H8IA 3O29A 4Z7EA 2O51A 1QULA 1CE2A 4X48A 2UVJA 1URDA 4XKPA 1MPDA 1MY4A 1YCJA 2Y7PA 5JTYA 2B65A 4OQOA 2QS1A 1BTJA 4KQPA 2R9JA 3U93A 5EYFA 1A8EA 3QK6A 3FGSA 3Q25A 1M5FA 2A5SA 4Z0IA 3K1PA 2Z8FA 1B7HA 1MH3A 4KI0E 2O69A 3B6TA 4U23A 5AA3A 1Y4TA 1PB7A 1M5BA 3V89B 1MG1A 5BWJA 2RC7A 3S9EA 2F35A 5FTHA 3H03A 3TTKA 5H8QB 2H99A 4IY6A 2V25A 1JEUA 3HPIA 3O6GA 4YMAA 4H65A 4PFYA 4YKIA 1IEJA 1WDNA 3TEPA 4F3GA 5JTYB 1IXHA 4MH5A 3UORA 3KOTA 2DWHA 1R9LA 4FEBA 3A3CA 4ESXA 3QAXA 3MVXA 5LOMA 4LATA 4YZZA 3IB0A 1QVSA 1MPBA 5H8HA 3OO6A 4R75A 2H9BA 5DYHA 2Y7KA 3IJXB 3PPNA 4QFOA 3C31A 2RC8A 3IOUA 2F36A 5IKBA 3K4UA 3VVFA 1XOCA 3K0VA 1TFDA 1B4HA 3Q29A 4F19A 4IY5A 1O64A 3DM0A 1OQHA 4XKRA 1XVXA 1OMPA 4LVQA 4BDQA 5ISUA 1MRPA 4OXVA 4YKKA 1A40A 2O68A 3MW0A 1S9TA 2I48A 1Y1ZA 1GR2A 2OJTA 3OO7A 4NEDA 1PB8A 5ICQA 1QUIA 3GLBA 3QYTA 3ILTB 4MLVA 1YTVA 2GHBA 2F7CA 4OEVA 2XXYA 2XXQA 3OSRA 2CMOA 3O6HA 2ALUA 5TU0A 4WXJA 3RQTA 4POWA 3MJNA 1Q1KA 1MXVA 1OLCA 1XVYA 1RYOA 1P99A 1J1NA 3VE1B 4H6DA 4DCYA 1B6HA 1FTOA 4U2RA 4OFJA 1ATGA 2NOOA 4DLDA 3CSGA 1ZKBA 3Q27A 3UP9A 2ZYOA 1AIVA 1P1QA 4JDFA 4NWCA 3FVKA 3M3FA 1UTBA 5DEXA 4OYVA 3THIA 3MP1A 2DVZA 2OWTA 2DWJA 4I8CA 1LGBC 3G3GA 2Q9TA 4JSDA 1SI0A 3ZS6A 1AH5A 4NF4A 5BUUA 4JB7A 4PFTA 4UA8A 4YB5A 4ZE9A 3TELA 1URGA 1B3LA 3TQLA 1MY3A 4ZEFA 2RCAA 4JBZA 1B5JA 1Y3NA 3PD9A 3C9HA 3S9LC 1LFHA 3MVWA 3N6UA 1NNPA 4KFQA 1P1UA 1D9VA 4RPNA 4KCDA 1B4ZA 2GFEA 5I57B 3U72A 2DXYA 4HCYA 5H8NA 3D4GA 1VFEA 5I59A 2F97A 5I58A 5DT6A 3QUJA 4ESWA 3C35A 3A3UA 4NF4B 4OZ9A 5EHMA 2REJA 1A7LA 2H25A 4EQBA 3MVYA 3RLFE 1OVTA 3MZ9A 2ZXTA 4QSEA 4ZEKA 2X7QA 5AE4A 3C4MA 3GXAA 4Q5TA 4KCCA 2OCUA 4OMBA 3SERA 3TFLA 4M4GA 3CFLA 3FVOA 1MM7A 3G3FA 5TP9B 4RPOA 4OVJA 3EHSA 1NFTA 1H76A 4PP0A 3Q26A 2Z8DA 3KFMA 4FE8A 4F18A 1FQDA 4RNSA 1YPNA 2QS3A 4IGTA 4GXAA 3JZJA 1B52A 1EZOA 5I58B 1TWYA 2XD2A 2G29A 4F3SA 1GV8A 1N3WA 3LSLA 5TPAB 2UVGA 2X7PA 3KJ7A 3UN6A 1BLFA 1QKBA 3VVDA 3LC8A 3G3JA 5FHNA 3VV5A 1DMBA 3OO8A 2GH9A 2PBWA 4JWOA 1LAFE 4OERA 2I0BA 1B9JA 4EQ9A 5B7DA 4ND9A 1B5HA 2V93A 3IB2A 3M3KA 2H5YA 3I6VA 4YB6A 3RN8A 1QUKA 4OETA 3KN3A 4G8NA 4NF5A 2QPQA 3PV0E 2R6GE 2HQ0A 2E1SA 2QL3A 3N5LA 3T96B 2VD2A 1UIVA 4U4XA 1R9QA 3EHTA 2A5TA 2I58A 5CBRA 4IO6A 4P11A 4WEPA 3T9VA 4P0IA 4XKQA 2GRVA 2DE3A 3TDJA 1Y20A 2XHDA 1LSTA 3IB1A 3FZVA 2LAOA 3S4UA 4THIA 2Q88A 4Q0CA 3MP6A 4QFKA 3V8XB 3ZKLA 4F1VA 3IR1A 3SESA 5JEIA 3PGFA 4BDNA 2VHAA 1FCKA 1MM6A 2XXVA 3R7XA 3SEYA 2ONSA 5I2NB 4JXIA 5M2VA 2QMXA 2THIA 5DTBA 3DP6A 3KBRA 4NF5B 4ZECA 1FQAA 3ILUB 4MBPA 1DTZA 3KZGA 4F3BA 1MQJA 2XD3A 2F6GA 2HFBA 4L17A 2ONRA 1LFGA 3SDFA 3H6UA 1MQIA 3H4ZA 4F1YA 3MWBA 1Z7ME 5L9OA 3OSQA 1TXFA 3E3KA 3L6GA 3HHGA 4BDMA 2V3TA 5JK4A 3IX1A 1LB8A 3RPWA 3SEUA 4F2QA 1BP5A 1SI1A 3AXFA 4C1TA 2HCAA 1Y4CA 2O7UA 3VLVA 4OFLA 3ZKKA 1I69A 3B6QA 1IUDA 4X9TA 4FIMA 3OOAA 1KWHA 1NH7A 2I3WA 3IOWA 4U21A 3T93B 1XC1A 4OENA 2XXHA 3FXUA 4KR5A 4I9DA 1AMFA 3UIFA 1DSNA 3U1OA 4EXKA 1H45A 1UTHB 3N26A 1NNKA 1B3GA 4ZDMA 4KYSA 4XKNA 4C1UA 1B0LA 4GFRA 1HSLA 3LSWA 2DS9A 3U92A 1Q35A 5H8SA 2Q8JA 1SW1A 1BKAA 2VOZA 4NF8A 2XXPA 3QXMA 4GL8A 2I49A 1B1HA 4WKMA 3KN8A 1POY1 2XXIA 4P0GA 3EN3A 1N0TA 3DP8A 1MQHA 2AYSA 2ZYNA 3PPOA 3G3KA 3W15C 3TCGA 4H5FA 4GQOA 3IOTA 3TQWA 4N07A 3BFUA 1EZPA 3T22A 4EF1A 1SW2A 5ICTA 1WODA 2ZNTA 2I4BA 1D4NA 3CG3A 3TCFA 4ECFA 3PUWE 2UYFA 1VSOA 1NL5A 4NMYA 4F22A 4DIGA 4NF8B 5FHMA 3MQ9A 1GGGA 2XX9A 4YICA 3IOVA 4F1UA 5KCJA 3HN0A 4F31B 1B05A 3B7DA 4R72A 2HZLA 4GVOA 1R6ZA 1R1NA 1T0KA 3PMXA 3USDA 5HBCA 2H4IA 4QFLA 3LSXA 1JW4A 2UVHA 3CI8A 1B7UA 2F5XA 2QS4A 4G8MA 2PX1A 3EPEA 1FQBA 1B58A 1YAEA 1Y1MA 4AB6A 3OXNA 1JW5A 3UA8A 2RINA 2Y7WA 4DXBA 5I84A 3FIRA 5I57A 3M8UA 4AQ4A 5CMKA 3MBPA 1MQGA 4QFNA 1WVJA 2VD3A 3I5OA 4N6PA 2XX7A 3LSFB 1MY1A 4FECA 5CMBA 3MP8A 1P1OA 1JETA 3GZGA 4GLIA 4LUBA 4EDPA 2I3VA 3MVZA 1IXGA 4BDRA 5KCJB 1B40A 1QJMA 1SVXB 4QSCA 5EHSA 1MXUA 4U4SA 3O9PA 1FTJA 2PMSA 1N76A 4RJZA 1PDAA 2DQVA 4DDDA 3CRBA 3ECRA 3PPQA 3LR1A 4R2FA 3LUYA 3B6WA 3OD7A 4X1DA 3I3VA 5TP9A 1PBQA 3TUSA 1US4A 3W9WA 4IO2A 4EF2A 5CMCA 4Q8RA 3ODBA 3RGYA 4QFPA 1SQYA 1B2HA 3K01A 4HTGA 2XXUA 4ELOA 5HPQA 4FATA 1EU8A 4OHNA 3IJOB 4XIGQ 5DVIA 2DE2A 5KZTA 3GBAA 3KOSA 2Y84A 2HAUA 3FJ7A 5KDTA 4R73A 5TPAA 4IO4A 5DVJA 3O6IA 1GTKA 3KEIA 3QSLA 5CMMA 5H8FB 3IORA 3PUYE 2DOJA 4GOTA 1LAGE 5ITPA 1B3EA 3PU5A 4H8JA 2OLBA 2GHAA 1QUJA 1LCFA 1MXXA 5K2YA 4RK9A 4HCWA 3CFZA 3K02A 4F2OA 1II5A 1AOVA 2O1LA 5AA1A 3U8QA 2O1MA 2Q2CA 4R6YA 1OLAA 3VXCA 3K00A 4EXLA 1IZ1A 2XXWA 4TOZA 5CC2A 1N7XA 3SKPA 3HCQA 1ZIUA 2WKYA 3DELB 4ELRA 3FASA 2DVCA 4JSOA 5KDTB 3MZBA 4G68C 2Z23A 3PUZE 3K1MA 4ZS9A 2F78A 1OQGA 5F1QA 4QRZA 1P1NA 3IL1B 1MXWA 1LBBA 3U94A 1IITA 4XTCQ 2P0SA 4YMBA 2IA4A 3K6XA 3TODA 3RT6B 1HSEA 2ANJA 1S7YA 3DLNA 4IO3A 1SYHA 2G93A 3PMWA 2D3IA 4KD5A 4G2ZA 3T66A 3TAJA 3QIMA 1DTGA 3WAFA 5ITOA 3H7MA 3KN7A 2FYIA 4H67A 2HXWA 3RUMA 3E13X 2VGQA 4G77A 1B0HA 1OIBA 3RT8A 5I2NA 1MDQA 3TTMA 2VP1A 4HS7A 4RY1A 1USYE 1SD3A 1DOTA 3MZ1A 4H5GA 3VVEA 2RC9A 5CRYA 1MY0A 3Q28A 4RA1A 4M1VA 3K1NA 4ONYA 3OMBA 4G8HA 4YU0A 2AL4A 4RXLA 1LB9A 4G68B 1A55A 3E9XA 2QRYA 1VR5A 1B3HA 4FORA 1FTMA 2BJJX 1LCTA 1B32A 4DXUA 3N6TA 4TQUQ 3IAZA 2DWAA 3FJGA 3CSBA 1A99A 2QMWA 4GD5A 4OWDA 3SEXA 4LQ2A 1LBCA 1B5IA 4NWDA 5I2KB 1MY2A 1VE4A 3O66A 4KHZE 2DWIA 3R6UA 3IO4A 4H1XA 5CI5A 4LZ8A 1MQDA 3D4CA 3S9NC 4EQ7A 4IO5A 2O6AA 3V5AA 4MFIA 2Q89A 5B70A 3MUQA 3OEMA 4R2BA 4I62A 1UTHA 4YKPA 2Z22A 4I1DA 3WAEA 2CZLA 1TFAA 4NF6B 1NKXA 1EZ9A 4MLQA 1PEBA 4QHQA 4HW8A 2HAVA 2DXRA 3SETA 4KYDA 4E0XA 2F6PA 3ONMA 1RKMA 3KG2A 1BIYA 3HO7A 4BLAA 3T9XB 1XS5A 3PD8A 1Y9UA 2NWJA 5I56A 4GRKA 3JV9A 2V3UA 3ZSFA 1UIUA 1PB9A 3KSJA 4FAJA 4FJPA 3MC2A 4MF3A 5A5XB 4LONB 2O7IA 4ZEIA 1FQFA 1N7WA 2R71A 1MS7A 1GVCA 1MPCA 4R9GA 2YLNA 3IK6B 1I6BA 4GIZA 2D21A 3JYRA 4NE4A 4QSDA 1MXYA 4FEDA 2ZYKA 3CR9A 2RKMA 2I0CA 3TYHA 3FV2A 2XXTA 3LBSA 2FA7A 3MAMA 5AA4A 2OWSA 1MDP1 1XHYA 1SYIA 2ZNSA 1MH4A 2DSFA 4RYAA 1ZJLA 2RCBA 1LFIA 4DE8A 2X26A 5I56B 2B3FA 4POXA 4G4PA 3KSXA 3L6HA 1Z7NE 3K6UA 3PUVE 3TTRA 2NUVA 2Y7IA 1M5EA 2QSXA 3MPLA 3O97A 1SW5A 4R9FA 1H43A 1ZMGA 1B46A 4PFWA 3FV1A 4OFOA 2XXXA 3SEVA 3MPKA 3FXRA 3CFXA 4U1OA 4XXUA 3VLUA 3H6VA 2ONKE 4R6KA 4N13A 3RTFB 5FTIA 3C32A 2ABHA 5L8DA 3K2DA 2F8DA 3R26A 5CM6A 3FD3A 1I6AA 5F7VA 5AA4B 4H0WA 2QS2A 4R6HA 1ANFA 4EUOA 1N04A 1Y3QA 1PBPA 2RF1A 1B7ZA 1A8FA 1Y3PA 2P2AA 2XXRA 3OO9A 3N94A 4GXSB 5AA2A 4U1ZA 3P7IA 4Q30B 3M3LA 2ESNA 1SW4A 2XX8A 3C33A 3CG1A 1NMUA 4O3CA 5H8HB 4PQJA 1IXCA 4RK2A 1URSA 4NTLA 4ZEBA 1ELJA 4O3BA 3VLWA 5HM4B 4YKJA 2QJEA 5K2XA 4OTEA 4F3PA 2AL5A 3UK4A 2V84A 4WEDA 2V3QA 1P1WA 4E0WA 1JVYA 1PC3A 4QF9A 4ZZEA 1DPEA 4IGRA 1ZU0A 3O2AA 5FHOA 1NNTA 1FTLA 1ZTYA 2UXAA 4TLMB 2Z8EA 1IQ7A 4AB5A 3FUZA 1B1XA 2PYYA 4JWYA 3GBBA 3BKIB 1B51A 1FW0A 3F11A 3FVGA 3FXQA 5H8FA 3FVNA 5AA2B 5L9SA 4YB7A 1S50A 3TTNA 1M5DA 4GWOA 3W9VA 3FATA 1ZBMA 1N84A 4IO7A 4UACA 1XT8A
chains in the Genus database with same CATH superfamily
4YAHX 2Q8MA 4OESA 4BDOA 2OWZA 5ELVA 2DP8A 1SDXA 2PT2A 1IIWA 2B3BA 5CBSA 3VFJA 3G3HA 3H06B 3KGCA 1UQWA 4ISUA 4PE5B 3PPRA 1LLSA 1FBGA 3DP4A 2AIXA 2M8CA 1EH3A 1D9YA 5DVFA 3TCHA 1LAHE 4F39A 4IB2A 1O63A 1SBPA 5ET5A 1H3DA 3OEKA 4LA9A 3BBRA 1DPPA 4LN5A 2H98A 1FSAA 1UTBB 5DEXB 1USYH 1JW1A 5AA2D 1G0HA 4PAIA 3RNNA 1QW0A 3GYYA 1G0IA 5EYHA 3K6VA 4PETA 1B3FA 3V83A 1FQEA 3H3GA 4U22A 2OZZA 4C0RA 4ELQA 1LBYA 3K6WA 2F34A 1IXIA 1RYXA 4GL0A 2UVIA 2HEUA 4JWXA 4PFBA 3HV1A 1US5A 3BFTA 2B4MA 4OEUA 1NH8A 3QMFA 3E4RA 3RY3A 3S9MC 3OENA 1JEVA 1NUWA 2OK2A 3A09A 1H44A 1JNFA 2HZKA 2D5WA 4PFRA 3HHFA 3VXBA 3FJMA 2PT1A 2NVUB 1L5TA 1FPBA 1JP4A 3KJTA 2OBGA 2MKZA 4P56A 3CVGA 4KYEA 5H8NB 4ZE8A 2W7YA 2IEEA 1N3XA 1LBZA 4G68A 5I59B 4LZ7A 1JQFA 2Q2AA 4MNPA 4K3FA 2ZMBA 4R74A 2REGA 4XEQA 4AS4A 4LZ5A 4BDLA 1IMDA 4MAGA 2FNCA 2ZZXA 1FTKA 2PCRA 4NG7A 3RTWB 3PMVA 3PPPA 4I3YA 1F9BA 4GF8A 2DYXA 2ZYMA 2YJPA 3EF7A 1ZLQA 4HXVA 3TPAA 1POTA 4PFUA 5I2KA 4OANA 3H6WA 4F29A 3H6TA 1M5CA 4TLLB 3VDFA 3T9HB 1AL3A 4DI4B 3O28A 1FPIA 2E0SA 2FHYA 4OVQA 4ZEDA 2Y7RA 2UYEA 1K9ZA 2PVUA 1JVXA 5I3SA 3SEWA 4LQ5A 2F7BA 2I4CA 3HSTA 1CB6A 5IZ1A 4NF6A 3UGWA 4N6DA 3G7WA 4LP2B 2F7AA 1YYZA 3T1BA 1O7TA 2O84X 4GWUA 1OVBA 1HSJA 1LAXA 1QKAA 3G3IA 2NXOA 4GX6A 4ELPA 4HE1A 3CIJA 4X1BA 1NNFA 3C36A 3EHUA 2DE4A 1I6QA 3TTLA 1MXZA 1EYIA 5L9MA 3TZAA 2YPNA 5J1DA 2I6EA 5A5XA 3IO6A 5IAIA 3TMGA 1VFDA 3T9UA 1A54A 1D3KA 2KLFA 4DXCA 3C34A 4N8GA 3EQ1A 3PUXE 2ZNUA 4DZ1A 3OELA 3S2VA 4KPTA 4O3AA 4DCXA 4ZZAA 2P1SA 3QUFA 2A5TB 5H8QA 5LDZA 2QFLA 1TT1A 3TKDA 1FQCA 3B8BA 4H8IA 3O29A 4Z7EA 2O51A 1QULA 1CE2A 4X48A 2UVJA 1URDA 4XKPA 1MPDA 1MY4A 3A29A 1YCJA 2Y7PA 5JTYA 4P3LA 5EQ8A 2B65A 4OQOA 2QS1A 1BTJA 4KQPA 1FBCA 2R9JA 2CZHA 4PF8A 3U93A 5EYFA 1A8EA 3QK6A 3FGSA 3Q25A 1M5FA 2A5SA 4Z0IA 3K1PA 2Z8FA 1B7HA 1MH3A 4KI0E 2O69A 3B6TA 4U23A 5AA3A 1Y4TA 4MJOA 1PB7A 1M5BA 3NOHA 4PBQA 2R8TA 3V89B 1MG1A 3IFAA 5BWJA 2RC7A 3S9EA 2F35A 5FTHA 3H03A 3TTKA 5H8QB 2H99A 4IY6A 2V25A 1JEUA 3HPIA 3O6GA 4YMAA 4H65A 4PFYA 4YKIA 1IEJA 2WBBA 1WDNA 3TEPA 4F3GA 5JTYB 1IXHA 4MH5A 3UORA 3KOTA 2DWHA 1R9LA 4FEBA 3A3CA 4ESXA 3QAXA 3MVXA 5LOMA 2CZIA 4LATA 4YZZA 2WBDA 4N8YA 3IB0A 5A5LA 1QVSA 1MPBA 5H8HA 1EYJA 3OO6A 4R75A 2H9BA 5DYHA 2Y7KA 2DDKA 1LBVA 3IJXB 3PPNA 4QFOA 1K9YA 3C31A 2RC8A 3IOUA 2F36A 5IKBA 2WYKA 1RDXA 3K4UA 3VVFA 1XOCA 3K0VA 1TFDA 1B4HA 3Q29A 4F19A 4IY5A 1O64A 1FBHA 3DM0A 1OQHA 4MEVA 4XKRA 1XVXA 5T3JA 1OMPA 4LVQA 4BDQA 5ISUA 4PAKA 1MRPA 4OXVA 4YKKA 1A40A 2O68A 3MW0A 1S9TA 2I48A 4OVTA 1Y1ZA 1GR2A 4IR8A 2OJTA 3OO7A 4NEDA 1PB8A 5ICQA 1QUIA 3GLBA 3QYTA 3ILTB 4XFEA 4MLVA 5ESYA 4GWSA 1YTVA 2Q74A 2GHBA 2F7CA 4OEVA 2XXYA 2XXQA 3OSRA 2CMOA 4P9KA 3O6HA 2ALUA 4O7IA 5TU0A 4WXJA 3RQTA 4POWA 3MJNA 1Q1KA 1MXVA 4NGUA 1OLCA 4QXDA 1XVYA 1RYOA 1P99A 1J1NA 4X04A 4H6DA 3VE1B 1B6HA 1FTOA 4DCYA 4U2RA 3FBPA 4OFJA 1FPDA 1ATGA 2NOOA 4OA4A 4DLDA 3CSGA 1ZKBA 3Q27A 3UP9A 4NF0A 2ZYOA 1AIVA 1P1QA 2F3BA 2F3DA 4JDFA 4O7MA 4NWCA 2XWKA 3FVKA 3M3FA 1UTBA 3T0JA 5DEXA 2XA5A 4OYVA 4OVPA 3THIA 3MP1A 2DVZA 2OWTA 2DWJA 4I8CA 1LGBC 3G3GA 2Q9TA 4JSDA 1SI0A 4OVRA 2ZZVA 3ZS6A 1AH5A 4NF4A 5BUUA 4JB7A 2Y5KA 4PFTA 4UA8A 4YB5A 4ZE9A 3TELA 1URGA 4PBHA 1B3LA 3TQLA 4H45A 1MY3A 4ZEFA 2RCAA 4JBZA 1B5JA 1Y3NA 3PD9A 1FPGA 3C9HA 3S9LC 2PFZA 1FJ9A 1LFHA 3MVWA 1IMCA 3KBZA 4I3EA 4N4UA 3N6UA 1NNPA 4KFQA 1P1UA 1D9VA 5ET6A 4RPNA 4KCDA 1B4ZA 2WEFA 1QGXA 3LV0A 2GFEA 5I57B 3U72A 2DXYA 4HCYA 1KZ8A 5H8NA 3D4GA 1VFEA 1NV6A 4GWZA 5I59A 1SPIA 2F97A 5I58A 5DT6A 3QUJA 4ESWA 3C35A 3A3UA 4NF4B 4OZ9A 5EHMA 4NN3A 1EYKA 2REJA 2VPNA 1LBWA 1A7LA 2H25A 4EQBA 3MVYA 1D9QA 3RLFE 1NV2A 1OVTA 3MZ9A 2ZXTA 4O8MA 4QSEA 4ZEKA 2X7QA 5AE4A 3C4MA 3GXAA 4Q5TA 4KCCA 2OCUA 4OMBA 3SERA 3TFLA 4M4GA 3CFLA 3FVOA 1MM7A 1INPA 3G3FA 5TP9B 4RPOA 4OVJA 3EHSA 1NFTA 1H76A 4PP0A 3Q26A 2Z8DA 3KFMA 4FE8A 4F18A 1FQDA 4RNSA 1YPNA 1IMFA 1KA1A 2QS3A 4IGTA 4GXAA 1IMBA 3JZJA 1B52A 1EZOA 1DBZA 5I58B 1TWYA 2XD2A 2G29A 4F3SA 1GV8A 4N15A 1N3WA 3LSLA 5TPAB 2UVGA 2X7PA 3KJ7A 3UN6A 1BLFA 1QKBA 3VVDA 3LC8A 2QVVA 3G3JA 5FHNA 3VV5A 2HHMA 2WYPA 1DMBA 3OO8A 2GH9A 2PBWA 4JWOA 1LAFE 4OERA 2I0BA 1B9JA 3KC1A 4EQ9A 5B7DA 4ND9A 1NUXA 1B5HA 2V93A 3IB2A 3M3KA 2H5YA 3I6VA 4NHBA 4YB6A 4PCDA 3RN8A 1QUKA 4OETA 3KN3A 4G8NA 4NF5A 4PDHA 2V4CA 2QPQA 4NX1A 3PV0E 2R6GE 2HQ0A 2KR0A 2E1SA 2QL3A 3KC0A 3N5LA 4PE3A 3T96B 2VD2A 1UIVA 4U4XA 4NQ8A 1R9QA 4XF5A 2P3VA 3EHTA 2A5TA 2I58A 5CBRA 4IO6A 4P11A 4WEPA 5EQAA 3T9VA 1NV0A 4P0IA 4XKQA 2GRVA 2DE3A 3TDJA 1Y20A 2XHDA 1LSTA 3IB1A 2WX9A 3FZVA 2LAOA 4GWYA 3S4UA 4THIA 2Q88A 4Q0CA 2HPGA 3MP6A 4QFKA 3V8XB 3ZKLA 4F1VA 3IR1A 3E78A 3SESA 5JEIA 3PGFA 4BDNA 2VHAA 1FCKA 1MM6A 2XXVA 3R7XA 3SEYA 2ONSA 2VT5A 5I2NB 4PF6A 4MNCA 4JXIA 5M2VA 4MMPA 2CEYA 4PC9A 2QMXA 2THIA 5DTBA 3DP6A 4X8RA 3KBRA 4NF5B 4ZECA 1FQAA 3ILUB 4MBPA 1DTZA 3KZGA 4F3BA 1MQJA 2XD3A 2F6GA 2HFBA 4L17A 4JVIA 2ONRA 1LFGA 1YXIA 3SDFA 3H6UA 1MQIA 3H4ZA 4F1YA 3MWBA 1Z7ME 5L9OA 1CNQA 3OSQA 1NV4A 1TXFA 3E3KA 3L6GA 3HHGA 2FIEA 4BDMA 2V3TA 1FRPA 5JK4A 3IX1A 1LB8A 3RPWA 5FBPA 3SEUA 4F2QA 1BP5A 1SI1A 3AXFA 3SZPA 4C1TA 2P3NA 1FPEA 2HCAA 1Y4CA 2B4LA 2O7UA 3VLVA 4OFLA 3ZKKA 1I69A 3B6QA 1IUDA 4X9TA 4FIMA 3OOAA 1NV3A 1KWHA 1NH7A 2I3WA 3IOWA 4U21A 3T93B 4PAFA 1XC1A 4OENA 2XXHA 3FXUA 4KR5A 4I9DA 1AMFA 3UIFA 1DSNA 3U1OA 4EXKA 1H45A 1UTHB 3N26A 4AS5A 1NNKA 1B3GA 4ZDMA 4KYSA 4XKNA 4C1UA 1B0LA 4GFRA 1HSLA 3D1RA 3LSWA 2DS9A 3U92A 1Q35A 5H8SA 2Q8JA 1SW1A 1BKAA 2VOZA 4NF8A 5IZ3B 2XXPA 3QXMA 4GL8A 2I49A 2XWIA 1B1HA 4WKMA 3KN8A 1POY1 2XXIA 4P0GA 3EN3A 1N0TA 3DP8A 1MQHA 2AYSA 2ZYNA 3PPOA 3G3KA 3IFCA 3W15C 1DK4A 3TCGA 4H5FA 2FVZA 4GQOA 3IOTA 3TQWA 4N07A 3BFUA 1EZPA 3T22A 4EF1A 1SW2A 5ICTA 1Q9DA 1WODA 2ZNTA 2I4BA 1D4NA 3CG3A 1FBFA 3TCFA 4PTKA 4ECFA 3PUWE 1RDZA 2UYFA 1VSOA 1NL5A 4NMYA 4F22A 4DIGA 4P1EA 4NF8B 5FHMA 3ISPA 3MQ9A 2CZKA 1GGGA 2XX9A 4GWXA 2FBPA 4YICA 3IOVA 4F1UA 5KCJA 3HN0A 4F31B 1B05A 3B7DA 4R72A 4MHFA 2HZLA 4GVOA 1R6ZA 1R1NA 1T0KA 3PMXA 3USDA 5HBCA 2H4IA 4QFLA 4PGNA 1NI9A 3LSXA 4GBVA 1JW4A 2UVHA 3CI8A 4DI3D 1B7UA 2F5XA 2QS4A 4G8MA 2PX1A 3EPEA 1FQBA 1B58A 1YAEA 1Y1MA 4AB6A 3OXNA 1JW5A 5EYGA 3UA8A 2RINA 2Y7WA 4DXBA 5I84A 3FIRA 4N6KA 3M8UA 4AQ4A 5I57A 5CMKA 4P47A 3MBPA 1MQGA 4QFNA 1WVJA 2VD3A 3I5OA 4N6PA 3MSTA 1FPFA 3LSFB 2XX7A 1MY1A 4FECA 1DCUA 5CMBA 3MP8A 4N17A 1P1OA 1JETA 3GZGA 4GLIA 4LUBA 4EDPA 2I3VA 3MVZA 1IXGA 4BDRA 4N81A 5KCJB 1B40A 1QJMA 1SVXB 2OX3A 4QSCA 5EHSA 1MXUA 4U4SA 3O9PA 1FTJA 2PMSA 1N76A 4RJZA 2ZZWA 1PDAA 2DQVA 4DDDA 3CRBA 3ECRA 2HXRA 3PPQA 3LR1A 4R2FA 3LUYA 5IM2A 3B6WA 3OD7A 4KXPA 5F24A 2L5VA 4X1DA 3I3VA 4HE0A 5DW8A 5TP9A 1PBQA 3TUSA 1US4A 3W9WA 4P8BA 4IO2A 4EF2A 3ODBA 4QFPA 5CMCA 3RGYA 4Q8RA 1SQYA 3RPLB 1B2HA 3K01A 4HTGA 2XXUA 4ELOA 5HPQA 4FATA 1EU8A 4OHNA 3IJOB 4QBAA 4XIGQ 5DVIA 2DE2A 4FBPA 3GBAA 4GX4A 3KOSA 5KZTA 1RDYA 2Y84A 2HAUA 3FJ7A 5KDTA 4R73A 1NUZA 5TPAA 4IO4A 5DVJA 3O6IA 5EQ7A 1GTKA 5IZZA 3KEIA 3QSLA 5CMMA 5H8FB 3IORA 5J16A 3PUYE 1IMEA 2DOJA 4GOTA 1LAGE 5ITPA 1B3EA 3PU5A 4H8JA 2OLBA 2GHAA 3EKIA 1QUJA 1LCFA 1MXXA 5K2YA 4RK9A 4HCWA 3CFZA 3LUZA 4O94A 2JJKA 3K02A 4F2OA 3E79A 1II5A 1AOVA 2O1LA 5AA1A 3U8QA 2O1MA 1FPKA 2Q2CA 4R6YA 1OLAA 3VXCA 3K00A 4EXLA 1IZ1A 2XXWA 4TOZA 5CC2A 1N7XA 3SKPA 3HCQA 1ZIUA 2WKYA 3DELB 1FPJA 4ELRA 3FASA 2DVCA 4JSOA 5KDTB 2KQZA 3MZBA 4G68C 2Z23A 3PUZE 3K1MA 5I7IA 4ZS9A 2F78A 1OQGA 5F1QA 4QRZA 1P1NA 2XWOA 3IL1B 1MXWA 1LBBA 1LEVA 3U94A 1IITA 4XTCQ 2P0SA 4YMBA 2IA4A 3K6XA 3TODA 3RT6B 1FJ6A 3RYDA 1HSEA 2ANJA 1S7YA 3DLNA 4IO3A 1SYHA 2G93A 3PMWA 4PGPA 2D3IA 4KD5A 4G2ZA 4H46A 3T66A 3B50A 3TAJA 3QIMA 1DTGA 3CHGA 3WAFA 5ITOA 3H7MA 3KN7A 2FYIA 4H67A 2HXWA 3RUMA 3E13X 2VGQA 4G77A 1B0HA 1OIBA 4GX3A 3RT8A 5I2NA 1MDQA 3TTMA 1FBDA 2VP1A 4HS7A 4RY1A 4NAPA 1USYE 1SD3A 1DOTA 3MZ1A 4H5GA 3VVEA 2RC9A 5CRYA 1MY0A 1VDWA 2BJIA 3Q28A 4RA1A 4M1VA 3K1NA 4ONYA 3OMBA 4G8HA 2QVUA 4YU0A 2AL4A 2XWVA 4OVSA 4RXLA 5ET7A 1LB9A 4G68B 1A55A 3E9XA 4MNIA 3MYUA 2QRYA 1VR5A 2QVRA 1B3HA 4FORA 1FTMA 5LTCA 2BJJX 4G61A 1LCTA 1B32A 4DXUA 3N6TA 4P1LA 4TQUQ 3IAZA 1NV5A 2DWAA 3FJGA 3CSBA 1A99A 2QMWA 4GD5A 4OWDA 3SEXA 4LQ2A 1LBCA 1B5IA 4NWDA 5I2KB 1MY2A 1VE4A 3O66A 4KHZE 2DWIA 3R6UA 3IO4A 4H1XA 5CI5A 4LZ8A 1MQDA 3D4CA 3S9NC 4EQ7A 4MCOA 4HE2A 4IO5A 2O6AA 1AWBA 3V5AA 2VPOA 4N91A 2CEXA 4MFIA 2Q89A 5B70A 3MUQA 3OEMA 4R2BA 4I62A 1UTHA 4YKPA 2Z22A 4I1DA 3U65A 3WAEA 2CZLA 2XXKA 1TFAA 4NF6B 1NKXA 1EZ9A 4MLQA 1PEBA 4QHQA 4HW8A 2HAVA 2DXRA 3SETA 5IZ3A 4KYDA 4E0XA 2F6PA 3BIGA 3ONMA 1RKMA 3KG2A 1BIYA 3HO7A 4BLAA 3T9XB 1XS5A 3PD8A 1XI6A 1Y9UA 2NWJA 1YZ0A 1FBEA 5I56A 1FTAA 4GRKA 3JV9A 2V3UA 3ZSFA 1UIUA 1PB9A 3KSJA 4FAJA 4FJPA 3MC2A 4MF3A 5A5XB 4LONB 2O7IA 4ZEIA 4PFIA 3HFUA 1FQFA 1N7WA 2R71A 1MS7A 1GVCA 1MPCA 2Y5LA 4R9GA 2YLNA 3IK6B 1I6BA 4GIZA 2D21A 3JYRA 4NE4A 4QSDA 1MXYA 4FEDA 2ZYKA 3CR9A 2RKMA 2I0CA 3TYHA 3FV2A 2XXTA 3LBSA 4JVCA 2FA7A 3MAMA 3PTYA 5AA4A 2OWSA 1MDP1 1XHYA 1SYIA 2ZNSA 4PDDA 1IMAA 1MH4A 2DSFA 4RYAA 1ZJLA 2RCBA 1LFIA 4DE8A 2X26A 5I56B 2B3FA 2FIXA 4POXA 1FPLA 4G4PA 3KSXA 3L6HA 1Z7NE 3K6UA 3PUVE 1NV7A 3TTRA 2NUVA 2Y7IA 4I40A 1M5EA 2QSXA 3MPLA 3O97A 1SW5A 4R9FA 3FXBA 1H43A 1ZMGA 1B46A 4PFWA 3FV1A 4OFOA 2XXXA 3SEVA 3MPKA 3FXRA 4MX6A 3CFXA 4GWWA 1KA0A 4U1OA 4XXUA 3VLUA 3H6VA 2ONKE 4R6KA 4N13A 3RTFB 5FTIA 3C32A 2ABHA 1FBPA 5L8DA 3K2DA 2F8DA 1BK4A 3R26A 5I5PA 5CM6A 3FD3A 5IGAA 1I6AA 5F7VA 5AA4B 4H0WA 2QS2A 4R6HA 1ANFA 4EUOA 1N04A 2PFYA 1Y3QA 1PBPA 2RF1A 1B7ZA 1A8FA 1Y3PA 2P2AA 1LBXA 2XXRA 3OO9A 3N94A 4GXSB 5AA2A 3BIHA 4U1ZA 3P7IA 4Q30B 3M3LA 2ESNA 1SW4A 2XX8A 4MIJA 3C33A 3CG1A 1NMUA 4O3CA 5H8HB 4PQJA 1IXCA 4RK2A 1URSA 2GQ1A 4NTLA 4ZEBA 1ELJA 4O3BA 3VLWA 5HM4B 4YKJA 2QJEA 5K2XA 4OTEA 4F3PA 3RPLA 4UABA 1NUYA 2AL5A 3UK4A 2V84A 4WEDA 2V3QA 1P1WA 4E0WA 1JVYA 1PC3A 4QF9A 4ZZEA 1DPEA 4IGRA 1ZU0A 5EQ9A 3O2AA 5FHOA 1NNTA 1FTLA 1ZTYA 2UXAA 4TLMB 2Z8EA 1IQ7A 4AB5A 3FUZA 1B1XA 1NV1A 2PYYA 4JWYA 3GBBA 3BKIB 5ET8A 1B51A 1FW0A 3F11A 3FVGA 3FXQA 5H8FA 3FVNA 5AA2B 5L9SA 4YB7A 1S50A 3TTNA 1M5DA 4JVDA 3ROJA 4GWOA 3W9VA 3FATA 1ZBMA 1N84A 4IO7A 4UACA 1XT8A 4GBWA
chains in the Genus database with same CATH topology
4YAHX 4OESA 4BDOA 5ELVA 2DP8A 1SDXA 2PT2A 1IIWA 2B3BA 5CBSA 3VFJA 3G3HA 3H06B 3KGCA 1UQWA 4ISUA 4PE5B 3PPRA 1LLSA 3DP4A 2AIXA 2M8CA 1EH3A 1D9YA 5DVFA 3TCHA 1LAHE 4F39A 4IB2A 1O63A 1SBPA 1H3DA 3OEKA 4LA9A 3BBRA 1DPPA 2H98A 1UTBB 5DEXB 1USYH 1JW1A 5AA2D 3RNNA 1QW0A 3K6VA 4PETA 1B3FA 3V83A 1FQEA 3H3GA 4U22A 2OZZA 4C0RA 4ELQA 3K6WA 2F34A 1IXIA 1RYXA 4GL0A 2UVIA 2HEUA 4JWXA 3HV1A 1US5A 3BFTA 4OEUA 1NH8A 3E4RA 3RY3A 3S9MC 3OENA 1JEVA 2OK2A 3A09A 1H44A 1JNFA 2HZKA 2D5WA 3HHFA 3VXBA 3FJMA 2PT1A 2NVUB 1L5TA 3KJTA 2OBGA 3CVGA 4KYEA 5H8NB 4ZE8A 2W7YA 2IEEA 1N3XA 4G68A 5I59B 4LZ7A 1JQFA 2Q2AA 4K3FA 2ZMBA 4R74A 2REGA 4LZ5A 4BDLA 2FNCA 1FTKA 3RTWB 3PMVA 3PPPA 1F9BA 4GF8A 2DYXA 2ZYMA 2YJPA 3EF7A 1ZLQA 3TPAA 1POTA 4PFUA 5I2KA 3H6WA 4F29A 3H6TA 1M5CA 4TLLB 3VDFA 3T9HB 1AL3A 3O28A 2E0SA 4ZEDA 2Y7RA 2UYEA 2PVUA 1JVXA 3SEWA 4LQ5A 2F7BA 2I4CA 3HSTA 1CB6A 4NF6A 3UGWA 3G7WA 4LP2B 2F7AA 1O7TA 2O84X 1OVBA 1HSJA 1LAXA 1QKAA 3G3IA 2NXOA 4ELPA 3CIJA 4X1BA 1NNFA 3C36A 3EHUA 2DE4A 1I6QA 3TTLA 1MXZA 5L9MA 3TZAA 2YPNA 5J1DA 2I6EA 5A5XA 3IO6A 5IAIA 3TMGA 1VFDA 3T9UA 1A54A 1D3KA 2KLFA 4DXCA 3C34A 3EQ1A 3PUXE 2ZNUA 4DZ1A 3OELA 3S2VA 4KPTA 4O3AA 4DCXA 4ZZAA 2P1SA 3QUFA 2A5TB 5H8QA 1TT1A 3TKDA 1FQCA 4H8IA 3O29A 4Z7EA 2O51A 1QULA 1CE2A 4X48A 2UVJA 1URDA 4XKPA 1MPDA 1MY4A 1YCJA 2Y7PA 5JTYA 2B65A 4OQOA 2QS1A 1BTJA 4KQPA 2R9JA 3U93A 5EYFA 1A8EA 3QK6A 3FGSA 3Q25A 1M5FA 2A5SA 4Z0IA 3K1PA 2Z8FA 1B7HA 1MH3A 4KI0E 2O69A 3B6TA 4U23A 5AA3A 1Y4TA 1PB7A 1M5BA 3V89B 1MG1A 5BWJA 2RC7A 3S9EA 2F35A 5FTHA 3H03A 3TTKA 5H8QB 2H99A 4IY6A 2V25A 1JEUA 3HPIA 3O6GA 4YMAA 4H65A 4PFYA 4YKIA 1IEJA 1WDNA 3TEPA 4F3GA 5JTYB 1IXHA 4MH5A 3UORA 3KOTA 2DWHA 1R9LA 4FEBA 3A3CA 4ESXA 3QAXA 3MVXA 5LOMA 4LATA 4YZZA 3IB0A 1QVSA 1MPBA 5H8HA 3OO6A 4R75A 2H9BA 5DYHA 2Y7KA 3IJXB 3PPNA 4QFOA 3C31A 2RC8A 3IOUA 2F36A 5IKBA 3K4UA 3VVFA 1XOCA 3K0VA 1TFDA 1B4HA 3Q29A 4F19A 4IY5A 1O64A 3DM0A 1OQHA 4XKRA 1XVXA 1OMPA 4LVQA 4BDQA 5ISUA 1MRPA 4OXVA 4YKKA 1A40A 2O68A 3MW0A 1S9TA 2I48A 1Y1ZA 1GR2A 2OJTA 3OO7A 4NEDA 1PB8A 5ICQA 1QUIA 3GLBA 3QYTA 3ILTB 4MLVA 1YTVA 2GHBA 2F7CA 4OEVA 2XXYA 2XXQA 3OSRA 2CMOA 3O6HA 2ALUA 5TU0A 4WXJA 3RQTA 4POWA 3MJNA 1Q1KA 1MXVA 1OLCA 1XVYA 1RYOA 1P99A 1J1NA 3VE1B 4H6DA 4DCYA 1B6HA 1FTOA 4U2RA 4OFJA 1ATGA 2NOOA 4DLDA 3CSGA 1ZKBA 3Q27A 3UP9A 2ZYOA 1AIVA 1P1QA 4JDFA 4NWCA 3FVKA 3M3FA 1UTBA 5DEXA 4OYVA 3THIA 3MP1A 2DVZA 2OWTA 2DWJA 4I8CA 1LGBC 3G3GA 2Q9TA 4JSDA 1SI0A 3ZS6A 1AH5A 4NF4A 5BUUA 4JB7A 4PFTA 4UA8A 4YB5A 4ZE9A 3TELA 1URGA 1B3LA 3TQLA 1MY3A 4ZEFA 2RCAA 4JBZA 1B5JA 1Y3NA 3PD9A 3C9HA 3S9LC 1LFHA 3MVWA 3N6UA 1NNPA 4KFQA 1P1UA 1D9VA 4RPNA 4KCDA 1B4ZA 2GFEA 5I57B 3U72A 2DXYA 4HCYA 5H8NA 3D4GA 1VFEA 5I59A 2F97A 5I58A 5DT6A 3QUJA 4ESWA 3C35A 3A3UA 4NF4B 4OZ9A 5EHMA 2REJA 1A7LA 2H25A 4EQBA 3MVYA 3RLFE 1OVTA 3MZ9A 2ZXTA 4QSEA 4ZEKA 2X7QA 5AE4A 3C4MA 3GXAA 4Q5TA 4KCCA 2OCUA 4OMBA 3SERA 3TFLA 4M4GA 3CFLA 3FVOA 1MM7A 3G3FA 5TP9B 4RPOA 4OVJA 3EHSA 1NFTA 1H76A 4PP0A 3Q26A 2Z8DA 3KFMA 4FE8A 4F18A 1FQDA 4RNSA 1YPNA 2QS3A 4IGTA 4GXAA 3JZJA 1B52A 1EZOA 5I58B 1TWYA 2XD2A 2G29A 4F3SA 1GV8A 1N3WA 3LSLA 5TPAB 2UVGA 2X7PA 3KJ7A 3UN6A 1BLFA 1QKBA 3VVDA 3LC8A 3G3JA 5FHNA 3VV5A 1DMBA 3OO8A 2GH9A 2PBWA 4JWOA 1LAFE 4OERA 2I0BA 1B9JA 4EQ9A 5B7DA 4ND9A 1B5HA 2V93A 3IB2A 3M3KA 2H5YA 3I6VA 4YB6A 3RN8A 1QUKA 4OETA 3KN3A 4G8NA 4NF5A 2QPQA 3PV0E 2R6GE 2HQ0A 2E1SA 2QL3A 3N5LA 3T96B 2VD2A 1UIVA 4U4XA 1R9QA 3EHTA 2A5TA 2I58A 5CBRA 4IO6A 4P11A 4WEPA 3T9VA 4P0IA 4XKQA 2GRVA 2DE3A 3TDJA 1Y20A 2XHDA 1LSTA 3IB1A 3FZVA 2LAOA 3S4UA 4THIA 2Q88A 4Q0CA 3MP6A 4QFKA 3V8XB 3ZKLA 4F1VA 3IR1A 3SESA 5JEIA 3PGFA 4BDNA 2VHAA 1FCKA 1MM6A 2XXVA 3R7XA 3SEYA 2ONSA 5I2NB 4JXIA 5M2VA 2QMXA 2THIA 5DTBA 3DP6A 3KBRA 4NF5B 4ZECA 1FQAA 3ILUB 4MBPA 1DTZA 3KZGA 4F3BA 1MQJA 2XD3A 2F6GA 2HFBA 4L17A 2ONRA 1LFGA 3SDFA 3H6UA 1MQIA 3H4ZA 4F1YA 3MWBA 1Z7ME 5L9OA 3OSQA 1TXFA 3E3KA 3L6GA 3HHGA 4BDMA 2V3TA 5JK4A 3IX1A 1LB8A 3RPWA 3SEUA 4F2QA 1BP5A 1SI1A 3AXFA 4C1TA 2HCAA 1Y4CA 2O7UA 3VLVA 4OFLA 3ZKKA 1I69A 3B6QA 1IUDA 4X9TA 4FIMA 3OOAA 1KWHA 1NH7A 2I3WA 3IOWA 4U21A 3T93B 1XC1A 4OENA 2XXHA 3FXUA 4KR5A 4I9DA 1AMFA 3UIFA 1DSNA 3U1OA 4EXKA 1H45A 1UTHB 3N26A 1NNKA 1B3GA 4ZDMA 4KYSA 4XKNA 4C1UA 1B0LA 4GFRA 1HSLA 3LSWA 2DS9A 3U92A 1Q35A 5H8SA 2Q8JA 1SW1A 1BKAA 2VOZA 4NF8A 2XXPA 3QXMA 4GL8A 2I49A 1B1HA 4WKMA 3KN8A 1POY1 2XXIA 4P0GA 3EN3A 1N0TA 3DP8A 1MQHA 2AYSA 2ZYNA 3PPOA 3G3KA 3W15C 3TCGA 4H5FA 4GQOA 3IOTA 3TQWA 4N07A 3BFUA 1EZPA 3T22A 4EF1A 1SW2A 5ICTA 1WODA 2ZNTA 2I4BA 1D4NA 3CG3A 3TCFA 4ECFA 3PUWE 2UYFA 1VSOA 1NL5A 4NMYA 4F22A 4DIGA 4NF8B 5FHMA 3MQ9A 1GGGA 2XX9A 4YICA 3IOVA 4F1UA 5KCJA 3HN0A 4F31B 1B05A 3B7DA 4R72A 2HZLA 4GVOA 1R6ZA 1R1NA 1T0KA 3PMXA 3USDA 5HBCA 2H4IA 4QFLA 3LSXA 1JW4A 2UVHA 3CI8A 1B7UA 2F5XA 2QS4A 4G8MA 2PX1A 3EPEA 1FQBA 1B58A 1YAEA 1Y1MA 4AB6A 3OXNA 1JW5A 3UA8A 2RINA 2Y7WA 4DXBA 5I84A 3FIRA 5I57A 3M8UA 4AQ4A 5CMKA 3MBPA 1MQGA 4QFNA 1WVJA 2VD3A 3I5OA 4N6PA 2XX7A 3LSFB 1MY1A 4FECA 5CMBA 3MP8A 1P1OA 1JETA 3GZGA 4GLIA 4LUBA 4EDPA 2I3VA 3MVZA 1IXGA 4BDRA 5KCJB 1B40A 1QJMA 1SVXB 4QSCA 5EHSA 1MXUA 4U4SA 3O9PA 1FTJA 2PMSA 1N76A 4RJZA 1PDAA 2DQVA 4DDDA 3CRBA 3ECRA 3PPQA 3LR1A 4R2FA 3LUYA 3B6WA 3OD7A 4X1DA 3I3VA 5TP9A 1PBQA 3TUSA 1US4A 3W9WA 4IO2A 4EF2A 5CMCA 4Q8RA 3ODBA 3RGYA 4QFPA 1SQYA 1B2HA 3K01A 4HTGA 2XXUA 4ELOA 5HPQA 4FATA 1EU8A 4OHNA 3IJOB 4XIGQ 5DVIA 2DE2A 5KZTA 3GBAA 3KOSA 2Y84A 2HAUA 3FJ7A 5KDTA 4R73A 5TPAA 4IO4A 5DVJA 3O6IA 1GTKA 3KEIA 3QSLA 5CMMA 5H8FB 3IORA 3PUYE 2DOJA 4GOTA 1LAGE 5ITPA 1B3EA 3PU5A 4H8JA 2OLBA 2GHAA 1QUJA 1LCFA 1MXXA 5K2YA 4RK9A 4HCWA 3CFZA 3K02A 4F2OA 1II5A 1AOVA 2O1LA 5AA1A 3U8QA 2O1MA 2Q2CA 4R6YA 1OLAA 3VXCA 3K00A 4EXLA 1IZ1A 2XXWA 4TOZA 5CC2A 1N7XA 3SKPA 3HCQA 1ZIUA 2WKYA 3DELB 4ELRA 3FASA 2DVCA 4JSOA 5KDTB 3MZBA 4G68C 2Z23A 3PUZE 3K1MA 4ZS9A 2F78A 1OQGA 5F1QA 4QRZA 1P1NA 3IL1B 1MXWA 1LBBA 3U94A 1IITA 4XTCQ 2P0SA 4YMBA 2IA4A 3K6XA 3TODA 3RT6B 1HSEA 2ANJA 1S7YA 3DLNA 4IO3A 1SYHA 2G93A 3PMWA 2D3IA 4KD5A 4G2ZA 3T66A 3TAJA 3QIMA 1DTGA 3WAFA 5ITOA 3H7MA 3KN7A 2FYIA 4H67A 2HXWA 3RUMA 3E13X 2VGQA 4G77A 1B0HA 1OIBA 3RT8A 5I2NA 1MDQA 3TTMA 2VP1A 4HS7A 4RY1A 1USYE 1SD3A 1DOTA 3MZ1A 4H5GA 3VVEA 2RC9A 5CRYA 1MY0A 3Q28A 4RA1A 4M1VA 3K1NA 4ONYA 3OMBA 4G8HA 4YU0A 2AL4A 4RXLA 1LB9A 4G68B 1A55A 3E9XA 2QRYA 1VR5A 1B3HA 4FORA 1FTMA 2BJJX 1LCTA 1B32A 4DXUA 3N6TA 4TQUQ 3IAZA 2DWAA 3FJGA 3CSBA 1A99A 2QMWA 4GD5A 4OWDA 3SEXA 4LQ2A 1LBCA 1B5IA 4NWDA 5I2KB 1MY2A 1VE4A 3O66A 4KHZE 2DWIA 3R6UA 3IO4A 4H1XA 5CI5A 4LZ8A 1MQDA 3D4CA 3S9NC 4EQ7A 4IO5A 2O6AA 3V5AA 4MFIA 2Q89A 5B70A 3MUQA 3OEMA 4R2BA 4I62A 1UTHA 4YKPA 2Z22A 4I1DA 3WAEA 2CZLA 1TFAA 4NF6B 1NKXA 1EZ9A 4MLQA 1PEBA 4QHQA 4HW8A 2HAVA 2DXRA 3SETA 4KYDA 4E0XA 2F6PA 3ONMA 1RKMA 3KG2A 1BIYA 3HO7A 4BLAA 3T9XB 1XS5A 3PD8A 1Y9UA 2NWJA 5I56A 4GRKA 3JV9A 2V3UA 3ZSFA 1UIUA 1PB9A 3KSJA 4FAJA 4FJPA 3MC2A 4MF3A 5A5XB 4LONB 2O7IA 4ZEIA 1FQFA 1N7WA 2R71A 1MS7A 1GVCA 1MPCA 4R9GA 2YLNA 3IK6B 1I6BA 4GIZA 2D21A 3JYRA 4NE4A 4QSDA 1MXYA 4FEDA 2ZYKA 3CR9A 2RKMA 2I0CA 3TYHA 3FV2A 2XXTA 3LBSA 2FA7A 3MAMA 5AA4A 2OWSA 1MDP1 1XHYA 1SYIA 2ZNSA 1MH4A 2DSFA 4RYAA 1ZJLA 2RCBA 1LFIA 4DE8A 2X26A 5I56B 2B3FA 4POXA 4G4PA 3KSXA 3L6HA 1Z7NE 3K6UA 3PUVE 3TTRA 2NUVA 2Y7IA 1M5EA 2QSXA 3MPLA 3O97A 1SW5A 4R9FA 1H43A 1ZMGA 1B46A 4PFWA 3FV1A 4OFOA 2XXXA 3SEVA 3MPKA 3FXRA 3CFXA 4U1OA 4XXUA 3VLUA 3H6VA 2ONKE 4R6KA 4N13A 3RTFB 5FTIA 3C32A 2ABHA 5L8DA 3K2DA 2F8DA 3R26A 5CM6A 3FD3A 1I6AA 5F7VA 5AA4B 4H0WA 2QS2A 4R6HA 1ANFA 4EUOA 1N04A 1Y3QA 1PBPA 2RF1A 1B7ZA 1A8FA 1Y3PA 2P2AA 2XXRA 3OO9A 3N94A 4GXSB 5AA2A 4U1ZA 3P7IA 4Q30B 3M3LA 2ESNA 1SW4A 2XX8A 3C33A 3CG1A 1NMUA 4O3CA 5H8HB 4PQJA 1IXCA 4RK2A 1URSA 4NTLA 4ZEBA 1ELJA 4O3BA 3VLWA 5HM4B 4YKJA 2QJEA 5K2XA 4OTEA 4F3PA 2AL5A 3UK4A 2V84A 4WEDA 2V3QA 1P1WA 4E0WA 1JVYA 1PC3A 4QF9A 4ZZEA 1DPEA 4IGRA 1ZU0A 3O2AA 5FHOA 1NNTA 1FTLA 1ZTYA 2UXAA 4TLMB 2Z8EA 1IQ7A 4AB5A 3FUZA 1B1XA 2PYYA 4JWYA 3GBBA 3BKIB 1B51A 1FW0A 3F11A 3FVGA 3FXQA 5H8FA 3FVNA 5AA2B 5L9SA 4YB7A 1S50A 3TTNA 1M5DA 4GWOA 3W9VA 3FATA 1ZBMA 1N84A 4IO7A 4UACA 1XT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAH X;  4OES A;  4BDO A;  5ELV A;  2DP8 A;  1SDX A;  2PT2 A;  1IIW A;  2B3B A;  5CBS A;  3VFJ A;  3G3H A;  3H06 B;  3KGC A;  1UQW A;  4ISU A;  4PE5 B;  3PPR A;  1LLS A;  3DP4 A;  2AIX A;  2M8C A;  1EH3 A;  1D9Y A;  5DVF A;  3TCH A;  1LAH E;  4F39 A;  4IB2 A;  1O63 A;  1SBP A;  1H3D A;  3OEK A;  4LA9 A;  3BBR A;  1DPP A;  2H98 A;  1UTB B;  5DEX B;  1USY H;  1JW1 A;  5AA2 D;  3RNN A;  1QW0 A;  3K6V A;  4PET A;  1B3F A;  3V83 A;  1FQE A;  3H3G A;  4U22 A;  2OZZ A;  4C0R A;  4ELQ A;  3K6W A;  2F34 A;  1IXI A;  1RYX A;  4GL0 A;  2UVI A;  2HEU A;  4JWX A;  3HV1 A;  1US5 A;  3BFT A;  4OEU A;  1NH8 A;  3E4R A;  3RY3 A;  3S9M C;  3OEN A;  1JEV A;  2OK2 A;  3A09 A;  1H44 A;  1JNF A;  2HZK A;  2D5W A;  3HHF A;  3VXB A;  3FJM A;  2PT1 A;  2NVU B;  1L5T A;  3KJT A;  2OBG A;  3CVG A;  4KYE A;  5H8N B;  4ZE8 A;  2W7Y A;  2IEE A;  1N3X A;  4G68 A;  5I59 B;  4LZ7 A;  1JQF A;  2Q2A A;  4K3F A;  2ZMB A;  4R74 A;  2REG A;  4LZ5 A;  4BDL A;  2FNC A;  1FTK A;  3RTW B;  3PMV A;  3PPP A;  1F9B A;  4GF8 A;  2DYX A;  2ZYM A;  2YJP A;  3EF7 A;  1ZLQ A;  3TPA A;  1POT A;  4PFU A;  5I2K A;  3H6W A;  4F29 A;  3H6T A;  1M5C A;  4TLL B;  3VDF A;  3T9H B;  1AL3 A;  3O28 A;  2E0S A;  4ZED A;  2Y7R A;  2UYE A;  2PVU A;  1JVX A;  3SEW A;  4LQ5 A;  2F7B A;  2I4C A;  3HST A;  1CB6 A;  4NF6 A;  3UGW A;  3G7W A;  4LP2 B;  2F7A A;  1O7T A;  2O84 X;  1OVB A;  1HSJ A;  1LAX A;  1QKA A;  3G3I A;  2NXO A;  4ELP A;  3CIJ A;  4X1B A;  1NNF A;  3C36 A;  3EHU A;  2DE4 A;  1I6Q A;  3TTL A;  1MXZ A;  5L9M A;  3TZA A;  2YPN A;  5J1D A;  2I6E A;  5A5X A;  3IO6 A;  5IAI A;  3TMG A;  1VFD A;  3T9U A;  1A54 A;  1D3K A;  2KLF A;  4DXC A;  3C34 A;  3EQ1 A;  3PUX E;  2ZNU A;  4DZ1 A;  3OEL A;  3S2V A;  4KPT A;  4O3A A;  4DCX A;  4ZZA A;  2P1S A;  3QUF A;  2A5T B;  5H8Q A;  1TT1 A;  3TKD A;  1FQC A;  4H8I A;  3O29 A;  4Z7E A;  2O51 A;  1QUL A;  1CE2 A;  4X48 A;  2UVJ A;  1URD A;  4XKP A;  1MPD A;  1MY4 A;  1YCJ A;  2Y7P A;  5JTY A;  2B65 A;  4OQO A;  2QS1 A;  1BTJ A;  4KQP A;  2R9J A;  3U93 A;  5EYF A;  1A8E A;  3QK6 A;  3FGS A;  3Q25 A;  1M5F A;  2A5S A;  4Z0I A;  3K1P A;  2Z8F A;  1B7H A;  1MH3 A;  4KI0 E;  2O69 A;  3B6T A;  4U23 A;  5AA3 A;  1Y4T A;  1PB7 A;  1M5B A;  3V89 B;  1MG1 A;  5BWJ A;  2RC7 A;  3S9E A;  2F35 A;  5FTH A;  3H03 A;  3TTK A;  5H8Q B;  2H99 A;  4IY6 A;  2V25 A;  1JEU A;  3HPI A;  3O6G A;  4YMA A;  4H65 A;  4PFY A;  4YKI A;  1IEJ A;  1WDN A;  3TEP A;  4F3G A;  5JTY B;  1IXH A;  4MH5 A;  3UOR A;  3KOT A;  2DWH A;  1R9L A;  4FEB A;  3A3C A;  4ESX A;  3QAX A;  3MVX A;  5LOM A;  4LAT A;  4YZZ A;  3IB0 A;  1QVS A;  1MPB A;  5H8H A;  3OO6 A;  4R75 A;  2H9B A;  5DYH A;  2Y7K A;  3IJX B;  3PPN A;  4QFO A;  3C31 A;  2RC8 A;  3IOU A;  2F36 A;  5IKB A;  3K4U A;  3VVF A;  1XOC A;  3K0V A;  1TFD A;  1B4H A;  3Q29 A;  4F19 A;  4IY5 A;  1O64 A;  3DM0 A;  1OQH A;  4XKR A;  1XVX A;  1OMP A;  4LVQ A;  4BDQ A;  5ISU A;  1MRP A;  4OXV A;  4YKK A;  1A40 A;  2O68 A;  3MW0 A;  1S9T A;  2I48 A;  1Y1Z A;  1GR2 A;  2OJT A;  3OO7 A;  4NED A;  1PB8 A;  5ICQ A;  1QUI A;  3GLB A;  3QYT A;  3ILT B;  4MLV A;  1YTV A;  2GHB A;  2F7C A;  4OEV A;  2XXY A;  2XXQ A;  3OSR A;  2CMO A;  3O6H A;  2ALU A;  5TU0 A;  4WXJ A;  3RQT A;  4POW A;  3MJN A;  1Q1K A;  1MXV A;  1OLC A;  1XVY A;  1RYO A;  1P99 A;  1J1N A;  3VE1 B;  4H6D A;  4DCY A;  1B6H A;  1FTO A;  4U2R A;  4OFJ A;  1ATG A;  2NOO A;  4DLD A;  3CSG A;  1ZKB A;  3Q27 A;  3UP9 A;  2ZYO A;  1AIV A;  1P1Q A;  4JDF A;  4NWC A;  3FVK A;  3M3F A;  1UTB A;  5DEX A;  4OYV A;  3THI A;  3MP1 A;  2DVZ A;  2OWT A;  2DWJ A;  4I8C A;  1LGB C;  3G3G A;  2Q9T A;  4JSD A;  1SI0 A;  3ZS6 A;  1AH5 A;  4NF4 A;  5BUU A;  4JB7 A;  4PFT A;  4UA8 A;  4YB5 A;  4ZE9 A;  3TEL A;  1URG A;  1B3L A;  3TQL A;  1MY3 A;  4ZEF A;  2RCA A;  4JBZ A;  1B5J A;  1Y3N A;  3PD9 A;  3C9H A;  3S9L C;  1LFH A;  3MVW A;  3N6U A;  1NNP A;  4KFQ A;  1P1U A;  1D9V A;  4RPN A;  4KCD A;  1B4Z A;  2GFE A;  5I57 B;  3U72 A;  2DXY A;  4HCY A;  5H8N A;  3D4G A;  1VFE A;  5I59 A;  2F97 A;  5I58 A;  5DT6 A;  3QUJ A;  4ESW A;  3C35 A;  3A3U A;  4NF4 B;  4OZ9 A;  5EHM A;  2REJ A;  1A7L A;  2H25 A;  4EQB A;  3MVY A;  3RLF E;  1OVT A;  3MZ9 A;  2ZXT A;  4QSE A;  4ZEK A;  2X7Q A;  5AE4 A;  3C4M A;  3GXA A;  4Q5T A;  4KCC A;  2OCU A;  4OMB A;  3SER A;  3TFL A;  4M4G A;  3CFL A;  3FVO A;  1MM7 A;  3G3F A;  5TP9 B;  4RPO A;  4OVJ A;  3EHS A;  1NFT A;  1H76 A;  4PP0 A;  3Q26 A;  2Z8D A;  3KFM A;  4FE8 A;  4F18 A;  1FQD A;  4RNS A;  1YPN A;  2QS3 A;  4IGT A;  4GXA A;  3JZJ A;  1B52 A;  1EZO A;  5I58 B;  1TWY A;  2XD2 A;  2G29 A;  4F3S A;  1GV8 A;  1N3W A;  3LSL A;  5TPA B;  2UVG A;  2X7P A;  3KJ7 A;  3UN6 A;  1BLF A;  1QKB A;  3VVD A;  3LC8 A;  3G3J A;  5FHN A;  3VV5 A;  1DMB A;  3OO8 A;  2GH9 A;  2PBW A;  4JWO A;  1LAF E;  4OER A;  2I0B A;  1B9J A;  4EQ9 A;  5B7D A;  4ND9 A;  1B5H A;  2V93 A;  3IB2 A;  3M3K A;  2H5Y A;  3I6V A;  4YB6 A;  3RN8 A;  1QUK A;  4OET A;  3KN3 A;  4G8N A;  4NF5 A;  2QPQ A;  3PV0 E;  2R6G E;  2HQ0 A;  2E1S A;  2QL3 A;  3N5L A;  3T96 B;  2VD2 A;  1UIV A;  4U4X A;  1R9Q A;  3EHT A;  2A5T A;  2I58 A;  5CBR A;  4IO6 A;  4P11 A;  4WEP A;  3T9V A;  4P0I A;  4XKQ A;  2GRV A;  2DE3 A;  3TDJ A;  1Y20 A;  2XHD A;  1LST A;  3IB1 A;  3FZV A;  2LAO A;  3S4U A;  4THI A;  2Q88 A;  4Q0C A;  3MP6 A;  4QFK A;  3V8X B;  3ZKL A;  4F1V A;  3IR1 A;  3SES A;  5JEI A;  3PGF A;  4BDN A;  2VHA A;  1FCK A;  1MM6 A;  2XXV A;  3R7X A;  3SEY A;  2ONS A;  5I2N B;  4JXI A;  5M2V A;  2QMX A;  2THI A;  5DTB A;  3DP6 A;  3KBR A;  4NF5 B;  4ZEC A;  1FQA A;  3ILU B;  4MBP A;  1DTZ A;  3KZG A;  4F3B A;  1MQJ A;  2XD3 A;  2F6G A;  2HFB A;  4L17 A;  2ONR A;  1LFG A;  3SDF A;  3H6U A;  1MQI A;  3H4Z A;  4F1Y A;  3MWB A;  1Z7M E;  5L9O A;  3OSQ A;  1TXF A;  3E3K A;  3L6G A;  3HHG A;  4BDM A;  2V3T A;  5JK4 A;  3IX1 A;  1LB8 A;  3RPW A;  3SEU A;  4F2Q A;  1BP5 A;  1SI1 A;  3AXF A;  4C1T A;  2HCA A;  1Y4C A;  2O7U A;  3VLV A;  4OFL A;  3ZKK A;  1I69 A;  3B6Q A;  1IUD A;  4X9T A;  4FIM A;  3OOA A;  1KWH A;  1NH7 A;  2I3W A;  3IOW A;  4U21 A;  3T93 B;  1XC1 A;  4OEN A;  2XXH A;  3FXU A;  4KR5 A;  4I9D A;  1AMF A;  3UIF A;  1DSN A;  3U1O A;  4EXK A;  1H45 A;  1UTH B;  3N26 A;  1NNK A;  1B3G A;  4ZDM A;  4KYS A;  4XKN A;  4C1U A;  1B0L A;  4GFR A;  1HSL A;  3LSW A;  2DS9 A;  3U92 A;  1Q35 A;  5H8S A;  2Q8J A;  1SW1 A;  1BKA A;  2VOZ A;  4NF8 A;  2XXP A;  3QXM A;  4GL8 A;  2I49 A;  1B1H A;  4WKM A;  3KN8 A;  1POY 1;  2XXI A;  4P0G A;  3EN3 A;  1N0T A;  3DP8 A;  1MQH A;  2AYS A;  2ZYN A;  3PPO A;  3G3K A;  3W15 C;  3TCG A;  4H5F A;  4GQO A;  3IOT A;  3TQW A;  4N07 A;  3BFU A;  1EZP A;  3T22 A;  4EF1 A;  1SW2 A;  5ICT A;  1WOD A;  2ZNT A;  2I4B A;  1D4N A;  3CG3 A;  3TCF A;  4ECF A;  3PUW E;  2UYF A;  1VSO A;  1NL5 A;  4NMY A;  4F22 A;  4DIG A;  4NF8 B;  5FHM A;  3MQ9 A;  1GGG A;  2XX9 A;  4YIC A;  3IOV A;  4F1U A;  5KCJ A;  3HN0 A;  4F31 B;  1B05 A;  3B7D A;  4R72 A;  2HZL A;  4GVO A;  1R6Z A;  1R1N A;  1T0K A;  3PMX A;  3USD A;  5HBC A;  2H4I A;  4QFL A;  3LSX A;  1JW4 A;  2UVH A;  3CI8 A;  1B7U A;  2F5X A;  2QS4 A;  4G8M A;  2PX1 A;  3EPE A;  1FQB A;  1B58 A;  1YAE A;  1Y1M A;  4AB6 A;  3OXN A;  1JW5 A;  3UA8 A;  2RIN A;  2Y7W A;  4DXB A;  5I84 A;  3FIR A;  5I57 A;  3M8U A;  4AQ4 A;  5CMK A;  3MBP A;  1MQG A;  4QFN A;  1WVJ A;  2VD3 A;  3I5O A;  4N6P A;  2XX7 A;  3LSF B;  1MY1 A;  4FEC A;  5CMB A;  3MP8 A;  1P1O A;  1JET A;  3GZG A;  4GLI A;  4LUB A;  4EDP A;  2I3V A;  3MVZ A;  1IXG A;  4BDR A;  5KCJ B;  1B40 A;  1QJM A;  1SVX B;  4QSC A;  5EHS A;  1MXU A;  4U4S A;  3O9P A;  1FTJ A;  2PMS A;  1N76 A;  4RJZ A;  1PDA A;  2DQV A;  4DDD A;  3CRB A;  3ECR A;  3PPQ A;  3LR1 A;  4R2F A;  3LUY A;  3B6W A;  3OD7 A;  4X1D A;  3I3V A;  5TP9 A;  1PBQ A;  3TUS A;  1US4 A;  3W9W A;  4IO2 A;  4EF2 A;  5CMC A;  4Q8R A;  3ODB A;  3RGY A;  4QFP A;  1SQY A;  1B2H A;  3K01 A;  4HTG A;  2XXU A;  4ELO A;  5HPQ A;  4FAT A;  1EU8 A;  4OHN A;  3IJO B;  4XIG Q;  5DVI A;  2DE2 A;  5KZT A;  3GBA A;  3KOS A;  2Y84 A;  2HAU A;  3FJ7 A;  5KDT A;  4R73 A;  5TPA A;  4IO4 A;  5DVJ A;  3O6I A;  1GTK A;  3KEI A;  3QSL A;  5CMM A;  5H8F B;  3IOR A;  3PUY E;  2DOJ A;  4GOT A;  1LAG E;  5ITP A;  1B3E A;  3PU5 A;  4H8J A;  2OLB A;  2GHA A;  1QUJ A;  1LCF A;  1MXX A;  5K2Y A;  4RK9 A;  4HCW A;  3CFZ A;  3K02 A;  4F2O A;  1II5 A;  1AOV A;  2O1L A;  5AA1 A;  3U8Q A;  2O1M A;  2Q2C A;  4R6Y A;  1OLA A;  3VXC A;  3K00 A;  4EXL A;  1IZ1 A;  2XXW A;  4TOZ A;  5CC2 A;  1N7X A;  3SKP A;  3HCQ A;  1ZIU A;  2WKY A;  3DEL B;  4ELR A;  3FAS A;  2DVC A;  4JSO A;  5KDT B;  3MZB A;  4G68 C;  2Z23 A;  3PUZ E;  3K1M A;  4ZS9 A;  2F78 A;  1OQG A;  5F1Q A;  4QRZ A;  1P1N A;  3IL1 B;  1MXW A;  1LBB A;  3U94 A;  1IIT A;  4XTC Q;  2P0S A;  4YMB A;  2IA4 A;  3K6X A;  3TOD A;  3RT6 B;  1HSE A;  2ANJ A;  1S7Y A;  3DLN A;  4IO3 A;  1SYH A;  2G93 A;  3PMW A;  2D3I A;  4KD5 A;  4G2Z A;  3T66 A;  3TAJ A;  3QIM A;  1DTG A;  3WAF A;  5ITO A;  3H7M A;  3KN7 A;  2FYI A;  4H67 A;  2HXW A;  3RUM A;  3E13 X;  2VGQ A;  4G77 A;  1B0H A;  1OIB A;  3RT8 A;  5I2N A;  1MDQ A;  3TTM A;  2VP1 A;  4HS7 A;  4RY1 A;  1USY E;  1SD3 A;  1DOT A;  3MZ1 A;  4H5G A;  3VVE A;  2RC9 A;  5CRY A;  1MY0 A;  3Q28 A;  4RA1 A;  4M1V A;  3K1N A;  4ONY A;  3OMB A;  4G8H A;  4YU0 A;  2AL4 A;  4RXL A;  1LB9 A;  4G68 B;  1A55 A;  3E9X A;  2QRY A;  1VR5 A;  1B3H A;  4FOR A;  1FTM A;  2BJJ X;  1LCT A;  1B32 A;  4DXU A;  3N6T A;  4TQU Q;  3IAZ A;  2DWA A;  3FJG A;  3CSB A;  1A99 A;  2QMW A;  4GD5 A;  4OWD A;  3SEX A;  4LQ2 A;  1LBC A;  1B5I A;  4NWD A;  5I2K B;  1MY2 A;  1VE4 A;  3O66 A;  4KHZ E;  2DWI A;  3R6U A;  3IO4 A;  4H1X A;  5CI5 A;  4LZ8 A;  1MQD A;  3D4C A;  3S9N C;  4EQ7 A;  4IO5 A;  2O6A A;  3V5A A;  4MFI A;  2Q89 A;  5B70 A;  3MUQ A;  3OEM A;  4R2B A;  4I62 A;  1UTH A;  4YKP A;  2Z22 A;  4I1D A;  3WAE A;  2CZL A;  1TFA A;  4NF6 B;  1NKX A;  1EZ9 A;  4MLQ A;  1PEB A;  4QHQ A;  4HW8 A;  2HAV A;  2DXR A;  3SET A;  4KYD A;  4E0X A;  2F6P A;  3ONM A;  1RKM A;  3KG2 A;  1BIY A;  3HO7 A;  4BLA A;  3T9X B;  1XS5 A;  3PD8 A;  1Y9U A;  2NWJ A;  5I56 A;  4GRK A;  3JV9 A;  2V3U A;  3ZSF A;  1UIU A;  1PB9 A;  3KSJ A;  4FAJ A;  4FJP A;  3MC2 A;  4MF3 A;  5A5X B;  4LON B;  2O7I A;  4ZEI A;  1FQF A;  1N7W A;  2R71 A;  1MS7 A;  1GVC A;  1MPC A;  4R9G A;  2YLN A;  3IK6 B;  1I6B A;  4GIZ A;  2D21 A;  3JYR A;  4NE4 A;  4QSD A;  1MXY A;  4FED A;  2ZYK A;  3CR9 A;  2RKM A;  2I0C A;  3TYH A;  3FV2 A;  2XXT A;  3LBS A;  2FA7 A;  3MAM A;  5AA4 A;  2OWS A;  1MDP 1;  1XHY A;  1SYI A;  2ZNS A;  1MH4 A;  2DSF A;  4RYA A;  1ZJL A;  2RCB A;  1LFI A;  4DE8 A;  2X26 A;  5I56 B;  2B3F A;  4POX A;  4G4P A;  3KSX A;  3L6H A;  1Z7N E;  3K6U A;  3PUV E;  3TTR A;  2NUV A;  2Y7I A;  1M5E A;  2QSX A;  3MPL A;  3O97 A;  1SW5 A;  4R9F A;  1H43 A;  1ZMG A;  1B46 A;  4PFW A;  3FV1 A;  4OFO A;  2XXX A;  3SEV A;  3MPK A;  3FXR A;  3CFX A;  4U1O A;  4XXU A;  3VLU A;  3H6V A;  2ONK E;  4R6K A;  4N13 A;  3RTF B;  5FTI A;  3C32 A;  2ABH A;  5L8D A;  3K2D A;  2F8D A;  3R26 A;  5CM6 A;  3FD3 A;  1I6A A;  5F7V A;  5AA4 B;  4H0W A;  2QS2 A;  4R6H A;  1ANF A;  4EUO A;  1N04 A;  1Y3Q A;  1PBP A;  2RF1 A;  1B7Z A;  1A8F A;  1Y3P A;  2P2A A;  2XXR A;  3OO9 A;  3N94 A;  4GXS B;  5AA2 A;  4U1Z A;  3P7I A;  4Q30 B;  3M3L A;  2ESN A;  1SW4 A;  2XX8 A;  3C33 A;  3CG1 A;  1NMU A;  4O3C A;  5H8H B;  4PQJ A;  1IXC A;  4RK2 A;  1URS A;  4NTL A;  4ZEB A;  1ELJ A;  4O3B A;  3VLW A;  5HM4 B;  4YKJ A;  2QJE A;  5K2X A;  4OTE A;  4F3P A;  2AL5 A;  3UK4 A;  2V84 A;  4WED A;  2V3Q A;  1P1W A;  4E0W A;  1JVY A;  1PC3 A;  4QF9 A;  4ZZE A;  1DPE A;  4IGR A;  1ZU0 A;  3O2A A;  5FHO A;  1NNT A;  1FTL A;  1ZTY A;  2UXA A;  4TLM B;  2Z8E A;  1IQ7 A;  4AB5 A;  3FUZ A;  1B1X A;  2PYY A;  4JWY A;  3GBB A;  3BKI B;  1B51 A;  1FW0 A;  3F11 A;  3FVG A;  3FXQ A;  5H8F A;  3FVN A;  5AA2 B;  5L9S A;  4YB7 A;  1S50 A;  3TTN A;  1M5D A;  4GWO A;  3W9V A;  3FAT A;  1ZBM A;  1N84 A;  4IO7 A;  4UAC A;  1XT8 A; 
#chains in the Genus database with same CATH topology
 4YAH X;  2Q8M A;  4OES A;  4BDO A;  2OWZ A;  5ELV A;  2DP8 A;  1SDX A;  2PT2 A;  1IIW A;  2B3B A;  5CBS A;  3VFJ A;  3G3H A;  3H06 B;  3KGC A;  1UQW A;  4ISU A;  4PE5 B;  3PPR A;  1LLS A;  1FBG A;  3DP4 A;  2AIX A;  2M8C A;  1EH3 A;  1D9Y A;  5DVF A;  3TCH A;  1LAH E;  4F39 A;  4IB2 A;  1O63 A;  1SBP A;  5ET5 A;  1H3D A;  3OEK A;  4LA9 A;  3BBR A;  1DPP A;  4LN5 A;  2H98 A;  1FSA A;  1UTB B;  5DEX B;  1USY H;  1JW1 A;  5AA2 D;  1G0H A;  4PAI A;  3RNN A;  1QW0 A;  3GYY A;  1G0I A;  5EYH A;  3K6V A;  4PET A;  1B3F A;  3V83 A;  1FQE A;  3H3G A;  4U22 A;  2OZZ A;  4C0R A;  4ELQ A;  1LBY A;  3K6W A;  2F34 A;  1IXI A;  1RYX A;  4GL0 A;  2UVI A;  2HEU A;  4JWX A;  4PFB A;  3HV1 A;  1US5 A;  3BFT A;  2B4M A;  4OEU A;  1NH8 A;  3QMF A;  3E4R A;  3RY3 A;  3S9M C;  3OEN A;  1JEV A;  1NUW A;  2OK2 A;  3A09 A;  1H44 A;  1JNF A;  2HZK A;  2D5W A;  4PFR A;  3HHF A;  3VXB A;  3FJM A;  2PT1 A;  2NVU B;  1L5T A;  1FPB A;  1JP4 A;  3KJT A;  2OBG A;  2MKZ A;  4P56 A;  3CVG A;  4KYE A;  5H8N B;  4ZE8 A;  2W7Y A;  2IEE A;  1N3X A;  1LBZ A;  4G68 A;  5I59 B;  4LZ7 A;  1JQF A;  2Q2A A;  4MNP A;  4K3F A;  2ZMB A;  4R74 A;  2REG A;  4XEQ A;  4AS4 A;  4LZ5 A;  4BDL A;  1IMD A;  4MAG A;  2FNC A;  2ZZX A;  1FTK A;  2PCR A;  4NG7 A;  3RTW B;  3PMV A;  3PPP A;  4I3Y A;  1F9B A;  4GF8 A;  2DYX A;  2ZYM A;  2YJP A;  3EF7 A;  1ZLQ A;  4HXV A;  3TPA A;  1POT A;  4PFU A;  5I2K A;  4OAN A;  3H6W A;  4F29 A;  3H6T A;  1M5C A;  4TLL B;  3VDF A;  3T9H B;  1AL3 A;  4DI4 B;  3O28 A;  1FPI A;  2E0S A;  2FHY A;  4OVQ A;  4ZED A;  2Y7R A;  2UYE A;  1K9Z A;  2PVU A;  1JVX A;  5I3S A;  3SEW A;  4LQ5 A;  2F7B A;  2I4C A;  3HST A;  1CB6 A;  5IZ1 A;  4NF6 A;  3UGW A;  4N6D A;  3G7W A;  4LP2 B;  2F7A A;  1YYZ A;  3T1B A;  1O7T A;  2O84 X;  4GWU A;  1OVB A;  1HSJ A;  1LAX A;  1QKA A;  3G3I A;  2NXO A;  4GX6 A;  4ELP A;  4HE1 A;  3CIJ A;  4X1B A;  1NNF A;  3C36 A;  3EHU A;  2DE4 A;  1I6Q A;  3TTL A;  1MXZ A;  1EYI A;  5L9M A;  3TZA A;  2YPN A;  5J1D A;  2I6E A;  5A5X A;  3IO6 A;  5IAI A;  3TMG A;  1VFD A;  3T9U A;  1A54 A;  1D3K A;  2KLF A;  4DXC A;  3C34 A;  4N8G A;  3EQ1 A;  3PUX E;  2ZNU A;  4DZ1 A;  3OEL A;  3S2V A;  4KPT A;  4O3A A;  4DCX A;  4ZZA A;  2P1S A;  3QUF A;  2A5T B;  5H8Q A;  5LDZ A;  2QFL A;  1TT1 A;  3TKD A;  1FQC A;  3B8B A;  4H8I A;  3O29 A;  4Z7E A;  2O51 A;  1QUL A;  1CE2 A;  4X48 A;  2UVJ A;  1URD A;  4XKP A;  1MPD A;  1MY4 A;  3A29 A;  1YCJ A;  2Y7P A;  5JTY A;  4P3L A;  5EQ8 A;  2B65 A;  4OQO A;  2QS1 A;  1BTJ A;  4KQP A;  1FBC A;  2R9J A;  2CZH A;  4PF8 A;  3U93 A;  5EYF A;  1A8E A;  3QK6 A;  3FGS A;  3Q25 A;  1M5F A;  2A5S A;  4Z0I A;  3K1P A;  2Z8F A;  1B7H A;  1MH3 A;  4KI0 E;  2O69 A;  3B6T A;  4U23 A;  5AA3 A;  1Y4T A;  4MJO A;  1PB7 A;  1M5B A;  3NOH A;  4PBQ A;  2R8T A;  3V89 B;  1MG1 A;  3IFA A;  5BWJ A;  2RC7 A;  3S9E A;  2F35 A;  5FTH A;  3H03 A;  3TTK A;  5H8Q B;  2H99 A;  4IY6 A;  2V25 A;  1JEU A;  3HPI A;  3O6G A;  4YMA A;  4H65 A;  4PFY A;  4YKI A;  1IEJ A;  2WBB A;  1WDN A;  3TEP A;  4F3G A;  5JTY B;  1IXH A;  4MH5 A;  3UOR A;  3KOT A;  2DWH A;  1R9L A;  4FEB A;  3A3C A;  4ESX A;  3QAX A;  3MVX A;  5LOM A;  2CZI A;  4LAT A;  4YZZ A;  2WBD A;  4N8Y A;  3IB0 A;  5A5L A;  1QVS A;  1MPB A;  5H8H A;  1EYJ A;  3OO6 A;  4R75 A;  2H9B A;  5DYH A;  2Y7K A;  2DDK A;  1LBV A;  3IJX B;  3PPN A;  4QFO A;  1K9Y A;  3C31 A;  2RC8 A;  3IOU A;  2F36 A;  5IKB A;  2WYK A;  1RDX A;  3K4U A;  3VVF A;  1XOC A;  3K0V A;  1TFD A;  1B4H A;  3Q29 A;  4F19 A;  4IY5 A;  1O64 A;  1FBH A;  3DM0 A;  1OQH A;  4MEV A;  4XKR A;  1XVX A;  5T3J A;  1OMP A;  4LVQ A;  4BDQ A;  5ISU A;  4PAK A;  1MRP A;  4OXV A;  4YKK A;  1A40 A;  2O68 A;  3MW0 A;  1S9T A;  2I48 A;  4OVT A;  1Y1Z A;  1GR2 A;  4IR8 A;  2OJT A;  3OO7 A;  4NED A;  1PB8 A;  5ICQ A;  1QUI A;  3GLB A;  3QYT A;  3ILT B;  4XFE A;  4MLV A;  5ESY A;  4GWS A;  1YTV A;  2Q74 A;  2GHB A;  2F7C A;  4OEV A;  2XXY A;  2XXQ A;  3OSR A;  2CMO A;  4P9K A;  3O6H A;  2ALU A;  4O7I A;  5TU0 A;  4WXJ A;  3RQT A;  4POW A;  3MJN A;  1Q1K A;  1MXV A;  4NGU A;  1OLC A;  4QXD A;  1XVY A;  1RYO A;  1P99 A;  1J1N A;  4X04 A;  4H6D A;  3VE1 B;  1B6H A;  1FTO A;  4DCY A;  4U2R A;  3FBP A;  4OFJ A;  1FPD A;  1ATG A;  2NOO A;  4OA4 A;  4DLD A;  3CSG A;  1ZKB A;  3Q27 A;  3UP9 A;  4NF0 A;  2ZYO A;  1AIV A;  1P1Q A;  2F3B A;  2F3D A;  4JDF A;  4O7M A;  4NWC A;  2XWK A;  3FVK A;  3M3F A;  1UTB A;  3T0J A;  5DEX A;  2XA5 A;  4OYV A;  4OVP A;  3THI A;  3MP1 A;  2DVZ A;  2OWT A;  2DWJ A;  4I8C A;  1LGB C;  3G3G A;  2Q9T A;  4JSD A;  1SI0 A;  4OVR A;  2ZZV A;  3ZS6 A;  1AH5 A;  4NF4 A;  5BUU A;  4JB7 A;  2Y5K A;  4PFT A;  4UA8 A;  4YB5 A;  4ZE9 A;  3TEL A;  1URG A;  4PBH A;  1B3L A;  3TQL A;  4H45 A;  1MY3 A;  4ZEF A;  2RCA A;  4JBZ A;  1B5J A;  1Y3N A;  3PD9 A;  1FPG A;  3C9H A;  3S9L C;  2PFZ A;  1FJ9 A;  1LFH A;  3MVW A;  1IMC A;  3KBZ A;  4I3E A;  4N4U A;  3N6U A;  1NNP A;  4KFQ A;  1P1U A;  1D9V A;  5ET6 A;  4RPN A;  4KCD A;  1B4Z A;  2WEF A;  1QGX A;  3LV0 A;  2GFE A;  5I57 B;  3U72 A;  2DXY A;  4HCY A;  1KZ8 A;  5H8N A;  3D4G A;  1VFE A;  1NV6 A;  4GWZ A;  5I59 A;  1SPI A;  2F97 A;  5I58 A;  5DT6 A;  3QUJ A;  4ESW A;  3C35 A;  3A3U A;  4NF4 B;  4OZ9 A;  5EHM A;  4NN3 A;  1EYK A;  2REJ A;  2VPN A;  1LBW A;  1A7L A;  2H25 A;  4EQB A;  3MVY A;  1D9Q A;  3RLF E;  1NV2 A;  1OVT A;  3MZ9 A;  2ZXT A;  4O8M A;  4QSE A;  4ZEK A;  2X7Q A;  5AE4 A;  3C4M A;  3GXA A;  4Q5T A;  4KCC A;  2OCU A;  4OMB A;  3SER A;  3TFL A;  4M4G A;  3CFL A;  3FVO A;  1MM7 A;  1INP A;  3G3F A;  5TP9 B;  4RPO A;  4OVJ A;  3EHS A;  1NFT A;  1H76 A;  4PP0 A;  3Q26 A;  2Z8D A;  3KFM A;  4FE8 A;  4F18 A;  1FQD A;  4RNS A;  1YPN A;  1IMF A;  1KA1 A;  2QS3 A;  4IGT A;  4GXA A;  1IMB A;  3JZJ A;  1B52 A;  1EZO A;  1DBZ A;  5I58 B;  1TWY A;  2XD2 A;  2G29 A;  4F3S A;  1GV8 A;  4N15 A;  1N3W A;  3LSL A;  5TPA B;  2UVG A;  2X7P A;  3KJ7 A;  3UN6 A;  1BLF A;  1QKB A;  3VVD A;  3LC8 A;  2QVV A;  3G3J A;  5FHN A;  3VV5 A;  2HHM A;  2WYP A;  1DMB A;  3OO8 A;  2GH9 A;  2PBW A;  4JWO A;  1LAF E;  4OER A;  2I0B A;  1B9J A;  3KC1 A;  4EQ9 A;  5B7D A;  4ND9 A;  1NUX A;  1B5H A;  2V93 A;  3IB2 A;  3M3K A;  2H5Y A;  3I6V A;  4NHB A;  4YB6 A;  4PCD A;  3RN8 A;  1QUK A;  4OET A;  3KN3 A;  4G8N A;  4NF5 A;  4PDH A;  2V4C A;  2QPQ A;  4NX1 A;  3PV0 E;  2R6G E;  2HQ0 A;  2KR0 A;  2E1S A;  2QL3 A;  3KC0 A;  3N5L A;  4PE3 A;  3T96 B;  2VD2 A;  1UIV A;  4U4X A;  4NQ8 A;  1R9Q A;  4XF5 A;  2P3V A;  3EHT A;  2A5T A;  2I58 A;  5CBR A;  4IO6 A;  4P11 A;  4WEP A;  5EQA A;  3T9V A;  1NV0 A;  4P0I A;  4XKQ A;  2GRV A;  2DE3 A;  3TDJ A;  1Y20 A;  2XHD A;  1LST A;  3IB1 A;  2WX9 A;  3FZV A;  2LAO A;  4GWY A;  3S4U A;  4THI A;  2Q88 A;  4Q0C A;  2HPG A;  3MP6 A;  4QFK A;  3V8X B;  3ZKL A;  4F1V A;  3IR1 A;  3E78 A;  3SES A;  5JEI A;  3PGF A;  4BDN A;  2VHA A;  1FCK A;  1MM6 A;  2XXV A;  3R7X A;  3SEY A;  2ONS A;  2VT5 A;  5I2N B;  4PF6 A;  4MNC A;  4JXI A;  5M2V A;  4MMP A;  2CEY A;  4PC9 A;  2QMX A;  2THI A;  5DTB A;  3DP6 A;  4X8R A;  3KBR A;  4NF5 B;  4ZEC A;  1FQA A;  3ILU B;  4MBP A;  1DTZ A;  3KZG A;  4F3B A;  1MQJ A;  2XD3 A;  2F6G A;  2HFB A;  4L17 A;  4JVI A;  2ONR A;  1LFG A;  1YXI A;  3SDF A;  3H6U A;  1MQI A;  3H4Z A;  4F1Y A;  3MWB A;  1Z7M E;  5L9O A;  1CNQ A;  3OSQ A;  1NV4 A;  1TXF A;  3E3K A;  3L6G A;  3HHG A;  2FIE A;  4BDM A;  2V3T A;  1FRP A;  5JK4 A;  3IX1 A;  1LB8 A;  3RPW A;  5FBP A;  3SEU A;  4F2Q A;  1BP5 A;  1SI1 A;  3AXF A;  3SZP A;  4C1T A;  2P3N A;  1FPE A;  2HCA A;  1Y4C A;  2B4L A;  2O7U A;  3VLV A;  4OFL A;  3ZKK A;  1I69 A;  3B6Q A;  1IUD A;  4X9T A;  4FIM A;  3OOA A;  1NV3 A;  1KWH A;  1NH7 A;  2I3W A;  3IOW A;  4U21 A;  3T93 B;  4PAF A;  1XC1 A;  4OEN A;  2XXH A;  3FXU A;  4KR5 A;  4I9D A;  1AMF A;  3UIF A;  1DSN A;  3U1O A;  4EXK A;  1H45 A;  1UTH B;  3N26 A;  4AS5 A;  1NNK A;  1B3G A;  4ZDM A;  4KYS A;  4XKN A;  4C1U A;  1B0L A;  4GFR A;  1HSL A;  3D1R A;  3LSW A;  2DS9 A;  3U92 A;  1Q35 A;  5H8S A;  2Q8J A;  1SW1 A;  1BKA A;  2VOZ A;  4NF8 A;  5IZ3 B;  2XXP A;  3QXM A;  4GL8 A;  2I49 A;  2XWI A;  1B1H A;  4WKM A;  3KN8 A;  1POY 1;  2XXI A;  4P0G A;  3EN3 A;  1N0T A;  3DP8 A;  1MQH A;  2AYS A;  2ZYN A;  3PPO A;  3G3K A;  3IFC A;  3W15 C;  1DK4 A;  3TCG A;  4H5F A;  2FVZ A;  4GQO A;  3IOT A;  3TQW A;  4N07 A;  3BFU A;  1EZP A;  3T22 A;  4EF1 A;  1SW2 A;  5ICT A;  1Q9D A;  1WOD A;  2ZNT A;  2I4B A;  1D4N A;  3CG3 A;  1FBF A;  3TCF A;  4PTK A;  4ECF A;  3PUW E;  1RDZ A;  2UYF A;  1VSO A;  1NL5 A;  4NMY A;  4F22 A;  4DIG A;  4P1E A;  4NF8 B;  5FHM A;  3ISP A;  3MQ9 A;  2CZK A;  1GGG A;  2XX9 A;  4GWX A;  2FBP A;  4YIC A;  3IOV A;  4F1U A;  5KCJ A;  3HN0 A;  4F31 B;  1B05 A;  3B7D A;  4R72 A;  4MHF A;  2HZL A;  4GVO A;  1R6Z A;  1R1N A;  1T0K A;  3PMX A;  3USD A;  5HBC A;  2H4I A;  4QFL A;  4PGN A;  1NI9 A;  3LSX A;  4GBV A;  1JW4 A;  2UVH A;  3CI8 A;  4DI3 D;  1B7U A;  2F5X A;  2QS4 A;  4G8M A;  2PX1 A;  3EPE A;  1FQB A;  1B58 A;  1YAE A;  1Y1M A;  4AB6 A;  3OXN A;  1JW5 A;  5EYG A;  3UA8 A;  2RIN A;  2Y7W A;  4DXB A;  5I84 A;  3FIR A;  4N6K A;  3M8U A;  4AQ4 A;  5I57 A;  5CMK A;  4P47 A;  3MBP A;  1MQG A;  4QFN A;  1WVJ A;  2VD3 A;  3I5O A;  4N6P A;  3MST A;  1FPF A;  3LSF B;  2XX7 A;  1MY1 A;  4FEC A;  1DCU A;  5CMB A;  3MP8 A;  4N17 A;  1P1O A;  1JET A;  3GZG A;  4GLI A;  4LUB A;  4EDP A;  2I3V A;  3MVZ A;  1IXG A;  4BDR A;  4N81 A;  5KCJ B;  1B40 A;  1QJM A;  1SVX B;  2OX3 A;  4QSC A;  5EHS A;  1MXU A;  4U4S A;  3O9P A;  1FTJ A;  2PMS A;  1N76 A;  4RJZ A;  2ZZW A;  1PDA A;  2DQV A;  4DDD A;  3CRB A;  3ECR A;  2HXR A;  3PPQ A;  3LR1 A;  4R2F A;  3LUY A;  5IM2 A;  3B6W A;  3OD7 A;  4KXP A;  5F24 A;  2L5V A;  4X1D A;  3I3V A;  4HE0 A;  5DW8 A;  5TP9 A;  1PBQ A;  3TUS A;  1US4 A;  3W9W A;  4P8B A;  4IO2 A;  4EF2 A;  3ODB A;  4QFP A;  5CMC A;  3RGY A;  4Q8R A;  1SQY A;  3RPL B;  1B2H A;  3K01 A;  4HTG A;  2XXU A;  4ELO A;  5HPQ A;  4FAT A;  1EU8 A;  4OHN A;  3IJO B;  4QBA A;  4XIG Q;  5DVI A;  2DE2 A;  4FBP A;  3GBA A;  4GX4 A;  3KOS A;  5KZT A;  1RDY A;  2Y84 A;  2HAU A;  3FJ7 A;  5KDT A;  4R73 A;  1NUZ A;  5TPA A;  4IO4 A;  5DVJ A;  3O6I A;  5EQ7 A;  1GTK A;  5IZZ A;  3KEI A;  3QSL A;  5CMM A;  5H8F B;  3IOR A;  5J16 A;  3PUY E;  1IME A;  2DOJ A;  4GOT A;  1LAG E;  5ITP A;  1B3E A;  3PU5 A;  4H8J A;  2OLB A;  2GHA A;  3EKI A;  1QUJ A;  1LCF A;  1MXX A;  5K2Y A;  4RK9 A;  4HCW A;  3CFZ A;  3LUZ A;  4O94 A;  2JJK A;  3K02 A;  4F2O A;  3E79 A;  1II5 A;  1AOV A;  2O1L A;  5AA1 A;  3U8Q A;  2O1M A;  1FPK A;  2Q2C A;  4R6Y A;  1OLA A;  3VXC A;  3K00 A;  4EXL A;  1IZ1 A;  2XXW A;  4TOZ A;  5CC2 A;  1N7X A;  3SKP A;  3HCQ A;  1ZIU A;  2WKY A;  3DEL B;  1FPJ A;  4ELR A;  3FAS A;  2DVC A;  4JSO A;  5KDT B;  2KQZ A;  3MZB A;  4G68 C;  2Z23 A;  3PUZ E;  3K1M A;  5I7I A;  4ZS9 A;  2F78 A;  1OQG A;  5F1Q A;  4QRZ A;  1P1N A;  2XWO A;  3IL1 B;  1MXW A;  1LBB A;  1LEV A;  3U94 A;  1IIT A;  4XTC Q;  2P0S A;  4YMB A;  2IA4 A;  3K6X A;  3TOD A;  3RT6 B;  1FJ6 A;  3RYD A;  1HSE A;  2ANJ A;  1S7Y A;  3DLN A;  4IO3 A;  1SYH A;  2G93 A;  3PMW A;  4PGP A;  2D3I A;  4KD5 A;  4G2Z A;  4H46 A;  3T66 A;  3B50 A;  3TAJ A;  3QIM A;  1DTG A;  3CHG A;  3WAF A;  5ITO A;  3H7M A;  3KN7 A;  2FYI A;  4H67 A;  2HXW A;  3RUM A;  3E13 X;  2VGQ A;  4G77 A;  1B0H A;  1OIB A;  4GX3 A;  3RT8 A;  5I2N A;  1MDQ A;  3TTM A;  1FBD A;  2VP1 A;  4HS7 A;  4RY1 A;  4NAP A;  1USY E;  1SD3 A;  1DOT A;  3MZ1 A;  4H5G A;  3VVE A;  2RC9 A;  5CRY A;  1MY0 A;  1VDW A;  2BJI A;  3Q28 A;  4RA1 A;  4M1V A;  3K1N A;  4ONY A;  3OMB A;  4G8H A;  2QVU A;  4YU0 A;  2AL4 A;  2XWV A;  4OVS A;  4RXL A;  5ET7 A;  1LB9 A;  4G68 B;  1A55 A;  3E9X A;  4MNI A;  3MYU A;  2QRY A;  1VR5 A;  2QVR A;  1B3H A;  4FOR A;  1FTM A;  5LTC A;  2BJJ X;  4G61 A;  1LCT A;  1B32 A;  4DXU A;  3N6T A;  4P1L A;  4TQU Q;  3IAZ A;  1NV5 A;  2DWA A;  3FJG A;  3CSB A;  1A99 A;  2QMW A;  4GD5 A;  4OWD A;  3SEX A;  4LQ2 A;  1LBC A;  1B5I A;  4NWD A;  5I2K B;  1MY2 A;  1VE4 A;  3O66 A;  4KHZ E;  2DWI A;  3R6U A;  3IO4 A;  4H1X A;  5CI5 A;  4LZ8 A;  1MQD A;  3D4C A;  3S9N C;  4EQ7 A;  4MCO A;  4HE2 A;  4IO5 A;  2O6A A;  1AWB A;  3V5A A;  2VPO A;  4N91 A;  2CEX A;  4MFI A;  2Q89 A;  5B70 A;  3MUQ A;  3OEM A;  4R2B A;  4I62 A;  1UTH A;  4YKP A;  2Z22 A;  4I1D A;  3U65 A;  3WAE A;  2CZL A;  2XXK A;  1TFA A;  4NF6 B;  1NKX A;  1EZ9 A;  4MLQ A;  1PEB A;  4QHQ A;  4HW8 A;  2HAV A;  2DXR A;  3SET A;  5IZ3 A;  4KYD A;  4E0X A;  2F6P A;  3BIG A;  3ONM A;  1RKM A;  3KG2 A;  1BIY A;  3HO7 A;  4BLA A;  3T9X B;  1XS5 A;  3PD8 A;  1XI6 A;  1Y9U A;  2NWJ A;  1YZ0 A;  1FBE A;  5I56 A;  1FTA A;  4GRK A;  3JV9 A;  2V3U A;  3ZSF A;  1UIU A;  1PB9 A;  3KSJ A;  4FAJ A;  4FJP A;  3MC2 A;  4MF3 A;  5A5X B;  4LON B;  2O7I A;  4ZEI A;  4PFI A;  3HFU A;  1FQF A;  1N7W A;  2R71 A;  1MS7 A;  1GVC A;  1MPC A;  2Y5L A;  4R9G A;  2YLN A;  3IK6 B;  1I6B A;  4GIZ A;  2D21 A;  3JYR A;  4NE4 A;  4QSD A;  1MXY A;  4FED A;  2ZYK A;  3CR9 A;  2RKM A;  2I0C A;  3TYH A;  3FV2 A;  2XXT A;  3LBS A;  4JVC A;  2FA7 A;  3MAM A;  3PTY A;  5AA4 A;  2OWS A;  1MDP 1;  1XHY A;  1SYI A;  2ZNS A;  4PDD A;  1IMA A;  1MH4 A;  2DSF A;  4RYA A;  1ZJL A;  2RCB A;  1LFI A;  4DE8 A;  2X26 A;  5I56 B;  2B3F A;  2FIX A;  4POX A;  1FPL A;  4G4P A;  3KSX A;  3L6H A;  1Z7N E;  3K6U A;  3PUV E;  1NV7 A;  3TTR A;  2NUV A;  2Y7I A;  4I40 A;  1M5E A;  2QSX A;  3MPL A;  3O97 A;  1SW5 A;  4R9F A;  3FXB A;  1H43 A;  1ZMG A;  1B46 A;  4PFW A;  3FV1 A;  4OFO A;  2XXX A;  3SEV A;  3MPK A;  3FXR A;  4MX6 A;  3CFX A;  4GWW A;  1KA0 A;  4U1O A;  4XXU A;  3VLU A;  3H6V A;  2ONK E;  4R6K A;  4N13 A;  3RTF B;  5FTI A;  3C32 A;  2ABH A;  1FBP A;  5L8D A;  3K2D A;  2F8D A;  1BK4 A;  3R26 A;  5I5P A;  5CM6 A;  3FD3 A;  5IGA A;  1I6A A;  5F7V A;  5AA4 B;  4H0W A;  2QS2 A;  4R6H A;  1ANF A;  4EUO A;  1N04 A;  2PFY A;  1Y3Q A;  1PBP A;  2RF1 A;  1B7Z A;  1A8F A;  1Y3P A;  2P2A A;  1LBX A;  2XXR A;  3OO9 A;  3N94 A;  4GXS B;  5AA2 A;  3BIH A;  4U1Z A;  3P7I A;  4Q30 B;  3M3L A;  2ESN A;  1SW4 A;  2XX8 A;  4MIJ A;  3C33 A;  3CG1 A;  1NMU A;  4O3C A;  5H8H B;  4PQJ A;  1IXC A;  4RK2 A;  1URS A;  2GQ1 A;  4NTL A;  4ZEB A;  1ELJ A;  4O3B A;  3VLW A;  5HM4 B;  4YKJ A;  2QJE A;  5K2X A;  4OTE A;  4F3P A;  3RPL A;  4UAB A;  1NUY A;  2AL5 A;  3UK4 A;  2V84 A;  4WED A;  2V3Q A;  1P1W A;  4E0W A;  1JVY A;  1PC3 A;  4QF9 A;  4ZZE A;  1DPE A;  4IGR A;  1ZU0 A;  5EQ9 A;  3O2A A;  5FHO A;  1NNT A;  1FTL A;  1ZTY A;  2UXA A;  4TLM B;  2Z8E A;  1IQ7 A;  4AB5 A;  3FUZ A;  1B1X A;  1NV1 A;  2PYY A;  4JWY A;  3GBB A;  3BKI B;  5ET8 A;  1B51 A;  1FW0 A;  3F11 A;  3FVG A;  3FXQ A;  5H8F A;  3FVN A;  5AA2 B;  5L9S A;  4YB7 A;  1S50 A;  3TTN A;  1M5D A;  4JVD A;  3ROJ A;  4GWO A;  3W9V A;  3FAT A;  1ZBM A;  1N84 A;  4IO7 A;  4UAC A;  1XT8 A;  4GBW A; 
#chains in the Genus database with same CATH homology
 4YAH X;  4OES A;  4BDO A;  5ELV A;  2DP8 A;  1SDX A;  2PT2 A;  1IIW A;  2B3B A;  5CBS A;  3VFJ A;  3G3H A;  3H06 B;  3KGC A;  1UQW A;  4ISU A;  4PE5 B;  3PPR A;  1LLS A;  3DP4 A;  2AIX A;  2M8C A;  1EH3 A;  1D9Y A;  5DVF A;  3TCH A;  1LAH E;  4F39 A;  4IB2 A;  1O63 A;  1SBP A;  1H3D A;  3OEK A;  4LA9 A;  3BBR A;  1DPP A;  2H98 A;  1UTB B;  5DEX B;  1USY H;  1JW1 A;  5AA2 D;  3RNN A;  1QW0 A;  3K6V A;  4PET A;  1B3F A;  3V83 A;  1FQE A;  3H3G A;  4U22 A;  2OZZ A;  4C0R A;  4ELQ A;  3K6W A;  2F34 A;  1IXI A;  1RYX A;  4GL0 A;  2UVI A;  2HEU A;  4JWX A;  3HV1 A;  1US5 A;  3BFT A;  4OEU A;  1NH8 A;  3E4R A;  3RY3 A;  3S9M C;  3OEN A;  1JEV A;  2OK2 A;  3A09 A;  1H44 A;  1JNF A;  2HZK A;  2D5W A;  3HHF A;  3VXB A;  3FJM A;  2PT1 A;  2NVU B;  1L5T A;  3KJT A;  2OBG A;  3CVG A;  4KYE A;  5H8N B;  4ZE8 A;  2W7Y A;  2IEE A;  1N3X A;  4G68 A;  5I59 B;  4LZ7 A;  1JQF A;  2Q2A A;  4K3F A;  2ZMB A;  4R74 A;  2REG A;  4LZ5 A;  4BDL A;  2FNC A;  1FTK A;  3RTW B;  3PMV A;  3PPP A;  1F9B A;  4GF8 A;  2DYX A;  2ZYM A;  2YJP A;  3EF7 A;  1ZLQ A;  3TPA A;  1POT A;  4PFU A;  5I2K A;  3H6W A;  4F29 A;  3H6T A;  1M5C A;  4TLL B;  3VDF A;  3T9H B;  1AL3 A;  3O28 A;  2E0S A;  4ZED A;  2Y7R A;  2UYE A;  2PVU A;  1JVX A;  3SEW A;  4LQ5 A;  2F7B A;  2I4C A;  3HST A;  1CB6 A;  4NF6 A;  3UGW A;  3G7W A;  4LP2 B;  2F7A A;  1O7T A;  2O84 X;  1OVB A;  1HSJ A;  1LAX A;  1QKA A;  3G3I A;  2NXO A;  4ELP A;  3CIJ A;  4X1B A;  1NNF A;  3C36 A;  3EHU A;  2DE4 A;  1I6Q A;  3TTL A;  1MXZ A;  5L9M A;  3TZA A;  2YPN A;  5J1D A;  2I6E A;  5A5X A;  3IO6 A;  5IAI A;  3TMG A;  1VFD A;  3T9U A;  1A54 A;  1D3K A;  2KLF A;  4DXC A;  3C34 A;  3EQ1 A;  3PUX E;  2ZNU A;  4DZ1 A;  3OEL A;  3S2V A;  4KPT A;  4O3A A;  4DCX A;  4ZZA A;  2P1S A;  3QUF A;  2A5T B;  5H8Q A;  1TT1 A;  3TKD A;  1FQC A;  4H8I A;  3O29 A;  4Z7E A;  2O51 A;  1QUL A;  1CE2 A;  4X48 A;  2UVJ A;  1URD A;  4XKP A;  1MPD A;  1MY4 A;  1YCJ A;  2Y7P A;  5JTY A;  2B65 A;  4OQO A;  2QS1 A;  1BTJ A;  4KQP A;  2R9J A;  3U93 A;  5EYF A;  1A8E A;  3QK6 A;  3FGS A;  3Q25 A;  1M5F A;  2A5S A;  4Z0I A;  3K1P A;  2Z8F A;  1B7H A;  1MH3 A;  4KI0 E;  2O69 A;  3B6T A;  4U23 A;  5AA3 A;  1Y4T A;  1PB7 A;  1M5B A;  3V89 B;  1MG1 A;  5BWJ A;  2RC7 A;  3S9E A;  2F35 A;  5FTH A;  3H03 A;  3TTK A;  5H8Q B;  2H99 A;  4IY6 A;  2V25 A;  1JEU A;  3HPI A;  3O6G A;  4YMA A;  4H65 A;  4PFY A;  4YKI A;  1IEJ A;  1WDN A;  3TEP A;  4F3G A;  5JTY B;  1IXH A;  4MH5 A;  3UOR A;  3KOT A;  2DWH A;  1R9L A;  4FEB A;  3A3C A;  4ESX A;  3QAX A;  3MVX A;  5LOM A;  4LAT A;  4YZZ A;  3IB0 A;  1QVS A;  1MPB A;  5H8H A;  3OO6 A;  4R75 A;  2H9B A;  5DYH A;  2Y7K A;  3IJX B;  3PPN A;  4QFO A;  3C31 A;  2RC8 A;  3IOU A;  2F36 A;  5IKB A;  3K4U A;  3VVF A;  1XOC A;  3K0V A;  1TFD A;  1B4H A;  3Q29 A;  4F19 A;  4IY5 A;  1O64 A;  3DM0 A;  1OQH A;  4XKR A;  1XVX A;  1OMP A;  4LVQ A;  4BDQ A;  5ISU A;  1MRP A;  4OXV A;  4YKK A;  1A40 A;  2O68 A;  3MW0 A;  1S9T A;  2I48 A;  1Y1Z A;  1GR2 A;  2OJT A;  3OO7 A;  4NED A;  1PB8 A;  5ICQ A;  1QUI A;  3GLB A;  3QYT A;  3ILT B;  4MLV A;  1YTV A;  2GHB A;  2F7C A;  4OEV A;  2XXY A;  2XXQ A;  3OSR A;  2CMO A;  3O6H A;  2ALU A;  5TU0 A;  4WXJ A;  3RQT A;  4POW A;  3MJN A;  1Q1K A;  1MXV A;  1OLC A;  1XVY A;  1RYO A;  1P99 A;  1J1N A;  3VE1 B;  4H6D A;  4DCY A;  1B6H A;  1FTO A;  4U2R A;  4OFJ A;  1ATG A;  2NOO A;  4DLD A;  3CSG A;  1ZKB A;  3Q27 A;  3UP9 A;  2ZYO A;  1AIV A;  1P1Q A;  4JDF A;  4NWC A;  3FVK A;  3M3F A;  1UTB A;  5DEX A;  4OYV A;  3THI A;  3MP1 A;  2DVZ A;  2OWT A;  2DWJ A;  4I8C A;  1LGB C;  3G3G A;  2Q9T A;  4JSD A;  1SI0 A;  3ZS6 A;  1AH5 A;  4NF4 A;  5BUU A;  4JB7 A;  4PFT A;  4UA8 A;  4YB5 A;  4ZE9 A;  3TEL A;  1URG A;  1B3L A;  3TQL A;  1MY3 A;  4ZEF A;  2RCA A;  4JBZ A;  1B5J A;  1Y3N A;  3PD9 A;  3C9H A;  3S9L C;  1LFH A;  3MVW A;  3N6U A;  1NNP A;  4KFQ A;  1P1U A;  1D9V A;  4RPN A;  4KCD A;  1B4Z A;  2GFE A;  5I57 B;  3U72 A;  2DXY A;  4HCY A;  5H8N A;  3D4G A;  1VFE A;  5I59 A;  2F97 A;  5I58 A;  5DT6 A;  3QUJ A;  4ESW A;  3C35 A;  3A3U A;  4NF4 B;  4OZ9 A;  5EHM A;  2REJ A;  1A7L A;  2H25 A;  4EQB A;  3MVY A;  3RLF E;  1OVT A;  3MZ9 A;  2ZXT A;  4QSE A;  4ZEK A;  2X7Q A;  5AE4 A;  3C4M A;  3GXA A;  4Q5T A;  4KCC A;  2OCU A;  4OMB A;  3SER A;  3TFL A;  4M4G A;  3CFL A;  3FVO A;  1MM7 A;  3G3F A;  5TP9 B;  4RPO A;  4OVJ A;  3EHS A;  1NFT A;  1H76 A;  4PP0 A;  3Q26 A;  2Z8D A;  3KFM A;  4FE8 A;  4F18 A;  1FQD A;  4RNS A;  1YPN A;  2QS3 A;  4IGT A;  4GXA A;  3JZJ A;  1B52 A;  1EZO A;  5I58 B;  1TWY A;  2XD2 A;  2G29 A;  4F3S A;  1GV8 A;  1N3W A;  3LSL A;  5TPA B;  2UVG A;  2X7P A;  3KJ7 A;  3UN6 A;  1BLF A;  1QKB A;  3VVD A;  3LC8 A;  3G3J A;  5FHN A;  3VV5 A;  1DMB A;  3OO8 A;  2GH9 A;  2PBW A;  4JWO A;  1LAF E;  4OER A;  2I0B A;  1B9J A;  4EQ9 A;  5B7D A;  4ND9 A;  1B5H A;  2V93 A;  3IB2 A;  3M3K A;  2H5Y A;  3I6V A;  4YB6 A;  3RN8 A;  1QUK A;  4OET A;  3KN3 A;  4G8N A;  4NF5 A;  2QPQ A;  3PV0 E;  2R6G E;  2HQ0 A;  2E1S A;  2QL3 A;  3N5L A;  3T96 B;  2VD2 A;  1UIV A;  4U4X A;  1R9Q A;  3EHT A;  2A5T A;  2I58 A;  5CBR A;  4IO6 A;  4P11 A;  4WEP A;  3T9V A;  4P0I A;  4XKQ A;  2GRV A;  2DE3 A;  3TDJ A;  1Y20 A;  2XHD A;  1LST A;  3IB1 A;  3FZV A;  2LAO A;  3S4U A;  4THI A;  2Q88 A;  4Q0C A;  3MP6 A;  4QFK A;  3V8X B;  3ZKL A;  4F1V A;  3IR1 A;  3SES A;  5JEI A;  3PGF A;  4BDN A;  2VHA A;  1FCK A;  1MM6 A;  2XXV A;  3R7X A;  3SEY A;  2ONS A;  5I2N B;  4JXI A;  5M2V A;  2QMX A;  2THI A;  5DTB A;  3DP6 A;  3KBR A;  4NF5 B;  4ZEC A;  1FQA A;  3ILU B;  4MBP A;  1DTZ A;  3KZG A;  4F3B A;  1MQJ A;  2XD3 A;  2F6G A;  2HFB A;  4L17 A;  2ONR A;  1LFG A;  3SDF A;  3H6U A;  1MQI A;  3H4Z A;  4F1Y A;  3MWB A;  1Z7M E;  5L9O A;  3OSQ A;  1TXF A;  3E3K A;  3L6G A;  3HHG A;  4BDM A;  2V3T A;  5JK4 A;  3IX1 A;  1LB8 A;  3RPW A;  3SEU A;  4F2Q A;  1BP5 A;  1SI1 A;  3AXF A;  4C1T A;  2HCA A;  1Y4C A;  2O7U A;  3VLV A;  4OFL A;  3ZKK A;  1I69 A;  3B6Q A;  1IUD A;  4X9T A;  4FIM A;  3OOA A;  1KWH A;  1NH7 A;  2I3W A;  3IOW A;  4U21 A;  3T93 B;  1XC1 A;  4OEN A;  2XXH A;  3FXU A;  4KR5 A;  4I9D A;  1AMF A;  3UIF A;  1DSN A;  3U1O A;  4EXK A;  1H45 A;  1UTH B;  3N26 A;  1NNK A;  1B3G A;  4ZDM A;  4KYS A;  4XKN A;  4C1U A;  1B0L A;  4GFR A;  1HSL A;  3LSW A;  2DS9 A;  3U92 A;  1Q35 A;  5H8S A;  2Q8J A;  1SW1 A;  1BKA A;  2VOZ A;  4NF8 A;  2XXP A;  3QXM A;  4GL8 A;  2I49 A;  1B1H A;  4WKM A;  3KN8 A;  1POY 1;  2XXI A;  4P0G A;  3EN3 A;  1N0T A;  3DP8 A;  1MQH A;  2AYS A;  2ZYN A;  3PPO A;  3G3K A;  3W15 C;  3TCG A;  4H5F A;  4GQO A;  3IOT A;  3TQW A;  4N07 A;  3BFU A;  1EZP A;  3T22 A;  4EF1 A;  1SW2 A;  5ICT A;  1WOD A;  2ZNT A;  2I4B A;  1D4N A;  3CG3 A;  3TCF A;  4ECF A;  3PUW E;  2UYF A;  1VSO A;  1NL5 A;  4NMY A;  4F22 A;  4DIG A;  4NF8 B;  5FHM A;  3MQ9 A;  1GGG A;  2XX9 A;  4YIC A;  3IOV A;  4F1U A;  5KCJ A;  3HN0 A;  4F31 B;  1B05 A;  3B7D A;  4R72 A;  2HZL A;  4GVO A;  1R6Z A;  1R1N A;  1T0K A;  3PMX A;  3USD A;  5HBC A;  2H4I A;  4QFL A;  3LSX A;  1JW4 A;  2UVH A;  3CI8 A;  1B7U A;  2F5X A;  2QS4 A;  4G8M A;  2PX1 A;  3EPE A;  1FQB A;  1B58 A;  1YAE A;  1Y1M A;  4AB6 A;  3OXN A;  1JW5 A;  3UA8 A;  2RIN A;  2Y7W A;  4DXB A;  5I84 A;  3FIR A;  5I57 A;  3M8U A;  4AQ4 A;  5CMK A;  3MBP A;  1MQG A;  4QFN A;  1WVJ A;  2VD3 A;  3I5O A;  4N6P A;  2XX7 A;  3LSF B;  1MY1 A;  4FEC A;  5CMB A;  3MP8 A;  1P1O A;  1JET A;  3GZG A;  4GLI A;  4LUB A;  4EDP A;  2I3V A;  3MVZ A;  1IXG A;  4BDR A;  5KCJ B;  1B40 A;  1QJM A;  1SVX B;  4QSC A;  5EHS A;  1MXU A;  4U4S A;  3O9P A;  1FTJ A;  2PMS A;  1N76 A;  4RJZ A;  1PDA A;  2DQV A;  4DDD A;  3CRB A;  3ECR A;  3PPQ A;  3LR1 A;  4R2F A;  3LUY A;  3B6W A;  3OD7 A;  4X1D A;  3I3V A;  5TP9 A;  1PBQ A;  3TUS A;  1US4 A;  3W9W A;  4IO2 A;  4EF2 A;  5CMC A;  4Q8R A;  3ODB A;  3RGY A;  4QFP A;  1SQY A;  1B2H A;  3K01 A;  4HTG A;  2XXU A;  4ELO A;  5HPQ A;  4FAT A;  1EU8 A;  4OHN A;  3IJO B;  4XIG Q;  5DVI A;  2DE2 A;  5KZT A;  3GBA A;  3KOS A;  2Y84 A;  2HAU A;  3FJ7 A;  5KDT A;  4R73 A;  5TPA A;  4IO4 A;  5DVJ A;  3O6I A;  1GTK A;  3KEI A;  3QSL A;  5CMM A;  5H8F B;  3IOR A;  3PUY E;  2DOJ A;  4GOT A;  1LAG E;  5ITP A;  1B3E A;  3PU5 A;  4H8J A;  2OLB A;  2GHA A;  1QUJ A;  1LCF A;  1MXX A;  5K2Y A;  4RK9 A;  4HCW A;  3CFZ A;  3K02 A;  4F2O A;  1II5 A;  1AOV A;  2O1L A;  5AA1 A;  3U8Q A;  2O1M A;  2Q2C A;  4R6Y A;  1OLA A;  3VXC A;  3K00 A;  4EXL A;  1IZ1 A;  2XXW A;  4TOZ A;  5CC2 A;  1N7X A;  3SKP A;  3HCQ A;  1ZIU A;  2WKY A;  3DEL B;  4ELR A;  3FAS A;  2DVC A;  4JSO A;  5KDT B;  3MZB A;  4G68 C;  2Z23 A;  3PUZ E;  3K1M A;  4ZS9 A;  2F78 A;  1OQG A;  5F1Q A;  4QRZ A;  1P1N A;  3IL1 B;  1MXW A;  1LBB A;  3U94 A;  1IIT A;  4XTC Q;  2P0S A;  4YMB A;  2IA4 A;  3K6X A;  3TOD A;  3RT6 B;  1HSE A;  2ANJ A;  1S7Y A;  3DLN A;  4IO3 A;  1SYH A;  2G93 A;  3PMW A;  2D3I A;  4KD5 A;  4G2Z A;  3T66 A;  3TAJ A;  3QIM A;  1DTG A;  3WAF A;  5ITO A;  3H7M A;  3KN7 A;  2FYI A;  4H67 A;  2HXW A;  3RUM A;  3E13 X;  2VGQ A;  4G77 A;  1B0H A;  1OIB A;  3RT8 A;  5I2N A;  1MDQ A;  3TTM A;  2VP1 A;  4HS7 A;  4RY1 A;  1USY E;  1SD3 A;  1DOT A;  3MZ1 A;  4H5G A;  3VVE A;  2RC9 A;  5CRY A;  1MY0 A;  3Q28 A;  4RA1 A;  4M1V A;  3K1N A;  4ONY A;  3OMB A;  4G8H A;  4YU0 A;  2AL4 A;  4RXL A;  1LB9 A;  4G68 B;  1A55 A;  3E9X A;  2QRY A;  1VR5 A;  1B3H A;  4FOR A;  1FTM A;  2BJJ X;  1LCT A;  1B32 A;  4DXU A;  3N6T A;  4TQU Q;  3IAZ A;  2DWA A;  3FJG A;  3CSB A;  1A99 A;  2QMW A;  4GD5 A;  4OWD A;  3SEX A;  4LQ2 A;  1LBC A;  1B5I A;  4NWD A;  5I2K B;  1MY2 A;  1VE4 A;  3O66 A;  4KHZ E;  2DWI A;  3R6U A;  3IO4 A;  4H1X A;  5CI5 A;  4LZ8 A;  1MQD A;  3D4C A;  3S9N C;  4EQ7 A;  4IO5 A;  2O6A A;  3V5A A;  4MFI A;  2Q89 A;  5B70 A;  3MUQ A;  3OEM A;  4R2B A;  4I62 A;  1UTH A;  4YKP A;  2Z22 A;  4I1D A;  3WAE A;  2CZL A;  1TFA A;  4NF6 B;  1NKX A;  1EZ9 A;  4MLQ A;  1PEB A;  4QHQ A;  4HW8 A;  2HAV A;  2DXR A;  3SET A;  4KYD A;  4E0X A;  2F6P A;  3ONM A;  1RKM A;  3KG2 A;  1BIY A;  3HO7 A;  4BLA A;  3T9X B;  1XS5 A;  3PD8 A;  1Y9U A;  2NWJ A;  5I56 A;  4GRK A;  3JV9 A;  2V3U A;  3ZSF A;  1UIU A;  1PB9 A;  3KSJ A;  4FAJ A;  4FJP A;  3MC2 A;  4MF3 A;  5A5X B;  4LON B;  2O7I A;  4ZEI A;  1FQF A;  1N7W A;  2R71 A;  1MS7 A;  1GVC A;  1MPC A;  4R9G A;  2YLN A;  3IK6 B;  1I6B A;  4GIZ A;  2D21 A;  3JYR A;  4NE4 A;  4QSD A;  1MXY A;  4FED A;  2ZYK A;  3CR9 A;  2RKM A;  2I0C A;  3TYH A;  3FV2 A;  2XXT A;  3LBS A;  2FA7 A;  3MAM A;  5AA4 A;  2OWS A;  1MDP 1;  1XHY A;  1SYI A;  2ZNS A;  1MH4 A;  2DSF A;  4RYA A;  1ZJL A;  2RCB A;  1LFI A;  4DE8 A;  2X26 A;  5I56 B;  2B3F A;  4POX A;  4G4P A;  3KSX A;  3L6H A;  1Z7N E;  3K6U A;  3PUV E;  3TTR A;  2NUV A;  2Y7I A;  1M5E A;  2QSX A;  3MPL A;  3O97 A;  1SW5 A;  4R9F A;  1H43 A;  1ZMG A;  1B46 A;  4PFW A;  3FV1 A;  4OFO A;  2XXX A;  3SEV A;  3MPK A;  3FXR A;  3CFX A;  4U1O A;  4XXU A;  3VLU A;  3H6V A;  2ONK E;  4R6K A;  4N13 A;  3RTF B;  5FTI A;  3C32 A;  2ABH A;  5L8D A;  3K2D A;  2F8D A;  3R26 A;  5CM6 A;  3FD3 A;  1I6A A;  5F7V A;  5AA4 B;  4H0W A;  2QS2 A;  4R6H A;  1ANF A;  4EUO A;  1N04 A;  1Y3Q A;  1PBP A;  2RF1 A;  1B7Z A;  1A8F A;  1Y3P A;  2P2A A;  2XXR A;  3OO9 A;  3N94 A;  4GXS B;  5AA2 A;  4U1Z A;  3P7I A;  4Q30 B;  3M3L A;  2ESN A;  1SW4 A;  2XX8 A;  3C33 A;  3CG1 A;  1NMU A;  4O3C A;  5H8H B;  4PQJ A;  1IXC A;  4RK2 A;  1URS A;  4NTL A;  4ZEB A;  1ELJ A;  4O3B A;  3VLW A;  5HM4 B;  4YKJ A;  2QJE A;  5K2X A;  4OTE A;  4F3P A;  2AL5 A;  3UK4 A;  2V84 A;  4WED A;  2V3Q A;  1P1W A;  4E0W A;  1JVY A;  1PC3 A;  4QF9 A;  4ZZE A;  1DPE A;  4IGR A;  1ZU0 A;  3O2A A;  5FHO A;  1NNT A;  1FTL A;  1ZTY A;  2UXA A;  4TLM B;  2Z8E A;  1IQ7 A;  4AB5 A;  3FUZ A;  1B1X A;  2PYY A;  4JWY A;  3GBB A;  3BKI B;  1B51 A;  1FW0 A;  3F11 A;  3FVG A;  3FXQ A;  5H8F A;  3FVN A;  5AA2 B;  5L9S A;  4YB7 A;  1S50 A;  3TTN A;  1M5D A;  4GWO A;  3W9V A;  3FAT A;  1ZBM A;  1N84 A;  4IO7 A;  4UAC A;  1XT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...